4ZMPA

Crystal structure of human p-cadherin (ss-dimer q101l)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDLNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmpA01
3LNDA 4NUPA 1Q1PA 4ZMVA 2OMUB 3Q2NA 3UBFA 5JYLA 2WBXA 2OMZB 2V37A 2O72A 2OMXB 3Q2WA 3PPEA 4NUMA 4ZT1A 1L3WA 3K5SA 2X2UA 4ZMZA 3UBHA 5JYMA 4XXWA 3Q2LA 1NCIA 3K6IA 2A4CA 4ZMYA 4NQQA 5CO1A 4AXWB 1EDHA 4AK1A 2OMTB 1WYJA 1NCHA 3K6DA 2A4EA 2WD0A 4APXB 1O6SB 3LNEA 5DZVA 4AXWA 1WUZA 5KJ4A 4ZMXA 1ZXKA 4ZI8A 2YSTA 3LNGA 4ZMTA 4AQEB 1SUHA 4APXA 4ZMNA 4ZMOA 4XXWC 2OMVB 4AQEA 1NCGA 3LNHA 3LNFA 4OY9A 1OP4A 1NCJA 4AQ8A 4NUQA 3K5RA 4AQAB 2YQGA 3MVSA 2WHVA 3FF8A 4ZMQA 3K6FA 2QVFB 2QVIA 5CZRA 4QD2E 4ZMPA 4ZMLA 4AQAA 1ZVNA 1FF5A 4ZMWA 3LNIA 2WCPA 4AQ8C 4ZTEA 2OMWB 2EE0A 2OMYB 3FF7A 3QRBA 3UBGA 3Q2VA
chains in the Genus database with same CATH superfamily
2R4RL 1D5BB 3HG4A 1OW0C 1AR1C 4PV9B 5LBVA 3VFUB 1V55B 5C92A 1ASOA 2HT2C 1MFCL 1BVKA 4LCCA 3BKJL 1OPGH 5AOZA 3ZVVA 5EU4B 1UA3A 2ZT9C 1Z1WA 4CAGA 5F3BA 1AYRA 3UX9B 4E36A 3GDBA 1CBVH 2HRGA 3BPLC 1RZJC 3TLRA 4HEPA 5AOJA 4D0BA 4ODHH 4NNPH 4YO0B 5D1QE 3TO2A 2O26U 1DCEA 3BXNA 4OGXH 2A7BA 2ALWA 2NLJB 1A3LH 1HZHL 2DF3A 1JXJA 3QW9A 1T3FB 4Y9BA 5IMOB 2PTUA 3TA4D 1XR9B 1AOHA 1E5CA 1XF5A 5BPPA 4MQXC 3O8XB 4HFUL 5J6HA 1DUZB 3DPDA 4N8PA 1NAML 4TNWK 1DQIA 3M1BB 1NGYA 4G80B 1PKQA 4WEMB 2IFGA 3KLAB 4NQEB 1D7DA 4PPTA 4S2SA 1EZSA 1TJIH 4Q2ZA 4C83A 4WGWB 3PWNB 2D0HA 3QXAB 2XV0A 4DO5A 4ESKA 1M9WA 3ILEA 4AQ1B 4Y4HA 1Z7JA 4Z7NE 2EO7A 3CBRA 4HIHB 2E8ZA 5IF0B 4JFFE 2UY7A 1S3KH 2IFFH 4L8DB 4KQ3L 5TF1L 2Z35A 3DX0A 1GZPA 3GPEA 5EB9A 3T77A 5HGAA 4KKLD 5DS2A 2BY2A 1DQLL 3DUSB 4PMEA 4U1NA 1O9ZA 4HLZG 1DSWA 3LXBA 2VDLL 1O6VA 7FABH 2NYYC 1OCCB 4QRRE 1JHTA 4TSAL 3IDGB 3SE9L 1ASPA 3MBEB 1Z9NA 4CSZA 1PZBA 2Q9OA 3LV3B 4JVUA 4PJDA 2AEPH 5D1QA 5J57B 5KSAB 5KW9L 1N0XH 2ZOLB 3Q1SH 5AW4B 4JKLA 3RGBA 4I18C 2UUDH 2JIXD 1K72A 4PUBH 5BO1H 3KLHC 4NNXA 5SWZA 4IOIA 3RWIA 3MRKA 1RIHH 5CUSL 3U30B 3QXDA 4GAAA 3NCFB 1K4CA 1JV5A 1H5BA 4LSQH 4MYPA 4YIQA 2P80A 5CCKL 4LHQB 1WCQA 4XNQA 1YPZF 5GRUL 1QQDA 2BVUA 4FJ6A 4GRMA 5CS7A 3U7WH 1YYLL 2AQRA 1U3HA 2CH8A 4GNKB 2YUZA 2NXZB 4RVBA 1QLEL 4ZTEA 2VMDA 1TXKA 2C9UA 1QI4A 3KEDA 4UILH 3ZDYE 3MFGB 1JZFA 4JFFA 3BVTA 4J2QA 4M5ZL 2WZ0A 1S78C 1MW2A 3TZVD 1CLVA 2G5UA 1AD0A 3CFMA 2C9VA 5GS0D 1JERA 4V1DB 7TAAA 3KHOA 5EU5B 5A40E 3WL9B 1F42A 4M3KB 5FYJL 3LDBC 1I8KA 1ZTXE 3MRQA 4I3SL 4QXUL 4WHTA 3QDGE 1BXVA 1N59B 5KVFE 4ANWA 2CO6A 4XMZA 5AYQA 4GJTB 3ULVH 3GZOA 4ZT1A 2FQFA 1SXBA 1F8TH 2OMUA 3AQZA 2PYEB 2IH9A 2PR4H 2Z34A 3FT2A 5JIDA 1G1KA 1A25A 4P2QE 1U9KA 3AG3B 1C1EH 1NFAA 3L54A 4LGRB 2BW5A 3FCSB 3QFDB 3QUKB 5KG9B 1V10A 3D2UB 1Q94B 5CZXD 5AAWA 4O2EA 2VXVH 4LLMA 1DL7L 2R29H 3SDAD 1KCSL 3QFJE 2ENJA 4ONFH 3LJ3A 4JPWL 2OV0A 4P46A 1JWSB 1NCDH 4HK3N 2HTLC 4UUJB 3W9EB 3UC0L 5I71C 4YSDA 1KXTB 4JGNA 2B16A 3BVNA 2WNKA 1L9SA 2XQYK 4KK5D 1UENA 2EXYC 4HIEB 4GUPA 4X5LA 1CXLA 4X80L 5HHOE 4ZMOA 2DMGA 4HDIB 2WXLA 5J1AA 3PAVA 4JE4B 4UV4L 4WNJA 1DJZA 2J8UA 2DQFB 1FH5H 2WNGA 2VH5L 1BD2E 1MCWM 3GZKA 1B0IA 4X7SL 1AHMA 2DQ6A 3QDGA 2QPDB 4L3EB 4YBLB 4YPGA 3RRQA 3RKDC 4WNQA 5T5FH 2CXGA 1CGVA 5TDPA 5TJWK 5BUGA 3QEUA 4K71C 4LEBA 4TVSa 5IMMB 3GSNH 3T8VA 4P2QA 5E9AA 5BVPL 1FORL 3P4OA 4UQBA 1T5WB 1HT6A 3LEVH 3BKML 5CP7B 1NFKA 2P8PA 5DMYA 3PL6D 5HBBA 4MXQC 1G7HB 4Q58C 3QFJA 4BE5A 1BPVA 4OUOA 3DRTA 4OZGE 5FGBC 2CGYA 2FIKA 3DX6B 2DQGH 4LASL 4N4YB 2AERT 3IPEA 3QIBD 3UJTH 2QGCA 5E5MA 4KAQH 4HPOH 1NIBA 2CDGA 1OOAA 1ET7A 1V7NL 1ZHNB 5EU6B 3OLEA 3VFNA 1JZIA 5FO7B 4AMKH 3G5VB 2GQHA 3D48R 5DD5H 5E6SB 3L3IA 1HAUA 1A5FH 5HHOA 4DP7X 3DGGA 3FO2B 4FLRA 2X2HA 1HQRA 1JXDA 1XGQA 3BLKA 2VABA 4G43A 4XMTA 1A6VH 1UJ3A 1CYGA 1QX1A 3CHRA 1BD2A 8CGTA 2Y3NA 4RQQB 5B1AB 4ZZFA 3CQQA 1PX8A 3VD4A 4IMLB 4F27A 2K9UA 4KTEH 5C2UB 3K71B 2MQ0A 3HZVA 1W72A 3I02A 4P9HC 4EUPB 5EU3A 2IADB 1G7JA 1GJIA 4AQ1C 3X14B 1I85A 1MJ7H 3THML 1P0SE 1QUNB 3F8UB 4LSVL 5I0WA 4MSWB 5AD0B 1EGJL 4FFZH 2B1AH 1U3ZA 2QBWA 3L6FB 3Q2LA 4A7GA 2VXTL 4OJAA 4D7BA 1KPVA 5F3HA 4QTFA 3HCVA 2NNAB 4OAWB 4X42A 3SY0A 3MYZA 3Q5YA 3MROB 4KTYA 2RQ8A 2HH0L 5IJVB 5I17A 2QPSA 1ETB1 1UJTA 5AKSA 1FVEB 2FGZA 3MBEC 4EDWH 2HVBA 3NFSH 5KSAC 3IM1A 3RTQB 3QWQB 5FUZL 5GS0H 1BQHB 5AOLA 1QRND 4JNXA 2YC1A 5D6DC 3ECQA 5ABDE 5IMLB 5GGVY 2ZKWA 4HJJL 2ZUUA 5JHDE 4WTQA 2IALA 4MDJA 1AC0A 1I3VA 2GTWA 4M4RA 3RDTB 3TONA 5J7CC 4X7FC 1UD4A 1DEEA 3TBYA 5EZOL 4BFGA 3HI6H 4Y5VB 4Y5XC 1U33A 2JXMB 2OZ4L 3QNXA 1CLZH 2QELA 4XWGH 2H32A 3N41B 4PI2A 4XNUH 4OBRA 2VAJA 2VUOA 5CGBA 3ZQXA 1I9IH 3HMXL 1BZOA 3FTGB 4YSRA 4Y16D 4ZUUA 2G3NA 3AG4B 1K2DB 4HQQH 2HKFL 5D7IB 2A6JA 2WIIB 3EO0A 5I1CH 4U1SB 2XTJE 4GRLC 5DT1L 4R0LB 4X6EA 3ELQA 3K4DA 3AG1B 4FS0A 1VFOA 4H13C 2WM0A 1IJNA 1CL7H 3WFEH 2D7PA 2FB4H 4LOFA 1GW0A 1J9CT 2YGPA 4ZMLA 4NLHA 3TWCH 2QFRA 4MJIE 3ZHFA 5TQ0L 1TTUA 2AW2A 2BERA 2ZG2A 4AIZB 1Q8MA 5TFSH 4RAHA 5KYYB 1GC1H 1T83A 2VM4A 1GTFA 1LK3H 4FNQA 4GQPH 3BRDA 5KVDH 2A73A 4NT6B 5T3ZL 2D2CC 4HC1A 5DI8A 4FQ1L 4Y1AB 3ZE0F 3ARFA 3ARGB 3TEXA 3AU0A 2H2PD 1B4LA 5F97E 2CALA 2QDWA 5IREA 4HXBH 5I0ZA 1P69B 4LF3A 4G3YL 2WTPA 3DROA 4HJUA 1D5MA 2MHAB 3ZIYA 2N59A 2GBUA 4RRPG 3QHFL 2WVTA 3SGJA 3X1BA 1WBYB 2DM2A 4FNPA 3H9HA 3UJJH 5EWIH 2C3HA 5GSVA 5TD4A 2GSIA 2VDOL 1TFHA 3C2SA 4LEXH 2X4NB 4NQCE 4KNTA 4TUOA 1HWGB 3IDJB 4D3CH 3I9AA 1P4IH 1YYMH 1ONQB 5D7LA 5BJTB 3JV6A 3ROLA 3EJZD 5JOPD 3JWNE 4YBLC 3EO1A 4B0MB 4IHOB 5E99L 1JHKL 1WV7T 4MJIA 1UASA 4KVNL 3MCG1 1Y18B 2J7LA 5E2UH 5CO1A 1N5AA 3AB0B 3GLEA 3U0PA 3V6FA 1G7PA 3SODB 4J39A 1E2WA 1P5VA 3QQ4A 1CIUA 3T2NH 2VB5A 3FQUB 5KANI 4KNQA 4HBQA 5INDA 1J5OL 3BE1H 4MASA 3LVTA 4JM2D 2P46B 4LLUA 1DE4B 5DZVA 1ACYL 2CRYA 3Q13A 1AXIB 4XHJC 4OGYH 1VGKA 4XPFL 4ZI8A 1X7SA 2YKKA 4MD5B 4G8FB 3QIWA 2KDYA 5F7FA 1N8ZA 1SUHA 3IETA 1OTTC 2FSDA 2BHUA 2R1YA 3L3DA 4P23D 1NEZG 1C5CH 2RJMA 1LO2H 5GGRY 3WS6A 5IB5A 3SJVB 4JY4A 3E0GA 4X9BA 4DQOL 3HG0A 4IMKC 5BMFL 3IKKA 3WN5A 4AL8H 2DLFL 1T1ZB 3ET9F 4H20L 4NWTH 3U6XA 3S3DB 1YEFL 3EBGA 3CX5J 1UCTA 2NX5B 1PLAA 3O4LE 2FIRT 4ZUSB 1VADA 3U6XS 1FJ1B 3ARDA 2F54B 4K5PA 4Z0BL 2XN9E 3E8UH 3N50A 1EZLA 3D39B 3P02A 1I9JL 1TENA 3EW3B 3CSTA 3FQRB 3FTXA 4NOBA 4YK4C 3WHXB 2B59A 3D4ZA 4FG6C 5I1DA 4PJ8B 5GRYA 2A1WL 4HWEL 3V0EA 1CTOA 2EDQA 2K7PA 1U91B 1ORQB 2O93L 4MNGA 3RNQB 2ZSVA 4YHZL 3JVGA 4K5LA 4NJAH 1IILE 4Z3EA 3DX8A 1KB3A 3DVIA 1JYXA 1QASA 4N6RA 3LH2H 3UBGA 5IFAL 1NAKL 1AACA 3TYGL 2B20A 4FQHB 1P6AB 1G6RA 1WS8A 4QNPF 4HALA 1TLKA 1Z6JT 3R4RA 2Y06L 3SOTA 3VRIB 4ZMVA 2YO3A 3WELA 3MODH 1UD3A 5C0ND 2MCG1 3FN0L 3SYPA 3MRCB 1HHKA 2OJEA 2ODHA 3NJVA 4KI5D 1HDMB 3O41A 3KWTA 1UWXK 1I7TA 2YQ2A 4S1SL 1XIWA 5E00A 2OA9A 4ZW7A 3IDNA 1L3WA 4RNRB 1EV2E 3TBBA 4J4PC 1H9VA 2A9DA 5IHZA 5HXMA 4LIQH 4LCYB 1HQ4A 1YEEL 4MD0A 5D5MF 5IWLC 3VWJD 3WDHA 1NBZB 1LD9A 1NC2B 1MCPH 1F11B 1OWRM 4X4XA 4Z3GA 5I0YA 2FO1A 1CG9B 3T8XA 1NC4B 5BV7H 4QRSA 1SY6A 2ARJA 4JRYE 4XPGL 5IIEB 3FT9A 1I8IA 1MF2H 5DLLA 1R3LB 4R0LC 4JFDA 1JGEB 4JDEA 3BDXA 1RURL 3J07A 4CADA 3ATEA 2CKBH 4WO4D 5GHWL 2Y3AA 4F7MA 4GSXA 1S9KC 1QTPA 2V5TA 2OTWB 5B4MD 4RMWA 1HWWA 3SOBL 4ZMXA 3VXRE 3CFUA 1YEDA 2WBWB 5J3HD 1QI5A 4A6YH 2VE6B 5IHWA 4NUJA 3VFRA 1FHGA 3SBWA 1IVTA 4PYHA 4HWZB 3TEYA 4EE2A 3NJKA 4U3CA 2VR5A 3Q5OA 3V4VB 4FA7B 3VDAA 2I24N 3QRFM 3NRQA 5CILL 2O6DA 4H0HB 3KBEA 3UDWC 3ARGC 2OW6A 4PJFA 3ZDWA 3QZPA 4N2DA 2XPGB 2PCXA 2V3EA 2Z8SA 4XNXH 3CFKB 3LPFA 4H7VA 1ZGLP 2UWEE 3WG7B 3ZUCA 4GMSH 5ITFB 3RFRA 4P5MA 2CO4A 2WHVA 3JZYA 3NP4A 4M6AA 1HL8A 2YPVA 3QPXL 1AVAA 3P54A 1JGDA 4JRYA 4QOKB 3AS3A 4LZKA 1QYGH 3H1ZA 1RUAL 1KXVC 1XWVA 1DQQB 2ZOWA 1DQDL 2R2BA 3EH1A 3GGWA 5E6RB 3JWOL 1HU8A 4WFFE 2VR9A 1I53A 1OZTG 4Y7OC 3CLFH 3MLZH 1DJHA 35C8H 1KEMH 4ZOEA 3VXRA 3CV5A 4MB3A 4L48A 4O02L 5ENWA 3AB0C 4YUEL 4M7KL 2DQIL 2R69H 4K3HA 4M62L 1NBVL 3GBML 1F6AB 4F1ZA 3CLEH 3L7EA 1LO5B 1RULH 5LN8A 3UFIA 4GBXA 5DVNA 4BWUA 1FGNH 4XWOD 3BISA 4QHNA 5K9KB 2ODIA 3U36A 4PLOB 2YS4A 2OMYA 1JN6A 2AABL 1F4WL 2PW2B 5JYLA 3ORJA 1AZBA 2ZP8A 5CD3A 4KKPA 2AEQH 4XBPA 4ELKA 2P80D 1J0JA 2UWEA 2DWYA 1ITCA 4MHHG 3IWVA 5FO2A 5F6IC 5IBLC 1CIDA 4FQCL 2HX9A 2X53A 4GP4B 4EN3B 2ATKA 2UZXA 3ARUA 1XZ0A 4K3JH 4KKNA 5DF0A 3WAKA 1EJOL 2QJDA 4C56B 3IVKB 5JYMA 2W94A 2VDKB 2EH8L 1AZZC 5LB1A 5KS9B 4PP2A 2P5WB 1DQKA 3BKCH 3KYNA 2BHFA 1N6VA 3DSNA 3LQAL 1FO0A 3TV8A 1M7UA 1I8AA 5DDHB 1TVHA 3QT2A 4HT1L 2JH2A 4HFWB 3RZCC 1NQBA 1T1YA 4OLZL 4CVUA 3DVNB 4M5YH 1OANA 4XXCC 5HSFA 4Z76B 1CMOA 5C0IB 5EOTB 3SDYL 3F2LA 1HI6B 4QRTB 1KYUA 4WI8A 3QDJE 5I1EL 5KJRH 2DH2A 3D07A 4HBCL 2P9RA 3V79C 4OLYL 4QRRD 4Y2DB 5EBLA 4PJ8C 2XWDA 4M7JL 1DQML 2HG5B 1WBZB 3O6MH 1AHWB 3VSTA 5C0EB 2I9TA 1GRWA 3PP4L 1XAKA 5SX4H 1S7SB 3RVVD 1RIUH 4FNRA 5DK0B 4AQEA 1LM8V 4JN2A 4J3SA 3GNMH 1RZ7L 5LWYL 2FL5A 3K74B 4QLRA 5HDBE 3WIHH 1HN1A 4C59B 2ZXEB 4S1QL 3AY4C 3MNVA 1IC4H 4I7ZC 1E43A 1IKNA 2AP2A 2V8MA 4PRPA 4FXKA 5EEVA 3MQIA 3WY1A 1O6TA 4AQOA 4OCXH 1TPXC 3SE3C 2QKIB 2X4OA 4LVNC 4P4KD 4ATTA 1J12A 3C60A 4YHNB 1J48A 5EUOF 5FUOH 2VISA 2WTRB 3AACA 1NDMA 4F7KA 2Z31A 4XMUA 1D9KB 1BEYL 2VDNL 4XN1A 4LL9A 4KJWD 1IEBB 5JPMB 3VRJA 4EOWL 1N6QH 2B2XH 3N40P 3HG1E 3S8FB 4JLRB 4KZDL 4NFBA 2DTML 2XCMC 2OYMA 3QDJA 4KY1L 4L4VA 3TBWB 3MLTA 3MRFB 3QDGD 4AYFB 1UT9A 3KPQB 3K2KA 1BZ7A 1KCKA 2WINA 1KPUB 3QQ9C 5DUPH 4UMSA 4ZFFA 3BAEH 1YEKH 1O75A 1EUTA 15C8H 1BLIA 1HHHA 2JKSA 4KKRA 4XCNA 3CVDA 4IIQA 1HL4A 3DVGB 3AFLA 3IJYB 1OAUL 3ARBC 4J3WA 3N43B 4NYLA 4GSDH 2DIAA 4P06A 3PHSA 4YHPB 5ALBL 2DICA 2HFGH 3EDKA 3IU4H 5D2NB 4MAYD 4LU5L 4GUCA 1XDTT 3GI8L 1FV1A 3N44F 3QFJD 1H8SA 3U1PA 4WHDA 2TRHA 3WFCH 4NO0B 5IB1B 2XHNA 3A47A 4LEEA 2NCMA 4LLWB 4S11A 3LMJH 4NFDA 2EDBA 4BUQA 1OSZB 1UB5A 2QL1A 3JTTA 4H25B 4I88A 4S0HA 2Z93A 3ZPDA 5CN1A 1SDDB 4YDKH 3UTZB 3FU6A 2RCSH 4JFYB 4DPRA 3L45A 25C8L 5HDOA 4ONOA 5G4NA 2UZYA 3DOSB 2V3DA 3HB3D 2Y1AA 4ZTPL 1KBWA 1WFTA 2X2JA 1BZ9A 5SV4A 2HAZA 3Q9QA 3VNZA 1XSOA 3D06A 4K7PY 3TASA 1EBAA 4M8RA 5DFVD 5IM7B 3TBSB 1QZNA 2H47C 3AY2A 2R2EB 2V9QA 1K4DB 3F85A 1PG7L 5KJ4A 1X7QA 3GZQA 4FQQA 1PQZB 2L7JA 3BPCB 2EYSB 4K9EL 1BW8A 4XN9A 1HFUA 5CSZA 4KXAA 4Z7WE 3GJFK 3B7SA 1B6DA 2X4PB 2G75B 1VESA 1MW3A 4MXWH 1X4YA 1NL0L 1MRDH 3JYBA 4B60A 1TT6A 2HJFA 3QRLA 4OI8A 3LHPH 1VEOA 4P2OC 3KCWA 4WVRA 1OARH 3IKCB 3A6OA 3CFEA 5EV7A 2LT9A 4YFLF 3TBVB 1AOZA 1BJ8A 1E27B 1PD0A 2FX9L 2O5YL 3UO1L 3DO7A 3DJ9A 4XP4H 1TNNA 1S9XB 4I1NB 2BY1A 1KTDA 3I85A 5CNHA 1IAKB 4UOQA 1DBJH 4PJAB 3PXJA 5IQMA 3RY6C 1QFHA 1ND0B 4ZQTA 2X44D 1TUPA 4HP5A 5GZNA 4DAGL 1AI1L 4Y2NA 5CBAA 1YY9D 3EDFA 2Y0SA 4EN3C 2PTTB 3PGFL 3DC0A 2YAMA 5IQ7H 5EORL 1HINH 3B37A 3HE7B 3QJRB 3B6SA 1BQLH 1OEZW 1WCBA 2H6UA 3P9MB 4U1HA 1C5DB 1TZIA 2YN5A 4HETA 4UB0L 4X4ME 4GYBA 4G6FD 4EI6A 1RHHB 5I1GH 4TNGA 5C70A 4Z7WA 1SXNA 5C09A 2IBBA 4LSPL 4ZUVA 1I7UA 3V0FA 1JNJA 1A7QL 3AG2B 5L2JA 3OR6B 5I1LA 2IV9A 2F5AL 5CJBA 4HMCA 2AITA 3ATDA 3RWGB 2EXTA 1BF5A 3ZZSA 3M7OA 3MOQA 3KYOA 2B0SL 1MI5E 3QYNA 4NKQB 5A2AA 4QTIH 4LLDB 1NLBL 3K1KC 2YIHA 4FADA 1ZPUA 1AHWC 3AC0A 4LLYA 2FX7H 2F7RA 3C5SB 4JQIL 3TIEA 2V7NA 4HIJB 2YA1A 4NN6B 4NQSB 1XBDA 4DVBB 5B38B 3FB5A 3IDIA 3DJTA 5AZEL 3U4EB 1KNOB 2Q87A 4YPJA 3VVVA 1QTSA 1EAPB 3OJDB 5JHDD 1I1CA 3AM8A 2DPKA 4L8CB 3HNTH 4L1HA 4XOBA 1HXYA 1PZ3A 3APDA 4LLVA 5F44A 8PAZA 3MBWB 2OL3A 3PHAA 3NEXA 4KPHH 3ZYOA 4H88H 5C86A 4JRFA 4M1GH 3Q3GA 4X4MA 3HNSH 3ZOAA 1NBYB 4BRVA 4RWYL 4KZEL 2C9XA 4MCZA 3QZBA 1QLRB 1NIAA 3QUMH 4NIKB 2G3MA 1Z5LB 4AMXA 3UTTE 1D9KC 5IB2B 1ZXKA 2I32A 3VCLA 2DQHL 3V52H 3FOMB 4JHUA 5CEXA 5JPMC 3IAGC 1OGAD 2XTJD 3C6LA 4X4YB 1PD6A 1VZIA 3DUUA 3PHOA 3WNPA 2YMTA 3QUYD 4WI6A 5D70H 4HIPA 1TG8A 4JRXE 5IY5B 4AGLA 1ZHBA 4NKDB 5FUCE 1MI5A 3D7PA 2H7WA 1WFUA 4MJID 5H4ZA 3GSNB 4UT9L 1BVLA 5LCVH 1KCLA 2ZIDA 4N0CD 2RACA 3H3KA 4BRJA 3IK2A 3JXAA 2H1XA 1SJEB 4Y2OB 2OQJB 4UINH 3WYRA 1WWWX 3SPVB 4G11A 4JY6B 1L9RA 4JPKH 4P4RA 3FMGL 5D1ZC 3IDYB 3N2JA 1FN4B 2EIDA 3FB6A 4CU7A 1ID5I 2J1WA 2D8KA 3FCTA 5ADPL 5HGBA 5CHNA 3DX9A 3GHEL 1XH0A 2WKGA 1G0YR 4WDIB 3LHAA 3ARTA 5B39B 1C16A 1U6AL 1NAMA 3F00A 1YPZE 2A9ML 1S9WA 4PQXA 3BAXA 1ADQL 3UTTA 2GTZA 1EK3A 2NDGA 3GMPA 2VMJA 3L3OA 3AQXA 4W9EC 1FPTH 3CH1B 1OALA 4NQCD 4PVNA 4H26A 2OMWB 1L9PA 2BJML 2QR0A 1Z9PA 1N18A 3KPSE 2VIRA 3BMVA 5DVMA 4WUUE 2WLIB 3X12A 5CJQL 5D1ZI 2JIXB 3RWEA 3QNYB 2GJZA 4JFQB 3MGTA 5TPWH 4XNAA 3HI1A 1GOGA 2A6KA 3FU9A 4X5XA 5FDWB 4KTGA 1FP5A 3D52A 1JS4A 5IHUL 2LU3A 3B4NA 2WPGA 4ZX6A 3QJVB 3E1ZA 3ES6A 1UD5A 1XSKA 5EF3A 3HKZA 4QWWC 3U82B 2UX7A 3BPNB 4XC3H 1FNSL 4XO4A 1YUKB 3OX8B 2W0FA 3UG5A 5C08E 3VQ1C 3RYMA 3ZYZA 2P49B 2WXKA 3GHBL 1D7BA 1QSED 1XF1A 5K69A 4JVWA 1H3PH 2YJLA 4FQXD 3TZVB 8FABB 2Q10A 4P2YA 3VJ6A 2VJ8A 3JWDC 3K1DA 4BHUI 2BFVH 3WY4A 3BC9A 3EJSA 4U49A 5B3NA 3NAAL 3U9UB 1JXFA 3V0GA 1G9ML 2R4SL 2C5DC 4NXKA 3V8OA 1T4KA 3GXFA 5BRZE 3DSFL 5TE4L 1U58B 4CGTA 1IE4A 2CDEB 5JOFA 2Z6FA 3J27A 3FL7A 1RK7A 1KXHA 4NM4L 2BIOA 3LIZL 3WFZA 1E6JL 2BOLA 1K3ZA 2BINA 3HE7C 3MRGA 3O4LD 1JL8A 4XXWC 3MJ8B 4E5XA 3FB7B 1ZHKB 1OGTA 2XN9D 1BQ5A 1CD8A 1T2JA 4HGKC 2FT7A 2NQ3A 3RIFK 4GT7A 1EA9C 4JHZA 5IKCA 2H3NA 5FHAH 3DHJA 1EDQA 1CDHA 1T7ZA 2VXSL 3EYUH 4DN3H 3DV4B 3LOWA 1JGVH 3SDAB 3L3KA 4M6NL 5C9KA 4J3OG 1H0DB 2XYBA 3C5ZC 3LKQA 1KZYA 3EOBA 4RX4A 5HHQB 4Z8FL 5KBNC 4IYKA 2O5ZH 5C08A 1MW1A 2BVQB 5IFJB 3BP7A 3BPOB 4BFRA 1CXHA 4D0DA 3ULVC 5LBSL 4Z7QF 2O5XH 1KN4L 3BP4B 5A2JH 2HLFC 1Q0YL 1TMCB 2BY0A 5LGKA 3NCJH 5CJOH 4M1CD 4HPYL 4PLKC 5BRZA 4PJEB 3RIAK 1K6QL 2ZUYA 5BS0E 3MNWA 4MZRA 5A3ID 2WWNA 4R4FL 4Q97A 3JBG7 4XC1H 4F2MB 2IMMA 3UPCA 3UG3A 3WD5H 3EOAB 1OV8A 3FF7A 3LZRA 4JKKA 2MMXA 5KTEH 4G2AA 4QRPD 3PABB 4ZFZB 3TNMA 4HKXA 4AGQA 2JCCF 4GKLA 5LAPA 3GSWB 1THAA 3CFBA 1A7RL 1EZUA 1FNGA 1QBLL 1RVFH 3E6HB 5IQ9B 3F7QA 4M7LL 2BVEA 2BP0B 2E8YA 4QAWA 5DLMH 4K7FB 5T1LA 2XX0A 4WJG3 1XB8A 3S96A 5CIPA 4RESB 4XPHH 4JRYD 3RNKA 4FOMA 5KSBF 1PZ2A 2VLRE 4F7PB 4RMSA 2Y07H 3QIBB 4KMTL 43CAB 3VD0A 4EKJA 2AQQA 3CCHB 2X70B 4KXCA 1LO0H 2R0ZH 2LE9A 1U95B 3HN8A 4V33A 3VXRD 2WSPA 3WTTA 1U8MB 2DQTH 5EN2B 5FX3A 4I85A 3QUGA 3FCUB 1DCLA 1S6NA 1U93A 3SKJL 3GQFA 5FCUH 3E9TA 2EIZB 4Q7DA 5BS0A 1PW3A 1U8HB 1MCQA 3JWNH 4EZMA 2X6VA 1HIMH 3O2WH 1QLFB 5F8QC 3S8GB 3IDYC 5JLZA 5KSUB 3EJYD 3D4YA 3ZTCC 3NFNB 3IMUA 4UQ2B 1CR9H 1E4KC 1XCTB 3QEQE 4JFVA 2JLLA 5B8CB 3MRBB 3BJLA 2CCVA 4CRPA 1OTSD 4FXGB 3NACH 1A1NA 5M95B 3VH8A 3F65A 1FZOA 5GRVL 2EUVA 5ESAA 3W11D 1SXZA 2Y5EA 4IRSD 5TE6H 4ODTL 3WDIA 5E4EB 5EBMB 4OY9A 2R0KH 2VO8A 3NSJA 4RIRB 4WFFD 4L9LB 4OBSA 5F96L 3B9AA 3T9WA 3TM6A 4XXDA 3KW8A 3QZOA 1CF8L 4BSVB 4BA8A 2EILB 1EGJA 1RZGB 1QRNB 1RFDL 5HVWA 4NKIH 5FM5O 1LNUB 2ZX6A 3SB3A 2DDQH 1YNLL 1KTLB 5KVMC 4JFXA 2YEZA 5BRPA 4XVSL 4HGWB 1DQVA 1IIIA 1FC2D 1I8LC 1JZJA 2YZ8A 3FUIA 3QG6A 3MHZA 4PSPA 1G9NH 1KELL 2K6WA 4PJGA 4YLQT 2EICA 4IBWA 5TDOA 1GH7A 4QO1B 4ORGA 4KNUA 3L1OL 5EG6C 1JGIA 2GSGA 3BPNC 2N4IA 3GMNB 3BUDA 3ZRSA 2EVFA 3VFMA 3QEQA 2IEPA 2JQZA 3H3PL 3IJEB 4GKZB 4HJGA 5GISL 4FEMA 4A2MA 1HH9B 5KYXB 5DS8A 4JO3L 4KRMB 1IU1A 2EEAA 3WUWG 3ZE0E 2LV4A 1QR4A 4XN5A 1QW9A 1D7CA 1PYWA 4XCCH 5F1NB 3U0TB 2KKQA 4Z5RA 4JKNA 2OZ4A 3I6LE 3LZFL 1CDCA 1GYUA 3FFCE 2OMBA 1QSFE 3L08A 1OAXH 4HH9B 5HGGS 3HMXA 4PIBA 1F1AA 2GVYA 4JGMA 3I9GL 1B0WA 2Q7YA 1SJVA 3VFWB 3N41F 1LMKA 1IKOP 2ZWSA 3HHMA 3OKOB 4FZ8L 4PIRF 5LNGA 1U41A 1LEGA 2M83A 2CM5A 2NW2B 4WI2A 5CZXC 1JRHH 5BV7B 5LXVA 4HS6B 4ZAKA 3L3GB 1OE2A 5AZ2H 2KLTA 2ZCZA 5ISZE 1XCQA 3FZUC 2CLZB 3BEVB 1QACA 4PH8A 1QR1A 2C3VB 1DP0A 2CKBB 3P77A 4DQAA 2NDFA 2CUAA 5GGQL 5ICZB 3U46B 3BPOC 3ZMEA 1SHMA 1IAIH 1ML0A 3NRPA 4MJ4A 3CPLB 4NBZB 4ZFOB 3VQ2C 1T03H 3CDZB 1R3JB 3I6GB 1WG3A 2BPBA 4MYWB 4A6YB 4U6HB 5IEKA 2QDVA 2PXYD 4N2EA 4KOBA 4ZFGH 2YXFA 4WI3A 2IDFA 3HAEA 2ZOOA 3B56A 3W5NA 5KSVB 1BQKA 1QVOB 1INQA 3FFCA 4DW2L 1GAFL 1HSAB 1V27A 2HFTA 4L5FL 3O9WC 4O2CB 4Z0XA 1E9OA 4X7TB 5IEHB 4PGDA 3BWAA 2DBLL 1F00I 3BGFC 3T0BA 1SVBA 4WEUD 3MRJB 1EVTC 3HG1D 3RILA 3V8CA 12E8L 4JM2B 4RAVB 3FW6A 3MV7E 4M93B 5HDRA 4HKBB 3T4YB 5HD8D 5JXED 3CFDB 1Z5HA 5DEFB 5C97A 2Y6TE 1YYCA 4FQPA 3KPOA 5ISZA 4KTDH 3QQDB 4OCSH 2FO8A 5MEPA 4AK2A 4P23B 3S35X 3I9PA 4TQEL 4JY5H 2QTEA 3TJHD 4YSQA 4C47A 3ZR6A 4AGMA 5JHBA 2IGFH 4B95C 3VXME 2Q1EA 1D5XA 3ARQA 3AITA 3UPRA 3G5YB 2MOGA 3TT1H 1MAMH 4PCKA 3VXMB 2CHDA 4NO2A 3ETTA 4PHZA 3WIFB 3O3EA 2FHCA 3X1NA 4K55A 1NGZB 4J1UB 1FO0H 5ICXA 1HH6A 4U6YB 3S88L 1G7LB 3TBCA 4TRPL 4JS7A 4N8VG 4MCNA 1BGXH 3NOIA 4AMWA 3N1MC 1JCVA 3MA9L 1F86A 1AZCA 2AJZB 1H15A 1W15A 2EEBA 5B21A 3S4SA 4S1RL 2IQ9H 4ZS7H 1JWUB 3GMMA 3RLSA 2J2ZA 2GAZA 1A3ZA 4FQJH 5D7EA 2CK0H 4YSPA 5GSRB 4OGAD 3MV7A 3V7MA 5JR1H 4RDQG 3QZWG 2YRLA 1HOCA 2IBGA 4KZCA 2XOTA 5F1OB 1ZOXA 4MTMA 2EE9A 5E4EC 1JPTH 2J6EH 4LSSL 3MUY1 1Z9SA 4QXGH 5HGHB 4ZPTA 2ZKMX 3CJJA 5TQ2L 4EI5D 4PRHE 2XTSA 3LKPA 4QXTB 3U7YH 3WE1A 5D5ME 3FU7B 2BVPB 2ADIB 5AB1A 4L9LC 2HKAA 4GXUN 4UM8A 1JPSL 1VGEL 1SOQA 1K5NA 3VXMA 1EWHA 3D2TA 4L4TA 5MI0B 2NXYD 3OSVA 5CJXA 1YAIA 2MKLC 5C3IA 5LHDA 2QHRH 3VGDA 4F8QA 1FIGL 5FKAA 4PG9A 1SLXA 3IEAA 4L8BB 4Z7VB 4NS0A 1KCUH 4JB9L 3PV6A 2NUTA 1S7WA 2X1WL 2XSKA 5LG6A 5C0BD 1TYEB 3NA4A 1T1WB 3VSQA 1A6WL 3VWJB 2WXNA 4PWEA 1ESOA 4JHWL 2WQSA 5ERWA 3SSGA 3QH3B 4AUJA 4FCAA 4LBAA 3MBXH 1NFDB 3F3HA 1T89A 3S3CB 1J5IA 3D85A 2D31A 2IAMA 1H3GA 2ADGB 4NKOB 5FECA 3RJQB 1KZQA 1J18A 2HVKA 3HN5A 3P2TA 4WO4B 4OTXL 4KVCH 3ARSA 1BZEA 3MGOA 2PO6C 1CC3A 3PPSA 4GEIA 5DUMH 4DGIL 1C7TA 1ACXA 3B7UX 1LWHA 1D2OA 3OKEA 4I48A 4PRHA 4A7UA 3KDMB 2CSPA 1TZHB 4E9LA 5KYUB 2R23A 4OIFA 3NCYP 5GS2H 1G4RA 2XACC 2IPTL 4NN7C 5GJTL 5T1JA 4D0BB 4H5SB 3S36L 3TO2B 3D09A 3BXNB 2JNZA 4HHGA 1TNMA 4HS3A 1MI5D 43C9A 1T0NB 3IE4A 1JSYA 3WFBL 5FKPA 3QDHA 2V5SA 3OGCA 3DBSA 5D72H 1HL9A 4PJBB 1XF5B 32C2A 3NTCH 4ZQKB 3TPKA 5J6HB 4UI2A 1RUQH 4TL4A 3D0VA 1IO4C 2IQAA 3P3SA 4F1SA 1SFHA 5DA0B 4ZXBC 4AT6B 4XOAA 5HYJD 1NGYB 3KPTA 4LPWA 5EO9A 1ZT7B 3MXVH 3WLWD 3T3PB 1BSIA 1FFQA 4QF1A 2RFXA 1MCHA 1NANH 4TULL 2V2XA 3RI5F 5AYUH 3DYMA 3ZL4H 1SVCP 1UA6L 3EGSA 2VL5B 1SJMA 3INUH 1E4XH 4DOHB 2VXUH 2QT6A 1PZSA 2ADYA 3V4VL 4M48L 3RWCB 3MZGB 1BIIA 2I26N 3OKKB 4R7VA 1PNCA 1L0PA 3O2VL 4F5CE 5DRNA 1MY7A 5HGAB 3II2A 3TA3D 1YN7A 4U3HA 4K8RL 5C6PB 5DYOA 1OSPL 2EIKB 3FQNA 1P1VA 4G42B 5KBLA 3D05A 4PJIB 5I6MA 4HUWA 4JANA 3IRZA 4JRXD 3TN0C 1HEJC 1R1CA 3HBQA 2LABA 3GRWL 4FLHA 4M93C 2A4EA 1S7TA 4XMLH 5F7BA 5EA0H 1M2VA 1PX4A 4NNXB 4MJHA 1OD9A 3VXTB 3QXDB 4FG0A 1JV5B 4JQXC 2GEEA 1A6ZA 2YD8A 4O02A 2C1PB 2DS4A 3A5VA 4P23C 4Z7IA 1N10A 1RSFA 2BRRL 4JPSA 3G6JE 5D1XA 4GRMB 1BAGA 1J88A 2ICEB 2HFFB 1SDYA 4O58L 2K6YA 2CNZA 5D2LF 4HUKB 1YEGH 3ZTJH 3D0LA 1JGLH 2HZHA 4OB5H 1K8DB 2B08A 2HJKA 3O3AA 4OQTL 1YNTF 4LDLB 4JN1H 3ZHDA 3QJFA 1A7PL 4JL1A 5D6CB 2CLVB 2J44A 2X1QA 2WXGA 3P11L 2WXPA 1DBAH 1TVDA 2E7DA 3ILPA 3MRDA 4F5CA 3DX4A 3M07A 2P43B 3UBXA 1C5BL 3KL5A 3GRGA 2YRZA 4GPVA 4FZEH 4BSJA 1WTGT 3DVFA 5C6TH 3UYRL 1EO5A 1ZLUK 3NPSC 5IROA 3EJRA 4QRRB 3H7BA 2DV6A 5E08H 1J1XL 3EJPA 3HG2A 3KPSD 3PXHA 5CN3A 3ZT5A 1IFGA 4WUUD 5EUOE 4APQC 5ILTL 6FABH 4O4YH 1J0IA 3AABA 3BSZH 2VDKL 1QBML 4FLQA 3F7PC 4S1DC 1CBJA 4K5NA 4WW2A 3QG7L 2WIMA 4NLAA 3ABLB 3G6JA 4O2EB 4WWNA 5LNDA 1NSNL 1U8CA 4QKTA 4WO0A 3WTYA 2XPZA 3ILDA 3MFFA 1LGVA 4JO1L 4EIZC 2F19H 1FNEA 3RL1A 3MLRH 5JOEA 1RQ5A 2I69A 3OR7A 4E41D 4NO3B 3EYVB 1WTLA 5MI0C 1AQMA 3WSQH 1EO8L 4HS8L 4P4KB 2ZF9A 2XPYA 5EOCH 3ZDYB 3OKNB 4AWJC 3OGOE 2MCAA 4KI5C 5KUKA 4WSJA 4CGUB 2OMZB 3S48A 3UAJD 3ULUC 3FPXA 3U1SL 5E1QA 3GTVA 1HCVA 4KJQC 1QFPA 1TQVA 1JD7A 2WXQA 2EACA 1V3KA 1BAFH 1XEUA 1ZXQA 3WNIA 4BQ6A 4IRZL 3UROR 3F7KA 3UGUA 1N64L 3QDGB 4YPGB 3VWJC 3O45B 4JJOA 4UTBH 5JA9A 2YAHA 4OZFG 5TDPB 1T2XA 5EUOA 1YQ2A 3QEUB 1I3RA 3EHBD 1Q0EA 4MXVF 5BUPA 1SOKA 4UOW1 3TVMA 3O0RH 3OXSB 2F1BA 3AVEA 5H94A 3SYCA 3B3IA 1SF5A 3UABA 4LCCC 3QUMB 2OJZH 5CZVL 4OZIB 4PJ9A 4XB8A 4MAYB 2MTAA 4LP8A 3KLQA 5KANG 3WO3B 4KUZH 1FL3A 3QFJB 5SX4I 1U8PB 3S6CA 3DRTB 3QYCA 3SCMA 1MH5A 1UXWA 1TZGL 2KHAA 5E5LA 3L3HA 1V7ML 1NH6A 3P30L 2PF6A 3AZUA 5CP3A 1DO6A 5DVLA 1MFBH 2EDKA 4HFUH 3WMSA 1A4JB 2A3TA 2CDGB 4HUMB 3VFNB 1JWMB 1QKZL 2Z4QA 2YGOA 3AMLA 1NAMH 3TCLA 4WEBH 4GI8A 3D25B 5EZIL 1DVQA 5HHOB 5EEZA 1LTXA 2A9CA 3TV3H 1XGQB 4WNSA 4AEHH 5EIIG 3PY9A 3BZ4B 3IS1X 4OR1A 4HCRH 1BD2B 2IAAC 5AVWB 4LOEA 3N43F 4I0KA 4K94C 2OMVA 3EJQA 4AC2A 1NDGA 3AREA 4KKBD 3V6ZB 1CBVL 2EXWD 1BBDH 3ZUNC 5TF1H 3QUXA 1IGYA 4KQ3H 3RL2A 4TVPD 4FL4C 5C7ZA 3PQYD 2HFEA 4Y4HC 4OIIH 4ODHL 5J13B 4NNPL 3LRLA 1ORSB 4LCIH 2ADJB 2VDLH 4OGXL 4F8NA 3OV6A 1J05A 1A3LL 5DGRA 5KBPA 3SYQA 1NGPL 2FEDD 4BFEA 3VXPA 4X0KB 1AFVH 3ZR5A 4L3FA 3HCVB 1P7QA 5DEGB 4OZGB 1A8ZA 1JYNA 2SODB 2VLRD 3DX7A 1A47A 3NZ8B 4OCYH 3RFZB 1OM3H 5D1QC 1P5UB 2QHLA 3CIAA 4GG8A 1TJIL 1MSPA 3MRRA 3FQ2A 5FB8A 1IM3A 4PS7A 3SZ6A 4A2EA 4X9FA 4M1DH 5FFLA 1ETZB 1MWOA 1H5BC 3L5WA 1PY9A 1YDPA 4DF9A 3ZO0A 4F33A 1S3KL 1USZA 2IFFL 4KO7A 3G5ZA 1L9MA 1T7XA 4N5EC 4D8PA 1DEEB 3TBYB 3OAYK 2ICEC 4FAAB 1I31A 1VFBB 3QNXB 3Q44A 4BV1A 2F74A 4IRJD 2R7EB 3QORA 4PTUA 5FYKU 2DM4A 4G6FB 4G8GE 2E6QA 1IGMH 4D7PA 2AEPL 1N0LB 1ULVA 4HX1B 1N0XL 3Q1SL 5DJDA 4F2EA 4BH7A 1X5KA 1RMFH 3DBXB 4X50A 5GGSA 3MR9A 4I3SH 4PUBL 5BO1L 2W80C 3HMWH 3EO0B 4FHJA 3TTSA 1RIHL 4LSQL 3R06A 2TAAA 3MRPB 3VFVA 3BUTA 3FH5A 4FFWC 4LEOB 2MNWA 2J55A 3DIDA 2HVJA 1Q9OB 3U7WL 5E7FA 1U8IA 1GGTA 4PRNB 3GSQB 4GW5A 4JFZL 3EUDA 3GRBA 3P9LA 1DL7H 1CFBA 4UILL 3QXWA 4WAFA 1KCSH 3SBPA 3V0DA 3P40A 1RK0A 5JHDB 2MJWA 5AAWC 4JPWH 1HS6A 1IQWL 3WTWA 3PREA 5L7XH 3KCPA 4WI7A 3UC0H 5D7JA 4P8QA 4ZAKD 4E9QA 4N24A 2EVIA 3E8VA 2YPLE 4P46C 4X80H 4JDVA 3VM5A 4Z78A 5F9JA 5BOPA 1FIEA 3S3BB 4G8GA 2FH8A 5F7KC 3NIDF 4JQIA 3ULVL 4YHIA 2W0LA 4GUQA 3N0AA 1KLUA 2GSIB 2A9AA 2GABA 4DO4A 1F8TL 4G5ZH 2PR4L 4X7SH 4R6UA 3VTMA 5CKGA 5EH1A 5F0PB 1YEJH 4HZLA 5FAAA 2XTJB 3MPCA 5EZLB 1C1EL 2WY3B 1HZLA 3TNNA 4J3OF 3QUYB 5FO9A 3OKDB 1A4AA 5DMIL 2E86A 5AW3B 3ROLB 2VXVL 3PWLA 3K8KA 1IT9L 2AQTA 2FX8H 3FFCD 4N2MA 3W1ZA 3FS9A 5FW7A 1QSFD 4MJIB 1I3UA 4G59C 3DIVA 3L1FA 2ZCHH 1KCBA 1RLBA 1Y6KR 2DAVA 3U0PB 1HHGB 3F83A 1Q72H 4H0IA 1NCDL 3X2QB 2ITDA 2XG4A 3KLKA 5T33L 1AS7A 4YSAA 1JIBA 1ZIAA 1HC1A 1X9RA 4MAUL 2FJFB 1XAUA 4PLJD 2BS8A 4LLUB 1JZGA 2CU9A 2CRZA 3CDGB 4P05A 3MUGB 2ZKYA 1VGKB 5ESVB 2YAEA 4NQEE 4W9JC 4PWHA 4OVUA 4JZNA 3CFCL 5DJAA 2WQRA 5ISZD 1FH5L 3GIVB 3IETB 2YPLA 2EC8A 2FD6L 3POCA 4UT9A 1CURA 4FP8H 1D5BA 3HZMB 1NINA 1TQCC 4HUXA 4PV9A 1XMWA 1JZ6A 5T5FL 1J7VR 3LS5H 2V7HA 3VFUA 2BP8B 4O51B 4Q56A 3GSNL 5HJ3A 2GIYA 4NQCB 3C5JA 1WZMA 2P52A 2LTQB 5EU4A 1CCZA 4WLCA 3LEVL 4NQQA 4AIXA 2WAQA 4DP9X 1MFNA 4W4OA 4YO0A 4HJ1A 2F8OA 4HK3J 3FRPB 4LSRH 1AANA 2DQGL 1ADQA 1AXTL 2GITB 2NLJA 4GAJH 4LSTH 5D4HA 4WGKA 4B5ZA 5JXAH 1I85C 1T3FA 1YQVH 1XR9A 4HPOL 5J13C 3O8XA 1DUZA 4AMKL 5HDWA 5L9DH 3FUDA 1A5FL 4PJ7F 2ZSVB 2V5YA 3VTAA 4NQEA 3KLAA 3A23A 4B6ZA 5JIMA 1B4TA 1QATA 3ZZQA 2NY3C 5FUZH 2CRMA 3QXAA 3DX8B 1QSEB 1YECH 4J5VA 4HAGA 3GB7B 3V55A 4FQXB 3DPBB 3FB8B 3GMQA 4FNTA 2L7UA 1U92B 4HIHA 4KTEL 4XPTL 3KBPA 3GSRA 4L8DA 3CU7A 1S2EA 4ENED 2R83A 2A9BA 5A7EA 2H9GB 2GBVA 2DQEH 2OZ4H 3DUSA 3SPIA 3CXDL 4FULA 3DARA 5IW3A 3MNZB 4FFZL 4K4KA 4P2CG 4XP1H 2B1AL 3O41B 4OFVA 4CU6A 4MJ6B 4Z7QE 3LV3A 3O4LB 4DKTA 2ZOLA 3DJRA 5DJCB 2XN9B 5DD6A 2Y7OA 2HKHL 3PNRB 4MD0B 1B0GB 4J6RH 3US0A 1ZCRA 5JZ7C 3NFSL 3KLLA 3V5HA 5DR5H 4QRSB 2NSXA 1WZAA 5GS0L 1H6UA 5F7LB 1X5JA 1I8IB 1JTTA 2VR6A 4LHUG 2X87A 3LIZA 2Y7MA 3KWUA 1BHGA 3MCLL 4G7QB 3H0TB 4R8WH 3F58H 3SIKA 5GJSH 3MYJB 1H9DA 1P4LB 4JPVH 2JCCE 1ZDSA 3HI6L 4PRHD 2DZEA 3QPKA 2QV4A 1YEDB 3FULA 5DO2C 2X88A 1CLZL 5KYWB 4HG4J 4JKMA 5AEAA 4U4BA 4EIGB 5JMOC 2W0KA 1I9IL 1QPKA 4G3YH 3Q8BA 3PV7A 2ZCKH 5CEYB 5EU5A 5IHLB 1JK9B 3WL9A 5DFTA 2LVCA 3ARFC 4R7DB 3C8DA 4HQQL 3UBHA 1N59A 5I1CL 4L9DA 3HEIB 5I8CA 2XXFA 4Z77B 4I87A 5LBSA 3IU3A 3IMRA 3W39B 3INOA 4QRPB 3WFEL 1CL7L 1SM3L 3NDYE 4XGZA 3SGJC 2FB4L 2ID5A 3B2UD 1GTNA 2V9UA 3ISYA 3TWCL 3U48A 2UXTA 3QFDA 3QUKA 4JPQA 5KG9A 3ABZA 1Q94A 3ENEA 2NZ9D 4JRYB 2LU5A 4MJ5A 5TFSL 1GC1L 1JCKA 2XTJC 2EKSA 1UM5L 3TP4A 3HC0B 5KVDL 1U4FA 5E8NA 3SQRA 3VVWA 5I75C 1JWSA 4UUJA 3W9EA 4HXBL 1L5GB 2VAAB 3VXRB 1WZ1H 5M7QA 3Q6FA 2FBJL 3BH4A 5EU6E 4DOHE 3KZ8A 3FN9A 4HIEA 4PY7B 1ACYH 3RGVD 2D2OA 4HDIA 3UAEA 4KO6A 1DR9A 2GIMA 3BUPA 3PIQB 3UJJL 3ILQD 2WBKA 5GS3A 2DQFA 1TJGH 4OFKA 1CVRA 3BT0A 1JZDC 4KHTH 2GW5A 4LEXL 1NCBL 4U1JA 4YFEA 1JN6B 4K7PX 4UYPA 3ZE2B 3QAZB 2IXQB 3VE0B 3QRGH 4A7QA 3ZHLA 4D3CL 3QIWC 3PLYA 4ELKB 3NUKA 2UWEB 1P4IL 1YYML 1UACH 2R1XB 4NWUL 4OD1H 3WS6C 5JW5B 5C0AE 2Y36H 1S5HA 5HHVL 3QVAA 1EAJA 5E2UL 2G2NA 5FF6B 3WOVA 1V05A 3NSDA 1PNDA 5I0DA 1IBGH 5F7DB 1V54B 3WN5C 3RX9A 1DDHA 1G7HA 4GKSA 4DPCX 3DSNB 1UGKA 1FO0B 3BE1L 9CGTA 2CO1A 2AMUA 3GS7A 4NUGH 3DX6A 3JWNC 1INEL 4P2RD 1T1YB 4IOSA 2EZ0C 4M7ZC 4RMQA 2MIZA 5EU6A 2A1WH 1OAZL 3Q7JA 1E0OB 3G5VA 5AW1B 4HWEH 4QEGA 5I74C 4B96A 1NM9A 2N7BA 4GQRA 3FO2A 1BZ8A 4XB3A 2ZAIA 1LO2L 4H1LH 3FSZA 4YHZH 1OZUA 2FQGA 2J6WA 3TBTB 2VDRH 2ZYSA 2OYPA 4IBUA 2JFCA 1WHPA 5A16A 3DMMD 4OH2A 4RQQA 2W07B 3QS3A 3VUAA 2ZWYA 3PGCB 3EFDH 3N91A 4IDJH 4AL8L 4IMLA 2I9TB 4DK5A 3JVGC 1T66D 1F02I 4NWTL 3K71A 1LDPL 5C07E 2DLIA 3CAFA 4OT1H 4NZDA 1CXFA 4A37A 4XP9H 3VI4B 1OO2A 2Y06H 4RSVA 5J0BA 3X14A 4BCYA 1PU0A 5DC2A 1A3QA 4GW1B 3I9IA 5C0AA 1KB9K 4MSWA 4H2AA 1JMXA 2C4FT 1NLDL 1ETA1 1Q1JH 4KXZH 3E8UL 2EDEA 4BFFA 2QZ5A 3OSKA 4RDQF 5D7IE 5L0QC 3TU6A 4OLXH 2X4OB 3L6FA 1D5IH 5DK2A 3VD9A 4OAWA 1ROWA 3MROA 2WAHA 1YEEH 1XIWC 4Z3HA 2I27N 5BZDA 3A21A 4PMFA 2D7TL 4N2HA 4NJAL 3RTQA 1QEXA 2Y1VA 5HI5D 1BQHA 2FWLB 3H54A 3MGAA 4QAMB 4BJLA 3LH2L 3H4HA 4HULB 2YAFA 5IMLA 4F9LA 3GTNA 3N06B 4PVBA 2GK0B 2X6UA 4Y1AE 1DVXA 1NCAH 3RDTA 1GYVA 4L5FE 3ZKMC 1FSKB 4Y5VA 3SOBH 3MODL 2JXMA 3H85A 4IIQB 1AG6A 5H4YA 5H35A 2VYRE 4JUTA 3RVWC 5I15H 3M8OH 3OLIA 4G6AC 3DOIA 3IDMB 2VN4A 2CJ3A 2X1OA 3MRLB 3MXWH 3GBNL 2EAEA 3FTGA 2Y25A 5IG7B 3TFBA 2UY6B 1FV1B 1EQWA 5CILH 1S46A 4KGLA 2J25A 3DUHA 2EECA 4LIQL 3SBWC 2DI8A 5D7IA 4ZYKA 1J8SA 2BZCA 2WIIA 4QD2E 2J20A 4U1SA 1X6NA 5IBUB 4X4KA 3DURB 4R0LA 1MCPL 4G8IB 1R33A 2BSTB 2E9WA 5BV7L 4TN9A 2Z93B 4AEIH 4D9QD 4U1GC 2DLEA 2VSDA 4MS6A 1MF2L 2WXJA 1ZVYA 4F8TA 2X6AA 5C0GA 2UZYB 3HG1B 4I0CC 2CKBL 4AIZA 2B77A 1FNLA 2DD8H 5KYYA 4J12A 5ANME 1BZ9B 3AS2A 4ZFOL 3WTSA 5IP4A 1N70A 1RUAH 4NT6A 4XMKH 5BUAA 5AL0A 2PW1A 4A6YL 3JWOH 4JZJA 1PCSA 1QRKA 2W1NA 4Y1AA 2OFQA 3QUXD 3N40F 5H2BB 5SWQB 1IMHC 4XN4A 1X7QB 2R2CA 1UCBH 3PNWA 4M5TA 3ABMB 3D5OF 4O2FA 5BW7C 2MHAA 5E0QA 2WXOA 2FBRA 4OGZA 4M7KH 2QPEB 2BIPA 3QIUD 1WBYA 2PWFA 1MAJA 1ZHLA 5T1DH 4AY0A 1AP2B 3SD2A 4XNXL 3IMVA 3BW9B 2ADFH 3SJVE 1LE5B 4NIYE 5TTRA 1JAEA 4MZIA 3HR6A 1OY3B 3CFEB 2KLRA 4GMSL 5E0FA 1VPOH 4ONHA 3EYFA 1IAII 5I0VA 5GGTA 2DMBA 4GBXC 3HRPA 4P5TD 3K80A 1TCMA 2X89D 5IVXB 2YPKB 5BJTA 3V4UL 4YDMA 2VZ3A 4N2BA 5A2LH 1QYGL 2N56A 2NX5E 4IHOA 3QAZC 4QGTA 1Y18A 2DQJL 1LP9F 2CJTA 5INCB 3MREB 4Z1PA 2HRPL 1DN0A 1RIVH 3CLFL 2XTLA 3D39E 3MLZL 35C8L 4NENA 1KEML 3FQUA 4Q9BA 2EXSA 3X3FL 4ZMNA 1U42A 1DE4A 4HT1H 3HUJF 2NR6A 2R69L 4OLZH 3STBA 3CLEL 2H2SC 1RULL 3K6OA 4G8FA 3RDJA 4EI5B 1OB1B 5I1EH 4K0OA 4HBCH 3T6VA 3RY5A 5AB0A 1U3NA 4JG9A 4U3SB 1D7FA 3SJVA 1RK1B 3UCQA 2AEQL 1EXGA 2VMFA 3CFIC 1UQSB 1FG9C 4R84A 5MENE 4HUVB 4KC3B 5E9DE 3KYOB 1AKJD 1WAPA 3PP4H 5FR3A 3POHA 4M6OH 2EQDA 1AGEB 1T1ZA 3CFQA 4GXVH 5FYKD 1VCBC 1WAEA 1HKLH 4LLYB 1W16A 2NX5A 3BKCL 5C0BB 3TIEB 1AO7D 1FJ1A 1QNZH 2F54A 3FUJA 3IDIB 5AALA 4F3FA 1FA4A 4NI3A 3CUPA 3PAUA 4NZRH 4GOSA 5FYJU 4HU8A 3D39A 3WHXA 1IKNC 4OJEH 4FXKC 2NY7H 4BKSC 2DYSB 3H6AA 1U91A 1ORQA 2VDNH 3HE6D 4GP8B 3RNQA 4CC0A 2OTUB 1MJ8H 2VDPB 4H0LC 3S5LB 4TVUA 5JHLH 2J88H 3GK8H 1DN2A 2EIMB 1H8OA 2FH6A 2VQ1B 4KZDH 2Z31C 3VDBA 2VLKE 3MZTA 3VYOA 4ELDA 4QLWA 2H41A 4L1BA 3O6ML 2QQKH 5ES4B 2AXWA 2KZWA 4MBOA 3C08H 5KEZA 4N2KA 2Z7ZA 5DRZB 4AYMC 2P7TB 2R8SH 5IW6B 3RVUD 3R19A 5CP3H 5AVRB 4HU2A 4TL5A 2DH3A 3VRIA 1ZHBB 3WIHL 5E9DA 5MENA 1C9SA 4WHYH 1HZKA 1MI5B 1IC4L 5FW6A 3CHXA 3MRCA 1HDMA 3A6CH 5HGDA 3KXFD 4OCXL 5ALBH 3IFLL 4XOEA 5KVEL 3VXUE 1X9QA 3MKKA 2FECI 3GI8H 4IIQC 2YGVA 4RNRA 2G30A 3B2XA 1UFUA 3D69B 5FUOL 5HYJB 1Y07A 3K6SB 2J21A 2AAVA 3NA9H 4XH2B 5DMKB 3MOBH 3F05A 1F58L 1NGWB 3LRMA 1NBZA 5IK3B 1NC2A 1F11A 1RJYA 1N6QL 2B2XL 2EVGA 1CG9A 1NC4A 3MLSH 2A74B 2X38A 4QOKE 5CHNB 4QXWA 3QQXA 3SKNA 1JGEA 2OULB 1C16B 4JFSA 1NAMB 2CHZA 2OSYA 3HC4L 5HVFB 2VLKA 3UTTB 3TA3B 5DUPL 3CN4A 3GMPB 1JZ4A 3CVIL 1M42A 3BAEL 3V9CA 2VN7A 4PJBF 4EQ2A 1YEKL 1QUPA 1FDLH 15C8L 1RJZB 5D2LE 1XGPA 3CVHH 4AC4A 1F4YH 2VE6A 4FJZA 2QR0B 2WO4A 4JRXB 1D5RA 1OP4A 2MKWA 4GSDL 4HWZA 2HFGL 3V4VA 4G82A 2ZKHL 2MRYA 3Q8CA 5HD8C 3OG6B 1L9NA 3GS4A 1S7VA 3CWGA 4I0PD 1R5VB 1W0WB 3I50H 3CFKA 2CUMA 3LMJL 3TJHC 1T0PB 1U3JA 2VDLB 3HPJB 3HZYB 3CMGA 4RH4A 3UZEC 2CZNA 5AVQB 3K2UH 4YDKL 1TEYA 5ITFA 3LH9A 4PWKA 3BUBA 3UO1H 2RCSL 1VERA 3GRWA 4BXVA 1X5XA 4JKPH 2NMSA 2F1AA 2IWKA 4WU5B 4QOKA 1UWXH 1NANI 2P5WE 2XWRA 2ORBH 4NERA 2FUQA 3Q8FA 4FYTA 5C6WH 1DQQA 3KD4A 1AQHA 3D0AA 1YPZB 4HLZH 1TOXA 1E4XI 3C8HA 1PZAA 3SE8H 2WO3B 1OOWA 3PGFH 1UKSA 2XY1A 1T4KB 5F9DC 3FUNA 4NXSA 5JOFB 5GZNC 4N0RA 4F15B 3WGUB 2KH2B 2KZKA 3T0EE 3KPSB 4MXWL 4OQTA 4WUUB 1MRDL 1F6AA 1REIA 3LHPL 4YEFA 3PF2A 3BI9X 4QHUB 5FYKH 3MRGB 4E5XB 2F8IA 5K9KA 3T09A 1OGTB 3ZK0A 2VUKA 5DHMC 2PW2A 4X6FB 1RI8A 4Q4EA 4TV3A 2C7UB 3VDCA 3VW3L 4XP4L 2VSMB 4UQDA 1NCIA 3CDYA 1GYCA 1DBJL 1PG7X 4Y19D 4RMRA 4EN3A 4E41B 1W2KT 4AIEA 3EOBB 4B53A 3LN9A 1NLBH 4C56A 1HNYA 4PAZA 4MXVE 3IVKA 4M8VA 1AIZA 3BP7B 3QFGA 4W81A 4D0DB 1X9UA 2OCCB 3T2PA 2P5WA 3ZE1F 5IQ7L 1HINL 4A2LA 2Q3ZA 2FJHB 4M8QB 2Q2LA 5DDHA 4NKMB 1BQLL 1AS8A 3BH8A 4M8UA 1G5AA 4HFWA 2WQWA 1TTRA 2K3TA 3OAZK 4BZ1H 2O6EA 5IB3B 3DVNA 2ICWB 1WF5A 5L6YH 1JPGB 2ZUQB 1RZ8B 4R5VA 5I1GL 1OCWH 1VF5C 5EOTA 5C0IA 4YHLH 4IQHA 4PRIE 1HI6A 3WNKA 4QRTA 3L4UA 2YBRB 3AM8C 3GKZA 3I2CL 3IPBA 3WMQA 4Y2DA 3CFTA 5F6HI 3EHBB 1RPKA 1VCAA 4WZ9A 1E90A 1SYSA 2HG5A 1WBZA 2W92A 4DKDC 1WWBX 2WSDA 5KJ7E 4X5WB 3HNVL 4AV5A 2HT3D 1AHWA 3CFBB 3E2HB 5DJZB 4L3CB 5C0EA 1JTOA 3NABH 2HT4C 1S7SA 3BQUD 4PRBB 4QTIL 5IMKA 3DYOA 4IRZA 4YSTA 1E6OH 3CHQA 1OK0A 2O4EA 4Y4KD 1NEPA 5D2NE 4CN6A 3TEWA 4XNMA 1SLWA 2P8LB 1XH3A 2X3CA 1EAOA 2OX5B 2BZDA 3VWKD 4DUWA 5IESL 1XQ4A 2MOQA 1VEMA 4N9OB 4O5LH 5HI4C 2QKIA 4M4PA 4H8WL 3HNTL 4YHNA 3K91A 4F7TB 4NQVB 4OKDA 1V3MA 4NDMB 1XL6A 4KPHL 1EHKB 1TZ8A 4H88L 3CZGA 1IEBA 1G5GA 3HNSL 1YN6B 2XYCA 2ENYA 4PRIA 3QUML 4JLRA 1C12B 3D9AH 3BRGC 3TBWA 1UZGA 3MRFA 5F1SA 4NX0A 1FAIL 3V52L 5CU9A 4AYFA 3KPQA 4XVUD 5JLZB 1QWHA 1EXUB 1KPUA 4TNVF 4W9FC 2A74C 4UOW0 4JG5A 5D70L 4RFNB 4ZS6D 1L3NA 4CVWA 4PN6A 5PCYA 3ML8A 1A1NB 3VH8B 3HLAA 3DVGA 3ZTNL 1ODAA 1KWGA 3L3OC 5LCVL 3W37A 1JV2B 1NMCB 3ZZLA 5D2NA 2VLRB 1J1PH 2MPAH 2YAPA 3T08A 5BXFB 1ZAGA 4LMQE 4UINL 5IB1A 1SDAB 4NO0A 1KBBA 5FUCC 4JPKL 4XXDB 4LLWA 4UANA 5ESQB 2LVEA 5IHUH 1E7UA 5DWUL 1IC1A 1OSZA 4H25A 3TFKD 1CDIA 1SDDA 3UTZA 1U4EA 2F1EA 3GT6A 2ZXBA 3S34H 4JFYA 4WWKD 3SE6A 5HVHB 1BOGB 3C09B 1FNSH 3OKLA 3BO8A 3MJ9H 3GHBH 1WUNT 2R9HD 3GHPA 4K2UL 1WHOA 4IRJB 3CQFA 2GSGB 1WGOA 4MLIA 3BH9B 1MNUL 5IM7A 3H4FA 3TBSA 5J6GB 4L1TA 2R2EA 2NY6C 3VA6A 1OT1A 4XX1G 1PQZA 1PAMA 1G9MH 3TOPA 2PUQT 3BPCA 5L8JB 2EYSA 3DSFH 4BEIA 3IS0X 1JNHB 1AHKA 1I75A 1P2CA 2X4PA 2G75A 4X6CF 5CJ5A 3LZPA 5E6ID 2NNFA 4K3EH 1J1OL 1HCFX 4Z5RB 1TLMA 1FWXA 3MLUH 1QFWH 1T6VN 2Y69B 1FUNA 1HCZA 3RVTD 4G1MB 2LLNA 3IKCA 3TBVA 1KGXA 4KROD 1E27A 3NIDE 4H8UA 4B27A 1UH4A 2E7MA 2QVFB 1Z32X 4XC3L 2Q7YB 1S9XA 1NCTA 1MHPH 4POZC 1IAKA 1X4XA 1YEIH 5G55A 3BCDA 3CZFB 2WLMA 4N0FB 1H3PL 3VGGA 5LQBH 1IEAB 1IKFH 1HNGA 4TM9A 5F9AC 2JMRA 4ZAKB 2EH7L 2DJSA 4H2CA 5LBSH 1VRSA 4FHBD 2CJSA 4LFHG 3HE7A 4EZLA 1Q0YH 3P77B 5C07D 3QR1A 3V6OE 1K85A 3P9MA 3EZJB 1C5DA 3LB6C 4JCMA 1RHFA 4PGBA 2NT1A 3ETBF 4X9IA 3ZE0B 4BKLB 3QXTA 3UYOD 2H6PA 4L29A 3F7VB 3AQDA 2X4RB 2WZPD 4KXDA 2BZ7A 4QT5B 2YWZA 5FHAL 2ZUQC 4Y4FA 3BKYH 1HHIB 3FFCB 3EYUL 4DN3L 3RWGA 3CX5K 1QSFB 2G0LA 1TQUA 2XWTA 3EHBC 1UH2A 2X4QA 4BDVB 2GHZA 5CGTA 2HTKD 1R3IH 1F45A 1KBKA 4R7NB 3EDDA 3GJFH 2O5ZL 3UH8A 1NOLA 5CEZE 4ZSOE 4U3XA 4LRNH 1T1XB 2H4EA 4AXWB 3C5SA 5A43C 4NQSA 2O5XL 4HIJA 4DVBA 1OE1A 1PD1A 5B38A 4ADGA 3U4EA 4KMTH 1KNOA 5CJOL 4ALAH 3OJDA 1EAPA 1R17A 1E40A 2XKSA 4HA1A 3BVXA 3VG9C 3CPUA 3W56A 5ISZB 4L8CA 2W9LA 1S7RA 3KWVA 7PAZA 2EDXA 2Z92A 3MBWA 4NCC2 3QI9D 4XNYL 4OSUH 3UZVB 3U4AA 3V6OA 4XC1L 1M3JA 4YDIH 1MUJB 2X2YA 3QJHB 1R3HA 2OR8A 2JVUA 1NBYA 3WD5L 3ESNA 1NUNB 1QLRA 3BAYA 5KTEL 1NGXB 1NCCH 1Z5LA 5IB2A 3UPRB 4QHKI 4PJ7E 1JJUA 4YN3A 5DA4A 4AKOA 1XZWA 4NO2B 1PY0A 3FOMA 1RVFL 4PGZA 4X4YA 5LUMA 5ICXB 2OYLA 5DLML 1IZKA 1IGJA 1ILSA 3TJEH 3K72B 1CYWA 4XPHL 5T5FA 4NKDA 5B1JA 4RBPH 1PJWA 2I07B 3MJWA 5MEOA 4ELMF 5KOVC 1FE8H 4LVOB 1OIOA 3GSNA 4DP2X 3GMMB 4ZSOA 3NCXA 1ZPLA 2DLGA 1F56A 3V0HA 3OZ9H 2GAZB 4F8OA 4GLRH 2XFGB 4TNFA 1M05A 2ZXGA 4KMLB 5E6YA 1SJEA 4KK9C 2FEDC 3H2QA 2OQJA 4FX5A 1O7SA 1QD0A 3E80A 2BNRE 3SPVA 2Y2WA 4JY6A 3UJIH 4ACTA 3MDJA 3EKCA 4GKNA 4ZG1A 5FCUL 3EYQC 1WFMA 4PWIA 1FN4A 1T6WA 4ZW3A 4TUUA 2CIKB 2G0KA 2K1MA 3SPCA 1ZIBA 4R4NC 1HIML 4XVSH 2GBTA 3O2WL 2YKLL 4HJIA 3M6DA 5B39A 4ADJA 4NZFA 2N7SA 1CR9L 4P04A 2ZPKL 3P4MA 3IPFA 3L1OH 4H1LB 1NKOA 3NACL 5HVHC 1WO2A 3CH1A 3LNDA 4QPEA 5MEQB 5FKAB 4PG9B 1S9VA 1ZT1B 2OMWA 2VDRB 3FO9B 1A8JH 3Q2NA 1TCRB 3A0OA 2IAND 4U6XA 2Q6WB 2NUTB 1S7WB 2KBGA 2WLIA 1LWRA 4JO3H 5TE6L 2JIXA 4WCYL 3QNYA 2R0KL 4JFQA 4QHMA 4QTHB 4Q8BA 5FDWA 1HILA 1UURA 4NN5B 3T71A 4OF6A 1XEDA 3S2AA 4FFZA 1ETJA 4EQ3A 2D31B 3D87B 1JDCA 5HTSA 1ZANH 5FECB 2ILLA 4N90E 2E9JA 3Q43A 3QJZA 3ISWA 4CW1B 5CGYC 3NBNA 2XXMB 3MGOB 1JZ7A 1G9NL 1J8HD 1U8JB 4X6DB 2BOCB 3NZHH 4PRHB 5FYLD 4JDZB 5D5MB 4YMPA 2R23B 4NQTA 2HX7A 4G83A 2XV3A 3TZVA 3QA3A 4XN2A 4PWFA 2PWHA 1BOYA 3C5XA 4G6JH 2YSTA 2DBJA 4V2BA 5KAQG 1GGIH 1E3XA 3IT8D 4HV8B 3U9UA 5KVDE 3CZNA 5MEND 3B34A 4HS3B 4KKAD 4PJEE 5E9DD 3TURA 43C9B 2CDEA 2N1TE 4YLCA 3OGCB 1L7TL 2E9GA 3DDFA 4ZAKC 2Z4TA 4WK4B 4V11A 2WANA 4GSRA 4F2ME 3P0VL 2WLZA 3GIZL 4QRFA 4KRPC 1MAKA 4XNDA 5J9PA 2L04A 3FB7A 4GUOA 1OL0A 5AVTB 1W8EA 4LLAA 5I1AB 2VR4A 4QF1B 2RFXB 2WC7A 4U1LB 2AJUH 4ZDHB 2V2XB 1DO5A 3EGSB 5JIQA 3DV4A 3NPZB 5HJDA 3SDAA 2F0CA 1O6SA 1CT8B 3BIKA 4XBMA 3M86A 1II4E 1H0DA 1FFRA 1L0QA 1XB3A 1I9RH 2R1WA 4JRWA 3X13B 1JRHL 4LCWE 4DCQB 4BZ2H 5EO1B 1KTJA 1H3VA 3ROOB 2BVQA 3H9SE 4YDVB 3GINA 2P28B 1FFOA 4MX7B 2VLKD 5AZ2L 2ENQA 3PYCA 4MKTA 4N9GB 1TO4A 1YEHH 4TTDD 3PXLA 3DWTA 3BP4A 2CBQA 1SMOA 3ETSA 1MIMH 2ICCA 1HE8A 2ZICA 4KUCF 4ETYA 1IAIL 4HUWB 4XCYB 1WBXB 5GGTH 4PJEA 3EFOB 5FK9A 3VU1A 4KFMA 3ZRCC 1IC5H 1M2VB 2IF7A 2QSTA 1KGIA 4GIAA 4LPYA 3TO4D 1E8YA 3NSFA 4ZFGL 2D7OA 4F2MA 4BZYA 3N42F 1MCEA 3VXUD 3EOAA 1UA7A 3BT2L 4F37F 4E2OA 4TNEA 3PABA 3IJHB 3OZKA 4ZFZA 3RWDB 4N87A 5E5RB 4BCZA 3SDCA 2IDSA 1A4CA 4AG4H 1P1ZB 1INDH 2H6OA 2X9WA 3F7YB 3PWJA 4Y5YB 2RBLA 3E6HA 5IQ9A 1MQKL 1NTDA 2BP0A 5K59E 3PL6A 4HWUA 2EDMA 4K7FA 5CFAA 3I3EA 4QUOA 1BG1A 3F6IA 1EJ6A 3Q8EA 4BK5A 5IV2A 3MA9H 5I6KA 5EBGA 1NKGA 3QJFB 3I75B 4GP5B 1YEWA 2VC2H 4LCWA 5E94B 3BWUF 1DSFH 3QIBA 4F7PA 43CAA 2AXGB 3UBXB 5DUJA 4ZJ9A 4FI7A 2OBGA 4DEPB 2X70A 4KTDL 4OCSL 1JVKA 1U95A 1BXAA 4B7LA 4JY5L 1U8MA 1M7DB 3OXRB 4KY2A 5EN2A 4RGND 5A2FA 3MAWA 3IF1B 4RZKA 4MNHB 2NYZA 4Q6IA 4TMPA 2IGFL 3G5XB 3DMMB 4FA8A 2EIZA 4XBGB 1Y6NR 1U8HA 4S0TD 1BFSA 3QCUH 2H1PL 1IGFL 3AS0A 4KRLB 2YLKA 1MAML 2H0EA 4BINA 1R3KA 3FJTA 3UJIL 4ZW8A 5KSUA 3ZO9A 3NFNA 3QJXA 2YRBA 1U8CB 1JBJA 5HY9B 1XCTA 1WAAF 1M57B 3H7LA 5B8CA 3MRBA 4JREB 1FNEB 4FXGA 1F41A 1KBPA 2JJWA 5FOBB 5CLWA 5IVNA 1BA9A 4K5OA 4ENEC 3NJXA 2NY0C 2N0MA 3VFGH 1OKEA 1S7QB 5CJXC 2IQ9L 4P0DA 4Q52A 3P4NB 4ZS7L 3RPBA 5DRWB 3SKMB 1TO5A 4JB9H 4HMDA 2OLDA 4Y1SA 4FQJL 3RVXC 2CK0L 5JR1L 3QP3A 5DVKA 5EBMA 5FYLH 4B9YA 3F5WB 4X8JA 1GHFL 2HRLA 2I5YH 4F8LA 3ZYJA 1KWKA 4RIRA 1E5AA 1X5YA 2IWGA 3I3DA 5CN2A 3FQ1A 1UC6A 4N2FA 1X5LA 1JPTL 2J6EL 4QXGL 1RZGA 4OKVB 5ADOL 3QZWA 2F18A 1LNUA 3OF6D 3U7YL 1KTLA 3VI4F 4F92B 2X05A 5E7BA 4HGWA 4KKCD 3PAYA 4NRZA 3T0ED 1MWAL 3O6FA 4K15A 4NN5C 5EUOB 5F8RC 3LQMA 1T89C 4IHBA 2TSAA 1WLHA 3T04D 2IAMC 3L1GA 4R2GC 2ATPA 2VDNB 3M1CA 1WA1X 4KXBA 2G5BB 4QO1A 3TH2T 3X17A 2XQBH 4JJ5B 4HIQA 3BUIA 1UM6H 2QHRL 3KJ4C 2F6AA 4E42B 1ZVHA 3QNZB 2IPTH 3GMNA 2FATH 4WGVB 1HL5A 4AX3A 4Q9QH 1KT2B 1UKQA 4K3GA 3IJEA 3RB5A 2FWSA 4M9PA 3FPYA 4Y16A 3S36H 1KCUL 3VI3F 5KYXA 1HH9A 4LL4A 4JO4L 4WJ5A 4KOCA 3GKWH 1MH5B 3KYKH 1AD9A 1CUOA 4N68A 1T7WA 3U0TA 1KIRA 3IAQA 4KXZI 5GS2D 1TIUA 3MBXL 5JOPE 4NAQA 3MO1B 4LGSB 3KR3H 5K9OA 3FO0H 4QMEA 3V7AG 5L4IA 4HIXH 5A2KH 4DP8X 3BEWB 1LJMA 3N44B 1DBKH 5DUML 5FM5M 4QHPA 3VFWA 4YE4L 2EINB 5DJ0B 1PZUB 1KGCE 3MN8A 2AEWA 4PRID 2XZQH 2J1KA 1CFQA 1KJMA 3NVQA 1ZJBA 3OWRA 5D4JA 3WKYA 3CZSA 4EIUA 5C9JB 4KDWA 1XGYH 1U8NA 4WI4A 5ETUA 1VFAB 4J3UA 3QUXB 3IGFA 3APCA 3O2VH 3UMTA 2HFEB 4HS6A 1TQSA 3NJNA 2EYRB 2C9RA 2Z7UA 4ICXA 3RKPA 4HVBA 2CLZA 2P5ED 2VWEE 3BEVA 3QIUB 4LOUC 2PCFB 1OSPH 2CKBA 3ZHKA 1J05B 4YDLB 5ICZA 3U46A 1ZSDA 3NTCL 4ZFOA 3CPLA 4U1IB 3IDUA 3CVHB 1R3JA 4WV1B 3UACA 3AU1A 4A6YA 5E5UB 4U6HA 3WLBA 5ECJE 4BUGA 3HUJE 4IK6A 4CMHC 3MXVL 4RGMC 3GBLA 1RZKL 4GFTB 2FEEL 4MMYB 5AYUL 1NDTA 1SN0A 2GJPA 4K07A 3JWOC 3D51A 3S5ZA 1ZRUA 1QVOA 2BRRH 3ZL4L 5KSVA 3INUL 1E4XL 3UZQB 1HSAA 2VXUL 3T3MF 1RUKL 4HSQA 4O2CA 4O58H 4X7TA 5B1CA 4NNYB 3MX0A 1QFUH 5IEHA 3AT0A 1ZEAH 2GBAA 5E95B 3EXLA 1WICA 5D1XC 1CGXA 2RALA 3MRJA 4FNLL 2CWRA 3IBEA 4PW9A 5DGQA 5I6XB 4JM2A 1A7PH 2IBZY 4Z6AT 1MREL 3T4YA 4PTUB 3CFDA 2C3WA 1L4IA 5DEFA 5BOZG 3LPPA 4KK8D 6TAAA 3QQDA 3ASWA 4XMLL 5GGSB 3GF8A 4A55A 1R9FA 2ZOKA 3MR9B 5EA0L 3PDOB 1YNKL 5B7MA 4PJ5D 4DEPC 1SRDA 3HR5B 4CBZA 5D9SA 5IROC 3OQ3B 4XB7A 4FFVD 3HUJA 4E9SA 2DYPA 2R69A 4B9CA 2HVJB 3G5YA 2NY2D 2Q20A 4NZTH 4AOFA 2AS5M 2F5BL 3WIFA 4A67A 1YEGL 2I7OA 3LQAC 1MEXH 1JGLL 4DGWC 2JB5H 4OB5L 1NGZA 4J1UA 4U6YA 3OHMB 4GW5B 4NPJA 1D6EB 1QZ1A 4U1KB 4JO1H 3QR0A 1AO7B 4JN1L 4WW2C 3FCGA 4QJ5B 4RMUA 2AJZA 2VRQA 3QEHB 1H19A 5AAPA 1DBAL 4MCYB 1ZS2A 3UBXI 2EDFA 5ABAA 3KCPB 2WNWA 5F9WB 3CC5A 3BP6B 5ICYB 4AE1A 4FZEL 4YBHA 5C6TL 1W91A 3IJSB 3HE6B 1RP9A 2IPKB 4JDVB 4QR7A 4Z78B 5E08L 3FQWA 1AR2A 5KVEE 3GXDA 4ETQA 1A6TB 2X0UA 1G7IB 1FZJA 2YOAA 1PLCA 4YHIB 1XR8A 4X5RA 3ZSTA 4IBZA 1ZKAA 5HPOA 3PWVB 4AZ8B 3BSZL 4BD4A 4LCVA 5ABZA 4PWGA 4QXTA 3IAPA 4HZLB 5I28A 5GGUB 3FU7A 2BVPA 3TPUB 2VOTA 4Z23A 4WKXA 4NM8H 1S5IH 3MV8E 3NP3A 3PWPE 3TNNB 1OD7A 4UV7H 2QQNH 2WZ6A 4Y4FD 2BWQA 2V17L 3NK3A 4X8XA 3S37H 3RU8L 5I76B 3DETD 1EEYB 3ABKB 3W5MA 2F19L 2XNAB 2Z1KA 1BWWA 2X2IA 3MLRL 4MDRA 3SDXF 5AOKA 2OKMA 3ALXA 3KXFB 5GZOD 3HRZA 4LARL 3TVMC 3WSQL 1WSST 2VRAA 1BFVH 2V5MA 4L8BA 4PJBE 1UXLA 5EOCL 1FZKA 4D9LH 3GXIA 4EXPX 4ANVA 2VDPL 4N2OA 3VMOA 3DGDA 1A6AA 3VFTB 1QSVA 1T1WA 2BM3A 4J3OD 3P30H 4HSAC 4PJ9C 2JJSA 3VWJA 3CN0A 4AKPA 3WIHA 4BQ8A 3MOAH 1SBSH 1ITBB 3QH3A 1QKZH 3SCMC 2E75C 4B7IA 1NFDA 2R56L 4RAUB 5ID1B 1VFUA 1A4BA 1GYWA 3PFQA 4NKOA 2ADGA 2GKIA 1GZHA 4HUXB 4NQDE 4MD4B 5D93B 4HIIB 4WQOA 4ERSH 5I18L 2V7HB 4UTBL 2AQPA 4XP5H 4WO4A 1THCA 2MWCA 1YUHB 4NJ9L 4M29A 4JJHA 5EBWB 5HJ3B 4PRDB 2XFXB 1EHLH 2OSLA 3O0RL 3C5JB 3KDMA 1TZHA 3GSOB 5F1IB 5KYUA 3LZOA 3MV8A 4I1RA 4DGYL 3U79A 2J3SA 3V5KA 4N5UA 2OJZL 4QHLB 2KMWA 4PJIE 1DVFD 3VGEA 1PSKH 3L2NA 4H5SA 4KUZL 1UATA 3AREC 2CO3A 3M17A 3QUXC 5HYSB 4I0PB 1T0NA 4F80A 5JHAA 2AJYH 4GXUM 3RE0A 1NGPH 3D12B 4NUPA 4PJBA 4ZQKA 1MFBL 3LKOB 5CEZD 3E3QE 2AGJL 1QI3A 1WVZA 2E47A 4WEBL 2W0PA 3LXCA 2YBGA 4AT6A 4UYQA 3NJGA 3CVCA 1ZT7A 3GMRB 3TV3L 2NUPB 3RZWA 5DZJA 2VZSA 2B1HH 4AEHL 1R34A 2VR7A 4HCRL 1BREA 1MCNA 2VL5A 4UAOC 3T6QC 3LZLA 3GMQB 3D1MC 2WMPA 1NIDA 4I9WD 4K9EC 3RWCA 4BKTC 3GSRB 3P73B 1BBDL 3OKKA 2DM7A 4OI7A 4Q4IA 3T2OA 1CGWA 1U8OB 2DQDL 2YGQA 2YHGA 5CJ8A 1OP3H 4OIIL 4RMVA 1QG3A 4R96B 4P49A 3SGKA 4FQ2H 2AQ1A 5F9OH 4LCIL 5DTFA 3PUCA 3WE6A 4U1MB 4G42A 1GR7A 4WTZG 4OJFL 3CSYA 3L5XH 4PJIA 3VXQB 1LVEA 1I82A 1AFVL 3MLXH 1DVSA 3L7FB 2WLYA 5DD6B 3QORC 1J8KA 2B4CH 2W65B 4OCYL 3VXTA 1CICD 4MWFB 3VGFA 1OM3L 3ZT7A 2EDLA 1A4KB 2C1PA 2ZUWA 3V5HB 4K73A 3EYSL 1U30A 4N3TA 3IFOA 2BCKB 4Y19B 1T4WA 4M1DL 2GK2A 4GFXA 4UDUB 2ICEA 2HFFA 3B1TA 2BNRD 2HG0A 2ZJSH 1K8DA 4YFLI 4JFZH 2VQ4A 3QWOB 1LXMA 1Z0MA 3KPRE 3WY2A 1JI1A 2ICES 5I1HH 1PPIA 1T7VA 3OTTA 1E28B 4FGMA 5D6CA 2CLVA 1P53A 4BFOA 2B14A 1IQWH 1MRCL 4FG4A 4ZMQA 1PDKB 1UZ6F 2GJJA 4TLTA 5HHPA 1IGML 1PTZA 2XIDA 4X7EC 2C9PA 2ZXAA 4HD5A 4GG6F 1RMFL 1TQBB 1BPLB 4HISA 3RP1A 1IFRA 3KYAA 3WCYA 1BYNA 4QRRA 2BP5M 1JZHA 3GEFA 3HMWL 4W4NA 5I8CB 5F72S 5D7JC 5F9WC 4Z7QB 3VXSD 1LO3H 2ED6A 3IU3B 4NSKB 4OLUH 1EBPA 4YX2H 1YLBB 4XGZB 1LQSR 5FV2A 1HWHB 3BQUB 5K9QI 3FTZA 4J3OH 5DMIH 4MJ5B 2WBJA 1NWPA 4Y4KB 4OZIE 1IT9H 2EKSB 3C6SB 4LBEB 3GUTA 5IT2H 1I8MB 4N90D 4Z18A 3BESR 5E8NB 1XVSA 3VWKB 4NO3A 3EYVA 3EBHA 4LVEA 4