5EC2B

Kcsa with v76ester+g77da mutations
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B01
2Q76B 3JVGA 4BH8B 1U8HA 2P47B 3VRJA 3BO8A 4QXTA 5GJSH 2B4CH 1PVHA 4RISL 1DCLA 5DRWA 4L4VB 1MEXL 4OZFG 5D2LA 3NZHH 1CLOH 4X6FA 1UKSA 1OP3K 3THML 3U0TA 4EOWL 3C6LB 3GUTB 1DFBH 5BZDA 1Q9OB 4PJGB 1PSKH 3QAZC 3P40A 5HHXL 4RNRA 5FYLE 1FVDB 4QOKD 4DCQB 4Y2DD 5MERA 4YGVA 1U91B 1I7UB 4LP4A 1NLBH 3P3YA 3IFOB 1Z9SA 4X99A 4N0CC 1MPAH 3U36A 1HIMH 3AM8A 3RZCB 3D3VE 5DUBB 5AUMB 3VH8G 3SDDC 4X5WA 5TE7H 2XQBH 4Y5YA 4PJBA 3TIDA 2BCKA 3NVQA 5BRZA 4D0BA 4L5FH 1BD2D 1F4HA 3RVUD 1T04A 3QYCA 4R7DB 4FTVD 1QLEH 5K9KA 5D96C 3T0WA 2CK2A 5IW6A 5FOJA 3FQXB 1BQHA 3U6RA 1KJMA 3NH7L 3QCUH 4RGOH 3OAUL 3KDMA 3U7YH 1MCLA 5IFHH 5DMGC 2NY5C 4KK6D 1XF3A 2CIIA 2PETA 3RGVC 3IS1X 4CGTA 1RK1A 3DMMB 5HDBE 3MFGB 1OP9A 3HC3H 3MRHA 5EU6D 4JZOA 3RAJL 3CDYA 3IAGC 5DURB 1FSKB 4RGNE 3U2SB 4W4OA 4RISH 1MEXH 1OGTA 3QDJD 4MSWA 3EYQD 1RIVL 2EDRA 4EZMA 5EC1B 1A4JB 2CUIA 2EKSB 2JJWA 1JZ6A 3F6LA 1UWXK 1NCTA 1J0YA 2APBA 4KJPC 3OTTA 4OF3A 3PDGA 2GTWB 2NY4B 5EBWA 1T83C 3CPLB 5GRVL 2J6EA 5HHXH 5ITFA 4L4JA 3ULUD 4NKQB 1PQZA 4U0RB 4ODVL 3TH2T 4X6BA 1B9ZA 4RDQG 3TNMA 1H5BB 2CMRL 3I6GB 4AL8L 1B0GA 2AXGA 4OGYL 1IGIL 5MENB 1C5DA 1LDPH 1RI8A 3CD4A 4N90D 5KVFH 4PTUA 5D4QA 2R0KL 4ZS7L 6CGTA 1K4DB 4QY8A 3VXNB 1DQDL 2EXWC 1CZ8L 3MRJB 1QRNA 1W0WA 1WFTA 4WTZA 1CR9H 3MRDA 3VW3H 4PRPB 1FYTA 3OAUH 3OAYK 1JN6B 5EO9A 2GKIA 4HLZH 5C6TL 4PTTB 5JMRA 3O41B 4QRRB 4MAYB 1R3JB 3HS0A 4GMTH 3UDWA 1NBYB 3OJMB 1LEGB 5C92A 1J0JA 1CD1A 4O58L 3RAJH 2EEAA 1EPFA 5KVDH 2GW5A 5KAQF 5I73B 1JZ4A 4X5XB 1O0VA 1OARH 3X14A 1J1OL 1RIVH 5BVPL 1X6NA 4TNWF 1RIHH 1FZMB 2W91A 1E4KA 1AGDA 4NP4L 3MJ9A 1VKXB 2X4PA 1IM3B 2EYTB 2Z31B 5FHBL 2NLJB 3JWNC 2BOCB 3QHTC 2EDXA 3ZKXB 4PYGA 4OLEA 1KJ2A 3VFUB 4ZPTB 3VFVA 5FCUL 1MCIA 1K4CB 5IB2B 2CMRH 2CUHA 2FH8A 2VZSA 3FQUB 3HC4L 3QWRA 5HXMA 5DGRA 3PGCA 1B0RB 1I9JL 4OGYH 4TUOB 4CVZB 1IGIH 2P42B 5T1LA 2OX5A 5FGBA 5IIEB 4ZS7H 1C5CH 4GRWH 3FFCE 3L3OB 1DQDH 4OJFL 4IBLT 1CZ8H 1YMMD 3K1DA 4UTBL 2EH7L 2JCCF 4N5EC 4JFPB 5L8JB 4YDJB 3D48R 2V5TA 3RWDB 5C6TH 3HE6C 1MLCB 2YPLD 4ETQB 1EZVX 2L7UA 5E2TL 3ARPA 3V5KB 5ELIA 4YAQB 4O58H 3MV7E 1G7JB 2NYYC 3F58L 3U1SH 1YQVL 1AHWA 1XIWD 2QKIA 1BQUA 2HKHL 5FYJU 3WN5C 2ITDB 1F11B 3ARDB 2V7NB 2EO9A 3WXVL 4ELMF 1J1OH 5BVPH 2QQQA 2OTPA 3ARSA 3QR2A 1HHGA 4XXDA 2AW2A 5EULV 4FXLA 1SJHB 5HI4C 1D3CA 4YIQB 1J1XH 5I66B 3GGWB 2WV3A 4NP4H 4ORZC 2NZ9D 1OCWH 3FRPA 3QUZB 3V5HB 2N56A 1JPST 4TNVF 4AEHL 4MJ4A 1U8MB 5FHBH 2AJUL 1HQRB 3DIFB 4Q2ZA 5FCUH 1HWHB 4F8QA 1A3LL 2HWZL 4NSKA 2FRGP 2OXGA 2H6PB 3HC4H 3WLWD 1AD9A 2VKXA 2CRYA 1K8DB 1I9JH 4JRYA 4I0PA 1HHHB 3SDXE 4JKPL 4OCWL 4X4MA 4PGEA 4K2UL 1HKLL 5BOZG 1G7QB 4PJAE 2EIZA 4CRPA 1OTSC 1CGUA 2B1HL 5JDJA 5I1CH 2JELL 4OJFH 1OB1B 4H1LG 4XNMB 1D5IL 1JHTB 3HTLX 3MC0A 1MCOL 2VZ3A 2X4TA 4LL9A 1NH6A 2EH7H 4UTBH 3EAKA 2F15A 1I9EA 2HVJA 4BFIA 3K1KC 4ONFH 3VWJD 3ISWA 1DE4B 4MD4B 5GRZA 4GRWE 1WZMA 4Q7DA 5HI3C 3G5YB 5E8EB 1I3GL 4R4ND 5AWNL 1JNLL 5KSAC 5E2TH 3GSUB 4NKIH 4QRPE 4Z78B 5C0AD 3S7GA 4GMSL 5D2NC 5FOBB 3F58H 4PG2C 2WNGA 3ARBC 1YQVH 2P4AB 4GQ9L 4F8TA 4LLAA 1N8ZB 2HKHH 4GAJL 4M8VA 4U7KA 2NY1B 5HD8C 3SGKA 1GRWA 3UTTD 3WXVH 4QT5B 1B0WA 1GOFA 4PR5B 1I8MB 3MLVL 1KIUA 2AEQL 4R0LC 1MJJB 1DANT 1ZAGA 3UTSE 4YDLC 1CDBA 4KC3B 2DD8L 4LHJB 1DANU 4I77L 2AJUH 4WHCA 2Z92B 5GGTL 4N1HB 4YHIB 1YPZF 4IRJB 1A3LH 4I3RH 3ALPA 2V2WA 3O45A 1GGYA 1YN6A 4R96B 5T3XD 1I3RA 3HPLA 4X80L 3LRSA 1KJVA 43CAB 1LEIA 3A0OA 3IETB 4P48A 3GK8H 4APQD 2NY5L 5D1QD 4OCWH 1WISA 1IM9A 2X1OA 1HKLH 4X98B 4M6NL 1QFOA 3KGRA 2B1HH 2JELH 4MNQB 3JBG7 3H9ZA 1MCOH 4L4TA 2W9LA 2A9ML 2MPAH 3D2UB 4Z7OE 1YPZA 1RD6A 4Y89A 5IB3B 5GGVY 4KKNA 1HHJB 1I3GH 3IYLW 3PL6C 3MJ7A 2E6QA 5AWNH 1QA9B 1JNLH 4KQ4L 3TN0D 1H8OA 1YNLL 4GMSH 3I2CH 3BWAB 4F7MB 1CD8A 1CGSL 2XXCB 2PO6A 2D0FA 3FQTB 1OSZB 3DGGA 5HYQA 3MLVH 3OR7B 2AEQH 2KH2B 2R1WA 1D5ZA 1Z5LB 1FVEA 2DD8H 1A3QA 1CL7I 1EJOL 2Z0BA 1FZJB 5IMOA 3IRZA 4OQTL 4I77H 5E6IB 5DJ0B 3QB7C 1FAIL 1P7QD 3EBAA 4EI5A 1BBDL 1DSFL 5J3HC 3RY6C 1HE7A 2OK0L 5CGYD 4QWWD 2NR6C 3C5JA 1ZGLB 5B3JE 2C3HA 4X80H 5HYSG 2BNQB 5FF6A 1WJ3A 3BP5A 1A7PL 2DBLL 2NY5H 3JUZA 5EUOB 3C6SB 5T1KD 3V9FA 1MY7A 4M6NH 5JLZA 4B50A 1QFWL 1LE9B 3ARGD 4ONOA 3B8YA 5IV2B 3ZE1E 2AS5M 5J9PB 2A9MH 5HY9A 4RFOL 4PJ8A 4H20L 4UOW0 5HI5D 2ZP0T 3CFEA 3FQWB 5JA8B 3MRKA 4LF3B 1A1NA 1CFSA 4MCZB 3C8DA 2WP3T 3PWPB 3TBTB 2VDNL 1KENL 4HKJA 4KQ4H 1KTDB 3SCMB 4XC1L 3ETBF 4HBCL 5J12B 1J0ZA 3PWUA 4U1NA 1YNLH 5E00A 1KCUL 3EDDA 1GXEA 2I9TB 4YZFE 1XGUA 2J8HA 2YA1A 1PY4A 4R4BA 4W70A 2XPGA 2UYLB 1ACYL 3KPRE 1CGSH 2HRLA 3BP7B 1RJYB 1KELL 2CO7B 3HG1B 2Q8AL 1OWRM 4XZUA 1EBPA 3RUGE 4P4KC 5J57B 4HIIA 4FS0A 3KWWA 3SDAB 1CIUA 4XI5D 5JTWA 1EJOH 4MS8D 1QG3A 4YHPA 4ZOCA 3RBSA 3GMPB 3BQUD 4N9GB 3T77B 3TO2B 3BZFB 1FAIH 3KVQA 1BEYH 2VZ1A 3IVKB 2OK0H 4M9PA 3EDEA 4NC0B 4JPKH 1PKQE 5F7DA 4KXZI 2JJSC 1VFMA 4H0GA 1A7PH 2DBLH 3IU3B 1W72L 1BM3L 3SE8L 4NQEB 3GMNB 5DFTA 3QQ4B 2X4NB 4Z18A 1QFWH 3CVIL 4S1DD 3D39E 5IVOA 2EDTA 3LKRA 4MJ5A 5FECA 1CL7L 4HUUA 4PV9B 3OGCB 2J88L 2ZUQB 3I9GL 3LCYA 4RFOH 5BRZD 1NAMA 5C2BL 4H20H 3IDIA 2YKLL 4APQC 2X6MA 2GSIA 4QEGA 3K80A 1BFVL 4JKLA 3MQIA 3VXPA 4OD2A 4NQCA 2VDLL 3W2DL 2MQCA 2CJUL 4UT7H 5CWSA 4TUJA 5LVEA 1KENH 3TJHD 5A2KH 3V6ZB 3KPSA 4HBCH 4O2FB 5F9OL 2GJ6D 3VXRE 1KCUH 1GAFH 3L7EA 4L3EE 3VE0A 4UUJB 1KIQB 1MCWW 4N0FA 1AQKL 4OLWL 5KN5B 3QHFH 4U0QB 1TTUA 3IU4L 2WIMA 4KK9C 4NYLB 4Q9CA 1ACYH 4DGVL 3BIKB 5A2FA 2Q8AH 3UP1A 2YWZA 3RTQB 3P11L 5IG7B 2VQTA 4WEMB 2XIDA 4KDVA 4ONHB 4WO4A 2R9HC 4EVNB 1NDGB 3VWKB 5C09B 2ZUWA 1P7KB 3EFFB 4BH8A 2IFFL 2M2DA 4Q6YA 2LQRA 2ZUSA 4S2SB 2VC2L 4L4VA 4CVXB 4K71C 2COQA 1QHOA 4TVPL 1NMCC 2HTKD 1RAMA 4PUBL 1WTLA 4C54A 1D5MB 1J7VR 1GIGL 4KTYA 1QSFE 3QHZH 2H41A 4FXKB 2F5AL 4M1DL 3ZSTA 3VXOA 3WIFB 1W72H 1BM3H 1FVDA 3SE8H 4DCQA 5FKAA 5CGYC 1U91A 4Q0XL 3SBWC 1I7UA 4YO0A 3CAFA 3TF7C 1F4AA 4XP9L 5CIPH 1R6VA 5SV4A 3RZCA 5DUBA 3QDMA 2J88H 3W9EA 3I9GH 2R0WL 5C2BH 2EIBA 2HT2D 2NXZC 3MUHL 1BFVH 4U33A 4S1SL 2VDLH 2PTUA 1QRND 4OB5L 4MQ7B 3ZYOA 2FSEB 1QKZL 2CJUH 4ZUWB 4R7DA 3ZT7A 1IC7L 1FYTD 4U7MA 3RDTC 3O8XD 1HXYB 5F9OH 1SHMA 1Z2KA 4OLWH 5K9QI 2ID5A 4YX2L 3IFLH 1UA6L 1LMKA 2EE3A 1BECA 4KUCF 1TQBB 3P11H 3DMMA 1RHHA 4YPGA 1Q8MA 3GRWL 3T0EB 4TULL 4RIRA 1FZOA 4W4NA 5DJDA 2IFFH 3U2SA 3WHXB 1UADC 1DL7L 4OF5A 2Q3AA 2ZOLA 2V9QA 4TVPH 2IC2A 3CZFB 4YC2C 3QEUA 2ADJB 1A4JA 4JREC 4OUOA 1M7XA 4PUBH 4QOKE 4XI5C 1LWRA 4EBQH 2XA8L 1Q9LB 5F88B 4LCWA 4ODWA 5F6HJ 4M1DH 3GIZL 3QUYB 4FQHB 2NZIA 2Z8SA 4YR6B 2PCPB 2D0HA 3PF2A 2Y23A 5C3LD 1KT2B 2VB5A 5I74C 4JM2B 2PW1B 4Q0XH 4XP9H 4KRPB 2IFGA 3L3IB 5BS0B 1BD2E 4OCMC 4PP1D 2FLBT 4UB0L 2R0WH 1JCKA 3IFNL 1FGNL 4HK3J 2NX5B 4LVOC 4S1SH 4Y2OA 1HCFX 3TWCL 3DVIA 3BPLB 1QKZH 4J3TA 1IC7H 2QHLA 1J1PH 1D6EB 4IM8A 5EU4A 5JMOC 5K9JL 5LGJA 2HH0L 3EYVB 4DGYL 3WS3B 3RPKA 3V4VH 3DUUA 4YX2H 4CVWA 4G8FB 3O41A 2N7BA 2W65B 3HA0A 4QRRA 1IGYB 2ERJC 3NGBB 4MAYA 3BE1L 3LQZA 5FO7B 5I76B 3VXUB 1NBYA 1LEGA 2YPVL 5I1DB 3QDJE 3E1F1 4HAFA 4JQXA 1WWBX 4N1CA 3Q2CA 2A73A 3H9HB 3LZFL 3FB6B 1IKFL 3QDGD 4LPWA 4Y4KB 1DL7H 1XGQB 4OUUA 4X5XA 2ESVB 3CXDH 4RA0C 4EXPX 1SBSH 2YD3A 2GAZA 5SWQA 1DBBL 3F12B 1MHHB 2A6JB 4OZFH 1VKXA 5C3TA 1IM3A 3PDDA 1MI5A 3GIZH 2EYTA 4LLUA 2Z31A 2XA3A 4TVPE 2NLJA 4F7EA 2J1KA 2BOCA 2HTKC 4NKOB 2QQNL 4ZPTA 1MCKA 4QRQB 2IMNA 4JRYD 1K4CA 4N90E 1G0XA 1IAIH 3B5GA 5IB2A 3FQUA 3HAEB 5C0BA 4I5BB 4ZXBA 1B0RA 5I15H 1FGNH 1OAUL 5EDXA 4CVZA 5TDOB 1SYVB 4ZPVB 1KB5H 5SWSA 3TWCH 4C56D 5IIEA 3EYUH 5D2NE 1QVOA 3L3OA 3RGHA 1H3PL 1MLBA 4TPRH 5K9JH 4Z7QF 2HH0H 4YDJA 3IGAA 1FE8L 5I18H 3B3IB 4U6HA 4DGYH 5IFAH 3EOYG 1NDMB 3QO1A 3RWDA 1G7HA 1OW0A 3AAZB 5EZIL 1IKNA 1MLCA 4P57A 2RAMA 3BE1H 4ETQA 3LPWA 2YPVH 5I6XC 3HZYB 1MFEL 4XPFL 4QGTA 3LHPL 3UDWC 4JN2B 4HIHB 1IKFH 3UCRA 1U42A 2ITDA 2Y5TA 4LVNB 3ARDA 3UEZA 2G60L 5DVOA 5EBLB 2CIKB 5C0GA 4KQ3L 1DBBH 1SJHA 2QQKH 1S78D 5I66A 2BOBB 4PJ7F 3SDCB 3MX0A 3QXVA 4HCRA 5GRVK 3QUZA 3NOIA 3MRLA 2M1KA 3T0XA 2YS4A 3LAFA 1K8IB 1E4KC 3UTQB 2QQNH 1D9KB 2JJTA 5T5FL 1WEJH 2J8UE 1BHGA 5D7IB 4TRPL 5HHOB 4ORGB 3RVWC 3MJ8A 3VFOA 1A7OL 2H2PD 2H6PA 1IM9D 3JV6B 2CXKA 1K8DA 4OM1H 4XAWH 1YMME 2QSCL 1OAUH 3BAEL 5HVWA 4NIKB 5JPMA 4MNHB 1G7QA 1LP9B 3ZDYF 3DHJA 5GSVA 5BZWA 3V0WL 1G7MB 4PP1C 1R5VB 1A4KB 4XNMA 2EDOA 1H3PH 1RZ8B 5FGBC 1CIDA 2DJ4A 1T66D 5IB1B 2YPLE 2C4FT 1SJVA 2IEPA 1FE8H 4UT9H 3P4NA 1DE4A 1LK2B 1P6AB 2C4FU 3FT2B 3SDYL 2CLRA 3H9SE 3M17B 3GSUA 2G75B 4Z78A 5K9OA 4YK4C 3ZKND 1FRGL 5FOBA 4XPFH 2PO6D 3WFBL 1N8ZA 4MNGB 5IQ9B 3PP3H 4U1GB 4DZ8B 3DHMA 1V8HA 2G60H 4YH6A 4NO0B 4PR5A 1AHWC 1I8MA 1T5XA 8CGTA 2DIAA 5D1ZB 2CKNA 2VSDA 3Q6FB 4ODTL 1KUMA 5BQ7A 4AH2A 4DJMA 4EI5D 5F3HB 5T33L 4JPVL 3MLRH 2D3VA 1UYWL 2NY7L 1M71B 3TZVB 2Z92A 5DRNB 4YHIA 4FHBD 4M6AA 5T5FH 2HMID 4PJDE 1J5OH 1EJ6A 1A7OH 2EZ0C 4FFZL 1EAPB 1H3XA 4J12A 43CAA 4JR9L 1XGTA 4PS4H 1G7LA 4TSAL 2QSCH 1I1YA 3B9KB 5HSFA 5HVHB 4X98A 2D9CA 2BC4B 3QIWB 4I0PC 4MXVF 4PJ8D 2NXYD 4NHUB 2R4RL 3V0WH 4MNQA 1W0VB 4P3DB 1KLGB 4NRXB 5HYJE 1FNFA 5CP7B 3EOTL 5HYEA 3IDYC 1J10A 4O2EB 4KU1A 1A2YB 4OBRA 3ARFB 1NUDA 3DTXA 3QP3A 5C0AE 3VDAA 2YA2A 3BDYH 2P7TA 3SDYH 4TSBH 2R39A 1I1FB 1AXTH 2VLLB 1X7QB 4F3FB 1LO4L 1FRGH 5GGQL 3WFBH 4KKLC 1HI6B 3BWAA 4XXCC 4F7MA 4KROD 4J8RA 2N1KA 4YFDB 3OAZH 2IPTL 2ZUXA 3FQTA 5I8KH 3CSGA 1OSZA 4UV7L 3OR7A 4G43B 3BIAX 2FYYB 5CGTA 3CU7A 2IAMC 4CJ1A 3H42H 5T1DL 3FO0L 4XNQB 5T33H 1VGKB 3LKSB 4X6DB 5E6IA 4JPVH 1UYWH 1YJDC 2NY7H 5DJ0A 3HNSL 4M8QB 3RU8H 2YD4A 4QO1A 4WHDA 3KPNB 4BYHA 1ZGLA 1MCSA 4Y1AE 4FFZH 2NTFB 4GLRI 2BNQA 4JR9H 35C8L 4GRLA 1T2XA 5EUOA 3MRNB 4PJCF 5INCB 5JOFB 1HXMA 5DHYB 1FFOB 4ZNEE 1LE9A 5IV2A 2R4RH 4K7FA 2H2PC 3LB6C 5J9PA 4NQCD 5CJBA 4LSVL 2NY2D 3EOTH 5IUSA 3FQWA 4IMKA 2KBGA 4HFUL 3SQBA 4LF3A 5KSBF 3F7VB 4LSPH 1CQKA 4HIEA 4MCZA 3PWPA 3NPSB 4IOFD 1KFAL 3B2UC 5DEFB 3TBTA 3EGSB 4LVHB 1CGTA 4FABL 1KTDA 3MZTA 1XZ0A 3PHQB 1O7VA 1ADQA 2ICWA 2AJSL 1LO4H 5GZNC 1ZS8B 5DI8A 4NC1E 5GGQH 2IWGA 2UYLA 5J89A 3SKOB 1UCBL 2A74A 3HUJB 5MI0C 4JHAL 2J6EL 2IPTH 4A2MA 3ZYZA 2DM4A 4C4KT 1BBJB 2BERA 4UV7H 5KSBA 5FCSH 3N9GL 3SDAA 4L4VD 3MFFB 5T1DH 4AQOA 3FO0H 3KXFB 3WNPA 5BVJB 1PG7X 4PRAA 4JZNB 2B2XL 4MA1C 1KACB 2C7UA 3WYRA 3C6LD 1DLFL 3T77A 3B5TA 1A5FL 1RVFH 1IBGL 3EO1A 2V5RA 3HNSH 3SGDI 1XH3A 4FFVD 2QBWA 3E8UL 1S9YA 5JORB 2N4IA 3FRUB 3QQ9C 2UVFA 3IU3A 2A83A 4WUKL 5L8LB 3RZCD 4NQEA 1BFOA 3BEWB 4JFHD 2X4NA 4OCYL 3TT1L 1YQ2A 4EDWL 5C0CA 2OJEB 3FB8B 4LSVH 4IRZL 1KXVC 3OB8A 3S36L 2XWBB 4HFUH 1MWAL 1NBVL 4NNYB 3O11B 1AFVL 2IH1A 4Z95L 1KFAH 5DT1L 4RMTA 3GM8A 4FABH 3T2NH 4O2FA 4HH9B 3LD8C 5J06A 2AJSH 4GBXB 4XTRC 3ECBB 1KIQA 4QGYA 5IVXB 1N6QL 1TIUA 5KN5A 2X10A 3DMMD 3MJ9L 2YPKB 4DN4L 1J8HA 1AD0A 1UCBH 5D2LE 3BIKA 1BZ9B 4JHAH 2J6EH 4MCYB 4NUJA 4A6YA 3RTQA 2WUBL 1ZHKA 3FQNB 4NRYB 4P2QA 5DURD 1S9WB 5IG7A 1NCDL 3RHWK 2EDWA 4ONHA 4EVNA 3VWKA 4Y19B 5C09A 3ZL4L 5I1LA 4KROC 4QNPF 2B2XH 2VNCA 3FONB 1DLFH 5T1MB 4CVXA 1A7NH 4NUGH 2NY4D 3FCTB 3IDMB 1U2CA 4LCWD 2RGSA 1TITA 3AY4C 3S96B 1D5MA 1JPFA 1E6OL 2DJUA 4FXKA 3SKJL 3VJ6A 3OG6B 1AC0A 4U3XA 1ZSDB 3WIFA 3AGVA 4PJBE 2DYPB 5DR5L 5BRZE 5EIIA 1CFTB 5F7FA 1A6UL 1YC8A 4M48H 4GSDH 5IHZB 5E7FA 4LRIA 4OCYH 4EDWH 1IGJA 2BXZA 5MEND 2O5YL 1UM5L 1XGPB 4IRZH 3S36H 2WSKA 1MWAH 5DJAB 1CE1L 4MQ7A 2Y72A 3VFGL 3VFRB 4ZUWA 5ENWB 2KZ1B 4HV8A 4GLRH 5ITBL 3MLYL 1HXYA 2JIXA 4JCLA 2NW2B 1NGXB 4JY5H 4QRRD 4MAYD 2ADGA 1N6QH 2MOVA 3MJ9H 4YHYC 4DN4H 1Y6MR 5GS1A 1CWVA 3K4AA 4N68A 3GSVB 4MD0B 3T0EA 1KJ2H 1NCDH 3FO1A 2H3NB 5LGHH 1G84A 3ZL4H 4AY0A 3VXSA 1Y0LA 4R26L 3S37L 2DQUL 3WHXA 1J0IA 5EZOH 5CS7A 3AFLA 4WO4C 3WFCL 2V9TA 1XGYL 2X4QA 4C83A 4HGWB 4ZG1A 3KG5A 4X4YA 3MCKA 4N8CH 2Z31D 2FH6A 1E6OH 3PG2A 4UDTB 3HZKB 3C08L 1A64A 5CCKL 2BVOA 4FQHA 4L1DA 2PCPA 1KT2A 5AZ2H 1A6UH 1CXLA 2PW1A 7FABL 3KLDA 4XPTL 1QRNE 3L3IA 1CCZA 2WP3O 5BS0A 4LEXH 4IDJL 2O5YH 1UM5H 1LEKB 2JF1A 3LRHA 1FYTE 2NX5A 3W9DB 3MMEA 1Z3GH 3I3BA 2MWCA 4F9PC 2R8SH 5GZOD 3NZ8B 2YRPA 5KOMC 3VFGH 3UTZB 3S6CA 1J0KA 1NUFA 1D6EA 5ITBH 3JTTA 2LABA 4CUCA 1NFDF 5L0QB 5DK2B 1WZ1L 1YY9D 3EYVA 4O51B 1YJDL 4XHQA 1XT5A 3RKDD 2VABB 2D9QB 4G8FA 5I76A 4BSWA 1I9RL 4HMDA 4M7KL 4X9HA 3ZYJA 5JW4N 1KXTB 1ONQB 3RWGA 5I1DA 1PEWA 3ARDD 4P5KB 5DEGB 2Y7QA 4LPUA 1CT8B 4R26H 3S37H 2DQUH 4Y4KA 5FYKL 1F3JB 3T08A 3BD5A 1XGQA 1NFDA 4ODUB 4AIZB 3MOQA 3VU2A 1SVZA 2W9EL 4ZTPL 4QTHA 3QUZD 2R2HA 1HNGA 3F12A 1G6RB 1F4XH 5BXFB 3DVGA 1T80A 2A6JA 4K8RC 3C08H 4WFFD 4YHZH 5ISZB 3VI4E 4L8BA 2EO1A 3KYMA 1VFBB 2I27N 4EKXA 3IDUA 4QRQA 4XPTH 3D9AL 3G04B 2BNRA 5F9JB 4IDJH 4LKXA 2R23B 4S0SD 1E28A 1JRHI 4K7PL 5T5NF 4QYOA 1OAXL 5TDOA 5EH1A 4PJIB 1C08B 2OTWA 3TP4A 3L6FA 4IRSB 4X8JA 2IANB 3P0GB 1S7WB 4PBVC 3WEXB 2IPUK 5F6IC 3CFBA 1WZ1H 5HVFB 3MA9H 3B3IA 4BZ1L 2APTA 1NDMA 1YJDH 5DFWH 1JHKL 3GB7B 4G6KL 1BOYA 4M7KH 4WI4A 1Z6JT 2NY0C 2DTML 2NY1D 4JN2A 3LY6A 1YEKL 5FYKH 4JQXC 4S1QL 4M43L 5L2KB 1AH1A 5EBLA 2G9HB 3W0WB 2W9EH 1HEZB 1Q9KB 4HIXL 4ZTPH 4KHXL 4JGJA 4BJLA 4HUWA 3CX5K 3BPOB 1HSBB 2FGWL 2YD6A 2BOBA 3SDCA 3MXVL 3SGEI 1TTFA 3WNMA 5MEQB 5DVNA 4JRYE 1NC4A 4IRJD 1K8IA 1YUHB 2E27H 4X4ME 1EO8L 1UEYA 2IF7A 1D9KA 5FM5O 5C0FB 1RJLA 3V6FB 5GHWL 5EZLB 2JE8A 5CGMA 2Z31C 5HHOA 4YEFA 3D9AH 1N5YH 3ZKXC 3T4YA 5F89B 4G8IB 3GSRB 4K7PH 1AGCB 2AP2A 3RWCB 4MNQD 3FB7B 4ZXBC 4MNHA 1LP9A 3D2UD 1DN0A 1X3DA 2AJXH 5HGDB 3G6JF 1A4KA 1M7DB 3HB3D 3MV8B 1FNAA 5IB1A 2V5SA 4O9HH 4GG6F 1M4KA 2NY3B 2G5BA 2ZG2A 5CP3A 1LK2A 4WGWB 4MA3A 3OJDA 1JF1B 2X4OB 4AM0B 4NQSB 1R3KB 4PJHB 1OW0C 1OGAB 4GW5B 1TFHA 1YY9C 1C7TA 4UDUB 3WD5H 3RFZC 4ODHL 5HTSA 2DTMH 4R90L 2BVPB 5D7LB 5IB4A 1YEKH 3TT3L 3VMOA 2Y4SA 4LGPB 1N26A 1B2WL 4M43H 3WIHL 4DZ8A 4GG6A 3KPQA 3FTGA 3PWNA 4FQLL 4XVTL 5FM8A 4XVUC 4HIXH 4Z77B 5ESAB 5F7LB 3ARDC 4G8GB 5D1ZA 3M8OH 5E6ID 2FGWH 5FYKE 3MXVH 3LKPA 3CJJA 4JO1L 1NAML 5F3HA 1CFQB 2AXHA 1H15B 1JZ3A 4ODXA 1EO8H 1M71A 4P23B 5DRNA 4PV8B 4CMHB 2GSGB 1JNHA 1RZJC 2BNQD 2O5XL 2WWMC 2Z93B 2WM0A 3O9WC 3MO1A 1LILA 1EAPA 1XR8A 4QCIB 4YFLF 1YPZE 5I1KL 4GG8B 2HJLB 4ZUUB 1NGQL 2F58L 5JIHA 3I6LD 4M7JH 3HPJB 1OTUC 1T1XA 4FFWC 4NHUA 3K4DA 2VAAA 2RJMA 1JWMB 5I0DA 4ZUTB 5IHBA 4LBEB 5CP7A 4O2EA 3FO9B 3PWPD 1A2YA 2C1OA 3ARFA 3TVMA 2E7HA 3MRPB 5I19H 3SCMD 4XHJC 5MP6L 1OLLA 3EZJB 2UWEF 1CFBA 1ZEAL 3IRPX 4ZD3L 3N1FC 4XH2B 4X6DF 1DQTA 3P0VL 1X7QA 4F3FA 4FG6C 5CHNB 5KG9B 3HG1D 3WUZA 4GAYA 4R90H 3LN9A 3TT3H 3C09B 3PP3K 3DX9B 2P5WB 5GRWA 1REIA 3OJ2C 1B2WH 4XBGB 3SDAD 4WEUD 1T5WB 4P5TA 4LAQL 4FQLH 5F1NB 4EN3A 1BPVA 4WHTB 4G43A 3O4OC 1JP5A 3QIUA 4FQQB 2UWEA 5E8OB 1DBKL 3PWLB 2Y6SC 1NAMH 1TJIL 2ZWLT 4X6DA 3HMXA 3C8HA 3OF6D 2O5XH 2XZCL 2F8XC 4YJZL 1HZHL 2NTFA 5I1KH 4NQED 3S88L 4JDZB 1QPPA 1I8LA 4R8WL 3T09A 5EU5B 4U6YB 5C0CD 2QADC 5JOFA 4MXQD 5DHYA 2DLEA 3E6FB 3LKQB 4M03A 1A7RL 4NO5B 5F1KC 2APVA 5C0JB 4R2GC 1KCLA 2YA0A 4UZGA 3QUMB 3F7PC 2BY1A 4N0UB 5HGBB 1A6AB 3BGMB 3F7VA 4XP1L 1IC1A 5MP6H 4Z7NF 3NTCL 1BIIB 4K55A 5INDB 4NZUH 1ZEAH 3EGSA 1JI1A 4ZD3H 3EOBB 4M02A 2UUDH 1X9QA 5GRUL 4K8RL 4OIAA 1M7IB 4JFYB 1ZS8A 1A3RH 1AKJB 3RTQD 2VZTA 3OAZK 5E1HB 4CW1A 3RNQA 1KLUB 3VWKD 3HAEG 1BBJA 1V3LA 5C09D 5BW7A 2VUYA 1AR1C 4JZJA 1ZGLP 2QR0B 4EDXA 4P2RB 3FL7A 1T0NB 2E9WA 4AENB 1GOHA 1INEL 4HMEA 2MSPA 1AJ7H 5DMIL 1VDGA 4F15C 3KXFA 3PGDB 5BVJA 1DBKH 2XNAB 3UYPA 2ICES 1NUNB 2PYEA 1FCCA 1KLFA 1S5HB 3K2MC 4DZBB 1ORSB 5JZ7C 1YEGL 1XF4B 3BP4B 3V8OA 3ULVD 5JORA 1MQ8A 2IPKB 1CD9B 2J3SA 1E4XI 2WIIB 1U95A 4QRSB 4NQCE 1A1MB 4R8WH 5I1AB 1QEWB 1BQSA 2CD0A 1A7RH 1RUQL 4GRLC 5M95B 4LLYA 2ADIA 3C8KB 1WGOA 5IEHB 2ZUTA 3FB8A 1RURH 1JNNL 3MNVB 3H9YA 1EVUA 1JPGB 3DUSB 2APXA 4Q74A 1MJ8L 3IF1B 1XF2B 2IJ0C 5DMKB 5JOPD 4LLQB 4U2YA 2R56L 4NWTL 4MMXC 3FOLB 1A9BB 4IMLA 4FQCL 4HH9A 2P48B 4GBXA 5GRJL 3ECBA 5E2UH 4DVRL 4PJ9B 5IVXA 1Q94A 4RFNB 4CMMB 3WE6B 5J12C 3T0ED 2R0LL 1EBAA 4L4VE 5FXCH 1X5FA 5CILL 4MCYA 2IALA 2BFVL 5SWZB 1TQCC 1MCBA 3FQNA 4NQTA 2VITB 1BF8A 2VISA 2HT3D 3DX7A 5EOCL 4XPGH 4WI2A 3CX5J 1INEH 4EUPB 5DMIH 1U8QB 4PJ5B 5C7XL 2EC9T 1EHNA 2ZJSL 3QEQA 4IS6B 5DJ6B 3FONA 5T1MA 3TLRA 4OLZL 2EC9U 1KPRB 1ROWA 3FCTA 3IDMA 2EDYA 1WBYA 2GJJA 3MRFB 3QUYD 1OQOA 1YEGH 3S96A 1UH4A 3QDME 1EFXB 1KPVB 4PJFB 4D9LL 2GCYA 5DC9B 2O26U 4L3CB 1ZSDA 4J2XA 3GMRA 4YGAB 4KTEL 4KRPD 1IZJA 5BS0D 1MCJA 4JM4L 1IL1B 4TTDD 5IHZA 1EXUB 5EO1B 3BSZL 2HJFB 3DI3B 1JTOA 2NX5D 4NN5C 4UMGA 1JNNH 4WNQB 5ESVB 2XTJB 3MBEB 5H2BB 1E0OB 3CUPA 1R24B 1DZBA 3I02B 3GSXA 3VFRA 2R1YB 5ENWA 4HKZA 2R29L 4NWTH 1PW3A 3F7RA 3DBXB 1LDSA 2X9WA 3SE3A 3ILQD 1NGXA 3FFDB 5GRJH 1JYWA 1S7RB 1MF2H 3VXUD 5TGBB 1BIHA 1KB9J 2R0LH 1RZJL 1IGCL 1KBGL 5CILH 2WAHA 5I2IA 1X5GA 2QLVB 5D7JA 3HI5H 4MD0A 5EOCH 3DRTB 4Y4KD 1GGIL 2BVYA 2ESVD 4K7PX 5A3IC 3B9AA 4LCWE 5C7XH 1U8JA 4P9ML 3VXTA 3OL2A 4I3SH 1FZKB 3MLXL 2HJKA 1FVCB 3FQRA 2HG5B 5JW4Q 5FUCC 5TDPB 4EXKA 2GUOB 3UYRL 5CMAA 4UDTA 3IDGB 4D9LH 4LSDA 1G9MC 3V7AG 2QEJA 4MVBD 1Q0YH 4WU5B 5GRXG 2X4SB 1CDJA 4KTEH 2QJDA 3WNLA 4JM4H 1ZMYA 3O0RL 1DQQB 3O2DL 4LCYA 3I84A 3TH4T 2PUQT 1LEKA 3CC5B 4NBZB 4YXHH 2NCMA 4ZUSA 1TETH 3QUKB 5DHVB 4GKOA 2AGJL 1DBAL 3NZ8A 4QRRE 1UEMA 2P1YA 5DEZA 3H6JA 3UTZA 4H88H 1EGJA 2KDGA 2R29H 3FN0L 2QHRL 3NACL 5JW4M 5B8CC 3ZHKA 4C4KO 1T4KB 2ZUUA 3WFHB 1S7XB 5DK2A 1ES0B 4ZYKB 4U05A 2ZNXA 5DJ8B 5C8JB 1KYOK 4HCRH 4Z7VB 3BUYB 2C3WA 4OZHB 2HT4D 1IGCH 1KBGH 3MLSH 5LBSL 2A6IB 1UT9A 1VGEH 1N7ML 4O02L 4I4WB 3MXWL 2ED7A 1ONQA 5GS1C 2UZIL 1GGIH 2VLRB 2D7OA 3GSOB 1CT8A 2GJZB 3QDAA 4TNWK 2DIJA 1JF6A 1MI5E 2I24N 4ZO9A 1BJ1J 2ICWI 4ODUA 4AIZA 3MLXH 3O4LB 3SDCD 3E6HB 1JUFA 1MFCL 2PYFA 3LMJL 3UYRH 5C0BE 2ZUYA 5BXFA 2B7DT 1D9KD 4IIQC 5ID1B 5ISZA 3WHE1 2BSRB 1UWEL 3SDXF 5HHOD 5SWSE 3B8SA 3UPCA 1C7SA 1VFBA 3QO0B 4JHWL 3SE9L 4H26A 3EIFA 1YEEL 4HJ0C 2CDGA 3O0RH 2QL1A 3BUTA 2DIBA 5F9JA 4G8EA 4TSCL 4YDKH 5GS0C 3BRGC 4QXGL 2ICEA 4PJIA 4TTDC 2AGJH 1DBAH 2RFXA 4M1GL 5ACZB 2MHAA 4YPJA 5F7MC 1IEBB 3DPBA 4IRSA 2IANA 4KMTL 3FMGL 3NACH 1QUNA 2QHRH 3FN0H 2UZXB 3MLWL 3WEXA 5IJVB 4H0IA 3EDFA 1XAUA 2EICA 2UY7A 3KS0J 3BGAA 3GB7A 5JQHC 5C07A 3NIFF 3V52H 1B4JL 4O02H 1N7MH 4U3CA 3D85A 3WCYA 1N2RA 4NHCL 3MREB 4GAFB 2UZIH 5SX4H 4PRIA 3P73B 3WS6A 3JTSB 4NO0D 2V2TA 2DLGA 4ZAKC 2MCPL 4WV1A 3KAAA 4MB4A 5D1ZD 1CLZL 2X1XR 3TA3C 1MELA 3AMLA 3FOMB 1OP5H 4WFFE 3KLHD 3W0WA 2ZCLL 3O6KH 1MFCH 1HEZA 1Q9KA 5KW9L 2W0LA 4WJ5A 3PWVB 1RHFA 2DQFB 4TNVK 4V2BA 1I1AB 1HSBA 3O6ML 2HVKB 1NCWL 1T22A 4Q9QH 4HS6B 2X4UB 1UWEH 1AO7B 3UTSA 4UAOB 4DTGH 5C0FA 4JHWH 1F4WL 1N64L 1YEEH 4GKNB 3B9KD 3V5DB 2P5EB 2HRPL 5F89A 1FJ1B 5C0EA 1X5HA 5ETUB 4QXGH 1TCRB 4AMKL 3GSRA 1AGCA 3QIWD 3FT4A 3RWCA 3KNBA 3WJLC 4BH7B 3C5ZA 3SKMB 4YHOL 4YBQD 1M7DA 3RY4A 5FUZL 3ARFD 1HYSD 3P77A 3ZDYE 1HQ4A 3TNNB 1KIRA 2PTTB 3N85L 4WWKB 3BP6A 3KYOA 3CLEL 3AREB 1B4JH 4Y4FC 5E6ZA 2XZQH 4JJ5B 2VDPH 5MEPA 1OL0A 4AM0A 1R3KA 2EDLA 1OGAA 4GW5A 4NHCH 5DJ2B 5BV7C 2ZCKL 2BVPA 5D7LA 5C08B 2MCPH 1GZPB 2B8OT 3RA7L 4P2OB 5KJRL 1A1OB 3MNWA 1MUJB 2ZCLH 2X7LB 4JO3L 1DTUA 5ESAA 3ZMRA 5HHNB 4NQDA 3H0TA 5B3JF 1INDL 3EJYD 1F13A 2Q7YA 1CFQA 4D0CA 1T6WA 3VFSB 4XVJH 3BYTA 1U3HC 4P23A 2EXYD 3C60B 2EYSB 2AJZB 5EZJA 2OP4L 4BKLA 3STLA 2GSGA 4XCYB 1PAMA 5MHSE 1F4WH 3A6BL 1N64H 4EQ2A 1V5JA 4MNQE 5D72H 2Z93A 1AY1L 4I0KA 1X5AA 3U46B 2HRPH 4QCIA 3N06B 4MZ3A 3JV0A 5FYJL 4AMKH 1ADQH 4Q9BA 4ZUUA 3E3QE 4XMPL 3UO1L 5CKAA 2I25N 2WLYA 3HPJA 3LSOB 1IGFL 3STZB 5IESL 2VOTA 5FUZH 2GK2A 4A6YL 3TFKC 3R0NA 4ZUTA 4MXVE 3FO9A 4UILH 1KTRL 4PLKC 4WU7B 2K3TA 3OKEB 3N85H 4N0YH 4I9WD 1JPSL 3O81A 4YBLB 3CLEH 4U1MB 2G5RA 5IMMB 4JRXB 3F8UB 2NY6B 1IRAY 4NT6B 2Y06L 4CDGC 2E9BA 5KG9A 1G9ML 1SJEA 2D4DA 4NKDB 4CJ0A 1QFHA 3CDCA 2P5WA 5D70L 3RA7H 3E2HB 4XBGA 5KJRH 2W38A 3W39B 5F1NA 1TNMA 4S0TD 3KXFD 2NQCA 3AROA 3UJTH 1GCFA 1INDH 4FQQA 2BHUA 3GMMB 2BNQE 5CKGA 5E8OA 4FFYL 2AK1L 1L4IA 5EUOE 3R06B 5C0DB 5JXEC 3BH9B 4UQ3B 3BDXA 5IEKB 2QSQA 1NC2B 2CLZB 2VIRB 3A6BH 4KRMB 1HWGB 4P5MB 4G6AC 4ZFZB 3I6LE 1AY1H 4K3DH 2PW2B 3N0PB 5FYJH 4XP6L 5AAMA 4JFEA 5EU5A 4XMPH 4JFOB 3WUWA 2FHCA 2ORBL 3PWPE 5GPRA 3A6CL 4A2LA 4KHTL 2HA1A 3UBXA 5F1SA 4HUVA 4A6YH 1H3TA 2JK5A 3HE7C 4K3EL 4G9DA 5D6CB 1BLNA 4LLWB 3DARA 3QUMA 5CD3A 2GFBA 4N0UA 5MEOB 5DMYA 2B39A 5HGBA 3BGMA 5DK3A 1KYOJ 2D31B 2NMSA 1JPSH 4HKXB 2VQUA 5JIPA 1NL0L 3ARFC 4GBXD 2F53B 3TVMC 5INDA 1U93B 5KSBE 1S9XB 4LLVA 4OGAD 1Q9WA 5IMKB 2O61A 5J6HB 2Y06H 1F6LL 1INQB 4JFYA 3QULB 4FZEL 1G9MH 2J5LC 2XICA 2XN9B 3EYOA 3IDJB 4HS3A 3TO4B 2JB5L 3D0VB 4KGLA 2A6KA 4RMWA 4JFDB 3KYKL 1R0AL 2I07B 1URLA 1KLUA 4Y19D 5BJTB 5FM5M 3S4SB 2QR0A 3A67H 4P2RA 4FQ1L 4L8SB 1T0NA 3HI1A 5JW4R 1JZ7A 5GS0L 5DJZB 3V6BR 2Q7NA 4P5TC 3BKCL 4EN3C 3PGDA 4GH7B 1N5AA 4FFYH 2AK1H 2XNAA 5DHXB 5FGCB 5KTEL 3GJFA 4J1UB 3QIUC 1S5HA 4DZBA 4NQEE 5F8RC 4HJGB 1ORSA 2IADB 2EDNA 3EO0B 3BDBA 3OSKA 3CZJA 4U1LB 5C0CE 1XF4A 3BP4A 3KJ4C 4Z0BL 1P9MC 2DYPD 2IPKA 4XCEB 4M7LL 4O5LH 1MFAL 1SEQL 3GMLA 3ILPB 2WIIA 4R3SB 4YQXL 4XP6H 4QRSA 4XNYL 1A1MA 1QEWA 3VG9C 2VE6B 3G5XA 5EBMB 5SX5H 5LXGH 4RZCA 3D18A 1HH9B 1I8LC 3ZDXE 4BFGA 3C8KA 5FYJE 2LAGB 2VJXA 2V5YA 4JG0L 4K3EH 2EDQA 3MNVA 1JPGA 2GIYA 2CK0H 1HHIA 5CSZB 1MIEL 1J8HE 3UAJC 2FBOJ 2H26B 5DMKA 4LLQA 1NL0H 1RZIA 2BSSB 4P99A 4YEEA 1BX2B 2UUDK 4P2QE 4U1JA 3FOLA 4L8DB 1A9BA 1KCVL 2HTLC 4QRUB 4GUPA 4F7CA 4NN6C 4RMRA 5C09E 4X7EC 1EHXA 4FZEH 3PNWB 3DYPA 3G6AB 1QSEA 3WE6A 2JB5H 3CDFA 4F37F 4ENEC 1CVSC 1T21B 1R0AH 4Y8DC 4NRZA 4M93C 4PJFF 4PJXF 5T3ZD 1QZ1A 5KS9F 2JKXA 3BFOA 2FX7L 4S11A 4JZJC 4PJ5A 4P46B 1F3DH 3BEVA 1ZLWH 4PY7B 3S35L 4QNPE 1QBBA 4I18B 5D8JL 1FIGL 3RIAF 1EFXA 4Z0BH 2WUCL 1LK3L 4M7LH 3EHBC 1S7QA 4PJFA 2V9RA 4PJXA 3B4NA 1SEQH 2K9UA 4YQXH 5KS9A 4XNYH 3OGOE 1JMZA 4IEFB 5DD6A 1EXUA 3V7MA 2HJFA 4XPHL 5BV7L 4OF0A 1MAML 1SM3L 3CVHL 5EWIL 4JG0H 5JOPE 3ES6B 4WENB 4LPXA 5I8CB 5B3NA 4TOYL 5ESVA 4CU6A 3RVXD 3MBEA 5H2BA 5FHAL 5JIIA 3I02A 1UCTA 3LN4A 2EEDA 3QA3B 2MQ0A 4FTVA 4D0DB 3GNML 2MKLC 2CUMA 3T0EE 3PE9A 1KCVH 3M1BB 1C12B 5IBTL 1E6JL 3FFDA 4M5ZL 3U30B 5EU7E 1I85C 3VXSE 3MYZA 1PY9A 1MJUL 3BPNC 1CDYA 2R1XB 3EZ8A 3ARYA 3D6GA 3GSWA 2YUZA 3KR3L 3V4PL 3EOAA 1YECL 3WL9B 4GW4B 4X7TA 4F57L 3DRTA 4J4PA 3LEXB 4NZJA 5EU6A 3ULUF 5ADPH 1T3FA 2C26A 1UXWB 5HGHB 1KG0B 3SE4A 3RRQA 1FHGA 1OTTD 3FFCB 3S35H 2HG5A 2OLDA 4LQ1A 1FIGH 5JPNA 1ZKAA 5ISZD 4J6RL 5BS0E 5FDWB 2ZNWA 3CSBA 4KZEL 2WUCH 1LK3H 3H7BB 4HC1A 4RGNC 1CGXA 4AZ8A 4RGMB 2NX5E 1A9EA 2X4SA 3BH8B 1JZ5A 1F00I 4OLUL 4IHOA 1MAMH 3MV7B 1DQQA 3CVHH 2B4CC 5DRXB 3L5JA 3CC5A 4MX7B 3UTPD 4NGHL 4IRSD 1BQLL 5DHVA 3C2SA 5FHAH 2IAND 3DWTA 4ODBD 1P84J 3ZTNL 2PXYA 4H5SB 3X3FL 4X4XA 4QHMB 3CH1B 1MAKA 4D8PB 3GNMH 1TVHA 1L6ZA 5CSBA 1XCTB 5IBTH 1E6JH 5IBLC 1ES0A 3QUXB 4M5ZH 3QWOB 1MJUH 4DN3L 2YUWA 5K59F 5DJ8A 5C8JA 1JBJA 2Z8RA 4Z7VA 5KZCB 3BUYA 1X44A 1NFDE 3SE3C 2ZUVA 3MRBB 3V4PH 3WDJA 2R2BB 1ZTXH 2BXYA 1BAFL 2VLKA 3IAQA 5JNYA 4WW1B 3ESUF 3OZ9L 2WBJC 4Z0XB 2C3GA 3JZ7A 3GSOA 5D7JC 2Q87A 5L2KD 2ARJB 4GOSA 4KKBC 3W0WD 2VYRE 3P0YL 1B3JA 3PJSB 4LOUD 4MQXD 5TE6L 3UBXG 1X4ZA 1OOAA 2EH8L 2H2SC 3QIBB 3MSPA 4J6RH 2BNRE 4WTWA 3G9VA 3MR9B 1DR9A 3ALXA 1P6FA 1NUGA 5ID1A 1GOGA 2XFXB 3GSNB 2A9NL 1IGML 4KJYB 1JK8B 3U79A 3WNKA 1NANI 5CP3H 2DKUA 1FFNB 1DBJH 3QRFM 3MBXL 4OLUH 4OIIL 4JKWA 3MRIA 2FZ3A 2BDNL 4PFEA 3PQYB 2HFTA 4NGHH 1BQLH 3ZTNH 5ACZA 3X3FH 3MLZL 2MCG1 3MV8D 4ONGH 3N1GC 1NJ9A 2NY3D 3U83A 2P46B 2OI9B 1HNFA 4LEOB 3CNKA 3GKWL 1FNHA 3TBSA 5D7KD 4GT7A 4M6ML 3L5HA 3GO1H 4YDVA 1OGAD 3GMQA 1Q1JL 5E56A 1FL5B 3IKCA 1MH5B 2FJHA 4Y5XA 3HMXL 5ANMB 5D7LD 4LFHG 3MREA 3O6FB 3ARTA 3D69B 3P73A 5CEZD 3JTSA 3B9EA 2EC8A 4UBDC 3P0YH 2XOTA 1N0LA 5TE6H 4G8GD 4N8PA 1IVLA 3VI3F 4RFEB 3FOMA 5J6GB 1UZ6F 4Q6IC 3PWVA 2DQFA 4PJDF 1QSZA 5HHOE 2FJGB 5IWLA 1KCRL 1V7ML 4DFHA 3INUL 4P23D 4N5UA 3EKCA 1JWUA 1QYGL 1AO7A 2XWTB 1HSAB 1PJ9A 1LP9E 4X6CB 4JKKA 1FG2A 4Z76B 2DKSA 4BM7A 3MBXH 4GKNA 2F74B 4HUNB 4OIIH 2P5EA 3V5DA 3UPRA 1WAAF 1FJ1A 4L29A 3RWFB 2BDNH 2GITA 3B83A 5ETUA 1J05A 1TCRA 1L0QA 2YD9A 4HS8L 4RDQF 4GKZB 4NQXB 1PZ5A 4KWUA 3MLZH 5GS2D 4KK5D 1YMHB 5CEYA 1JGUL 2VUOA 4U1KB 1CBVH 4FQXB 5C0NC 1ZOXA 2ZCHH 4FXGA 5KSVA 3BXNB 5E4IA 5D6DA 5E4EC 5JHDB 3O3DB 4IRSC 3GKWH 3WDIA 1F6AB 3STBA 3CGTA 4M6MH 1IFHL 2PTTA 3C87A 1WAAA 4KFZC 4WWKA 1CICB 1Q1JH 3AREA 4GG6E 4JJ5A 4OV6F 3ARZA 3HMXH 3VXQA 1YDPA 1NCAL 2P5WD 3RX8A 4XNXL 4PP2B 5HDLA 1OD9A 3MUGA 1RK0B 5C08A 1OP5K 1CDUA 2D4FA 3FO2B 1QOKA 3UTTA 1MUJA 5IMLB 4BQ8A 5E94B 4WV1C 1U3YA 1V7MH 3TPKA 3INUH 1I7RB 3CSPA 3I6KB 3ZO0A 1KXQE 5L8KB 3L95A 5FYLL 4WW2F 4HPYH 1U8KB 3X3GL 5F3BA 3G08B 1X5XA 1QYGH 3VFSA 3NCCB 5EC2B 2DWDA 3TESA 1DEDA 3MCLL 2GI7A 1J12A 4XCYA 5IB5A 4Y4HC 4NM4L 2XZZA 4H0HB 1CN4A 3U46A 3HLAB 4MDJA 3UYOD 5D1QA 1IJ9A 1F58L 4HS8H 2OL3A 3K8LA 4U31A 4XB7A 2VN4A 1TJGL 4PGBB 3QNZB 3VFNB 3P2TA 4W6WB 4WW2A 3STZA 3RUGB 4EQ3A 4K94L 1JGUH 1UVQB 3QAZB 4QXUL 3V7AE 1X4YA 4PLJD 4QRTA 3C5ZC 4K3HA 4KV5E 2BX5A 4WU7A 3V79C 3OKEA 1IFHH 1UACL 3AU1A 5IOPB 5LWYL 4GXVL 1F4YL 4F9LA 3SDDB 4U6VL 1CK0H 3IAPA 2P8MB 4JFZL 4OIBA 1AKJD 4JRXA 5FV2A 4UTAL 1PKQB 5EIQA 4NT6A 1DQLL 1NCAH 5LQBL 2UWEE 4XNXH 4X0KA 4NKDA 2AXFA 5D96B 5FA4B 4X6DE 4P2RD 2HYMA 4OZGB 3ROOA 1H8NA 4KJWD 1NEZB 2B4CL 3NN8B 3X11B 3RGVB 3GMMA 4UT6L 5EFIA 3X3GH 3KYAA 4MHHI 5C0DA 3SEPA 1G7IA 4HF5L 3SY0A 3BH9A 4UQ3A 3MCLH 2UV3A 3TV3L 5IW3A 1PSKL 4HWZB 1NC2A 2CKBA 2CLZA 3BI9X 2VDOL 1U2HA 4LFHD 3P4LA 3REWA 4L3EB 3EYFA 1KIPA 1ZLSL 5E2VL 4HDIA 1IGTB 1U8OA 1DP0A 2X05A 2W60B 4NZRL 4JFOA 1TJGH 2R69L 2J7LA 3CFKA 2BSED 3ARGA 1KTLB 4PJEF 4K94H 4QXUH 3EJZD 5EORL 3X12B 4POZD 1BGXL 2FEDD 1S5IL 1VB9A 4L5FL 3L5WA 1R3HB 4Z7WF 4J23A 1UACH 5HYIA 3I50L 4GXVH 1TZIB 4U6VH 2F53A 4RGOL 1EUUA 1IEAA 1LO2L 4NDMA 4PJ9D 4UTAH 3U7YL 3RVVC 3WFEL 1S9XA 1QSED 1QSFB 2Z4QB 4Z7NE 1DQLH 5J6HA 1TDQA 1ETZA 1VERA 4F7PB 5E5MB 5LQBH 4PJEA 3QULA 2EE2A 3KXFE 2XN9A 1WITA 5SWZD 3TO4A 3P4OB 5CZXD 4EIGB 5E9DB 2PYEE 3MYJB 4R7NB 3DSNA 2YK1L 4JFDA 2I07A 4Z7WA 5BJTA 4RWHA 4H1LA 2MKWA 4OFVA 4JFFB 3S4SA 1NCCH 3UZQA 1WV7T 4PJ5D 2AQ3A 3P9MA 4L8SA 5E08L 5DJZA 4LKCA 4O4YH 5F97E 1J86A 3D5OF 4G9FB 4UT6H 1GZQA 1EO5A 4LSRH 3BQUA 5CEXB 2R4SH 4WFED 4HF5H 4PJBF 2F9BT 4HJGA 2IADA 3TV3H 1EFXD 4X83A 2BY2A 4GW1A 2VDOH 2VLMD 1AGFA 4U1LA 3QISA 1EGJL 2E7MA 4XRCB 4XCEA 1AR2A 1ZLSH 5E2VH 3ILPA 4F33B 5FUOL 4HIJA 4LGSB 4HZLA 3GKZA 4FRWA 4NZRH 3OKLA 4X7SL 2R69H 2VE6A 3UMTA 4MQSB 1HH9A 1MCEA 3MRRB 3M45A 5EORH 2XTJD 1HILA 3MBED 1BGXH 1LDPL 1S5IH 5KVFL 5GS3A 1NSNL 2MTPA 5IVXE 3OKDB 2VSCA 2OYPA 2E7LA 4PGCA 3I50H 1CR9L 2H26A 4D2NA 1AGEB 4JO2L 3VW3L 2BSSA 5CBAB 3RIFF 1BX2A 4L3AA 1BVLB 1NCNA 4PLJC 4OZIF 1LO2H 4L8DA 3WFEH 2GJ6A 1PX4A 4Y19E 1AXSB 4RBPH 3PNWA 3Q3GB 4GMTL 3G6AA 2M8XA 4BK5A 5TH2B 1T2QH 3QEQE 4L9LC 1HOCB 1U41A 2WINB 3F65A 1ZLVK 4J4PD 2YK1H 3T4AB 1T21A 3UC0H 5KVDL 3ZSSA 3T1WA 5E08H 2HLFD 3U7WH 3HE6B 2X4RB 3W82A 1W72B 1OARL 2RB8A 1AXIB 2V2XB 1RIHL 2IG2H 4OZIA 4ZS6D 4P46A 3QEHB 1U8IB 1RUPL 4KJWC 4PY7A 5IKCB 2N7AA 1FDLH 5DUPL 3AS1A 1N0XL 4I18A 3QWQB 1JWSA 3WN5B 1WIPA 1EGJH 4MGXA 5FUOH 5IROC 4TUKH 2XKSA 5SX5K 3HMWH 1HDMA 3TYFB 4JN1L 4X7SH 5E0QA 4J3SA 4U3HA 1T1WB 1BVKA 1N6VA 2NW3B 4JB9L 4WTXA 2YWYA 3QDJB 4WCYL 1DJSA 3OKNB 1NSNH 2PXYD 2XKNB 1C5CL 2UY6A 2LU4A 4JO2H 4HXBH 2FATL 3F6IA 2DQJL 3O8XA 3M1BA 3UTOA 5HYSA 4CAGA 1ZA6B 2VLKD 4JFXB 4G42B 2OSLA 5DVKA 4KRLB 2XI9A 4RFNC 4JCMA 2VLRD 3WL9A 3U1SL 4DKDC 5D5MB 2QSTA 3GI9L 4HXAH 2DBJA 3QNXB 2X09A 2DQTL 2F5BL 1RZ7L 5CZXC 3LEYL 2VKWA 3V6OA 3ZT5A 1ZLWK 5C2UB 5KSAB 4HEME 3ZKQD 1RUPH 1UXWA 5E7BA 5HGHA 3VI4F 1WWWX 4KMLB 4OD3L 1J1XL 5D2NB 1YY8A 2YRLA 3WJJA 3ARBB 5DUPH 1OCWL 3IS0X 1N0XH 3GBNL 5I8EB 1RIUL 5JXAH 2EYRA 4HMCA 4OI7A 3CIQA 5H94A 2CR3A 3H7BA 3TBYB 1MAJA 2KL6A 3H3BC 4R0LB 3LDBC 5KANI 4YDLB 1UB6A 3BH8A 4JN1H 1QFWM 2BNUA 3VA6A 4JB9H 3F5WA 4Y2DC 2DN7A 4WCYH 1R3LA 4NKMB 4OZ4B 1NKOA 5DRXA 2VLJB 2D0GA 3BYYA 4GS7C 5I1CL 3MUJA 4HJJL 3QH3B 1MRDL 4LLDA 4H5SA 1P4LB 3MUY1 4QHMA 1ND0B 4ONFL 2OTUB 5I17B 1T89A 2FATH 2DQJH 4JPWL 3RVUC 1QLRB 1OPGH 3QUXA 1CTOA 5FDYA 4YNYB 5A2IH 5TDNB 4X7FC 2YC1B 2DTSA 1P5UA 4NKIL 3H3PH 2J8UB 3DURA 3MLPA 4JVWA 3PHOA 1FN4B 4OZFB 3GI9H 1QO3B 1CXHA 4KK6C 2DQTH 2F5BH 3MCG1 4Z7UF 1RZ7H 3LEYH 3U48A 3PL6B 4ZSOB 3QDGA 2ARJA 5FK9B 1FPTH 4J4PC 4W6XB 5ISZE 4DKFL 4AJ0A 3NCBB 3PJSA 3P4MB 2X1WL 5HJ3B 1I1AD 4OD3H 3NCFB 5AD0A 5D93C 4F7TB 1UJ3C 3GBNH 4ZFOA 1RIUH 3QIBA 3QXAB 3SE4C 3EYQC 1AO7D 3PIQB 4LSTH 3WO4C 2ICWJ 2DWEB 2A1WL 4KI5D 3GSNA 4MDIB 3QI9B 3OXRB 3KPPB 4I3RL 4PJIE 1JK8A 3MJGX 4Z7UA 3EDJA 3H9SB 1AP2A 2P5ED 4KKAD 3UTPE 1KEGL 5I71C 2OCFD 1MREL 1FFNA 3ULUC 2IANE 3GK8L 4GO6B 3BGFC 3UROR 1S7VB 1ZANL 3PQYA 4LQFL 1JTTA 1M05B 1I7ZB 5E8DH 4E0RB 1EUTA 4HJJH 4LGRB 1A6TA 1MRDH 1OVZA 3S4SG 5C07E 4C56A 2MPAL 3TBVA 3BZEB 1OAYL 4E5XB 2FR4A 2XV6B 2X40A 1UXSB 1QTYT 1K6QH 2PXYC 5DJXB 4JPWH 4LCUB 4WWKD 2JTDA 4LEOA 2AABH 4PRIE 3ARED 5GIRB 4EI6B 5FA3A 2LV4A 5DTFA 2VR9A 2ZSVA 4U1IB 2V7HB 4L9DA 2RQ8A 3W0WE 1PLGL 4WHYG 1S9VB 5K33A 1MHCB 5DK0B 3I2CL 1BOGB 4X6EA 4UU9B 5C08D 3L3DA 3NIFE 2E8ZA 4P2OD 5ID0B 1U6AL 3QG6B 1MRFH 4DKFH 1QFWI 3MLUL 4RFEA 5J6GA 5E8PB 4DAGH 4PRHB 1NEUA 5EA0L 4RQQB 4PRBB 5B4MD 5HYJB 3S3SA 1JHLL 4W6YB 2Q6WA 1KJ3H 3C60D 1JV5A 5GS2H 2A1WH 4NNXA 1FO0B 4I3GA 4PBXA 5I1GL 4E42A 4P4KB 3VRLF 1PYWB 1GSMA 1FQ9C 4IJ3C 2Q86B 1KEGH 5CLTA 1MREH 2J4WL 2BJML 2F74A 4XMKL 3LQAC 1V3MA 3SN6N 4HHAB 1ZANH 4M6OH 1PGRB 4LQFH 1QQDA 2XACC 4RAUB 1LD9A 3QJFB 1OF2B 3NBNA 4JPIA 1OAYH 1YMHA 5D7KE 1EHAA 3VFPA 4XC3L 4RSVA 1TJHL 5DLML 5DD5L 2DL9A 4FQXA 4C58B 1WZLA 2VL5A 1U8NB 1OGAE 4BSVA 1FG9C 3HZMB 4XP5L 3BKJL 2UVEA 3BXNA 5CJ5A 4MJ2A 2SEBA 3JWDC 3QFDA 3GFUA 1PFCA 3O3DA 1SEBA 5JHDA 1XGRB 2JJVA 1G0DA 3SKNB 2GT9A 5D7LE 3G5VA 1TCMA 4JRXD 2BVQB 4LARL 4M7LT 1CICA 2NY6D 2R2EB 1PLGH 4Y1AB 4ZO6A 4I13B 4NQDE 1JGEA 1GGBH 2F8OA 4Y5XC 1U6AH 43C9A 2E5EA 1F97A 1RK0A 1RZGB 1IAOA 1F5WA 5JO5B 3MLUH 2WLZA 1CDIA 1A14H 1XIWC 4MB3A 2EDBA 4J3XA 5EA0H 4CKVX 3OJVC 4CNIA 1JHLH 1I7RA 3I6KA 1LE5A 4R97C 1BEYL 4HAGA 3K2UL 1NC2D 2W1NA 4PYHA 3G08A 1MCDA 3QUMH 3SO3C 5I1GH 5EC2A 2NZ9C 4JPKL 1DQML 1S7UA 2J4WH 2BJMH 1IAIM 1KULA 4XMKH 1GH7A 4JAMB 3IFPB 1NMCB 1ZWIB 2DLIA 5IT2L 5J8OA 3UJIH 2HN7B 1T1ZB 2BHZA 4PGBA 3WLWC 3OX8A 1CGWA 3DSFL 2AV7A 4R9HA 3VFNA 4KKCD 4LPVA 1P2CB 4XC3H 1UVQA 1TJHH 5DLMH 2BVUA 5DD5H 1QR1A 4XP5H 3BKJH 1AE6L 1WWAX 4OZGF 4GFTB 3OR6B 1ZVSB 4UT7L 4OV5A 2F53D 4Y0GA 1O5DT 5IOPA 5JHLL 2P5WE 5D6DC 2XZAL 2DM2A 4LARH 4GRMB 3VWJC 1U8PB 4NN7C 3GJFH 1GAFL 2NXZB 5J1AA 5IFJB 4KZDL 3RPIB 2XN9D 3QHFL 3TO4D 2NTSP 1KCKA 4R4NC 5IF0A 3FT3B 4JFDD 4MJ6B 1H8SA 1T2JA 1F3DJ 5GGTA 4PY8I 3VFMB 1KPUB 5GGVL 1ZK9A 2C1PB 4OZGA 3RDTB 3W11D 2UZYB 2YXMA 1MRCL 5EU3B 4PBWD 1MCFA 1EEQA 2X1PA 3CSYB 5JUEH 4KUZL 2YEZB 1R5WB 3GMOA 3NN8A 4YXLH 3DX6A 3ZKMD 2IBZX 3B6SA 3D0LB 1QNZL 2I9LA 3RGVA 1WCQA 3K2UH 4JFEE 3QG7L 2CPCA 3R8BB 4HWZA 1LO3L 1DQMH 3QHZL 5KVGH 1MFBL 1J88A 1L7IL 3ARQA 1A21A 1C8PA 5IW1B 1OT1A 2Z91B 3VD3A 3VRJB 4N0UE 1IGTA 4YC2B 4QXTB 5H8DA 5IT2H 3NIDE 4JREB 5DRWB 2W60A 5D2LB 4JG1H 4OKDA 3SGJA 4CN1A 5FO9B 4X6FB 3DSFH 1VFAB 1BJMA 1KTLA 1VEOA 4UINL 5D1QC 4RMQA 3MLTA 5BZDB 4OFPA 4IDLA 3SKUD 4D9QE 1AE6H 4GKSB 4WW2C 1ZV5A 5I74B 5HDOA 3UZVB 3QPQD 4RNRB 2BRQA 5MERB 4YGVB 5JHLH 4LSUH 2XZAH 4FA8A 4X99B 3KPOB 2H45A 4KZDH 4LVOB 2HP4A 4P2RE 4HX1B 1FAKT 2Z4QA 3IFLL 4OQTA 4X5WB 4N0RA 4PJGF 3TN0C 1I8KB 3TIDB 4CDHA 1MFDL 4HC1L 4MD5B 4M3JA 5GGVH 4AEEA 4D0BB 4R7NA 1T04B 1MRCH 3ULUL 1VCAA 5IJKC 2Q76A 1IAII 4JFFA 4OFYD 1DQJB 4KUZH 4KAQH 3WKML 5AG8A 3GI8L 4P46D 5KVMC 1BQHB 1KJMB 2KKQA 2ERJB 1QNZH 3KDMB 4G9FA 4NC1C 1CXFA 4NBYB 1GYAA 5CEXA 1JGVH 1XEDA 3C6LA 3QG7H 2CIIB 3VA2C 3GUTA 1Y6NR 1Q9OA 4EBQL 4PJGA 1RK1B 1LO3H 1ULVA 3L3KB 4WDIB 1MFBH 3MJ6A 4PGZA 3MRHB 1L7IH 4R4FL 5DO2D 4QWWC 4F33A 3HZVB 3IFOA 3ARVA 4C57C 5AUMA 1X5IA 4LPCA 2XXMB 4UINH 3MRRA 1EIBA 2I5YL 3ARGC 5DC0A 5DFVD 4X4ZA 3VGHA 1TVBB 4NCC2 4JHZA 5ITFB 3OKDA 4NFDA 1QSEE 1J1PL 4GQPH 5HI5C 4U4BA 1PQZB 5C0RL 3PGFL 3FQXA 3MOBH 1MHEB 4UV4L 2YD5A 3TNMB 3V4VL 4DGIL 3T2OA 5ABDE 1ZT4B 1FBIL 5DZLA 1B0GB 1AXSA 4PJ5E 2P44B 1MFDH 5TH2A 4HC1H 3CCHB 4PTUB 1HOCA 2BMKB 2WINA 4Y5VC 3T4AA 4QY8B 3ULUH 4ZODA 2EDFA 3RX7A 2F19L 5HHQB 3LQAL 3MV11 3WKMH 4WFEE 3GI8H 3MRDB 3CXDL 2O93L 3JVGC 4PJFE 1DDHB 4JVPA 4PJXE 1SBSL 3FFCD 3FN3A 5EO9B 5HDQL 2VLME 5KS9E 3QEHA 5EC1A 2A2QT 2EKSA 3LIZL 1OHQA 1U36A 1CD0A 5I6XB 3HS0B 2GTWA 4MS8C 5E2JA 5DHVH 3RJQB 3CPLA 3BMWA 3BQUC 1CD1B 3JWDL 4HWBA 1MWAB 4R4FH 2AEPL 5HGAB 3U4BL 2XTJE 1QD0A 3TYFA 1H5BA 1IAIL 4G5ZL 3MV7D 3LPGA 1T1WA 3I6GA 1N59B 4FTVE 5I15L 5E1AB 3AM8C 5DA4A 1KB5L 1AGDB 2I5YH 5MENA 3HR5B 5GGSB 4S1DC 4YUEH 3DUHA 2X4PB 1K4DA 3EYUL 4Y5YC 3VXNA 3MRJA 1A02N 1SQ2N 1F45A 5C0RH 4TPRL 3PGFH 1RY7B 3KHOA 2LE9A 2FX9L 4PRPA 3QUXD 4UV4H 5I18L 5IFAL 2E7LC 1JN6A 4DGIH 5EU6E 1FBIH 4PTTA 4RBPK 32C2B 2ZSWB 5KZCD 3TJHC 1ZA6A 1R3JA 5A2JH 1RUML 4JFXA 5T1LB 3RWHB 2VDMH 5DD3L 2D7MA 3TH3T 1OAQH 3GBML 5D5MA 2F19H 3LQAH 2A0LD 2EDDA 3WHE0 1YNKL 3BN9D 4LP5A 3RBGA 1UWGL 4PREB 5HDQH 1OWWA 2AV1B 3KYNB 4W4OC 3SJVB 1FZMA 5KSAA 5J1SC 3LIZH 3ULUE 3QIBD 4MAUL 4YK4B 2QQKL 3K74B 4ZOBA 3ARBA 5I8EA 3T3PE 3JWDH 3VFUA 1WEJL 2AEPH 1AHWB 4NJ9H 3U4BH 2JCCB 4R0LA 1EZVY 4S1RL 3GHBL 4G5ZH 3OWEA 3P9LB 1C1EL 1EHLL 3QZWB 2LTQC 4OM1L 4OT1L 3PQYD 4XAWL 5AG9A 4TUOA 3ZE0E 4RAVB 3ROLB 2QV2A 4UNUA 4NKMA 2FB4L 2VLJA 1NEZG 2X1QA 3N50A 3RL1B 1CXEA 1PEZA 1S7TB 4Z7VE 3GRWA 2HT2C 1P4LA 1ND0A 2VLKE 2VR4A 4JFPA 2FX9H 4UT9L 7CGTA 2OTUA 5GJTL 4OAWB 2HFFB 5I17A 4ELMB 3MA7B 1AIFB 4I0PB 3PABB 1RUMH 4PGEB 2YC1A 3O8XC 3V5KA 5DD3H 4YAQA 3IDYB 3RVTD 1G7JA 5D1XB 3GBMH 5K59E 1QO3A 1SMAA 3PV6B 4ZDHB 5I75C 1F11A 3VGAC 2V7NA 1RULL 1YNKH 3PL6A 4ZSOA 5T3XL 4YHMH 1UWGH 5FK9A 5A16B 3VG0H 1I3VA 3P4MA 4MAUH 4YIQA 2OL3L 4U2ZA 3GGWA 1L0XA 1ZHNB 4F7TA 4RCAA 3V5HA 3QXAA 1BMGA 3O2VL 1U8MA 3MLRL 1HQRA 3WJJC 1C5BH 1VFUA 2DWEA 3DIFA 4PIRF 1J5OL 4JE4B 4MDIA 3QI9A 3OXRA 3KPPA 2DM3A 3LQMA 4S1RH 2NPLX 3GHBH 1C1EH 2IAMB 1P4BL 1EHLH 1WC7B 4B0MM 4PS4L 4OT1H 9CGTA 1HHHA 2CRIA 4DW2L 1AC6A 5ACLA 2APWA 2AAVA 1M05A 2FB4H 4E0RA 4DQOL 1UM4L 4JGMA 4G7YH 12E8H 1OB1A 1JHTA 4FQXD 1EMTH 5JHDD 3ARUA 1UXSA 5GJTH 1YN6B 3HPLB 5DJXA 4MD4A 3LRSB 1KJVB 4LCUA 1LEIB 2DJSA 3BDYL 5DQDL 3G5YA 2CDFB 4TSBL 5E8EA 1CICD 4EI6A 1T89C 3H7LA 1AXTL 2FEEI 5J11C 2YD1A 4U1IA 1TPXC 4OBSA 1MHCA 3R1GH 4L4TB 4OLVL 1BOGA 5I8OL 1JYVA 4UU9A 2CKBL 3DETD 1YPZB 3DI2B 4LIQL 3NCEB 1RULH 1MCCA 4QT5A 2XRAL 5I8KL 5T3XH 1N4XH 3QG6A 1TTGA 2CSPA 1AO7E 1CF8L 1MJJA 4WFHD 2XQYK 2OL3H 2DQEL 3H42L 4PRHA 4RQQA 1NCUA 3HKFA 4PRBA 1U9KA 3VFWB 4ALAL 3O2VH 2P5EE 3R4DA 4XNZC 3VI3E 5B39B 5MI0B 4M1CD 3RNKB 1UZ6E 4IRJA 3RU8L 6FABL 1FO0A 2YZ8A 4PRDB 4OI9A 1PYWA 1TZGL 4R96A 2IQAB 1P4BH 2Q86A 4P0DA 1NCBH 4M4PA 2JLLA 4N8VB 5F7UA 3IETA 4MA1B 4LDLB 4BQ6A 3UPAA 3U7AA 3O2WL 4DW2H 4E41B 2CH8A 3S98A 4RAUA 1UM4H 4DQOH 3QJFA 4MQTB 1OF2A 1WAAE 3D2UA 2DB8A 3QQ3B 4XPBL 3AUVA 4LSPL 1EFQA 5FF6B 5IB3A 5DQDH 3SDDD 1HHJA 1XGRA 3BP5B 1FCGA 4DEPC 4QKXB 3SKNA 4WWID 1QA9A 5C08E 1IE5A 5JLZB 4RRPG 2BVQA 3UTTE 2YR3A 2R2EA 3DYOA 1F42A 1CU4L 4OLVH 5I8OH 3L3JB 2CKBH 3CFEB 4LIQH 3KLAB 3D25B 2CR6A 2XRAH 3OMZA 1RZGA 1YEFL 1CFSB 1V3KA 1CF8H 3WFZA 1OAZL 2DLTA 5EUOF 3ZT6A 5JO5A 3QBTB 3LD8B 3SGKC 1Z5LA 5TQ0L 3S97C 5DMGD 1F2QA 3IJSB 2DQEH 1JIBA 3RGVD 1FZJA 4ALAH 3ZE2F 3PWUB 2C3XA 4GXUM 5F7NC 5T3XE 5ADOL 4XAKD 2FEEL 1RVFL 6FABH 1S78C 1TZGH 3DROB 1CDGA 4L3ED 2GQHA 3C6SA 2V17L 4JAMA 5JDSB 1YYML 3MGOB 4KJPD 2DQGL 2B5IC 3O2WH 4CU7A 1ZWIA 2HN7A 5D9SB 4DK6A 2Y36L 2YUXA 2WBKA 3QXTA 1CLCA 2VH5H 4BZ2L 1UGNA 1EEYB 4XPBH 4LASL 4JRXE 1HKFA 4H1LH 4L8CB 3C9NB 2F54B 3TPUB 1ZVSA 2IBZY 3GDBA 5CZVL 4XX1G 5HYFA 3BKMH 2VXTL 1VACB 1T66C 3HFML 5LAXB 3SCMA 3T2NL 4OD1L 1QSFD 4GRMA 2P43B 3GM0A 5J0BA 5IFJA 2I9TA 4MJ5B 1CU4H 4HUUB 3T65B 2EXWD 1NAMB 5E9DD 5FO8B 2HAZA 3BP7A 2GSIB 1RJYA 4MJ6A 5M94B 3HG1A 3VXPB 2OZ4A 3V95A 4WHYH 3ZKNC 1KPUA 4JFFD 1YEFH 2C1PA 3RDTA 1OAZH 2PO6C 5CWSB 2IPUG 5EU3A 5TQ0H 1CG9B 5EIVA 3CSYA 4G9FD 3KPSB 4LIQE 4POUB 5ICYB 1R5WA 3GMPA 4YHYB 2DF3A 5HHPB 4N9GA 3BJ91 4GAGL 3TO2A 3D0LA 3BZFA 3L7EB 5ADOH 1A7NL 4U1SB 4NUGL 3IVKA 4DOHE 3KPTA 1U92B 5FGSA 4EI5C 5C71A 2P8LB 3OF6A 5F96L 2E8YA 5DRZB 3FAXA 5F9WC 4WVRA 1I8IB 4WO4B 3ZDXF 4JRWA 1EEUA 2V17H 1YYMH 2HMIC 2PNDA 3GMNA 5IW1A 2DQGH 2Z91A 3QQ4A 4M48L 4GSDL 4B41A 1WWCA 3K3QA 3AS3A 3VD4A 2XT1B 2Y36H 4PV9A 3OGCA 5FO9A 1FP5A 3R8QA 4BZ2H 1VFAA 1D5XB 2F53E 1ZVHA 4LASH 4PJ8C 4GKSA 2NXYC 4X9IA 4PJEE 3VXOB 2XN9E 5CZVH 2VXTH 4UIMB 4XCCL 3V6ZA 3HFMH 5FKAB 5CJOL 3FJTA 3V8CA 3GJFK 4OD1H 4JFDE 4YO0B 2Q3ZA 2E3VA 2KUTA 4Z7WE 3KPOA 4JY5L 1KC5L 4UUJA 4KRNA 4K23L 3QDMB 2EECA 4HX1A 3W9EB 4LCCB 4NYLA 1SMOA 1WBZB 5DWUH 5AEAA 4N5ED 1I8KA 2OJZL 3WLBB 5EOTB 4UQ2B 3BIBX 3OBAA 3LOWA 1BJ8A 4MD5A 1KJ2L 5FGCE 5CJQH 5I1HL 4NFCA 3ULVF 3HE6D 1QFUL 5LGHL 1NDGA 1P7KA 3EFFA 1DQJA 4FOMA 5EZOL 3TGXA 1QBLL 4S2SA 5IR1B 4NZDA 4GAGH 3U4EB 4DUXA 2NYYD 3FN9A 1FC1A 4DVBB 4OCRH 5BMFL 3ME0A 4N8CL 2VXQL 1JZ2A 4CADB 3L3KA 4QHUB 2ED9A 5F96H 1RHHB 4YPGB 3BD4A 4WDIA 4RIRB 1FZOB 1QLFB 5DJDB 3DV6B 5I1EL 5AZ2L 5HI4D 2ENSA 2GY5A 3F7YB 3HZVA 1FFQA 2H32B 5K9QG 2ZOLB 4LEXL 4DUVA 3QEUB 3THMH 3RZWA 5I9QC 4EOWH 1Z3GL 3SGJC 4HFWB 2R8SL 2GJ6E 2FSEA 1RZKC 3TM6A 4LCWB 4ODWB 1TVBA 2DOCA 5CJ8A 4X5LA 2RIKA 4PRPD 4XCCH 2NY2C 1WCBB 5CJOH 4RX4D 5J13C 2ATPB 1MHEA 3O3UN 1X5KA 1KC5H 1OTSD 4K23H 4TVPD 4F37K 15C8L 1ZT4A 4IOFC 1NGZB 4ZFOL 2OJZH 1A6VL 4OF8A 4LMQE 1MOEA 4OZIE 4Z6AT 4BQCA 3CCHA 5I1HH 2BMKA 3GSNL 1QFUH 2D7TL 1K85A 5HI3D 5F6IB 1J0HA 4JM2F 4HGMA 3H3KA 5HHQA 4M7ZC 5KSAD 1QBLH 5EU4B 5LGJB 3TYGL 4F80A 3NH7H 1DDHA 3CZFA 3DUUB 3ARBD 1T1YB 2ADJA 2NY0B 3DXAB 3RIAK 5BMFH 2VXQH 1QRKA 3LQZB 1F4XL 5HD8D 1Q9LA 5F88A 1WK0A 3C6LC 3NAAL 4YHZL 3QUYA 4YR6A 1B6UA 1MWAA 1KEML 2A73B 5I1EH 4FFVC 4WI8A 4JM2A 5HGAA 1ED3B 1L7TL 2VL4A 4OUUB 2DQCL 3PXHA 4TYUA 3WV0A 3BD3A 1B4RA 4ETYA 2GAZB 5SWQB 1N59A 1RSFA 5E1AA 2VLJD 3RZCC 3VRIB 2YMXL 4HPOL 3ALWA 4KMQA 4MA7L 3HR5A 5GGSA 3SHSA 1TENA 4KVNL 1U0QA 4AEIL 2OS7A 1MI5B 4LLUB 4F7EB 3T2QA 3MRCB 3JSSA 3LV3B 5DGQA 4ODVH 3MA9L 4JO4L 3WS3A 3DJ9A 5C0BB 15C8H 1FORL 4CU8A 32C2A 2ZSWA 4ZXBB 4AL8H 1BZ7B 2W65A 3U9UB 1IGYA 5FO7A 3V6OE 1A6VH 5SWSB 3VXUA 1RFDL 2Y25A 2LU3A 2R0KH 3NFPB 3RWHA 3GSNH 2YBRB 2D7TH 2IGFL 1QVOB 3H9HA 3QEGL 3DMMC 3FB6A 1MLBB 3PL6D 4BK4A 4QXWA 2ESVA 3TYGH 3BHBB 3IGAB 1FSKC 2BZDA 4JANB 4U6HB 4PREA 1ITBB 2AV1A 3KYNA 3SJVA 5FV1L 3QO1B 1G7HB 5TPWL 3V4UL 1B6DA 1FC2D 4K07A 4W68A 4P57B 5IVNA 4V1DB 1MHHA 1UM6L 3NAAH 4QTIL 2E27L 3QI9D 2VDQL 1KEMH 2NY4C 4NKOA 3H9SD 5FIEA 2WBWB 1L7TH 2JCCA 2Y5TB 2DQCH 1N5YL 4LNVA 3P9LA 3HAEA 4I5BA 4U0RC 5C0GB 3QZWA 5J3HD 3RX5A 4ELKB 2NR6D 4RAVA 1SYVA 1H5BC 4ZPVA 2YMXH 4HPOH 3ROLA 4MA7H 1CGVA 2XYCA 1RZFL 4KVNH 3MRLB 4AEIH 2AJXL 3RL1A 1S7TA 4DKAA 3O9WB 4E9LA 4O9HL 3NCYP 1FFPB 2OMNA 3MJ8B 4JO4H 3VFOB 4OAWA 2HFFA 4ELMA 1FORH 1VSCA 3AAZA 3MA7A 1AIFA 3DNKA 1UG9A 3PABA 3QDGE 1BVZA 4PJ7B 3K81A 5JPMB 1RFDH 5F7WC 5TQ2L 3WD5L 5BZWB 4MAYC 4XWOD 3HZYA 5GSVB 5CJXA 2IGFH 3NFSL 5D1XA 3QEGH 4HIHA 3PV6A 4ZDHA 3RP1A 5D7IF 5J56B 1ZHLB 4P2YA 4NO3B 3BWUC 2VN7A 3P4NB 2CIKA 3L3GB 5A16A 4PRHD 5I73C 5TPWH 3V4UH 3M8OL 2CLRB 4Z7UE 1DLHB 5CD5D 5HYJD 1FV1B 4XT1C 1LP9F 1ZHNA 1UM6H 5CLWA 5K9OB 4QTIH 4XXCA 4KGJA 4P4KD 2VDQH 3UTQA 2XKUA 5ESQB 3HRPA 1IQWL 3PQYE 4V2CB 5D7IA 2PF6A 4BUHA 4ORGA 2CDEB 3BT2L 5ALBL 4C56E 2X2YA 3O4OB 1NFIB 2DI7A 2IAMA 1T5XB 3JV6A 1WC7A 5BQ7B 4AH2B 4M7JL 3QNYB 1RZFH 4AEHH 1G7MA 1R5VA 2C9AA 1RZ8A 5DYOB 3AMKA 4P3CL 1BQHG 1LO5B 2HWZH 5GZOC 5ANME 2QADB 5I19L 3FT2A 1XGTB 2CDFA 1G7LB 1I1YB 3M17A 4JKPH 2FIKB 3ZKSD 4K2UH 4AEFA 1T0MB 2G75A 4R2GB 4Y1AD 1IKNC 5TQ2H 3Q6GL 3V0VB 4N9OB 3NFSH 1D5IH 3RKDC 5DSCB 4LK4A 5F44A 4MNGA 5IQ9A 2VXUL 5BCAA 3LRGA 4NO0A 2BY0A 5IHLB 3DTXB 2YRZA 3NA9L 2Q1EA 2P7TB 4YHKL 4KK9D 4NQVB 3Q6FA 3DVFA 1ODAA 4X6CE 1U8LB 5F7EL 1L0YA 3VFWA 1RZKL 2CXGA 2ZZUT 5B39A 3TZVA 2R9HD 2OR9L 3RNKA 4GQ9H 3QUZC 4BFBD 1IQWH 4PRNB 3WXWL 1G0YR 4GAJH 4YLQT 4TVSa 4J8RB 4PRDA 2ZPKL 3BT2H 4PLOB 5ALBH 5A43C 1TNNA 2IQAA 2JJTC 3IDXL 4F15B 3QI9C 4N8VA 1Z9OA 3B9KA 3VRLE 3IXTB 3DRQB 5JHDE 4E41A 2BC4A 3QIWA 4KV5F 1W0VA 1T7YA 4P3DA 2X89D 4WTZG 1KLGA 4NRXA 5GGTH 3RQ3A 1ZT7B 1VEPA 5JW5B 3QRGL 3QQ3A 4P3CH 1EH9A 3BJLA 4W81A 3AS0A 3C5SB 5DMJB 4ZQKB 2FECI 3T1FB 1QBML 4GRLB 3U0WL 2NXZD 4NZUL 4OSUL 3GBLA 1I1FA 3CX2A 1UZ8B 1FFRA 1NGYB 1HXMB 2QQLL 2VLLA 3Q6GH 4Q9RL 3DO3A 4K7FB 1A3RL 3ARRA 2RHEA 2VO5A 1HI6A 3L3JA 4WFHE 4D94A 4OQ1A 1K9TA 2VXUH 3RDTD 5F7HA 4JY6B 2A38A 3KLAA 3D25A 1ZT1B 3NA9H 1ORQB 4XWOC 1DVFB 4HIEB 2DM7A 2NY1C 4YHKH 1CDCA 1WBXB 2FYYA 1AJ7L 4FN0A 1CGYA 1PDKA 3IJSA 3S36X