4ZMPA

Crystal structure of human p-cadherin (ss-dimer q101l)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDLNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmpA01
4ZMOA 3MVSA 1NCIA 2WHVA 4NQQA 3UBFA 3Q2LA 2OMTB 2YSTA 4ZMVA 3PPEA 2WCPA 3UBGA 4ZMLA 5JYLA 4ZI8A 3LNGA 1NCJA 2YQGA 2A4CA 2WBXA 1WUZA 1WYJA 3LNEA 1ZXKA 3K6FA 5DZVA 2EE0A 2OMUB 5CO1A 2OMVB 4QD2E 3Q2NA 4ZT1A 1FF5A 4APXA 4ZTEA 4NUQA 1NCHA 4ZMZA 3K5RA 4AQ8C 2OMWB 2OMXB 4AQAA 3QRBA 1NCGA 1Q1PA 1EDHA 4XXWC 2WD0A 4NUMA 4ZMXA 4ZMTA 2QVIA 2OMYB 1O6SB 3FF7A 1OP4A 3FF8A 1SUHA 3LNIA 3K6DA 1L3WA 2O72A 4XXWA 5KJ4A 4AXWA 5JYMA 4NUPA 4ZMPA 4ZMNA 3K5SA 4AXWB 3Q2VA 1ZVNA 4OY9A 3LNDA 4AK1A 4APXB 2V37A 3LNHA 4ZMYA 3K6IA 3LNFA 4AQAB 4ZMQA 4AQEA 4AQ8A 3UBHA 2QVFB 2X2UA 5CZRA 2OMZB 4ZMWA 3Q2WA 4AQEB 2A4EA
chains in the Genus database with same CATH superfamily
4WUUB 2Q20A 3C75A 1BZQK 2QPFA 2OX5B 3TBSA 1SDAB 1Y0LA 4FFVC 3ECQA 3MCKB 1WEJH 4L8SB 3RJDA 3BZEB 3WMSA 5GRVL 4NCC1 1DDHB 2VLJA 2OW7A 4JFXB 4HIPA 5I30L 1AHKA 1BZ7B 3UAJD 2VMFA 3QXAB 2B9BA 4TS6A 5F9AC 4QRPB 1UA6L 3UJIH 4NQEE 1EEYA 2ZX8A 2AANA 1NPNA 3QQDA 4BQ9A 2WY3B 3HZ3A 3IU4H 3RL2B 1QRND 1E3FA 2VAJA 4F2MA 2CO4A 4ZS6D 2NY0D 1CGVA 1BXAA 2WGNB 1YYMH 2LLGA 3MYJA 1U3NA 3WN5A 1QUNA 1V3JA 3P0VH 3UJJH 2LU4A 2ICWJ 2NNFA 3KXFB 4KKRA 4OF8A 1Q4NX 3PGDA 1RZKL 5AAWA 3SE4C 2V2XA 3AY4C 3NPSC 1LEGB 1R9FA 2R2CA 4Q89A 1M9WA 5I66A 3QRGH 1X5YA 4XNYH 1I8AA 3AQZA 3KGRA 1KXQA 5A6LA 5LUMA 3SDCC 1MDTA 5E5MB 2HN7B 3M17A 4YBHA 5E24E 1NCTA 1P7QD 1MFDH 1QI4A 3UL4A 3S3BB 4NYLB 3MFFB 4CDHA 4LSTL 4LQ1A 3SYOA 2V9UA 3ZK0A 4R90L 4OCSH 4S0SD 4FZ8H 4JM0A 1IM3D 3MODH 4M56A 5I9QC 2FJGB 4OB5L 1R24B 3QDGD 3QDJA 4GI9A 4WJ5A 4PY8J 2NPLX 3BE1H 1RK0B 5EU6E 1IC7H 3RA7H 2GY5A 4MD4B 4Q7DA 3WFBH 3SBWC 2HJFB 3PWUA 3HBZA 4WI6A 4V1DD 4PV8B 5KYXB 2IQAA 5D2NA 1MFCH 1T7YA 4NFDA 3QWOB 5IESH 3GEWB 2FX7H 3MLTA 5ANHA 3KWXA 1G4RA 4QXUH 1RCYA 3MBXH 4JY4B 4OLUL 2VKXA 5JXEA 5FUOH 2ICWA 4LCCA 4OTXL 4CSTA 5KBDA 2Z31C 1BQHB 3E9UA 1Q1JH 3FRUB 3QUMH 2XWDA 4O9HH 4GSXA 4KKAC 1RP8A 4N2CA 4LMQI 2GSGA 2NLJB 4KZDH 3ZTJG 4WTZG 2HYMA 4RISH 1NL0L 3U6XA 3PHQA 3JV5A 4I48A 4FFVD 1CFSB 4C56D 3P9LB 3C5SA 4NLAA 3CCHB 5HHME 1FG2B 2P5WA 1MJ8L 4AEIH 1GY1A 3WU1A 1F86A 5ETUB 5LCVL 3RUGE 2OAAA 3QJHA 5DQDH 1QSED 2QPSA 2NY6C 1N3NB 2GQHA 3F7LA 4KITB 5I6KA 1TVDA 1Z0NA 2BIIA 2K3HA 2YGOA 3AS2A 3QEGH 4LRNL 2PTTB 1F4HA 3EF4A 4KKBC 4ODUB 1YEHL 4LEXH 4MS8C 4KWUA 3P4MB 1VPOH 5EDXA 3RNKA 5HHVL 2ZWSA 2DI8A 4QEGA 2P8PB 4M1DL 3QFJB 2V3FA 2HSIA 3LS4H 4J3XA 5FA4B 4S0HA 1F18A 4WO4C 3FONB 3KCWA 3VFMB 2A99A 1U3HC 1CU4H 2JIXB 4N8VB 4JREB 5DVLA 4HS8H 3TASA 4QCIA 2YUZA 2VZVA 4DT2A 1FVEA 3V6ZA 5DLML 2YMXH 3WJMA 4EBQL 4RFEA 3SDCD 2ZYSA 3ARGB 3O4LB 3VH8G 2XX0A 3BGMA 1KOAA 4UV7L 2W5PA 3TX4A 2B1HH 3P3UA 4NRZA 3WFEL 5DURD 2IWFA 2VDNB 2C3GA 3NZHH 4PQXA 3US1A 3RAJH 4RRPM 5DK2B 4OFDA 1W91A 1MLBA 3O45B 3QYNA 4A2HA 2Q3XA 2WVVB 4GQPH 3D06A 3MQIA 2RQEA 3BOVA 4I77H 4N3TA 3MBEB 5DJZA 4JFEB 1E7VA 2AEPL 3FTVA 1S8DB 4OJFL 3QUMA 2Z64C 1RQ5A 4YFDB 2R1XA 3O3EB 3VRJA 1QYGL 3PP4H 2ZTBA 4NJ9L 3TVMB 2DJUA 1A3RH 1FP5A 4HIHB 1C16B 5F72S 1DQQA 2ID5A 4UOW0 3TH2T 3VXUA 2FQFA 3VM5A 3OXRA 4G82A 2IDTA 3I75B 5SWSB 4L8CA 1ZLVK 1G7IA 5EOQL 4ANUA 4DW2H 1X5IA 1J5IA 3BUDA 4HD5A 2Z31D 1W6WA 3X1BA 2P9RA 5JPMC 3FSOA 3LD8C 2YMTA 5EU7C 4KKAD 4BFKA 2RALA 1A6TA 5EBLB 1L0QA 3CLEL 1USZA 3GK8H 3BMWA 5AYQA 4KTGA 2Q8BH 3PV6A 2MOQA 1ZJAA 4R0LC 4BGDA 1YUHA 5PAZA 1H0DA 1A6UH 1MCLA 1YAZA 3IETB 1T4KB 4C57C 4X6DB 4N2BA 1U8QB 1CBVL 3LRHA 2CGYA 3GSRA 4LOEA 4DVBB 4HFUL 5IVXE 2NY6D 4FI8A 1KIUB 1RUPH 4D3CL 4WHDA 4JAMB 4ORGA 5GHWH 4X6DF 5E00A 4KKBD 2C1PB 2X28A 2OMUA 1M7XA 4MS8D 2BNRD 3MRBA 3ZE1B 4LHUA 1Z3GH 1VFAA 4PGCA 4WO4D 4UT6H 5CJXC 1GGCH 1U3HD 2EXYC 3ZE1F 2G3ZA 3VWKC 1PY9A 2OL3H 1OCRB 1F4WL 1UYWH 3FK3A 5JHDE 3SGKC 3BLBA 4YZWA 4X99A 4DJMA 4DVRL 2GABA 4OZHB 2A5UA 1VGKA 1AXTL 4K3GA 1ZCRA 4ZAKA 4MAYC 2WMPB 3SE9L 4XC3H 5IBUG 1PZ5B 1E9QA 1WHPA 1KUMA 1IM9D 1D5BA 1GZHA 1D9KB 3VFNB 4ESKA 4OZHF 2OJ1A 4LVOC 2H45A 1YZZA 5F7KC 3AS1A 4WSGA 1LEKA 4F5CA 1DJHA 2EE6A 3MRRB 2F58L 4W4NA 3U2IA 4KUCF 4DFIA 2NXYB 2ZUQC 3NCYP 3QNYA 1AR1B 3SYQA 3TN0C 5DD6A 1C1EL 1XXDC 1N68A 4FS0A 5F7BA 3SGJC 5C0JA 4NUMA 4XH2A 1FFRA 4IBUA 3ZXAC 3FUHA 3O9WA 3MUGB 3O3BA 4WWKA 4TV3A 1MVUA 3L7FB 2R29H 3INUL 4HOXA 4JN1L 3UGXA 1IKNA 2V4LA 3QCTH 4OLWH 2WGXA 2WXFA 2FWSA 3TNNA 2CGZA 2R7EB 1QD0A 4GAAA 1E2WA 1NGYB 3T0XA 2W07B 1UXWB 1NGPL 4IOIA 4O00A 4LEOB 5IB2A 3BZ4A 3VXNA 4M5ZH 1Q9WA 5L2JA 2H1LM 2XZAL 3BSZH 3MSPA 3N42B 1ZKAA 4UT6A 1PPIA 2A6JB 5D9SB 4U2YA 4IMLB 3VCLA 1H3PL 3HC0B 1KBGH 3GHBL 4OCWL 4HCRH 2OL3A 3BVNA 1KJ2H 3H6AA 4JQXC 2ZAIA 3HI6H 3HPLA 2IAMB 3N42F 5DQ9B 1V05A 4FI6A 2BSRA 2Y1ZA 1FV1A 4QO1A 3ROOA 3SJVB 4PVBA 5HPOA 4FCHA 2W91A 3R18A 1IVTA 2UZYA 4I88A 5D6CB 3QDMA 1O7VA 2OYMA 3WS6A 2EXYD 4E9VA 4XP6H 3VWKD 4ZUWA 3PL6A 5GGTH 2C1OA 2GUOB 4E9TA 5I16A 2NY4B 4QRAA 4KK5C 3BN3B 1UOLA 4RIRB 1FA4A 5GIRA 3OAUL 4M5YL 2ADFH 1RZKC 3IBOA 4JCWA 1Z66A 5LNEA 3V4VL 1KPVA 2X4UA 4FQ2L 3NZ8A 2K7QA 4PMFA 2EIMB 4MAYD 1FFNA 3VYNA 5JYLA 1KCUL 2B3IA 4XAKE 2WTRA 3VFWB 3R1GL 4P49A 2CLRA 4ZX4A 1DLFH 3TCXA 3VSUA 2F5AL 2D7NA 2P3YA 5BQDA 5IP4A 4WI0B 1KCSL 3ZRSA 5JPNC 2L0DA 5F93C 2ADJB 2F53D 1BW8A 4CVUA 3DV6A 3K1DA 2IH1B 3CFUA 4HKXA 3DBXA 3HI1B 4UIKH 5FDWB 4ZUVB 4O4YH 4A63A 1FNEA 4JANB 2LFGA 1FVDA 2R29A 4XNQB 2CCVA 3TBSB 1Y0LB 3CSFA 3V4PB 3BAYA 3TN0D 2WZ6A 5C0AE 1JWSA 1MIEH 3NIDE 1JV2A 1PDKA 3GS4A 4JR9H 2ZNWA 3MV8E 5E6SB 3C2AL 3MZTA 3HC4H 2VLJB 4PD4K 3MV7E 1X5ZA 2W59A 4NKQB 4N2GA 5CINH 3TONA 3ZHLA 4AQAA 3TIEA 3BSZA 4IBVA 1EEYB 3U6RB 1T4WA 3RFZA 1CLVA 3L54A 4OT1L 4HCRA 5I8KL 4HQQH 3MPCA 4TVSa 1KJ2A 4JEGB 3Q5OA 4OAWA 1BZEA 2GVYA 3MYJB 3MRPA 3WN5B 1QUNB 1XGUA 2DI7A 5AB1A 2WXPA 3QWRA 5INCA 2BVPA 1ORQA 1Q8MA 2MSPA 5DJ6A 5F71A 4ZO9A 2YMOA 3PGDB 5E1AA 4Q0XL 4ALAL 1AS6A 4IRZL 5I66B 3MJ9H 1JHLH 4JPKL 1DQDL 1S78C 3RIFK 4LLUA 1JPGA 3GTVA 5GGTA 1S6NA 4NCC2 2HZHA 4I18C 5AG8A 4HIEA 3M17B 3WXVL 5D7LE 5DHMC 2WO3B 4U1SB 1JXKA 4AZUA 2DM3A 1UD4A 3NAAH 4PJAA 1R33A 2IBBA 5FA3B 3ARUA 4LCIL 3QIBC 4PREA 3WFDL 5I23A 1HHJA 3QDJB 4KK5D 1ZHKA 4NO5A 2DICA 3ARFC 5LB1A 2YAPA 5CCGE 3UC2A 2PP8A 3UTPE 2VMDA 1HH9A 4OCRL 3PAUA 3DX4A 2IQAB 5TE7L 3FO9A 5BRPA 1FNHA 1SN5A 4N2HA 1I7TA 2AKRA 4F37F 1KCWA 3NGBB 3HMXH 1DR9A 3GZQA 2BOBB 3FFOA 5GS2H 2ICWB 4LCCB 5I1AB 5ICYA 2I60L 2DD8L 2R0ZH 2H41A 3AMKA 3ESMA 5KS9E 5MP6L 2ZG2A 1RUAH 2GSGB 3MRDA 1DQLH 4OZGE 3G7TA 3B2PA 4Z7UE 3FUNA 4IMKA 4DO4A 2ZWLT 3PE9A 3PHQB 2DQHL 2X41A 4OKDA 5AYUL 3RZCC 3UP1A 4BSVB 2E9GA 3OLDA 5DVNA 2BVUA 3C5SB 3E1F1 3NJKA 5J5EA 2P5WB 2BZDA 3OVUB 5DMGC 3VSVA 4A39A 4XCFL 4IRJA 4G83A 3QJHB 3E1ZA 4YJZL 1UQSA 2DJSA 1WFIA 2Z0UA 5EEVA 3OWRA 1R5WA 1IVLA 3MJ9A 4LDCA 5ALCH 3U0TB 1RULL 3MLXL 1CGYA 3ZDZE 1LO4L 2O1AA 3RNKB 3FU6A 4M6MH 5B1AB 5IVXA 1QLRA 1J9CT 1VFMA 4QOKE 3U7WL 2R1WA 3ZR5A 4YEFA 4PBDA 5IROC 5FEBA 2VO8A 3GSVA 1NCOA 3K4ZA 2IJ0C 3FAXA 3GI9H 3SQBA 5DO2C 4GSUA 4X42A 3W5NA 2GTWA 4AYSA 3LZOA 4QCIB 4NKIH 1AFVH 1UD5A 3H7BB 1S78D 4A2MA 1FO0H 5F7EH 1FVEB 3V6ZB 3UEQA 3WJMB 5E56A 4Q74A 2O5ZH 3BMVA 4ZTOL 3BGMB 1CF8L 3SGDI 4A6YB 4OLXH 4NRZB 2X6AA 1FZOA 3I9GL 4KXCA 2VTFA 3CDZA 1OAYH 2WINA 4HOZA 1JGLL 5IMKA 1T03H 1N7ML 3MLZL 3GLEA 4ONFH 3IDIB 3O3UN 1MLBB 4QRTA 3DMMC 2WSPA 3QIBD 4M6NL 3UDWA 1OF0A 2BMKA 4YHKH 3RP1A 2L7UA 2G9KA 3LH2H 2VC2H 5HVWA 5BZDA 3ARFD 5L0QB 4R5TA 4PJ8A 1XR8A 2Q86A 3TJEH 2F1AA 1M2OA 1CXHA 1TVBA 3VRJB 3VD3A 2R8SH 2LABA 3ESOA 4WZ9A 4ATWA 5DEZA 3VXUB 5LGHL 1DQQB 4LL4A 4NN5C 4QRUA 4QLRA 3VACA 3OXRB 1T21A 2EVGA 3WUWB 5FGBC 5AVWB 4L8CB 2Z92B 1G7IB 4DP5X 4IK6A 4PHXA 2ODHA 1U8HA 2QQQA 3U4BL 4ZS7L 2XTJC 5D4QA 5ISZD 2CK0L 2J6EH 3OKDA 1A6TB 4AIOA 2R51A 1INDH 3W57A 4NRYA 2ZUVA 3OX8A 4JZJB 3N2JA 3LKQA 4JKKA 3QH3A 2Y69B 3PV6B 4KMQA 4GW1A 3RZCD 1HNFA 3OLEA 1YUHB 2EH8L 4WLCA 4KU1A 1H0DB 1QFWI 4FLQA 1JYNA 2L3BA 4FYTA 4ZI8A 1CO1A 1ED3A 1S4IA 5DMGD 4WEEA 2IOIA 2O6FA 2FBOJ 1OD9A 4B5ZA 3QXVA 3P54A 1TPXB 3UTZA 4KZ0A 5JOPE 3X3FL 2X6UA 1BBDL 1TQUA 4ORGB 4AVIA 1XGTB 4X5QA 1FO0A 5E00B 3K6FA 4I1RA 2OMUB 4GXVL 1QWUA 4HCIA 4G8IA 4OCMC 1IT9H 2W60A 1A4CA 4X6EA 1CZ8H 3Q8CA 4FKKA 4HJUA 1ROCA 5I1KH 4ELKA 5IROD 1ZE3H 4PIRF 3B9KA 5BNXD 1J5HA 2OMWA 1VFAB 2COQA 5J89A 4U7MA 4TF4A 4HWEL 2QGCA 5FWQA 2BW5A 2D2OA 2W9DH 4IU2A 5DO2D 1PJ9A 4P5SA 2MOGA 3SBRA 3MREB 4BWTA 3E8UH 2HLAA 2NXZC 4AK2A 4ZZKA 3GRBA 3BH9A 3ARDC 4AM0Q 3AZUA 1D5RA 4R4BA 3CFTA 1E3ZA 2YGPA 3QQXA 4CU6A 4ZMXA 4HJEA 4EVNA 1HZKA 2KKQA 3PNRB 1KG0A 2J21A 3RGHA 3CV5A 4Y5VA 1VGKB 4ZAKB 5GZNA 3HHSA 4UQ9A 1PL3A 3CMGA 5HYJB 1NC2D 1SDDA 3V8OA 2X4SA 3UGEA 1E9QB 3DMMD 5I2IA 5JYMA 4XB7A 3WJJA 1D5BB 4JFQA 4KZEH 3L1EA 2OTWA 1CGUA 3LDBC 2FHBA 4JO4H 2QPUA 5GGSA 3GDCA 4W93A 5FPIA 3JWOL 3GQFA 5GISL 5C2BH 4OM1L 1PCSA 1GSKA 2XWZA 1LEKB 2P5EB 3KJ4B 3KPRA 3WLBA 1IQWL 3VXRB 1DO6A 2J6EA 4KVCH 5CLZA 3IFLH 4PGZA 2RMNA 4FERA 4JFFE 2Y5EA 4KI5F 12E8H 3KYKL 5FKAA 1JI1A 5T1KD 3VD0A 4P59L 3PWPD 4GUQA 4NWTH 4A38A 3EYOA 3GB7A 2QVTA 1P1ZB 1OTTC 4P5TC 5FHBL 5J6GA 1PG7W 4XH2B 5FYKE 2FJUB 5D7IB 3T2OA 2O5XL 2ICCA 5C0AA 4DIXA 1A7NH 2XTJD 3O9WB 4FAAB 4WWKB 4WY7H 3RBSA 3FPXA 2DRUA 3S6CA 2EDRA 3MV8A 1MVUB 3TO4B 4HUMB 2DLEA 3H3PL 3MV7A 2LVCA 1CYGA 5D7IF 4O51A 3I02A 4Y2DC 2ICES 3LPFA 5B22A 1I1RA 4PRNA 3TNNB 1OHQA 2OJEA 4F8NA 3KYOA 3ZL4L 1TLKA 4TXVB 2VDPB 5IB2B 3UBFA 4IOIB 1G9MH 2X44D 3BZ4B 1VZHA 3VXNB 2G60L 1BOGA 1Q9WB 5L2JB 1CE6A 2BS8A 4KC3B 3GSQA 4TNEA 4KPHH 5FHAL 5JZ7C 3VCLB 2E4TA 4MDJB 3F85A 2BY1A 4PJIE 5C09E 5CLWA 1RIHL 4XVTL 3B7TA 5E9DD 1OV8A 2QQLH 4H25A 5BS0E 5F6IB 2OL3B 4TSBH 5F6IC 2HFGH 2IPTL 2V9RA 3GXIA 3HPLB 1XSJA 1MSPA 3ROOB 2BSRB 4QO1B 1FV1B 4KVPA 5C97A 2UUDK 3PP3H 4ZODA 3JWDC 4QTIL 2UZYB 4QHMA 1F13A 5DJ0A 5JHAA 4ZFGL 4ABQA 1I53A 3QDMB 3I50L 5BRZB 4FYRA 2NXZD 4KK8C 4Z3FA 1K9TA 3I9PA 4ZUWB 3PL6B 4ADJA 5I16B 4M93C 5ID1B 1QFWM 3I9IA 3ARDD 1FF5A 5FV2A 3CVCA 1OK0A 3H3KA 5GIRB 1HEZB 4YDKH 4PLOB 2PYEE 3ZY7A 1KPVB 1ZHNA 2X4UB 5DT1L 3NZ8B 5J56B 1NCGA 3VRIA 2N01B 1FFNB 1BDYA 1CDHA 1Z3RA 2CLRB 3SSGA 4QXTA 2C4FU 4N1EA 1OTSC 4Q58C 4F8LA 4G9FD 1JZFA 2XACC 4JDTH 2NW2A 2QSTA 1EERB 1SQMA 2DDQH 3DV6B 3DBXB 3Q1SH 2UWEA 4HIXH 1REIA 4W4OA 4OM0L 3NA9H 1B6UA 1CLZL 3GXDA 3HNVH 4N20A 3ZDYB 3SBPA 2ICEC 3S35L 4EXPX 1JWSB 4PYHA 1JV2B 1PDKB 4OZGA 1OTTD 4P5TD 4YSTA 3LXUX 2A9MH 3QNFA 4HPHA 5DMIL 3QC5X 1Q0EA 1SN2A 5AW9B 3OQ3B 4L1LA 3ZDYF 5DEJA 3CFEA 2AXFA 3QCVL 3BYTA 4AQAB 4IS6A 3G6JE 3CXDL 3SIKA 1S5IH 2KLTA 3KDMA 4KVNH 2DZEA 3X1NA 2ARJQ 3O2DL 3IJEA 1WD8A 4I3RH 3RFZB 1MF2L 5C7XL 2F61A 4Y2DD 3UG4A 3BI9X 3ZT6A 4HUCA 4HA1A 4OAWB 1Q9KA 3LRSA 2C9SA 2DWYA 1TJMA 1XGUB 2AZUA 3MRPB 3O0LA 3MKGA 5INCB 2BVPB 1ORQB 2P4AB 1AQ8A 3S4SA 1N0XH 2XN9D 1JF1A 3NIFB 2NQDA 2J1WA 1I4FA 3WLWC 1O5DT 5JZ7D 4J4PA 3BKMH 4N0YL 4UQCA 4LLUB 3TT3L 1T1YA 4N6RB 5FR3A 4N8PA 2E7BA 1MCOL 2DIJA 3CX5K 4PVNA 2EO9A 4JZNB 1E4WH 4FQXC 3SPGA 3L7EA 5DHDA 4HIEB 4RFNC 3NIFF 3UBXI 3UADA 2PP9A 3HUJE 2IG2L 1NDGA 1UM5H 1P4BL 5HDBB 4DETA 1PZCA 3QZOA 4ETQA 3II1A 3RFRA 5A6MA 2Z93B 2IDFA 4PJAB 4KK8D 1EJ6A 4PREB 2VO5A 4ZUSB 2F9BT 3RWGB 1P6WA 1HHJB 5HDBF 5TE6H 4NO5B 4L0ZA 3JWNC 4YPJA 4PJAF 3KR3L 5IFAL 2M26A 3BIAX 4QGYA 4YHMH 4AEHH 3WKMH 3FO9B 4R26H 2EH7L 4JVPA 2YFNA 2AKRB 2CQVA 2B3RA 4M9OA 5BVPL 4IHOA 1EFQA 3QWQB 1QI3A 2JKWA 3L81A 4PJDE 4R7NB 1QWNA 5F7DA 3B3IA 1IBFA 4LHQB 3D0VA 5ICYB 1OTSD 3PQYA 2ED9A 1AJ7H 4RMTA 3CZLA 3ZYIA 3HPJA 1NGZA 2IDSA 1NBYA 4FJYA 4GSRA 5CSBA 1J9RA 3ZN6A 3O11A 3RTQA 3C09B 2HVKA 4FA7B 3FMGL 3O6KH 1A7PH 3TT1L 2DL2A 5E9AA 2WYZA 3D69A 5JUEH 2P47B 4KKCC 1IX2A 2TSBA 3EO1A 5AKTA 2YBRA 2GJZB 4PJXA 5DO8A 5D70H 2WQUA 1A6WH 1KCRL 1CL7L 4EI6B 1N67A 1UQSB 3K5SA 4PAZA 3RVUC 5I19L 4KQ4H 3GWJA 2CBOA 1FJ1A 3E38A 5FYKH 3R8BB 1I9RL 3TTYA 4B0MM 2VUKA 3L2NA 3QUYC 1QHQA 3X2QB 1D2PA 2F8VA 1QLRB 4IGBC 1IFHH 1UOVA 4GAGL 5CZKA 2R1WB 2I27N 2QHLA 1G9EA 3AW5A 4X6FA 2K3TA 4K7FB 3U9PH 5CGMA 3GSVB 3P30H 3ZSSA 4HGMA 2C7UA 4J23A 3SQBB 4PCTA 5IVXF 2GTWB 1X3DA 4M00A 4PRAA 1DZ0A 3WLWD 3F6JA 4Z95L 4DGWC 3GHEL 1CYWA 1O75A 4L5FL 1GYWA 4LEBA 1Q0YH 5EZIH 1L9OA 3ATFA 3K2MC 1BJ1H 4J3WA 4FQXD 2VDRH 3OHXA 4K94H 1TQBB 3N1FC 4PJ5D 2AQPA 3J8F7 1QFOA 3SYCA 2ISDA 1FZOB 3CDZB 3CK0L 1SHXA 4XNZC 4NGHL 1KLGB 2D7PA 3NJGA 4QWWC 5IMKB 1JNLH 4M02A 3FU5A 1V27A 3P77A 4P8QA 3QP3A 4JO5A 4QRTB 4U6XA 1TQTA 3I6GA 4M8VA 5J06A 4GG6E 5C9KA 2A6IA 3O8XC 1DBBL 2OV0A 3DGCR 3IMUA 3ISWA 4HBCH 4PJ8B 5T1LA 2Q86B 4P9ML 3AACA 4YDLC 3TWCH 3ZKMC 1D7FA 5ESAA 4NBYB 3QHFL 1RJCA 1WITA 2BSTA 4QRUB 1BFTA 2AV7A 5E2UL 4Z3IA 1T21B 3PJNA 3A6BH 2H32H 2YXFA 3UZQA 1I1FA 2WZ5A 3IDXH 1U8HB 4JG0L 3FTXA 3FTZA 4S1SH 1GOFA 2CWRA 3ZZ1A 5I18L 3DX8A 3OKDB 4X7EC 4BBWA 1V7NH 4XVOA 5KVGL 4K07A 4NRYB 3BISA 3IMRA 3I3EA 4J3OH 3UC0L 1PEZA 2DYPA 3LKQB 3QH3B 3EHBC 2DLFL 4GW1B 4L4VD 1UJTA 4U1MB 3EZ8A 1A4KA 3FH8A 1E8WA 3JWOC 4HT1L 2XXGA 4L1SA 3X1GA 1ED3B 2CHNA 4KKCD 3GYRA 3CFQA 4ZRGA 1B4TA 2WOYA 2WWMD 3BKCL 1MZYA 3AS3A 5HDRA 1P7HL 3RVUD 3WD5H 3T0VA 4CNIA 1NSNL 4MA7H 1Q9OA 1SQ2N 4KGJA 4ODHH 4UM9D 3EJSA 3APFA 3NQKA 3U7YL 5FX3A 1VCBC 3QUYD 4JQIL 4J8QA 4XMXA 5I71C 2W60B 4IGBD 4X6EB 1SBBA 3MRNA 3AWEA 4PJIA 2WIIA 4ELKB 3B9KB 4LPTA 5BS0A 3FUDA 4HKJA 3OKNA 1OGAE 3LMJH 4IU2B 5EIQA 2EYSA 4AWJC 4XT1C 4X9FA 4MDIA 4HWZA 1AS8A 4AQ8A 4JFSA 3BH9B 25C8H 4LE8A 3B37A 1AQKH 2QGBA 4YAQB 4R4BB 2F19H 1BECA 2VC2B 3V9FA 1E6OH 2WN2A 4U31A 4ZMWA 4XRCA 4EVNB 1O6TA 2I9TB 1NPJA 1KG0B 4GO8A 3V5HB 5I0WA 3II3A 4Y5VB 1AGBA 4AKPA 3WAJA 4HJ0C 3HHSB 4QWWD 1KENH 4U1NA 5FO2A 1I82A 2DQEL 2X4SB 4P2RA 4G6MH 4YSDA 1XEDA 2H32A 4P2AA 3LHPL 1JZHA 4Z18A 2K8MA 5BUPA 4PJCE 2OTWB 3O8XD 4ACTA 1PY0A 1DANU 2RR3A 3DVGA 1NEZG 3KEHA 3WGUB 5CEYA 3ZKMD 3CIQA 3KPRB 3D05A 4KAQH 5G4MA 3WLBB 2WXQA 1FQ9C 4AZ8A 1Z9SA 5FKAB 3D30A 4TNGA 1YNLL 4U0RB 4MX7B 3GB7B 4NC2B 4WW2C 3C6LB 1CK0L 3OZ9L 4YSSA 2HPOA 5EH1A 4OFIA 4YDVA 3NVQA 4LNRA 4ZTPL 3NFPA 1YEDA 3DOIA 5KVDE 4XE5B 2ATPA 2V8MA 4LL9A 2P8LB 3MV7B 3L4ZA 1ITBB 4F15B 4GRLA 1CCZA 1TMCB 1X9RA 1WA2X 4O51B 3EHBD 2Z8WC 4PRNB 1NCAL 4J6IA 3G6JA 2OJEB 3VUAA 1MFNA 3KYOB 1INQA 1YN7A 5IOKA 3ASOB 3D85D 5E99H 1YHPA 1HX0A 3LKNB 2QADC 2VMJA 4GO9A 4Y9BA 3A67H 3EDKA 4A04A 4PG2C 3GSQB 3HZKA 2G30A 4J6RL 1AAJA 2HT3C 2LU3A 4W9HC 3GTTA 2ZXCA 2RTTA 4H25B 4Z76A 2CE6A 3H42H 4YHLL 3DO7B 2F74B 1HIMH 2QZ5A 4N2OA 4KHTL 1X7SA 4K8RC 1VFUA 2NY7L 3FYEB 2DWDA 4QHMB 5DJ0B 4P46A 1XF2A 2Q1EA 3P73B 1HC1A 4K7PH 4FP8L 1TENA 1LO0L 4Z7WE 2PWEA 1E50A 1HKLL 3HUJA 3KGSA 2DMKA 5JMOC 2TAAA 4LP4A 1CGWA 4XPGL 1QABA 5FGCE 1N26A 3V5DA 5FO8A 1Q94A 3FCTA 2IAND 4TL4A 5AZEL 1IBDA 4OCYL 4BCZA 2XXFA 1ZHNB 1D5XA 3O0RH 5F0JB 3Q2CA 3VRIB 4ZD3L 1VHPA 4FXGB 2YQBA 4HJ0D 5FCUL 1MCPH 2BIQA 3PF2A 2R2HA 2Y7OA 5IQLA 5T5NF 4WKZA 3REWA 3T4YA 1HHKA 1DHKA 3EFDH 2XWTA 2CHZA 3KPSD 4R3SA 4ACPA 1T1XA 5L4MA 5LVEA 3CH1B 1NBZB 2A38A 4AMXA 4KNSA 1RZFL 2NW2B 4PJDA 4N26A 4XMLL 2UWEB 4KNTA 5EPMA 5T5FH 3ULVE 3JT2A 1S3KL 3NACH 4YN3A 3ATAA 2WUBL 4UZGA 4Q56A 3TPKA 3VGEA 3QEHA 4KTDH 3ZKQD 2W88A 5TPWH 4EZLA 4L0YA 1IC4H 4X7TA 3T0DA 2UWEF 4Q6KA 3DX0A 5FYJH 5IVOA 4LLVB 3ZQWA 2EILB 2MCG1 5BW7A 1RP9A 1FSKB 2LR4A 4O58L 43CAA 2AXFB 2XN0A 3G08A 4IS6B 2FLMA 1DJZA 1NLDH 3APNA 3MLVL 5FUZL 3DWTA 5DS8A 3BKJH 1PKOA 3IJEB 2CLVA 3IAQA 4QXGL 2BY0A 2H1XA 4AV4A 3QJOA 5SWQA 1EHXA 4TPRH 3AROA 3GBML 4GPVA 2V9TA 4N0RA 1Q9KB 2NMSA 3LRSB 3WJLC 2QFPA 5DC9B 3CN0A 3NCCB 4XBGA 5IMOA 5E8PA 5JW4N 1JD9A 4LQFL 3DX7A 3CHPA 2QADD 3S4SB 1HXYA 5EOCH 1ZVHA 1XZWA 1JF1B 5GS0H 3V52H 4Z3EA 1WAAE 1I4FB 2HT3D 4JRXD 3V6OA 2PMZA 1T1YB 4LOUC 2VZOA 4NQDD 5E1QA 4GKSA 4RX4D 1BVNT 4Z8FH 2ED6A 2X1OA 3L7EB 2AQQA 4PPTA 4P3DA 2D2CC 2EVHA 4K8RD 3FHEA 4MD0B 1NDGB 5FO9A 4UIMA 3VJ6B 1KCVH 3DVFA 3WS3A 1KJVA 1U8OA 4ETQB 4I8DA 4QRBA 1AE6H 4NZTL 2Y7MA 3G6DH 3FF7A 4PWKA 5C0NC 3LVEA 5EOCJ 4IBLT 2AP2A 2KH2B 3FL7A 3QZWG 3PPSA 1R0AH 5IW6A 4NJAL 4AJVA 2DQIH 3UPRA 2K6WA 5AB2A 5I75C 5FYLD 1G43A 1OLZA 5C08D 3ZVVA 1ZLUK 4PRID 1JAEA 3NCBB 4ERSH 35C8H 3VXOB 1QZNA 3M8OL 1JZ2A 2Z9TA 3PXJA 5T5FA 3T0EB 2PW1A 2R4SH 1KYUA 1DLHA 5I1IL 4IHOB 3NRQA 4JUSA 3OJMB 3QC6X 2NYKA 1A47A 5F7DB 2YARA 3B3IB 2XJKA 1KY7A 3FB6A 4D0BB 2GJ6A 1OB1A 1QI5A 3PQYB 2NY5H 4YVUA 1UKQA 2GY7B 2XI9A 1B4LA 2A9NL 2Z35A 2AERT 3ARBB 3OR6A 2YA0A 3HPJB 1NGZB 1NBYB 5DJCA 3RVVC 3O11B 3RTQB 1JF6A 1RK7A 1UURA 1UXSA 2BNQD 3JVGC 5DGQA 2XJLA 1RUML 3NABH 4U49A 3GSNB 3D69B 3C2SA 4JFVA 3EO1B 4ZUUA 2YBRB 2DEYX 4FG6C 4MZIA 4PJXB 4H7VA 5DRZA 5TD4A 3B9VA 4FOMA 1BVKA 2AJVL 5IFJA 1FJ1B 2TSAA 4LBEA 3VYOA 3QORA 4PJXF 1Y18B 2VKWA 3ATEA 3ETSA 5KVDH 2Z3FA 3T6QC 2UXFA 2I85A 4L9LC 2GTQA 4G7YL 2BVQB 3FTSA 1HSAA 4X6FB 1ETA1 4JM2A 1QEWA 5EDSA 3U4KA 1ZVSA 2C7UB 1U2HA 3HMWH 4PW3A 4PWGA 2BLFA 3AXIA 4GKLA 1ZT4A 3SE6A 2OSXA 4ZW6A 4ADIA 3LN4A 5C6WH 3N9GH 3K74B 2ATKA 3OKKA 5D1XB 3IEAA 1HHHA 4LOUD 4QHLB 1OGAA 3C5ZA 3BH8A 4UQDA 4WHYG 1ZK9A 1BXVA 1OAUH 3HC2A 3RRQA 1AD9A 3OHXB 2FQEA 3PAZA 2PXYA 4DKDC 1UVQA 5SX4H 3LVTA 4H2AA 2HWZL 3RY6C 3TJPA 2XYBA 4DP1X 1QR1A 3FN0H 2GIXA 3P77B 4JFOB 4U6XB 3EJQA 2LTQB 4IKNA 5C0ND 2YIHA 3H9SE 3X13A 1CLYH 4N2IA 1IC5L 2A6IB 4P9HH 4YR6A 5FC9A 3EYFB 1SJMA 3LEVL 5A2BA 1XF3A 5T1LB 2GK2A 4U6VL 5DZJA 4KK6C 1IO4C 1I1AC 1CGSH 1UG9A 4NT6B 2ENPA 3ARWA 1AZNA 2Q5BA 4AL8L 1JVOA 2BSTB 1BG1A 5I8EA 2AV7B 2CO1A 4N5EC 3BJ91 2AXJA 1K72A 3Q9PA 3UZQB 1F8TL 1FAKT 1N19A 5TQ2H 1ZV9A 1HHIA 1E2ZA 4DGUA 5J11C 1S7QB 4YE0A 3UROR 2BPBA 3ESNA 5DF0A 2YKLH 3DX8B 4ABWA 4IDLA 3OB0K 1TQWA 3ZE0E 3RVVD 3GMLA 4JMNA 3TYGL 4NO0B 1PLGL 2WTOA 2DYPB 5DWUH 2Z8SA 4ZPTA 5CKAA 4RGNE 2H6UA 3HR5A 3Q8FA 4A1RA 1A8JH 4XXCA 2Y07L 2ZOKA 3WXWL 1SVCP 4FXKA 4FG6D 4GEJA 2WZ0A 4N2NA 3OD3A 1SHSA 4JFZH 4EI5C 2XIIA 1QLEL 1HXKA 3SCMA 1NGQH 1MLCA 5J7CC 2FQGA 1TJHL 2L7JA 4YHOL 3MVSA 4MA8H 1BEYH 1YEEH 1KEMH 1JPSL 3CBKB 2HKFH 2IGFL 1AZUA 3FTGA 1MHHA 1WAPA 1FWXA 3C6SB 4Z9KB 2UZIH 1QATA 3MRNB 5DFTA 2WIIB 3GZPA 3ME0A 4JO3H 3HLAA 4HKJB 3BUIA 3FFCE 4KOCA 2RFXA 1E6JL 2Y1YA 4JLRA 4MDIB 5G5DA 1KULA 1RVFL 1AGEA 1OP9A 2W94A 5I82A 2C3XA 4DHLA 4XRCB 3KYMA 4H8PA 4JKPH 4YL9A 3GBDA 4Y4HB 3K2KA 3NJJA 5DMJB 1KLFA 4BIKA 3LH9A 5MHSE 3KDPB 5D7JA 1ULVA 5DJDA 3N1PC 1BFVH 1AGBB 3CC1A 3BKYH 2H8PB 4JG5A 3MJWA 2J1ZA 3FNKA 4P2RB 2BHYA 3CN2A 4U7SA 2H32B 1PSKH 1MWOA 4K5MA 4DF9A 4XWGH 4HJ1A 5EUOE 4FZEH 4AITA 2G5RA 4ZTEA 4KK6D 3TXAA 1I1AD 5CEYB 1EO8L 4B50A 5ABZA 1MY5A 1RURH 4RAVA 2D4DA 4MJIE 3FQ2A 1Z9SB 5E6IC 4N5ED 2ADIA 5FM5M 4TUOA 1AACA 4QRQA 2Q7NA 2UXVA 3FYIB 3GC3A 4IHBA 5EU5A 4ZMTA 2QVIA 3TOPA 3OKEA 1MQ8A 4YDVB 1FC1A 4L8SC 2ITDA 1RZ7L 1X9QA 3V9EA 5JMRA 4OGAC 3KVQA 4LNRB 2H0JA 2RH0A 1KXVA 2R0LH 3NFPB 5EF1A 1YEDB 1I85A 2ATPB 1CQKA 3VXSA 2OBGA 5IHUL 2ZYHA 2R0WH 4WK2B 5ACZA 3OKYA 4NUJA 4AYID 4BGLA 3UYOD 4KXBA 1X6LA 2MTPA 5J9PA 4AKOA 4LGSB 5CSGA 4TSCL 3TFKC 4BZ1L 2OMTA 1YN7B 5I26A 3EFOA 3VQ2C 3ZT5A 1CGTA 1OCZB 1LK3L 2VW6A 4EI5D 3HZKB 3DJRA 3MRIA 5C0CE 4YXHH 4ZMQA 3G6JF 1BFOA 3QXDA 3GBNL 4LAQH 3TH4T 2JJVA 2JV6A 2A6DA 1PFOA 3ERXA 1ONQA 3U9UA 1H9VA 4EOWL 3QE5A 4A2DA 3BYYA 1MREL 4TLSA 2A4EA 2BVOB 2IFFL 1ZTXE 4G8AC 3F58L 3KZ8A 1DJWA 3J7HA 2FNWA 5AW4B 3PGCA 1WQVT 1U8IA 1ZV2A 1NAMH 3WKNA 1XF2B 4P46B 1E28A 5DUPL 4JKNA 1XB6A 3OF6D 3I2CH 3HUJB 1BWWA 2HA1A 1YAIA 1PVHA 3EYSH 1AHWA 4ONHA 4QYAA 3L5XL 4N87A 5LN8A 3DXAD 3OKLB 1MQKH 4NHCH 3GJFH 1Q94B 2I5YH 3FCTB 3JTSB 3V5DB 1IBGH 5ALBL 4E9RA 3HUJF 3MLWL 1TETH 4C4UA 1VKXA 2Z1KA 4AV0A 2UZXA 1B2YA 1NFIA 3GGWA 4XOEA 1D5XB 3BHBA 4XO8A 3REWB 2R2HB 3T4YB 2XZQL 4JO8A 2XWTB 3KWTA 4N22A 1DVQA 4R3SB 1JHKL 2QDWA 1L9QA 1W72H 2X4QB 2XPGA 3E3QE 4WNSA 5LDSA 5I6MA 4Y1AD 4WUKH 4PUBH 3VTAA 4PJFA 4BFJA 4DP9X 2F5BL 4GIPD 4LU5H 4JDZA 1NM9A 3UG5A 1DSFL 2NR6C 4KMTH 3O2VL 3IDMA 3E2HB 1RERA 4PJHA 4UM8A 1SF5A 3FQYA 1EQWA 1X5FA 5E6ID 2VW7A 3UJTL 5TK2A 5CEZE 3TIDB 1DCEA 1NIBA 3ZTNH 4LSTH 4WUUD 2DKSA 5D6DC 4PJDF 4MJ6B 1T0OA 2B1AH 2EDLA 3IT8D 5FCSH 2NX5E 5T33L 5EWIH 4OGAD 4AQZA 1J8HE 3FT1A 1U8KB 1P9MA 43CAB 2PPCA 3MFGB 3G08B 4LLDA 2WD0A 1U8MA 4FHJA 4JO1H 1D6EA 5DS8B 2WSDA 1CL7I 1RUKH 1ZT1A 2CLVB 3CH8A 3L4VA 3S3PA 3T2NL 3V0FA 4XMWA 2GT9A 1VGEH 5C9JB 1R3HA 4JHBA 3MNWA 5MEPB 5E6UB 5G2NA 5I1JH 2XKNA 3TFKD 1EHLH 4ATTA 4XBGB 4XBEH 5E8PB 5IMOB 2NUTB 1NAMA 3WMPA 1A7RL 1EDQA 3ULAB 4YDMA 2Y22A 3CZSA 2VRKA 5CD3A 1UH4A 3TBWA 3VD1A 3ATDA 1NANI 3H8NA 4JREC 2J4WH 5KTEL 4GKSB 1SJEA 4TLUA 1M7DA 5IOPB 3EXJA 3GJFA 1TFPA 3B34A 3EOBA 4YH6A 3RWJA 1XMWA 1WEJL 3GNMH 4UIMB 3WS3B 5FO9B 2O93L 1BD2E 1KJVB 1U8OB 3ARGC 4LIQH 4PSPA 4V2BA 3J07A 2APBA 1NBQA 5INDA 3CVHH 1GYCA 5EOTA 2QQKL 4AQEB 3U25A 3MHZA 1BQHG 5B8CA 3DGGA 3MLUH 5IW6B 1CBJA 2F54E 4MZRA 5K59E 1NKOA 3UPRB 1JFHA 1W72A 3UJIL 1TCRA 1NCCH 1ZJBA 3MBEC 4WV1A 3IU4L 4XO4A 4M7LT 4PJ7E 2B39A 1S9YB 3MN8A 4KV5E 4NQQA 1X4XA 1YYML 3PXLA 1DLHB 4CMHB 4H0LC 3CHSA 3F64A 3CU7A 1UA7A 5EO1A 3P0VL 3TVMC 2P46B 3UJJL 3TEYA 4ZMVA 1BQ5A 4OZFH 1PIFA 3FB6B 2GJ6B 1CURA 1OB1B 3ZQ9A 4IOSA 2NW3A 4YDJA 2GAZA 3VAEA 1Z9PA 2Z35B 3QRGL 1E4XH 4XNYL 3PS6A 5J12B 5EEYA 1LO2H 1PZBA 2NR6D 2YQGA 4AGQA 5DJCB 4Z7QE 2C3HA 3L3IA 4N0UE 4YC2C 4W9DC 1NOLA 3IJHB 4F9PC 1XGPA 3S37H 1UXSB 1JDDA 4HISA 4RESB 2XU9A 1MFDL 4M5TA 3QJFB 1QTPA 1YMMA 1XX9C 5KUKA 4OCSL 2XQYA 3D39E 4FZ8L 5AW5B 4AL8C 2WZAA 3MODL 1P84K 3L45A 5DRZB 1BIIA 4UANA 4ZT1A 4HS6B 3IYLW 1EZVY 3S36H 1CR9H 1BVKB 1TVHA 2AEPH 3QUHA 4KX7A 2YJLA 3BE1L 2OCFD 5IFJB 3ZIMA 1CD8A 1IC7L 3RA7L 4LBEB 2GK0A 3DOSA 3QORB 3WFBL 4NIKB 2KMWA 4KKNA 3D12B 4HHAA 2AK4A 2JK5B 1MFCL 3C8KA 1MOEA 3KNBA 1HSAB 2L04A 3KE0A 4GRWH 2MHAB 4G1EA 5CMAA 4WDIB 2FX7L 4JM2B 5E95B 5IESL 4QXUL 2NY3B 1IGJA 3MBXL 1C8PA 2LOEA 5B1CA 2OR9H 5FUOL 4RDBA 3Q43A 3LN4B 4OQ1A 3CVHA 1FNAA 4KH2A 4OH2A 5C8JA 3QFJD 2J2ZA 1MCWM 1Q1JL 3AREA 3QUML 4O9HL 4APQB 3D08A 3ILQC 4JM2F 4QRSA 3FFCA 1FN4A 1OGAB 3C5ZB 1BM7A 3BH8B 2JIXD 3L9RA 4KZDL 3D4YA 2BIMA 2F8OA 3DO4A 3OG6B 2E47A 4WFGD 1AD9B 1JRHH 2PXYB 1XR9B 5KZCB 3CE1A 1X9UA 2NRDA 1LD9A 4Z7VE 1NDMA 1X44A 2E7MA 3ARGD 3O4LD 1LYQA 5AW3B 1VCAA 5K33A 1QR1B 1ZTXH 3MA9H 4XO5A 4AEIL 4G72B 5C0FA 2DLTA 3WELA 4HFUH 3X13B 2DOCA 3QO0B 5DQDL 4OZFA 4YR6B 1DQIA 3QEGL 4KHXH 1XF3B 5F70A 5CKGA 1F97A 2QL1A 3UBXA 1D9KC 3L6FB 2OFQA 3MBED 3INOA 1X5MA 4LEXL 1C08A 1NFDA 4JFED 3SDXE 1VPOL 3H4HA 4JG9A 3V0HA 1MJUH 2M8XA 3B8SA 5EUOA 5L88H 5I8EB 4K7PX 1TU2A 2XSKA 2FTAA 1S7VA 4MXWH 4GP8B 3TVMD 3LS4L 1GCFA 1AR1C 1T7XA 2VABA 4MJIA 2D03H 3ZGHA 1HHIB 3BD3A 1CU4L 5SWSD 3O6FA 2FUQA 4HS8L 1WISA 1JGEA 4QMEA 1F3DH 2W0KA 4IJTA 2YMXL 2EABA 2ZSVA 5IQOA 4F57H 2IBZX 4JRFA 2BERA 3P9WB 1VZGA 2WO4A 4QLWA 2GJJA 4H8WH 2BXYA 4ZFZA 2CO6A 2B1HL 4ZPTB 4NP4H 1JJUA 3NZHL 1O7DE 3HR5B 4OJDH 1JZ4A 3KH3A 1KYOJ 2ZOKB 3RAJL 3WCYA 2OYLA 4FXKB 5JW4Q 2WBXA 5CJ8A 1SNRA 4I77L 4GXUN 1P5VB 4F8OA 3SCMB 3BP6A 2C8NA 3PNWB 3FQXA 3M88A 4HDIB 1DJXA 3SKUD 3VX0A 1OE3A 1RZIA 4ZX3A 5C0CA 1G1YA 3PP4L 1A3RL 3JVFC 1T2QH 3FTGB 1MHHB 3P3YA 4E9LA 1KIRA 4ZOAA 3HLAB 2X1WL 2JJWA 2IAMC 1JV5A 1SLUA 2RFXB 5KG9A 1T83C 4JLRB 2AJXH 1AXSA 5G5DB 1HAWA 1HINH 3ILQD 1TT6A 4BSJA 1AGEB 1JGIA 3AUWB 3R0MA 4HUUB 5CILH 5DXWA 1J8RA 3QI9A 4HIJB 1ACCA 5E4AA 3GK8L 3KYMB 2NY4C 5TGBA 1CT8A 2Q8BL 1KLFB 1GPOH 5D7JB 3SZKC 1N5AA 1SYVA 2RIKA 1A6UL 3VDBA 1A7OH 4WI8A 1E9PA 5F1OB 4DESA 2ENQA 4BA8A 1HDMB 1HT6A 3QNXA 4MCYB 1RUPL 4JRYB 1ZVNA 3V0AC 4FTDA 4KUCD 5B7EA 4OCWH 4TQIA 5GHWL 5HHQA 5HVHB 5I6XB 1D9KD 3MR9A 4KRPB 1ESOA 2YGQA 1EAPA 1MIMH 3IDUA 4RAVB 2V7HB 5EF0A 1SVZA 2QV4A 4AIXA 2YPLE 2ADIB 1Z3GL 2ZOUA 2VLKE 4MMXA 4GBXA 4QRQB 3GXTA 4TUOB 5EU5B 4JFDE 3QQNA 1AR1D 2PO6B 4JFWA 4UT6L 1GGCL 2ZCZA 5CIPH 4RSVA 3PFQA 4G2AA 5AOLA 2OMNA 5E8OA 2XVKA 5ID0A 1FDLH 2OL3L 2ZAHA 4JY5H 3N43B 4MJ5A 3VXSB 4Q6YA 1UYWL 1H3GA 3KLKA 2ZWKA 1ZK5A 1BGXH 2NX5A 2X4OB 3DI2B 3CZJA 4MB1A 2K45A 4W9GC 5SX5K 2EICA 4G6AC 1J8HA 5ACZB 4NUJB 3IFPA 3V4VH 1A14H 4HMEA 2A74A 1QNZH 2DQCH 2EIEA 3N43F 2OMTB 1TZ8A 2XOTA 4XC3L 3C08H 4DKEH 3EFOB 3FQ4A 3PPEA 5D7SH 1OSPH 3MRIB 3BAWA 4IRSA 3QXDB 4E9QA 2EO1A 2A6DB 1T2JA 1ONQB 3U9UB 5HJDA 1EXGA 4BFOA 4RA3A 2EDXA 3QEUA 5FWRA 5DJXA 2VM3A 4PWHA 3LNEA 1JUFA 5IFHH 3D2UA 1HCFX 1XSIA 3PGCB 4TM9A 1U8IB 3DPDA 4H1LB 2IAMD 3SJVD 1HZLA 4G8GE 4ELME 4JFHE 1BP3B 3HS0C 3IK2A 2VZUA 1EJ8A 2B59A 1AHWB 4ONHB 4D0DB 1XZ0A 4MA1B 4LO9A 1JZDC 2NSMA 3FTYA 2NY4D 4YXLH 1VKXB 2OMYA 4FKEA 3EGXB 4I89A 4JUTA 5DFAA 2A73A 2UZXB 3QCTL 4OLWL 5F7WC 1NFIB 1I75A 2F54A 2WXGA 3BHBB 5DC0A 1AMYA 3DSFH 1OZTG 4TVPE 2NCMA 1MNUH 3F3HA 4G43A 3WHXB 4G71B 4M5ZL 4PJ7A 3HBGA 5IGXH 3T08A 3BSZL 1GVIA 3NGBC 2XPGB 1UZGA 4AYGA 5F8QC 3QARA 4PJFB 5JXEC 4LCCC 1KBGL 1IRAY 2BSSB 4HCRL 4JDZB 3P2TA 2CA4A 3TBYB 5KYWA 4UU9A 1SMDA 4F24A 2EDJA 1KJ2L 2X89D 3IDMB 2DM7A 1JTOA 3FUKA 3HI6L 4PJHB 4U6TA 4UM8B 5M7QA 5D7KD 1PD1A 4GW4B 1EHKB 1MFUA 3V4VA 4PJFF 4CC1A 4C4KO 4N2LA 2EIZB 4MA3A 3AY2A 3EOYG 4PRPE 3ZTDC 3K2UH 4HXAH 4N0UA 4FTVA 1CDGA 1SPDA 4PJHF 1EUTA 5F0PB 4MGXA 2WN3A 2FNBA 4XMPH 1ZHLA 2YBGA 3CDCA 4XP6L 3FOMA 5GGTL 4PRDA 5JOFA 1U8MB 2CDFA 5HYEA 5E4IA 3HG1B 5FF6A 1D6EB 2B2XH 2J25A 4OLYH 1ZT1B 2GPZA 5EZLB 2ADFL 4G6AD 3KBPA 1F02I 2BIOA 1R3HB 4ENED 3MNWB 1VACA 4L0PB 3NTCH 5JW3H 3DOHA 2E86A 2VDQH 3OM3B 2AAAA 4DOHE 2EVJA 2LE9A 1PBYA 4KH9A 1DLFL 1UUNA 5A2KH 1KFAH 1YEFL 3Q13A 1U91A 4FE9A 5HGAA 2V7NB 4PTTA 5CD3B 5I8OH 2HRLA 2YXVA 1OW0A 4G1MA 5GRYA 1CN4A 3TBWB 3IAGC 5LDUA 1XGRA 3QYCA 2VLMD 4UIKL 5C7ZA 3D0AA 1YY8A 4O4YL 3V79C 4Q9QH 4J7RA 1U95A 3CZFA 3IGFA 5IUSA 3EOBB 4ZO7A 3RWJB 4L4JA 3OHMB 1MIEL 5D5ME 3G9VA 1O6SA 4JR9L 3EBAA 4F3FA 2HG0A 3LKSA 5INDB 5EOTB 3HC4L 4X4YA 5BZZA 5TFSH 3ZMNA 3VW3H 2BVYA 5CINL 4D2NA 3EOTL 3D51A 3DGGB 4D9RE 2O61A 3CZKA 3TV3H 3BSGA 4B9ZA 1V7MH 3MU3A 3OGOE 3SPJA 1TCRB 5JIIA 2YRLA 1XD0A 3QDJD 4WV1B 1RXLA 5K9JH 3RX5A 5L0QC 4HQQL 2CO7B 5GJSH 2FX9L 2CDGB 5DZ9A 3OAYK 5ACMA 2ADYA 4WNQB 4Z0XA 2EUXA 5EO1B 3PGFH 3EF7A 3SDXA 4KRLB 3F12A 4GRMA 4H44C 4P2QA 2HKHH 3MJ9L 1RL1A 1JHLL 5F9JB 3ES6A 2NW3B 4YDJB 2GAZB 3Q5YA 3WENA 5JXED 2FWOB 2WLYA 4JCMA 3NCWA 3EH3B 1CYXA 2VR8A 4ZTOH 3ALWA 5CEXA 1Y7VA 1XGPB 3NFNB 1VFBA 3RIKA 3U7AA 2ZQKA 4Y8DC 3BW9A 3DIDA 3CAFA 3ZKSD 2VLLB 1A7QL 2OSYA 4B0MB 2N7BA 2WBWB 4JZJC 1YMMB 5MENA 2YQ2A 3L9BA 3NAAL 3P69A 4W81A 4I3GA 3VFVA 3D0LA 1BIIB 4RGNB 2P5WD 1LJMA 2X9XA 3VFOB 2F7RA 2VRAA 4E42A 1F90H 2QPDB 1TVHB 2X05A 1KYDA 1MPAH 5E6YA 1TPXC 4U1IA 3N85L 1NLBH 4ZFFA 1Z9LA 2G5BB 3QHZH 4N2EA 4HHAB 4A2LA 2AK4B 1MY7A 3KNBB 3FB7A 5GRUH 5CMAB 3TGXA 4G1EB 3X11A 1HNYA 1LWHA 3DK0A 3HMXL 5IB1B 5KN5A 1IGJB 4NPJA 1B9KA 3U4BH 4FJZA 5ILTH 5C8JB 2J2ZB 4I0PA 4Y5XB 3U83A 2R0ZL 3AREB 4G7RB 5CNHA 1N6QL 4B3VA 4HHWA 1P4LA 3FFCB 1FN4B 2C4FT 1RUAL 1TZAA 3VI4B 1DQLL 1C5CH 3L9RB 3HEIB 2XVBA 4LP5A 1NIFA 3PAYA 5E7FA 1GS8A 1M4KA 3BRFA 2H3KA 4NNYA 5AVRB 1I8KA 1NDMB 3VI4F 3POHA 3WUWG 1DQJA 3GT6A 1BREA 3TJHC 1QRNE 1NIEA 4K5OA 4AQOA 4ZMLA 5C0FB 4ZAKC 2DTMH 4LFHG 3IJSA 5DJ2A 1AZBA 1S9VB 3QJSB 5KAQF 2WZPA 4U6YB 2ZCHH 4QXVA 1W80A 5ALCL 3UBXB 1DBKH 1GZHC 2YD6A 3QAQA 2J71A 3UAFA 1C08B 1NFDB 2ENSA 4KI5C 4M6ML 5H4ZA 2W80C 1QFUH 2A9DA 5DR5H 5FUCE 4ES9A 2KDYA 3KJ4C 1TU2B 1YJDH 3FW6A 1NFDF 3GI9L 3VXUD 1U8LA 3GKZA 2WSKA 4HOWA 3RPBA 3O6FB 1K3IA 1AFVL 2EJ1A 3L2LA 4TVPH 4QT5B 1FO0L 2JSFA 2FZ3A 5F7EL 4JFDA 4RFOL 3VMPA 4LFHD 1LE9B 3H9HA 3O9WC 4WWKC 4OW6A 3QDGE 2CO6B 4OLXL 3TO4C 1RPUA 5EN3A 1WBXA 4JBSA 3MROA 1H6UA 1OAYL 1IKNC 4MZ2A 5TE4H 2DW5A 1T03L 4GRWB 4ONFL 2OCJA 2BRRH 3CN4A 4V1DE 4KY1H 4PSRA 5JHLH 4YHKL 4H4NA 2HTLC 2HFFA 4HG4J 4HAFA 4K73A 4LDEB 4RSYA 3LH2L 1S3RA 4L37A 2MNJB 1KTKE 2VC2L 3BP6B 4OM1H 1I8UA 1FAIH 3FQXB 6FABH 4GRWF 5CN3A 3TJEL 1WVZA 4DK3A 3ML9A 1RZIB 2R8SL 3WTYA 4X50A 5C0CB 1FNSH 1X4ZA 3A23A 4CADB 1KWGA 3TESA 4OY9A 1W8OA 1K8DA 3RDTB 1KIRB 4XN2A 1XFPA 1JV5B 4YIQB 5AWNH 1RHFA 3FQWB 4UWQB 2VISA 2XA8H 8CGTA 4C56E 3Q8EA 1AXSB 5I1LA 2B14A 1MKFA 3M7OA 1ZOXA 4H8UA 3TBTA 3UBHA 4AYFA 4OCLC 1B0IA 2H4EA 2J6EL 3U48A 3GSWA 3T3MB 4AYDC 1UEMA 1INDL 1NPUA 2XTSA 3QI9B 3EXLA 3PL6C 5DI8A 3APMA 3DBSA 1AG0A 1CT8B 3K46A 1QSEE 1XCQA 2HRPH 5FFLA 1H3TA 1N5AB 1SYVB 2ED8A 2GJPA 3T3MF 3DX3A 1E9PB 2H9GA 3IDNA 1E5AA 4YSOA 3TJHD 1OVZA 4PTUA 4AMWA 4NM8H 1VZIA 4ZAKD 1AIZA 5HYJD 1NDTA 4MNHA 4JE4B 3UGUA 5HHQB 3MR9B 1IB5A 3B2DC 5T3XD 4KI5D 1EAPB 3PDDA 1OAKH 5HDQH 5AW1B 1RU9L 4UTBH 3VGGA 1CZ8L 4UAHA 2P5ED 3EJZC 3VXRD 4MMXB 4GBXB 2KC0A 3SPCA 2W9DL 1YA5A 3EJYC 4FD0A 4ETYA 1SXBA 3E8UL 3T6WA 3B9EA 3MRGA 4TKWA 5JHLA 5AQ0A 1RZQA 3CJJA 2IPUK 4GMTH 4JFUA 4PRPA 1R3JA 3OR7A 5E8OB 3FULA 4MJ5B 1NCUA 1A4JB 1UC6A 2QMJA 4HZAA 2NX5B 3O9WD 2YD3A 3APCA 4WWKD 5EFIA 5GGUA 3DETC 1J8HB 3WTTA 4DGIH 1II4E 3TO4D 5L4JA 2A74B 1MWAH 3TA3B 2B77A 1KBVA 3RFZC 4O02H 4S1DC 3LPWA 1M1SA 3ARTA 3QAZC 3L3KA 1IIIA 2DMBA 3EJCA 2HTLD 3HJEA 4KZEL 5BJTA 4HMDA 4JO4L 1VB9A 4U1LA 4DEPB 3HE7A 5C2BL 4B41A 4AT6A 5IJVA 4KVCL 2B4CH 3IFLL 3QEUB 4P2YA 5DJXB 12E8L 1JUFB 2EYTA 4WJKB 1SYSB 5K1JA 1YPZB 1X5KA 2MOVA 2VYRE 3Q5TA 4R9HA 2F8XC 3WYRA 1HCZA 3S36X 1E27B 1P2CA 2KDGA 1A7NL 2B59B 1CDIA 2J8OA 1YPZF 3QDMD 3V0GA 1TJIH 4WY7L 2Y36H 5D5MA 4YE4H 3R7QA 1CLOH 5BRZD 5I0DA 2G2RA 1ZWIA 6CGTA 3FQRA 3PL6D 4EUPG 4UNVA 3TTSA 4OCNC 4HFWA 3M07A 1W0VA 2A73B 2LAGB 3CG8A 1KXHA 1P69B 3JV0A 5IMLA 4LKXA 2D0GA 4UDTA 3FB5A 4UTBA 5J8OA 3FCBA 3GXFA 4FFTA 3D50A 4B60A 3K8MA 3W37A 1G9ML 3S2AA 4AG4H 1QMUA 4G43B 3QNZB 2C4XA 5HVGB 4PJ7B 4YGVB 5BQ7A 2BNRE 4RZKA 2DKMA 4TQ8A 2EO7A 4KPHL 3REVA 1WBYA 1MCQA 5B3JE 4N0YH 5DS2A 4NQCA 2ESVB 5KYWB 2QQLL 2J57A 3D87B 4UU9B 4PJ7F 2HFGL 3RIAF 3KPPA 2JFCA 3LZFH 2V33A 3EJZD 2DLGA 2ZICA 1U21A 3AG1B 5HHNB 5AAMA 3TP4A 2W0LA 4PG9A 3V4VB 5JXAH 3C09C 4BUQA 4MA3B 1MWAA 1PQZB 4IQHA 4N0UB 3EJYD 4FTVB 4O02A 2YD5A 4LVEA 5FFGA 2OLDA 3NN8B 1ZHLB 1ZD6A 3S98A 3FOMB 3FRPB 4J3BA 4UUJA 5JOFB 2FH6A 2E9IA 3IDJA 4DP6X 5FF6B 4LXFA 4YDKL 3DETD 1I1YA 2QPEB 1E4JA 2WAQA 4N86A 2A9AA 5ENWA 1GGTA 2BSED 1B0RB 4HS3A 3T3PE 4S1DD 2XZCH 2VUYA 2X4RB 3VFGH 1B4RA 4YBLB 1MCDA 3S8GB 4L8BA 4DAGH 1U91B 4APXA 3JSSA 4PTTB 3CFIC 4JDTL 4G1MB 3RURA 2XWJA 1XGRB 4HIXL 3Q1SL 4N0FA 2DDQL 5K1VA 1YY8B 3EBGA 3LB6C 2J6WA 5DD1H 3NA9L 1U95B 3CZFB 1OT1A 3C60B 3F01A 3HNVL 2X4TA 3CIAA 5EU7E 2XPYA 3QSKB 1OAXH 3I9AA 3SZ6A 1TQBC 1O6SB 4F3FB 1FORH 3LKSB 5I15H 2EXWC 1PTZA 2A9ML 1I7ZA 4M8QA 5FV1L 4IBSA 1D3CA 4DFHA 1IAKB 2O61B 4BWWA 3RZWA 1S5IL 4KVNL 2JB6A 5GQBA 1QRNA 4I3RL 3OMAB 1RY7B 4X5LA 5AKSA 5I5JA 4G7QB 3S3DB 3BIKB 4PJ8C 4EIZC 1JYWA 1LDPH 1AOZA 3GM8A 1JIBA 4Z0XB 4M4RA 3F2LA 3SDXB 3F12B 3RGVA 1N0XL 1VDGA 3IPBA 3LXBA 4AX3A 1MCNA 4P2QB 5HHPA 4WFHE 3ES6B 3BKML 3P0GB 4W70A 4XBPA 4J2XA 2DQFA 1EWHA 2R1YA 5ABDE 3W38A 1IGYA 3SDXF 4WQOA 3ZTJH 3K6SB 1E4WL 3L3OA 1OZUA 1VFBB 1KGWA 2AQNA 4ANXA 1KJMA 1UM5L 2AEIT 3BW9B 4MJJA 5D93B 3NDZE 5GZOC 3TA4D 4D7BA 5MENB 3TL5A 1EEQA 2EEDA 2VDQB 3ESPA 4HWBL 4OD1H 2NNCA 3JZYA 3MDJA 3VFVB 2YD2A 1OQXA 4BZYA 4UAOB 4MNGB 4E42B 2YSSA 5TE6L 2KPWA 5I17A 1XWVA 5HI5C 3ZZSA 4ANVA 1TXKA 3G5WA 4U1IB 3K81A 2B08A 3DUHA 3IU3A 4V1DA 4ZFFB 3MRJB 5AVYB 3S5YA 1N8OE 5CFAA 4YHML 5E94A 3BVUA 2DH3A 4R26L 3WKML 4AEHL 1I8IA 3BGFB 2Q10A 3FB7B 1G7QA 2F53E 3IFNH 5C86A 4X9HA 3BVXA 4GFTB 4NNXB 5TDNB 3F83A 3WTXA 3MUZ1 3B9KC 3BDBA 1WD9A 4LRIA 2G3MA 4I0PB 4DGYL 2QDVA 4RQQA 1AJ7L 1P4LB 2FGZA 4K3DH 3SN6N 2IH3A 4OD3H 3LB6D 1N59A 4DN4H 1CWVA 5H8DA 3A4FA 3EBHA 3O6KL 1RLBA 1A7PL 3DC0A 4NNYB 4I1PA 1I8KB 3LIZH 3UPCA 1W8EA 3NA4A 1F58H 1NFAA 3MX0A 5JUEL 1DQJB 3BWUF 2ZCLH 1GZQA 2HT4C 4CVWA 1CFMA 5D70L 1A6WL 4Y5VC 1QSEA 4B9IA 3EFFB 5GZNC 1CFBA 5EU3B 1JCVA 2BFGA 4KQ4L 4HGWA 4PS4L 2P45B 5FYKL 3MCLH 5HHOE 3WJJC 5GS2D 1TTGA 1PKQE 4WCYH 4PJ8D 4WTZA 1IFHL 3L9EA 1IBHA 3AM8C 1X5AA 2OQJA 1DJYA 1FHNA 4BRJA 2BY2A 3U9PL 1DEEA 3P30L 4FI7A 5IHBA 4B9YA 5JO5A 2AQ1A 3AY4A 1U8LB 5HTSA 1KPRA 4U0RC 4AV5A 3L95A 2YEZB 3C6LC 3KWVA 2FZ3B 3KBHE 2DM2A 4JFDB 1Q0YL 3OLGA 5EZIL 4BFFA 2E7LA 2P80D 1BBJB 5F0LB 2VDRL 4K94L 1N64H 4XMUA 2IPUG 3RY5A 3RB5A 1WBXB 1EJFA 3MROB 5I0XA 1S7WA 2EINB 4F15C 2ROXA 5GZOD 5KYNA 1JNLL 3RQ3A 4H2CA 4YZFE 4NCDA 3KLSA 2XWCA 2HFFB 1THCA 4L37B 2XFXA 3UTQB 5F2FA 4GG8A 3NSYA 5HI5D 3KLDA 1B3IA 4H20H 2DY2A 4HBCL 3SBWA 1K4DB 3TWCL 1UJ3C 3KBEA 4XP1H 3ABZA 4FN0A 1PD0A 3FCGA 4FRWA 3VH8A 4Z77A 1TG8A 1K8DB 1AO7D 4NWUH 4RAHA 3A6BL 1YEGH 3CFNA 2Z31A 5AOJA 3IDXL 3WFHA 2VISB 3B9KD 4S1SL 3GTNA 1P0SE 2ADGB 3KW8A 5I1LB 3G5YA 3TEWA 4A2EA 1MDAA 3TBTB 4FMVA 1ZLWH 4GIOA 4AYFB 3GSWB 1V7NL 2AJYH 2XWBB 1K4CA 5DI8B 1J10A 1FGVH 3FQUA 1XCQB 3T1FA 3IJYA 4EJ1C 1EEUA 3W39B 4BFBD 2UX7A 3IDNB 2P8MB 2Z4TA 2HT4D 2OPCA 4PTUB 2YAHA 4DN3H 4EMZA 2Z91A 2OM5A 4PJ9B 4FXGC 1ZPUA 5GZND 1KB9J 3L4CA 5DJ8B 4DK6A 4MNHB 1GGIL 3WD5L 1WF5A 4MA7L 1F4YH 4M29A 3FT3A 4NZJA 1EHNA 1RZ8A 1YLBB 5JQ6L 4M1GH 3HTLX 3KWUA 4AYEC 3V4UH 3FUFA 2Y7NA 3SOBH 3KPRD 1OP3K 4XVUC 1SFDA 4M1CC 4W4OC 3FQNA 4GKNA 4WO4A 5CGTA 3UO1H 3LMJL 3VX1A 2A83B 4PY7A 2JJSA 3MZGB 2X9ZA 4HC1H 1ITCA 2KHAA 1J87A 3L1GA 3MRGB 2GBAA 3C6LD 3DX9A 1BVZA 5DUJA 4Y16B 2C34A 4AXWA 5B38B 25C8L 3OR7B 1AQKL 2V0AA 1BQRA 2F19L 3ILDA 5ADOH 5KYUA 1FSKC 1E6OL 4QHUA 1UZ6F 3AXHA 3OKMA 4RGOH 5AZEH 4PN6A 3GSOB 1JDAA 3IWVA 5EFIB 1J0IA 3LTVA 5DEFA 4M43H 1QRKA 4C8XA 3MV7D 4NQSA 2XPZA 3A0OA 4ZSOE 4UTAH 1KENL 1BM3L 4J1UA 4W6YB 3L3KB 5GRJH 4G6ML 4Z3JA 1QX1A 1EDYA 4MD5A 2ZF8A 1URLA 1SUJA 4CSSA 4ABUA 4AC4A 2VN3A 4U1LB 1CE1H 1UFUA 4AT6B 3T8VA 1CDCA 4JMXA 4KAQL 4MQTB 5IJVB 5H4YA 1L9SA 4E9XA 2WUBH 4HEME 4PRHA 1MI5A 1KC5H 4NN7B 1NCIA 5TH2A 1ZLSH 2VXTH 1R5IA 1I9JH 5F7NC 4N2AA 1BVLA 5LBVA 2FBJH 5JPMA 1QHPA 2HJKB 1H15B 4UYPA 1P2CB 2FECL 3QIWA 4QTFA 1ET7A 4ZYKA 4A7UA 5D5MB 5AVVB 1NEPA 3F00A 2WCSA 1ZWIB 2X09A 3JZ7A 3FQRB 2K70A 1NM4A 1ETZA 3S5ZA 2IOOA 1NKGA 3I6KA 3I3BA 4HFWB 2D4FA 1DJIA 2ZX9A 3BAJA 3O3AA 2UX6A 5IMLB 4LKXB 2I25N 3BCFA 3CNKA 4UDTB 5D5MF 1QUPA 5FIEA 1OPOA 3B7SA 4ISVA 4RCAA 2MTAA 4OFYA 2Q6WA 43C9A 4LLWA 3T0EC 1PCXA 3GMRA 4LB8A 5E99L 5BQ7B 4U05A 3A67L 2AXWA 3K72A 4HC1A 4NKOA 4WI4A 3REVB 1WBYB 3BUTA 4NQCB 3JYBA 2E27H 1SMAA 5AD0A 2NOYA 3H42L 4IKKA 1HIML 3KPPB 1SBSH 3ARBC 2APVA 4XVUD 3UXFA 1RZJC 8PAZA 2VM9A 4M1CD 3RTQC 5DU7A 3MUHL 4TNFA 1MWAB 3RJOA 4K7PL 4O02B 5FKPB 4UTAA 4XCYB 3B5HA 4Y2NA 2DBLH 5E2WH 1WAEA 3V0VA 4UUJB 1CUOA 1NGXA 4HETA 2VZ1A 1GGUA 2YGNA 3N40F 5KBMA 3FF8A 5DHEA 5TF1H 2GB2A 1I1YB 4I2XB 5ENWB 1CFVH 3ZTEA 3Q9QA 3O0RL 4GAJH 4HS3B 4R7LA 1PLCA 2QTEA 4EDXB 1KGCD 2AF2A 5D6CA 1MCPL 4MYPA 4NQXB 1KNOA 4U3SA 4NX0A 3EFDL 3Q06A 1CVSC 1HSBB 2IAAC 2X12A 3MJ8A 1G9NL 1QSFB 1SOXA 3A4DA 4K3JH 2Y5TB 4L8BB 4A2FA 4APXB 1A9EB 1BJ8A 1T3FA 4JQVC 2FATH 3WDHA 5DEGA 5D1XC 3B4NA 5T5FL 4NAQA 4WFFD 1GKEA 3ARZA 1N6UA 5TF0A 2QKIA 3NACL 1F6AB 2GJRA 2XTJE 3ZTCC 1HFUA 4KTDL 1UD2A 3BXNB 5IQMA 1H6FA 1ADQH 4NS0A 5TPWL 3U2SB 1IC4L 1MW2A 2CSPA 2E8YA 3OHXC 4RA0C 3ZX1A 3ZT7A 1I7RA 5IR1A 2BP0A 2PYFA 1I7ZB 4M8QB 1XL6A 1AYOA 4HLJA 4NC0B 2D9CA 1A0QH 2IF7A 3ZZQA 2HX8A 1NLDL 1I7UA 2LTQC 4F27A 3BKJL 2JB6B 4ZPVA 4CU7A 2QEJA 4PGDB 3VVVA 3MYZA 3POCA 5HDLA 4TPRL 1Z5LA 3DVIA 5LXGH 5HHOA 1L7TH 4AC2A 1FIGH 5E9DE 5J1SC 5I1GH 3L08A 3SOTA 3T0ED 4UYQA 3AAZA 4NXSA 3RGVB 5EOCL 2KYIA 5HSFA 1S2EA 5GS0L 1MCRA 2CJ3A 4FQCH 3V52L 3VI3A 5HHPB 4BFIB 1ZSHA 1F2XK 3KLHC 5IB5B 3RBGA 1ILUA 1WHOA 2DQFB 1ZLVH 2R1YB 1IC1A 1PD6A 1CGXA 1J5CA 1XH2A 4JQXA 5D71H 5K39A 3RE0A 3PQYD 3ISRA 1SY6H 4Z8FL 3ARBD 3TZVB 3H55A 2Q76A 3Q01A 4G9DA 1KCVL 3MLSH 2GSIA 3RTQD 5BCAA 2P43B 2H2PC 1AE6L 4R8WL 4XR8C 1LO5A 1TDQA 2Y3NA 3G6DL 4PR5A 1TEYA 1C5BH 1HILA 3FKUS 2IWKA 2YSSB 2ZP8A 5A2JH 4RRPG 3X1FA 1R0AL 5I17B 2DQIL 3EDEA 5HP5A 3F6IA 3NH7H 2PCXA 1R3KA 2Q7YB 1MRFL 4V1DB 3WTWA 3IU3B 3TPUA 3KPLA 1N12A 35C8L 1QVOA 1QPXA 2R4SL 4G9FE 4GMSH 4L1BA 1I8IB 1FZMA 2OMZA 3AUVA 3MRLA 1G7QB 2ZOWA 4M7LH 1CB4A 1AYRA 4ODSH 3D34A 1QA9A 2EC9T 3GKWH 1ADQA 1W0WA 3RI5F 4XXWA 2CA3A 4BK4A 1R4XA 3B8YA 4PJGA 1YNTB 1D7BA 2NY5L 3WNKA 1AZVA 4RQQB 2NTSP 5T3ZH 3OKOA 2W9EH 3MNDA 1WGOA 1JNJA 2IH3B 5D1XD 1N59B 4N6QA 3L2MA 4MKMA 3TYGH 1EZLA 1YNTF 4H13C 4NN6B 1CXLA 3NABL 4N9OB 4MAUH 5GGSY 3BPLB 3C87A 4K23H 3JUZA 3HCVB 3KD4A 3MX0B 4HJJH 4Y4HC 4X83A 1GC1C 2H2SC 3DX6A 1GZQB 4JPIB 5E0QA 2BH0A 2X3BA 5GJTH 4DPAX 2K6YA 4W9FC 1QSEB 4G8EA 1JWMA 1VIWA 4POYA 5CCJA 4OUOA 3QEQE 2VERN 4HGWB 4UOZA 3FCSA 2C3VA 1NQBA 4PP2A 4XN5A 4LASH 2DWXA 2KZWA 2XN9E 5KVDL 2Y7LA 2X0UA 5A3IC 5T1LD 3FO0H 3MOBH 1SY6A 3A4AA 1I8LA 2VRQA 3IAPA 3FQTB 4HW6A 5DA0B 4CILA 2OQJB 4EXKA 2P44B 1LHZA 4X6CA 2OMVA 4FQIL 5DMYA 1DEEB 1WS8A 5D2LE 3WIFA 1IEHA 3HMWL 4MXVF 5JO5B 5DC2A 3QPKA 4ZFQA 4PGBA 1BZ8A 3GLAA 1EXUA 4OGYL 3L95B 5F3HB 4L4TB 3KLHD 3N9GL 4FFWC 3CVDA 2WNWA 4Q6IA 1TEFA 1H8OA 2R9HC 3JV6B 4X9BA 4I18A 4AM0A 2VIRB 2WCPA 3AGVA 1DSWA 4H0HB 1OAUL 4AGNA 2D7TH 3W81A 2GCYA 5LLIC 3D09A 1ASPA 2WVUA 4NO0D 2H2PD 2DYPD 5I9QB 2GW5A 5DFWH 2WWNA 3FN0L 1R5VA 3T4AB 1AQMA 4Q4IA 4WHCA 3UTSA 4LARH 1CLYL 4P9HL 2XFXB 4ZSOA 3RL1A 3OTTA 1CGSL 3D7PA 2NQCA 3QFDA 1NMBH 1SJXA 3OG4B 1AI1H 4XBMA 5I1DA 3VH8B 4Z77B 2FH8A 4TULH 1KYFA 3D25A 3EO9H 1AANA 5F1NA 4FJ6A 3EH4B 4YHIA 2AI0H 2PWHA 2FUTA 1UOKA 5DS1A 2KQNA 5L4IA 3HR6A 3NSJA 4XPFH 1QW8A 3G5YB 1QQDA 2HLFC 3ULUH 2YKLL 2EUWA 5CGBA 4XPBH 1U8JA 2EDKA 3HZMA 1SUHA 4Y0GA 2DTSA 2P5PA 2HFEA 3EDJA 3RWEA 2FWLB 3FQUB 5DWUL 1XH1A 5IVZA 5B39G 1WT5A 1ZSDA 2VDMH 2LGNA 2ORBH 3IJYB 3RPIB 1CTNA 4Y4HD 4UV4H 5LG6A 2H2SD 1L9NA 5ANMA 1F3JA 4M7ZB 5A2FA 5IIEA 1OL0A 2BFVH 1ZGLA 1JWUA 2Z91B 1HE7A 2JCCB 3SDAA 4JFZL 4JS7A 3KYNB 2PPEA 1UZ8A 4P2RD 4OJYA 1NGQL 4QYOA 1RJYA 4I9WD 4FNLH 2ZXWB 3ARPA 3HBQA 4PIBA 4MA8L 1XF5A 2KLSA 3W2DH 4AH2A 4NZUH 2BOCA 4H8VA 1BEYL 1KCKA 1XMEB 1YEEL 2JCCF 4LGPB 4UNTA 1MXDA 4A67A 1KEML 2IFFH 3NSXA 2I07A 5A3ID 2QQNH 2HKFL 4TVUA 5IROA 5F1IA 1DCLA 5DUBA 3IGLA 4LHJB 1L3NA 5ERWA 32C2A 5IQ7H 3E2HC 4JO3L 4EPSA 3D52A 3FQNB 4JB9H 4D8PA 4QHKI 4PY7B 4XHQA 4QHPA 1VF5C 4PJ5E 2EKSB 2YN3A 4XVJH 5B3JF 4FFWD 3DX9B 4ZMOA 3GS0A 4PBXA 3MJ6A 2R9HD 3VXMD 4BSWA 4HKBA 4QY8B 3FT4B 5BW7C 3U0PA 2IV8A 4NNPH 1C7SA 4QHUB 1TKWB 3DGDA 4GP5B 3BD5A 3FCUB 4JKPL 5J0BA 2MWCA 2OZNA 4W68A 1H8SA 4JK0D 3MGOA 2CRYA 1BFVL 4NQSB 2K4AA 3JWNE 4MTMA 2AMUA 4J1UB 2Y25A 3DROB 4FYSA 3H2PA 1G7MB 3SQOH 4U1KA 1YY9C 2OSLA 1CDUA 1PSKL 4QNPE 1E30A 1AGCA 4MD5B 4MRBA 5DK0A 1IILE 5CJBA 4XWGL 4Z3HA 3EKCA 4FZEL 3VFTA 2CKBL 4W9JC 5CS7A 2J5LB 3HA0A 4OZ4A 2G4GA 3DRTB 2WC7A 4PB0H 4Y9GA 4KJPC 1RURL 3V6OC 1GRWA 2D0FA 5C0DA 3RHWK 2BIPA 4PRHB 1MI5B 4HIIA 3RWFA 4MKTA 2VR3A 5LBSH 5TH2B 2KUTA 5I28A 1E3XA 1T6VN 1R5IB 4NB7A 3DYOA 3WE6A 4IOFC 1BVLB 2CMRH 5IBUB 3N55A 4L4VE 2ZKXA 4W9CC 3EH1A 3QIWB 2R0LL 4J28A 4ZYKB 5KSBE 2HLFD 3AU0A 4TLTA 4LSUH 3CXFA 2APWA 2GFBA 3UP6A 4DCQA 2R0WL 1ETZB 2EE2A 2ARJA 2CALA 3FS9A 3I6KB 2B5IB 1S46A 4X8JA 3O3AB 1A1OB 2Y72A 1GKOA 4UQ2A 43C9B 1WE5A 2G5UA 4ISVB 2Q6WB 3RVTC 4PJ6A 1Q72H 4IIZA 4IYKA 4LLWB 2FX8H 2V6HA 1GIGH 3GMRB 5GPRA 4F7MB 2MNWA 3LPGA 3K72B 4YXHL 3TV8A 4NKOB 5BOJA 4MWFA 5L9DH 1GMIA 1KCBA 2NY2B 4LAQL 5E9DA 4Z7NE 5A2CA 4Z7OE 1SZNA 4NPKA 2DQMA 4ILDA 5AD0B 2H5UA 2FHCA 1F41A 3O2WH 5J12C 1QNIA 3WMQA 3S8FB 2CPUA 2X2JA 1NAML 5L7XL 1CXIA 2QQKH 2DAVA 1PYWA 2R0KL 3F7PC 2YWZA 5JR1H 4QAMB 3C9NA 3I2CL 1PZ3A 3D3VB 3QZNA 3EYSL 1M7IB 1NGXB 4DPCX 4KO7A 5ADPH 2BX5A 4J8RB 4XO9A 5HHXH 3PFUA 1MQKL 1M2VB 4H0GA 2I5YL 4NHCL 3JWDH 4TNVK 1IBGL 1TETL 5KVEH 2JWYA 3A47A 4MNQA 5IMMB 4KX8A 4Q97A 3QORC 3W0WD 1TITA 4EDWH 5AW6B 4UILH 4FULA 4BYHA 3WY1A 2D7MA 3BZFA 4U3SB 2NZIA 5LBSA 2F15A 1YY9D 1ZIBA 1WIOA 2EACA 2FT8A 3MJ8B 4JM2C 1BF8A 1W72L 1IGIH 3VFPB 3LV3A 2NY3C 3HE6A 3H6JA 1F45A 4PUBL 4WUKL 1NAKH 4YXKH 4YSRA 1T3FB 4NSKA 4YO0A 5C0EA 4LU5L 3LOWA 2IFGA 2W65B 4XAWH 2JKSA 1OK8A 4KJPD 4KMTL 3B6SA 1VRSA 4XX1E 4APQC 2QKIB 4M5SA 4UT9H 2WLMA 4G8FA 3C5ZC 3ET9F 1ICTA 4LCWA 2MCAA 3ZTNL 3B5TA 4P5TA 5DGRA 3SYAA 4OF6A 2PXYC 1EVTC 1UA3A 1I7RB 4IOFD 1A7BA 2BP0B 2B1AL 3M86A 1RIVL 5EWIL 2O4EA 1GJIA 2P24A 5DJAA 3VRLE 1MRDH 2FE0A 4MB3A 4Y19A 5D1QA 4F7TA 5BV7H 2UXTA 4JO1L 5LWYH 3AG3B 1RUKL 4ZPVB 2OYKA 1YRKA 2PCFA 4Y2DA 1N5YH 3OMZA 3NSDA 2OJZH 2EDWA 1VGEL 1ASQA 1JI2A 1KPUA 1Z5LB 3FQ1A 2NY5C 2EYRA 3QEQA 1ZANH 3AQDA 4UMSA 3VD2A 1MHEB 5HHOB 3RVTD 5F96H 5I1JL 1EHLL 1YEWA 4G3YH 4EF3A 4XBEL 1A64A 2HT2C 2XN9A 1TQCC 3AAZB 2YRPA 1YO4A 3CSPA 4HUKB 2H6PA 3ELAT 3VI3B 4P99A 2D3VA 2NYYC 3U36A 1AKPA 1JVLA 5FYJD 2NZ1A 4B3EA 2FCBA 1EZUA 2GJ6D 3IJ9A 1L3WA 1S7UA 2GKIA 2J4WL 5E03A 3T09A 1L6PA 4YEEA 3VI3F 5F9OH 4M4PA 4H5SA 2FSDA 4FC3E 2PR4H 4B7IA 3GNML 4G9DB 5SWZB 2GSIB 3ZDXB 2XQBH 4Y4KA 4LIQL 4Y89A 3R0NA 3ULSA 1LO5B 2BHUA 3CVHL 4Y7MA 2IANE 1QR4A 4LPYA 4P23A 2XTLA 4JJ5B 4PR5B 1SOQA 2X3AA 4XXCC 4B9FA 3MLUL 3ZDXF 1OAQH 4N8UA 3BAEH 1IIKA 1UM4H 1B6DA 4OF0A 2ATAA 1R3KB 4TUJA 1NCCL 5BUGA 3VD4A 2A7BA 3TPUB 2CKNA 3KPSE 3GMPA 3SCMC 3SKJH 1OARH 1LLAA 3QORD 2OMZB 3MRLB 4UT9A 3ZHFA 1MFBH 3X14B 1P1VA 5GRWA 4OBSA 4M6AA 1L0PA 1QA9B 3QUGA 5F1KC 3BUBA 4X4KA 3UCRA 1KF9B 3OPUA 4AIZA 3OSVA 4JM2D 4PJGB 2NY3D 1WO2A 5DC4B 1IBYA 1SGKA 5E1IA 3V0DA 1E4XL 2V3DA 1LO2L 3P02A 4APQD 5I0ZA 5I76A 2O6DA 4LLYA 4PJGF 3S37L 1L7IH 3ZHNA 1OGAD 3C5ZD 4BWUA 4P9HC