5EC2B

Kcsa with v76ester+g77da mutations
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B01
5IMLB 4QRPA 1K8DB 4O2FA 2AXFB 2ICWI 2XZQL 4KMLB 2BNUA 4U1SA 2CUMA 1WAAE 3O6LH 2OQJA 5B38A 5CEZE 1CFTA 2QKIA 3MCLL 4Z5RA 4EVNB 4QOKA 1BFVL 1HHKB 4UZGA 3QHTC 3TO2A 3VJ6A 2BOCB 4YHKH 5JLZB 2Q8AL 2MFNA 3BP7B 4NWUH 3L1OH 5I71C 3H9YA 1FDLH 2VR9A 1X5LA 4B0MM 2A83A 1QSFA 4X98B 4G6JL 5FA3A 4Z7WB 1TQCC 4K7FB 5HYJB 1IEBB 2R0WL 2FEDD 4G3YL 5AUMB 4GH7B 5T1MA 3SPVA 4RFEA 3X17A 2CH8A 1J05B 3OV6A 2Z0BA 4CMHC 2HFEB 1KEML 5C09A 3LH2L 4GAYB 3GGWA 4H26B 4LASH 5EZIH 3VWJC 1AE6L 2B20A 4O4YL 1BAFH 1HHIA 4UNTA 1BBJA 4FABL 2YOCA 4JG0H 1S9WB 1IEHA 1CFNB 3UYRH 4S10A 4M7LT 4Y5VA 5IGXL 1HNGA 3VGDA 4LCWB 3BGMA 4ZS7H 4ZFFA 4D9QE 1HHJA 1P7KB 4HFUH 1BD2E 4QHNA 3FT3A 3PIQA 4OT1H 4PRHA 5IW6A 4OD2A 3UJTL 2CIIB 1QRND 3QIWC 4CDHA 2AXJA 2I27N 4ODVH 2AQ2A 3JV5A 3N1FC 2XYCA 3RDTB 2LVEA 3L5IA 2DTMH 2BC4A 4FMFA 1KB5A 4KHTH 4CN6A 3BI9X 4GQPH 2H2SD 5HI3C 3C09B 5I16B 5BV7L 1B0GB 4LVHC 1WUNT 2R4RL 1C16B 2MHAA 3G6JB 3C6LC 1Y6KR 2FX7H 3Q1SL 2NXZB 2JCCF 1AHWB 3QEHB 4HSQA 5T1DH 5IB1A 5ADPL 3LS5H 3U2SB 3LDBB 3JV0A 3ULUL 4NP4L 3AMLA 3SDCD 1T6VN 1LE5A 3INUH 4G9FD 2DM7A 3OXRB 4PB9H 1Y6MR 3GSNH 3ROLB 3QULB 5CZXD 1RU9H 4P5KA 3QDJE 4NC2B 4PP2A 3X11A 3UC0H 1WGOA 4L5FL 2R0KL 5D1XB 4JGMA 4KMTH 3MGTB 2FWOB 4G9FB 2BVOA 1I9JH 1XFPA 5F97E 4XMKL 2XKUA 1RFDL 2IQ9L 3FB5A 5SX4I 5I8KH 2J8UE 1ZLWK 2N1KA 1NCBH 4MQ7A 4NDMA 4HAFA 4NSKB 2Z8VC 2QHRL 3I3DA 2ITCB 5D93C 5J12C 1VEPA 2Y36L 4R2GC 2YD5A 1UH4A 4F3FA 1J0KA 2E8YA 1INQB 5BMFH 5E99H 4DKFL 4OCXL 5A2KH 3OHXB 1M7IA 3DVIA 3E0GA 1GYAA 2A6DB 3MRRB 3MXVL 2XXMB 4LLVB 1HYSC 1GGYA 1X4YA 1LMKA 4FXGB 3QXDB 1BQHB 4MJ4A 4X6EB 3MZTA 3QHZL 1NKRA 3O4LE 3DETD 5SWZA 1FYHB 3IRZA 4JO3L 4UDTB 3BWAB 4XVJL 2GJ6A 5SX5H 4JRXD 3FQWB 2PO6A 5CJXA 4OCYL 5AG8A 1KIRA 3PGCA 5I1AA 2VQ1B 2AS5M 3QDMD 2VDNH 4YZFF 2UWEE 1Q38A 3CLEL 8FABA 2V2WB 2W60B 4L3CB 1W8NA 3EFDL 4Y4FC 5LQBL 2X6MA 2CDGA 4OLWH 3UTQA 3QDMB 4GQ9L 5HYQA 1Q1JL 2OR8A 1MY7A 4CU6A 1HH6B 1XGPA 4WUKL 2ENYA 3Q6GL 5TPWL 3BYYA 3EOTH 5IV2B 1FHGA 2BVQB 3GSRA 1XGYH 1IQDB 1BX2A 4PJDE 4X4YA 4FQ1H 1ZT7B 5AWNL 1KGCD 1RIHH 4NQCE 5IF0A 3PWVB 4TRPH 4WW1A 1A0QL 1RZGB 3E6FB 4WUUB 5JOPD 1T1XA 1GAFL 1I4FB 5GGRB 2ZJSH 1IGIL 4HX1A 5KSBE 3OGCB 2I9LB 1CXFA 4F7EB 5D1ZD 1F4WH 2BNRA 3IDMA 1UZ6E 4GKZA 2YA2A 4OZGE 1CFSA 3PWNA 2NR6D 2I60H 4WWKD 2X4PA 3D9AL 4XB8A 4ENED 2ED9A 1G9NL 5J13B 4R3SA 3QT2A 3X3GL 5IMMA 2DJUA 2D0HA 3T04D 3BP4B 3PABB 4X80L 2AV7A 1KCVH 2P24B 5GGSB 5L2KA 1AR2A 5L8JB 3W5MA 3O2VH 3WL9B 2GJZB 3C5ZD 1FORH 1H3WM 2B4CH 3LS4L 3BEWB 2XRAL 3ZZ1A 4PS4H 3ULVE 5JXEC 3JV4A 2VDQH 1NGPH 3IKCA 3LVEA 3NFNA 2R1YA 4OF7A 5D7IA 4PLNC 5I17A 3WFHB 1M05A 3QO1A 1I1AD 4GG6B 1E27B 4L3EE 3KYKH 3HAEA 3HUJF 3CXDH 4R7DA 5C0CD 5DJXA 4NT6B 4POYA 4PRNB 4JFZH 1ED3B 2YUXA 3CX5K 3MRLA 1WFTA 5IW1B 5DO2C 3VH8B 2VDOL 1MI5D 4J3VA 4MQSB 1I3VA 1IM9D 4BUHA 1T1YA 1I1AB 4OCWL 1G7LB 2PTTA 3KPQA 4KMQA 4OJFL 2NY5H 4LEXH 4XTRD 1CF8L 1HI6A 2MKWA 2GSGB 1UVQB 2C1PA 1Q9LA 1ZV5A 1MI5B 4FQLL 1IM9B 3QFDA 1MCQA 2V17L 2VDKL 5CZKA 2AJUL 1MLBA 4RRPA 1U8QB 1L7TL 5HYFA 2FB4H 1X5ZA 5DVMA 1HXYB 5E94A 3W11C 1CD9B 3QEGH 4R0LB 2QEJA 1JJUA 2DIJA 2VUYA 1JMZA 4XMLL 4R8WL 3MRMA 4MNGB 3LKQA 4LSVL 5D7SH 1KJ2H 2ICCA 5IJVA 1QKZL 1D6EB 4RMQA 3DJ9A 5DQ9A 4HKJA 4XCCH 5E8NB 1KUMA 4ONHA 2HJFA 1HZHH 3CX2A 3WN5A 4PJGF 4L4VE 4HIJB 2I26N 5DC9B 4XP6H 2VAAA 4YDIL 5C6PB 4P2OB 2FO4A 3BHBA 1SYSB 4J6RH 4GW5A 4G6MH 4YHYB 3V52H 5AZEL 2GT9B 2HRPH 3JWOL 1B3JA 1E28B 5FGBC 5IIEB 2J88L 1OAYH 3ZTJH 1IGML 2DQFA 4HXBL 4QRQB 1DDHA 3LMJH 1KIQB 4Y2DD 3RVWC 3WIHH 1EEYB 3TBWB 2GY5A 4B41A 2AEPH 4JRXA 4UBDD 4MDIA 1DQMH 1XCTB 3PJSB 4LBEA 2X9WA 5EOQH 3WFDH 4FQJL 4LSTL 2CPCA 5F7NC 2O5XH 35C8H 5T5NG 3THMH 3O3DB 1OLLA 2P8MA 5EH1A 1BD2B 5IVNA 1RY7B 4Y2DB 4P46C 3GI9H 1L6XA 1W72H 2PCPB 3WFBL 4CVZB 3H3PH 4P2QE 3LN9A 1NBYB 3HZKB 2AJYH 5C86A 3LHPL 5TDOA 1UJ3B 5TE7L 2EIZB 2CGRH 4L8BA 5IB3B 3TBYA 4YDVB 4ZTPH 3BKYL 5DRNA 4R9HA 4DAGH 3QQ4B 2D4FA 3DX7A 3BH8B 3DUSA 5D70L 1NCCH 3VXMB 1CE1L 2AJZB 2V5TA 2IPKA 3X13B 4OTXH 4JVWA 4JM4L 1NLDL 3NA9L 2FO1A 4A6YL 4NFCA 5D1ZA 4WFEE 2HT3C 3UDWA 3KPOB 1YMME 5DJDB 3JSSA 1EGJL 4WWKA 2NNAB 3QUYD 5BV7C 4K8RC 1RMFH 2QLVB 5CMAA 1NAKH 4KRMB 1YEHL 3ZDYE 1MRFL 4BZYA 4X6DE 5IBLC 2NXYC 1WZ1H 3D3VE 2DLTA 4Y4KC 2BXZA 2PUQT 1DUZB 3B9DA 4KWUA 4AM0B 4IRSB 1IC4L 3ZTJG 1MNUH 3C5ZA 2QQNH 3BZEA 4FQIH 3GRWH 2VLMD 3JTSB 2HVJA 4Y5XB 1F8TH 5F89A 4Z7OE 3LQZA 3G5XB 2WUBH 5BW7C 3H3BC 3P4NB 4LDOB 1S9VA 2CKNA 5IHUH 5JXAL 2WUCL 1K6QL 5C0CA 2AJSH 1INDH 1I85C 5J89A 1UZ8A 3WFZA 3RNKB 1JNLH 2VC2L 3A0OA 4XP1L 4QEGA 3RVUD 4NWTH 2CRMA 1G7PA 3KJ4C 4DGIH 1J5OH 1EHLL 4DVRH 4JR9L 2CLRB 4KAQH 2QADC 4LCIH 4PTUA 1WBYB 1G7MB 2OL3B 2VAJA 3TBSA 1HCFX 3QG6A 1DCLA 4GRLC 4FQHA 2DMBA 3EYSH 4QTHB 2C9AA 3T4AA 1Y18B 2A6KB 4YXKL 4D0CB 5DEFB 2H2PC 1ZEAH 3E8UL 1KC5L 5I2IB 1KTLB 5EU6D 1U3HA 3SY0A 2DD8L 4K55A 1FNFA 4RMTA 1BZ9A 4YHZL 3P2TA 5E8DH 1PSKL 1F3JB 4PTTA 3R0MA 1J0YA 5ITBL 1WTLA 4OCSL 3F6IA 5EU6B 1G6RB 2KDGA 4PGCB 1H5BA 5MHSD 2CKBA 4LK4A 3C5SA 3O0RH 4YGVA 1T66C 4BZ2L 4XC1L 5CGYD 5J11C 3KLDA 5DR5H 4L1DA 4HD9A 2NY2C 4H88H 3NZ8B 1DVFC 1XGTB 4WNQB 1CVSC 4NNYB 3Q0HA 5DHVH 1UYWH 1N7ML 3EKCA 1I1RA 4OZHF 1S7UB 5GJTH 3BE1H 4XPGH 4NKDA 5CJBA 5KSBB 1DBKH 3DV4B 1V7NL 2ADGA 3D25B 4MAYC 2FJHB 3BKMH 4MQXC 3VXTA 4PJ9B 1D5IL 5TJWK 3TF7C 2ZCHL 4N90E 2NX5E 5KAQF 1MWAA 1YN7B 4QRRE 1E4KC 4KDWA 2I9TA 1EVUA 4Z7UA 3OKLB 4N8CH 4WJ5A 2YA0A 4JJ5B 5DI8A 2YN5A 4E42A 2DQEL 3BO8B 3GNMH 4NRYA 2FX8L 1U8MA 4PUBL 4JO4H 1RZJL 3JZ7A 1J8HD 1NDMB 3BGFB 3QIBC 3HG1D 5D8JH 2YPKA 4CU7A 4M62L 3OKNB 4M03A 1BQLL 1IAOA 1OD7A 3PQYA 3BZDA 2D7NA 4KC3B 5IOPB 3T2NL 1J8HB 5AD0B 4LAQL 2XTJC 4UQ2A 1U8LB 3KPNA 4HUVA 1XF2A 3HG1B 1GZQA 3QXWA 4M6AA 5FUCC 4EI5C 4Y1AE 5E6ID 2FGWL 3D6GA 1TZIB 2AV1A 4M1DH 4ALAH 1YY9C 2MMXA 2UYLB 1Z9MA 2OR9L 3IJYA 3NAAL 4M1GH 5FEBA 3MJ9L 4KTDL 2YK1H 4LCCB 4PJIF 5LKNA 2YD3A 3IJHB 1OTTC 1QSVA 1YMHA 4NKOB 3UTSA 4BQCA 4UAOB 1CLCA 4ZUUB 3WHE0 2XV6B 1JFQL 5DD5H 1NFDB 5C0RL 5JW4N 5ILTL 3V4PH 1XMWA 4YHLL 2X4NB 4ZO8A 1FZKA 4HWZB 3UAJD 1HXMA 1QLRB 3KPRB 4IRZH 4JFFD 5D96C 3DHJA 1OTSD 4HLZH 2DBLL 4FS0A 1N2RB 1KJVB 1FVEA 5IB5A 1YJDH 3GKWH 1LK3L 1U3ZA 2DQTL 4FFWD 1Q0XL 2E9BA 5A2FA 3SOBL 3AUVA 2WM0A 3SBWA 2R1WA 3MNWA 4LOUC 3BPCA 3ZKMD 1U8IA 2XKNA 2YD6A 4YXLL 3TZVD 1CWVA 4XRCB 3TNMB 3FB8A 4JEGB 4AENA 1EXUB 3NFSH 1X4XA 1FLTX 5FXCH 3BAEL 1MCIA 4X9GA 4DFHA 1AH1A 2VXQH 1KBGL 5IR1B 2KQMA 3WIFB 3QO0B 5CJ8A 5EA0H 3NGBB 1IAIH 2RFXA 1DANU 4LIQE 3CFIC 4YHPA 3HPJB 1WC7B 1N3NA 1XR9A 1NMBL 3VXOA 3L95B 1I8IA 2KZ1B 3VMPA 5HDQH 4O2EA 3DMMB 4TVPL 3P4MA 3CDGA 5JO5A 4MJIB 1UGNA 3MQIA 4NO0D 4WY7L 4MAUL 4GRMA 3SCMD 2DI9A 1NMCB 1VCAA 3MBEC 2X4TA 1NDGA 2CK2A 3RUGF 2KQNA 4RA0C 4KKLC 5LCVL 1OTUC 3MFFB 4RGNE 2X1XR 4HKXA 4RIRB 3PF2A 3W2DH 5J6HB 2BK8A 5CEYB 3BKJL 1UCBL 4G43B 3RL2A 1WWBX 4ELMA 3STLA 3QJFA 2QQLL 3MYJA 2YC1B 4ZFZA 5I8CB 4OFYA 2EEAA 5LVEA 3F7YB 3CUPA 2J5LB 2EZ0C 1KLFA 5TE4H 2EYSA 1EEZB 5D1QA 1TETH 1NBQA 1CU4H 5F72S 3PE9A 4LRNH 2WP3O 4U6VL 3MLPA 4HLZG 2VXSL 2DQUL 4S1RL 3OJDB 1QBBA 4F57L 3FQRA 3LB6D 2Z31D 2JJSA 5D2LE 1RZFL 2GSIB 1JYXA 1C8PA 2CSPA 2X4UA 4HT1L 5D7KE 1JPSL 4YEEA 1KF9B 1C5CL 4RGMB 4BA8A 5T3ZL 2NY3B 4HUKB 1TJIL 2Z31B 4OIAA 1N8ZB 3FFDA 2MPAL 3EJZD 5C0JB 1NCDH 1M7DB 4I4WA 3T2QA 4ODHL 4JFQB 3TCLA 3NOIA 1ND0B 2YD9A 2PYEB 4MA8L 3EYFB 1KPVB 1MJ7H 2QHLA 1FJ1A 1FYTA 3L3HB 3VD7A 4ZYKB 4FTVE 3CVHL 2BERA 2H3NB 5B8CC 1IGYB 2Q6WB 4MGXA 3HLAB 1IKFH 4AT6A 3WKMH 5DJ0A 2YKLL 4C57C 1J11A 3CH1A 2VDRL 3MRJA 4ZDHB 1S7WB 1F6LL 4ZSOB 4P2RB 2V2XB 3GSNA 1U3JA 3S37L 1YYLL 2ED8A 2V5SA 3RIAK 3QH3B 3QRGH 1DQDH 3ARFA 1TJHL 3KPSB 1UADC 1CDBA 1S9XA 1HKLL 3GJFK 1A4KB 1CDYA 4GAFB 4JCMA 4L9LB 3OZ9H 1I8MA 5DUBA 5KS9A 2YA1A 5F1SA 4I3SL 4JFPA 2Q3ZA 3O3AB 1BJ1H 5A40E 4P9MH 4ZNCD 4NZRH 5BS0E 4W70A 4GLRH 3MODL 5DC4B 5KVGL 1QO3B 4KI5E 4PJ7E 3VGAC 1T1ZA 4RBPK 2F8OA 2WBJB 1UXWA 1ZT4A 4U0RB 4K71B 1AKJD 5C9JB 2D7TH 5I74C 4P9HH 1F3DJ 4Z78B 3O8XC 4I2XA 2EIDA 3LQAH 3QSKB 4OZIA 3QEQA 3RY6A 4DQOL 4QTIH 1JHLH 1PYWB 4F8TA 1BIIA 5FFLA 1OB1B 1AFVH 1ZVHA 1AKJB 1CDGA 5CUSH 5FM5M 4ZOAA 4YUEH 5I18L 5GIRA 2A6JB 3JBG7 1EHXA 5HHME 3TIEA 1T1WB 3VD9A 4TYUA 3T65B 5T1KD 5HBBA 4R4NC 2UVFA 4NZUL 2AJVL 1T5XA 3TZVA 1DBJH 2ZOKA 3AM8A 2F5BH 1MCJA 3CIQA 4ZD3H 5I9QB 1RZ7L 2VIRA 3H42H 5EUOB 5GRYA 3PP3H 3BIBX 4CJ1A 3PG2A 4JM2B 2VH5L 2NTSP 1TENA 2R29L 3TN0B 4DJMA 2H1PH 2W59A 5T1KB 2BSTA 3HMXH 1OGAD 5D72L 3WO4C 1HHGB 3ALPA 4Z8FH 3NIFE 1JHTA 3OB0K 1RIVL 3KPMB 1PX3A 1KJ3L 1HSAA 1QBLL 4L9DA 5AZ2L 1Q72L 4LKXA 6CGTA 1NC2A 4U4BA 3PWLA 1F45A 4LNRB 4MCZA 4PGDB 2C3VA 3SCMA 1BLNB 2C7UB 1KB5L 3MROA 1E6JL 2QL1A 3ILPA 4DKDC 5EOCJ 1OPGL 4JRYA 3MV7E 1F11B 3FO0H 4CU8A 1MFEL 3VI3E 1N6QH 3IFNL 3O3BB 5MEQA 5DGRA 2OTUB 4UV7H 1I1FA 2YPLE 5JNYA 3TBTB 4LSQL 5HGBB 3ET9F 3MRFA 1IC7H 1WTGT 2BRRL 3PXHA 3B9KC 3D39E 5F1KC 2FL5A 3S5LB 3U7YL 4JZNA 4I18B 1FNSH 4FOMA 1LGVA 1RZJC 2VLJA 4P0DA 5GGSY 1IE5A 3GHEH 3OG4B 2WZPD 5DJZB 4UU9B 4PV9B 1JRHH 1JZ6A 1JF1B 4HF5H 4HMDA 4LLQA 3GB7B 4ONGH 4DKEL 2YMXH 4MMXC 5K59E 4LARH 4APQC 1A7QH 5FO9B 1C08B 4JKLA 2XA3A 2R2BA 3IT8D 1CQKA 4JHZA 1T20A 12E8L 1MCBA 3HE7A 5C0GA 4XPHL 2VE6A 1UWXK 3RVVC 1ZXQA 4X5LA 3RNQB 4PJHA 1A9EA 2EKSA 3VH8G 3ULUF 4X83A 2XN9E 4KK6C 3CFJA 3K1DA 2R4SL 4O51B 3DGGB 1CFVL 1P5UA 2X1OA 5DJYB 3MLRL 4X7SH 3GIZL 5INDA 1NMAL 3ZYOA 3G5YA 4LPUA 4UV4H 4XNZB 4W6XB 1GGTA 3RZCD 1YNTB 4W4OC 5EFIA 5KTEH 3VFMB 2A73B 3HR5A 3DTXA 3O45A 4LMQI 4OZFB 5IK3A 4G7YH 1T7XA 5D2NB 1SEQH 2Y06L 1KJ2A 2NLJB 2Z35B 1VFAA 3EDDA 3C2AL 3HCVB 5EU4B 4F80A 4JG1L 3HPLA 4OCMC 4XNXL 3WE6A 1JF5A 4W6YB 1XGRA 5C6WH 5EORL 1LE9A 5E2UH 1AD0A 4GMSL 1HCVA 4WI9A 3TJHC 2ZNXA 4P57A 1JHKH 5F44A 4BH8A 1OAQH 2LU4A 2LABA 3FFCE 2Z91A 4LNVA 1KLGB 4LLUB 3H9HA 3IS1X 4KFZC 5TQ0L 5FUZL 3WIIH 1A8JH 5I8EA 3LEVL 3GMLB 4NHCL 3VRJB 3IF1B 1A7OH 5GISL 1IBGH 3KLHD 4PJEA 4XBEL 3WIHA 1DL7H 1BVKA 3H2WA 4KJWC 4WHTB 1GH7A 1SEBB 2JCCB 3FMGL 1QBMH 4TUOA 5DZLA 2AGJL 4Q6IB 1DE4A 2HKFL 3TJEH 2BY3A 2EIEA 32C2A 5DMKB 5DEGA 1LK2B 2YWZA 1YUHA 2SEBB 3VXPA 4OI7A 2D03H 1A3QA 5FF6A 1EEQA 5ISZA 5IQ7L 1OGAA 2GHWB 1V5JA 2X4QB 3SDAC 4YDLB 1DBBH 2P8PB 1DP0A 2F58H 5F7WC 4MYWB 4NO3B 5E2JA 5J6GA 1FZOB 1GPOL 3T0ED 3PWPD 1MRCL 1QRKA 3FB7B 4W68A 4ZAKD 2IMMA 3LCYA 5EPMB 2H6PB 4PR5B 1G6VK 4OM1L 3WNOA 1GGCH 4PJCF 4AL8L 1LO5A 5F96L 5DTFA 1ES0A 5EOTB 4HBCH 4RAUB 4X9FA 1IARB 3HFMH 3PWPB 4HUWA 3U4EB 2EH7L 3B9VA 1I9RL 4ZAKB 1WBZA 1EMTL 4OLUH 2XA8H 5E8EA 5F3HA 4Y16C 5DQDL 5IHZA 3B4NA 4GRWF 5I1EL 3VGEA 3FO2A 5FOBA 4WWID 1QBAA 3ULSB 3ZE1F 3KS0J 3FONA 4XBGA 4DZBB 5I66B 4PV8B 4HWUA 4MX7B 4RISH 2KZWA 4QRUB 5B21A 2IC2A 3ARBC 3WS3B 5BJTA 2QSQA 1IGCL 5DHYB 4OLYH 1UXSB 1AGFA 4GBXD 1PFCA 3G5VB 2XG4A 1LEGA 1G6RH 5DLMH 3RTQB 1XF4B 2DLFL 1BQUA 1HDMB 4X99B 3CU1A 3M45A 4JZJB 4LPTA 3P0YL 2D9QB 4ZPTA 5GSVB 1JPFA 4J8RB 3HRPA 5DMJB 3PL6A 4NGHL 4LVNC 3QI9B 4PJ7B 3UYPA 4MZ3A 3MRQB 4G8FA 5ADOH 3S9DB 2BNQD 1IC5L 1S78C 2VLRD 4MJ5A 4P3DA 2A77H 5DRZB 2DYPA 5IVXA 1SVZA 5JMOC 2R56L 3WDJA 2EDJA 3OX8A 4IEFB 1FN4B 5E5UB 2KBGA 4PJBF 3MV9E 3VXSA 1X5XA 2BNQB 2OXHA 2VLLB 3LRGA 3NIDF 2VLRB 3OSKA 4KJYA 5LGKA 3DGCR 5DRWA 4ZNEE 4NRZA 4KZDH 1J87A 3V4UH 1RHHA 3IU4H 1DFBH 4XZUA 1IC1A 5J8OA 3TIDA 3GK8L 5HHOE 1D9KD 2Y7QB 1T03L 1J1PL 5DMIH 2EYTB 1QLFA 4NKIL 3E3QE 4K3DL 1I3GH 2B1HH 1OSPH 4Z6AT 1WBXB 4GAGH 4LHUD 3IDGB 4TTDC 4DGVL 4UTAL 5AAWA 5C8JA 2ERJB 1MJ8L 4KDTC 5TGBA 3MACL 1SYVB 1R3IH 1MIEL 4JHWH 1YPZA 3KXFE 4Y4HB 5F9JB 3B6SA 3T3ME 1EV2E 4P4KB 4LHUB 4Y5VC 4O58L 3MREB 2W9EL 3FN0H 3RVTD 3S4SG 4BQBA 5KJRH 3LN4A 4TUJB 5FIEA 5GJSH 1LDSA 3EDFA 2ZSWB 2X09A 3QQNA 5E08H 3D0LB 3HI6L 4E5XA 5GGQH 1TLKA 1OP5K 4UNVA 1IT9H 2P8LA 3S88L 2APXA 3PGFH 4QGYA 5DHVA 1J10A 2DIBA 4D3CH 4YH6A 2D2OA 3TPUB 5C0BA 2V7HA 3QDGD 1SM3H 2OXGA 3DX9B 5HYSG 4QHUB 5DFVC 4F9PC 3SKNA 2VDLH 1T0MA 4OLVL 1PG7X 3F5WB 3EOAB 2F53E 3GBLA 4MS8C 4PRPE 7FABL 2YUZA 4PRDB 3QDGB 1KCRH 1A7NL 3KAAA 4JFEE 1MHEB 2YPVL 4ZMAT 1T7WA 3HTLX 2AXFA 3O81A 3O41B 3O6FD 2EDBA 1MF2H 4OF0A 3B8SA 2DS4A 3QCVL 3MUHL 4UINL 2B2XH 5D5ME 5T3XD 4KUCF 1RJZB 3U0PB 2BOCA 3ARGD 4S1QL 4EOWL 4Z7NE 4I9WE 4KUZH 4JB9L 3ILQD 3CK0H 1YEKH 3O6FB 4QNPE 3QUXC 3EYOA 4QYOB 1TZHB 3L5XH 4K7FA 5HYJA 5J3HC 4BSWA 3K4ZA 3I3BA 5F7DB 3VXRE 4U1LA 4JZOB 3K8MA 1JGUL 2FIRT 2FLBT 1EO8H 4KI5F 4RFNC 4NZDA 3VGHA 1IFHH 5JOEA 1QLEH 1GC1H 1DN0B 4S1DC 2FEEL 4LGSB 1NCNA 2CMRL 3TYGL 3NACH 5JORB 4GAYA 1FLRL 2GUOB 4HV8A 1C12B 4HPYL 5F6IB 2BOBA 4P4RB 4ZUSB 1F6AA 4GBXA 2A9ML 1QSEE 5F9DC 3RKDD 5MENE 1SJHB 1FC2D 5JQ6L 2B7DT 4YWGH 3CLFL 3MZGB 5HHVH 5L2JB 4DOHE 3V6BR 3U4BL 1P7KA 2PR4L 1JPST 4EDXB 2FCBA 3QDAA 3X3FH 5JOFA 1CT8B 3W39B 2P5WA 2NW3B 3DARA 3SKOA 1WZMA 4JFHE 2DQJL 2R0ZH 2CKBL 5TQ2L 1HQRB 1J7VR 5BO1H 3RDTA 2IANE 3U7WH 3NIFF 1OSZA 2VDPH 4G8GA 3W9EB 1Z6JT 3PWUB 2EDNA 2HKHH 2FEDC 3QNYA 4HQQL 4BKLA 3MLYH 5ALBL 1R5WA 1T7ZA 2CQVA 5T5FH 1UB6B 2ICWB 3QZWB 3QBTB 5FOJA 3EO9L 3G6JA 1D9KA 5EO0A 4FZ8H 3HI1B 1U36A 1WICA 2Q7NA 1F4YL 2VABB 3VRLF 4NCC1 3L3IB 4KK5D 5C0AE 3C5JB 4HZLB 2RAMA 2GJ6E 1PGRB 3BSZH 3IDJB 4QY8A 1MWAL 1HQ4B 3L3GB 4WW2C 4JO1L 1G9EA 1RUQH 2LFGA 3OXRA 4RWYH 4D9RD 4R26H 4G8EA 2OZ4H 1FO0B 5E8PB 3MLWH 2RIKA 4PRIA 3GSXB 2ESVE 5CEZD 3HE6D 4UB0H 1KULA 3AS3A 1U2CA 5D1XA 3AMKA 2BSRA 2B1AH 1SJXA 2FWOA 4PJXE 2IFFL 3GMRA 4G6KH 2ZUQB 4YHNB 4POUB 2XT1B 4N0FA 2OK0L 1BPVA 2OSLB 2XWJB 5JW5B 3HE6B 3R06B 5I1IL 4GG8B 3FHAA 4JPKL 3MLXL 2ZG2A 4JPVH 3DV6B 1IEAB 5K59F 1A6WL 2Z92A 4YK4C 4PP1D 3UO1H 4KZEL 5ICXB 4XVSH 5IQ9A 5DQJB 3NZHH 1B9ZA 2F74B 1DLHA 4I48B 2H2SC 3OHXA 1KFAL 4ZPVB 1AGEB 2A6DA 3P4LA 4HPOH 2I07A 4XNQA 5IB2B 2IH1B 3LEXB 1H8OA 5BCAA 4PRBA 4PGBA 4X6EA 1JPGB 1YEGL 3A6BH 1EHNA 3LV3B 4NQED 4N0UE 4M6OL 1EFXD 1XR8A 5D71H 4OGXH 1YEEH 1KCSL 3GMNB 3SDCC 3BN3B 1ACYH 4KV5E 1SVCP 3O3EA 3AU1B 2AI0H 4XPAL 1ZHBB 2VQ1A 5CZXC 1LD9B 3BKCL 4TSBH 1RZIA 4NQEB 1SY6A 4JY5L 1B88A 3QA3B 2G75A 5C07A 5I71B 4LKCB 2F54E 5L0QB 4PIRF 2PNDA 4UT6L 3O6LL 1ORQB 3L5WB 2AXGB 1TQCB 1NGZB 4WU7B 5KOVC 5IV2A 4MD4B 3VWJD 4L29B 4YHKL 4WO4D 2OTWB 4U1KB 2ARJB 2YD1A 1JPTL 1IQDA 4NWUL 4K23H 1VGKB 3L1OL 5ERWA 1FDLL 5F6HI 2E8ZA 4F9LA 1CIDA 4CMHB 5GS0H 5GS2D 1RZGA 3E6FA 4WUUA 2ATPB 1F58H 1P84J 1RUPH 4BZ1L 1VKXA 3OB8A 3I75B 3VWJB 4KPHH 5GGRA 3KGRA 1V3MA 3ALXA 1Q9OA 1A6TB 2BVYA 2KH2B 2H45A 4HGKC 5JHLH 5SWSA 4RMSA 3HI5L 3FOLB 4RSVA 5CP7A 4JO2H 1U8NA 3DETC 1IZKA 4LASL 5EZIL 2ADFH 3PABA 4OF6A 4GKOA 3QDJD 3ES6B 3HMWL 2H26B 3DVNB 3UYRL 4YX2L 4PJAA 4JCLA 4L8CA 3LRSB 2A74A 5IG7B 1ROWA 5HI3D 3QIWB 3RI5K 4ZS7L 2XZAL 3BXNB 1FBIH 1EX0A 2VO5A 5C0NC 3HMXA 5I75C 5DVNA 3EHBD 4JFDE 4OT1L 4LPYA 4QWWD 3KYMA 4PRNA 1VADA 5KG9B 2X70B 4OBSA 3IS0X 1MRDH 4HHAB 1L9MA 4LVHB 3QP3A 3C6LB 1A64A 1G7LA 3P9MA 1K3IA 3V6OE 4D9LH 3LRHA 2V5RA 3EO0B 4IOIB 3AROA 4ONFH 4PJFA 5D7LE 1PBYA 4CAGA 1WEJL 4HCRH 2GSGA 2DICA 1UVQA 4KHTL 5E2TL 4CVXB 5D1ZC 3CH8A 3UDWC 1WCBB 2ADIB 3VFNB 4WWKC 1WAAA 1A22B 2DQGH 2EE9A 2FX7L 4ENEC 3FT2B 1HXYA 5T1DL 2QR0B 4R0LA 3KYOB 3LS5L 4OZFH 3A6OA 5EBWB 3T2PA 2R2EB 4GSDH 5FYJD 3VFTA 4AZ8A 3C5ZC 2ZUTA 5CJ5A 3INUL 3RWJA 2AK4D 1H9VA 1OAXH 4PB9L 3GSNL 5L7XH 4XCFH 1RU9L 3SJVD 5E8NA 1PQZB 1WLHA 3TESA 4LIQH 3UC0L 5HJ3A 5D93B 5J12B 3AXLB 4HIJA 3QNXB 1I1AC 4R2GB 2FSEB 4KMTL 3PWJB 4JDTL 3O2DH 3QHFH 1HYSD 4G42A 3F7QA 1I9JL 1CGTA 4NQVB 1PLGH 3BZFB 5F7EH 4P2OA 3UJIL 3KLSA 2EECA 2P48B 1G7JA 5I8KL 4ESKA 3GI8H 3HZYB 5E8OA 1NCBL 4HIIB 1JNHB 4WI7A 3VXQA 3MA9L 4PG9B 1JYNA 4XTRC 1KIQA 1QSEB 2EE6A 4J2XA 5MENB 2HWZH 4Y19D 1T0PB 2IG2H 1NL0H 5DA0B 5BMFL 1XCTA 5E99L 3PJSA 1KIPA 2J6EH 4GMTH 4XCNB 5KN5B 1EH9A 3MFGB 3LZFH 3W82A 3MO1A 4JN2B 2V5MA 3SDDD 5TFSL 1BD2A 5CILH 4AMKL 5EWIH 4CW1B 4PPTA 4Y19B 3WBDA 3RUGB 3VWKA 4CVZA 4UT7H 1A6ZB 1IQWH 5C08E 4Y4FB 3DUUA 3ULVD 4EN3A 5LGHH 3MRGB 3Q2CA 4YDVA 5D6CA 3STZA 4X8JB 2VDNL 4OZFG 3IFOA 4EI6B 1QEWB 4E41E 4Z77B 1H5BC 4YHYC 4XB7A 3ELAT 3U83A 4OB5H 4LL9A 4O02H 1U93B 2DRUA 1L0QA 4OLWL 2X44D 4JY6B 5KANI 2Y5TB 4H0HB 3SQOH 3NCBB 4OFPA 4YHOH 5C0AB 3EOTL 4J4PD 1FV1B 1NGYA 5IROA 1XGYL 1SHMA 5JDSB 1I7ZA 4FQ1L 2K7PA 2FBOJ 3MV8E 4CADA 2APWA 2Q7YA 4TRPL 3SKMB 3D18B 4UBDC 1MIMH 1RQ5A 3FQNA 3QDJA 1G7QA 5B39B 3CJJA 2FIKA 3JVGA 3BEVA 5C6TH 2W65A 3MRPB 2FEEI 1AD9A 3JTSA 2GK0B 4KY1H 5IJKC 1DEEB 4Y5XA 2OJEB 2I60L 1FNHA 3G5XA 3OKMB 3P4NA 1XF1A 2J8UA 4JFOA 2RJMA 1YEIH 5DO2D 4XAKE 1CYGA 3IAPA 5HY9B 4OZ4B 1WIOA 2GTWA 4KDVA 1MHHA 2OTPA 1KCVL 1AGCB 1S7SB 5KSVB 5BXFB 3O2VL 1FORL 4E0RB 1NAMA 1SMOA 4Z7NF 2B4CL 3TA3D 4X4ME 4OV6F 4PS4L 1K8IA 1U6AH 4YNYA 5K9OB 2XTJE 2DLHA 3CZJA 3RWEA 2VDQL 1CICD 1NGPL 1ZSDA 1L4IA 4RZCA 2D31A 1FL6B 2CLRA 3V5DA 2FJGB 2DWEB 5KVMC 4U49A 5ICYB 5JR1H 1YC7A 3KYKL 3QUZD 3CXDL 1HIMH 4G7VH 4JFZL 1FAKT 4KVNH 3QUYC 3O4LA 4N0UB 4BSVB 4D8PA 4QRSB 1Z3GH 1Y18A 4HAGA 1PZUB 5DEFA 4XPBH 1P9MC 2EDLA 1ZHLA 2UUDK 3F7PC 4XC3H 3Q5TA 2NY5L 4LEXL 4XH2B 4RBPH 1NEZB 2CIKB 3V0VA 1OWWA 1MCDA 2UWEA 1F90H 1SQ2N 2EO9A 5E5MB 2XQYK 2P46B 3B5HA 1NGWB 3T3PE 3S4SA 3HNSH 4C56D 5IEKA 4V1DD 3E6HB 4PGCA 3WDHA 2IADA 3MCG1 2E9JA 2VSDA 3QEGL 4UUJB 3UZVB 1T6WA 3IFLH 4K7PY 3OGOE 2EDXA 5FHBH 4RQQB 3SDYH 4KVCL 4V1DB 1RZKH 4PJDA 1QNZH 3UJJH 4MMZC 3PDGA 1T7VA 3SBWC 1HHHB 3VXNB 4U1IA 1KJ2L 2MQ0A 4NQCA 3JTTA 3L7FB 3Q48A 4ZUWB 5HYSA 2O5YH 4XCCL 3DSFH 5HDOA 1HZHL 5FYLE 5KSBA 4WI6A 4YPJA 4H0IA 1UM4H 4F37K 2A2QT 4WFED 4XP6L 3D0VA 4YDKH 4PJ9A 4OZGA 2A1WL 1T21A 4P46D 2H41A 1JP5A 1Z5LB 5BQ7A 4NC0B 4NO5A 2DKUA 2HN7A 4J6RL 4G6ML 3OB0H 5T1LA 3V52L 2HRPL 1KOAA 1X5JA 5HGAB 1OAYL 4R7NB 4LVOC 2EDOA 4HUMB 2WW8A 1CZ8H 3P77A 3L3KA 2ZUXA 4P46B 4XX1G 1AO7B 2CLZA 2IBZY 2O61A 3LMJL 1DLFH 2GFBB 3WIHL 2IBGA 5F9WC 5JW3L 3MNVB 3SE8H 3D1MC 4OV5B 5DD3L 2AEPL 1RZ8B 2PYFA 3LKOB 1DQML 4EDWH 2IAMD 5EOQL 1DBMH 2AAVA 2O5XL 35C8L 3THML 5C0EB 3SE3A 4PG2A 4L3EA 4LFHG 5HPMA 4MNQE 5FYKU 1T89C 3GI9L 1P7QB 1KV3A 4HWBH 4JFDB 3ZL4H 1KACB 3H3PL 1I8KB 2ITDA 1BM3H 4O2CB 2AJYL 5KSUB 3U9PH 5D1QC 3G04A 4NQDE 1UB5A 2FLRT 2ZCKH 3REVA 2NXYD 2CGRL 3CPLB 1LNUB 2IH3B 4J4PA 4ZTPL 4PBXA 4PYGA 4DAGL 2AJ3A 3LKSA 2JJSC 1L7IH 1VB9A 1AXSB 3BPLB 4DUXA 1NCCL 5DHXB 5BV7B 1VFOA 3ULUD 3ZE2F 4ISVA 4C54A 5BVJB 1A6VH 5ANME 1PY9A 2NXYB 4NNXA 4OTXL 3U9UA 4U7MA 3WUWB 5JPMA 1GXEA 2PTUA 4M5YH 1QFWM 1NFDA 3L3DA 1K2DB 3WD5H 1GCFA 3N50A 1RMFL 4HWZA 3RWGA 1QLRA 4PB0H 1B90A 3QR2A 1WZ1L 1BVLA 4OKDA 3S3JA 2Y07H 3DI2B 2FZ3B 4AH2B 3MUGB 2FNBA 4KV5F 3P11H 1MNUL 3WHE1 2QQNL 3DX6A 3I02B 5I6XC 4FQIL 1EDQA 4NYLB 4L4VA 4XVUC 3E2HC 3GRWL 3TA3A 3VXUE 5EBMA 3IDNB 4J3OC 1II4E 2IALB 1F8TL 2JB6A 5D7IF 1FFPB 3U82B 4LPCA 1J12A 2WUBL 1D5MA 3QIUD 1L0XA 1N6VA 3KJ4B 4EIZC 1MAKA 2QADB 3QO0A 3QUZA 2H2PD 4ZS6D 5IHUL 1MJJA 2AJSL 4MSWA 1INDL 1Z0MA 3DXAE 1EA9C 4WEMB 1EAPB 1P2CB 5E6IC 5J56B 3PDDA 1MCFA 3R1GH 1JNLL 5FYKE 4HUUA 2YD4A 5D6DC 3TO4D 1KN4H 2JTDA 3T0VA 1CLOH 2QQKH 4NUJB 4PJ5D 3LKPA 2OCFD 4DGIL 3U36B 1J5OL 4DVRL 4KAQL 5ALCH 5IKCB 3LKRB 4PJ8D 1TVDA 4LCIL 5DJ8A 4RNRB 5AAMA 5EBLB 2WINB 4P2QA 4PJ5B 3UPRA 1ORSB 1N5AB 3EYSL 1FO0H 3UAJC 5J6HA 1FL5B 1M7XA 1ZEAL 2NY2D 2O5ZH 1OTSC 1DVFD 4H8WH 4U1MA 1UM5L 3MLZH 1W0WB 3BH9B 1RJLA 4KROD 5GGUA 3L3JA 3NPSC 5GGVY 4E41B 4YHIB 2NPLX 5J11B 4JQIH 1MVFA 3ZKMC 4ZQKB 2NY2B 5SX5K 1D6VL 3ARVA 1DVFB 2NY1D 3K2MC 3TZVC 1GRWA 4MJ6A 1ONQA 1ITCA 2JJVA 5DJCA 2J1KA 2YWYA 4X6CE 2D0GA 2FHBA 4XPTH 3O0RL 3WMSA 1EIBA 1YMMA 2RCSH 3I6GB 4R4BB 5FGSA 2CUHA 4MAYB 1ZWIB 2HT4D 4PJCB 5CD3A 3P4OA 4X6DA 5TH2B 2HH0H 4AY0A 3D3VA 4CRPA 4DUVA 1KTKE 1YN6A 3DO3A 1UYWL 1CFQB 1KPVA 2FJFB 2P7TB 3QUKB 3BE1L 5GJTL 2R2HB 3QB7C 4ZYKA 3H0TA 1DBKL 4GRWB 3BKML 3QZWG 1Y6NR 3SCMC 4Q2ZB 4X9BA 1A5FH 2IAMA 3DECA 1WQVT 4ZG1A 2BY0A 4N5EC 3MBXH 3OXSB 1DTUA 2GW5A 4UI2A 5IVOA 1IM3B 3IETB 3QIBB 4P2RA 1A02N 4N8CL 2VMFA 2OZ4A 43C9B 3CC5A 2IBBA 3QH3A 2EXYC 1CGYA 3IGAB 3CFDA 1YDPA 3GNML 1A4KA 3GSUB 4K9EC 4M43H 4L9LA 4JO4L 1OGTB 2VZTA 4EI5B 4QCIA 4P23D 1OTTD 3LB6C 5D8JL 2OR7A 4GUPB 5E5RB 3BDBA 4XP5H 1FFOB 1X3DA 3MJ8B 1T2QH 5E95B 3B2UD 1ZHKA 1HINH 5FM4A 4LP4A 1E4WH 4LHJB 3IDXL 5FK9A 2AJXH 2OJZH 4F33B 2CLVB 2HLFC 3VFSA 4JRYE 4Z78A 1B4RA 2C3HA 3EJZC 4MHHI 4M1DL 4ALAL 1Q9WB 8CGTA 1XCQA 4PJBB 4M1GL 3HE7C 5GS2H 3S3SA 3VFUB 2Y1VA 4NFDA 1ZLVH 4AIXA 2ICWJ 3ARYA 1GGIH 4LSRL 4LOUD 5D96B 1U41A 1FNEB 2YK1L 3DYMA 1AIFB 4FXKB 4K7PL 4ZODA 3DNKA 3RA7H 4G80B 3T65A 5DD5L 2B5IC 1OW0C 5FGCB 3NMEA 4HGWA 5FO8A 3B2VH 3PP4H 4IRZL 1FGNH 2GTZB 5GQBA 1M71B 5TDPA 2CUIA 3LEYL 3V6FA 2CXGA 3TN0A 1YJDL 3GKWL 2FHCA 5E4IA 1EAJA 4HFWB 1Y0LA 3DIFB 4MDJB 1D5BA 3U79A 1QPXA 1GJIA 2RR3A 2YN3A 2E9IA 3TO4A 1FRGH 5C0FB 5DJAA 1ZS8B 1Q9KB 1BVZA 3LPFA 3PDOA 2NX5A 2BSSB 3NFSL 1ZHNB 4LNRA 3QXTA 2VXQL 1LP9E 4KKLD 1VACB 1OTUD 4QRRA 3SO3B 1NGXB 1RVFH 1BLNA 2C7UA 2HG5B 4H20H 3IXAA 3QFJD 5EA0L 5FM5O 1IAIL 3L6FB 3H3KA 3MBEB 4PGJA 4FTVD 1RURH 4EUPB 1TQBC 6FABH 3KHOA 2OTUA 3ROOA 5HDQL 1JWUB 4U1JA 4NZTH 3QFJB 5IEHB 3TBTA 4PREA 4FXLA 4MXVF 4HMCA 4O5LH 5AYQA 3ZDXE 1S8DB 4KUCD 4I13B 2AKRB 5D9SB 1EO5A 1T04B 4NKQB 5DVOA 1NFIA 4UU9A 3W2DL 2APTA 1J86A 4PV9A 3TFKD 3CFEB 5EN2A 3OL2A 4Y1AA 4J3XA 3OF6D 1R3HB 1MFCH 5TE4L 4RWHA 5FO9A 1TETL 3KHQA 4TVSa 5DDHB 1CU4L 3NIGE 4LRNL 2X4OB 4KI5D 1PKQE 4HBQA 1G9MC 4HH8A 4FZEH 4C83B 1OAKH 3W0WE 1HILB 1ZGLP 3FO1B 5C9KA 4ODWB 5E00B 4X7FC 2AABL 3ARWA 2Q8BH 1CR9H 3RNQA 1BFTA 3IRPX 4H5SB 4JKPH 4WFGE 2XICA 4TNWK 3T8XA 4JVUA 2CJUH 5B8CB 4O51A 3DGGA 3A67L 1D5ZB 4HJGB 4HCRA 1NLBH 5DJYA 5DSCA 4Z7UF 1AGBA 3RWFB 5I1LA 2QV2A 3QRFM 1ZA3B 4X4XA 4N1EA 5CKGA 1I1CA 1X5KA 1U91B 3C8HA 3VXUB 4I3RH 3VFMA 5ESAA 3FOMB 2WWMC 3WKML 3D69B 5CBAB 3T3PF 2MJWA 2DQHL 4WIQA 3VFOB 4JLRB 1A2YB 3HRZA 3C60D 3S96B 5D2NA 1QD0A 4Q7DA 5HHQB 1JGVH 2Z35A 4D2NA 1DN2A 1NANH 5JHDE 1JWSB 1QA9A 1SY6L 3MNZA 3HCVA 4HK0A 3PV6B 3VGAB 3QRGL 1DQDL 4QF1A 3CNKA 2VZUA 3KLAB 3O2DA 3OZ9L 4M8QB 3B3IA 4LLUA 4D0DB 5GRVL 4P9ML 2VR4A 4NZRL 1NSNH 1OWRM 1BZ7B 1B6DA 2JJUA 4R4ND 5LAXA 1ZA6B 3HC3L 3OJVC 1JZ7A 3MV7D 4P48A 2EC9T 2D7TL 2X1WL 4P9HL 1A1NB 4WHTA 5BOPA 5D7JD 1YQVH 3TC9A 2NQCA 2YPLD 2J6EA 3LQAL 1EPFA 1JHLL 4PY7B 3T77A 1AFVL 1LK2A 2Q3AA 4JQVA 3RZCC 4YUEL 4Z76A 2VZ1A 3MRCA 1H3GA 1J18A 3ESVF 1GZPB 2X4QA 3C6SB 5D2LA 5LGJB 2P8PA 4QKXB 3F7VB 4U3XA 1OF2B 5DYOA 4L4TE 3WO4B 3EOYG 4LPXA 3SKJH 3ARPA 3D85D 4BH7A 3RWCB 2R8SH 1DBJL 3FB7A 3O9WD 4HK3J 2F5BL 3BZ4B 1BFOB 4ZD3L 3SDXE 3QWQB 3QPQD 3UZEA 5EU5B 3N1GC 3PGDA 1K4DA 1YEDB 2H1PL 3KDMA 2NTFA 3VXSE 1U58A 2YD8A 3HMXL 1DBAH 4MXWH 5IB4B 5CGMA 4Z8FL 2YEZA 3MLSH 2R15A 4I77H 2VISB 4LDEB 2FATH 4L8SA 1P1ZA 2VXUH 5HSFA 2OX5A 2X10A 1VERA 4XXDB 4X5WA 4XP9H 3TYFA 1MCNA 3CSYB 3OKKA 1EBPA 3IDUA 4S1SH 3VI4E 5E2VH 1KTDA 1DQJA 1F2XK 5L88H 3NA4A 3B9KB 3EDKA 5CSGA 2JE8A 5ICZA 3OKOA 3RIFF 4KRPD 3K3QA 3RWDA 5B3NA 2DQCL 4ELMF 3MCLH 1N6QL 5A16A 1BFVH 3G5VA 4U6HB 3RTQA 4UV7L 1XF4A 1K3ZA 4GW1B 5B39G 4MNHB 1NCWH 2Q8AH 3K74B 1IC7L 5BS0A 4KRPB 4Z95H 4APQB 4PJ7A 1FNSL 3QPXH 4M1CD 4NIKB 3TVMD 3T0EC 3GHEL 4Z7VE 3D2UB 3FQTB 4ZAKC 3AAZB 4RX4D 3N85H 4NBZB 4NQXB 2JLLA 1IRAY 2P43B 3FTGB 4G3YH 1JRHL 2J8OA 3MRBB 4HF5L 3WFEL 3P73B 1S9YB 4F2MB 5ACMA 4PLJC 4YIQA 4ZUVA 3PV7A 5EZOH 1PY4A 4WU5A 3OKEB 4UIMA 2YMXL 2C4FT 3UBXA 1KCKA 4LARL 2FH6A 2CDEB 4QGTA 4RMVA 3K1KC 4UQ3A 4Q0XH 3V6ZA 5B4MD 2VLKD 3KYAA 5E9DE 3EOBB 5IFHH 2ZSVB 5DFTA 4HKBB 1S5HA 2GCYB 4FABH 5ITFA 3ZMRA 2J8HA 3VFWB 4ZOBA 1PEWA 3RBGA 4PGEA 1IMHC 1HK6A 2H32B 2VLKB 1WBXA 3H9SD 1KEGH 3IDGA 3IDIA 1P4BL 1SJEB 3AREA 5IFJA 5F7HA 3C60A 4RFOH 4X7SL 5DA4A 1NEZG 4GBXC 4F7TB 2BVEA 3U48A 4CNIB 1Z9LA 3MCKA 3ETBF 3OR6B 3TJHD 3GDBA 1I9EA 4OUOA 4P5MB 4Y4HA 1W0VB 5F9JA 3TNNB 3IAQA 4UV4L 3H9SB 3JV6B 3MREA 1JL8A 3RWIB 5KTEL 4Z7WE 5HVFB 5KS9F 1CG9B 2ZSWA 3MLTA 1YJDC 1HN1A 4I0PD 3D0LA 1IL1A 2X1QA 1U2HA 1BOGA 3AGVA 1LP9B 4TVPD 1IGFL 4X9IA 1XIWD 1SEQL 4Q9QH 2BZDA 3GEWB 1AC6A 4IMLB 2F5AL 5BV7H 4WDIA 4K8RH 4MA3B 2VQUA 3MV7A 3CX5J 1J8KA 2FECL 5BRZD 3DX9A 5E2UL 3VFVA 1RJCA 5HVWA 4QHUA 3FO9B 1FZMB 1JHKL 2VITA 5E2WH 1OAQL 3R8QA 4OZIF 2O93L 1QVOA 4URTB 2YPLA 3TBVA 1A6AA 2GITB 4NP4H 3SDAD 4NN6C 4Y5YA 4EXKA 3D39A 2D7OA 4BFBD 3NCFB 1D9KC 4M61B 4N8VB 1F42A 2MQ3A 4OUUB 4LCWE 1X5YA 1A7OL 3X14A 1KLUB 1IBGL 4ODTH 3P9LA 4MLIA 3UTTD 4M3KB 3SDAB 1UKTA 1XF3A 1W0YT 3FKUS 2P5EB 5GHWL 3FN9A 1QBML 3NTCH 3O9WA 5HD8D 4XMKH 3TJEL 3W9DB 2IQ9H 4OKVB 3GMPA 5T3ZD 2GI7A 1IAKA 3V7MA 3PNWA 2D03L 2QHRH 3GHBH 4Y16D 4I0KA 4HWBA 3UTTB 2HP4A 3QDHA 3NCYS 3W0WB 4QYOA 1DBBL 2K7QA 2R1XB 4YO0A 4DVBB 4FN0A 2WWKT 1QRNE 1NAML 1K4CA 1D5XB 4YFEA 4JZOA 2CRYA 2FBJH 5I8OH 1T0NA 4Y16B 3O6MH 1T83A 2XN9A 3MXVH 5IVZB 2NY4D 1DN0A 4IRJD 5CWSB 1FG2A 4ZO6A 4G8IB 4DN3H 5J9PB 4G5ZL 4HBCL 2D7MA 3HFML 2GUOA 5GXBB 1JUFA 4OLUL 1M4KA 3KYNA 5HHOD 4EXPX 1TCRB 3F12B 3ARBB 3SE4C 3IXTB 4MA1C 2DIAA 4IRJB 5E7BA 3WUWG 4NJAH 5IMOA 2X7LB 5ETUA 4QOKD 2PXYA 1R3LB 4U31A 4XMPL 4YBQD 3H7BB 3L3OA 1CE6B 1FL3B 2OLDA 4G9FE 1LHZA 4QRPB 4O2FB 2W0PA 3O6FC 2BNUB 4U1SB 3TVMA 5LQBH 5K9QI 2OQJB 4LVNB 5B38B 4OLYL 1CFTB 2QKIB 4XPFH 1QSFD 2EXWC 2NW3A 4QOKB 4Z5RB 3ARGC 2FHFA 1G6RL 4IJ3B 5DLML 4WUKH 4HG4J 1MCPH 3VJ6B 3FFCA 3QQ9C 4PD4J 2XFXA 2FD6L 3GMOA 5AWNH 2A83B 4AQ1B 1S7TA 1VGEH 1QSFB 3CZFB 3I9GH 2EDFA 4QO1A 3K8KA 4WHYH 4OSUH 3W9EA 4BK4A 3PWUA 3WLBA 1IGJA 3HB3D 5ADOL 3BFOA 5C09D 3QZWA 2PW1A 2A77L 4PJHF 3T2OA 5T1MB 2OMNA 5T5NF 3SPVB 4G9DA 7CGTA 3D9AH 4F9LC 3L3IA 4TSAH 4XWGH 1RUKH 4N8PA 5EO9A 5EDXA 5FKAB 5C09B 1LEKA 1CDHA 3LSOA 5FAAA 5F9OH 3RKDC 4KZDL 1E6OH 1HHIB 3V4UL 1NCTA 1BBJB 3IU4L 1DFBL 5E8PA 3GSXA 4L4TB 5I1CH 3LS4H 2MQCA 4PRHD 4Y5VB 1KENL 1I3GL 2B1HL 2VL4A 3FQXA 2V2TA 1YC8A 5CP3H 1RULH 4ZFFB 3QDME 2FH8A 1LWRA 3F58L 4OAWA 1XIWA 3FT3B 1U9KA 1CXHA 3PIQB 4ORGA 4QRTA 1R3IL 3FRUA 2XWJA 4JHWL 4X6FA 5DFVD 4NRXA 5JW4M 5IW6B 1BHGA 3FN0L 4UOW1 5KJRL 4Q9BA 2H8PB 3AFLA 4OJFH 4Q6YA 2WWKO 3SGEH 5E08L 5ICXA 2BC4B 5GGQL 2F74A 1IT9L 3PGFL 1N59A 1S7QA 1FZJA 4YXHH 4WHYG 4PJEF 5JOPE 4KQ4H 4D3CL 4CMMA 3EJYC 4KK5C 4HWEH 3O2WH 1SM3L 2OMBA 4DN4H 4BYHA 3BN9D 1MH5A 5IB1B 4YFDB 4NOBA 2VDLL 4GLRI 1KXQE 1BGXH 4J3UA 4MB4A 5HI5D 1BJ8A 1MCSA 4DW2L 5J3HD 4ODUA 1KCRL 1QHPA 3VG0H 3A6CH 3ZHLA 25C8H 4LCYB 4Z7VB 4P5KB 3X11B 4GG6E 1KB9J 2F19H 1E0OB 3DX8A 1T5WA 3WO3B 3QUXB 5EU7E 1ORQA 3L5WA 5DD0L 4YDIH 1MF2L 2AXGA 4H25B 3VG9B 4JFHD 2BVOB 1PG7L 5GRJH 3STBA 1JGEA 4ELKA 5JZ7C 1NGZA 2B2XL 4XHJC 4MD4A 2Q87A 2IAND 3MV9A 4NUGH 1TTFA 4MQ7B 4KUZL 4NDMB 2ARJA 3VA6A 4RFNB 5E1HB 3DURB 1JBJA 1YEKL 2JELH 4ZNEA 1MQ8A 2LE9A 4N0YH 1MVUB 4PP1C 4PBVC 1CK0H 2HFTA 2I5YH 4WFFD 4C55A 4F3FB 5HHOA 3NABH 1MI5E 3QWOB 3I75A 1R3KA 4AIZA 1T80A 2B0SH 5KVEH 2R23A 4EUPH 3N1MC 1A6TA 1EO8L 1M7IB 3SGDH 3ARZA 5L8LB 5SWZD 3Q5OA 2GJ6D 2Z8WC 1GC1L 3FJTA 1H3XA 2PO6D 1KNOB 1JZ8A 4HS8H 3MGOA 3NACL 3WFBH 3KXFA 1JNNH 5L0QC 4MNGE 1RIUH 5SWZB 2ESVD 3ES6A 1I3UA 3C8KB 2BXYA 5GS1A 5EC1A 1KIRB 3PGCB 3BKYH 3HS0B 1HH9A 4YWGL 1MAJA 4YHMH 3V8CA 3LN5A 3KVQA 1AJ7L 1HEZA 5KSAD 3X3FL 2CDGB 1BWMA 5IVXF 5EBGA 5HYQB 3TV3H 3UXFA 1TTGA 3MTRA 4M7JH 4WO4C 1XGPB 2R0ZL 4DEPC 3C6LA 3T1FA 3GSRB 4B7IA 1I7UB 1BX2B 4HDIA 2BNRD 2F53A 1KG0A 4PRPA 2OI9C 2XQYG 5HDBE 3U7WL 1A14H 1I75A 3UZQA 5INCA 3EYVA 5IF0B 2VDPL 4JFEA 4CVWA 4WW1B 1FFNB 3KWWA 2HKHL 1T1XB 1JRHI 3MLYL 4CVXA 4WW2B 3EJJX 4P3CH 2J12B 5T5FL 3H8NA 1BEYH 3MV01 1A7RH 2MWCA 5L2KD 4FZ8L 4GKZB 1CFSB 3PWNB 3ARDA 4OLXH 2X4PB 4EUPG 2YS4A 3ZDZF 5D5MA 4WI8A 3KYOA 3G6AB 4R3SB 3BSZL 5IMMB 5EBWA 1JN6B 1YPZF 2X5PA 1RUQL 5L8KB 2AV7B 3JVGC 5CD5C 1QR4A 3G08A 4RWYL 2F54D 4R26L 3VXME 2OZ4L 3MLWL 2Z9TA 2VC2H 3VXRA 3T4YA 1QRNB 5CIPA 4UB0L 4Y2OA 5FYKH 4UIKH 4KXZH 2W0LA 3FB6A 2G5RA 2C26A 3NFNB 4FQXD 2B1AL 5D7IB 5I17B 3BP6A 4YK4B 1M05B 3EHBC 3QO1B 4QWWC 2V9RA 4G6KL 4IHOB 4R7DB 5DJXB 2Q76A 4K2UH 1JNHA 3V0WL 4JPVL 1YNKH 5CSBA 2E27L 1QSEA 4PLOB 4L4JA 5MENA 1WT5A 2PTTB 3KPQB 1RUMH 3UO1L 2E9WA 5EIIA 2K3TA 3CFBA 3VGFA 1HI6B 3NZHL 5DMGD 3MXWH 4JHBA 4XCNA 3SDCB 4YHZH 2C1PB 1Q9LB 5TE6H 5CBEA 4JN2A 2FECI 4YDJB 4HPOL 5I1GL 3QFDB 3LPWA 1BFSA 5ITBH 1K5NA 1CTNA 2EKJA 4TQEH 3A6BL 4GJTB 3BQUA 4AEIL 5E94B 5D71L 5JPNA 4OGXL 3BP5B 1YEEL 4XC1H 1QFWI 1ACYL 1H3UA 4GKNA 5ESVA 2AI0L 4JKKA 3MRMB 3BWUC 3IFPA 2IANA 3LKQB 1U8HA 3UTPD 5IJVB 3BRGC 3P9WB 4NC1E 1N7MH 5DQ9B 5EIVA 5C71A 4HKJB 3MMEA 1UJTA 4ONHB 3GO1H 3HNVH 1JMXA 5EO1B 2VAAB 1MEXH 2Y5TA 1P4LA 2FO4B 3K0WA 5C0AA 2JKXA 3I2CH 4LSPH 4GW5B 3UTZA 3U7AA 4HJJH 4IMKC 4K23L 1ZLSH 5MERA 5E70A 4OQ1A 2A6IA 1PKOA 3J7HA 2DQFB 2GJJA 1DDHB 1HSBB 3O11B 1NPUA 1WIPA 5GS0L 1F58L 3HA0A 1RUPL 2KL6A 2ESVA 1QQDB 4JHAH 4JRXB 2FX8H 3VA2C 1GOFA 4PUBH 4LBEB 3SDDC 2ZUSA 1BWWA 5EU6E 3MRPA 5C0ND 4BFIA 1X5FA 4PJXA 5JHLL 2P8MB 5ID0A 2ZNWA 5JXEA 3U0WH 1JTTA 2ADJA 4M62H 1N5YH 4JO2L 2H9GA 3MUZ1 3T2NH 5HY9A 2ADFL 3BUTA 5KSAA 3ULVC 2ATKA 4LAQH 1AGCA 4ODXA 1ZMYA 5I75B 4Y8AA 5TDOB 1AXIB 1U8OB 5MHSE 4E0RA 1KELH 2EO1A 4L8BB 3TBYB 4XHQA 4YAQA 4X7CC 2FGWH 4DZ8B 3QUMH 3WCYA 2JK5A 3L9RB 4ZXBA 5DRNB 5K9OA 2OR9H 3DX7B 4XWOD 1DSFH 2BSED 1OP3H 3I50H 2FJGA 2BHYA 4G6FD 43CAA 4KTDH 1FBIL 5F70A 1EUUA 2IPKB 2W9DH 5ICYA 3RKPA 1JZ5A 3N1QC 3CSPA 5H8DA 1OY3B 5HGGS 1J1OL 3G6JF 4J4PC 1MRDL 1JK8A 5GS3A 5MEOB 4BSVA 4N0UA 5D1ZB 4QRSA 4NHUA 5ILTH 2DI8A 4TNVF 1YYMH 4WWKB 5CMAB 4LSUL 5HXMA 2W0FA 4K94L 4UT9H 2H32H 1R0AL 4ONFL 2XWBA 1GGBL 2CIKA 2MSPA 1PAMA 4HCRL 2DDQL 2P42B 5IBTH 3U1SH 2XTLA 4JKWA 3C5ZB 2F54A 3BZEB 3GIVA 1C5DA 3E6HA 3OBAA 2DQDL 2DQGL 5IESH 2IEPA 3LQZB 1J8HE 4FQXA 4R96A 1R3JB 2B8OT 2DJ4A 1KBGH 3HG1E 5H35A 1S5IH 3GBMH 2ZUUA 3ZE0E 1S9VB 3IB4A 4GSDL 5C0CB 3SGKA 5JIIA 3VXNA 2GK2A 1UZ8B 1OAXL 3TA3C 3L7FA 4H0GA 3K4DA 3B9AA 4NJ9H 4ZUWA 5L7XL 2ZUVA 4XCFL 1AXTH 1CICC 3C2SA 4LIQL 4LEOA 2J7LA 3S35X 1A3RH 1JYWA 1G7PB 1FNLA 2UZIH 4ZO7A 5CAYB 3TT3L 3O2DL 1I3RB 3QHFL 3QUZC 1Z5LA 3V8OA 4MVBD 1AGDB 4PTUB 1NFDE 1PLGL 5F7EL 4IOSD 3TBSB 1U3HD 3GI8L 5J7CC 3KPRE 3SEPA 1OM3H 1CXKA 1FIGH 3T4AB 3S35H 1CD1A 1AO7A 3MRIA 1N4XH 3BKJH 3BPNC 3OQ3B 4QXTA 4U2ZA 3WEXA 2X05A 2GFBA 4YPGA 3MNVA 2HWZL 2HJKA 2BFVL 1U3HB 2IG2L 3DRQA 1NL0L 3MUJA 3SY0B 5I30H 4E9LA 2WIMA 4PY8I 1P6FA 1BZ9B 1W2KT 2J6EL 4GMTL 4JFFE 3V4VH 2KKQA 3LZFL 4U6VH 2DLGA 4PTTB 3RWHA 4JN1L 5CILL 2C1OA 3DVGA 3WJLA 4JFDA 2QSCH 5DS8A 1H5BB 1IQWL 2CKBB 4HT1H 3C5SB 2P4AB 5FECA 3MRKB 4KRLB 4QHLB 4ZFOA 5LGHL 2D3VA 4ZTOH 3B9EA 3CPLA 3V6OA 1GHFH 1LNUA 2IH3A 3EO1A 3BPOC 5D7LA 4PRAA 1LILA 4MA8H 2DLEA 2P49B 4MJIE 5I19H 5BZDA 4NKDB 5SWQA 1P84K 4O02L 4Y4KA 2ADGB 4X0KA 3VXTB 1KTRL 2YD7A 1MELA 5DD6B 2BDNH 2HRLA 3SQOL 4FHBD 4ETQA 4RGOH 3MRNA 2LAGB 1MWAB 1VPOH 3SE9H 2DN7A 2I9TB 1U3YA 3OAUH 1N0LA 5FCUL 4Z7UB 4HXAL 4WJ5B 3S37H 4PLKC 4Q74A 3SO5A 5B3JF 2GYSA 4N8VG 2IAMC 2AEQL 1MIML 4LVEA 3PQYD 4NRYB 5J1AA 4PJAF 3SHSA 1I85A 3M1BB 5C6TL 1LO4H 4I3SH 4KY1L 2NW2A 1I1YB 4FFVD 5GZNC 4XBPA 4YQXH 2YPKB 1F3RB 3BPLC 3ZT7A 3PQYB 1YEIL 4JAMA 3WNLA 3ZT5A 3AB0C 1R5IA 5FB8B 3CVIH 3KPNB 4HUVB 3WXWL 1XF2B 1DR9A 3HZVB 4GRLA 1WWWX 2PYEE 3UTSD 3EGSA 3RY5A 4EBQH 4UOJA 2AV1B 5LBSH 5F88A 3QUYB 4IS6B 1BREA 1U6AL 4NUJA 3ULUC 4PJFF 2X1PA 3IJYB 2E7MA 3U36A 5FUOH 4KHXH 3DROA 1ACZA 2V9QA 4RNRA 5JR1L 1YMHB 3UTSB 1HIML 1WFOA 1N0XL 4G7VL 1WAAF 5EBLA 1FCGA 4KVNL 4ZSOE 1QFPA 4P2RE 4J1UA 1Z3GL 1FVDA 1N64H 4XPBL 5C08A 4NO2B 1FZKB 3NH7H 3DYOA 1HXMB 3KPSE 4XC3L 4HUNB 4GS7C 4OLZH 5IB5B 1C7SA 2F15A 4E41A 1F90L 4MNQD 1YEJH 5F7YC 5D72H 2XIDA 3HNSL 1ZLUK 2R1WB 3BPCB 1U8IB 2XKNB 3OWEA 1KJ3H 3QIUC 3FB8B 4AENB 4RCAA 3DWTA 4ZS6C 3IFLL 4R4BA 4HKZA 4MAYA 5FHBL 2Z93B 1ZWIA 3SDYL 3L5JA 5IUSA 1QNZL 3UJJL 2VKWA 2XKSA 3MV8A 4WFHD 1EERB 3TO4C 1OPGH 3NN8B 2RFXB 1UACL 4MB5A 4GKSA 1MFEH 1CFQA 2O5YL 2O26U 3DSFL 3VXOB 3BDYL 3WDIA 1I8IB 4LVOB 3RAJH 1BQSA 4O2EB 4PJ8C 1UM4L 2EEBA 3P4MB 1WVZA 4YDKL 1UH2A 3CDGB 1QTYT 4LSQH 5JO5B 5F9WB 5CINH 5GS0C 4GRMB 2NY7L 3EDEA 4OFYD 1A7PH 1KT2A 4X7TB 1NDGB 4I3GA 5EUOE 5D1QD 4HKXB 1CZ8L 43C9A 4A2LA 1U92B 4YFLF 3RL2B 1TZGL 3IJSB 3FCTB 1DLFL 3QJFB 3STLB 4ELMB 4ZFZB 4ERSH 4KROC 3SE8L 5M94B 4Y7MA 3CUPB 3O3UN 4X4MA 4DKEH 5CP3A 3U0TA 4EDWL 3BW9A 1A21A 5D1QB 4LCUA 1DBML 4YLQT 2BCKA 2NY1C 4EI5A 5KZCD 4DTGH 2CDFA 1E4XH 1CN4A 2WSKA 5HHNA 3EYQD 3F6LA 3FQRB 4HWBL 2J3SA 2AVGA 3OKDB 2X4UB 1PG7W 1BM3L 3QJHA 2HT4C 3U9PL 1T4KA 1F6FB 5KZCB 2CLVA 1FYTD 2ZCKL 3QYCA 1RPQA 1UQSA 1G9NC 1MFAL 4JGUA 3FFDB 2W07A 4I4WB 1S7RA 1L7IL 4NQSB 3TCLB 3GM8A 3VFUA 1A6VL 4XVUD 5DT1H 4FQQB 1FJ1B 1FYTB 4K94C 4XCYB 4G80A 4U1HA 2JJTA 3ZKNC 4M5YL 3Q6FA 5DJ0B 3ARFD 5K9KA 5I6XB 2EDKA 3CH1B 3RU8H 3WD5L 2R0LL 1NEUA 3E2HB 3MRJB 2J8UF 4RAVB 2HJLA 4PB0L 3WJJA 3GSNB 2GTZA 1M71A 3HZMA 2Y07L 1X9QA 3MR9B 3AY4A 3M8OL 1TXKA 4FFYH 3T0AA 2Y9RT 1E4JA 3ARFB 5I76A 4BQ8A 1KPRA 3P11L 2W92A 1OQXA 4DGYL 4P23C 2HMID 1I8MB 5E6IB 5DUBB 5KS9B 5C0DB 5DD1H 3B2UC 4KQ3L 3LEVH 1T1ZB 4LRIA 3QEQD 1CIUA 4ODSL 4OGYH 4NN5C 1X7QA 2YR3A 3JWDL 1URLA 5DF0A 4I2XB 3R1GL 3BVNA 1MHCA 1KN4L 1G7HA 2F9BT 4X5XA 1CLOL 2QQKL 3REWA 2YRPA 3VFGH 1JWUA 1BIIB 3GSQA 4JFFB 4MWFA 2BVUA 2UWEF 4LLWA 5ALCL 1YA5A 5GIRB 1WCQA 1JZ2A 4OIIL 4MCYA 1F3DH 1MCOH 3TIEB 5IQ7H 4MNQA 3B83A 5D2NE 1RK0B 4CN4A 2BVPA 3NPSB 4FQCH 4M4RA 3X12A 5ID1A 2HLAA 2MCPH 5CJQH 1T5XB 3TZVB 1MRCH 4NQDA 1NC4A 2ZOKB 4YJZL 2O5ZL 5JUEH 4JQVC 2VIRB 1OCWH 4IIQA 4H8WL 5IW3A 4PJDF 3MLZL 4AL8H 3JWOC 1NC2D 5DDHA 3SO3C 2BSTB 4JQIL 2EH7H 1ETZA 5ANMA 1I9RH 1JHTB 4S2SA 1YY8A 2PW2A 5KSBF 2JIXA 2QTEA 4QLRA 1HSAB 3MC0A 4LKXB 4N5ED 1UZ6F 4OD1H 4OZGF 4JRYD 3PWLB 4XPTL 1JF6A 5BVPL 2RCSL 2C3VB 4AG4H 4F7MB 2ICES 4NO0B 5FV2A 3SCMB 3TPKA 2J4WH 4AK1A 2JCCE 4UDUB 3GSWA 4HJGA 3MROB 3ILPB 2EXYD 1IZJA 2HH0L 4XNMB 1A3LH 4L8SC 1CXLA 5GGTH 5DK0A 1TMCB 4Z0XB 1XGQB 2VLJD 3ULVF 3OR7A 3QXUA 2DLFH 3VXUA 5C0IB 5JNYB 3TM6A 1A5FL 3MRFB 5FO7B 1TITA 3D69A 5EOCH 5CBAA 3Q3GA 3QNZA 4WENB 3MBXL 2FL5B 3VFOA 2V6HA 1F97A 4NGHH 4JZNB 3RPKA 3S96A 4I0CC 2IPUK 2OP4H 2VLJB 3TFKC 2HLFD 5IM7A 1XGUA 3U30C 3DXAA 1ZT1A 1EO7A 4LLQB 3PWPE 3P40A 4NM8H 3HE7D 4M43L 4DCQA 3VDAA 2X41A 4KI5C 3R0NA 3O8XA 1WSST 2R2BB 4QHKI 5HGHB 4N68A 4XP5L 3VCLA 3G5ZA 3QCTL 5F1NA 3S6CA 1AQDA 3HE7B 1FH5L 3GK8H 1HINL 2G2RA 2RBLA 1EHAA 1E4WL 1NUFA 5GZOD 3NFPA 1NFDF 4NKIH 1A9EB 4PJHB 2EKSB 2Q86B 2AJXL 2OJZL 4JREB 1F4HA 4LLDB 3MJ7A 2B5IB 4XNUH 1MHPL 3S97C 5INDB 5LXGL 5I1HL 5A3IC 4GW4B 4IOFD 3G5YB 5JA8B 3VD5A 1JGLH 1GGIL 5DJ2A 3I6LD 4YZFE 1MFNA 3RA7L 3C6SA 5EFIB 3QG7H 4QHMA 3F7VA 3AREC 3FAXA 3C60C 4X6CA 2CR6A 1K85A 3DTXB 5IK3B 1NBZA 2XOTA 4FFZH 1ZANH 3ZLQC 4WHDA 4HWNA 4Q9RH 3B2VL 1BFOA 3PP4L 5IFAH 1KJ2B 5F6HJ 5I1KL 1FGNL 1VFAB 1UWEL 4D0BB 4DKAA 3HPLB 3WE6B 2VWEE 2BNQE 3KPPA 2VLRE 1AD0B 2Y6SD 5CHNA 4XX1E 3ISWA 4P57B 4BH8B 3QWRA 1FRGL 2Z91B 2DKMA 3DLQR 3EAKA 3IU3B 3H9HB 4WFGD 1BQHG 1TQBB 3CCHA 1MLCA 4ORZC 1EZVY 1FNGB 5I8EB 4KKBD 5HHXH 5ESQB 2PN5A 1KJMB 3EZ8A 4NKMB 5E1AA 4BFGA 1RVFL 4H20L 5D7JC 4PJEB 3B9KA 1BVKB 1MPAH 3K2UH 1VA9A 5ISZD 1RURL 4TUOB 6FABL 3UBXI 4Y5YC 1XT5A 2XQBH 3RX7A 4S1QH 4NZTL 32C2B 4EQ2A 4JB9H 1CGVA 3VXPB 4JQXA 3M17A 1A1MB 4O5LL 5FF6B 5IMKA 2NYYC 5ISZB 4AIOA 2P44B 1OGAB 4FQPA 3GSOB 3TT1L 3RPIA 3O9WC 5EU3A 5CEXB 5J6GB 3HUJE 1VFBA 1H15A 3IDYC 4BSJA 2VR5A 3FTGA 3QPQC 3QUMA 1MCRA 1U42A 4ZUTA 4LF3B 2E6JA 3ZDYF 2EYRA 1MFCL 3OKEA 4X6DF 1LO5B 1TVHB 3PUCA 5DTFB 1ES0B 5ACZA 2CDEA 2CMRH 2DL9A 1R5VA 5GSRA 4HUWB 4HPYH 4FZEL 4CGTA 2ZSVA 4HKBA 4R4FL 1OAKL 4FP8H 2ICEA 5E8EB 4YE4H 5F3HB 3QDGE 2WWMD 1T83C 5IHZB 5M7QA 1QFUH 3JUZA 1HOCB 3RY4A 1M6OA 1XH3A 2DQIL 3FO2B 2G5BB 2LTQC 2Q8BL 2MCG1 4Z7OF 5JQ6H 5FOBB 5CSZA 1CR9L 4P5TA 5DC0A 4JKPL 3FONB 4XBGB 4W4OA 5F7LB 2CJUL 4TN9A 1G0XA 3HC0A 3BD4A 4KRPC 1NLBL 4MQTB 3Q5YA 4LPWA 5CZVH 2XNAB 3R8BB 1A9BB 5H94A 3PL6D 4P5MA 5EZLA 3F7RA 5KOMC 1CGXA 1LEGB 1A6PA 3JV6A 4JDVA 3KS0H 2PXYC 4I3RL 4GOSA 1IVLA 5T3XE 4AEFA 2DYPD 5HVHC 5FDWA 4ZPTB 4M1CC 3WSQH 4OFKA 1JPFB 4PJGE 3TVMC 1LP9A 3BESR 1JGVL 5ACLA 3VXSD 3GBNH 4FG6D 2G9HB 5CJOH 4P3DB 1DANT 3RGVA 2DYPB 1AP2B 1O0VA 3V5KA 4XNYL 1ZTXL 3OX8B 3FO9A 1FVCB 4XGZA 1TVBA 4QXWA 5B4MC 5FM8A 4NN7C 3JWDC 2GITA 1RHFA 1MWAH 3DO7A 5DRWB 4NRZB 1RHHB 3MX0A 5I73C 4XZUB 4TUKH 3TIDB 4U3CA 1CLYH 4YR6A 3RZCB 1I7RA 1VESA 1QLFB 3V0AC 1YQVL 4WV1A 2EDRA 1KN2H 1VEMA 2BY1A 5TDNA 5C8JB 4HULB 5CLTA 3W9DA 2ZP0T 5AYUH 5TGBB 4OKVA 1I7TA 1PKQA 3B6SB 3W0WA 4I0PC 3LN4B 3GSVA 5EC2B 2R1XA 3AVEA 4DVBA 1DQQA 1XIWC 1D5XA 1LO2H 3SKJL 5C0BD 2XACC 2R8SL 2P8LB 4W4NA 2HVKA 4RMWA 3CSGA 1DBAL 4MXWL 5C0BB 2V7HB 1GOHA 1CD8A 1W72A 3MLSL 4CBPA 4I77L 3SKNB 4HH9A 3HC4H 3ARBA 1T0MB 3RX5A 1AI1H 2VXUL 3IXTA 1CDJA 5K9JH 4FA8A 4XPAH 2YSSA 4XP9L 4NPYA 2WQRA 3BKCH 2EH8H 1IGTA 4S1SL 3GUTA 3H7BA 5E2VL 1MCWM 4F58H 5JHDA 5DJ6A 4D9RE 5L88L 3O6KL 3BD3A 5I0ZA 4PLJD 4UT6H 1TCMA 5HD8C 2OL3H 3VRIA 3T0EB 5HYJD 3UCRA 5JW3H 1J0ZA 2HTKD 1UM6L 2ED7A 3P30H 1NCWL 1JPTH 4Z95L 1T22A 3CZFA 3EYOB 3HKFA 3QPXL 1J0JA 3RBSA 1JZ4A 4BZ1H 4BSWB 3C9NB 2DF3A 3VFRA 3N85L 4U1LB 2NY4C 5DWUH 4IRJC 2VL5A 2X4SA 5E6YA 1MCCA 1G1YA 5EZOL 3GRWA 4U6YA 2Q20A 3HI5H 3QQ3A 1Q94B 5FKAA 4Q0XL 1MAMH 3GKZA 4MXQC 4HV8B 2HA1A 4LCWD 3VE0A 5IFHL 2NCMA 2LAAA 2NY0C 2BOBB 3E3QC 1F6AB 4GBXB 3HMWH 4KDTA 4L8DA 4NQEE 3BUYB 2EDDA 4YX2H 3WHXB 4L4TA 5HHPA 3ZYIA 2P5WD 5FKPB 4IJ3C 4YBQC 5BZWA 4J3SA 1ZLVK 1X5HA 3KPLB 1KEGL 3RJQB 3CFKA 4M7KH 3QAZC 2XZAH 3SDXA 3BIKB 4I5BA 4RFOL 1JGDA 3GMQB 3RDTD 5JOFB 2P5WB 5GS1C 3LD8C 4HIXH 4G8GD 4HUXA 4PBWD 1LQSR 3BDXA 3SKOB 1R6VA 4OZHE 1A1OA 2DM4A 2H8PA 4ZFOL 3ECBA 4WCYL 5DRXB 2VYRE 1WEJH 1OSZB 3I85A 3MA7A 4LU5H 1CLZH 4NNPL 2NXZD 4G8GB 4F9PA 3HB3C 4Q9QL 3QNYB 2VN4A 3V5HB 4BKLB 5E2TH 3LKNA 1R5WB 4NN6B 2X89A 4K8RL 3PHQA 1XZ0A 1D9KB 5EO0B 4M3JA 2DWDA 4JPIA 2FX9H 1RJYB 4UTBH 5FYJU 5CKAA 5E2WL 5JMRA 1P53A 4PRID 2YBRA 2JF1A 1FP5A 1KPUB 4QY8B 5D1XD 5JQHC 1QACA 4LQFH 1RSFA 4N0CD 2E7LA 4G8EB 5D2LF 4X4ZA 4QXUH 4LCYA 4PRIB 4LLYB 3ARDC 4Z7VA 2L7JA 4ODTL 3ZHDA 3HUJB 4R90H 1G0YR 3QUXA 2BMKA 3N9GH 2BSRB 15C8L 1XF5B 4BK5A 4JDTH 1PD6A 4H25A 2XPGA 3NTCL 3GMRB 4ETYA 3UJIH 4N0FB 4YEFA 4U2YA 3GHBL 3DURA 5E9DA 4M9PA 3MA9H 1CDCA 1MVUA 1SBSH 2Z92B 3KNBA 4FNLL 3QWOA 1H0DB 5IMLA 4PJIE 2VXVH 1K8DA 1V8HA 5IQ9B 2FBJL 5I8OL 1DLHB 3O6ML 4MA1B 5TFSH 4EVNA 2I07B 4XNQB 5HTSA 1HHKA 3MOAL 4AMKH 1KNOA 2EXWD 4ONOA 4DN3L 3BN9C 1WT5C 5JLZA 1AQKH 4LAJH 1QFOA 4PRBB 3BP7A 4PGBB 4NBXB 3QQ9D 2X4RB 1XR8B 5C07D 5IP4A 5HI5C 4X98A 3C8KA 4Z7WA 3O3EB 3VG9C 1IEBA 3ZT6A 4NJAL 1T3FB 3ARGB 4PJGB 3HS0A 1RZIB 3G6DH 3WFCH 3WLWD 5FYJE 5AUMA 5C70A 2VZSA 1U8JB 3FN3A 4PJ7F 5L9DH 1CTOA 4DFIA 2NY6C 2G75B 2AK4E 5C07B 1J05A 3BQUC 1W8OA 1J1XH 3SJVE 2HFEA 4XPFL 3TGXA 4OQTH 4H26A 3CXHK 5I1JH 3V79C 4W81A 4WUUD 1CXIA 3EFFB 1LO3H 1MCPL 5IWLA 3RIAF 1S9WA 1CFNA 1I7UA 5ERWB 1NCUA 4M9OA 1VGEL 3I9GL 1ZOXA 5HPOA 5SWSD 4OSUL 4LCWA 1FFNA 3S34H 1VKXB 4WW2A 5EUKB 1Q9OB 1Z9OA 5SV3A 4Y19E 3RUGE 2PO6C 5CJXC 3C08H 5CCKL 5SWSB 4TSAL 4XWGL 2DAVA 1RUKL 5CP7B 2CIIA 1U8NB 3G6AA 4K9EH 1JN6A 5F9OL 3RZWA 3P0VH 3TWCH 1E6OL 2R39A 3OPZH 5C3LD 3T0DA 4PJAB 5I1CL 1QRNA 5I16A 4L8CB 1B0GA 2A74B 2XY1A 1C16A 1F4XH 1GSMA 4HJ0D 1WFNA 1RULL 3ZSSA 3BRDA 5KSAC 2WBWB 3RQ3A 1AHWA 1Z0NA 3EJYD 3QEHA 4QT5B 2X42A 4MHHG 4IHOA 3U2SA 3KYMB 1VADB 4M7ZC 3CSBA 4TTGA 3VI3F 4ZXBC 2N4IA 5DUMH 5F1IB 4OD3H 3ROLA 3P9MB 3QULA 4M6NH 4K3JL 2VZ3A 4PJFB 1GL4B 3MYZA 4UOW0 3CFCH 1NANI 2OS7A 4TSCH 4JANB 3SDCA 3MGTA 5EG6C 4G9FA 4YDJA 3OJMB 5GRZA 4YXHL 5GGTA 3BD5A 1I8LA 2JB5H 4KQ4L 1NGQH 5JZ7D 3K81A 4HWEL 4NSKA 3O2WL 4JFYB 4XHJD 4DN4L 2ITCA 3BP5A 1BGXL 1UWGH 3VFTB 4KVCH 1INQA 2IF7A 4IDJH 3RWJB 4HLJA 3VG0L 3A6CL 4P2OD 3FAWA 25C8L 3MRRA 2CR3A 4FQ2H 4FQXC 4LLVA 2E6QA 2F19L 5HJ3B 4H1LB 5EO1A 2IPTH 4FXGA 5FYLL 3QXDA 1BQHA 2A1WH 2VZVA 4G42B 3SGKC 5GRJL 1D3CA 1G7JB 4UDTA 3BWAA 5E8OB 4NUGL 1ZLUH 3FQWA 2BHZA 1NJ9B 1VFMA 3VXQB 2JELL 4MA7L 4N0YL 4D9QD 1HSBA 1CK0L 3O11A 2I5YL 1BD2D 3B5GA 4OF8A 5DMGC 1EFXB 2ZCLH 3LIZL 3NABL 4WGWB 4XP4H 4GAJH 1QQDA 3VWKD 5DD3H 2B0SL 2V2WA 2W60A 4L3CA 5KVEL 1KIPB 4LQ1A 3MO1B 1KYOK 1LDPH 4M6MH 3QDMA 4EN3D 5LG1A 1HH6A 3TLRA 2DM3A 2BVQA 4HS8L 3VWKB 3GZKA 4NM4H 3PHOB 4C56E 4JY4B 5J4MA 4V1DE 1JNNL 3VXMD 1ZT7A 1RIUL 3WN5C 1V3LA 3DUUB 3PWVA 4EN3B 1G9MH 1U8OA 4OZHB 4Q58C 4HG4K 1MQKH 1B4JH 5A2IH 4HIHB 2DLIA 5D6CB 3STZB 1I4FA 4DZ8A 4PD4K 3L9RA 4WO4B 3WJLC 2YRZA 3OGCA 5F8RC 3IVKB 3IFOB 2I9LA 4YHML 4F7EA 4DEPB 2MKLC 1BP3B 1HWHB 5A43C 5E4EC 2OI9B 1JTOA 2V9TA 3IKKA 1FGVH 3V6OC 2L4OA 3KG5A 1EJOH 2BHUA 3TV3L 1QHOA 5MEOA 3BP4A 4M7JL 2P24A 5GGSA 1BAFL 2APVA 4IRSD 1AO7E 3WL9A 2GJZA 3H9ZA 4JG0L 1NGYB 4WTXA 4HIEB 5CD5D 1I7ZB 5I0DA 3BEWA 1X5IA 1DQLH 1A14L 4CADB 2Q7YB 4F7CB 5CGTA 1A4JB 3WFHA 3FQNB 3QDJB 4NCDA 1G7QB 4GG6A 4HFUL 2FIKB 1E27A 4P3CL 1EEUA 1BEYL 3BEVB 4TOYH 1A7RL 3O4OC 4YBHA 2W65B 4NT6A 1AD9B 2MTPA 1ED3A 2C4XA 4OLXL 1WIUA 5IW1A 1BIHA 3VH8A 3K8LA 5CS7A 1KCUH 1R3JA 2AEIT 2J8UB 4JFOB 1I1AA 4ODVL 2JJWA 2GTWB 4D94A 1MHHB 4XVTH