5EC2B

Kcsa with v76ester+g77da mutations
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2B01
3JZ7A 4E5XA 4MB3A 3TH3T 2ORBH 3IS0X 5F1IB 4WO4B 1MCDA 3C6LC 3MCLH 3BEVB 2NY5H 1RUAL 1C08A 3MRFB 4PJGB 3OGCB 4YDVA 4PG9A 1ZT4B 5SX4I 4UIMA 1JGVL 2AK4D 3VGEA 4N8CL 4PP1C 4HX1B 4M8QB 1NFIB 2HFEB 3D3VE 4HBCL 3WD5L 1AXTL 1R3HB 3D1MC 3MRNA 3VFGL 1EGJL 1ND0B 4YFLF 4IHOA 1MVFA 3G6JB 2PXYB 1DBBH 5EB9A 3ZYIA 2RHEA 3QUYD 1M6OB 1KC5L 2P5ED 4WY7H 1AR2A 3HRPA 3NIDE 1LE5A 4BK5A 4Z7UB 4ZO9A 4XCNA 4F7CA 3GMRA 4YNYB 4LDOB 5CEXA 2G2RB 4KROD 3BT2H 2EEDA 1FORH 1NEUA 2V2TB 2X7LB 4G42B 3E0GA 3V5KA 3U4BL 2APXA 1NQBA 3DYPA 3HR5B 4G80B 3T1WA 2WANA 3BH9B 4IJ3C 1RHHA 2X1QA 3NFSL 4XNZB 3MGOB 1MLCA 1U8JA 5HPMA 4YXKL 1Y6NR 3S34H 5KS9A 3KLSA 3BZDA 4PD4K 3MRQB 1KCRL 5A43C 5ISZD 4ONGH 2FGZA 1K4CA 1H0DB 1FJ1A 3FO9A 5L7XL 2Y36H 2H2SD 1EO7A 4LNVA 2EDJA 4AG4H 1TVBB 4N90D 2R4SH 3V4UL 2W0LA 4YHNA 1X44A 5E6ZA 4AH2B 4I4WB 5K59F 3QB7C 2AK4A 4E42A 2J4WH 4ELKB 3LRSA 2E7BA 4HPYH 2E7LC 5IFJA 4MQSB 5TPWL 1LP9F 1T7VA 5GHWL 1DBMH 3SKNA 1TQCC 4ZOBA 1BPVA 1AR1C 4LPUA 2RGSA 2WBKA 3LN9A 4WW1B 4JM2C 3SDXF 3W5NA 1OAKL 2VZVA 4L8DA 4NGHH 2P5EA 1T66D 5D72L 2DDQH 4K3HA 5AZEL 1OGAA 2QKIA 5T3XD 4OCSH 3SDAB 2YD1A 3B9AA 3L3HB 1EXUB 5A16A 1NEZA 2CRZA 2X2YA 4XAKE 2MOVA 2IJ0C 1ZT7A 3DI3B 5ICXA 1MHCA 3HUJA 4BELD 2PW2B 3GBMH 1G1CA 2UZIH 5DJCA 1TZHA 1F58L 3QDME 4HT1L 4CN6A 3B9KD 2H2PD 5GRZA 3TWCH 1A5FL 4WHYG 1QP1A 5EULV 4MCZA 5ISZA 3ARBB 3STBA 4JEGB 1R5IB 3UJIL 4HMDA 1ZLSH 4OB5L 1S3KL 1HH6A 5DVKA 2EYTB 4S1RH 4L5FH 3HFML 1CD9B 4IOSD 3GK8H 5F7EH 3TO4B 1GGBH 4CN1A 4YX2H 2R39A 2P7TB 1Z3GL 3TFKD 4IMKA 4ODBD 1KJVB 2J8UF 1CDJA 3ULVE 1EFQA 4FA8A 2X4PA 4JPIA 1R24B 2OTWB 4KPHH 1SEBA 3RNQB 3T08A 2Q76A 4U1HB 5JW4R 3TNMB 1W0VB 3D0LA 1CN4A 5I19L 5GIRB 5EOCL 3C09B 3MBED 2O5YH 5DHVB 5CGYC 3ZL4H 3TT1L 1C16A 3F7VA 2NY6D 2AJUL 2KKQA 3KPRB 4OFKA 2BNRE 5DF0A 3BN3B 1BFTA 3B9KA 1NDGB 5DJAB 2IALA 3MLRH 5T3ZL 5GJSL 1MWAH 4Y19D 2F19L 4P2QE 4J3UA 1A6TA 5KW9H 5D7IA 4HEPG 15C8H 4PPTA 2P45B 2VZOA 4KV5E 2ENSA 3BXNA 4G9DB 1BQLH 2BNRB 1MFNA 4NQTA 3H9SA 2LU7A 5HY9B 3DOSA 5JQ6H 1IM9A 2ZNXA 4HIJB 3MLVL 4KUCD 3HAEG 4EN3D 3QEUA 1JRHH 4K3DL 4NN7C 2XOTA 3X13A 2BP3A 4KRMB 5CBEA 5F6HI 3BO8B 3U0TB 2LABA 5DQ9A 1T5XB 3FMGH 3QG6B 4JDVA 1A1OA 2QQQA 1P4IL 5GGTL 4KWUA 5D6DC 1KIRB 3EDKA 3I50L 1U8KB 4BFBD 25C8L 1INEH 1NUGA 2OR7A 4WVRA 3CXDL 3MBEA 1UKTA 5D1XC 5F1KC 3KAAA 4MNGA 4P9HL 2EH7L 2DQTL 2VO5A 4CKVX 1I9EA 1LK2B 1RK1A 1A4JA 2BY2A 4YHPA 4GMTH 2BMKB 3MA7B 1DSFH 3CUPA 5A2JH 4J7RA 2F58H 2RFXB 3HKFA 5CINL 4ZSOE 4PRDA 4G9FD 4KJPD 4D8PA 4KUZL 1R0AH 1A2YA 1ZHBA 2HKFH 1DUYB 5I1HH 3I6GB 1WEJL 2RQ8A 1NMAL 3CFDB 4PTUB 5FHBH 3DV4B 3IYLW 5GGUB 1T89A 5GZNC 2K1MA 1BF2A 5D7LB 4XCEB 1FE8H 1TIUA 5CP7A 4YC2B 1CXFA 4PRIE 5TQ0L 3RDTA 5FKAB 4R96B 3WS6C 5I8KH 3VXSA 4MNHA 3VG0L 4OLVH 5LBSH 2YKLH 2I9LB 1E4KC 2MHAB 2N7AA 4OD2B 4LRNL 3D9AL 1NAMB 1RK0A 2DQDL 3O3BB 2P46B 3SJVA 5ILTH 3MLWL 2Y6SD 3HPJB 3IETB 3RHWK 1KTRL 3WV0A 3RAJH 3R06B 4WI7A 2GCYA 2OMBA 4HMCA 1HK6A 1T7XA 4JPVL 1CL7I 2I60L 3QUZD 1Q0YH 1NLBL 2UV3A 4TPRH 3K74B 4G9FA 3TA3C 5A3ID 3BIBX 2P8LB 3WFDL 2M2DA 1OTTC 2ZSVA 4J4PD 1K5NA 1KN4L 1P7QD 2IMMA 1WC7A 1A4KA 3FQRB 4RGMB 1BOGA 5DI8B 4M61A 3R4DA 4OGZA 4ODSH 2DYPD 4K23H 4OBRA 2CLVA 2ICWA 3G5VA 2GJ6B 1CG9B 4JZOB 2VSDA 4HFUL 2Z31C 4IEFB 4OCMC 3T2NH 3DBXB 2R9HC 2VLME 3C6LD 3L9RB 3VCLB 3RU8L 2YPLD 3HG1E 1X6NA 4PP1D 2VDNL 1JI1A 1YEFL 1QA9A 1NEZG 1SMAA 3QEHB 1LEKB 1MQKH 2BSTB 3PL6C 1CE6B 1NGPH 3DVGB 4IOIB 4LPWA 2HFGH 1HKFA 4PJ9A 1RZFL 5D7SH 3KXFE 1M05A 1S9KC 1HOCB 5JDJA 3LKPA 5ALBL 2WNGA 3KS0H 3VFOA 5IEKB 4H88L 4QCIA 2CUHA 1GOHA 1OF2A 3KLAB 4HWZA 4AL8H 4NC2B 3T2PA 4U2YA 5DD5H 3HCVA 1CFTA 2J3SA 3T0AA 1WIOA 2CK0H 4HWNA 3LKSA 1RZIA 4I0PB 4RFEB 1OP3K 3VXMB 1HNGA 4I77H 4MX7A 3FQUA 2LFGA 1K6QH 4NWUH 4K7FA 1AJ7H 1QR1A 3TEUA 1W0WB 3DETC 2FGWL 3UTZA 4GG6A 4FQ2H 4UNVA 5F7DA 43CAB 5F8RC 1MHPH 3C6LA 3BAEH 5KVFH 1C1EH 4OCRL 5DGQA 5CGMA 1CF8L 2MSPA 5BQ7A 1IC7H 2WSKA 2YPLA 5HVFB 2IANA 5SV4A 2GJZA 2NCMA 3G6DL 5E2WL 3AXLA 2ED8A 3W0WE 3WDHA 2HWZL 4L8CB 3ZKSD 3RZCD 1J1OH 1JNNH 3MA9H 3ARED 2NLJA 3U4AA 1ZLWH 4CJ1A 1G7JB 3TYFB 3DSFL 4OLXL 3K80A 5AUMA 4HW6A 2HP4A 4P4KB 1AR1D 2EYSA 5D8JL 1CXLA 3TYGH 4NBXB 1FCCA 2PYED 3DX7B 3K4AA 1D9KB 2X4SA 3CSPA 1D5IH 1NUFA 2BSRB 4Z7VB 2XQYG 3QUMH 4C4KT 2ZSWA 2LVCA 1MEXL 4PJDF 1JWUA 5D6CB 4IIQC 5EU3B 2CKBB 4WTXA 3L3GA 3C2AL 5FO9A 1KJ2B 2CIIA 2IGFL 3OX8A 1G9NL 1J8HE 2R15A 4UIKH 1FO0B 4NSKB 2UVFA 4KI1A 5C0BD 4WIQA 3TCXA 5ANME 4WUUB 1FZJB 1FHGA 5I18H 2BVEA 4JB9H 3QDJD 1S9YA 4BM7A 1MRDL 2A6DB 2UZXB 4XVUC 2Y07H 4EUPB 1J8HB 4XCYB 2PUQT 2E7LA 3FOMB 4MMZC 3Q48A 5ANMB 4CNIB 4PJ5D 2Q7YB 3RBGA 4JM2A 3BZEA 2PYEA 4H0IA 3CX5J 3KJ6L 1IE5A 4NC1C 4Z5RB 1B4RA 4WUKL 3P4OB 3MNZA 4I2XA 4KHTH 3EJYC 5TE7L 2OMNA 3SGEI 1KELL 4LPYA 3QIBC 2V9QA 2A6JA 5B3JE 4M9PA 1XZ0B 1RZ8A 2AJSH 1U8MA 4HPOH 3U79A 2BNUB 3VFUA 2Y7QB 1I4FA 4GBXC 3DX9B 4AMKL 3QFJA 4FFZH 3MV9E 5C0BA 2Z9TA 5BZWA 4N8PA 3MLPA 4QT5A 4N1EA 4PLJC 1ROWA 1AQDA 4Q9RL 3R0MA 1KTLB 3PWPD 4HC1H 5C0DA 1ETZB 1LEIB 1VFAA 2KQNA 1MIML 2D9QB 1I1YB 1JYXA 4P48A 4UMGA 4Z7NE 3H0TB 4JFQA 4LU5L 5DK0B 3PV6B 2VAAB 4M7ZB 2NZ9C 5DUBB 2H32A 1G9EA 2JK5A 5IM7B 1I7TB 4N0YH 2FR4A 5FDWB 1A9EB 5GQBA 1I1AB 3DVFA 5HGGS 5LGKA 4U1MA 3S35X 1BFOA 1IILE 4GAYA 4RNRA 4IM8A 2V7NA 2J6EA 4NPYB 3R1GH 1U36A 3UEZA 1G7QB 4NZUL 1HHIB 1URLA 2WLYA 1Q0XH 1K2DB 2R1WB 2CIKB 3A67L 4G8EB 4HDIB 2B2XH 3E6FB 4F7MB 1KSRA 4OD3L 4RGOH 3OMZA 4G43A 1U8NA 3GJEA 3TVMB 3BE1H 4N0CC 1S7SB 1KB9K 3JUZA 4X6CF 3SPVB 4EIZC 4U1SA 5EZIH 2EICA 5JORA 3PWPA 1F3DJ 3MNVA 1X3DA 3GHBL 1YPZF 1PZUB 1HKLL 5GZND 4O4YL 5FV2A 2IH1B 5I66B 1T1YA 2EDFA 4NKDB 5JNYA 1VADB 5JO5A 3MR9B 1DDHA 3MV8B 3BWUC 2BVOA 3LSOA 1G0XA 4QHKJ 3V8CA 5JUEH 4IDJH 2A9ML 1X7QB 3WNMA 5EORL 1HINL 4C54A 1UH2A 4C56E 2XQBH 1NCTA 1GC1L 4QRRD 1UM6H 5D6DA 4OF7A 2VXQL 1B88A 2WUCL 4OQTA 4FABL 4UUJB 5L2KE 4MHHI 2KZ1B 4HGWA 5D1XA 4H8WC 4WRLA 5GGSY 1GGCH 3MRIB 1A7RH 2XKSA 1CICC 4YHMH 5L88L 4P5TB 4D3CL 1PX4A 4DEPB 4WFFD 5FDYA 1O7VA 2NQCA 3S5LA 2KPNA 4C56B 3SQBA 3K1DA 1FP5A 2J6EH 4JDTL 3TA3D 4YBLB 3ILPB 4JANB 2DQCL 1ZGLA 2XZQL 3EO9L 2FJHB 3AS2A 3QEQE 4L4VB 3UYPA 2I26N 1OTTD 3I6KB 4BSWA 4P9ML 1FFOB 5D5MF 4PRHD 3WXWH 3GMOA 4JREB 5JR1H 3GMLA 4WW2C 2B1AL 1U58B 4JPKL 4Q2ZA 1LNUB 3RL2B 3PIQB 1HYSC 2GKIA 1J88A 1INDL 1NUNB 5IW1A 3RUGA 3ESUF 1DQDH 2VR9A 2Z31D 3ARFB 2ARJA 3HI6H 3PHOA 3CDGB 5T33H 3P0YL 2IAMD 3QEQB 3HE7B 4LKCA 3WS6A 4AK1A 2XWJA 4AIOA 1CT8B 1R3KB 3V7MA 3UZEA 1IGJA 4QRRA 3NZ8A 3SDDC 1KB5B 1E4KA 4JQXC 5JLZA 5J13C 2H9GB 1DBJL 3O4LA 5IESL 1HEZA 4G6KH 3G5YA 4XNQB 1C5CL 4RISL 3EFDH 2F53E 2VN4A 4XCFL 4K3GA 1CDIA 4LHUD 3PL6D 5C07D 4XI5C 3TIEA 2XY1A 1PY4A 5I1JL 1S7UA 5KANI 3TA3A 5KN5A 4LPTA 4HJJH 5E2JA 5L9DH 5SX5H 3EAKA 2J8UA 5IHLB 1CFSA 3HI1A 3PJSB 4HLZG 1QFWH 5FGRA 3SKOA 2HT4C 3FTGA 4CRPA 1NAKL 4DJMA 4YPGA 1AGCB 4GS7B 5EBGA 4JRYE 1CVRA 4PBWD 5TE6L 3MRLA 5IQ7L 1SEQL 4ZFGH 1MCSA 2RB8A 3ELAT 2Z31A 3DETD 1MSPA 4XVSL 5EU7E 3IAGC 3SOBL 4Y2OA 1BIIB 4WU5B 5IVNA 1RZKC 4KMLB 5IW6B 4MA7L 5E8DL 3UTPD 5MP6L 5CJ8A 3D39B 3GGWB 4YAQA 2EDXA 3CMOL 1MVUA 1IGCH 3L3KB 2WWKO 3NCJL 5D2LF 3W81A 1UB5A 2FO4A 4P59L 4G8IA 1U6AH 4G8FB 4DTGL 1D6EA 1EV2E 1JNLL 2F5BL 5C9JB 3ZKMD 4LHUA 3CLFL 3RWEB 5DFTA 3PL6A 3DRQB 4OTXL 1FZMA 4L9LB 2O61B 5C07A 1EEYA 2DJUA 5L8KB 3RWCA 4E5XB 4HQQL 3P11H 4F58H 1IKNC 3UTOA 4CN4A 5HTSA 4IOFC 4HKZA 3HNSH 3K7UA 1UJ3C 5DO2C 2CD0A 2R1XA 3N85L 1HXYA 5A2FA 5F88A 4YDVB 5GISH 4UIMB 4N1CA 3ZDZF 3HHRB 3X3FH 2FX8L 5BS0D 3QWOB 4ETYA 3IRZA 4OFIA 5C0CA 4X6FA 3O2WH 1A8JH 1UVQA 5FXCH 4I9WE 4F7PA 5MEND 3CSYA 2NXYC 1F6AA 1YMMA 2A6IB 4BQ6A 3UZQA 4NKOA 4NZTL 3QFDB 4XMKL 1BJMA 1J11A 4BZ2L 4IRJB 2KZWA 2DQIH 4HK3J 4OKVA 3GSRA 1OAXH 3I9GL 5MI0C 2AK4E 5D71L 3AMLA 4ETQA 5C0EB 4OZHA 1DQLH 3ULSA 4EKXA 1YC7A 1SVCP 2D31A 1MLCB 5A2IH 3DURA 5HPMB 3QIUC 2D7PA 5B38A 4QO1A 3LH2L 5I1EL 4Z9KB 3QZWA 5IHZA 2OTPA 1T04A 3EJYD 3MCG1 3IDYB 1K4CB 3FO9B 3TBVA 2P5EE 3FT4A 3QIBD 1OGAE 4IIQA 4LF3A 2AK4B 5DUML 5J0BA 3BD3A 5CJBA 4E42B 4ODUA 3R8BB 2R2CA 5BS0A 1WBYA 4PJHF 4RQQB 3N0PB 3ZE0F 4LPXA 1EFXD 1JV5A 3ULUC 4P2OC 4MB5A 1NBYB 2WZPD 3SKNB 1BQHG 5MENA 3HE6B 1U3JA 3QUYB 4WCYL 3JV6A 3HUJE 5DZLA 2V17H 4L8DB 4HUVA 5B21A 4PLJD 1CK0H 3H9YA 5HYJD 2QKIB 4F9PC 3LEYH 5IB3A 5ISZE 4M02A 1UM5H 3ZE1E 1A6AB 1WSST 1MWAB 4N90E 1QSFD 5F97E 3MQIA 5ALCL 1BLNA 3ARUA 2NZ9D 4OM0H 2E9WA 4MXVE 1DP0A 4OUUA 5DJCB 1T6VN 1LO3H 4YEFA 3WMSA 3VFSA 3DECA 2GW5A 3BHBA 3RTQC 4MCZB 3WKMH 3QRGL 3S5LG 2XXMB 2PTTA 3WE6B 2NW2B 4O00A 1A6UL 3ZE2E 1J0IA 1HH6B 3QIBA 3D48R 5T3XE 1GH7A 1IGYB 3DX8A 4CW1B 3S3PA 4HAGA 4RWYL 1T4KA 4GBXA 3BESR 5J1AA 4JFYB 4JPWL 4F57L 3O6FC 3EOBA 2YPVH 4ZFOB 3RNKB 1FFPA 4ERSL 2VZ1A 2JCCB 3MGTB 5FCUH 5GSRA 3O45A 2Q86A 3GMQB 4QYOB 2Z93B 1FLTX 3VXNA 3P0VL 4QHUA 1CD8A 1EHXA 4GKNB 3IDUA 1B0GA 1KLUB 1QSFA 5D7IE 1YN7B 4JFHD 2CLZA 1Z9SA 1QYGH 4CADA 4AJ0A 2DQEH 1HHKA 5DT1H 3TGXA 3H9SE 1R6VA 3EYUL 1JL8A 3B9KB 3BQUD 4Y4FD 5DHYA 1L7IL 3V7AE 3DJ9A 5DK2A 2R0ZH 1I75A 1E4JA 5HHMD 1KBGH 4NKMB 1FNGB 2XICA 4JO1L 1MRCL 3LEXA 1RIUL 3ARQA 1DQQA 4POZC 32C2B 2XACC 3E3QE 1U92A 5KZCD 3B83A 2OI9B 3G08A 3CD4A 3PDDA 4MNGE 1UGNA 2VR4A 3HZYA 4RBPH 4YE4H 4HIIB 1IKFH 3GIVB 1T22B 5IV2B 3UTTB 2NR6C 3GM0A 4OCYH 3NPSB 1AC6A 1FZKA 5EA0L 1I3RA 1AGFA 3C60C 4PJFB 2WUBL 2CO6B 4P2RD 4Y19E 3U6RA 4I8DA 4TVPD 2DLEA 5J06A 3T3PE 3DYMA 4UT9H 4MNGB 2NY6B 4PG2C 1HYSD 2Y5EA 5DMKB 3TZVC 1ZGLM 4NOBA 3PP3K 3CFJA 5IKCA 4BZ1L 2NY7L 3IS1X 4PJDA 5KAQF 5DFVC 1G9MH 4LHUG 4HS8H 4OQ1A 4NKIH 3R8QA 3VXOB 4PRDB 4OAWB 1JUFB 2I9TA 2IADB 4Q0XL 3KPOA 4D8PB 1NC2D 4Y19B 1LDPH 3SDDD 4JFZH 5D1QC 1QFUH 1ZT1A 2D7MA 5GSVA 3VXSE 2DLHA 2D7TL 3VXTB 3HLAB 3UX9B 1CICA 3JBG7 3RWIB 1ZLWK 3RWGB 3SJVE 3VI4F 4EN3B 2NW3A 4F3FA 1BJ1J 4U6YB 4XP4H 3BIKA 5E8NB 5F7WC 5KVEH 3D0VA 3SDYH 1C5BL 5CMAB 3F7PC 2XV6B 1ONQA 1KEMH 2Y23A 1EO8L 4UT7H 3PQYA 2B1HL 4LDLB 1N8ZA 5BRZD 4MNHB 4OLZH 2DRUA 4G9FE 5JOEA 5GRJL 4P2RA 2HRPH 4EI5D 4OZIA 1JF1B 2OQJB 4JY6B 3LEVH 1YY8B 4WW2A 1NGQH 5EUKB 5IK3A 5GRXG 5I9QC 2X4OA 1N64L 3ZKNC 4Y5YC 3H9ZA 1T1XB 4NO5A 4HV8B 2R0WL 3V4PL 2ITDA 4QRPD 3BMVA 1T7WA 4E41D 4G9FB 1NC2A 5F9WC 5KSVA 4F37K 3SDDA 4JVWA 5EBWA 3UPRA 3M1BA 1TNNA 4JQXA 1K3ZA 2ZSVB 3ARDC 3BEWA 4ZO6A 2XZAH 3MFGB 1BOGB 1KJMA 3IF1A 2C7UA 5HJ3A 1YEEH 4QXTA 2AJYL 4LAQH 3C6SA 5IF0B 3P9MB 4JFXB 3O41A 2P43B 1I7RB 3DGGA 1AD9A 2DM3A 1FLRH 2EIZB 4IOFD 4U1JB 2BRRL 2AV7B 1IQDA 2V5TA 4P3CL 1JE6A 4TSAH 2R0KL 4TOYL 3LN4A 2N7BA 2X9YA 5IMLB 8CGTA 3FQTB 5IEHA 3WNPA 3BP5A 3QUMB 2DBLL 2NXYD 3QUZB 3TPKA 4QRPA 4XNXL 4FFVC 4MAYC 4E41A 1M71B 4LIQH 2X4QB 5IFAH 1B2WH 1XF4B 4GG6E 5F7LB 3VFOB 5FB8B 3EO1A 1OF2B 4R7DA 3BN9C 2ZUUA 1P7QB 3LB6C 4X7DC 5B8CB 1QVOA 4PTTB 2YPLE 2IANE 1A6VL 2DYPB 2GK0B 1XGRA 2C5DC 4TTDC 2ICEB 1KGCE 3SE8H 1M7DA 1IGTB 3QCVH 2GSGA 3QIUD 1QLRA 1MPAH 2HVJA 4RGND 1IKNA 3QYCA 2G75A 3OTTA 1CXKA 5I16A 4YHYB 1UJ3A 1NGXA 1FRGH 3CFBB 3BP6A 1XAUA 2DLIA 1OAUL 5DR5L 1TPXB 5BQ7B 1U95A 2GJZB 2YSSB 4FZEH 5I1LA 1F4XL 4HCRL 5KTEH 4GSDL 4FG6C 4ONFH 3FFDA 5J6GB 4P2OD 3V0WH 2VLKB 4G8GD 5EC1B 4J8RA 5EN2A 5HHQA 2EYSB 4U7SA 4M6MH 1KF9B 1OY3B 3WCYA 3P3YA 3CDYA 2OM5A 3TIDA 4Z78A 4CVXA 5F3BA 5FYJD 1CLZH 4LVEA 3BX7C 3JV4B 2DIAA 1JZ4A 4S1QL 2VE6A 3FOLB 4MDIA 4GXVH 4XNYL 4BKLA 1FO0L 4IJ3B 5DD1H 3NCBB 4YIQA 3QIUA 5D5MA 3DROB 4JFFA 3RFZC 2JJTC 5F9DC 4M1DH 1QRND 5INCA 1TVHB 1FZOA 3RIFF 1WK0A 3RTQD 3CU1A 2PYEE 3TJEH 4KVNH 4I2XE 4GAJH 3M45A 5IMMA 1YYLH 3WFCL 5GRUL 1DN0A 4M6OH 4KGJA 1SM3L 3I85A 5F93C 3RZCB 3AREB 3VD4A 2YPKA 2VDLH 4P2OA 5GGVH 4FQLH 4G8GA 5DD6B 2LAAA 3O6FD 1VGEH 4UBDC 3OB8A 5IHBA 4P3DA 4M5ZL 3BZEB 2PYEB 3QFJE 1MHHA 2P47B 4X98A 4PJCA 5C0BE 5JW4M 4EI6A 4LCIH 4F9PA 1XGPA 2EDDA 4QXUL 5HYEA 1TZIA 3MRCA 5FK9A 3P40A 4JHAH 4PB0H 3UJTL 5DUPL 3WJJC 3WNKA 3H42L 5I76B 3FCTB 1I4FB 4P2YA 3CH1B 5GJTH 1L0YA 3V5HA 1MCKA 1JZ3A 5KG9A 4KGLA 3RJDA 1QRNA 1Z9MA 2DI7A 4PJ5E 3RTQA 2FYYB 5D1ZC 4ZS7L 1X5HA 4N0UB 3T4AA 5HI3D 2W0PA 4K94L 3QDJB 4HUUA 4NM4H 4TULH 1VFAB 3MJ9A 1M4KA 5HI5C 3QH3B 4NC0B 1N6UA 3OKKA 5L6YL 1MRFL 4Y4KC 3HI5H 3GKZA 1EPFA 1T0PB 3CC5B 3AB0B 4OZ4B 1NH6A 3HRZA 3O6FA 2H32B 3PHSA 4M03A 2JK5B 5CSZB 1XGTA 4PJ5B 2HFTA 2PF6A 4OLEA 1HH9A 2OK0H 4XZUA 2AJ3A 4L8SC 1KCUL 4YBQC 3RVTC 5EZLA 5J12B 4OGAC 3S37X 4JQVC 3S4SB 1BQUA 1UWGH 3C60D 2J5LC 5SX5K 4GAYB 1IGIH 5EOQL 2FIKA 1HDMA 2EDWA 3QXDA 3PWPE 5F6IC 5CJOL 1WFUA 2VB5A 4JFDA 4JKKA 1KCVL 4KKLD 3L3IA 1CQKA 3PDOB 3G9AB 4O2CA 3TZVD 4Z6AT 2COQA 4XP5L 5LXGH 2X1OA 1T03H 2R56L 1I3GH 1JNHB 2OL3L 3VH8A 2V5SA 5AAMA 1EJOH 5DFVD 3GJEB 2ICWI 4OM1L 4WHCA 1T2XA 3OR7A 5EU6D 1T0MA 1A14L 1G7PA 2BC4A 4DKEH 4U1SB 4XWGL 5F7HA 3MNVB 5D1QD 1YA5A 3S37L 2FLRT 1LDSA 5DJ2B 3C08L 1H3XA 3VGBA 2ADJA 1T1YB 1BQHB 4XRCB 5JNYB 3MLSL 1DDHB 4NN7B 4WI3A 2VQ1A 1Q1JH 3LQZA 4YHKH 4X7TB 3ARTA 2MJWA 1FV1B 4BH7B 3GJFA 3TNNB 4N0FB 1F97A 2OSLA 4R3SA 3C60A 3VW3H 4PJBA 2RIKA 5ESQB 3VRLF 3IU4H 1S9XA 2QEJA 4HGWB 3QUXB 4OCLC 3FONA 1H5BC 5E00A 3I75A 4FQXB 4PG2A 3TZVA 5HHVL 3MRPA 4MD4B 3S36X 3EBAA 3OJMB 5C0RL 4D9RD 3O6KH 3KYKL 1ZMYA 1EVTC 5EU6A 4W4NA 1WBXB 3RUGE 4PJXA 1IAMA 4G6JH 1CIUA 4NNPH 1KIPB 1LP9B 3BKMH 4KJQD 5D1QA 5JIPA 4WI4A 3VFWB 1YEHH 3TF7C 2W65B 4QRRE 1JWSB 2EDBA 1H8OA 3SDXB 1RZ7L 4MLIA 3O4LE 4HWBA 1BZ9A 1OD7A 2QR0B 1FNSH 3B9EA 1PQZB 2YC1B 3KR3H 4L1DA 7CGTA 5CIPA 1UYWH 4YDKL 4V1DB 3C2SA 4K8RC 3EDJA 4DW2L 4ZS6C 4YXHL 2A9NL 3LZFL 3S36L 4IMLB 4WFFE 3ALWA 1JHKH 3AM8C 3HB3C 2XWJB 5D93B 3MLXH 1KB5L 2IQ9H 1QBBA 1IGJB 4R90H 3NZ8B 3GSXB 4X9FA 2ORBL 2P8PB 3MCLL 3O11A 2J8UE 2NY5L 4TYUA 1C7SA 4MDJA 1N5AB 5IVXF 2W9LA 4N9GA 2AXJA 4Y5YA 1I9JL 4HIXH 3K8MA 3U0PA 5KVDH 5D9SB 3TIEB 1SBBA 3FQWA 7FABH 4FFVD 4MAYD 1FC2D 3BKYH 1YNKH 2JE8A 1DBBL 2XZCH 5E94A 2EH8H 5ELIA 2VABA 3ARDA 1GGUA 2J8UB 4Y2DD 4WY7L 4JFPA 4YHOL 1Q9OA 2H26B 3LB6D 4PRHB 1LD9B 1JPGA 4MJ6B 4AM0B 3CZFA 3SDCC 3NAAH 3BT2L 1JIBA 1E4XH 1FORL 3DNKA 4QHMA 3DUUB 2D3VA 2X70B 2YEZA 1SYSA 4HUWB 2IAMB 1LO0H 5DJ0A 3CFKA 5F6HJ 4GAGL 5C07E 1MCJA 1XMWA 5EIVA 5CD5D 3VA2C 3S34L 2BY1A 1HHJB 3CCHA 3MSPA 1JTPA 1S9WA 5K9JL 4ONGL 4NQVA 2FJGB 2Y36L 2DOCA 4AG4L 2R4SL 3PHQB 1A1MB 1BBDH 1HXMA 4LP4A 1D6EB 3KWWA 4POUB 3N1QC 1G6RA 1B9ZA 3EYQC 5J9PA 2J4WL 2X9WA 5GGSA 5C0CE 4HPYL 4K55A 4X0KB 4MAYA 3H3PH 5FYKE 1T0NA 1DBML 1SJXA 1R3IH 3FN9A 3D6GA 1YMME 2H45A 2P48B 2AAVA 1VFOA 4NGHL 3UTPE 3ZTJH 3UYOD 2R1XB 2DDQL 1P9MC 1PG7H 5F88B 3OR6A 3MCKA 2VL5A 5J7CC 2HYMA 3P9WB 4G6FD 2JJWA 1EMTH 4OCSL 1AHWB 4GO6B 3NCYS 4X6FB 2UY7A 3UP1A 2IQAA 4F7PB 3LRGA 2GTWA 5JW5A 3CSYB 3GSWA 2AW2A 3LV3B 1GGIH 2FEEL 4OZHE 1WZKA 5EU4B 2UZIL 3LN5A 4RMVA 4YDIH 4NBYB 2NY4C 2GT9B 1G7IB 3TWCL 5DSCB 2CMRL 4OF0A 4PJIA 1IAKB 4APQC 1HI6A 4K71C 4PRPB 4HF5H 1ZLSL 4PJ8B 1ITCA 1IEBB 1BJ1H 4S1RL 2IPKA 1YNTB 4L5FL 5DRXB 5CEZH 2BDNH 1RUPH 3SO5A 2ITCA 4UBDD 3GK8L 5F7EL 4OZGF 1OP5H 1IEHA 4X9IA 1GGBL 1WWWX 4RBPK 5BS0E 4YX2L 4Z0BL 3DURB 1NC4D 5MENE 4RFNC 3VH8G 3FL7A 5IHZB 1ORSA 1I7ZB 3ECBA 3TBVB 1XF3A 2QQKH 2YD9A 4KPHL 1ADQH 4IIQB 3UMTA 4NO3A 4JQIH 3O2VH 1HNFA 1C12B 3C5JB 1WWAX 3ULVF 1FYTB 1WBYB 3FRUA 3TN0B 3L95B 1JV5B 2O5YL 4MA8H 3ZL4L 5MENB 2JJTA 5DRNB 3JV6B 3ILQC 1KIQA 1INQA 4HUVB 3NCYP 3O8XD 4GRLD 1OAYH 4NC1E 4LHJB 1BM3H 3MLRL 1P4BH 3BYYA 1MWAL 3I3DA 1FGVH 5HI5D 2VSCA 2XZZA 1U8IA 5BXFA 1SY6A 3MROA 4XPBH 4A6YA 1U8HB 3JTTB 4Y4KD 5DTFB 15C8L 1AO7B 1PLGH 3NCEB 1FIGL 4NKQB 3CX5K 4LLMB 4LVOB 1YEDB 1W72A 1BQLL 4WHTB 1IL1A 2AEIT 4R0LC 3LAFA 5JQ6L 4AZ8A 4LCWD 3WS3A 2FO1A 1JRHL 4YBQD 5C09A 5FF6A 3RL1B 2YD6A 4KV5F 1ZWIB 3PV7A 1FIEA 3QIBB 1FVCA 5I17A 1HHGA 2A1WH 3N1MC 3WJJA 3KHQA 3FB6B 2AK1H 1EUTA 5E2VH 2JB5L 5E7FA 2D0FA 1BD2D 2EXYC 4NNYA 4L29B 1EFXB 5I1AA 1QSFE 4ZFOL 2ESVA 4JY5H 2OTUA 3EOBB 1BFVL 3ARVA 4DFIA 5BZDA 43C9A 3RIAK 3QULA 5HDBE 4GMTL 3RVVC 6CGTA 1DSFL 1FVEA 5D1ZA 5H2BB 1IZJA 2F58L 5EIIB 1QG3A 5HYJB 3S3JA 3SE9H 1OVZA 1HZHH 1R0AL 2HKFL 2VITA 3B9DA 4OIAA 5I1HL 2X5PA 1QSFB 4Y4KA 1WUNT 5FHBL 2M26A 1AGEA 2C3VB 3NIFE 3KLHC 3E6HB 4FXKB 3L5WA 3ZTJG 5I1CL 2F74B 4L8SA 4LCWA 3MODH 4JGJA 1OB1B 5I1IH 2DI9A 1E4WL 2OBGA 4JQVA 3FRPA 1NUDA 5CILL 4P23A 3C9NA 5I8KL 2B4CH 5JIHA 4YO0A 1QRKA 1WTGT 1FVDB 4OLVL 5LBSL 2YKLL 3BI9X 1QOKA 2NY0C 2VUYA 3D85B 3QXWA 4S11A 1BD2A 3OKDA 2D7OA 3BW9B 3VGHA 4PR5B 1BVLB 3WSQH 4JFHE 3BH8A 5ILTL 3VI3E 1N3NB 3HZYB 4Y16C 5JZ7D 1ZTXH 2PYFB 3RAJL 4C58B 5GS1C 1KXTB 3JTSB 4PJDE 2QSCH 4DUWA 5MEQB 1MELA 2ZJSH 3GMNB 4XWOC 1FZKB 3T04D 1Q0YL 4NT6A 3D87B 2HJFB 5GZOD 3QJFA 4F9LC 2IBGA 1LO5B 1ZSDA 4QOKD 3MUHL 5HHME 4BSVA 5HVHC 2HVKA 4Y89A 3JV5A 1T21B 5L8JB 1GOFA 3CFJB 4ODSL 3P9LB 4K8RD 3BQUB 1FSKB 4ZS6D 5IKCB 1KOAA 2R2EA 4PJDB 4Y4FB 3IRPX 2Y25A 2PKDA 4JFEA 2F54A 1NKOA 1JMXA 3HB3D 3KPOB 2I5YH 1SVZA 2P24A 2MCPH 5C8JB 3G6AA 3WDJA 5E2UH 3PQYE 3AU1A 1G7MB 4X4YB 1H5BA 3VXRA 4Z76A 3PGDB 5JIKA 1OARH 4P2RE 5I0DA 4TVPE 4OZIE 3OKYA 3GUTA 5KZCB 5HYFA 3CDCA 3STLA 4F7TA 3WNOA 4MA1C 1MQKL 3D0VB 1JMZA 5K9KB 5HGDA 4X9HA 3GSNH 1NGPL 1RJYB 2HFGL 3SY0A 5D7SL 5M95B 3RWJB 4P2RB 5L8LB 3O2DA 1VEPA 4PGCB 2G5BA 1CIDA 1XH3A 4LLVA 3ZSTA 4AL8L 3S88L 3UTQA 3Q3GA 1WZ1H 4Q58C 5DD5L 5KAQG 3VFPB 4R8WH 2QQNH 1X4XA 3MLTA 2D4FA 2CK0L 4WJ5A 1RUKL 3FQNA 4KJYA 3ZHLA 4I77L 4ZNEA 1RJCA 4YGVA 1K6QL 2ITDB 3ME0A 4NWUL 4YZFE 3AM8A 5H37H 1XGUA 1NC2B 5FYLL 1U3HD 3SHSA 3SDDB 1R5WA 5C0ND 3VGFA 3L1OH 5J13B 1BAFH 1MHPL 3BAEL 2Z8SA 5KVFL 3IF1B 3LPGA 1IC7L 5ID1B 5HJ3B 1UXSA 2HG5A 3BRDA 5F21B 3MBXH 4I18C 1I9IL 1KCSH 5F1SA 3D2UD 1GL4B 5DMJB 3EYQD 1F3JA 2DICA 3DTXA 1CD1A 4OLYH 4JLRB 1J1OL 1JNNL 3JV0A 3MA9L 1PKOA 4QHLA 3UYRH 2ADIB 4N5ED 3FN0H 3WFHA 4DQOH 1AD9B 4GUPA 3ROOA 4QRPE 2PETA 3TYGL 5BRZB 4E41E 1BMGA 5FO7B 4TQEH 2M1KA 4CUCA 1BWWA 4EI5B 1D5IL 2XPGB 3RGVC 4LHQB 5DRZA 3LN4B 4PV9A 3SDCA 3DV6A 3IU3A 5DZNA 3QUML 5IEHB 1RVFH 3T0WA 3HZKB 1GZQA 2C3HA 4NNXA 1DUZB 2APVA 4QRPB 2CPCA 1A3LH 2F8VA 4BQBA 4P46D 4R7DB 3KDMA 5I18L 1KG0A 4APQD 5DVLA 1JNJA 4JB9L 2XTJC 4JR9H 3QSKB 1QBMH 1LGVA 4XNMA 4DGVH 3NFNB 4X6CB 5J56B 2ZG1A 2Y07L 1M7DB 1OSZA 3VMPA 2Z92A 4LEOA 3OKLA 3GSUA 1FAKT 1QLRB 1YPZB 2WP3T 4CMMB 2YS4A 2VQTA 4YR6B 5I16B 4LSUH 2IH3B 1WCBB 1NDMB 2NTFA 3L3DA 1P9MA 3RZWA 4KHTL 5AZ2H 1FG2B 1PVHA 5HHNA 2JIXD 3UJJH 2ILLA 4NUJB 1AGBA 4QLRA 4KMTH 3F7YB 5FYJU 4I1NB 1S8DA 3FFDB 1IAIM 4AIXA 5LGJA 3MRMA 1GIGH 2AJSL 3CPLB 4HPOL 4J8RB 2NXYB 4KU1A 3VWKD 5EN2B 2ATPA 3ILQD 3IKCA 1S7VA 1CQYA 1G6RL 4YGAB 3D25A 4FFZL 4A2LA 5D5ME 4LCYB 2IWGA 4JFFE 4P5KA 4S0SD 3TBTB 3TIDB 4APQA 1CLYH 3FRPG 4XVJH 4HC1L 1U93B 3T0XA 1QFOA 5K9QG 1JZ6A 4MDIB 3LOWA 1FFNA 2GSIA 1UWEH 4YIQB 3QIUB 5D5MB 4RA0C 3FB7B 4MMXC 3D3VD 3QIWC 4MA3B 3T65B 3FT2A 5ICZA 5M94B 4RGNB 3OXRA 4G8GE 4OIBA 4K9EC 4LSDA 2BNQD 1ZA3B 4N0YL 3OGOE 1SJHA 4PJCE 4Z7NF 3RQ3A 5IMMB 3MOBH 2MTPA 4YDLC 2JIXA 1XCTB 5JTWA 5FYJE 5H37G 1XF5A 2EXYD 5TDNA 2YPKB 5MERA 5FO8B 5CHNA 3IFPA 3R1GL 4P2OB 4F8QA 1IT9H 2XWTB 3AROA 3IDMA 4G8GB 1ZVHA 5E8EA 4P3DB 3BGFB 5IMKA 5EPMA 4XHJC 3RVVD 1QO3B 5F9OH 2B2XL 4RMSA 5IHUH 1JGDA 2BCKA 3F8UB 4X98B 3CVHA 4EI6B 3FB8A 1HQ4A 4WV1B 5HGHB 1QRNE 2EE2A 4NQEA 3ZYOA 1DQJB 1TZIB 1DCLA 3BE1L 5IUSA 5FK9B 2AJZA 5EZIL 3ETBF 1OT1A 1F02I 3KPNA 4PYHA 5EOCJ 2QADC 1CE1H 1ES0B 2X4TA 5EO1B 4JN1L 4L4TD 3H9HA 5D96C 3WIHH 2N1KA 4R0LA 3M07A 2R4RH 3IDJB 1XGQA 4MZ3A 4EVNA 1QRNB 5BV7C 3RTQB 5DEFA 4PLNC 3QO0A 2BNQA 2Y5TB 5ENWB 2CDFA 2JF1A 3RPKA 5JUEL 3T4AB 3RPIA 4KHXH 4X6BB 2XWBB 4HUUB 2MMXA 1NCBH 1II4E 4DGYH 3I3BA 3U36B 4U7MA 1G7LA 3OG4B 1VFBA 5KJRH 2XQBL 1UM6L 4LASH 1JPSL 1JPFA 5TJWK 2NY0D 4AQOA 3QJHA 3U9UA 4JFDE 1SY6L 2NNAA 2DQGH 4G7VH 3O6FB 1A7RL 4AEFA 4M93C 4Y16D 3T1FB 5HHPA 1XGTB 4HH9A 1QFWM 1HH9B 3PGFL 4YHML 3ZYZA 3CNKA 5IG7A 3VFRA 1U3ZA 5D2LB 1ZEAH 3QI9C 4XWOD 5F89A 3K4DA 4DZBA 1S7WB 1X5FA 3ZDZE 1A6WH 2FIKB 5JA9A 5F3HA 3QXDB 4FQQA 3FT3B 3EOYG 5EO0A 1CI5A 1B90A 1RUMH 3QT2A 1XCQA 4QRTB 5IVZB 3WXWL 4NQDB 1Z5LB 4L4TA 2C9AA 3QQ9C 5JR1L 1LVEA 4R4FH 3MPCA 2PTUA 3EJJX 3JWDH 4LEXH 4NHCH 2FWOB 4PJEA 1J05B 2X4RA 3MACH 1DQDL 3HI6L 3ULVD 5T33L 2H8PB 5E6ID 5BCAA 4K3EH 4CMHC 4YUEH 2XG4A 1A3QA 4PJBE 3BUYB 5E0QA 5DRWA 5EFIB 2VIRA 3FO0H 3L6FA 5IWLC 2ADJB 4G5ZL 4G6KL 3EFDL 3UDWC 1A0QH 5C08A 1CL7H 5F8QC 4Y16A 3VD3A 5EBMA 5GS1A 5FV1L 5FYLE 3IDGA 5B4MC 1AGDA 1A7NL 2OSLB 4R3SB 5EU6E 2H3NB 2DQUH 4F9LA 5HYQA 4DKAA 3BRGC 4MVBC 4OZGA 4PJXE 3HZVB 4HJJL 1JBJA 5EU5B 4X4MA 2QSQA 4WWID 3ARSA 4P2QD 3RY6C 1QFWL 4L3CB 2OS7A 5D2NB 5ESAA 3HMWH 3MRPB 3VD7A 2J88H 4HS6B 2MKLC 3MV7D 4ZFGL 5EU6B 5DJXA 3U46B 4PJHB 2NXZC 2V2XA 2HLAA 3C8DA 5FECB 4MSWB 5ITFA 1UACH 5K9OB 2HKHH 2NZIA 1B0RA 2PR4H 5CCKH 3CGTA 3WHXA 1VKXB 1YUHA 1PAMA 3O9WD 4NUGH 1NBVL 3KG5A 2FECI 5TDPB 1IGCL 2AJVL 4HAFA 5FA4A 1OP5K 4FXGA 5IQ9A 4ZDHB 1U6AL 2VLJD 4JN2A 1KIUA 4JRXD 2VH5H 4LCCC 12E8H 4I3GA 4D9RE 1DLHB 1LHZA 1M7IA 2GFBB 1NBZA 3PDGA 5J3HD 1ITBB 2ZPKH 3VG9B 3P11L 3REWB 4F58L 4QRQA 5DEGB 2YRZA 3HNSL 3PF2A 4UT6H 5CLTA 1LMKA 5GISL 1CDCA 1MJ8H 5DLMH 4N9GB 3B8SA 5GGQH 2VYRE 1GJIA 1YYMH 1HHHA 1VB9A 2Z91B 4C57C 3O2WL 4DCQA 3G04B 1BP3B 2E5EA 1DN2A 1CU4H 5ERWA 2XFXA 2EE6A 2XTJD 2Q7NA 4MWFA 4OCWH 4PRAB 1VHPA 1CFNA 4YXLH 3PG2A 4I18A 5DHVH 1SJEB 2EE3A 3GFUA 4X5WB 3ULVH 1X5KA 5ACZA 2VLJA 4XPAH 1ED3B 5KS9F 1SYSB 1DQLL 4JRXA 5DJ0B 1EEQA 1F4WH 2VISB 3H8NA 2Y1VA 4LRIC 3S8WA 5IJVB 4ONOA 3HS0B 2EDNA 2FX9H 4JZJC 3RGVA 4NQVB 1NCUA 4MQXC 4J1UA 1OCWH 4JFOA 4IS6A 1MCWW 1ZLVH 1IQWH 2BOBA 6FABL 1QPXA 5T1KD 1CFQA 1L0QA 2L4OA 4XMLH 3TBYA 3QQ3A 2VUOA 4GMSH 2CO7B 1U8LA 1GRWA 5BW7C 5IIEB 4XNUH 5E4EC 2V17L 4ZAKC 4GJTB 4Y2DB 3NGBB 4P4RB 3ZDYF 3SKUD 3GRWH 3DXAA 1OSPL 2VL5B 5JDSA 3K2UL 1T2JA 4MCYA 2HLFD 3LEYL 4PJIE 5TGBA 1U8QA 5C1MB 1UM5L 1X5IA 3HUJF 4TUOA 5TFSL 2IQAB 2GTWB 1J8KA 4KXZH 3QIWD 3WXVH 3GSWB 3SQOH 4NO0D 4OM0L 3RVWC 3QQ4B 3T77A 3LN5B 2ZOKA 4AIZA 1LO3L 3MRDA 5MEOA 1H3WM 1ZVYA 5A2LH 3ZE1F 3MXVH 5CD3A 4GLRI 2E9IA 5EDXA 1QTYT 1MAMH 3IDIA 4EQ3A 4NYLA 5ADOL 2BJMH 4QY8B 3GNML 5E1AA 3ZYJA 1MFEH 4NQSA 4MXVF 1AC0A 3SBWC 2IPKB 3QUKA 4Z95H 2W9DL 1S7XB 3KPPB 5T1KA 2ITCB 4RZCB 5GGRA 3OKEB 3RY5A 5ESVB 2ZNWA 1EGJA 5HI4C 1DL7H 3PE9A 2GITB 4KTEH 1ORSB 2RR3A 2YPVL 5C7XH 3ECBB 4MGXA 3UXFA 1FL6B 1Y6MR 5FCUL 5ETUA 4U3CA 2R2HA 3S6CA 4BSJA 8FABA 1W0YT 1S5IH 1S7QA 2QADD 4NRZB 2BSSB 1NAMH 3K3QA 3FRUB 1MCPL 5CJQL 3GSOB 3EFFB 2X09A 3W0WD 1QYGL 1FBIH 4TNVK 3I84A 3QIWA 4ZUVA 1KIQB 2DQEL 4NO0A 1DE4A 1G9NC 3STZA 1V7MH 1WLHA 4TSBH 2NY3B 3IJYA 1NMCB 5D7IF 3MMEA 1N59A 5BXFB 1KXQE 4Y4HC 5IB4A 1TCRA 3P30H 1KBGL 1SBSH 5KSUB 2EDRA 2V7HB 3F6IA 2HMID 2Z35B 1W72B 1IGMH 4TUKH 3BWAB 1IL1B 1NC4B 2ESVE 4X5XA 3DMMC 1OPGH 3WFBH 3TO2B 3U48A 2UWEA 4YE4L 1IZKA 3UBXG 3PWVB 2V5MA 3J8F7 3DX6A 1MCLA 3O3DB 1FGNL 5ACLA 1E4XI 3KYMA 3WD5H 4RSVA 3OJ2C 3VFGH 5LAXA 1BOYA 4FTVD 5I1GH 3QXVA 4I13B 3KPSD 1CZ8H 4XHQA 5BZDB 2WW8A 1JYWA 3PNWB 3EYVA 1MLBB 4KK9C 4LVNC 4NHUA 5K33A 2O93L 1EX0A 2EE9A 3IGAB 5IR1A 5AD0B 4LCWE 5F9JB 1OAZH 3NIGF 3O8XB 4GRLB 1QBLH 1G9ML 4HS8L 4NKIL 5JHLH 3X12A 5T3ZD 2FATH 1X5AA 1YN6A 3UAJC 2W0FA 1JF6A 1LDPL 4JFZL 2OZ4H 3U4BH 4Y4KB 1QFUL 5C0GA 4UV7H 3QO1A 4GG8A 2EKSB 2XNAB 1Z0MA 1AD0A 1BD2E 3VA6A 4RRPG 3BPNC 1P84J 3OKMB 4TVSa 4D0BB 5B4MD 1WBZB 3GSVA 1YDPB 3QI9A 4D0CA 3MV9D 3RIFK 2J5LB 4RMQA 5F9AC 3SDYL 1BZ7A 4MVBD 5H8DA 1KEML 1QSED 4NWTL 1TVDA 4NN5C 4RAUA 1T1WB 1MAKA 1XR9B 1ZS8A 4OLZL 3GSNB 4OUOA 1DBKH 2HRPL 2AV1A 1AXSB 5GHWH 4J12A 3LRHA 1HSBB 3LEVL 1GPOH 1WCQA 4HZLB 4FTVA 3UTSA 3LPWA 3ALPA 3KPSA 4XGZB 1NGQL 5FOJA 2ZOLA 5I2IB 4ODHL 1OLZA 3HN3A 3OHXA 1MF2H 1AP2A 5JPNA 2NXZD 4AEEA 5FKPB 2APFA 4JFEE 2F54E 5EC2A 5JHDD 2AXGB 1ZSDB 2UYLA 1ZHNA 4X99B 4HGKC 3I3EA 2BK8A 4F7EA 5SWQA 5I73C 5IWLA 3O6LL 2XZAL 3UDWA 3VXRE 2CKBH 4R26H 1EVUA 2DWEA 1LE9B 1YEEL 3JVGC 4LAQL 4Z7WA 5SWZA 5I6XB 3IXTA 4BYHA 4OB5H 3U2SA 3RWDB 1H15B 2YXMA 4Z0XB 5IGXL 1J1XH 4TUJA 2I07B 3CX2A 4U1NA 1QSEA 4NOFA 4E0RA 1K8IA 3RP1A 4XP9H 4D94A 4Z76B 1GC1C 4NQCA 5GGTA 3RY6A 5FHAH 5HYSG 4TSAL 2YZ1A 3Q1SH 4EUPH 3GUTB 1P2CA 4EDXA 5DJZB 1KTDA 5IBTL 3MFFA 1NSNL 2R1YB 1AXIB 3VWJC 4F7TB 2BSED 2WIIA 3GB7B 4ZNEE 5I19H 2N56A 4X80H 3AS1A 5JHDA 1I8MA 5EOCH 2EXWC 1UH3A 4LIQL 2AQ1A 5IFAL 1B2WL 3LY6A 5HHOA 4QOKB 3NFPA 1TJGH 4XBGA 5L2JA 3Q3GB 4U05A 5L2KD 4X4ZA 3WO4B 1YMHA 4G3YH 3QXTA 3T0EC 5DXWA 1NFDA 3C5SA 4PRBA 3RRQA 3KS0J 4KJYB 4YGVB 4GG6F 2PNDA 4ZXBC 4LCCA 3QCVL 3SKMB 1XGUB 1U91B 2Q20A 1R5WB 1MPAL 2YRPA 1CGUA 2JKXA 1OL0A 3OXSA 5TE4H 3BZFB 4MQXD 1J10A 2MQ3A 1FRGL 3O3EA 4N1HB 1PW3A 4C55A 3VGAC 1I8KB 1UXSB 4W81A 5EBLA 3QAZC 3BPLB 1ZA6A 3WYRA 1RHFA 4XXDB 4JO2H 5FM4A 1OP9A 4Q74A 1Q8MA 4ONFL 3TCLB 3EOTH 4HS3B 3V0WL 2BVYA 1ZHKB 3ARGC 2EDTA 1T20A 2BY3A 3MUZ1 2ICWJ 2Y72A 1Q9LA 2P8MB 3ROOB 1B4JH 1A47A 3I50H 4M6ML 4WDIA 5MHSD 4PGEA 1S9VA 1JK8A 3QNZB 2ZUXA 5D4QA 5TH2A 4D9LL 4MJIA 5JXAH 4P9HH 5DRZB 3NA9L 2EH7H 3B6SA 1NLDH 1UZ8A 1UCBH 3UO1H 4ZNCD 4NRYB 2VKXA 4LSRH 4Z77B 1GZQB 1NGZA 5ICYA 1HE7A 4LLDA 1RZJC 2F53D 2DIBA 4UDTB 4GXVL 3FAWA 4Z7OF 4JO3L 5DD1L 5GRVK 4JKMA 4LDEB 4LRIA 1EA9C 1FN4A 1U3HB 4Q6IC 4JZJA 5FOBA 1ORQA 2J2ZA 1JWMB 1OLLA 3TJEL 4KVNL 1OWRM 3VE0B 2H1PL 3GZKA 4MNQD 5D7JC 3TBWA 4XNMB 4YFDB 3D2UB 2FD6H 4M6OL 3CFCH 3FZUD 2WBJC 3NCCB 4JRYD 4Q7DA 4UTAL 2VDLL 4LEOB 4JM2F 3GBNL 3GSUB 5HI4D 4EDWH 5GGVL 4FQLL 4XPFL 1ZE3C 3LKRB 1VGEL 1QEWB 3KLDA 5BW7A 4ZAKA 3KPQA 4MJ5A 3NOIA 2NTFB 4LRNH 4WO4C 1I7UB 2YR3A 1Q94A 1KLGA 3IXAB 1KT2B 2Z4QA 4O9HL 2W60B 1ZAGA 3ZHKA 1S8DB 3IJSB 2YD2A 1HN1A 3MRMB 2I60H 4PGJA 1A1NA 3V52H 2R23A 1DLFH 5DS8A 4WHYH 1S7VB 1EUUA 1A3RH 3A6OA 4P46B 4M7LT 1KN4H 4LVHB 2IFFH 3L7FB 4YWGL 4KK8C 4APQB 4K71B 4BUGA 1KPVA 3B8YA 4Y4HD 4MNQA 3SBWA 3MX0A 3M17B 4NM4L 1WWCA 2O5ZH 2H6PA 3LQAH 5K9QI 3TM6A 1KNOA 1U2HA 4OFDA 3HI5L 1KJ3H 1BIHA 3V9FA 2QQLH 3FT2B 3NZHL 3DMMD 4XNZC 4RFNB 4QRSB 4I9WD 5DJ8A 2OK0L 3QNXB 5DHXB 2FL5A 3OG6B 3RU8H 1SJHB 4RX4D 1QFHA 1AIFA 4NQEE 1LEGA 2AABH 2X9XA 1EZVY 5DJDB 1IGIL 1GZPA 1YEFH 3IJHA 4UB0H 3QA3B 1XF5B 5TDNB 4CL7A 3WHE0 5CHNB 2KDGA 4ZFFA 4HJGA 3VWKB 5E8EB 5HGBB 4KK9D 5LXGL 1T03L 1RPQA 1I3GL 3RVXC 4DWHA 1I85C 2R29H 1EJOL 4KVCH 4K7PH 5IVXB 1YQVH 3PWJA 3PWNB 2BNQE 4QWWC 5IBUG 2AJZB 4DKEL 4ZYKA 4Y4HA 3TBSB 3SDAC 3KPNB 2XN9D 2E7MA 2BVPA 1OGAD 3HPLA 1TMCB 3HAEH 2WINA 2YD3A 1TZGH 4FP8L 4PBXA 1U2CA 3E8UH 3LHPH 4R0LB 2ID5A 2MWCA 4XPGL 3D3VB 4W6XB 3DMMA 3V6ZA 5DEFB 1S7RB 1DBAH 1CF8H 3GHEH 4RX4A 3ARBC 5E2WH 4DKDC 1RMFH 4K9EL 3HNTH 5A40E 3MYJA 3VW3L 4U1KA 1V3KA 3MGAA 1LQSR 2OP4H 4OLXH 4LLWB 5TF1H 3IU4L 3RKPA 4Q9BA 5D8JH 4GRWE 3F7QA 4HH9B 3Q5TA 2VDOH 3HZMB 4L4TE 3F12A 3KNBB 3U83A 3U9PH 1J12A 1WGOA 1TETH 1OQOA 5K93A 2WK2A 5C0JB 1FNFA 5C0AD 4PJEE 3RJQB 1P7KB 2FSEA 1UQSB 3O6KL 4S10A 3V5DA 1XIWC 1S7TA 2YWZA 4F2MB 4PJ7A 2VDPL 1KPUA 3QEGH 4G6JL 2B20A 5EO0B 3C2AH 3BKML 3KYNB 1YEHL 2IGFH 3C09C 2XN9A 4HKJB 1NCDH 2X4UB 2ICES 5B39A 3RUGF 4OCXH 1GVIA 1FNSL 4HIHB 4O51B 4NN6B 1F6FB 3KR3L 4LK4A 1UYWL 3D69B 1UA6L 3KPMA 3WEXA 2JB6A 4XB8A 2X10A 5BV7L 1JHKL 4UV4H 3L3JA 5T1MB 2ZUQB 1HCVA 2IBBA 2IQ9L 4TNWF 4R90L 4YDJB 3Q6FB 4OZGE 2NY0B 1ZLVK 1F2QA 2AXHA 3DRTA 3FQXB 3JWOH 4X6EB 4ELMA 4OSUH 2ADFH 4K7PY 4Y16B 3WIFB 3KJ6H 2HN7A 4WUKH 5GS1B 2OXGA 1JZ2A 2A77H 4LKXB 1HSAA 5TE7H 4WNQA 4HIXL 5TDOA 3H9SD 5C0AA 3MRRA 3QDMB 1IM9D 1AGDB 4U1LA 3BJLA 5IP4A 2EXWD 4HHAA 5BMFL 1YNKL 1D5MA 2XZCL 4G6AC 1KPRA 2EH8L 4UILH 3BPCB 3O4OB 1NL0L 5HVHB 5L0QB 1T2QL 5GS0C 5GS2D 4AMKH 4BQ9A 2W07A 3FB5B 3MO1A 4CVZA 1VACA 2E8YA 1MH5A 3T0ED 2EDQA 3JVGA 4U6HB 2ZUYA 4FQIH 4LSSH 3UBXB 1N7MH 4LPCA 2QV2A 1NBQA 1PYWA 4ISVA 4DKFH 1Y18A 1TFHA 1PEWA 5E6IB 1LO0L 5INDA 3T0DA 2I27N 5ITFB 4PIRF 5C3TA 1FDLH 3BSZH 4I5BB 1T6WA 5KOVC 1PG7X 1YZZA 1LK3H 4H25A 4ZOCA 5HPOA 2CR3A 3V4VL 5DURD 3PWUA 1R3JA 4H1LA 3IDXH 4ZPTA 5FA4B 4L8BA 4P3WA 3VWJA 4ZG1A 1BBDL 4Y8AA 2ZUWA 3PWLA 4RCAA 4MA1B 3X14B 2CDGA 4YC2C 1J5OH 1JF5A 2XYCA 3MV7E 1M7IB 1P53A 3H3PL 4X6DA 1R3IL 4NJAH 3MRKA 1H3VA 1DVFC 1NGWA 1T5WA 4RA3A 2JJUA 3RDTD 4P2QB 1ZHLA 3CDFA 1PG7L 3T4YA 3VXSD 2AXFA 4LGSB 1EMTL 1BX2B 2OR9H 3OKNB 4RMTA 3RI5F 3T0EA 3DARA 4NRXB 5LVEA 3B2UC 3MV7B 4RAVB 4ZXBA 1RJZA 4UU9B 1O0VA 3SJVD 2VLJE 2ZCHH 4H0GA 3HMXA 1GGIL 4JRXE 1TXKA 4XP6L 3T09A 5T3XH 4DVBB 4YDIL 1U8OA 3O9WB 4RGMC 3W9DB 1CFNB 4PP2A 4Y1AD 4IRZL 3VXQA 4OZHF 2A6KA 3OAUH 2DL9A 5EIQA 2WBJD 2A9MH 4HUXA 2P5WA 1EAPA 5CEZL 5EORH 3ARGA 1RUPL 3L7EB 4JDZA 5DQJB 5J89A 5JPMA 3MYZA 3LKNB 1JP5A 4LBEA 1YJDH 3CSGA 2AVGA 4ZSOB 4MZ2A 1ZK9A 4E9LA 3ES6A 5C0FB 1IM3A 4J1UB 4GW1A 2GUOB 2IPUK 1E6JH 2YWYA 4QTHA 3B3IA 2QQKL 2Q3AA 2XTJE 4WEBL 1GAFH 2E6JA 1D5ZA 1CFQB 1NANH 5DJYA 3KJ4C 2FJFB 3MRHA 4XTRC 4XAWL 2DQCH 4HG4J 4MA8L 1FL5A 1A21A 1JJUA 3O3AA 4Q6IA 4PRIB 5GS2H 4MLSA 1N4XH 4JG1H 4KK8D 1FFRA 1XF2A 4D0DB 5HYSB 5JOFA 1TJIL 1OAYL 2XTJB 1BM3L 5D7JA 4PJ9D 3WL9A 4HKBA 1P4BL 4WGVB 4Y1AA 1U8QB 1F11B 3ARYA 4DGIL 1FGVL 5CUSH 4XPBL 4TUOB 4FXLA 2WBJA 5E99H 3RWFA 4DFHA 2R8SH 4F15C 1DTUA 3MOAH 1KEGL 3DUSB 1RD6A 4CAGA 2EO9A 5F1IA 2YXFA 1C5CH 4WO4A 4U6VH 1UEYA 1NGYA 4HSQA 2BHUA 3MRFA 4NYLB 4AEHH 3OGCA 1ZT4A 4LSPH 1NFKA 2A1WL 5ACMA 1EIBA 4HX1A 4M8QA 1NFIA 2HFEA 2X44D 1R3HA 2AK1L 5T1KB 1ND0A 5GGRB 5DQDH 1A6ZB 4YLQT 2IAND 5B39G 4D9QE 4LNRB 2Q8BH 3FO1B 3G6JA 3VRJB 2HJLA 1CGYA 1YEJH 4JY5L 1M6OA 2HRLA 2X89A 1KGCD 3D18A 4P4KC 5AG8A 2MQCA 4BFGA 5M7QA 4FOMA 2OJEB 1D9KC 3P77B 1F8TH 3PXHA 4GKZB 3BRFA 4Z7UA 5ETUB 3L3OA 4JVUA 4GKOA 4YNYA 3SE9L 1HZHL 1BGXH 2G2RA 1S7QB 2VLLB 4O2EA 4EOWL 1A7OH 4MS8C 2V2TA 2X7LA 4G42A 3WHE1 3HG1B 5HDBF 4XVSH 4G80A 4HKXB 3SOBH 9CGTA 1MUJB 3QIWB 2SEBB 4OV5B 3MGOA 1DE4B 4XVTH 3BKCH 5BVJB 3S96B 3MRQA 3MODL 5IB2B 1OGTB 3ARBD 1H0DA 2C1PB 4EJ1C 2UWEE 5I1IL 3BGMB 3KXFB 3BPOC 2ARJQ 3DVNB 3MMEB 5ID0B 1TVBA 1AQKH 5J6HB 5CWSB 3NIFF 4AH2A 4DTGH 5JIIA 3V8OA 2B4CL 2YD5A 4FQPA 4B5EA 1JGEB 4ELKA 1E27B 1UXWB 2DM7A 4KZEH 4ONHA 3TV3L 3WSQL 3GEWB 4X5XB 4P57A 5I1KH 4KMQA 4WW1A 2X4NB 1I85A 1ZTXL 1F42A 1I1FB 5KBNC 1E0OB 3K4ZA 3UBXI 1MJUL 1XIWD 2DWDA 4XPTH 2A73A 4KRNA 4ZMAT 5CLWA 2DMKA 2ZJSL 1OTUC 4JM2D 3SDAA 3L3HA 2QADB 3VI3F 1ZGLP 5JOPD 1EXUA 2L7UA 1PBYA 4R4BB 5LAXB 2CLRB 3KPRD 2B0SH 4DN4H 3W0WB 2PW2A 4H1LG 3FO2B 5DEZA 1SYVB 3PGCB 1JZ5A 2E6PA 3C5ZB 2DD8H 2HJKB 1FL3B 3ARBA 3QFJD 3C8KB 4ZUTB 1CCZA 3I9GH 2W0FB 4MQ7B 1TDQA 2EYTA 4K94C 4S1SH 2MCPL 3V7AG 2D0HA 5D71H 5C0GB 5LQBH 4FQJH 3T8XB 3TO4A 1XEDA 2YA2A 4Y88A 1OARL 1D7FA 4LGPB 1Q9WA 4PGZA 1KJVA 1CDUA 4M7ZC 2CR6A 1PZ5B 3L5JA 1MCCA 1JYNA 4FTVE 3UTSE 2DB8A 3KPSE 5AYUH 4WI2A 4MD5B 2OTWA 2BERA 3F6LA 3RNQA 1XIWA 1BZ7B 1I1AC 4U1HA 4G6AD 4EEEA 4OZIF 4RAUB 5JW3H 5T3ZE 4WW2F 5GIRA 1ZS8B 3V6FB 1LO2H 4KXZI 1OHQA 4EXKA 4NDMA 3AGVA 4FTVB 3KPRA 4Q9CA 4WCYH 1DEDA 3S9DB 1WZ1L 1QFPA 4M7JH 5CZVH 3T0BA 1G7HA 4R8WL 1REIA 2QQNL 2ZOLB 5CGYD 1G84A 1NDGA 2GAZB 5DJAA 4Z7WE 5SWZE 4O02L 3TVMC 5DDHA 1HILB 2LQRA 2DQFA 4XCCL 1JPTH 3CK0L 4J3OC 5SWQB 1IJ9A 1QSEE 4DZ8B 3L1OL 1BAFL 1V3MA 4AY0A 4NQCE 2Q6WB 2CUMA 3GSQB 5HY9A 2JLLA 4YZFF 1WIPA 2DWEB 4JY4B 4HIJA 2LTQB 3MBXL 3BO8A 3U0TA 1H3PH 3MNWB 4OLYL 5I1DB 3MV9B 3L5XH 5IBUB 3UYRL 3FN0L 3QG6A 4TUJB 3MREA 4HLZH 4U1NB 1N26A 1QSEB 1PY9A 2A74A 4GXUM 4X7SL 4ZODA 3U4EB 1DVFD 3MRJB 5JHDE 3ZSSA 1U8KA 1EEUA 4TQEL 3MJ7A 4URTB 2HAZA 4JPWH 4HULB 4EDXB 5IT2H 3MFFB 1T7YA 3U7YH 1RVFL 2BMKA 3MA7A 2VMFA 4DEPC 5D1XD 3O0RH 1NFDE 4WU7B 1Y0LB 5EWIH 1HWHB 1QLFB 5JHDB 4YBLC 1CR9H 1DUYA 3I6GA 1A3LL 1S78C 5CEYA 3NFPB 3CFDA 4PTUA 3DV4A 4U3HA 1K8DB 5GGUA 5L2JB 5E4IA 4JREC 1R5VA 5D7LA 4XCEA 4UI2A 4JR9L 1H8SA 2EC9U 3ZT7A 1MI5D 3C5SB 4PRBB 3S35L 2GJ6D 4LLQB 4FFYH 1JHLL 3KPLB 3ARFC 3W9EB 2AEQL 3HE7C 5FKAA 4R96A 3MUGB 2X1PA 4KI5C 4CDGC 1HQRA 3ZTNL 4I0CC 1B0WA 3V0VA 1OT2A 1MCHA 3MRBB 4LSUL 5J11C 1BBJA 1DVFA 2I9LA 1L9MA 4POYA 3O3EB 4OD2A 1NCWH 4MJIE 3O3BA 4ZQKA 5EBLB 5AZ2L 1ZA6B 3HPJA 3IETA 4GKSB 1DANU 2NPLX 4LSQH 1G0YR 2NY5C 3UJJL 3WN5C 3R06A 4X9BA 5F96L 2QSTA 3O4LD 2H32H 3B2VH 2J12B 2AEWA 4U1GB 5JW4Q 1GIGL 1A9BB 4XC3L 1A7PH 3BVNB 1Q9LB 4JJ5B 4CBPA 2AJXH 3W82A 4NQUA 5F7NC 2P8LA 1S9VB 5TH2B 2A38A 3B6SB 5DI8A 4KDVA 5DA0B 1CLYL 5L2KB 4GS7C 2HH0H 4XVJL 2CRIA 4LLDB 4XP1H 2WP3O 1MI5A 1MCFA 5IMOA 2GJ6A 4OLUL 1CG9A 1QPPA 1PD6A 4JZOA 1UWEL 3DBXA 4DN3H 1FC1A 3MUJA 1NCCL 3DO3A 2D7TH 3L9RA 2ED9A 5FFLA 3HMXL 2EIDA 5MHSE 4M5YH 3SGDH 3TBWB 3LS5H 2R9HD 3PABB 3MOBL 3ULUF 1NMBH 2DS4A 3VD5A 3QEHA 1LEKA 1C5BH 4PGBB 2BSTA 1EO8H 4NQXB 4L9LC 1CE6A 2GTZB 1IT9L 3LKOA 4P4KD 3DVGA 4IOIA 4PJCF 4LCUB 4QRUB 4WI8A 4ZUSB 3BUTA 2DTMH 4LLYB 5T1DH 3CFEB 5F9OL 3WIIH 2UVEA 3IFNH 3KLAA 1P1ZB 3NABL 4NZRH 4OQTH 2Z4QB 1I3UA 4HUKB 4XPHH 3KPTA 1AFVH 1D5BB 1N64H 4MNQE 5JW4N 4RFEA 5DJ6B 3VXMA 2WWMC 2F53B 3W39B 2R23B 1CE1L 4XH2B 3TPUB 5DS8B 2JELH 2VAJA 1RZJL 1ERNA 3EUUA 5I8EB 2XKUA 3WIHL 3HAEB 2FB4H 3OAYH 5LWYH 2R4RL 1PG7W 5C0CD 3BZ4B 5GRVL 3SCMB 1KCLA 5F44A 5FYKD 1YMMD 4IRJC 1KPVB 3NH7H 1UENA 4KHXL 4MNQB 4R7NA 4ZUUB 1NCBL 4DGYL 2DMBA 3IDNA 4P49A 1DR9A 5EOTB 5KJRL 1IRAY 1X5XA 4LASL 4KY1H 1JI2A 1AI1H 4PREB 1KNOB 4EBQH 4HCRA 4JRYB 1G7JA 5T5FH 3TYFA 4YHZH 2DQGL 4P4KA 4G7VL 1OAQH 4QTIH 1D9KA 1XT5A 2Z8WC 2FDBP 4JKPH 1IAOB 3LPFA 3IDYC 2BSRA 3LKQA 4Z7VA 1CDHA 3O6MH 1AIFB 3H7BB 1LEGB 4M1GH 1A6WL 4PUBH 4WTZA 2DN7A 4NBZB 5LKNA 3CSBA 5EU3A 2CSPA 2VXUL 1C08B 5DVMA 2DL2A 1RUML 4XNXH 1CFVH 4KTYA 2OJZH 4PG9B 1FO0A 5HXMA 4NSKA 4R4FL 3JWDL 3HE6C 3QUYC 4HIEA 1MCOL 3MRNB 3EW3B 4WUUA 3OAZH 4C83A 1C8PA 4IHOB 3PWJB 3MACL 1X4YA 2IC2A 1A6VH 4Y4HB 4OI9A 1UH4A 2A6DA 2R0LH 4K3EL 4YUEL 5KS9E 1LE5B 4XCNB 4XCYA 1UC6A 4F7CB 3FO0L 3FOMA 3GMRB 5IFHL 4CNIA 5CEXB 5DMIH 1MCIA 1A0QL 3DMMB 1CL7L 4WFGD 3OV6A 4W4OC 4XVUD 2Q7YA 4ZPVA 1J1PH 1EHAA 2NY2B 3V5KB 1M1SA 2FIRT 4Z5RA 3FN3A 3P4OA 2FH8A 4PJBF 1I1AD 4U33A 1RHHB 3EHBC 3ARXA 1F4XH 1U8JB 4ZTOH 5KS9B 1XGYH 2DQUL 4PJ7E 1AKJD 4U1KB 1XZ0A 4I3SL 1FJ1B 3OKOA 2BNUA 2Y7QA 2XN9E 5FGCE 1RFDH 3DX9A 1AY1H 3S7GA 4YHNB 1TLKA 3HMWL 2J88L 2BY0A 4PJXF 3ZDYE 3N1PC 3TVMD 2YUZA 3LRSB 4GBXD 3V5DB 1T66C 5IFJB 1J9CT 3O3UN 2CJUH 2ZUSA 1KTLA 1KPUB 3K2MC 3QXAA 2YN5A 1ETZA 1LEIA 4S1QH 2P5EB 1V8HA 5FGCB 1JVKA 1TTFA 2XKNA 4NP4H 1OGAB 4U0QB 5B39B 5CCKL 3H3KA 3MJGX 1OP3H 3H0TA 1P84K 2C4XA 4NUGL 5DK0A 4O5LH 3PV6A 3Q6GL 3BPNB 3OF6D 5DUBA 4K3JL 3MV8D 4KROB 2DM4A 1I7TA 5FYKH 5IM7A 5A16B 1NEZB 4ELME 5C3LD 1ZT7B 5ICXB 1MHCB 3KPMB 2JB6B 3HUJB 1I1AA 2XQYK 3AVEA 1H9VA 2VH5L 3L3JB 5GPRA 1TZHB 4NN5B 5GRUH 5C0AE 12E8L 1JYVA 1MFBH 1CXHA 3MXWH 2J8HA 1AKJA 2FLBT 2ZPKL 4MXWH 3MLUH 1ACYL 5ISZB 4P99A 1FH5H 1HHIA 4LAJH 1N5YH 4UT6L 1K2DA 3NA4A 1RURH 5J4MA 1PSKL 3BKJH 1KTKE 2YZ8A 4G8EA 4HDIA 4OZFA 3E6FA 4F7MA 1MJ8L 4ALAH 5DLML 1VA9A 2Q8AL 2OL3A 3TVMA 1YYML 3MZGB 5C0AB 5CSBA 3QRFM 4CU7A 1S7SA 3F7RA 2NTSP 1A7BA 4U1LB 3SGJC 2E9JA 4L4VD 4MQTB 4OI7A 3H42H 2X4PB 4J6RH 4JPIB 4N0CD 2IH1A 5I66A 1SEBB 1EHLH 2Q76B 3MO1B 3D0LB 4OCWL 4U2ZA 3OF6A 3MR9A 1BVKA 3MV8A 3LS4H 2V9RA 4LPVA 4ISVB 4JKLA 5ADPH 1C16B 1X5YA 1X7QA 3F7VB 4XPAL 3HE7D 3WBDA 4KI5D 1MFCH 2WM0A 5INDB 1F4WL 4UUJA 2K7QA 4I3RH 4X6DE 2IALB 5F71A 3IAPA 2FX9L 4P2CG 3NACH 3MRIA 2VC2H 1OCWL 1A6TB 3FHAA 5D7IB 1JHTA 1IQWL 2VZ3A 2C3WA 3T0EE 3BXNB 1UJTA 2KQMA 1CICD 3H9SB 1IM9B 2ZUVA 5AAWA 4XMLL 3ILPA 2FJHA 4L4VA 4GMSL 3QEUB 3SKJL 5HBBA 3I6KA 3X13B 5CBEB 4UOJA 5I30H 5DQ9B 5CP3A 3DO7A 3QPQC 4JDVB 1A1OB 3PQYD 3GMPA 4L3ED 3GRWL 1LNUA 3RL2A 3T0EB 3PIQA 1MAJA 4JE4B 5GS0L 5HDQH 3NIGE 3VRIA 4X7FC 3MBEB 3ARFA 2J1KA 5D7KD 2P5WE 4F80A 3QEQA 4Q9QH 2I25N 3WXVL 3HE7A 1RV6X 1RK1B 1A4JB 1CT8A 1R3KA 4KJPC 4YHPB 3SQOL 2VDRH 4PJIF 3V0AC 3CUPB 5C0IA 1KB5A 1CGWA 2EC9T 5D70H 3MXVL 2YUXA 2MPAH 4XNQA 1J0ZA 3ZDXE 1MAML 5DURB 1A2YB 1ZHBB 3JWNC 3L5IA 4WTZG 3WN5A 5B3NA 1MFEL 3V95A 3F58H 4HUXB 4Z95L 1CWVA 4JDZB 4YH6A 4UDUA 1AE6H 3RX7A 2AGJL 4DK6A 1DL7L 5CJXC 3CFIC 4KTEL 5CP7B 3VMOA 1DANT 4UZGA 3ZKXB 4WGWB 4XI5D 5C7XL 3HC4H 3PJSA 3RDTB 4QTHB 4KAQL 1EHNA 1AGCA 4L3EA 3VXSB 4M6AA 2WWMD 1S5IL 4PLOB 2WQRA 1D5ZB 4Y1AE 5DJYB 4FQHA 1NAML 2HT4D 3ARZA 1RK0B 3SJVB 2XA3A 1YC8A 1FL5B 2CH8A 3QUZC 1FBIL 1BIIA 4WU5A 4Q6IB 1BQSA 3QP3A 5IW6A 1I8LC 3X17A 3VXPA 2GCYB 2YMXH 3D39A 1XF2B 3GGWA 1V7ML 4TSBL 4J4PC 1RULH 1HYRC 4HKBB 3L3KA 4Y1AB 4G6MH 5B8CC 5B38G 1ZVSA 4G8FA 4DW2H 3QZWG 1K5NB 1WC7B 1A4KB 4LARH 5IB1A 4X4XA 3DRQA 4L9LA 1WTLA 3VDBA 4M61B 1IGML 4TUKL 3G6JE 2ZP0T 2CLVB 2ICWB 3G5VB 4NJ9H 4OIIH 1GHFH 1OPGL 3WFBL 4UNUA 4ODXA 4YHYC 3QDAA 5IVOA 4UQ3A 1NGYB 4QHNA 5E56A 1TPXC 4JM4L 4Z7UE 1IC5H 4JRWA 4H8WH 2DQJL 4MYWB 1I9JH 5DO2D 4DAGH 3QWOA 1F4YH 1VEOA 1ZANL 5CJ5A 1EEZA 2HJLB 5I1GL 3HE6D 3D18B 2A6IA 1CZ8L 3MZTA 2H41A 3QFDA 1QA9B 4YHOH 3B9VA 3MTRA 5HHXH 4R97B 4ZOEA 4YK4B 1OAZL 4IRJA 1QBLL 4R2GC 3L3OB 3X11A 4PJ9B 2ZG3A 5JHLL 4TVPH 1M05B 2FATL 3LKPB 4O2EB 4QCIB 2OZ4L 2VZSA 4HWZB 1MCQA 4OD1H 5C0EA 4UV7L 3HCVB 1CFTB 4GAGH 4QXGH 1IGFH 3LD8B 3LKSB 1RZIB 4HXAH 4OZFG 3E2HC 4MX7B 2WV3A 3FQUB 5K9JH 4K7FB 3EHBD 1QR1B 5DGRA 4JFFD 5CGTA 3UTZB 4DVRH 4WEUD 4GG6B 4PS4H 4TTGA 5F7DB 3PP4H 2EYRA 3C6LB 2ZKHH 4OF3A 1P6AB 2CQVA 3RZCC 3DSNA 4NM8H 1DBKL 3AREC 4GQ9H 4RQQA 4KK6C 2YPLB 2IANB 4IRSC 5HYIA 4ONHB 1NBYA 1GPOL 1RY7B 4NZJA 3HE6A 3AXLB 3QUYA 2ZZUT 4P57B 2NLJB 3ULUD 2DWDB 5AUMB 2A73B 1MF2L 5FM5O 3X3GL 1QQDA 2IBZY 1A6AA 4Y0GA 2X4SB 1MWAA 4Z7OE 3ARWA 4ODWA 4BQCA 2ZSWB 1IBGH 2CKBL 1JWUB 3LIZH 4R26L 4W4OA 2BXZA 1A7QH 1KJ2L 2AKRA 3L3GB 3I2CH 2CMRH 5FO9B 1RZKH 2CIIB 3OX8B 4ODTH 3WE6A 4RMWA 2NW2A 2ADGA 5F72S 1NANI 1J1XL 2JJSA 1IGYA 4CW1A 1UADC 1Z9LA 2PN5A 4XP9L 2V2WA 4Z7QE 2XIDA 3WFEL 5JOPE 4Z0BH 1LWRA 5FHAL 2RCSH 1Q9WB 5SWSD 1S9YB 3Q1SL 3AB0C 1F90H 3K8LA 4HLJA 4JFYA 3KPRE 3CXHJ 4ZFOA 2EEBA 3RNKA 2JCCA 4LQ1A 2EDEA 3UTTD 3MGTA 1MQ8A 1XIWB 2VXTH 1FCGA 2M8XA 1TQCB 3GMQA 3IAQA 4QYOA 2Z93A 5J12C 1GCFA 4P0DA 3U7WH 4JM2B 4U1IA 4X80L 3FKUS 2C1OA 1QKZH 4GKNA 4WENB 3GDBA 3MNZB 2Y4SA 1QHPA 3P2TA 4I2XB 1KLUA 1YN7A 4NDMB 1TJGL 2I24N 2EDOA 2A6JB 1G7HB 3CH8A 1RZ8B 4G3YL 4JFDD 1U8MB 4KC3B 3VFUB 5DDHB 2DQFB 1YNLH 3QFJB 2MCG1 5C0BB 3UC0H 5BZWB 2PW1A 3NVQA 4NKMA 1FNGA 4QT5B 1KCKA 1MCRA 1FIGH 2QHRH 5TE4L 1U0QA 32C2A 1AQDB 4OFYD 5C0DB 5SWSA 4TRPH 4L3AA 1EZVX 2VNCA 3VD9A 3HC3L 1OQXA 4JO2L 4HIIA 1VGKA 4POZD 3GIVA 1T22A 5IV2A 3UTTA 4JFQB 2CUIA 3QPXH 2GHWB 2LAGB 3EOTL 3SGJA 3MREB 1GSMA 4XBEH 2A74B 4PJFA 2EC8A 1B4JL 4OKDA 4WFEE 2CXGA 2JB5H 2FR4B 2NR6D 4JG0H 1YY9C 3MJ7B 3QPQD 2FBJL 2DKSA 3QUXC 2Y06L 5JXAL 4U1MB 3QHFH 1BFOB 1BFVH 4FQXC 1NLDL 4RNRB 5DMKA 1UCBL 4P23C 1TCMA 3UO1L 3QISA 3OL2A 3ULUH 4LSRL 4CDHA 5D7LE 5C9KA 2V7NB 4KQ3H 3VXOA 3OAYK 4OAWA 1JUFA 2IADA 2AEPL 5E08L 1T3FA 4Y19A 5FYLD 4G43B 1U8NB 5CEYB 2DLTA 1CBVH 3QCTL 5FYJH 1DQTA 3AAZA 4FZ8L 2XA8H 3NCFB 3VXTA 3HLAA 5JORB 1R5VB 4OFYA 3PWPB 1X5LA 3RWIA 5I1CH 2G5RA 3QWQB 3MLZH 3RWGA 5GGVY 3T0VA 1DEEA 4EN3A 1E4WH 4U6YA 2FD6L 4LSVH 5E8NA 3BFOA 3CFCL 1PKQA 5CMAA 5CILH 5JO5B 4EDWL 4WI6A 3THMH 1UM4H 5D93C 1HQRB 4ORZC 1BJ8A 4M6NH 3V0VB 2BVOB 3LSOB 3GMMA 1MREH 1BBJB 1DVFB 3MJ9H 4X8JA 1JF1A 2OQJA 4JY6A 4TNWK 4ORGA 1YY8A 4FQCH 4ZQKB 1GOGA 3RA7H 5EUKA 4O2FA 4OGXL 3GKWH 4OT1L 5D1XB 4F33A 3VDAA 1MI5E 1T1XA 4JAMA 4HV8A 3V52L 2GJ6E 1DLFL 4GLRH 3KHOA 3TH4T 1GGYA 4J2XA 3OAZK 2A83A 1W8NA 1CLCA 3ZKND 2G9HA 4IBLT 1A3RL 3S5LB 1CGSL 4YQXH 2IFFL 1ZGLB 2W92A 4QNPE 4Q6YA 3T2OA 3ARDD 4BSWB 4XXCC 1MI5B 5IF0A 2O5ZL 3P9MA 4JFXA 1VPOH 4RFOH 4WWKC 4QKXB 5H35A 5IMOB 3LQAL 1RSFA 3GMOB 3GMLB 1I7RA 1KJ3L 2IAMC 4Q2ZB 2QQLL 5DWUH 1JGLH 5CJXA 1CXIA 2EIZA 4K7PX 2AI0L 5IW1B 4U1JA 3RUGB 2AV7A 3PHOB 2ARJB 2GIYA 1V05A 3M8OH 2FBOJ 4YEEA 3ZHDA 1K4DA 4LKCB 5IMLA 4QRRB 3FQTA 2AABL 4HG4K 4BJLA 4UB0L 3QUMA 5JLZB 3KJ4B 4YJZL 3O4LB 1HEZB 3G5YB 2VLKD 3VXME 1N0XH 5IOPA 1CDYA 2D7QA 3LKOB 3QUZA 3BDYH 1M71A 1I8LA 4NO2A 2X4QA 1BWMA 1B6UA 1XF4A 3GJFH 3IVKA 5FB8A 4AYFA 3QCUH 3S88H 5IJKC 4J4PA 2JTDA 2R29L 1P7QA 4HH8A 4R2GD 4KVCL 4K7PL 2DLGA 1YQVL 2ATKA 1S7UB 1MHEA 3A6CH 5B8CA 3TA3B 4PTTA 5FYKU 5KN5B 1RUKH 3JUYA 4HUMB 2DYPA 1AHWC 2BX5A 2GK0A 1RU9H 3BN9D 1CFSB 3HI1B 2ICEA 1R3LA 3SKOB 4F15B 1IGTA 3PP3H 3RI5K 2VRAA 2YUVA 3FTGB 4D2NA 1TZGL 5FYLH 4YPGB 3E8UL 3LHPL 4FS0A 1TITA 3OPZH 3MRLB 4TTDD 5BVPH 4GT7A 2V5YA 1DBAL 2IPTH 2Z31B 3CFBA 2DKMA 3GHEL 2DAVA 2IMNA 3AUVA 4U0RC 1WISA 4R7NB 2OX5A 2YSSA 4Z7VE 3IDNB 1RMFL 1I9IH 4PJ8C 5BJTA 4HWBH 3HNTL 4UINH 3QG7H 4YAQB 4KK6D 5J6GA 3D5OF 5DC4B 3B4NA 4IRSD 1MVUB 2VLKA 3ZKMC 2MKWA 2OP4L 5EC1A 5TF1L 3RIAF 5CIPH 3F5WA 1UB5B 4UQ2A 2FO4B 4G8IB 4FN0A 4FG6D 2VDOL 1WQVT 3U9PL 1U8PA 4K2UH 1TETL 4LHUB 3PL6B 1FZMB 3LKQB 5C07B 4WUUE 1EEYB 1K9TA 1MNUH 4BH8A 3RWCB 2L7JA 2EIEA 2R2BA 2KUTA 4GRWF 3JV4A 3QEGL 3FOLA 4HC1A 1PGRB 4HKZB 4H5SA 3TN0C 1HXYB 1NCDL 1S5HA 5T1LD 5FA3A 4PJEF 1NCAH 2YA0A 2XXCB 3DROA 1HCFX 4JO4H 4HIEB 4OCXL 1TVHA 2JJVA 5C0CB 4C83B 4MB4A 5E24E 1UVQB 3BPOB 4G7YH 4XMPH 1F6AB 1YMMB 3GBML 1U3YA 3TESA 4UV4L 4NKOB 4PY8I 4CU8A 1K85A 2VXVH 3JSSA 3RZCA 3AREA