5EC2B

Kcsa with v76ester+g77da mutations
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B01
3UJTL 1A6AB 5D70L 5E2UL 1J1XH 3MOQA 5AEAA 3MLSL 1S9YB 4NC1C 4XZUA 4LQFL 1SY6L 3WXVH 2C1OB 5C0BE 3F6IA 3FQUA 3SE8H 2ATPB 3ZSSA 3VXRE 4OI7A 4UBDC 5DQ9B 1RFDH 4MCZB 1JWMA 4K3HA 3V7AE 1A7QL 1CFNB 4JCLA 4M6AA 4X4XA 3SDCA 5DJYA 3SGJC 3TBTB 3KR3H 1MCDA 1HK6A 3HMXH 1QSFD 1ROWA 5HJ3B 4Z78B 2ADIA 4YK4B 4FS0A 1YJDH 5C2BH 4R4BA 8CGTA 4JO2L 3VI3F 2OL3B 1EK3A 3IDXH 5MENB 5EUOF 4JDZA 5T1KA 4OF5A 1H3WM 3QUKA 4H1LH 4IEFB 5JW4M 4QO1A 5AWNH 3MRQB 3RVUD 3MO1B 3QXUA 4UNVA 5IQ9A 3MRCB 4KK9D 4JY5L 4U05A 1YNTA 1YMMA 1VEOA 2MWCA 3ZDZE 4IOIA 2FR4A 5TFSL 1YJDL 2XXMB 5EOQL 3N50A 3EFDL 4NQDE 4OI9A 5D4QA 4XP1L 4GW1A 1L9NA 1INEL 3GO1L 5DMGD 1JYVA 4YPGB 1KIQA 5L8KB 4FQQA 4X99A 1U8JB 3C5ZA 3QFDB 4S1SH 3RZWA 1K8IA 2HWZL 3T2QA 3QUMB 2OR7A 1AXSA 4F37K 1PQZA 4IMLA 1I7UB 5T1MB 1C5BH 3TBWA 1TQBB 1FZOB 1I3UA 4X4YB 1Q1JH 3PQYB 1XF2B 3KWWB 1IQWH 5DUMH 4G80B 4XXDA 2B0SH 3Q6GH 3UO1H 1KJVB 5C0BB 5F3BB 3LS5H 3O4LB 4RDQG 5JA8B 3BGMB 2HKFL 1KLUB 1K3ZA 1NFIB 4X80H 1JN6B 3SPVB 1OP5H 4E41B 2JIXB 4Z7NF 1ZVSA 2XQBH 5F9JA 5SWSA 1MCOH 3U7YL 5HYSB 1KLGA 4XXCA 3V4VH 3R06A 3CMGA 1ZXQA 1MHCB 1QFUL 2YN3A 2ESVA 4CVZB 3HUJF 2BMKA 3V5HB 3VFGH 1GHFH 1K9TA 1MJUL 3DYMA 4HLZH 2NZIA 1S5HB 3PUCA 4OIIH 3WIIL 5HTSA 5SX4I 4NIKB 1GL4B 4U7KA 4ZTPL 5CEZE 1ED3A 5DD0L 2X4TB 4N8VA 4MA1B 3V6BR 3SE4C 2ADIB 4HF5H 1DN0A 3MRPB 3QFJD 2X05A 4Z78A 5DJCA 3B6SB 2OQJB 3OF6D 2OP4L 2VLKD 2HTKC 4Z7VB 1D5BB 3ARBA 2Z93A 3U4AA 3MLWL 5KW9H 5DD0H 5KOVC 3T1FB 5KVMC 3TA3B 4I0PA 3LKRB 3TA3A 4XNMB 2MCPL 2IBGA 1GGBH 2HVJB 2CH8A 4DUVA 4N8PA 1G7LB 2ARJB 2YUWA 4M03A 3WL9A 4X5XA 4G7VH 4U2YA 1I1CA 4U31A 3BWAB 1XR9B 3QJFA 1QKZL 1B6UA 3QEHA 4LHUG 5E99H 2P46B 5E2VL 5J12B 5I2IB 2XA8H 1SYVB 4Y5VC 4V1DA 5CP7A 4EI6B 1TTUA 3G5XB 5L2KE 2APFA 4KJWD 5DMJB 5EG6C 1S7SA 2E8YA 5EUOB 2YA1A 4CADB 3A6OA 4Y5YC 4D0DA 2GY5A 2AJVH 3WJJC 1UWGL 5DVMA 5GRZA 3G5ZA 5EBMA 5FYKD 3U9PH 2BNQB 3WLWD 3WUWB 5SWQB 3BRDA 2BNUB 1AGCB 3DTXB 4LSPL 1P4LA 3LKPB 1A6WL 1UM4H 2BNRB 3L3KA 3U4BH 4Y5XB 1K4DA 2VXVL 4X98A 4G9DA 4RMRA 4NWTL 4ENEC 3LRHA 2FGZA 4C56D 4MLSA 2FO1A 1S5IH 1KV3A 3HNTL 4RQQB 2VDLH 1RZ7H 4GG6F 4L3AA 2ZOKA 3SHSA 3FOLA 5C09A 3QR2A 3VFSA 4PJEA 4QRTA 4PJCA 4LLDA 3G6DL 4WWID 3C5ZD 5GISH 3VI4F 3ZL4L 2G5BB 3MGOA 3S36L 1T5XA 2VDRH 1LO5B 4HPOL 4Y5YB 4G7YH 2P5WE 1AY1H 2NW3A 1FYTA 1ZHLA 4LPXA 3GKZA 4G6JL 1XCQB 4L4VD 5JHDE 2W0LA 2A9NH 4KHTH 2E9JA 1TDQA 4MJ5B 3VXNA 5F1NB 5CP3A 1VKXA 1TQCC 3SKMB 1JL8A 3SGDH 4OCMC 4F15C 2Z8SA 3PWPE 3MRHA 4Y88A 3L3OA 2HLAA 4OLWH 4KC3B 1R5WA 2NPLX 4X98B 4P5KA 1A6UL 4NUJA 5IHUH 4GSDH 3QEUB 2FH6A 3TESA 5EZJB 3SDDD 1OF2A 5TPWL 2APWA 4IRJC 3V4PH 3IS0X 3NABH 5JQHC 3MROA 4N0UA 5EUOA 1X5GA 3EOTL 1DCLA 5LBSL 2WBJB 3L3GA 4H5SA 1TLKA 2X89D 3CFDB 5HXMA 5KANI 4RIRA 4ENED 4K8RD 5JW4R 3VMNA 2WBWB 4OZIF 3GSOA 3H9HB 1MHPH 2Q3AA 3ALXA 3WIFA 1T0PB 1SY6A 5TH2B 4KKAC 4NRYB 4OF6A 4EXPX 5TDOB 1DUYB 4F8TA 4XMPH 1MVUB 1TZIA 5IGXH 4X0KB 3BE1H 3IDUA 4JFPB 4FFWD 1Q0XH 5I15L 1BOGA 1BFSA 3QG6B 4M62L 4HBCL 5DUBB 1FYTD 5IJVA 3MOAH 3L7FB 1SM3L 4PRHA 3CZFA 3K7UA 5IB3A 4M7LL 3HE7C 4BA8A 1C1EL 2ZSWB 3RWDA 1I7UA 2FEEL 4N9GB 1AXSB 4U1GB 3GSNB 5CBEA 2BCKB 5E95B 4I18B 4JO2H 5F9WB 3D9AH 2OI9C 3F7RA 4YDVB 4MB3A 1F11B 1SBBA 4GRMA 4BSVA 2FYYA 4YBQC 4NC0B 1DVFC 3OAZH 4AEEA 4NQCB 1WF5A 3PWPB 3DO7B 2VDMH 3VXNB 5TE4H 3RHWF 3M1BA 4H1LG 4G9FA 1FO0H 1KIRA 1NGWB 4KKNA 4E41A 5E1HB 4D9LH 1KPUB 1WIPA 2Z35B 3SDAB 3EYVA 1RUKL 3MJ7B 4DKFH 1IFHL 5EH1A 5CWSA 3RWJA 2ENSA 1M1SA 3LMJH 4G6AC 3MV9E 5ESQB 2NNAA 3IFPA 1BD2A 4ZNEE 5DC0A 3VWKA 3M8OL 4UBDD 4YUEL 4XMLH 4PRPB 1W0WB 5C6TL 1A6TB 1CIUA 3S37H 1HH6A 3I3EA 4PV8A 4N0RA 2G75B 4YDLB 5TE6L 5DMKB 2BSSB 2P5WB 5L88H 2YPVL 1S7WB 2CJUH 3NCEB 3WS6C 5JOPE 5DO2C 1WBYB 1DVFB 1S9XA 3L5WA 2IG2H 1BJ1J 4MA8H 3U9UA 1SJVA 4E42B 3KYMA 4F15B 4QRQA 1WK0A 4WHTA 3AY4C 2P45B 2R0KL 4XP4L 3ULVL 3LY6A 4IRSB 5LGJB 2BNRE 3UTTE 1EBPA 4DTGL 1XR8A 3GM8A 4HC1L 4I0PD 1T1ZB 5ID1A 5DLML 1NGPH 1KB5L 1CTOA 3ROOB 3ZKSD 1DLFH 4PP1D 1H3UA 4S11A 2DBJA 5DUBA 3G08A 4XCFH 4UINH 3RWIA 4QRPA 3PP4H 5L2KB 1OSPL 4BFBD 3LKSB 4NFCA 4QHNA 1A3RH 4NNYA 1TTFA 3OKDA 1NC2A 3GI8H 3BHBB 4YBHA 1FE8H 2APTA 1DBAL 4XNYH 5ANMA 2Z0BA 5FKAB 1OARL 4PRIB 5FECA 1F4YL 3PV6A 5IBLD 3OHXA 1FV1A 3FQXA 1OAUH 1CD0A 4WUUE 3H9HA 1CBVL 2ZJSL 3KJ6H 1DBJL 1MAML 5C0JA 2C1OA 2V9QA 2DTML 2C3XA 3KLHD 4PLOB 3KPSD 4PUBH 3AXLB 1JGVL 1BLNB 1A1NA 1JFQH 1KYOJ 2YD3A 1MLCA 3SJVA 3PGDA 4HWUA 4KH2A 1RU9L 2BXYA 4HWEH 3G04B 1KN2H 3QP3A 4KTDH 1INDH 2QQNL 4JQVC 5T3ZH 4GMSL 2YD2A 1PEWA 2HJFB 2NX5E 3C6LD 4PBXA 3K1DA 2VKXA 4PGEA 3AMKA 1X3DA 4GUPB 4RMTA 4B7LA 3DX6B 4Y4KC 3F7PC 4LGPB 5D7IB 3RJDA 1LP9E 1A2YA 3BP4B 2VMFA 32C2A 4O02L 5J1AB 1RZKL 5IJKA 1TPXC 2JJSC 5CLTA 5DO2D 4MJIE 4JPVL 1NC4B 3P0YL 3MLRH 2EDOA 1WFOA 5KVGL 4LBEA 3LKNB 1K4CA 4JPIB 1CS6A 3TYFB 4I8DA 1YEJL 3DX7B 3KPSE 4KUZL 4TSBL 1U8NB 4PP2A 5IK3B 1LNUB 5CJ8A 3UTZA 5E24E 3G6JE 3FFCB 1IAIH 4X6DE 1WEJH 3EO9L 2GT9A 3UTQB 1A9BB 4QXGL 4LPVA 1RY7B 2YD7A 4BSJA 4Y5XC 5FO7A 4AMKL 3U7WH 4PJBA 2VERN 2Z35A 3OGCB 5I18L 4OGYL 3GSXB 3BP4A 1IQDA 4MB4A 4CMHC 4P4KA 1B0GB 3WBDA 4YPGA 2ICEA 4NQUA 1UYWL 4AZ8A 4NKMB 2G60L 3WFEH 3WIHL 3MYJB 1J8HB 3EFFB 4HHAB 1U8MB 4E0RA 4G6KL 4HS6B 4P4RA 4WWKC 3FB6A 5TDNB 4YDKH 3SGDI 4PJAF 5E5MB 5JUEL 5IVXB 1YNTB 3MTRA 1P4LB 1ERNA 3VXRD 1IBGL 4O5LH 1J18A 5JMRA 4HCRH 4U6HA 5JR1L 4UT6L 4NJAL 3QCUH 4X5WB 2I07A 4XC3L 4NSKB 2BX5A 3P4MA 3K74B 4PY8J 2JJWA 4Z77B 4IJ3B 2D7TH 4JHWH 4WWKB 43C9B 1OP5K 4TNVK 5DFVC 2PF6A 4YXLL 3T3PE 3F8UB 5ISZE 2CIIA 5J3HD 4LSQH 4GG6A 4BFEA 2GHWB 3CDYA 2ESVE 3MBXL 3RU8L 1LEGB 3IETB 4OB5H 7FABH 1XCTB 3TBTA 2BP3A 3EYOB 3QJFB 4UOW1 3S37X 2Y7QB 4J4PA 3MQIA 2O61A 1H3PL 4PRPD 2QSTA 4M5YH 2DYPA 1QHOA 1HNGA 2NY3B 1BJ8A 3DX9A 4PJFA 1RK1B 3HI1B 1KOAA 4QHLA 3W9DB 5DURD 5HI4C 3N9GL 4R4FH 4P9MH 5CSGA 1UA6L 3OAUL 5C2UB 1FORH 3V95A 5TDNA 5HVFB 2GUOA 2IALA 3T1FA 1CE6B 4X8JB 2Z93B 1XEDA 4G6ML 4KUZH 3PV6B 1WAAA 5EB9A 5E8OA 3BSZL 2DJSA 3GIZH 3VXSD 2QV2A 5C92A 4O2EB 1KEGH 4LIQH 3QWQB 2CRZA 3DARA 1UT9A 2C3GA 2E27L 1KTLB 3RWFA 2OXHA 4YHNB 5I1DA 3PIQA 3V5KB 2ATKB 3UJJL 3GB7A 1TZHB 2XZZA 3T0XA 3V7AG 4KJQD 1S5HA 4JY6B 2MCG1 4PTUB 5EU6E 5SX4H 4R4NC 4GKNA 4F7TB 4ZOAA 3VD4A 1JRHI 4L29B 4ZUUA 3CFBB 5BZDA 2FB4H 4F3FB 4JM2D 4HWEL 2QR0A 1N26A 2BVOA 4K7PL 1EGJL 3L3DB 1UQSB 3MJ9A 4KWUA 1MPAL 3CDFA 4O9HH 4RGNE 2HN7A 4ZFGL 2A73B 3OB0K 4R3SB 3I2CL 3TVMA 3IGAB 4NQCE 3RNQB 3UPCA 1CL7I 1KIRB 1NGWA 3D3VA 4XC1L 3NA9H 3TYFA 1T1WB 4G80A 4U1GC 1JI2A 4K8RC 2VXQL 4S1RH 4NQCA 3BVNA 4DQOH 5B38G 5DRWB 2W0KA 1TFHA 4PJGE 1ZV5A 5CEZD 2P5ED 4RFEA 1GPOH 4Z77A 2JKXA 3QXWA 3P4MB 1SMAA 2I60H 3VXMD 2OTWA 5F1KC 2DWEB 4P2OB 4PJ8A 1F00I 4J1UA 4OT1L 4TUOB 3HNSH 2P24A 3B8YA 4HH9B 4PRHB 1T03L 4Z5RB 4GQPH 1U92B 5E8NA 3S88L 1NANH 4ZMAT 5F7MC 2EDQA 4ZUSB 1FP5A 3NPZB 2YD6A 4DJMA 3RGVD 1MIML 3CXDH 4NKMA 5HHOE 2B1AH 1BVZA 1KENH 4LLQA 5JHDA 3W11C 4EKXA 4LP5A 1S7TA 3FFCE 5MEOA 1XF5B 2WUCL 3HNVH 4HC1A 5E6ZA 4ZD3L 5SX5K 2OK0L 5GJTL 3NCJL 3FONB 5JW4N 4KKCD 1G9NC 1KFAH 5GQBA 2QHRL 4HZAA 3KXFB 1AP2A 4XWGL 1FGVH 4NNPL 5C0EB 4U1HB 4OCXH 1NEZB 3LCYA 4L4VB 5DEFA 4P3DA 3VFWB 3PE9A 3ULVD 1T1ZA 4LVNC 2MMXA 1XF3B 2YA2A 3OX8A 5FOJA 1BEYL 3MV8B 1KCUL 2FBJL 5D7IE 2NY3D 3I3DA 1DJSA 4ZPVB 1AFVH 3FOMB 3HI5L 3FT4A 4LRIC 1IFHH 3OKMB 3ZYOA 3F7YA 1FV1B 3D85A 3WNPA 4GKZB 5D7LA 2GTZA 1BVKA 1UC6A 4WWKD 4FQCL 4K9EH 5DD3H 3PDOA 4KHXH 2G60H 3BEVB 2A6DB 3WFEL 1OGAA 3CAFA 1OHQA 3QO1B 1OT1A 2VDPH 1CIDA 5EOTA 1MFAH 3QYCA 4JGJA 1QLRB 1RSFA 5IFAH 4RGOL 3FRPA 1A1NB 4NJ9H 5C7XL 3IF1B 1KTDB 2E9IA 1U91A 4KDVA 5DJZA 1F90L 1GXEA 1UACH 1T2JA 2NY2C 4K3JH 2IPUG 4OLZL 1F5WA 4D0BB 4YFLI 5HHPA 2NY0D 4JLRA 1CWVA 1IAIL 2FX8H 5CJQH 2YOCA 1T83C 3TPUB 1HKLL 2HRPH 1J0IA 4MHHI 2FATL 2Z9TA 4PR5B 3QUXD 3KPMA 4RRPG 5FFLA 1N8ZB 1N8ZA 1YEJH 1PG7W 1FFNB 4TPRL 4WI3A 12E8H 4PRBB 5E00B 3HLAB 3LB6C 1QOKA 2VWEE 5EBGA 1FJ1B 4A6YB 4NRXB 2NXZB 3L3KB 2XXCB 5FO8B 4OD2A 5F1IA 2R9HD 1WJ3A 5ADPL 5IT2L 4OGAD 3O6ML 3FT3A 2UYLA 1MFCH 4J3TA 4GMSH 4JJ5B 2DTMH 1KN2L 1BJ1H 4H25A 4JHBA 4AIOA 3Q6FB 2BZDA 5IFHL 2CDEA 3WIHA 5J13C 1JGDB 4PJCB 3RVVC 5HGGS 4OM1L 3WE6B 3C6LC 4LLMA 1SYVA 5BS0D 3GI8L 5C0CE 5JW5A 1T03H 3VCLA 1W72A 2VLLB 4QGTA 2JTDA 3QFJE 1QNZL 2D31B 1F11A 4AIZA 1U58B 3TCXA 5A16A 2IEPA 4NHUA 5K9KB 4HIJA 4PRAB 5D7LB 5SWZE 5MENA 4LAQL 1T04A 3S9DB 4YQXL 5MI0C 1JTOA 5I1GL 35C8L 3WUWA 4QOKD 3PXJA 2IANB 2VO5A 3LH2L 1HINH 1M71B 5GGSB 1N7MH 1MRFH 5GGSA 3NA9L 1FO0A 1Z3GL 3FQUB 2JJSA 3FT2B 1F8TH 5GGTL 2I26N 4ZFGH 1U3JA 2XKNA 5MI0B 2XV6B 1EAPA 1QBLH 5DVLA 2N56A 3O3EA 4LSUL 4UV7H 3TH4T 1T1XA 1MUJB 4KROD 5TF1H 4JFEA 4CRPA 3GBLA 2OJZL 2YXMA 5GPRA 5C0GB 4OLEA 4OFIA 4A2MA 5IEKB 3S98A 4ODVL 3FCTB 4MXWH 4LLQB 4LU5L 3TPUA 3HMWH 2CIKA 5D7LD 1A3QA 3TGXA 1NFIA 4N0YH 3SPVA 4I0PB 3JWDL 4WW2C 3QIUD 1ZHLB 5EOCJ 4QLRA 1MF2L 4CU6A 4DGYL 5IHZB 2YC1B 2K1MA 4Z7VF 3MV9D 1D5BA 1BZQK 1CU4H 2VDQH 1AXTH 1U6AH 1EHLL 1T20B 5JIKA 5KAQF 2HFFB 1NFDA 3LZFH 3QXDA 5FCSH 1F13A 4TRPH 1U8QB 1ED3B 3SJVE 2MQ3A 2OZ4H 2X4RA 4DKFL 3GMQB 5L9DL 4ZFOB 1HQRB 1GZPB 4NBZB 2VXSH 1D5MB 2AJSH 2DQIL 3MJ9L 4ETQB 5E2VH 1F3DJ 3LRGA 1QSFB 3DBXA 2ZKHL 5CZXC 4KAQH 3D48R 3EYFB 3KNBA 1BIHA 2CUIA 4JFQA 2B39A 5KVFL 1CGVA 4XP6H 1YYLH 2C3HA 2W60A 2ZWLT 2PETA 5FM5M 1H5BC 3SBWC 4YEFA 1YEEH 3D9AL 4GS7B 3BXNA 5INCB 2EYSB 4U1KA 3MRLB 5ITBL 1BQHB 3QUXB 2HLFC 3T2OA 4YK4C 2DI8A 3S6CA 4NZUH 3JBG7 1VPOL 3KPOA 1RUQL 1G7JA 3ARZA 3DXAB 5E56A 3CK0L 2D03H 2DQDH 4O5LL 1MRDH 4KK5C 5LJYH 1NBVH 4HWBA 2F74A 3FOLB 2NY5H 4ERSH 3MJ7A 3U0PB 3ZDYF 3EDFA 2DM3A 5CEXA 1XR9A 4RQQA 3IDYC 2VLRA 3PWNB 4TVPE 4DUWA 4RGNC 1FLTX 4LLMB 3QDJE 4X7FC 4RDQF 5GS0H 5EORH 3LHPH 4PY8I 2V7NA 1GGTA 3F7YB 3J7HA 4KVCH 3OKMA 4Z8FL 2BNUA 2AEQL 4Y16C 5DEGB 1CFTB 3EJJX 3IDMA 3VU2A 4F8QA 2AEPL 1FNGB 5I1JL 2NLJB 4Y5YA 4N9GA 1OPGL 1OTTC 3PL6C 3FMGL 3BP5B 4KU1A 3ZMRA 4GSDL 2X1XR 2ZG1A 1U8IB 4NRXA 4P46B 2XY2A 4M43L 3HFMH 4J3XA 1Q9LB 2I5YH 2WUBH 4P5TC 4NRZA 1EAJA 1DL7L 1RVFH 4P5TA 4I5BA 3SDDC 4MJID 4WI2A 4KVNH 3VWJC 5IHUL 4KQ4H 4N1HB 3TNMB 5FYJU 2Y07H 3FQRA 3OAYH 4K94L 4NOBA 2NY3C 5J4MA 4GAFB 3S34L 1T0NB 1MHCA 4QHUA 4UQ3A 5HHMB 5CUSL 4JPVH 5C6WH 4MAUH 5I75C 5IEHB 1EFXB 3MSPA 1B0RA 3SDDB 3BKMH 2YPKB 1PD6A 3QDMB 4L29A 4ZG1A 4ACPA 1RK1A 3HI1A 3BYYA 3EO0A 4G6JH 5T3ZL 4X4YA 3HC0A 3RHWK 4APQA 5CEYB 5SWZB 4Y7MA 3GSNH 4KZDL 2AXHA 2R8SH 2R0ZH 2V2WA 3U0TB 4TVPH 6FABH 3FO2B 4RFEB 2DQCH 5JXAH 4IBLT 1PLGH 1NC4D 3WKML 4DZBA 4D9QD 1YY8B 2Y36L 4UV4L 4OAWA 2NXYB 3OGCA 1DE4A 3BKJH 3EJZC 4BKLB 1LP9B 1YYLL 3P2TA 4YHLL 4PJDB 4MVBC 1V7NL 3MNZB 1ZLVH 2ICWI 4OSUH 2FZ3B 3REVA 4ZYKA 2VABB 1ORSA 1LE5B 1RIHL 4FNLH 5FUCE 5MEPB 2D0FA 4L8BB 2CKBA 3K2UL 3WS3A 1H3XA 1L0QA 3LN5B 3TBSA 3UYRL 5GIRB 3UPAA 4J23A 1CU4L 4NNXA 1T7WA 5IVZB 2B2XH 3PQYA 3MLSH 4CN4A 3SDAC 3OJDB 5D7JC 1F3JB 5TGBA 1BZ9B 3RDTA 3KPQB 4JRXA 5JOPD 3OXRA 3U2SA 4DUXA 1HHHB 1HIMH 3WFDL 4NO0D 3B5GA 2AV7A 3OB0H 5E99L 5T3XD 3IU3A 1LEIB 2HH0H 3K2UH 5BO1L 1Z9SA 3P73B 3JUZA 4YDJB 4GQ9L 4OSUL 3OXSA 5JHDB 2FJFA 5CS7A 3QZWA 4HWZB 1GZQB 1YN7A 5FA4A 1D9KC 5A2KH 3JZ7A 5B39A 5FCUH 3KYNA 5IMMB 2MCPH 4OZFB 2DD8L 3IJYA 5DQJB 5FOBA 4HKZB 1I85C 4LVEA 1FZMB 4HJJH 3H9SD 1I85A 4TVPL 3UROR 4X7DC 2X4OA 4LCWB 4JAMA 1W72L 1U95A 4W4OC 5EC1B 1I1AC 1Y18B 2QR0B 4JFFB 3LEYL 3CFBA 5BZDB 2DI7A 1FC2D 5E08L 5DRXB 2F54A 2FJGA 4NZRH 5DHVA 5GRVL 4GAJH 3UDWA 4YR6B 2NYYC 5T1LB 3QNYA 4OCWH 2O61B 1UWXK 5D71H 3VXSE 1Z0MA 4HIXL 4PRIA 1A6ZB 4Y2OA 5B3JF 1OAYH 4WJ5A 4OKVA 4DZ8B 1IL1A 1G7IB 3WSQH 2QQKL 1WZMA 4P46C 1R3LA 4UNTA 5BV7L 1HWHB 2AABH 1E28B 2X41A 1PZUB 1FO0L 2CDGA 2XOTA 3HAEB 5EPMA 5CAYB 3BWAA 3C08L 2D2OA 2KUTA 1UJ3A 2UV3A 4LAQH 5GGRB 2VLMD 3SJVB 4WU7B 5EWIH 1H8NA 3VGAB 2V17H 3O2DA 3DV6A 4GQ9H 1FQ9C 3ULUD 2DIAA 4QRRB 1B0WA 1RHFA 1XF4B 3ETBF 3GHEL 5MEPA 2C1PA 3NBNA 3VXQA 4G42B 4MAYA 4HS6A 1MHHA 1T22A 4L8SB 5A1AA 1JWUB 3GI9H 4UT7H 4EZMA 5B38A 3B9KD 1IQWL 1PY9A 2EKSB 2OQJA 4KJPD 1G7QB 4X6FB 1OP3H 4NNYB 4X6FA 1M7DA 4XAWH 3PHQB 1CICB 3TV3H 3TCLB 2A6IA 3P0VH 4D3CL 4QXWA 4NO2A 2A2QT 3BD5A 3KJ4C 1HN1A 3EFDH 4WEBL 1DSFH 3CFKB 4F58H 1E6OH 4XZUB 4DN3L 4QOKA 2FECL 4XCEB 3IDYB 4XX1G 5C9KA 3RZCD 1ZE3C 3KPNB 5D1QA 3ARBD 2JIXA 5GGVL 1X5LA 2R0ZL 4XPHL 5A3ID 5DF0A 1FZMA 5IW1B 5HD8C 5F6HI 1BVLA 1QSFE 3NOIA 2WP3O 3WKNA 4RNRA 4S1DD 4OLYL 4LBEB 3FFCD 5EA0H 2EICA 2R1YA 2Z92A 1S7WA 3MLZH 3OKDB 3BISA 1I7TB 5DT1H 1WT5C 4CVUA 4PJ7F 4QCIB 1YMMD 5AUMA 1CFQB 5CJOH 1IAMA 4I18A 4PGZA 2VISA 3GMLB 2VAAA 1U8OA 3BW9B 3BPNB 2Q86B 1OD9A 4YO0A 1LO2H 1LQSR 3OJDA 4HWBL 3EYSH 4L9LB 3S34H 5HSFA 2OL3L 4TSAH 2F5BH 1JNLH 1FZKB 3ZE1E 4IIQC 3T2NL 3WNMA 3LZFL 5H35B 4KGLA 4TTGA 1CDIA 1MI5D 3QQ4B 4R9HA 5D71L 2CKBB 1AE6L 2RCSL 2EIZB 3Q1SH 1ZHNB 2Q8BH 2VZ1A 4PYHA 1DEDA 3OJMB 4OZGF 2OM5A 3MA9H 5DRNA 1NAKL 2E3VA 3M45A 4ODSL 3UJTH 4NNPH 1VFBA 2EE3A 4HIHA 4OZGA 3MC0A 2W38A 4UQ2A 3PWNA 2JE8A 4MQXC 3S36H 3TLRA 4L9DA 2VYRE 2XRAH 5I71C 3DUHA 4AM0A 1WBXB 1C5CH 4NKIL 1KB5A 5CBEB 5FM8A 2XYCA 4RGNB 2ARWA 3RVTD 4KZEL 4PRID 4G5ZH 4TUJA 1Y0LA 3C5JA 1MFEH 1F3JA 5TGBB 4GXVL 2GJ6E 1JTPA 5TF1L 1S7UB 4UDTA 1QBLL 1T1YB 3AXLA 1LILA 4DFIA 1AR1D 4F33A 5F7UA 4JN2B 4XCYB 5AZEH 1HIML 3WFDH 4DKAA 4JFOA 1KPUA 3ME0A 3DMMB 3VD5A 4KK6C 5M7QA 5DXWA 2YPLA 4JFEE 2X6MA 4JFDE 2R39A 3SKNB 3OJVC 1AQDA 1GGCL 1C8PA 1BMGA 4D94A 1TJGL 3ARQA 1OTSC 5ICZA 3ESVF 3FCTA 5T3ZE 2F58L 3FQRB 1JHKH 5EU4B 1VFOA 3S88H 2R2EA 1IGIL 2GSGA 3CCHB 1HQRA 5TQ2H 1MUJA 4LK4A 4PV8B 5EU3B 2OX5A 3O9WA 1K5NB 3UTSB 4EUPB 3O3AA 4MA3B 4F9PA 3L3GB 4Q0XH 1X5YA 3E1F1 5CSZB 4OBRA 5DJ0B 1TXKA 1KJ2A 2Q20A 4GXUM 1MCCA 2K9UA 2B7DT 2DQIH 2APBA 5FDWA 2EEDA 1A6VH 4FXGB 2X70A 2GIYA 3UZVB 2AK4D 3OKLB 3RVXC 3AY4A 2NQCA 1CLYL 2W9LA 2HFGH 3QG7L 4NUJB 2VL5B 4XNUH 1BX2A 5BS0E 5I66B 4F7CB 3NCMA 2CKBL 3DX8A 1DFBL 1G9MH 1WFUA 1U93B 4FQ2H 1XIWD 2BVPA 4LVOC 4DGVL 4ELKB 3CZJA 1I1RA 4FQIH 1XMWA 2OS7A 3C6SA 3CU1A 3EO1B 3HPJA 5M94B 1YQVH 4K3DH 4HEPG 4QRPB 5GSRA 4Y5VB 2LE9A 4JM4H 3KVQA 4XPFL 3H9SA 3TO4A 3WEXB 1O5DT 4Y4FD 1FPTL 4KQ3L 3C60C 2BNQA 4NN6B 1ND0B 3JTTB 4CW1A 3RWCA 2YKLH 5KSAB 3AS0A 4BZ2L 1PZ5A 3BXNB 4K55A 3TYGH 4MNQB 3WFHA 5DZOA 1FIEA 3DOSA 1DFBH 1C12A 4IRJD 5C08B 3EW3B 4PJXF 3MV9B 3L5HA 5ALCL 3SY0B 5D2LF 4Y1AD 3P9MA 1D6EA 1F4WH 1HINL 4XTRC 1NBQA 4RRPA 1CD9B 1OT2A 5GJSH 3UAJC 1MH5A 3MRKB 4YXLH 4NYLA 3ARFA 5D6DA 2VQUA 4H5SB 3MCKB 4MWFB 3HAEG 1KB9K 5DK2B 1HEZB 3T09A 4U6XA 5TQ2L 2VIRA 3IU4H 4M8VA 1I8MB 1ZLUH 1INEH 1J11A 2XTJC 3NTCL 4LSSH 4XP1H 3TBVB 1PG7X 4RBPH 2D3VA 3ISWA 4HX1A 4MNGB 5JR1H 1OGAB 1S9VB 3QUZA 3ARRA 2Y6SC 1A4JA 1TQCB 2IH3B 2HLAB 3IU4L 1N6VA 3O2DL 4NM8L 4Y89A 3QQ9D 3WL9B 4LEXH 5D7SL 4CVZA 5L8JB 3OQ3B 4FQ1H 4LCIL 4LLYB 2P8LA 1KLGB 1R3KA 2OTUA 3HNVL 4GXVH 3CX5J 4QTIH 1OQXA 2G5RA 4JLRB 4M3KB 3BZFB 5I1CH 1J88A 1DBML 1UZ8A 2OSLA 5C07B 3X13A 1RURH 3MROB 4KI5D 1BD2E 2J8UB 4TPRH 5L9DH 2J8UA 4G8GD 3SDXA 1KJVA 1DQMH 1S78C 1ZS8A 3E6HB 1DEEA 5L8LB 1LO5A 1F6AB 4YHYC 4WNQA 1WCQA 4M4PA 1XIWB 5EO9B 1FZJB 2ZSVB 3EO9H 5C0DA 2GJZA 2Q8BL 2PO6B 4BZ2H 3IJSA 4FXKB 1EGJA 3LQMA 4JFDD 5DJ6B 4B5EA 4QWWC 2DTSA 3GSVA 1G84A 2DM4A 4K7PX 4RGOH 1TCRB 4P4KD 1YEDA 5DWUL 1J0HA 2DJUA 2DMKA 1N5AB 2LAGB 3MLXH 4KI5E 4LCCB 5DFTA 5BMFL 1T4KA 2BC4A 4HKBB 1KCSL 1DUZA 4ZODA 1AI1L 3CVHA 4N1CA 3UPRB 3UTSD 5EU6A 1E6JL 3SE9H 3TO4C 4LLAA 1JZ4A 3MJ6A 1PG7H 5DJ2A 2PN5A 3BJLA 2EEBA 4AT6A 1C16A 4YPJA 4JKPL 4D0CB 1Y6MR 2Q76B 4OD1L 5EA0L 3MR9A 4XNUL 1WZLA 5ERWB 4U1MA 1P1ZA 3RPIB 4RFNC 1E4JA 2J6EH 1D9KB 2LTQC 2WIIB 1RIUL 4Q2ZB 3P11H 4BYHA 5EU6D 1I75A 2EC9U 1FFOB 3R8BB 5JDJA 3M17B 3V79C 4KV5E 1U8HB 1WUNT 2EE6A 5C0FB 2E27H 1OSPH 3H8NA 1OARH 4YE4L 1P53A 1RJCA 3NCJH 1R3HA 3D2UD 4RGND 2VAJA 1WWWX 43CAB 2GYSA 5INDA 3CJJA 3LPWA 4PRNB 2EO9A 4LARH 3TNNA 3DGCR 1KSRA 3QUYA 3QHZH 1CD1A 4DVBB 3NCBB 1AR2A 4WO4B 4M1DH 1JGUH 5JLZA 4WTXA 1FZOA 3SKJH 4X4ME 3MRPA 1VGKB 3STLA 5CMAB 5CZVH 5GSRB 2CO6B 1MH5B 2UUDH 4W6WB 4J3OC 5GS3A 3D0LB 4O2FB 4XGZA 3VI3E 1Z0NA 5AUMB 2D4FA 4X7TB 1MFCL 3RX7A 1CT8B 1NGXA 5E9DE 4ODUA 2C5DC 1FL5B 3GHBH 3O41B 2V2XB 4YE4H 3UAJD 3HRPA 1DBBH 2BOCB 4JRYB 2FX9L 3QIUA 1QSEB 4RAVB 5J6HB 2ZPKH 4QEGA 3HPLA 4MA7H 5IB1B 1U91B 4HSQA 3ILPB 4ZSOB 3HI6H 3JWOL 2FX8L 2HT2D 4X6EA 5HHOD 3C2AH 5E8DL 5DJCB 1RMFL 2YUXA 1CDCA 4P2YA 3QPXH 3VXOB 1J8HA 1NDMB 3EFFA 4HHAA 4F57H 1A3LH 4NN6C 4WCYH 5FGBC 1T3FA 5C3TA 4KK9C 3DVFA 4GAGH 2JK5A 2R29L 3DPBA 3RBSA 2GSGB 4Q6YA 4L8CB 3VXME 5DA4A 4PRHD 1I1YB 2VR4A 4LHUD 3O8XD 4L3ED 4MXVF 4CBPA 4NFDA 3Q48A 4FTVE 4HWBH 5HGAB 2AEWA 2YD8A 4RGMC 2VZVA 4P0DA 5JQ6H 4MDJA 5E2WL 1BPVA 1KULA 4ODBD 3Q3GA 4WDIA 4XWOD 5GRJL 4LDLB 4KHXL 1SJXA 2GUOB 2IALB 1HCVA 4R2GC 5IWLC 5CJOL 3PJSB 5JXED 3EDKA 4TTDC 5F71A 4Q0XL 1X5ZA 3LV3B 5FYKL 5F1OB 5J7CC 4RMUA 2H6PB 1ZA3A 3T4AB 2C3VA 2J1KA 2ZUXA 5DEFB 2Y6SD 1JHLH 2R4RH 4R7DB 5DHYB 5CEZH 5C0AA 4EI5B 1QD0A 1TCMA 2Y7QA 1KJ2H 1AGDA 3PWVB 2F9BT 3BMWA 3HZVB 4JRYD 5HI5C 5TJWK 1G1YA 4JM2B 1VHPA 3ZKQD 3RWHB 3BPLC 4R97C 3WLWC 4WENB 5CGTA 3PABA 1FGVL 4PJ8C 2FGWL 1QRNA 5HDOA 4FQJH 4QTIL 1MCWW 1VENA 4YFLF 3RNQA 3QIWC 2AS5M 1U2CA 5I1LB 3TVMB 1REIA 3BP7A 2KQMA 1BBJB 1MLCB 2KH2B 1ES0A 4LSQL 1MCNA 1ES0B 2UVEA 3VG0H 1IGTB 4WHYH 1A6PA 1S7UA 3V6ZA 1CG9B 4NO5B 2WK2A 4TULH 5ABDE 1K3IA 5I0ZA 1IC4H 4PJDF 1CQKA 4JY6A 3B5TA 4NJAH 1BQUA 3DSFL 3BGFB 3PV7A 5DJ8B 4PLKC 4JVUA 5E1AB 3TWCL 4OCSH 5GZNC 4S10A 4GXUN 1BFOA 3QAZB 3DVIA 5E8PA 3MMEB 1D9KD 3OXRB 3U2SB 3QJHB 4ALAH 1UFUA 3X11A 4WW2B 5DD1L 4M9OA 4XPAH 3C60A 5FHAH 1DQJA 3B5HA 5GJSL 4WFHE 3A6CH 5IB5B 5I17B 4Y4FA 2OXGA 3WSQL 2ZCKH 4RISH 3S8WA 2Y06H 1N6QH 2YBRB 4XBPA 1MWAH 3PJSA 2XN9D 1RVFL 4OZHE 1DL7H 4PTUA 4O9HL 5D2LE 3PDGA 4HUXA 3KYOB 2X9XA 5CJXA 4DAGL 3I9GH 4WY7H 2P8MB 3Q5OA 1AGEB 4OQTA 4NQSA 4Z0XB 2FB4L 3WFBL 4JQVA 1LO3H 1YPZB 5B21A 5CINH 3E2HB 4G7YL 2Z92B 4OCNC 4XPHH 4F7MA 5C8JB 5EC2B 5DTFB 2KDGA 3ZTNH 2CDFA 1A6TA 3QH3B 1JWUA 4PJ7E 3W39A 4L5FL 5BVPL 1KPRB 4DN3H 4ZFFA 3VFOB 2CKNA 3K4ZA 1IZKA 1UG9A 1Q94A 1ULVA 2VITB 2VXVH 1FSKC 1FNLA 2YD9A 1KEGL 1VGEL 4ZO8A 1MI5E 1KELH 3RVWC 3TJHC 3CNKA 5TF0A 2AGJH 2NXYD 1LK3H 1DQJB 4HV8A 1G9NL 5B8CB 3VRLE 5SWZD 1DR9A 3O4OC 3RZCA 1KCKA 1L7TL 1PKOA 5D7JB 5MHSE 2F8OA 3UYRH 3G5VB 4I2XE 4YFDB 4JB9H 2YWZA 2VZOA 3H9SE 1GAFH 2AXGB 3ULUF 4ZO7A 3G08B 1ZTXH 2R23A 2ZJSH 1AJ7L 5ERWA 1N2RB 3MUGB 4LCCC 5T1LA 1Z5LA 2C1PB 5DHVB 1TVBA 5JW3H 1G7PB 5FUZL 3VXUB 4CVXB 3DURB 2H32A 4OLXH 1LHZA 5EFIB 2NY6B 3SDXF 2WLZA 4GBXB 2H3NA 2XZCH 3C60B 5I1IL 4KZDH 1SM3H 3H0TB 4LKCB 4P3CH 4X6DA 5JORB 3DO7A 2W1NA 4X6DF 4XMKL 2R1WA 1U6AL 1EHLH 3JTSB 2EDXA 3AVEA 4YDJA 5FYKU 4WI6A 2PYEA 4GAJL 1JCKA 5JXEC 2V7HA 3VGEA 4QTHB 5I1AB 1ACYH 1CFVL 4A6YH 1MF2H 1W72H 2RGSA 3ULUE 5D8JH 2OZ4A 2VZ3A 2AJ3A 4ZUVB 2P47B 2BVQA 4MA8L 2EH8H 1F3DH 4ODHH 4HUUA 1F6AA 1RK0A 2EYTB 5L2KD 4FQPA 2NY6C 4FHBD 2APXA 3X13B 1ORQA 2AJXL 1EPFA 1FAKT 4QXGH 5K59E 3HZMB 4NC1E 4HK3N 4NKIH 1MCOL 3U7YH 3B8SA 1LE9A 5BO1H 2BOCA 1QLFA 2HH0L 3FMGH 1IEBA 3VDBA 4M6ML 4G3YL 5TQ0H 4FFYH 4OCYL 5SWSE 1QFHA 2MTPA 5CJXC 1YY8A 3T2NH 2K7QA 1B2WH 1AQKL 1DP0A 2YN5A 1F2XK 1P7KA 5FYLH 4TQEL 3TN0D 3CIQA 4NRZB 1S7RA 3Q1SL 4V2BA 5DZLA 2BRRH 1B88A 3FT2A 4WI8A 5ADOH 3WMSA 1CICC 2VDML 1NFKA 8FABB 3FQTA 3JWOC 4ALAL 1WV7T 2X7LA 3SGJA 2P5WD 4IOFD 3MLYH 1YY9D 1OWRM 5GIRA 2H32H 4IS6B 4CJ1A 3W0WB 3GJFK 4MJ6A 5CD3B 1R3IH 1QG3A 3F7VA 2X1QA 3MLTA 4PLKD 4U6XB 1SJEB 2CQVA 1WC7B 4JRWA 3WNNA 1YEIH 2CIKB 1A1MB 5DVOA 3HG1D 2Q7YA 4OFVA 3TN0B 5ITBH 4P23A 3S35X 4GLRI 1G7MB 4OFKA 2GJZB 1A4JB 4ONOA 2P44B 1DDHA 3TH3T 1C5DB 1HILA 2A0LC 4FQHA 4EUPH 3IAGC 4BJLA 3ARDA 3HZKA 4LEOB 1HZHH 2VDNH 5JO5B 1G7JB 3PWPD 4P2CG 1UXSB 3SOBH 4HD9A 1D6VH 1IM9A 4H25B 3FRPG 1FFRA 4ZSOA 2ERJC 2AXJA 3SE8L 4XAKE 1I9RL 3CH1B 2OSLB 4LMQI 4NQXA 5C07A 2EXWD 4ZSOE 4H0HB 2ILLA 5E2TL 3QEQA 1BF2A 3GI9L 4UT7L 3FTGB 2BOBA 1QPXA 5DLMH 5LBSH 3G9VA 4HC1H 4F7PB 3EOTH 3LB6D 3ZDXF 2J5LB 4KXZH 4PRBA 5E00A 1KGCD 2GKIA 3QWOB 1PKQB 3W81A 5L7XL 4XPBL 1PKQA 3KPRB 2WZPD 1JV5B 4HUVB 2ADFL 1JF6A 4OIAA 1R0AL 1D7FA 2Y9RT 3MNWA 3A67L 4HX1B 2XT1B 1GRWA 1QEWB 2DQUL 5IF0A 1IM3A 4QKXB 3PL6B 3LQZA 4F37F 3BQUC 1TZGL 2GAZB 3RTQA 3JSSA 4LSDA 5CILL 3T8XA 3TT1L 5HPMB 3OR7A 3CVHB 3UPRA 3DYPA 5BVJB 2EDBA 1NLDL 2MHAA 5EZIL 1MWAA 1ZT4B 5AYUL 1R5IB 3NIDE 5J0BA 1RIVH 1MFDL 2A6KA 5BV7H 4M3JA 3MRRB 4M93B 3O3AB 4G6FD 4AEHL 3VFRA 3V7MA 5FKPA 3O3BB 3CFIC 4BSVB 1HHGB 3GSUB 4M7KH 4Q2ZA 4TSCL 2E5EA 1AGBB 4JQIH 4KKBD 2D9QB 1E0OB 4AH2B 1BAFH 1C12B 4CJ0A 5FB8B 2E7HA 5I6XB 1MCLA 2PTTB 3LPFA 2DLFL 2I9TA 4Q9BA 4JGUA 3PDDA 3TT1H 2FHCA 5IFJB 1A8JH 4XVJH 4FXLA 4EIZC 1TZGH 2ZG2A 1DBBL 3H9YA 4OQTL 1MQ8A 1DANT 1J05B 1MLBA 1X9QA 1S7XA 1UGNA 1XGPB 4WEMB 5ICYA 1WCBB 3O2WH 4F7MB 1EO7A 1AD9A 3A67H 3SE4A 3GSWA 3ES6B 3SDCD 5DGQA 5IB4A 3G5XA 4NQSB 4Z0XA 4ZFZB 5I8OH 5DYOA 4EUPA 3EYQD 4N8VG 3IKKA 4X6BA 2LABA 1T7VA 1U58A 1YNKL 4RGMB 4IDLA 4UB0L 4MQTB 4YHKL 3QHZL 4UNUA 5D7LE 5D1ZA 4KY1H 1IEBB 3SKMA 1QR1B 4LCYA 3B9KB 2B2XL 3D85B 5BJTB 5F9JB 4WHDA 4DGYH 2UZYB 2XQYK 2A77L 5I76A 3ECBB 5GRUH 1VDGA 4FP8H 3QHFL 2BY2A 5I73B 1OAQH 4OLUL 4F33B 1MLBB 1HDMB 2RBLA 3WKMH 3O9WC 4R0LA 3TBYB 3GMOB 2BNRD 2RB8A 4KJQC 3MACL 1HKLH 2ICWJ 3AMLA 5CJQL 5IKCA 1HHJA 5GRXG 4QRTB 2MQ0A 4FN0A 5D5MA 3VFSB 4CN6A 5E9DD 2OL3A 4DCQB 3DMMD 3MLUL 1CTNA 2BSTA 5CLWA 5KJRH 3U1SL 4YAQB 2HP4A 4G8EA 3OKEA 4J6RL 1L6XA 3RIFF 5FV1L 1JUFA 4QWWD 4AYFA 1CXHA 2AQ3A 3ARFD 3MRRA 2MPAL 4PGJA 4PREB 1XCQA 5A2FA 3UZEA 3MV01 4KJWC 3LPGA 5I8KH 3W2DL 2UWEB 1N64H 4JN2A 3CPLA 4KQ4L 3EYUH 3TJHD 5KSAA 3RKDC 3U46B 4JFFD 3U6RA 1A6AA 4XHQA 3PL6A 1CXEA 1QO3A 1GGUA 4RMSA 5JNYA 1CFSB 3CDCA 4LRNL 4POUB 3IKCA 2Q87A 5D1QC 1AGFB 3ALPA 1OP9A 3RWGB 4HGMA 4L3EE 4JZNB 4KV5F 5DD5L 3G6DH 4BH8A 3B43A 3X3FH 4IHOA 3TFKC 3T4YB 4P59H 4X7SL 4NO0B 1MHHB 1EHAA 2CLRB 1P69B 4WUKL 5HHNB 4PJ5E 4UUJA 4EI5D 2WANA 3CU7A 5EOCL 4HT1L 4WTZG 1YMMB 4LCYB 2P48B 3ZKXB 3FN3A 2PNDA 1AO7E 1N5YL 5C0ND 3MNVB 3OBAA 3G6JB 5I9QB 1QLRA 3HB3C 5C0EA 2JIXD 1HYRC 4KPHL 3ZKMD 4LEOA 1RZ8A 5EIIA 5EPMB 3ARDB 4YNYA 5ID0B 4BH7B 2OMBA 4JDVB 2MOVA 5F7EL 5GZOC 1KJ2L 2W92A 3H3PL 4XCCH 3EJYD 1KC5H 3GBNL 2V9TA 3RZCB 3QZWG 1ZWIB 2MFNA 1LK2A 4DKEH 2HJLA 4PJCE 4YC2B 5I1IH 3IDGB 4KKBC 4NUGL 4X4XB 5TE7H 4W6XB 4NZJA 3ABZA 3U4EB 1JNNL 4M7ZB 4PB9L 1SVCP 2I60L 5DQDL 1F4XH 3BP6B 4ZPVA 4YHYB 1AO7D 2EDDA 2PW2A 4KJPC 1INQA 3BZDA 1ORQB 4Q9CA 5IW6A 2VDPL 4U1IB 1M05A 4DN4H 5FB8A 4PJIB 4LSRL 1BZ7A 4JHZA 2DL9A 4XXDB 4Y4FB 4I77L 1EFXD 1EX0A 3IFNH 3P3YA 4MX7A 4HDIA 3DI2B 4KAQL 3BGAA 2CUMA 5KN5B 3DUSB 5AD0B 3GUTB 1QSED 5GRJH 3HAEA 3C5ZC 1T7XA 2A1WH 3MLWH 5C0CD 1AXTL 2CO7B 3QZWB 3QPQD 3DVNB 4HWZA 1FBIL 4MVBD 3T0DA 1ZLVK 1IAKB 2ESVD 3NH7L 5A3IC 3GJFA 4MJIB 3FB5B 2Y25A 2D7OA 1PEZA 5HI5D 1JPSH 1YNLL 1U8PA 1YUHA 2E7MA 3PWVA 1JYNA 4MAYB 3GMRB 5IW1A 3HMWL 2APVA 1JP5A 4MXWL 4GBXA 1DQTA 3MRBA 2PUQT 5E4EB 3GJEA 3LKOB 4PJ5B 4XB8A 4WO4D 1QFUH 4N0YL 1C7TA 4AK1A 3THML 2XN9E 3QIWD 4Z7QE 2YMXH 1I1AA 1U8NA 1A7PL 1TVBB 4JPWH 1NCWH 3WS6A 3OKEB 3ZTNL 2P4AB 4FQ2L 1FNFA 2LTQB 3TJEH 3FO0H 4AQOA 1I7ZA 3IFOB 2YR3A 1T2QH 3AUVA 5BZWA 4K7FB 4KTEH 4HMDA 4MSWB 3D0VA 3QG7H 4NOFA 1I1FB 4R8WH 1ZVHA 2DF3A 1EH9A 2VH5L 5DUML 5MEOB 1MHEB 4YIQA 3IXTB 3QB7C 1YDPB 4Z7UA 5FO7B 3TEUA 4PGEB 1P5VA 4YXHH 1VESA 3K4DA 3NFNB 1MWAL 3R1GH 1T22B 2DQEH 2GEEA 1ZHNA 1T6WA 1XZ0A 4OB5L 4E5XB 4JY4A 4PJIE 2BDNH 2V5YA 5DRXA 3WUZA 1UB6B 3GK8L 3L3DA 2CMRL 4XBEL 5FHAL 4I48B 5JHDD 1EFXA 4FFVC 2JELH 5D1ZB 4QHLB 1Q72H 4Y19A 4J4PD 2CMRH 3MJGX 4XBEH 3BP6A 4JFZH 5L2JB 5B22A 3ULSA 4JQXC 1EDQA 1U8OB 2R4SH 5TFSH 1QNZH 3WD5H 2N7BA 2V2XA 2FJFB 5I73C 3MRDB 2ICWB 3MRMA 3QPQC 3HE6C 5D7KE 5T3XH 2P7TA 4I5BB 4JFDB 4G9FE 1XGPA 4O2CB 1MPAH 5IFHH 2G9HB 2VRAA 2JJTA 5CJ5A 2PYFB 4IRSC 4L3CA 5D2NB 3RP1A 3ZKNC 1QSVA 4GBXD 2DLTA 1F3RB 1MFEL 3QEGH 2Q6WA 4UDUA 3MXVH 2F54B 2FJGB 5ID1B 4M4RA 3O6MH 2I25N 4BK4A 4ZXBA 3OMZA 4RAHA 2C4FT 5D6DC 1LO0H 3W9DA 5E5MA 5HHNA 2IPKB 1EVTC 3MA7A 3QCTL 4YHPB 3U82B 1KPRA 3FO9B 2DKMA 1BP3B 2IF7A 5DMIH 4JG1H 5D7KD 5EBWB 1BBDH 4GAYB 3CVHL 5GZOD 1A7RL 1OAXH 5DVNA 3STZB 1P7HL 1WAAE 2HRPL 4TVPD 3FO2A 3P73A 4O2EA 5DJXA 5CFHA 1EXUA 1XGRA 5KSVB 1RZFL 3D6GA 4HXBH 3BZEA 1UENA 1NFDF 1RUKH 4HFWB 2A1WL 25C8H 1OAZH 3V6ZB 2CXGA 2NNAB 3QXTA 1XR8B 3CC5B 3ZKMC 4EOWH 3CFJA 5HD8D 5IFAL 5MERA 4PRNA 4NP4H 3VWKD 3LN5A 1DQQA 1RURL 4NPYB 4PJFB 5DT1L 1BIIA 1T5WA 2FBOJ 3ZLQC 2W60B 2JCCE 1S3KH 1ORSB 3VDCA 4D9RD 3EYOA 3GMPA 5FGSA 4R96B 2KZ1B 1WBYA 3L5WB 5ITFB 3FTGA 4ZAKA 3O2DH 2YRLA 4M61B 1IL1B 4KKAD 1JBJA 4LF3B 3GBNH 4OCXL 4P46A 4HUMB 4LASH 4HQQH 4HAGA 4IRJB 3PXHA 3C5SB 1T20A 4EI5A 3CSPA 5J89A 5C09E 5HBBA 4JZJC 5JPNA 2CGRL 2HFEB 3GMOA 4N5ED 3SGEI 2IANE 2JELL 1HI6A 3D1MC 2F8VA 4O51A 3TV3L 1NBZA 4QXUH 2AXGA 3NACH 3MFFA 1I4FA 5KVEL 3PP4L 2WQ8A 4P2QE 4PIRF 1DQLH 2NX5A 3BZ4B 3DRQA 5GJTH 1RHHB 3A6BH 1MCRA 4HAFA 2VDKH 4H88H 2P8LB 2V5TA 3EYFA 4XX1E 5L6YL 3I3BA 2O5XL 1L0YA 1NC4A 2V9RA 1B0GA 4LLUB 3JVGA 4G8EB 1AHWB 1WQVT 5GSVB 2AJZA 4JFHD 3BH8A 4YBQD 3AB0C 3HA0A 4OZIB 3C8HA 1HSBB 1W2KT 4GRMB 4Y1AA 2BY3A 5CGYC 3QWRA 3GMMB 1II4E 2R0KH 3FFDA 4NHCL 4WO4C 4OCLC 3EKCA 1KJ2B 4QRUA 2M26A 5LCVL 2X4NB 4P57B 1NCDH 1QQDB 3B2VL 3CUPA 3PGDB 4Y4KD 4LVOB 1WCBA 4XPFH 3TBYA 3VWJD 2EDWA 2H6PA 2YMXL 2R1XB 4PJBF 5KTEH 1NBYA 2DWDA 2YKLL 3D5OF 3TZVC 1YQVL 4K3DL 3IDJA 1DUZB 4Z7UF 4X9HA 4J4PC 2VABA 5MHSD 1N64L 4OV5A 1KTRL 1ZGLB 3MCKA 4N68A 1R3KB 2OTUB 3MBEA 4IJ3C 4HFUL 3MXVL 5GS1A 3RDTD 5CSBA 2DKUA 2X1OA 2FDBP 2NX5B 3BZ4A 3DRQB 3RL1A 5DMKA 5FKPB 3O11A 3QDJB 2ADJB 1IT9H 2G75A 3S4SB 2C7UA 2NXYC 1MCIA 1H0DA 3BO8A 3VXMA 4O2FA 3UTPE 4NQED 4MNHB 5ALBH 1T6VN 3RWEB 4NM4H 3BN9D 1UEMA 1A0QL 4JKLA 3IFNL 1V05A 2EXYD 2PCPA 1OAUL 5FCUL 1TVHB 2X1WL 1I1AD 1KCSH 1BQHA 3MV8D 3SN6N 4LVHC 2M2DA 3ESUF 4PJAE 2NYYD 4PJDE 4Z7OE 5IF0B 1LD9B 3JTSA 3SCMD 4LLYA 2CLZA 4M7LH 1GH7A 1F58L 3CD4A 4I0KA 5F97E 1EVUA 3KPTA 2VLJB 2D31A 3BKCH 1IGIH 5C0GA 3RX8A 4O58H 2IMNA 3AU1A 1D5MA 2HTLC 1UWXH 1AXIB 4QHKI 1J0YA 2L7JA 1JWSB 4WI9A 4FQLL 5DGRA 1DANU 4H1LB 4ODTH 5F9OL 2HVKA 3KPPA 4KKCC 4UILL 4HBQA 1CGWA 3HC3H 3GBMH 2F5AH 3MRBB 5SV4A 5HHOB 3CX5K 3RU8H 3R0NA 2M8XA 3OKLA 4HKJB 2JB5L 4KMLB 1N5YH 1MHPL 3WFCH 2D0GA 3RL2B 3CSGA 4JCMA 3SQBA 4P99A 3GKWL 2X9YA 2X09A 1JGLL 2ZUUA 4UMGA 2X4UA 5BS0B 4LCCA 4JPKL 3QI9D 3M17A 4KK8C 2V2TB 1X7QA 5C09B 4PY7B 4UT6H 1X5IA 4ZS7H 1CGTA 1OGTB 2DLFH 4XH2B 4C4KO 3EDJA 2X4SB 5KVDL 3AU1B 4GW5B 1OSZB 1HHIB 4OI8A 2EH7L 3T1WA 3N1MC 1KT2A 4B53A 2X4RB 4E9LA 3B4NA 5GS1B 2OP4H 1CCZA 4ZFZA 3QFJA 5LXGL 5T5FL 3REWA 4RWHA 2OL3H 4TSAL 3WIHH 5KBNC 2W59A 1SJEA 1WFNA 1WISA 3QCVH 1YEKL 4DGIH 3KS0J 5I0DA 1YEGL 4NQEB 4PTTA 3NZ8B 1NGYB 3R8QA 4MDJB 3ARBB 3W82A 4OZIE 4NO2B 3ILQC 3QIBD 3JTTA 1J87A 2YD5A 1LVEA 1JNLL 3LEXA 4P57A 4RZCB 1EEZA 2EIBA 2X10A 4HZLB 4LSRH 3DI3B 2C4XA 5LAXB 3KXFA 4Y4KA 2AK1H 2ICWA 3DETC 3MRMB 4WV1A 4JR9L 1CQYA 4NP4L 5TDOA 2DLGA 3T65B 4YC2C 4EDXB 4ETQA 5F3HA 4M5ZL 2FNBA 1CICD 1J0JA 1I8LA 1OPGH 3C9NB 4TOYL 4C83B 4HS3B 3GMQA 3MOAL 4UAOC 5DRNB 2A6KB 7CGTA 5I8CB 1AC0A 5D9SB 1RHHA 3VRIB 1VEMA 5IB3B 2YEZB 1WTGT 1UJTA 2A83B 2NY2B 3I6LD 3VXTB 5GS0L 2BSRB 1N59B 1WZ1H 2CLVA 4JM2F 5E8EB 3EOBA 4UZGA 5DMIL 3QHFH 2R2CA 3GEWB 4OBSA 4JREB 3W11D 5ACZB 5LWYH 2L4OA 1KGCE 5HHOA 1E4KC 2I9TB 2EDKA 2D9CA 1HSAB 2X9WA 4FQIL 1RU9H 4P5KB 1WWAX 2O5YL 4JVWA 4WUKH 1CF8H 1A4KA 4UU9A 3OAYK 4PS4H 3T0AA 3HE7D 3O2VH 3T0EA 3SY0A 5D2LB 2XA3A 4HWNA 3CH8A 2Y4SA 3O3EB 3OKNA 4Y8AA 5E4EC 4UAOB 2BFVL 2ERJB 3GNML 1P4IH 2J88H 2O26U 2ZUWA 4IDJH 2A73A 5JHLH 1MAMH 4NQEE 4UTBL 1BGXH 1KN4L 2Z31B 4C59B 3KGRA 3DVGA 5IQ9B 3D69A 1ZEAL 4WRLA 2VOTA 1VACB 1VA9A 4XVSH 4K07A 3FJTA 4XNYL 3QNXB 5FO8A 2OZ4L 1T04B 4KDWA 5D93B 1AH1A 3P9LB 4ODXB 5CZKA 1CZ8H 1CK0L 3AS2A 2A6DA 3T3MF 5FXCH 4B7IA 1HWGB 4HJ0C 3QDGD 3ET9F 4MD0A 1FYHB 3BDYL 5FYJD 1MOEA 3EHBD 2C3VB 3LEYH 3LRSB 1CXLA 5FA3A 4AIXA 1NGPL 1MFDH 1W8NA 3O9WD 4CNIA 1LD9A 2EDJA 1JPTL 2VN7A 1XGTB 1H15A 4PJHE 5C1MB 1YECL 1BFVL 3O81A 4MJ6B 1ZA6A 4IS6A 2YUVA 3UYOD 2HJLB 3UJIL 2F53E 3ZE1F 4RX4A 1K8DA 4G8FB 1C08A 3MRJB 4XPGH 3T04D 1V5JA 5K9JH 5DJDB 4X80L 2A6JB 4YGVA 3DROB 4MA1C 5FYJE 3PDOB 1QYGH 2ADFH 4Y1AB 5CEYA 5SWZA 3HTLX 2UWEF 4LCUB 1S7TB 4QHMA 5JOEA 4HXAH 3GBML 5I1KL 5HGHB 2WWKT 2P5EA 4LSVL 1UWEL 3LH2H 1KEML 1FFPA 4BQ9A 3JV4B 1XGQA 4NFBA 4MDIB 4KJYA 5I16A 5IFJA 2HWZH 1FBIH 5ETUA 3O6LH 3VD3A 1J0ZA 1U92A 1LO2L 2OCFD 2HFTA 4UDUB 4CADA 5CD5D 1S7VA 5CSZA 3VJ6A 3IXAB 3DGGB 3VXSB 3RGVC 4G7VL 4I77H 4JZOB 1V7NH 4I3GA 3WN5A 4OGAC 3O9WB 3RQ3A 3AAZA 4DK3A 3BEVA 1EJ6A 3VH8B 1HSBA 1YEHH 1R3LB 1V3KA 3BN3B 5CHNB 1E4XI 1TETL 2VZUA 3TBVA 1BQLH 2ARJA 3IU3B 1MCWM 4LSTL 3U46A 5GGVH 5SWSB 4JO4H 2GJ6A 1X5FA 1EZVX 3H0TA 4LKCA 2JF1A 1BQHG 5ILTH 5IQ7H 2EIZA 1KNOA 4M62H 4U6HB 1R3IL 5C0FA 3K8KA 4JFFA 3UBXG 2JCCA 3OX8B 3MRKA 3PP3K 2Z31D 5IGXL 5KZCB 5E7BA 5LGHL 5D2LA 1BM3L 3IJHB 4D3CH 3FN0H 3IAQA 4PJ8B 4YAQA 3GMRA 4WUUD 5T1MA 4N8VB 5EZOL 1OL0A 4UTAH 3KLSA 1GCFA 3LKNA 4JPIA 4XVTH 4WUUB 4I3SH 3RPIA 4Q9RH 2GITA 4JRXE 5J11B 5E2UH 1U8KB 1G0XA 1JHTB 5KZCD 2Y5EA 5BW7C 5LGKA 1JYWA 3U0TA 5DHXB 4M6MH 1T83A 2Z31A 4KI1A 1CF8L 5CINL 2R0WL 3IFOA 1ZVSB 5I1JH 5IR1B 2AEPH 4PLJC 4PJXA 2X40A 3NABL 5JIIA 3VD9A 4Q9RL 3LN9A 1X5HA 3MBEC 1EZVY 4HKBA 1BD2D 2RJMA 4X6CA 4P2QA 2O5XH 3I02B 2XNAB 4U49A 3LIZL 4PJFF 3P0GB 4POZC 3I75B 5F6IC 4HS3A 2FL5A 2Z8RA 4HKXB 1AHWC 1QRKA 2DWEA 1CLOL 5GZND 4UTAL 3G5YA 3NZHH 1F4AA 1YEFL 3MNZA 2R23B 1GZPA 1CFVH 1LO4H 3L1OL 1QUNA 1ZWIA 3AM8A 1FRGL 1VFAB 3RVXD 4NQVB 4QYOB 3MBEB 2N4IA 4WHCA 3MV7E 3P4LA 5F7DB 3RNKA 2D7PA 4OUUA 1YEKH 3AAZB 2W91A 4IRZH 4DGIL 3FRUB 5E8OB 1ZLWK 2IFGA 5IQ7L 1AO7B 1NEZG 4P3CL 3NZ8A 1CGXA 4U7MA 4Z7VE 4MX7B 1ZHKA 1YMME 4R3SA 4Y16D 1MI5B 4JANB 4XWGH 5K9QG 2FX7H 5J12C 1S8DA 5I9QC 4P9HC 1AC6A 2VDLL 4I4WA 4Z9KB 4LNRA 2WUCH 4WU5B 5ENWB 1CR9H 1NSNH 3CFKA 5AYQA 3C9NA 4Z7WE 2QSQA 3EZJB 4YXKH 1NLBH 3WHXA 1S9WA 5E7FA 3QIUB 2VB5A 3GM0A 2VXSL 3REVB 4U4BA 3QI9C 2VXUH 3RY4A 3MV7D 4BQ8A 4XCNB 1MIMH 5ICZB 3SO3C 2F53D 1OQOA 2XKNB 3QHTC 2G2RB 1NC2B 2B5IC 2K3TA 1J8HE 4X4ZA 5I1EL 5HJ3A 4RA3A 3QBTB 5C0AD 4LSVH 5DEZA 4Y2DA 2QL1A 4LOUD 5EIQA 3NCYS 4O58L 1B2WL 4KROB 4TN9A 2AV1B 1NGYA 5C09D 2DM2A 1IZJA 1F58H 3QI9B 4FTVA 1MCJA 3C5SA 3FQNA 4HPYL 1K6QH 5CEZL 4I18C 1V7MH 3TA3C 3VFNA 1TMCB 4C57C 2VXUL 4P2RE 5HGDA 2V7HB 2DN7A 4AQ1B 2GJ6D 4HUVA 3NA4A 1E4XL 2NY7L 3DIFB 3RFZC 2AJYH 4CU7A 2R1WB 4D2NA 4WEUD 2BK8A 4H26B 5DC4B 4HIHB 4OZGB 1FL3A 4YHOH 5C0AE 3CFCH 2X1PA 1QA9A 3DBXB 5DUPH 3TNMA 4MCYB 3WJLC 3CX2A 4PGBA 2OJZH 2MKWA 2ZG3A 3LKSA 3FHQA 5T3ZD 4OZ4B 3WUWG 3WCYA 3PG2A 2GCYB 4UIKH 3S35H 2ZSWA 1CN4A 1F97A 1CL7H 4HFUH 1VSCA 4ZTPH 2VR9A 2WMPA 4P5MB 4XP9L 2ZUYA 3RA7L 2YZ8A 5BCAA 5D6CB 2J3SA 3BW9A 5DURB 2XFXB 1FJ1A 2GK0A 2VC2H 2XWBA 3F7QA 5IHZA 2HT2C 5DDHB 4M8QB 1B4RA 5I76B 1CK0H 2LU4A 1FGNH 2R56H 5HYSG 1BGXL 1H5BA 1ZHBB 3BQUD 5DD1H 3SBWA 1TZIB 4E42A 1NCDL 3B2VH 1OM3H 1YEDB 1OB1B 4OD3H 1FLRL 3OKYA 2LFGA 3GRWA 2C9AA 3OXSB 5I8EA 1DE4B 3DYOA 5C0RH 2BFVH 2DQEL 2PTUA 3ARXA 1UA6H 2NX5D 4QHNB 2EDNA 1R5VB 4EDXA 2AW2A 3MYZA 4JKMA 2IH1B 5LCVH 5DJZB 1NDMA 1ZGLP 4PRPA 3O2VL 4MLIA 3DO3A 3IXAA 1FIGH 3GNMH 5EO9A 4AT6B 1MCQA 3MX0A 1PY4A 3EGSB 1XF1A 4NNXB 5C07E 1FNEB 1EIBA 2X4PB 2AEQH 3SQOL 2BSRA 5C0JB 2VQTA 4APQD 4KRPC 5FUOL 1P84J 2VDKL 4M7JL 2D7TL 4G9FB 3X14A 2UVFA 5TH2A 1EA9C 2E7BA 1AQDB 4Z0BH 1N0XL 1S9WB 4NKDB 1GVIA 1MRDL 4GUPA 1KCVL 4MQ7B 4ETYA 4U7SA 1AGFA 2VXTL 3P11L 3I75A 4NCC2 4AENA 1X4XA 4I4WB 3QUMH 5F6HJ 3QXDB 3BFOA 1RIUH 4GS7C 3SGKA 5H94A 3G04A 1R5IA 2BJMH 3EYQC 3SGKC 3EOAB 2VSCA 4FRWA 4E5XA 1RZJC 1RD6A 4N0UB 3ZHLA 4JY5H 1JHLL 2R4RL 3E8UH 4WFED 3TM6A 4JJHA 1Y0LB 3C5JB 2GCYA 2NLJA 3GMMA 3KS0H 1U9KA 1WT5A 2FIKB 3IDXL 3PWJA 4KRPB 3U7WL 1PVHA 5LVEA 5C2BL 3CSBA 2H8PB 3C09C 4ZOCA 4NRYA 2DM7A 3PWPA 1UKTA 3MLYL 5JORA 3QUZD 1D6EB 1JZ8A 2AXFB 4U6VH 4FZ8L 1JPGA 3IDIA 1DQDL 4NQTA 1NKRA 4DVRL 3NGBB 2Y5TB 3R4DA 5E0QA 1U95B 4OCSL 4LCWA 1QO3B 4J3SA 1RZFH 4HXBL 4JG1L 1J1XL 5EIVA 5JOFB 4P2QD 3CZFB 3D69B 2ZNWA 3IFPB 3MUGA 4XXCC 2EXYC 1QYGL 2VIRB 4AL8H 5BV7B 2B4CL 1HHKB 1MJ7L 1U8PB 2EH7H 4ZUTA 4TULL 1HHKA 1RUAH 3HE7A 1ND0A 3ZTJG 2NY4B 2UY6A 3VG0L 5H8DA 4X5LA 1RZJH 4P2OD 4JN1L 3VXMB 1DVFA 1S9XB 2OK0H 5CKGA 2HT3D 1CLCA 5AD0A 3IGAA 3GKWH 2AXFA 1NUFA 3BUYA 1NDGB 5IMLB 4PUBL 1ACYL 5AG8A 1ZA3B 3B83A 2YRPA 5D5MB 1KPVB 1IGFH 3QRFM 1LP9F 5ICYB 2UZIH 4JHAL 5E2JA 4HMEA 4PLNC 4LSSL 1N59A 3UBXI 5KSBA 3HC4L 1HQ4B 1CDBA 1M7IB 3VW3L 3I84A 3VRIA 2A74A 2Z91B 4ODWB 3VMPA 1ZEAH 4F7EB 5IMKB 3MLVL 2ENYA 1LDPL 4Y5VA 1YC7A 2EKSA 4S1RL 2P8PB 4NQVA 5I6XC 4U2ZA 1T3FB 5EBWA 4OJFL 2CR6A 2H2PD 3O3UN 5HYFA 4XBGB 5DJDA 4OQ1A 5I1HL 2UZIL 1QBMH 3E2HC 4WV1C 1S9VA 1UB5B 2EDRA 4G8IA 2DIBA 4Y4KB 2VL5A 2QTEA 3O3DB 4K2UL 4S1DC 1TPXB 2P5EE 4S0SD 4Y4FC 4GW4A 4D8PB 1OLZA 3SE3A 3JV4A 5BQ7A 4GRLD 4O51B 2NZ9C 3QG6A 3NIFE 2FHFA 1L7IL 4HH9A 3B9VA 3B6SA 1RZJL 2AJ3B 4ZUVA 3MLXL 3S97C 3OZ9L 3WXWH 4N0FB 1OAQL 4OLUH 3GZKA 4XMLL 3P9LA 4ODXA 3CCHA 2SEBB 2QJDA 3JVGC 5MENE 2KKQA 3E6FB 1QFWH 4HG4K 4HGWB 3MUHL 1QLFB 2Q8AH 4PBWD 1U36A 3T08A 2UWEA 3DWTA 1JN6A 3LKRA 3BP7B 5CCKH 4RCAA 5FOBB 2FRGP 3QQ4A 1YNKH 1FORL 1X6NA 1CLYH 1X4ZA 2FIRT 3NFPB 1IGML 1DQLL 1MFAL 3QIWB 3N9GH 5FA4B 3MJ8B 4ZUUB 2IAMD 4MJ4A 3BQUA 3GSQB 1CLZL 3BIKA 4TYUA 1YPZF 2BSTB 4PJBB 4NYLB 1WFTA 2X4TA 2Y5TA 2FO4A 1F4XL 1P6FA 4N0FA 1NGZB 2FO4B 5SWSD 1CFQA 5C0NC 2V5RA 4DOHB 4E41D 3H7LA 3K0WA 3A6CL 4NKOA 3HRZA 1J1PH 3TPKA 1SEBB 1OAKL 3O4LD 4KK5D 3V0WL 1IAII 1ZANH 4GAYA 4GRWF 4PR5A 1K4DB 2BJML 3BOVA 3PQYD 3BE1L 5CGMA 2XY1A 4DKEL 2J6EL 4FTVD 3LAFA 4S1QL 3VFNB 4IOIB 5C0BA 5F3BA 3V0WH 1KC5L 5F7HA 1JE6A 3RZCC 1A14H 4QOKB 3FB5A 1A7BA 5I74C 4OCRL 4X6CE 4HT1H 3A0OA 2OTWB 3HE6B 1JNHB 4HUWB 4I3RL 1PBYA 1YPZE 1YN6B 1YN6A 3WN5B 1T89C 2JB5H 1U0QA 4ZQKA 3O11B 2X4QB 2A74B 3DJ9A 4PRIE 4C4KT 5DWUH 5KG9B 5I18H 1U3HB 2GTZB 1HE7A 3G9AB 4LPUA 2F5AL 4AMKH 1BHGA 4BSWB 1DEEB 1OAZL 3VXPA 4RAUA 1R0AH 2HT4C 2YK1H 3HN3A 1AGCA 3ARDD 4XNMA 5DS8A 3HZMA 5DS8B 4HS8H 2ZUSA 3T2PA 1JF1A 2EKJA 1PJ9A 4NBYB 2DB8A 1AGBA 5HGHA 4P3DB 3VFWA 4PG9B 1FLRH 3SE3C 1FPTH 1QQDA 3BUYB 3CUPB 4KQ3H 5H37H 1OM3L 1UJ3B 5LGHH 2E9WA 2WSKA 3QO1A 2IH3A 2BHZA 5I8KL 1FN4B 4V1DB 5L0QC 1S7RB 1C7SA 1A5FL 3PIQB 4NCC1 2ICEB 1R5VA 1CFSA 1Q9KA 2DQTL 4R4BB 4C56B 4U33A 4BELD 1NAMH 4KGJA 2D7QA 4FQ1L 1KCLA 3QDGB 1ADQL 2VDRL 4POYA 1CGYA 1ZA6B 4Q7DA 4NM8H 1I7ZB 2QQNH 3HR5A 3PWUA 5C70A 2BNQD 5DEGA 4YR6A 2ICCA 1KG0B 3U0WH 2MQCA 1DBKH 1JK8B 5EFIA 5GS0D 1LNUA 1QTYT 4X6CB 3WYRA 1MIEH 3H7BA 1NDGA 4FG6C 4QOKE 1JPGB 3IDIB 3UJJH 3ALWA 2BVEA 5HY9A 4PJXB 1FFQA 3IB4A 1LDSA 4HG4J 3WO4B 3MACH 1L4IA 2A77H 4QTHA 4PY7A 3VW3H 3WE6A 1I7RA 5EZLB 1P2CA 3BIKB 5DSCA 3BRFA 1P2CB 4HPYH 3QEQB 3GK8H 3NAAH 3L3HA 4NN7B 5D93C 4LGRB 3I6KA 2FX9H 3HE7B 2WWMD 1PYWA 4RNRB 3MODH 3EOBB 4UB0H 5FYLL 1B3JA 5F9AC 1JIBA 5AAWA 2HT4D 3QO0B 3OKKA 4P9ML 3WV0A 1RJYB 2VJXA 2XWTA 4KTEL 5C9JB 3TO4B 4IM8A 3O4LA 5A2JH 4JFQB 1O7SA 1U8LA 1H3PH 4MNHA 1MRCL 1L0XA 4EQ2A 3MRCA 5CZVL 1XF2A 5HI3C 4JFYB 3E6FA 4H0GA 1G7MA 3TYGL 7FABL 3SDAD 4P23B 2HTKD 3I6GB 5TE6H 2PXYA 3NACL 3UTTB 3JV6A 4EBQL 1OCWL 1UM5H 1I8IB 3DHJA 4KDTC 5I66A 5IBUG 3V5KA 1JPST 4GKSB 1BX2B 4M9PA 1NFDB 2EH8L 1BAFL 2YUZA 1ZGLA 4NQCD 3U48A 3LEVL 1XT5A 3THMH 3DVNA 2ZUQC 4OGXH 3VA6A 5L2KA 3W0WA 3BAEH 4EN3D 1RJLB 1TITA 1ETZA 4WGWB 5IESL 1RZKC 5J9PB 2VN4A 4TTDD 4XMKH 4PGDB 4U6YA 2GK2A 3U83A 3VGHA 4BFIB 4FFZH 4NZRL 4G43B 1K5NA 5F7FA 1QR1A 3UYPA 5IW6B 5I17A 5IVNA 4AEHH 5MP6L 4YHZH 3Q3GB 4WDIB 5E5RB 3QUKB 4YX2L 2AP2A 4XNQB 1KN4H 1WWCA 2P5EB 1MREL 2XQBL 1OB1A 5JW3L 4JFDA 1NGQL 4P49A 5CILH 5TE7L 4JFOB 2BSED 2EXWC 1AGEA 4X7CC 5DJ8A 4ZS6D 4L4VE 2VLRD 3RWIB 5L7XH 3F58L 3AS1A 3OL2A 5HYJD 3ARPA 4G42A 3QNYB 4R97B 3SO5A 2WBJD 5CD5C 4NUGH 5DK2A 1OAXL 3H2WA 3H6JA 3SDDA 2OI9B 4XPBH 4XMPL 4HIEB 4Y2DD 5IB2A 2XWJA 1N0XH 4Y4HC 3RKPA 3IDMB 4GFTB 4AIZB 5C9JA 1JWSA 4JRXD 1P84K 3OKKB 5KVGH 3KPRA 4BZYA 5GGSY 5ITFA 3BPLB 2IJ0C 1OLLA 3TC9A 5BS0A 3MCG1 4BQCA 4M8QA 5I19L 3O8XC 9CGTA 4L1DA 3QUXC 5ILTL 3CDGA 3IKCB 5HPMA 4O4YH 5JNYB 5ECJE 5E8NB 4OTXL 4XWOC 5DRZA 3MGOB 3P4OB 2XKSA 1LEKB 4DVBA 1NAKH 4OM0L 3MJ8A 3GHEH 2L0DA 5IJVB 2IADA 3D39E 3O6FA 3WO3B 3AREA 4PRDB 1I3GH 5EU6B 4IRZL 1G0YR 4CVWA 3PGCA 4BZ1H 3BO8B 3BH9B 4L8BA 3F62A 3AFLA 3FB6B 4ZDHA 3TO2B 3D39A 1NJ9A 4LHJB 2DQJL 1TJHL 4XB7A 1F4HA 4UI2A 2GI7A 1K4CB 1QFPA 1FGNL 5BRZD 5ADOL 5F6IB 5FYLE 1O7VA 1WC7A 4FXKA 2WIIA 2MPAH 4P23D 2BRQA 3WLBA 3U0PA 5EN2B 2AV7B 4GRWB 4X9IA 4YH6A 3GFUA 4P4KC 3GSRA 2IFFH 4MJ2A 4QXTB 1AGDB 1CL7L 4MQXD 3DXAA 1A22B 1JI1A 4QNPF 5KJRL 5KS9E 5L0QB 3ARBC 3D39D 2CSPA 4FQXC 4PV9A 3CFEA 5I1KH 4PV9B 1WAAF 4KUCF 3T4AA 1T66C 4TNVF 3W5MA 3ULVH 1HH9A 4MA3A 3GB7B 4AENB 15C8H 3W0WD 5IEHA 4D8PA 3BN9C 3WS3B 5EC2A 1OF2B 3VWJB 3P77B 1EEYB 2BXZA 2R2EB 4O4YL 1A02N 5F7NC 1J8HD 4GH7B 3QWRD 2CRYA 1A7PH 3S7GA 5KSBE 4A2LA 2F53A 5FECB 1UXWB 3ARDC 1I8LC 5HGBB 3ZYJA 1A6WH 1UM4L 2ZCLH 5IMOB 2FYYB 2XTJB 4R7NA 1HHGA 1EO8L 3CLFH 3PWLA 1NGXB 2IPTH 4Y19B 3K80A 2V2WB 2YBRA 1UWGH 4G43A 4JE4B 5E70A 1Q0YL 3FN9A 4XAWL 3ARGA 4YZFE 2XZAL 1CE1L 4HZLA 1HI6B 2GQHA 1EEZB 4WU7A 1ZHKB 3BDYH 4X6EB 1XZ0B 3EJYC 2Z4QB 4ZNEA 5I1EH 1P5UA 2IH1A 3O0RH 1RUML 3I6KB 5B39G 3SO3B 1XGTA 1V3JA 5E5UB 3F58H 5K9QI 4L4TB 2OR9L 4PGBB 2O5ZH 3QDGE 1AHWA 4OZFH 1OGAD 3QFJB 4HUKB 4LGSB 4Y4HB 3T4YA 3VFVA 2EEAA 1A7OH 4BUGA 3FKUS 3MXWH 3U36A 1ZTXL 3UTPD 4B0MM 2PYED 1BQSA 4ODUB 3TO2A 5JW5B 4X7TA 1PLGL 1KIUA 5FUCC 5ALBL 4N5UA 1Q9WB 1AJ7H 4M7KL 2BNRA 2QQKH 2O5ZL 5HVHB 3OG6B 2IQ9H 1N3NA 4TRPL 3KLDA 2NXZC 5CZXD 2R29H 3IJYB 5KW9L 3RWJB 3NN8B 4QXTA 3NFNA 5INDB 1KTKE 2MSPA 1FDLH 2DKSA 1IM9B 4HXAL 3SDAA 2PYEB 1T7YA 1KELL 3G6AB 1NCTA 1IAKA 3MGAA 1CE1H 2LU3A 5AG9A 3ROLB 3HI6L 3JWDH 3JWOH 5C08D 4ONHB 2ZNXA 3KDMB 2FJHB 1IMHC 4NHUB 5K9KA 1LK3L 2WV3A 4ORGA 3GMPB 4K23H 3TT3L 3VGFA 3BIAX 1YJDC 3HE6D 2M1KA 3VCLB 5CJBA 3N85L 5IVZA 3DHMA 5KSAD 1ACZA 3AREB 4KZEH 4Y2DC 4Y5XA 5HVGB 3GHBL 3RUGB 4X7EC 1EFQA 1MI5A 2R0WH 4YDLC 4R90L 5GRYA 4Q9QL 4YHML 1EEUA 1HDMA 4URTB 3BZEB 5BQ7B 2PCPB 5E2TH 3EYVB 4BKLA 3I9GL 4WY7L 4Z6AT 3ECBA 1J12A 4I3SL 4QHMB 5I1DB 4F9LA 4XVTL 3NIFF 5I8CA 2BVYA 1Q9KB 5F1SA 1TCRA 4XCNA 3H9ZA 1VFMA 1NUDA 3DV4B 5I74B 2B5IB 1DTUA 3FL7A 3VXSA 2K7PA 1R24B 1UCTA 3FHAA 1X5AA 2OLDA 4PGCA 2NTFB 1G6RH 4YDVA 3TWCH 4XPAL 3P4NA 1QRND 2WBJA 3QIBC 4PG2C 3B9EA 1RUQH 4UUJB 2DYPB 3DX9B 4LSTH 4LVNB 3JXAA 2D7MA 3UEZA 4BZ1L 5FDWB 5KVDH 2XTJE 2X4PA 2YC1A 3B2UC 2ZCHL 4OM0H 5D2NE 3QQ3A 2EDYA 4U1HA 1ADQH 4JQXA 1IJ9A 3P40A 3QEUA 1MHEA 4QRUB 4W6YB 2B20A 1MVUA 4P5TB 1AKJD 1JYXA 4E41E 4PJBE 2EDTA 5I2IA 4BH7A 1E6JH 4HUXB 2YHGA 4XPTL 4J2XA 3HE6A 3S5LA 4DOHE 3G5YB 3P9MB 1RFDL 2XG5A 3S4SG 2W9EL 3HMXL 4U1SB 1GYAA 1JPFB 1ITCA 3L5XH 3V0VB 3ZHDA 1W0VA 2VNCA 2Y07L 3NIDF 3PNWA 3QULA 4QT5B 4XRCB 4KVNL 3TF7C 4N90E 4M48L 4PGDA 1NJ9B 5LG1A 2DBLH 4GJTB 3SDXE 1FYTB 4M43H 3C6LA 1NPUA 2E6PA 1EMTH 4HS8L 1CD8A 4HH8A 4XNZC 2NW2B 2NZ9D 4EXKA 5D70H 3C2SA 4PJ5D 1M6OB 3S36X 2AI0H 3IXTA 4IRJA 5C7XH 1I7RB 1LO0L 5EZLA 2I24N 4MHHG 4MYWB 1A4KB 4UU9B 4LFHD 3T77B 5K9JL 1FG2B 3FONA 4K7FA 3BPNC 1MCPH 5ISZB 5C71A 2PXYB 2W07A 4K3EH 2YWYA 4NKQB 5FYKH 2BMKB 4A6YL 4H8WC 4FQQB 2ESVB 4UQ2B 4JFXB 4IOFC 1AIFA 4ODHL 4R96A 2A0LD 4NM4L 3FB7B 2EDLA 4OCRH 2YRZA 4YX2H 2HLFD 5C0CB 1F8TL 3SKOA 4LL9A 1QFWI 1A3LL 4WCYL 1A14L 5IM7B 3QO0A 3GRWL 3PWUB 5IVXE 3HI5H 4FMFA 5K59F 4QT5A 4XRCA 3QXVA 3VXUA 4HGWA 1RIVL 4IMKA 5BXFB 5ANME 5AYUH 4UOW0 2SEBA 1RZIB 2Q86A 2KBGA 5FYKE 5KSVA 1Y6NR 2AKRA 1GGYA 3SKUD 2XZCL 4JPKH 5FGBA 5IBTL 1HHJB 2BDNL 1KTLA 3QFDA 4POZD 3RX5A 4NKDA 5KN5A 3WDIA 2HYMA 4UTBH 4PJEE 2VDOL 3BKYL 3QRGH 3MLPA 2NY4D 3ELAT 1WVZA 1EEQA 1S7XB 1XFPA 2X2YA 5T3XE 3MXWL 1Z9OA 3KYOA 4PJ9D 2ITCA 1BVLB 1ITBB 4RWYL 4RX4D 5ETUB 1KXVC 4J3UA 2PW2B 3FOMA 3MA7B 4J3WA 1SEQH 5FV2A 5IM7A 2UUDK 1ONQB 3F7VB 1V3LA 1UQSA 4ZXBB 3P4NB 2AEIT 3UDWC 4M1DL 3BT2L 4R4ND 3E0GA 4BSWA 1URLA 4EQ3A 3BHBA 3LDBC 4PGCB 2O5YH 1NCWL 1G6VK 1AO7A 2FD6H 1TTGA 4PJ9A 3QUZB 3BPOB 4XVUC 5ELIA 3UTTD 1I3VA 4WV1B 1D5XA 4U0RC 4YHNA 4JO3H 1JRHH 1B6DA 4LARL 3HKFA 2R69L 3GO1H 5F7LB 4X5XB 4R26L 4GRLC 4NZDA 4JM4L 4L4TD 2MHAB 3GGWA 5EULV 3KAAA 1MCEA 3NGBC 3R06B 3QUYB 1CYGA 5JTWA 5FK9A 2GAZA 3RTQB 3U0WL 4G8GA 1FVDA 2QKIB 3MZTA 1BJMA 5JOFA 3RGHA 1RJZB 4ESKA 4OLVH 4I48A 4JKPH 1HKFA 4JAMB 3R0MA 3QEQD 1N0LA 4BH8B 1N6QL 4LLVB 5FO9A 3HRZB 4Y19D 1NH6A 2ZCKL 4OIBA 4YO0B 5IR1A 1T7ZA 3KYAA 3U36B 1QBML 4YHIB 5I1HH 1ZT1B 5H37G 4PD4K 4MNQE 5SX5H 2MKLC 3SE9L 2Y06L 3KPOB 4OJFH 4YQXH 4RISL 4JO1H 5ACZA 4WWKA 43C9A 3TFKD 5E4IA 4MNQA 1Y6KR 4JJ5A 5BMFH 3RIFK 4TQEH 2IGFH 1A9BA 3TVMD 3DIFA 2Z4QA 1J86A