4ZMPA

Crystal structure of human p-cadherin (ss-dimer q101l)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDLNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmpA01
2QVFB 2OMUB 4OY9A 1FF5A 3UBFA 4NUPA 4ZMPA 4ZMYA 4ZMVA 1ZVNA 4AQ8C 1WYJA 2O72A 4ZTEA 3MVSA 4APXA 1WUZA 5JYMA 4APXB 3Q2WA 2OMWB 3UBHA 2A4EA 4ZMZA 4ZMOA 4AQ8A 5DZVA 3Q2LA 2WD0A 1L3WA 1NCJA 1ZXKA 4AK1A 4ZMNA 4NUMA 1Q1PA 2OMTB 3K6DA 4QD2E 4XXWC 4ZMXA 4AXWB 3Q2VA 3PPEA 4ZMTA 4ZMQA 2A4CA 4ZI8A 2V37A 5JYLA 3Q2NA 3LNHA 4NQQA 1O6SB 4ZMLA 2OMVB 3QRBA 3K6IA 5KJ4A 3UBGA 4AQEB 1NCIA 1EDHA 3FF8A 2WBXA 1OP4A 4AXWA 1SUHA 3LNIA 4ZMWA 2QVIA 2WCPA 3LNGA 3K6FA 2OMXB 3LNDA 3K5SA 3LNEA 2X2UA 4XXWA 3K5RA 3FF7A 4AQEA 2EE0A 4NUQA 5CZRA 4ZT1A 2OMZB 4AQAA 2YSTA 2YQGA 2WHVA 4AQAB 2OMYB 5CO1A 3LNFA 1NCGA 1NCHA
chains in the Genus database with same CATH superfamily
5JPMB 2P9RA 4Z9KB 2VO8A 5DRZA 1OAYL 3T8MA 2YGOA 3H4FA 3NCWA 1NGWA 4ZFGL 2AGJH 5CP3A 4FNPA 4OFQA 4NKQB 1F11A 2AXFB 2NX5E 1T1YA 3FQXB 3MRDA 3J8F7 3H6AA 5MI0B 1JF1A 3BDBA 5KANG 4PVMA 3UTTA 4LQFH 1A7NL 3ZKXB 3ZMEA 4L9LB 5AYUH 4PWHA 1A8ZA 1KYOJ 1CDYA 4J4PA 3LZPA 4YHOH 2X2YA 2PCXA 1G9NH 3ALWA 1S5IL 4PS8A 5IQMA 3LZFH 5MEOA 1A7OH 5I66A 1XSKA 1YJDH 4WWPA 1MCCA 2Z93B 2FWOB 2G3XA 4PM1A 5DMKB 1KTBA 2B59A 3RB7A 3KW8A 5KVEH 3ILEA 1ZT7B 5I1HH 1CN4A 4X6FA 3VD2A 1RUAL 3QQ4A 4XMPL 3IDNA 5EBLA 1PG7W 2BX5A 2ED8A 5D1QB 1A6TB 3ZDYE 1NCWL 2X5PA 4GAGL 2Q76A 4OT1H 3VACA 2MPVA 4A38A 4C56D 4JS7A 1X7QB 2YPVH 3VFMA 1O9WA 2XWBA 4PJFF 3TIDB 3KYMB 2VSCA 1A6VH 4M3JA 4Y4HA 3WY2A 2HN7A 2IAMA 3QNZA 1JPSL 2FH8A 1PIFA 3VI3A 5DJZA 1AZNA 1J18A 2CJ3A 1PMYA 4HFUL 5TQ2H 4PB9L 5J89A 2ICEC 4BKLA 3BUDA 4XPAH 2Y1VA 5GGSB 3NH7H 3MGTB 1TCMA 4QOKE 4OD1L 4UTCA 3FU5A 4C58B 1INDH 1G0XA 3MRKA 4GW4B 4ZD3L 2NW3B 3HVNA 3BP6B 4FULA 2VDRL 2YSSA 4YUEH 2AV1B 3QUYD 2CJUH 2PP8A 1OAKH 4Z7AA 3RVXC 5T1KB 4LEOA 5BS0E 2GSGA 3BZEA 5LXGH 3TNMB 3FQYA 4FS0A 2I5YH 4UM9D 4XO3A 1J0JA 3II2A 2VXSH 5C70A 3B4NA 5C07B 1B4TA 4B5EA 3PWPE 3PP4H 3QUML 2XN1A 3STZA 1UXMA 1RAMA 2OTUB 4XN7A 3GSUA 5G4OA 1FNEA 5CEZD 3QJOA 2WVTA 1LE9B 5C0JA 4WV1A 2JJUA 3CDZB 1W6LA 2LTQB 4P57B 32C2A 3A4EA 5CJOH 4XPHL 3RGVD 3O0RL 3U9PL 4XB8A 3BWAA 2YPVA 4BK8A 1HYRC 2L4OA 4HH9A 1R17A 2XZAH 3CU7A 1JHKH 3QDHA 4LFHD 2GJPA 4FFZA 2VERN 3NAAH 3HTLX 3SDCC 5AB0A 1KF9B 4EIGB 3WUWB 2DBLL 4MQTB 3GHPA 2HWZH 1D5BA 1MOEA 1Q94A 1GJWA 4C4UA 4G9DB 4WTZA 2PW2B 2PR9A 1I1YA 4X6CA 3ZTDC 2IBZX 5KSBB 1U93A 3GMPB 1FIGL 5FYKD 2A2QT 3N1MC 3AITA 1T2QL 4K3JL 3JT0A 5E5MA 5IHWA 5IMOB 5DR5H 4M7ZB 2CHNA 3QQDB 1EAPB 5TE4H 5SX4I 2A9ML 1BXVA 4CBPA 1GIGL 3VSTA 4Y9GA 2BK8A 4FXGA 4Y5VC 4YSRA 4LLQA 4WAFA 2LOEA 1XCWA 3ARBC 3IDYB 5FUOH 4PJIE 1IGYB 2W0PA 2Y23A 1OARL 2BJMH 3DSNB 5AVVB 1UQSB 4YEFA 3S5LG 5F8QC 2BVQA 1OTTC 2HLAB 5KVGL 2Y36H 1OGAB 5CSGA 2VDOB 1A1OA 2P5WB 2V9QA 1K3ZA 2WQSA 3HMXL 4KKNA 2QSTA 4N9GB 4B9FA 1X9UA 5IM7A 1TF4A 2ZCKH 3WSQH 4NZUL 2L0DA 1XIWC 4CADA 4FYRA 5ENWA 4NN7B 2V4LA 3MRIB 4G42B 5DUBA 1I8AA 3QDMD 1BPLB 1U41A 4HSQA 4ZFFA 1BBDH 3JWOC 5JW3L 2ATPB 1G7HB 3ZRCC 2VRQA 1I3RB 4PJ7F 4U6VL 1A8JH 1C16B 4X7FC 3QXAB 4F7PA 3MRMB 1A9VA 1XEUA 3N55A 4F3FA 3QZLA 3DHJA 4NO0B 2RD0A 3F62A 4AC2A 4U1MA 4PY8J 4Z7VF 2ZUQB 3G6JB 3SE4A 3OPZH 2F5BH 4F8TA 3GJFH 3SKOA 4JPIB 1T6VN 5HDBB 5GISL 5T5NG 4G8IB 3REVB 1WGVA 1IT9L 4KFZC 4LL1A 1KXVC 2VQ1B 2A9BA 4H2AA 3DA0A 2X53A 4FZ8L 1CLOH 3ATEA 15C8L 3CDGB 4OFYA 1DSFL 2JCCF 1B4LA 1I53A 1H5BC 3IM1A 4MAUH 4X5WA 5GXBB 2ZWLT 7FABL 4A39A 4J3SA 2VM9A 1XAUA 3OKMB 4RFEA 1A6ZB 4PRHE 1CE6B 4GKZB 1JVOA 2Z31A 1ZAGA 4L8SC 1SJMA 4L3FA 4HJ0C 2BNQE 2WSPA 4LPCA 4P05A 3QORC 1GY2A 3TWYA 4OIIL 3T0DA 1M2VA 1X5LA 4KXAA 5EPMB 3X17A 4FQXB 4OCWL 4JDVB 4FXTA 1NANI 5EZIL 4I3GA 1EFXA 4QXTB 4WSKA 1PZ5A 5GRUH 2WV3A 3GRWH 2YZ8A 1JXDA 3ARWA 2CLRA 5LN8A 2O72A 3RTQA 2F08A 4G6JL 2FIRT 3QUZB 1INQB 3O3AB 3WV0A 4XMZA 1FPTL 4OUUB 4WI4A 3LKQB 3LQMA 3VFOA 4PRPA 4NZ8A 1FDLH 3KLAA 2YQ2A 2EC9U 4XMUA 5F71A 3TT3H 4OFDA 3JSSA 5F1NA 3B9DA 5LNGA 2VLJD 3GJFA 2FSEA 4MMZA 3V9EA 4AGMA 3T2NL 5DURD 4L2YA 5IW6B 1WWBX 4WW2F 3BWSA 4WFGD 4B7IA 1T03H 3IWVA 5FW7A 1HKLL 3M45A 4EN2A 5HSFA 1FFOB 2WSKA 2CLZA 2F74B 3BYTA 3QUGA 2VABB 4DAGH 3NJNA 2IH9A 3VWKD 1A0QH 5IW1B 3AUVA 4NHUB 4G8EA 4BK5A 2WY3B 3R18A 3T3PE 1J87A 5IF0B 1SN2A 3BWZA 5DJCB 2Q20A 4RZCB 3E2HB 4FRWA 4HXAL 5ECJE 3CVHH 5ILTL 3UBGA 3T08A 2R1XA 3KH3A 1EHAA 5IFAL 3TBWB 4QY8B 1DBML 3GRWA 4MBRA 1BQ5A 4LKCA 4R5TA 4YK4C 4GP8B 4P3DA 3MYZA 3QZPA 2IDSA 4I88A 4IIQA 4OGYH 4R4BB 3DVNB 4GAAA 3QEHA 4BH8B 1UWXH 1YG9A 1E3XA 1OT2A 3B9AA 3EJZD 3OAUL 4OJYA 3NZ8B 4WVRA 4BQ9A 1HYSD 1N6QL 3NFSH 5IBUG 1JDDA 4LCIL 3Q48A 5J3HD 1A4JA 1JXJA 2IH1A 2IMNA 5I6XB 1Z3RA 1R5IB 3GLDA 1SLVA 3OJ2C 4FQCL 3UAJC 5GGUA 2AQ2A 3O3BA 2J73A 2PO6D 2V2TB 1FO0H 1ZSDB 5EU7E 1N9PA 4JHBA 1X5YA 5ELIA 4DKEL 4Z3GA 2P26A 1FFTB 3PXHA 5JR1H 3EO1B 4TS6A 3QQNA 3ALPA 3HJ0A 5KVFE 3IKKA 4LCCB 3GI9H 4HK0A 5E8NB 4LP5A 4X4XB 4X0KB 5DSCB 5C0FA 1CU4H 3VYNA 4BSWB 3TPUA 2ZOUA 1JK8B 1TJIL 1T0MB 1YEIH 3UX9B 4GP4B 1NBZB 3P9MB 4ZW8A 2KH2B 5AVTB 3FHQA 5FO7B 2WTPA 2H1PL 2ZOLA 4HX1B 4QHNA 3ZGIA 3SPIA 3U4BL 2E6PA 4P5KA 2CH8A 3BAIA 3I3BA 1HQRB 3DOHA 1LWRA 1F41A 3L3IA 3S5ZA 1WUNT 5L2KB 3GBNH 4JO1H 1E9OA 3O9WC 5E00A 2YMXH 3K91A 2HH0L 4Z0BH 5I0XA 2NR6C 4ZMZA 2D2CC 2QHLA 4JPQA 3LZQA 4U6TA 2NY2D 5FDWA 4KX9A 1C5BH 3HZYA 2WNWA 2EICA 4GAYA 2YEVB 5MP6H 3WAJA 3D85A 2F7PA 3F2LA 1IL1B 3S3DB 4MXQC 1VGEH 1I7RB 4YDVB 3GJFK 2BSSB 5HHNA 3NIGF 1GYCA 3ZTNL 3AVEA 4PV1C 5D2NB 1ZA6A 5EU6E 3ZKNC 4FDWA 2X1OA 4NJ9H 3GM8A 3TVMD 4FFYA 5CXPA 1FFPA 4B95C 3ZT7A 4RVBA 4XP6H 5DYFA 4DT2A 2OW7A 2FX9L 1JD9A 4W68A 3SIKA 4G8GB 5FKPA 2HUHA 2A6JA 1O7SA 3U46B 3DROA 3V0JA 1AZBA 5FF6B 2P5PA 2EUVA 4GFTB 3ZZQA 3BQUB 3BKCL 2PETA 1KJ3H 4LAQH 3ZDWA 3VFPA 3ROOA 3TCLA 4OZHE 3KPLB 4D0BA 1UWGH 3MRHB 2BO0A 1OEZW 4AIEA 2ED9A 3GSWA 1B0RB 3U2SB 1HOCB 4M3KB 4RBPH 4R7VA 2P5EE 4AVHA 3WCYA 3BAKA 3PXLA 4LSDA 4MZ2A 1DQML 2IQ9L 4TVPE 3RNQA 1UXWB 3MCG1 3B7UX 1B4JH 3HPLB 4ZUVA 2JKIS 4POYA 4Y7MA 3BD3A 4UINL 3C60B 3SO3B 2VDNH 4JY6A 4C55A 4J7RA 1AO7B 1OCWH 1JXGA 4J1UA 7PCYA 2FE0A 4XX1E 4UQ3A 1BZEA 4C8XA 1ZD6A 2JIXD 2YGPA 4Y2DB 5IREA 3T09A 4S1QL 4JK0D 1ZGLB 1CDBA 3IJYB 4HOWA 4KBPA 2B77A 2XQBL 5KEZA 3FFDB 3T0WA 5MI0C 4TNEA 5GZNA 4DEPB 3NJKA 3ZKXC 2YPKB 4L9LC 4QRRE 5HYFA 3DUSB 1XGUA 3FFCE 4ZFQA 1Z5YD 2Y7NA 2CG9X 5E2TH 2PXYD 2Z4TA 4JN2B 4G11A 4ZOEA 4OZGF 3PUUA 2X89A 3L17A 3QISA 3M7FB 3WFHB 2BZDA 4L18A 5DU7A 4HS8H 2FJGB 5GGVH 4HUMB 1CDUA 4JBSA 3DI2B 2UY6B 3C9NB 3KLHC 1IBGL 4QXGL 5AYTA 1ZA3B 4JCWA 3CFEB 4Q2ZA 4V1DA 5F7BA 4WI5A 1QFPA 1I9EA 3BSZL 4YFDB 2WYZA 4HUVB 4PGCA 1OAZL 3H85A 3HMWH 3S98A 2N59A 5JQHC 1BFOA 4NO2B 4KJWC 2CRIA 3CZFA 1B3IA 3HEIB 5D1QC 5C6PB 1U2YA 1L6ZA 1LGVA 1ZEAH 4FQJH 4LKXA 5DZVA 4BRVA 4RDQG 1KIPB 1KGCD 3B8SA 1L7TH 4FCHA 1UWXK 1KCBA 4WF7A 3HNVL 3BH4A 4X8XA 5I24A 5TH2B 4PTTB 3VG9B 3FCGA 4O51A 3FT9A 3QFGA 1H3VA 4ABWA 5B38A 2GBTA 2NYYD 4NKOA 2EVIA 2WP3T 4P4KC 1J8SA 3HI6L 1P4BH 2R4SL 4LK4A 4LHQB 2J8OA 4IKNA 3BZFB 1RPKA 4YWGL 1V54B 1LE5A 3GBEA 2ZKYA 1IKNA 4ZMTA 1ZSHA 3FT2B 4LLMB 4BJLA 5DWUH 4UBDC 4FI8A 1INEH 4ZW5A 5KBNC 4JM2A 5BZXA 4WHYG 2KT6A 4G82A 2WJ5A 4PJXA 4CILA 4O02B 3ZE2E 3WIHA 1GC1H 1B0GB 3CVDA 3L48A 4BXSV 5GZOA 3WTUA 2R8SL 1SEQH 4KZDH 5C0BD 5SWSD 4DK5A 1MJJB 4XT1C 1UT2A 1VADA 4JZNA 3VXSB 3CX5K 2J56A 3GGWA 2HT4D 1HI6B 2AK4E 3PWPA 4XNUH 2WLKA 5C0AB 4NEHB 3BMWA 3H2PA 3CFDA 1IKOP 1RZFL 3LSOB 4LPTA 3VFGL 1CFNB 2LLNA 3SQRA 2R15A 3CFIC 4ZMWA 4JR9L 3SJVE 3VXQB 5IB2B 2WGNB 5HYJB 4KJPD 1RI8A 3PU7A 5I30H 3UTOA 1JP5A 3GUFA 3ARXA 3HAEG 1OPOA 2AV7B 4B6ZA 3T3MB 1A9BA 4FZEL 3D69A 5C0DB 4OZIF 3FO0L 4AQEA 4OUOA 4LSSL 2WNKA 1AXIB 5MERA 1DLFL 4P5MB 4J6RH 2CBQA 2B0SH 3KWXA 5HHXL 5ALCH 4A04A 3T4YA 4KUCF 1KB5H 4R4FL 4Q89A 4HWUA 1I85A 1OB1A 3NZSA 4LMQE 5GS3A 3UBXG 1TZIB 1YA5A 2JFCA 3HE6D 1KCSL 3TT1H 1X5IA 2FATL 2DRUA 4LO9A 4HPOL 4Y4FA 4XXDA 5I76A 3APNA 3I6KA 2HFFB 2BS8A 4M43H 1FF5A 4TRPL 1UB6A 2QDWA 3DC0A 3N41B 1S9WA 4M7ZC 4RMRA 4XN1A 1TJGL 4YR6A 4NBZB 5I5IA 2FR4A 1UGNA 1HIML 1F6AA 1IFRA 1YEEL 1ROCA 1SBSH 3CH1B 5J12B 4PJIA 1MVYA 1JI1A 2BRQA 1NCUA 2B5IB 1U8IA 2E9IA 2EP6A 5I1KH 5ESQB 5C09B 3RBGA 3IDYC 4N5ED 3IDMA 5DD5L 1CBJA 3NDZE 2Y1ZA 2YWYA 3PG2A 4PJDF 1JNNL 4QRPD 4AMXA 2DQHH 1WS7A 3NCJH 3LD8B 4P59L 5CILH 4XNMA 1MCQA 1NUGA 4JY4B 4CC4C 2QADB 5IOKA 3ZDZF 1JNJA 4Z6AT 3QXVA 4RBPK 1G6RB 4LCYA 3FO9B 2VDQH 2MOGA 2R9HD 3H3PH 3RAJH 3SBWA 5ID0A 3GZQA 1I8IA 4ODSL 2J57A 1E4JA 1TJHH 5HHOA 4PB0L 4U1KA 4JFYB 4NN7C 4ENEC 3UO1H 4WTQA 4KUZH 5A2LH 3I50H 4UTBA 3S3SA 2QKSA 1KB5A 3QW9A 1FH2A 4ZI8A 1WBXB 3FCUB 2IMMA 3FCTB 5EHFA 3S7GA 1NCBH 1DANU 1F3RB 3KBHE 3SY6A 2VXQA 4OIFA 1O6SB 1DDTA 3JV5A 5BZWB 4XVOA 3VX1A 2X4OB 4P23C 1BM3H 1W0VB 4FA7B 2ZUQC 5DHEA 4UI2A 3UJIL 1MDTA 1OXYA 4DUWA 4AQ1A 3N40P 4HLJA 5JXEA 3S36L 5FKAB 1WAPA 2I07B 4U6HB 2WZ0A 3ZT6A 4B5ZA 4FNSA 3T0EE 1R19A 3EOTH 4P46D 3BIKA 1RQ5A 5J57B 1IGMH 4J3OG 2RALA 3KJ6H 4PRHA 5CHNB 5KSAB 3HUJA 3D25A 1R3KB 4HMDA 3SYPA 5LXVA 2BNQA 2A38A 2IOMA 4H44C 4PN6A 1CFSB 4GW5A 5F1KC 1E27B 2Q0ZX 4IU3A 4HWEL 2NT0A 2UYLA 3PAYA 3WGVB 1NGXA 1A7RL 4Z7WE 1VLXA 3SDXB 4C4BA 1RK0A 1NGQL 3ASWA 3CSGA 4XB3A 2AJVL 3L1GA 3RWHA 3VXNA 5K9JL 3DJTA 3IMBA 1E4XH 4ORZC 1W8OA 4KNUA 3ZTEA 1RFDH 1WIUA 2A6IB 5FR3A 2XG5A 4PGBB 3GDCA 3QUZC 5IQ9B 3BPLB 1TTCA 4KKAD 3I9AA 4RAVB 1IZKA 3FFOA 1R3LB 4Y5XB 1KNOB 3B5TA 3A6CH 3O6LH 5JHLA 2OM5A 4BSJA 2H47C 2W95A 3DX6A 2GC7C 1NGPL 4MB5A 4N2DA 3QAQA 1T89C 1YY8B 4G1MB 3SQOH 3AGVA 4HOMA 1SM3H 2OX5A 2A74A 3S0PA 1S9VA 4AG4H 4MHHG 1NGYB 1FWXA 4U1SA 5C7XH 2BHZA 2OMYA 1UVQA 2J7LA 3IGUA 4FFWC 4YSPA 5KVFH 2FEDC 1M6OA 3LRHA 4MMYB 3FH7A 4TSBL 4HCRH 2KKQA 1NDMB 4G7YL 4NOBA 1E4KC 2Q9OA 5CGYD 1YHPA 2IC2A 2E75C 4H88L 5AAMA 5CLWA 2DI8A 1NBYA 2BP3A 1KY6A 4PCKA 5KBDA 5JHDB 1NLBH 5M7QA 3MRCB 4QAWA 1YUKB 4PGZA 1ZHLB 3ES6B 2YR3A 4XNYL 4HWBH 4C54A 1A22B 1KEMH 4U49A 1S78D 2VQTA 3FQ4A 3D34A 1OVZA 4X5XA 3WNKA 3WTYA 1H3GA 1Q38A 2NNAB 1QFOA 3AG4B 4Q0XL 3ZSSA 2BMKB 4JB9H 4M48H 2R2BA 3E2HC 1RXLA 5DO2D 4A2EA 1BEYH 2P24B 2DMCA 1F42A 3MC0A 4X7DC 1C08A 1FSKB 2W9DL 2G5RA 5I1JH 1YPZE 1CFTA 4HBCL 4Q56A 3LN5B 4DFIA 3GNMH 1ZE3H 4E0RB 5E70A 4QLWA 4LOUD 5KOVC 4X50A 4A6YH 4PVLA 1T5WA 4G43B 4IOFC 2AP2A 4PG2C 4MD5B 5KVGE 4RESB 2X4UA 1KIRA 2IDCA 2W07A 4MAYA 4HUWB 3MUGA 2XA8L 4OLEA 1CGVA 2NZ1A 5I6XC 1JZFA 4YGVA 1E9QB 3GBMH 3KH4A 4LHUB 2FAUA 4YJZL 1HXMA 2WQWA 4UB0L 2O5YH 5EA0L 5ECGA 1YMHA 3U9UA 5GRXG 2E7CA 3IJEA 4HCRA 5HGDA 3WEBA 1HU8A 2ATKB 1ESOA 1BPVA 1RURH 2AI0L 2EH7L 3HNTH 3K72B 1F4XL 1I7UB 4LCCC 4MA7L 3ZL1A 1C9SA 4OJCA 3ZR6A 3IJ8A 4JFWA 2DIAA 2V9TA 4QHPA 5I0WA 4ACPA 1OV8A 3C6SB 4D8OA 3Q1SL 2J1WA 3FAXA 4WGVB 1CLVA 1O7DE 1I3GH 2GG1A 1M9WA 4KZEL 1MG2C 4K73A 2G5BB 1BX2B 3MAWA 1JZDC 5LBSH 4FNTA 3P3TA 5JQIB 4MVBD 4PUBH 1RUMH 4N1EA 2Z91A 5DC2A 1CF8L 4ETQB 4TVPH 2XXFA 1U8MB 2ENYA 2UVFA 3NFPA 3G5WA 3IPFA 4K5LA 4N2EA 5BVJB 4UV7H 3B9KB 5KYNA 2ADFH 1NCTA 4DQAA 2AKRB 3RURA 4BFBD 1MCSA 5DQ9B 5F9OL 4ZFOB 4X7TB 1KCRH 4NM4L 3VXTA 4IRZH 3KHOA 3CLWA 1R5WA 3EFDH 3RU8L 4A6YA 5DD6A 3UEQA 5IQNA 1KBPA 4LCWD 1IFHL 1G7LB 4JFVA 3HOGA 3S5LA 3GZOA 1FC1A 2BSCA 4WO4A 4UIKL 3QPXL 4R8WL 2ZF9A 3L3OA 3P9LB 2VLKB 1RZGA 4G5ZH 3AB0C 4DTGH 3KPRE 5EU6A 5FEBA 3UZEA 1GGBL 2I7OA 4I48A 1P9MA 2WANA 3SD2A 4LCUB 2VDMB 3HCVB 3Q6FA 5D2NC 4WJG3 3NG5A 5BZDB 3FRUA 5CINL 4PW3A 2G3MA 4F7MA 5BJTA 2XXCB 3QEUA 2CUAA 4HHAA 4K5MA 1M56B 5FHBL 3X11A 2XTLA 3O2WL 4IYKA 3SPHA 2PWEA 3SPCA 2ZXBA 3UTSE 4ZNEE 3O45B 3WLBB 3R19A 2HFEB 4ZUWB 3BQUC 1KPUB 3N44B 5E0QA 4K3GA 4JVUA 2G5UA 4NYLA 4FG4A 4FMKA 1DQKA 4CVXA 1JPEA 3BH8B 5LBSA 1UZ8A 3QSKB 2R1WA 4I3RL 2VN5A 4MA1B 4XVJL 3CN4A 3V0VA 3EG9B 1L9QA 1U4FA 4QLRA 4JDZB 5E9DA 2WXKA 5I1CH 2Y7SA 2QKIB 3LQZB 4NLAA 4HHWA 5D7JB 3VAEA 2XYBA 4N85A 2ZE0A 1UT1A 4PY7B 3FRPG 1SDAB 2F19H 1MCJA 2R59A 1E9PB 4IRZA 2R23B 4BZYA 5T1LD 3VCLA 5E99L 4I18B 4L3CA 3KMDA 3QG6B 1OK0A 5F6IB 5E7BA 3MCKB 4ZFZA 2IGFH 3SO3C 3LS5H 3CD4A 4C57C 4QRQB 1LO4L 2J5LB 1NPUA 1PPIA 5IJKC 4D9QE 2H5UA 2MCAA 4Y2DC 4PJHF 1HINL 5FB8B 3FB7B 5F89A 3ARDB 4JRXB 4P2RE 2D2OA 2P7TB 4W81A 4DEPC 4DKAA 2C9RA 1BFVL 4AT6B 4KI5E 1K85A 2YPLA 2YXVA 1JPGA 1EMTL 3BFQG 4F33B 1J8HD 4HIEB 3BZ4A 3RIFF 5I8EA 3FMGL 1T4WA 5IBTH 2HFGL 4FQHB 3CV5A 1BLNB 3ARGA 4FYQA 2BCKA 1Z32X 4ICXA 4KGJA 2VZ3A 1SJVA 1TU2B 3PPSA 1QKZH 1ZT1A 2ARJQ 3MRQB 3VH8G 1UH2A 3EJTA 1NCGA 2V6HA 3B3BA 4U3SA 3P4OB 1S7XB 4D8PA 5TPWL 3KR3L 2VUYA 2HX7A 4PR5B 3MODL 1F3DH 2UZIL 4YDZA 1JGLH 2CKBH 3MN8A 3NIDE 3WTXA 3OJDB 1XHHA 4A2DA 4HIHB 3MLXH 2GAZA 3NSDA 2JXMA 1CGUA 3NQIA 4UOW1 1JV2A 2PF6A 3NTCL 4Y9BA 5HHQA 2FO4B 5AL0A 3DX8A 2V7HB 5LBVA 1CLZH 2GTWB 4KOCA 3VG9C 5IMLB 4N4YB 4LSQL 5TE7L 3NIFE 3BDYL 2W60A 1CLYH 5IG7B 1NC4D 4ORGB 3ZY7A 3BE1H 5E8EB 3MJGX 3DXAA 1UXSA 3EFFB 1DQDL 4JO3L 3V6BR 1HH9A 3AT9A 1BJMA 1HXYB 3F7YB 2PABA 3RUGF 1QLEB 3D2UB 1FP5A 5KSUA 5KG9B 1SF3A 2DL2A 3GTTA 3FHAA 4OLVH 2NY6D 3EYVB 2W9LA 1FZKB 3MRGB 4PS3A 4HAKA 2MNWA 2VJ0A 4P0DA 3I6GB 1LD9B 3E8UH 2OL3B 4AJYV 3GDBA 1HHGA 43C9B 1DL7L 2FLRT 4I87A 1OAYH 3GLZA 4JZOB 4YX2H 5HYQB 3F5WA 1TTFA 1R3JB 4NJAL 2FTAA 3D18A 5FECA 3D39E 3BVNA 3HRZB 4B9PA 1J7VR 1YMMD 1NZRA 5IJDC 2X09A 1YCSA 4L1DA 3P3RA 2Y1YA 1A7NH 5K59F 2PTVA 3FHEA 3OL2A 1OWRM 4V2CB 3P2TA 3IK2A 4YHPA 4NC0B 4GRLA 2CKBA 4UILL 3B7YA 5KJ4A 4M9PA 3QZWG 4FLOA 1S5IH 3F12A 4X5PA 4DOHE 2ZUYA 2XVBA 3BI9X 4XAKD 4K5NA 2BW5A 3CFKA 3N06B 2NXYD 3C6LB 2PYED 1SDDB 1KJVB 3TO2A 1O9ZA 3VMOA 4PJCA 2VN7A 5DK0A 4WDIB 1BW8A 3HG2A 5J11B 3CFMA 2L7JA 2ZP9A 4LOFA 1AC0A 1P7QD 5DEFB 5B3SB 1KB9K 2BP0B 2H2PD 4OD3L 1NCWH 2CM5A 5B3JF 4K94C 4TQ8A 4KMQA 3JV4A 3KCPA 2EADA 2ZPKL 3IVKB 1ODUA 2X0UA 4IRSC 4I0PD 4R26L 4OGXL 1MRFH 2ISDA 3QCTL 1JPSH 3SDDA 5K93A 5T3XD 1SOQA 4ONGH 5J12C 4HFUH 4WTXA 4K8RD 1QG3A 4PB9H 5BRZE 3CVIL 2H26B 5FUZL 5IWLA 3EJRA 4X8CA 4XOEA 1A4AA 2C4FT 3FCBA 4FQIL 4L8DB 4DP1X 1ZS8B 2XN2A 4OD1H 2GY7B 3B3IA 3LD8C 2GJZB 3W37A 1X9LA 4L4VB 4AGQA 3BN3B 5F0JB 3HG4A 2QADC 3NABL 1ZVNA 4ZD3H 2D0HA 5GQBA 2VDRH 4HH8A 4UIMA 5D7LE 5E1GA 1W8NA 5I0DA 1BOGA 12E8L 1MW1A 3WDJA 3OD3A 3TIEA 4N0RA 2FVNA 1KUMA 3VFSB 3KVDD 2AQRA 4I4WA 1IEAB 4LNRA 1W0WB 3TU6A 1XGRA 3ZIMA 4ZOBA 4R7XA 3U6RB 4XNXL 2NY4D 2XTJB 1VPOH 4Y0GA 3UIYA 1AGDA 1F4HA 1WTGT 5HP5A 1UD3A 3OVUB 4CVWA 4AEIL 5F97E 4IDLA 4EQ2A 1M05B 5F88A 1VFAA 4K71B 4N22A 3SKNB 4AEHH 4XPHH 1L9TA 1NMCB 4Y2LA 1OF2A 3O0RH 3V10A 2XHNA 3U9PH 4UNIA 2W91A 1JWMA 3IFPA 4LP8A 3PFQA 5L6YL 1OZUA 3DDGA 3T0EA 3VXUB 2BNRE 3QUXC 4NNXB 2DBLH 4U1HB 2TSBA 2D7QA 5IQOA 3AY4C 2J5WA 3SGJA 2F54B 2FWUA 2GT9B 3ZE1B 2VE6A 4AL8L 1VFBA 2PUQT 5D7IE 3TYFA 4DPAX 4DUVA 5KSAC 5JUEL 1HZLA 1TQTA 1EVUA 5KANI 1FIGH 4PBVC 5CMAA 3TH3T 1ZVSB 2C3GA 1R24A 2DJMA 4XXCA 1T2QH 3QWQB 3L4TA 2BZCA 3O8XB 4K3JH 4Z7WA 4NQED 1NCOA 2ITFA 1BWWA 5K9KA 2F53D 2J2ZB 3LH9A 3DGCR 1XDTT 1MHHB 5DC0A 2MIZA 4WHYH 4R96A 4Y2OB 4HD5A 1GIGH 3FQRB 1S9YA 2VNCA 3QK0A 1KJ2L 3GINA 3WFBL 1SVCP 3CBRA 5B1JA 5EO0A 3RIAK 3V6FA 1JDAA 4PJFE 2DICA 3QUMA 2LVCA 4PD4K 1WIPA 5C0CB 4JFOB 1V05A 1MFVA 5DS2A 3WMQA 1K6QL 1SHXA 4L4TB 3VNYA 3BPLC 5KVGH 3HMXH 2AMGA 4Y5XC 1NCDL 4XNBA 5EZLB 4JGUA 4MJIE 4Z0XB 2K8QA 2J1YA 4F92B 4ZUTB 4NZUH 2X88A 4LRIA 4EDWL 1JPFA 3FB8A 5AOZA 3HAEH 3KWVA 3WG7B 1F18A 4CMMB 3FTYA 2W9EL 3IT8D 2PCPA 5HJGA 3LRKA 2NUPB 2APFA 2ODHA 2WBJB 4OZFB 3FQTA 3HS9A 5DK2A 4ABQA 4M29A 5JW3H 2A6DB 3X2QB 1MIML 4LLVA 3CSYB 4NGHH 5HHME 4YVNA 4ZSOA 4TLUA 4N87A 3FTVA 4D0DB 1MWAB 2XX0A 5G4NA 1MHEA 1E4XI 3JWNG 3K80A 4GUCA 3NCYS 2VDPL 3HZVA 3LY6A 5GISH 5G2NA 5HVHC 4U1GB 2VZ1A 5AB2A 1OSPL 3ZHNA 2R2HA 1IT9H 3E38A 1KB3A 3IDGA 3DTUB 1P5VA 2RCSH 5GJSL 2YAEA 2OYLA 5JA8B 4FZ8H 4B9IA 2WIMA 1N10A 15C8H 2IG2L 1DSFH 3AS3A 5I6OA 1FCCA 5FYKL 7FABH 1FSKC 2LABA 4AM0Q 3ULVD 2BIOA 2LHAA 4ADIA 2JKWA 2PCYA 3DX1A 3PUCA 3WTSA 2IH8A 4XVTH 5C97A 1ZPLA 2Y07L 4JRYA 3HMXA 5BQDA 2BY1A 4HIIB 4IRJA 2ESVB 3VUAA 4OIIH 4UQCA 5DXWA 4AXWB 1XZWA 4OCWH 3ZDXE 3PPEA 4Z3TA 4TTDC 4CN4A 5EZIH 2IF7A 3HAEA 2P8MB 3FOMB 2BLFA 4UU9A 5DVMA 3ZX1A 1WICA 1CPUA 3RX5A 3DWTA 4WWKD 3G5XA 3ILPB 5D4IA 1XF3A 4NRZB 1T1ZB 2CUIA 4G6JH 2WMPB 4QCIB 3HC0A 3KW7A 3MLZL 2CGYA 3HLAA 1FPTH 1QLRA 4EI0A 4YHNA 1Q9WB 5ALBL 3TBSB 5JORA 4YZFE 4YMPA 4PAZA 2QQKL 1CGSL 1SYSA 5DZJA 4E5XG 1Z3GL 2JK5A 5C8JA 2J3SA 3H7LA 5E9NA 4BZ1A 3UBXA 4BFFA 3BYYA 3MUJA 3UTQB 2AJUL 4FERA 3T2NH 1QBBA 5D71H 1K4CB 1YAIA 4F7CA 1RH8A 1HKLH 1LP9A 1U8CA 4H8WH 4Q58C 4AZ8B 4GRWE 1SXSA 4NQSA 1ZOXA 2EDOA 3QNXB 3QI9B 4LLYA 3GMMA 3BAJA 2Z4QA 4ZUSA 3S4SB 1FFNA 2BW4A 3B9KC 1UG9A 3GMRA 5ISZB 4PJ5A 3ESVF 3RTQD 4M8UA 5K39A 1IAIM 2QFPA 4PJ7E 1RZKC 4BIKA 2F9BT 3FK3A 1J9QA 1HEZB 1U8PB 3NP3A 4PRPD 2AC0A 4M5SA 2E76C 1KTDA 4FTVE 2VKXA 3KPRA 4HXAH 4RDBA 5ILTH 4Y19A 4PS7A 3ZYJA 4IBWA 4KNTA 5IFAH 1DBMH 4EN3A 4YHYB 1U3ZA 5D6CA 3OSVA 3J27A 4TL5A 5DRZB 1LILA 4W6WB 3U25A 4TNWK 1IRAY 4XOBA 4G59C 4IK7A 2G60L 3CGTA 1F11B 1PSKL 3OAUH 1T1YB 3G6DL 3UTSA 4APQA 1N6QH 1XVSA 2VZUA 3CHXA 1JF1B 4NN5B 4LCIH 4OTXL 4O2FB 5KS9E 4O2CA 3BP7A 2ZKMX 5F9JA 4KXDA 1WD8A 3QJZA 4FQCH 3GZPA 3M1OA 4MX7B 5CJQH 3NRQA 3UBHA 1TQCB 3P1VA 4ZZKA 1RJLB 5IOPB 1WFOA 2WGXA 4LNVA 3ZHFA 3IMSA 4MA1C 5MEOB 4OCMC 5FWQA 4KXCA 2CSPA 4R90L 3ZTNH 2QKIC 1AS7A 4POZD 5D7HA 5HY9A 3ALXA 2B59B 3DBSA 3VDAA 2IWFA 2FT6A 5K1NA 2NT1A 1TJIH 3MNDA 3NQKA 5DFVC 3QQ4B 3V55A 1JAEA 5J06A 4JZJA 5EBLB 2OTPA 5F6IC 1CICB 1PLBA 2R9HC 3K7UA 5TTRA 4X9IA 2Q76B 2H1PH 2J5LC 5ETUA 3VFMB 3PNWB 1U36A 2XWBB 4P2RA 5DRWA 3E6HA 4A68A 4XC3L 4O58L 3MMEA 3ULUC 3DGDA 3ISWA 5EMYA 3MTRA 3QNZB 1KCKA 2IAMB 2FEEL 3K6IA 3VI3B 1SJHA 2IALA 3RWFA 1CMOA 3THML 5DZNA 3NCBB 3QARA 3L5WA 3UFIA 4BKLB 3CMOL 1YN7A 1XGTA 2JVUA 4AYSA 3VFTA 5H35A 1J0ZA 4PCTA 1SUHA 5D2LF 5E1QA 3PABA 4RIRA 1YYCA 1ZT4A 1TXKA 3D8MA 3NVQA 4P2OA 1D9KA 2CUMA 3P40A 4G8GD 2CIIA 4PLJC 2YSSB 4U6YA 5FV1L 3P77B 1VZIA 2XQ0A 3BWUF 4KAQL 4YSTA 4LPVA 2WP3O 1OAUL 1BYOA 4LEOB 4RNRA 2GSGB 2ROYA 3TTYA 2BC4B 2OXGA 5L8KB 1QTYT 1EEYA 4KFMA 5HD8D 4LF3B 4I9WE 4JPVL 1VRSA 2A83A 2CO6A 3AQDA 2FX9H 1Y18A 1GW0A 1ZHBA 3ASNB 3SOTA 3MYJB 5HPOA 2IFFL 5C0JB 2V33A 3R0NA 1I1AB 4WKXA 4WEMB 4PS4H 1MHCA 3BKCH 1D6VL 3IPBA 2ZXWB 3R7QA 4ECNA 4IMLB 3JT2A 2OMUB 5DCCA 2AQNA 3KXFB 3L7EA 4QF1A 4U3XA 4HH9B 3C60D 3D52A 4AEEA 4F7KA 2I69A 1LL1A 3RZCA 3MBEB 1DQMH 2JI2A 2IQ9H 2PPCA 1Q94B 4JQXA 4P2QD 4L9DA 1L9RA 4H0IA 2HRPL 1P7HL 3IXAB 1HTYA 2APBA 4X6CB 1WUZA 3AWGA 1IVLA 2YJLA 4FE9A 4MMXB 3W2DH 2PWGA 4UINH 5L9DL 2NY5L 2WXIA 5DMGC 4S1QH 4AYDC 4KKCD 3QEQB 4WUUB 3TO4B 2XQBH 2V5TA 4TUKL 2HLFD 5DMJB 4FXGB 5ACMA 1TZGL 4AIZA 2FRGP 3IXTB 2C1OA 3N43F 4LMQI 4LSVL 1T22A 3APCA 2BVQB 1XGZA 1TTGA 5TK4A 4BFNA 1A1OB 1KPVA 5DLML 1K5NA 3C6LC 4Z3HA 1IBGH 1RZIA 4KDWA 4B3VA 3V5HA 1X7SA 5IM7B 4L4JA 3BSZH 3DNKA 5CFHA 4CADB 4ANKA 5J11C 1YY9D 4ODHL 2WQUA 3V0HA 4LEEA 2DQFA 1RJCA 4NUJB 1AFVL 4BGLA 2FEJA 1MFNA 2GJ6E 1KIQA 4LOUC 2B1HH 5GZND 3MJ7A 2WO2B 3BSGA 3R06A 1WVZA 5DVLA 4WSJA 3B2PA 1U8OB 1ZCRA 3C75A 3HNVH 1QBLL 4AYBA 1WWWX 4HPHA 1HN1A 2AABL 2O26U 4CVZB 1P2CA 2Z0UA 5BRZA 1GZQB 1N7ML 2XBDA 5F9AC 2HJKA 2X89D 2YD3A 1OPGH 2PWHA 4AYGA 4JRWA 4YWGH 4M93C 5DT1L 4HIXL 2D3LA 1I82A 3GSOA 4BHUA 3TURA 5C0AD 4HA1A 1RMFH 2FWLB 4JKNA 4TLTA 4V1DD 3AC0A 1BQHG 2YQGA 4X5WB 2R8SH 3FUJA 2X0WA 2QZQA 4YFLI 2XX1A 5HGGS 2X9ZA 1CS6A 1OQOA 3F7PC 5L0QB 1QSFE 5LO7A 1V27A 2Z31B 4W6XB 2NMSA 5GGRB 3GTVA 5IB5A 3OG4B 2C3HA 1W80A 1RZFH 3WKPA 1T04A 2K3TA 3VFGH 1G7JA 5EEVA 4YQXL 1Z9PA 2PTTB 2DKUA 5J1AB 1KTLA 2XTJC 4JR9H 2J55A 1TYRA 1CXHA 3BSZA 3FSAA 1LO5A 2GFBB 4Z7UF 3RVUD 1EFXB 4E9VA 1PZ5B 1FL5A 5LBGA 5D4JA 5JW4M 5C1MB 2H6UA 5FYJU 3MTXA 1NGZA 4K71C 3I6LD 3WJMB 4F15B 4WHDA 1A4CA 1AKPA 4FZEH 1T7WA 3D6GA 3FO0H 3L3JB 2FGWL 4JFFD 5I0VA 4LSSH 5JNYA 3GXNA 4L3EA 4W4OA 1U8JA 3FRPA 5HHXH 2EE3A 1MCBA 4OZGE 4R4FH 5F1NB 3BVUA 3LZLA 1AY1L 4BQBA 2XACC 3GJFB 4DF9A 1PBYA 2BDNL 4MMZB 4LFHG 3H9YA 1TG8A 1KCSH 4UQEA 3WELA 1CIDA 1RP9A 2FATH 2FIKB 4HPOH 3CXHJ 4D7BA 2P44B 3SYQA 2EO7A 3VQ2C 1E28A 4TRPH 5H8DA 4NSKB 1KLGB 1TNMA 1TJGH 4BA0A 4CNIB 3L5XL 2XN0A 1HIMH 3RI5F 2X1WL 1YEEH 2HKFH 4PJFA 1BGXL 2WLLA 1PY0A 2IVFC 1A3RH 5F7KC 1SLXA 1B3JA 1UD8A 4G6AD 5DD5H 4OZ4B 1JNNH 3APFA 4MYWB 2Q7YA 1RUQL 4X2UA 4P59H 4XCCL 2BSTA 1G9MC 4CSPA 3L13A 4U1IB 1CT8B 3VH8A 4MJIA 3GD1C 4OU3A 1P1ZA 4LKCB 3FB6B 4RZKA 4CU8A 1WT5A 3BAEL 4W70A 3BEVA 1ZHNA 3QEHB 4ODSH 1DJYA 4WI0A 4EMZA 4PB0H 5C2BL 2XVKA 3EAKA 3KM1A 1NEZG 3IAQA 2PP7A 2ZONA 4NWTL 1ET7A 2BSDA 4ZO9A 1VEOA 2WBJC 2FECL 3D3VB 2GI0A 2IH1B 2E8YA 2LR4A 2JKTM 2NY7L 3K8LA 2X40A 1FN4B 2YBRA 3HFML 5IUCA 1QRKA 2OLDA 1MAJA 1BP3B 1NM4A 5AZUA 3AFLA 1CD1A 2RH0A 3WLWC 1L5GA 3UJIH 1DJZA 3JV0A 4HD9A 3D0VA 1N70A 2UWEB 3ABKB 4U1GC 1MFAL 5JW4N 4GRWH 4NOFA 5DJ0A 5C0FB 3S36H 1I9IL 1NMAH 2X38A 1YYLL 1SF5A 2HJFB 4OV6F 1FVEB 3M1BB 3NJFA 1AQDB 2VLRD 3E9UA 3S3CB 3SCMA 3GMQB 4X4YA 3LEYL 2Y06L 1UB5A 3F7LA 4ZTEA 4QHNB 1KWGA 3BGMA 3CVHB 3U36A 2O61A 43CAB 2X4QA 4P5KB 3UC0L 5D72L 4HWEH 4UOW0 3L3IB 1A7RH 1EJ8A 3SDAA 2DJ4A 1E9OB 1DSWA 1NGQH 5E00B 3UZVA 4EE2A 1XSIA 4OBSA 5I6NA 5K9JH 1SHWA 4Y16A 1FRGL 2XN9A 1SDYA 5FDWB 4Z95L 3HZYB 3QZWA 1MJ7L 4GAYB 2E7HA 4BSVA 1M7DA 1QACA 5A1AA 3D85B 4PRAA 1YEWA 3GSRB 4LDOB 3UBXI 3WD5L 5HYSB 1BLIA 3KWWA 3MHZA 5D1ZA 4YHIA 2H45A 4E9LA 3BFOA 3CSBA 1FO0B 3M8OL 4PJDE 1ZA6B 3DIVA 4LPYA 4AYFA 3MV9D 4HIPA 4DO6A 4CL7A 5IMKA 1RZJC 1KN4L 1MQKL 5CD3A 2YLHA 3LOWA 1N12A 1CTNA 2ZSWA 5FKPB 3EIFA 2A6JB 3DROB 2MKLC 3GSNA 4BFOA 4PLKC 4DGWC 4LU5H 2ZXGA 1P53A 4S0HA 3L4CA 4PJGE 4B60A 3KS0J 1XBRA 3QI9C 4G7YH 3VFPB 3V9FA 2OQJA 1DN0A 3SPGA 1WV7T 3BVDB 1KDJA 4R0LA 3OKNA 1G5GA 4HS3A 4PJ7A 4YO0A 2GTZA 2L7UA 5J9PA 3L2LA 4PYHA 2CJTA 1RIUL 2YGVA 4LBEA 4XNYH 4C56E 4F57L 3ARYA 4Z7VA 1PLCA 2DYPA 4Q0XH 5E1IA 3O3DA 3EYOA 5J1SC 1T7ZA 3UPRA 3FTUA 4KMTL 4I2XE 4ZUVB 1N68A 3OJVC 4YSQA 4HBCH 4MB1A 2NX5B 2Q87A 2ZAHA 4JQVA 2JCCA 4J1UB 2XT1B 4MXVF 4UQ3B 2D31A 5B1CA 5CZVL 4Y7OC 3G6JF 2VAAB 4WEUD 3U6XA 4NN5C 3W11C 2QBWA 2ZOWA 2BIQA 2DM2A 1H3UA 3W82A 5AFAA 5HDBF 5CBEA 3MLWL 4JHAL 2XA8H 4WJ5A 2CDEA 4OI9A 4J4PC 2GITA 1ZDSA 2ZAGA 2N0KA 1LJMA 1TQCC 5AALA 3MLTA 1SJEA 1CL7L 4J12A 3CPUA 4UB0H 3O4LD 5EA0H 3RL1A 2EEDA 5CEZE 1D3CA 4DEUA 2AI0H 2EH7H 4Q2ZB 4L29B 1F4XH 4MA7H 3F04A 4DP7X 3S37L 4OFKA 5KZCB 1BMWA 2WQ8A 3MRPA 3OBAA 4Q4EA 1MNNA 2CR0A 3GKWL 4OQTL 1MFDH 2MOQA 1GGUA 2P3YA 3Q1SH 4ZXBD 3ZDYB 1Y6NR 4AKPA 1BFOB 5AVZB 1WISA 3B2DC 5E9AA 4KKQA 4OV5A 4KZEH 1CICC 2X4NA 3TM6A 3J07A 2K45A 3D9AL 3ISYA 4MAYD 3B43A 1CF8H 2NYKA 1KLFA 4P06A 3V4VL 4JN1H 4WW2A 4Y4HC 4O51B 1DUYB 2IAMC 5B38B 1IEBA 2NY4C 4XP1L 2Q6WA 3OKLA 4NKOB 2Y6TE 3TH4T 5C2UB 2X4TA 4DPCX 2GUYA 4QOKB 5F9OH 2ENPA 4NM4H 1LE5B 3I75B 1TSRA 3RU8H 35C8L 1GS6X 1HHHA 4JANA 4AWJC 1JNHA 1T5KA 4JHWL 3ZTJG 1IFHH 3SGEH 2J12B 4UIKH 4QRUB 3QPXH 4AENA 4GKNA 2IADA 4R8WH 2GSIB 3QQ9C 5BS0B 5J56B 1ORSA 2WWKT 3KPSA 3POHA 2XPGB 3TEWA 4ZTOL 4KY1L 4PRNA 2WKOF 1FNGB 1F6LL 3PWPB 4WK2B 5E7FA 3TASA 1CDJA 1JGVL 3CFDB 5CINH 1YJDC 4CVUA 2X0VA 3AU1B 3SPJA 5FHBH 3ABLB 3O2WH 5D7JD 2CJSA 5SWQA 1AOZA 1KTRL 1RIHL 4GBXA 4NQVA 3CFCL 4N0FA 4WV1C 4XN8A 4BV1A 1AHMA 1KGJA 4WKZA 3LIZL 5F1OB 4WRLA 1AQ8A 1OCCB 3HHRB 4I3RH 4XVJH 3RY6A 2AITA 2VW6A 1IARB 2QSCL 1OK8A 2HT3D 3T4AA 3KYOB 4N2OA 3T4YB 1XD1A 5E2VL 1DVFA 1QUNB 3KVPA 3PAZA 3ARDD 3N9GL 5E99H 1EVTC 3PWLB 3HG1D 1KJMA 4MMXC 3ZLQC 4Y4FB 6PAZA 4XXDB 4DVRL 4LRNL 3I6KB 3OZKA 1P84J 1YNTB 1LO4H 3UGUA 2APXA 2JLLA 3FCSB 4ERSL 3EW3B 5KJ7E 3D4YA 2FR4B 5A2KH 4ZAKA 1HINH 1F6AB 2H0PA 2VISA 1KXQE 4PJIB 5E1HB 1D5ZB 2VR5A 1DQQA 4FXGC 3MXVL 1BFVH 3O2VL 2EYSA 2EIEA 1FNSL 2CPCA 4WUKL 4GB9A 2H7WA 3IDMB 1H3XA 2IWKA 5IHZA 5F93C 4HLEA 1DVYA 1XF2A 1JJUA 3FMGH 5GIRA 2HFGH 1MSPA 1BVKB 4XNMB 3ZKMD 2QEJA 1MFBL 5FM5O 1FAKT 2RIKA 2VZSA 4WHCA 1D5IL 1QZNA 2X3CA 5ICYB 5FYLE 2IJ0C 4I1NB 5ID0B 3TEZA 1CLCA 3CK0L 4E5XA 1P5UB 3C8KB 1B2WH 1I8IB 4LLWA 5DFWH 2YKKA 3EJYD 6FABL 4M00A 5TPWH 3KR3H 5E8OB 2GJ6A 4U1KB 3UIZA 1MCPL 4U3HA 1QQDA 1WIOA 3MODH 5PAZA 4TSAL 4QR7A 3ABGA 2AQTA 1KB5B 2E5EA 1QD0A 1JGEB 3TA3A 1YEHL 4IU2A 3EGSA 3LIUA 3NTCH 2Z64C 3W81A 3AXLA 2YPLD 4BHUI 1EEZB 4M1DH 2VLJE 5H4ZA 3OKOA 4ATWA 3LH2L 2HJLA 4P07A 4PRDA 3FB5B 3V5DA 1TVDA 1GVIA 5TE7H 2Q8AL 3SE4C 3F84A 3IFOA 3BDYH 4WFGE 4E41A 4OB5L 4JFED 5IGXL 2PPEA 3O41B 5CJ5A 1DQDH 1PZ2A 2RA1A 4EZJA 2ZT9C 1XF1A 3H8NA 5H2BB 3BIKB 3ZE0F 2CCWA 3RWDA 2VR3A 1QSFA 4PRHB 2K4AA 4UAHA 2G2RB 2FZ3A 3D25B 1RVFL 5AW8B 5L0QC 3F58L 2BNQB 3M86A 4QT5A 2Z31C 2X6UA 2C9VA 4NJAH 5AYQA 3H2QA 4GI6A 5GSVA 4MCZB 3OKKB 1NGXB 1N4XL 2VDQB 4ZO6A 1RK0B 2IDFA 2XY2A 4AOFA 1FZMB 3RWHB 3VXNB 2ZQKA 3IF1B 2TRYA 1G84A 1E7VA 1OTSC 4LLDB 3DXAD 3WHE0 4RMWA 4PJHE 4QRSA 3L16A 3SBQA 4YDKH 1A7PL 3H9SA 4G6KH 3SB3A 4F15C 1NH6A 3E3QC 3N3EA 3RX9A 4OZGA 4RSYA 5K9OA 1DQTA 2KC0A 3DX6B 4FNRA 5F7DA 4ZMVA 3PE9A 5EOCL 3BLPX 4HALA 4L1SA 1THAA 3A5VA 2OX5B 2A74B 3VWJA 3C12A 3QHZL 1S9VB 5IHLB 5LGJB 1WC7B 4U1SB 1AE6H 5FGCE 2GEEA 4JKMA 4MMZC 3BW9A 2N01B 4X4ZA 5HHVH 3CU1A 2YLKA 3LQAL 2ICWJ 2XIBA 4OD3H 1LEKA 2JH2A 3WEAA 3RIKA 1HZKA 3E6FA 2F58L 2H3NB 1T66D 2ZPKH 2CO2A 4HT1L 4RMTA 4R26H 4OGXH 3CHRA 3QCTH 4NM8L 5JIKA 3H3BC 3T3PB 3NCEB 4BK5C 4IGBA 4OM0L 1Q1PA 4G9FE 3CVIH 2FHBA 3QFDA 4JPSA 5FUZH 1F90H 3OLDA 3PQYA 2ZYHA 3HS8A 2W94A 4FQIH 2R2BB 3HJEA 4MB3A 5EDXA 2XTSA 3Q2VA 4FQ2L 4G80A 1U91A 3CC5B 1E8ZA 3QWOA 5AKTA 1IC1A 3QC6X 4MNGA 4QHLA 3V52H 4FNLL 4OAWA 1JERA 1C08B 3QJUB 4XBPB 2BXYA 4RISL 1CFTB 3SN6N 1E2VA 1KIUA 12E8H 4ZQKB 4Z5RA 1GGIL 1GS7A 1VCBC 4HKXA 4RLDA 1UATA 1RP8A 3MUHL 4B9ZA 5BOJA 1U8NB 3VD4A 4UOZA 4EI5B 2X4UB 1KIRB 2W07B 1HE8A 4K3EL 4XNXH 3UTZA 4AEIH 4YGVB 4H13C 1NIBA 3DVGB 1HXMB 1OT1A 1EEQA 2A0LC 1KT2B 3C8HA 1YMHB 3U9UB 2XNAB 3VW3L 3WKML 3WNPA 1ITBB 5HGDB 3IE9A 3V2AR 2CM6A 4TNFA 3D7PA 2IEPA 5L8JB 2H9GA 3NJLA 5IB4B 2AHIA 2OZNA 3VRIA 2O6PA 4A7GF 4OZIA 2WINA 2RTTA 1G87A 2GUOB 5EOTA 3PL6A 3VRLF 4ZX4A 2IH3A 3VI4E 3TF7C 1UFUA 2XV2A 4AL8H 3ZOAA 2WHVA 3QXTA 2NXZB 4HS6A 5JUEH 2ZUUA 3OWEA 1UM4L 4F7TA 3FO2A 3LAFA 2N3JA 5AOKA 2E86A 4RRPA 4RMVA 4DPRA 4HBQA 4Y4KD 3ELQA 1IAMA 5C0CD 4MA3A 2FJHA 3NFPB 5HD8C 2ALAA 2VCOA 3T3MF 4FADA 4DP8X 4X80L 4DN3L 5T3XL 2WIIA 5DZLA 3UBFA 3J7HA 4WI8A 4N1HB 1KC5H 3GHEL 4K8RL 1KJ2H 2X7LB 5ADPL 1R5WB 3AM8A 1L3NA 1YEGH 4A6YB 1VGKA 1C1EL 3B9EA 4RWYL 1TEGA 2XRAL 3FN0L 3Q9PA 2YAOA 3HB3B 4WO4B 2H6PA 3D07A 3QHTC 1IM9D 5DEJA 5JHMA 1K6QH 2EYTB 1PLAA 5DDHA 4PJDA 5EBMA 5FIEA 2OMWB 5EU6B 3C09C 1R5VA 2XWZA 1NCDH 4I48B 2O5ZL 3TEUA 3ELAT 3Q6FB 2DEWX 3CZNA 4JKLA 1IM3B 3CFJA 4JAMA 4D0CA 4PFEA 3RKDC 4DH2A 2V0AA 4EDWH 4F7MB 2K9UA 1TYJA 3QEUB 4G6ML 5GS2D 3O6FD 2H3XC 2W9EH 4FJYA 4HHAB 5D1XA 3WEXA 4M62L 2IGTA 3H9HB 3NJHA 3DX4A 2Q86B 3UJTH 5CEZH 3S96B 4OZHB 1MIMH 1AMYA 3QG7L 1S3KL 2V2XA 2GABA 3S8GB 4NYLB 3EDKA 4H4NA 3WMSA 5JW4Q 3DJZA 1LQBC 3BT0A 2YXFA 4AUJA 1FYTE 5JOPD 1MZZA 1L4IA 1A3ZA 1HAUA 1UZ8B 5IVXE 2X44D 1BQRA 2P5EB 1JPTL 4NRYA 2XQYA 3DMMD 1SMOA 2VDPH 3UADA 1KGCE 2EEXA 5JZ7D 1OSPH 3OHXA 4N2MA 4OIAA 4U7MA 5GJSH 1EUTA 2ESVD 4I2XA 1BQHA 4AEFA 2H0EA 3L7FB 5DHDA 3VCLB 4XRCB 1ETZB 2IG2H 5H94B 4M5TA 2EIBA 2XWTB 3MFFA 1F1DA 4FG6D 4BRJA 5B7MA 3WDHA 4Y5YA 5G4MA 3W56A 1BEXA 1F86A 1HHJA 2X87A 1MUJB 4X9BA 2Y07H 4YE4L 3W5MA 5C3LD 5D5ME 3VQLA 2WWMC 4QRRB 5F89B 4DCQA 2AJ3A 3FFCB 5C0BE 2PNDA 1RHFA 2ZCLL 5ICXB 4J3WA 2WXNA 5SWSE 3SQBA 4H8HA 3ARTA 5CWSB 1PDKB 2C9QA 2K0RA 2OI9B 3BZ4B 4L8BA 1GA2A 4FFZL 1LWHA 4PJ9B 5L2JB 2EXYD 1N0LA 1B6UA 4FKEA 1CC3A 1N26A 1UA6L 1ZRUA 3ARGB 4PIBA 1J05A 3ZGHA 1ET5A 1ZT1B 2Y9RT 5E8PA 2XWEA 1UCTA 2BCMA 4GUPB 5LLIC 1ZJAA 2D7OA 2EO9A 1MJ8L 2YUVA 3RGVA 2QTVA 2AS5M 1AACA 2QQKH 1CGSH 4FI7A 4D8PB 1Z3GH 2DLTA 5ESVA 1K4DB 3D4CA 1JGIA 4JRYD 4K7FB 4JM4L 2BSEA 3BLBA 4IRJD 2AJUH 4MS8C 4I1PA 2ZUXA 3CE1A 2BNUB 2P45B 3X3GL 1ZMYA 2YXWA 1ZLSL 5I5RA 3DX8B 4U7SA 3NESA 4KX8A 4ZYKA 2GJJA 1RUPL 1MKFA 1NCAL 5IY5B 1NUFA 1WE5A 4AKQA 4PGDA 1Y0LA 2W60B 2VW4A 2N0MA 4I0KA 3FT3B 1QABA 1CO1A 3EGXB 1VDGA 1OTUC 4AQ8A 4H0GA 3AADB 5KBMA 1HFUA 3ZE2B 2IO5A 1OP5K 1HH9B 2WQAA 4ALAL 3ESOA 4JM2C 4LSPL 2VXUL 1NOAA 3I9IA 3ILQD 4AX3A 3BXNA 3ESPA 4Z7QE 1S8DB 3KLLA 2QHRL 3LRLA 5GZOC 3ULVL 2AK4B 2O6CA 3CCHA 2VR9A 5C0ND 1HHGB 3QJXA 2UZYB 3F7KA 3GIVB 3C5JA 4G1EA 2Y7LA 4QRPE 3ZT5A 2N4IA 5JYLA 4XN5A 2HPOA 2G60H 3SJVB 1PSKH 4QXUL 1NEZA 1U4EA 4NZTL 5IBUB 2ZNWA 3G6DH 2EDEA 3T65A 4OTXH 3TLRA 5DD3L 4PJ8B 1ZLVH 1KYOK 2XIDA 3SBRA 4DGIL 2NTSP 4Z3JA 4PJ5D 5FYLH 3KM2A 2XVGA 5E6UB 3QDMA 4GRLB 2CKBB 3ZMRA 1IAOA 1RKRA 4R2GB 3LKRA 3F12B 1S5HB 4HSAC 2ZX6A 1KXTA 1NIFA 3CFKB 1N6UA 4UZSA 4O4YL 3FTWA 3OR7A 4WIQA 1ES0A 3B6SB 1BAWA 1QNZL 3TO2B 4A2HA 4R90H 3Q06A 1H3PL 2ZOTA 3B8YA 4OKDA 5DK0B 4EN3D 5C08D 2DBJA 3SGEI 3AWEA 3QR2A 2AQ3A 4RA0C 5GS0D 1I85C 1W0YT 1XEDA 2X9XA 2VR4A 1SXNA 3WNNA 1U3HB 1SQ2N 1A6AA 4G71B 2WYHA 4I5BA 4XXWA 5I15L 4Y4FC 4Z78B 4GKSA 4FFVC 1JRHL 4FL4B 3QUKA 1GC1C 2J8HA 4AQAA 5JDSA 1GGCL 3DPBA 2HT2C 3GSXA 3JV4B 3KCPB 4XC3H 4O58H 4R7DB 4RFOL 4PU2A 4GI9A 3HZKB 4JKKA 3SDDB 3DKHA 3OXRA 4NQDA 3THMH 3L1OL 1H0DA 3L4VA 5HI5C 4TNVK 3CMOH 3Q5YA 2BM3A 5I73B 5J7CC 3GRGA 4NDMA 5A2FA 3NJXA 3S36X 2H32H 2EE9A 4MXWL 5H4YA 2N1TE 1PKQE 3GS0A 3B3IB 2BWIA 4PP2A 2QSQA 4MSWA 3X3FL 3JWDC 3G04A 3DV4A 3QS3A 1OF0A 2Q7AA 4J3OD 2NRDA 5I8KL 1CGYA 4G72B 1BOGB 1I1AD 4KAQH 2QMJA 3SBWC 4BXVA 1OAUH 1ZVHA 3QIBB 1CXFA 3KPMA 5IKCA 2G2PA 3D51A 4DETA 3U6XS 1XGRB 4HJSA 3L2MA 1ZJBA 4FXKA 4JPVH 5INCA 3T6XA 1GSMA 1AGDB 2D7MA 2EDHA 4GO6B 2L8AA 3U83A 5EF3A 1J8KA 4MJ4A 2IFFH 3MBED 1E43A 3L3DB 1M7XA 4JG1L 3QWRD 1D6VH 1UEYA 3TBBA 5KSVA 4F7EA 4ZUUB 2VERA 1NKRA 4WW1A 2A6KA 1F4YL 1OF2B 2RHEA 3CUPA 1XGPB 2BH0A 3HZMA 4EXPX 3IFPB 1D9KD 1R9FA 4J2XA 5IVZB 4QJ4B 4AQ1C 3T0EB 3VWKA 5JXEC 1AZCA 2IIJA 2A7BA 2J1ZA 2XCMC 1IBZA 1J8RA 2AK1L 2HRPH 3H2WA 3TO4D 1VFBB 2WQVA 2AEQL 1NFDE 4GXVL 4UT6L 4WNQA 5AENA 4CGUB 1DZ0A 3GF8A 5EBWA 2HCZX 4MDRA 4DZBA 2VTFA 5JMRA 5CMAB 4JDTH 2XYCA 1R24B 3N44F 3NT0A 1DO6A 4Z7WB 2G9HA 3FU8A 2A1WL 3ECVA 3TN0A 3QPKA 4ANXA 5L9DH 2NY5H 4GS7C 4KK5C 2VDRB 1JUFA 1M3JA 3FTXA 4J39A 4M61A 3V4VA 4QGYA 4TUKH 3Q5OA 4Q14A 1S9YB 4G8FA 1C12A 1OW0A 5EO0B 4PJHA 4RGND 4P99A 1UUSA 4YIQA 1RLWA 2JQZA 3HE7B 4OLYL 2B16A 1KGWA 2HKAA 2WW8A 3EF7A 5EBGA 1JZ5A 1NBCA 1M4KA 2WXMA 5DJ2A 4NZFA 1UCBL 4X7SL 5E6IA 3N1PC 2WOBA 5IFHL 3TZVA 5G5DA 2NDFA 5DLMH 5ICZA 2ADJA 1IQWL 4ODWA 1E5ZA 3ETSA 4G7VL 3ULUF 2A74C 3QIWD 1JPFB 1URZA 3E7JA 4LVNB 1T83A 4ODHH 4HW6A 3WY1A 1JNLL 1N5AB 5CZXD 5EO1A 5AOJA 4AH2A 5B4MC 1AFVH 4YVUA 3FQTB 2HZHA 5HJ3B 4ZPTA 2DQTL 4LLVB 5HYIA 2R2EB 2IBZY 1AVAA 1SGKA 2F1AA 1QBLH 5AAMC 2AABH 4UM8B 2YA1A 1N7MH 3UP1A 2VSMB 4XP4H 4ISVB 1ZLVK 4W9GC 4KJYA 3HZVB 2C1PB 4HIXH 4A66A 4U33A 2R2HB 3VA2C 1UA3A 1P5VB 2BS9A 3P30L 3S97C 2AEPL 3ATBA 1SYVA 4GMSL 2WLIA 1YPZB 3U1SL 3V0DA 2CAKA 4A7UA 4CSZA 1OD9A 1I7TB 2CHXA 2CXGA 1G43A 2HTLC 3TBYA 2F8VA 3RUGA 4MQ7A 4GQQA 3REWB 4R7NA 3LHAA 1V5JA 3CQPA 1Q9KA 4LCWE 2JLPA 1RK1A 4S10A 1C7TA 2GK2A 2HRHA 1A6PA 4M9OA 4KQ3L 5AW2B 3RWCA 4E9RA 4YQXH 1SOXA 5CLXA 3UTPD 2DTML 5T1MA 1GMIA 4A7TA 1RU9H 3VFVA 3TVMA 5I1DA 1E8YA 5IB1A 3BMVA 4QHKI 3HAEB 4LZKA 4P3WA 5I74C 4LGSB 2K4WA 5EU7C 4HK3N 4F9PA 3QB7C 2X42A 4MZRA 4X8JA 4XP9L 3HC0B 2ZOKA 3KDPB 3WUWG 2NUTA 2FGWH 4LT7A 3W39A 4J3BA 1ACYL 5JO5B 5JORB 3VI4A 5EN2B 1SYSB 3TYGL 1T1XA 3UPCA 3VXRA 2ITCA 5C8JB 3UBXB 4OSUL 2FDBP 5MHSD 4LASH 2BDNH 4NT6A 2W59A 2QR0A 4K7PY 1MLCA 2VMFA 2V3EA 4O2EA 1I75A 1TQSA 4F7CB 5MENE 1U8CB 3RX7A 3ZXAC 4NQSB 3ARFA 3CDYA 3EADA 4LLYB 3GMMB 4N2FA 3AMKA 2VJXA 3GMRB 3LS4L 1WP6A 1ZE3C 5E4EC 3T71A 3CLFH 4JY5L 1Z0NA 5K39B 2JIXA 5D93B 1DFBL 2JKLA 3MA9L 1BGXH 4G6FD 2EC8A 5CCHE 4BFGA 4DERA 1U8QA 1AI1L 2R69L 4GINA 1GOFA 1GZHA 3RVTC 1KEGL 3AAZA 2VWEE 2AJZA 2O30A 3HB3C 1KTDB 2JSFA 1RUQH 3KPRB 4L37A 2V5YA 4P5TD 4WO4C 4XCCH 3W0WA 3ZL4L 3ZO0A 5MEQA 5LG6A 3WY3A 5E6RB 3L3OC 3WXWL 5I28A 4LDCA 2PXYA 2VSDA 4AK2A 3IDXL 1HHIA 5D6CB 3TTSA 1CUOA 1NC2D 3QDJD 4KKLC 1P9MC 2BOCA 3BAEH 1J8HE 4PP1C 3V0IA 5LAXA 3K6SB 2N7SA 2P28B 2FL5A 5ANME 1EEUA 4EVNA 3UTSB 3MRRA 4APQB 5C2BH 3T6WA 2MSPA 4NWTH 1IAIL 4L8CB 1M7IA 4IQHA 4O2CB 4LLUA 3Q2WA 3X1FA 2ZD0A 2NY7H 2R51A 3CFBA 4HVBA 4KO5A 3HFMH 2CCLA 5A6MA 1OAJA 3DECA 2UY7B 4OJFL 4QTFA 6CGTA 3BEWA 2OK0L 3NK4A 4P2CG 1CE1H 4WENB 3ZRFC 3C2SA 3FUDA 3LYRA 2WD0A 1BVLB 1NCJA 3BAYA 3O3EA 1JZ7A 1SQMA 3B1UA 2GK0A 4QO1A 4TN9A 2F8IA 2E0PA 4OKVB 5HY9B 1MFAH 4BFJA 2WWNA 5GJTL 2CO7A 3D0LA 3ZZ1A 3HIZA 3RG1C 2KZKA 1I9IH 3WE6B 1AR2A 1RZ8A 1YYLH 3OZLA 2YGQA 3ZBMA 4NQCD 4JZJB 3MCLL 4YDNA 1V3KA 2C9UA 1M71A 5D5MA 3LEYH 2Y06H 3PYCA 4TUUA 2C9SA 3GJEA 3FULA 4P2RB 3E6HB 1KLUA 3MMEB 1I8LC 5D72H 5SWSA 1AHKA 1OGTA 5E08H 1SJHB 1UJ3A 2IALB 5IBLC 3RWFB 1S46A 5CR1A 1YN7B 5T8IA 2ENJA 4QRAA 2HTKD 3C5ZD 1FRGH 1T21B 4MNQA 2P8PB 2OI9C 4Z95H 1MCEA 3UG4A 2GKIA 3PABB 4XZUB 1MJ7H 1IKFL 1JSYA 1MNUL 4PJ9C 2PCFB 3ZE1F 2EUWA 1YMME 1FYHB 2LLLA 3ARGC 3BJLA 5BZZA 2CIIB 3HLKA 3QYNA 3WD5H 4QYOA 4U6YB 4WEEA 1A66A 5DI8A 3SCMD 2ZG2A 3M8OH 1KGIA 3OGOE 2YXMA 4WFHE 3NIDB 3IRZA 5CZRA 1QW8A 2OXGB 2WBWB 2E6JA 3BPNB 2XKSA 1LNUB 3JVFC 3MJ8B 1KN4H 1MQKH 2P4AB 2PYFA 4HISA 4XAKE 2EIJB 2CO6B 2A83B 4U6XB 2AZUA 4YLBA 1AZZC 3H0TA 5LJYH 2PYEE 1ZHBB 1KFAH 1JPST 2HLEB 3KPOB 5EB9A 3TJHD 2QVFB 3ARZA 3HE6A 3FN3A 3NIFB 2IAND 2UXVA 2XN9D 2WWKO 1D5XA 4L1HA 3TNNB 4YPGA 2K6ZA 1JYVA 4OR1A 1OY3B 3RWGA 3L7EB 2WVVA 3JWDL 5JPNA 3UOAB 1S7RB 2EIZB 2NX5D 3UTTE 4CKQA 1RIUH 4PRBA 3K2IA 2HSIA 3RZCB 4DEWA 1IGFL 4PI0A 5EUOE 5CCJA 2RGSA 3DIFB 4OGQC 3SKMB 3TL5A 2ZWYA 2JI3A 4HLZH 4PRIA 2IPTH 4KMTH 1F4AA 3FU7A 3GEFA 1G1OA 3D39B 4UTBL 4BA8A 1DUZB 3WTVA 2A77L 5KAQG 1HK6A 4K3DL 4F9LC 4LL9A 4K9JA 1JHTA 4XX5A 2VB5A 4KTEL 2VXQL 1C5DA 3MNZA 4JMXA 1CR9L 1WH0A 5FOBA 3HBPA 3B5GA 3LMJH 4PJ8C 3A24A 2OR9L 4AIZB 3MLWH 4RQQB 2WTRA 4JHAH 1K2DA 4DOHB 3KJ4B 1HE7A 3OR6A 4GRLC 2X2IA 4LPXA 3KYNA 2X1XR 5IW3A 3SDCA 5IIEA 1I7ZA 2DYPD 3QVAA 1CL7H 3G6AB 1TTBA 1K5NB 3DUUA 3LZNA 4LSUL 4TTGA 3P54A 3AG1B 3RB5A 5B8CB 2VRAA 3QRFM 3AGWA 2WZ5A 3O3UN 4OJAA 3S37H 1IC5H 2JB5L 3S3JA 2YD4A 3S2CA 3V8OA 3GKWH 3MJ6A 4OQTH 4PG9A 4DKTA 1J48A 2DQFB 5F96H 3AJ7A 1LO0L 3CPLA 3LNIA 4U2YA 1O0VA 1CB4A 3JTTA 4P46A 5HDRA 4JFHD 3D4ZA 4FL4C 5CU9A 3D9AH 3VFWA 3FTGA 3R06B 5I19L 4DKFL 3BC9A 4Z7OE 3GMNA 4HC1L 4HWZA 4PY8I 1RSFA 1QFUL 4IBQA 5BRZB 4XVUC 3SDDC 4XP1H 1X5MA 1NWPA 3FYEB 4D3CL 1QHPA 2YEQA 2G4GA 2YOAA 5KTEL 1PKQA 1ET8A 4JDEA 5FAAA 5EG6C 3KE0A 5I73C 1V55B 35C8H 5IWLC 5JHLL 3TV3L 1BMZA 2WVSA 1T0NA 2F53E 1JN6A 1WCBB 2W0FA 4JHWH 3RVVD 1FQ9C 2BVOB 4ZS6D 5D7LB 2DJSA 1XIWA 1S7TA 1Q9LA 5EIVA 4N9OB 3BCFA 4XCNA 1UOWA 3ZHDA 3FU9A 4GSUA 2O5XL 4KY1H 4ZTOH 3T0AA 3U7WH 5IB5B 2OR7A 1EO5A 4NO5B 1JGVH 4S1DD 5BW7A 2BVPA 4MGXA 2I9TA 3LPOA 1G7JB 1XGQA 1Q72H 3AQXA 3EHBC 4CU7A 1KTLB 1EUUA 1EJ6A 1VACA 2DF3A 1TKWA 1SLUA 3PWNA 1RERA 5TD4A 5I17A 3A23A 1COBA 2WLHA 4Z8FL 1OCOB 1QI5A 4L1BA 4CAGA 1GOGA 1RIHH 3ECBA 1OD7A 2V7NA 4I77L 4X8GA 1NGZB 4W9EC 2FEEI 3MA7A 2V8LA 3LIZH 5LGYA 2Y7MA 1JK9A 1X7TA 3T0BA 2YQ3A 4FQQA 3V6OA 2BNRB 2YUXA 4YFEA 1OE3A 1TYEB 1BHGA 2QSCH 3T0EC 3FRPB 3WL9B 3FQUA 1A5FL 5E2VH 1NFDA 5SWZD 1D5MB 1OOWA 3Q1EA 5D7IB 3QFJD 3VG0L 3HHMA 1S7VA 4BCZA 1IE4A 3N9GH 3B7TA 3T2QA 4R9HA 1E5AA 4Q9QL 1KG0B 1MFEL 5F7YC 4DVRH 4LRNH 1HWGB 3QORA 5IR1A 1SZNA 4XXCC 4Y88A 2FYYB 1AD0A 3MO1B 3FU6A 2Y7QB 5IJBC 2C7FA 3V0AC 3DO3A 4JG9A 3GTNA 4ERSH 1EHKB 2VL4A 4RRPM 1A4KA 2XIIA 1ZVYA 4JFDA 4PJFB 3ULVE 3UG3A 5E6YA 5B1JC 3O2VH 3CIQA 1FNSH 4WUKH 3F83A 2BWQA 3KCWA 3KL0A 3FO1A 1BJ1H 1OT4A 2JB6B 2EJ1A 3HPJA 2FHFA 5DFTA 3HE7C 4AJVA 1TUPA 4PCYA 3QJRB 5HI3D 2M1KA 3KPTA 4L3AA 2BSTB 4K7PL 3QGVA 4GEJA 3N2JA 2IXQA 3FSVA 1MFBH 2H0FA 3KBPA 2ZOOA 4MJIB 4YSOA 3VH8B 3N42B 5D2LA 3VDBA 1X5HA 1JTPA 4H7VA 4NO3A 3K1DA 3MKKA 3LIZA 4JG0L 3BEVB 3CK0H 4GQZA 3K1KC 5DJ8A 3WS6A 5D55A 1G1KA 2FBJL 2G75A 4LRIC 2DWTA 1Z5LB 1MCPH 3VI3F 5F7AA 1J11A 3UYPA 1J0HA 4TSAH 3AQYA 4KK8D 5HHMB 3DRQA 2X4SA 5IV2A 1D5RA 1YEHH 2YRBA 4L8SB 2GB2A 2YBRB 2JWYA 3O6KL 3ZR5A 2LVEA 1FH5L 2CIKA 2I7SA 1XD0A 4XPBL 3LH2H 1A02N 5IEKB 4PHZA 1NFIA 3ZU8A 2Q8AH 4ODUA 1ILSA 1JE6A 4LPWA 5KYWA 1G7MA 2OJEA 2OMBA 2YUZA 3D0VB 1V7ML 2ADIA 5K9QG 4PREA 2ORBL 2DD8L 2Q8BL 3HR5B 3MACL 5D6DA 5DJ0B 3SYAA 2CO4A 1XF4B 2NY1D 4JO8A 2NTFA 4WWID 4TKWA 3N0PB 3BN9D 4BFIA 1MCWM 4N2LA 4M8VA 5AW3B 4LCWA 1RVFH 4X4YB 2HKHL 3E3QE 1UB5B 3LEVL 4AM0A 2GC4C 1AGFA 3F58H 3U36B 5JIQA 5AEAA 3BRGC 4PRPE 1EJOL 3G9VA 3T0VA 1I4FA 2X4QB 3TA3D 3TESA 3FUFA 4PBWD 5CLYA 1QR1A 2MRYA 5EWIH 5TF1L 4N0YL 4XNAA 3ZDXB 1NCNA 4HOZA 4FHKA 1N4XH 3OKEB 4N0CD 3SDAB 3UAJA 2ZX5A 4AVJA 3AWFA 5AVUB 3UL4A 2OYMA 4X83A 2YD7A 4Y16B 1PG7L 1J1PL 3VA6A 1QEWA 2DY2A 2G3NA 4TV3A 3QZWB 3QXDB 5KYYB 3QR0A 4BSVB 5FO9B 4I13B 4S1RL 4I9XA 3MV01 2Y0SA 1M7DB 4X6CF 5DJXB 1A7PH 3L1FA 1MCNA 5FXCH 2H2SC 3UACA 3WNMA 1JWSA 4RCAA 4F58L 3KWWB 3NEOA 4F8PA 5EOCH 1O7DC 2XICA 5CU5A 5AOLA 4AYFB 1C5CL 3DUHA 4OI7A 4KHTL 3QHZH 5IMKB 5C0NC 5CD3B 1E2WA 2L7EA 2Q3ZA 4GRWB 3U7AA 2ZSWB 4UTAA 4D2NA 5EU5A 3LQAH 3ECWA 3B7RL 5HHPA 4IKLA 1V7NL 5T1LA 3JBG7 3K4AA 4KGLA 2F58H 1PFOA 2OQJB 4GRMA 1DN0B 4HT1H 2P8LA 3VD9A 4YXHL 4ONHB 3FC8A 2BVEA 2PKDA 4HS3B 2YQBA 4PJ7B 1SOKA 4NM8H 2OSLA 3PJNA 3S88L 3H9SD 4DGVL 1NAML 1RY7B 5D93C 2HP4A 5E5LA 1J5IA 4LBEB 4FTVB 5IEHA 5I8CA 1FJ1A 1AQKL 2EYRB 3O3DB 3I02A 1L7IL 2A5UA 4FQ2H 5EIQA 1ZIAA 2P80D 1GYVA 2ZYRA 3VWJD 3TFKC 1RZJH 4A7QA 4YBLB 2OMZB 4RISH 3PWJA 2C7UA 2HG5A 2ZWKA 2FK9A 5FK9A 4F8NA 3V0WH 4GG8B 1E6OL 1T4KA 2R4RH 3OLIA 2D31B 5GRZA 3O6ML 4JFPA 4Z76A 5KS9B 3ZE0E 4APQC 4HYTB 3DX9A 3QNFA 2MJWA 5F3BB 5TE6L 3FUHA 4NFDA 5GRYA 3GSQB 3ECQA 4PSPA 5CBEB 4HJTA 3B83A 2CDEB 2GITB 1PD6A 4QXWA 4YDMA 5EV7A 2VDKL 1W9XA 1KTCA 1SJEB 4UMGA 3MV8D 2NXZD 3VW3H 3FZUD 4DW2L 4K2UL 3SPVA 5A16A 5F8RC 3VE0B 4XCEB 5FCSH 3NCMA 3IFNL 5JPMA 25C8L 1J86A 4ZX3A 1M1SA 1N5YL 1QW9A 5CP3H 2XPYA 4JZJC 3SKUD 4OV5B 1PQZA 1BIHA 1V8HA 2X4NB 1MY5A 1UM4H 3H9ZA 1QHOA 2C4FU 3PV6A 2EZ0C 3EOYG 2OMTA 1O5PA 3BOVA 5AZ2L 4WU7A 1KLFB 2MCMA 4P2QE 1FG9C 2DEXX 4L9LA 1MAML 4N2CA 1IEBB 2Q6WB 4PTUA 3OKLB 4KI5C 4X80H 4DN3H 1UJTA 5T3XH 3AG2B 3SE9L 2X4TB 5DHMC 1WWAX 4DP2X 2FECI 3GHEH 4K8RH 3LRGA 1MCRA 1EAJA 3DETD 1SLWA 5ADPH 3QIUD 3QZBA 4JANB 1WGOA 1YMMA 4LAJH 5AAWA 1IM3D 5IJVA 1C1EH 4RWYH 4W9KC 3FN0H 3ARED 5FDYA 1WTLA 4TMPA 1BIIA 2Z93A 2FWOA 4P2OC 2NZ9C 5DMKA 4AENB 1T1WB 2IADB 3AS2A 5AW4B 1ZT7A 1T7XA 1DVXA 2VW7A 3RTLA 5FGBC 3MOBL 1S9XA 3M1CA 4PRNB 1FGVL 1XFPA 2YKLL 3QDGD 1P7KA 3PIQA 4HSCX 4TNGA 1A6TA 5D1QA 3CNKA 5GGTL 5HGAB 3BPNC 4NAMA 4J5VA 3BVXA 4GAJH 5F6HJ 4G6MH 3FH8A 1ASPA 5I1EL 5TDPB 4TVPD 1ULVA 4M62H 3AROA 3ORJA 2CDFB 2FJSA 3K5SA 5FWRA 4GBXB 5DUJA 1P7QA 3QG7H 4NQVB 5D7EA 4MWFA 4WKZB 3OHMB 4MTMA 1FZJB 1OLLA 2FD6L 5BOZG 3T2PA 2GCYB 1HOEA 4I0PA 3RILA 3T4AB 5EUOA 3VFNB 3DVFA 2NW3A 3RZCC 2NY0D 3BP6A 4YBQD 4JQXC 3F8UB 1SJXA 4QRRD 2ETWA 3FFCD 4E9TA 4XPTL 2XETA 4DGYL 4E42B 3U82B 4Q8BA 5C0IB 1F4WL 1SY6L 1EBAA 4OGAD 5D1XD 1IVTA 1WFIA 4YE4H 2HVJA 5IHHA 3IJ7A 4MB4A 4V1DE 2MCPL 3UG5A 4ZAKB 5L7XL 1KCWA 4N6QA 1DZBA 4GXUM 3A6BL 3MQIA 2AXHA 2ZCLH 3UJJL 2X2HA 1DQQB 1ECYA 2UWEF 2EYSB 4LHUG 4XVSL 5F7EL 3KJ4C 2DQJH 4FFZH 1XF2B 1Q8MA 2VN6A 4M6ML 1DHKA 3RVWD 4K9EL 4P4KB 1UA6H 3WUWA 3F7VA 3L9EA 5I6KA 3GXTA 3ATDA 4G9DA 2PW2A 2TSAA 5B8CC 1A2YB 1MJ8H 5BQ7A 1MVFA 5GGRY 5AWNL 3DYMA 3GMPA 4YS4A 1IFGA 3I6LE 1QSED 5I1AA 4OJEH 2GJ6B 5D4HA 1ZKAA 4PJXE 4JM4H 4JFFE 1EAPA 2XPZA 2VR6A 3L4ZA 1BZ9A 1F3DJ 4JQIA 3EGSB 1EK3A 2ZSVA 1QRND 3X3GH 3RDTB 5L88L 3KWUA 1H8OA 1F8TL 3OKOB 2EILB 2KLSA 2HJLB 3SHSA 1EGJA 1NCAH 1RUPH 2DV6A 1WF5A 3Q9QA 5D8JL 3V5DB 2AK4D 3QUHA 3DSNA 4E41B 4NQEA 2F53A 4HZAA 1AGBA 1Y7VA 2P5WA 3IDJB 4ALAH 4LSPH 2VXUH 3FONA 1CL7I 4N9GA 1F6FB 3FH5A 3RWDB 2B1AL 1QSFB 2QHRH 1MEXL 3IE4A 4JO2L 2Z6FA 3NFNA 2ZXEB 5I2IA 4A7VA 3ULVH 4HKJB 2BSED 2IPUG 2J8UE 4NUGL 3TONA 2MWCA 4DP5X 3DJRA 4YZWA 3MRIA 4G42A 4HEPG 4UNVA 4JGNA 2YD9A 1K8DA 4NFBA 2E7LC 2H4EA 1O9VA 4JGMA 3TBVA 1JD7A 2CWRA 1G7HA 2C5DC 2DLEA 2X6MA 4QXUH 4NZTH 4DN4L 1I3RA 1C16A 3BCDA 3QXAA 4HAGA 4L5FL 2ZNXA 1AZUA 1NDTA 5DD3H 4DGIH 4NO0A 2BS71 4KK6D 3G6JA 1U30A 3QWNA 2ITDA 3H1ZA 4JPIA 3REVA 4PGEB 3CZUB 4GXUN 1PZAA 4GIPD 2VQ1A 2QLYA 5BMFH 4JFUA 4RFNB 3V79C 4OZGB 1X5AA 4W4OC 1QNZH 3MLPA 1H3PH 4F8LA 4AVIA 3HR6A 4MKTA 3OKMA 1AYOA 1A4BA 2Y24A 4I0CC 4GKZA 4KNSA 1UA7A 2E46A 4R97B 4U0QB 2AJSL 2M8XA 5I15H 1RL1A 3BKML 1AKJD 2DS4A 1OZTG 4PGJA 4GW1B 2J6EA 1X5XA 4LEBA 1ND0A 5EPMA 3WO3B 1PZ3A 3Q7JA 4FQXA 3E6FB 1GGCH 5FYJD 4JDVA 3DTDA 2OR8A 1ONQA 4RFOH 2ZJSL 4QXTA 5GGQL 5GHWL 1EHLH 3V9CA 2AXGB 2G3ZA 4DWHA 5HHOE 2VLRE 3B2UC 3BUYB 4N90E 3L1OH 4ELMF 4PV9A 4X5RA 2EDTA 4KV5E 5CEYB 3QFDB 2D3JA 4TSCL 3P0GB 1INQA 3O3AA 2WKLA 4KRPD 2BSRA 3VFRB 4MXWH 4Y9FA 4KROD 4P23B 4G80B 4W9FC 1A65A 3QWOB 3ZDYF 4YAQA 2NY3D 3DV6A 4BZ1L 2WWOA 4OAWB 3BD4A 4ELDA 1BAGA 1JVKA 1CVRA 5I8KH 2B2XL 4WWKA 1Z9NA 1WT5C 3UCRA 5HJBA 9CGTA 5BO1L 3WXVH 2ZKWA 3F6IA 5E95B 2OA9A 3F65A 2CUHA 4