4ZMPA

Crystal structure of human p-cadherin (ss-dimer q101l)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDLNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cadherin-3
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmpA01
4AK1A 3LNHA 2WBXA 4ZI8A 2OMXB 1NCHA 4NUQA 5JYMA 1EDHA 5DZVA 2X2UA 1O6SB 3FF7A 5KJ4A 4ZMOA 2EE0A 4AQAA 2A4EA 1FF5A 3LNGA 4NUPA 4ZMQA 1NCIA 3UBFA 3LNEA 4AXWB 3LNIA 4AQ8C 2QVIA 3UBHA 2OMTB 4QD2E 1Q1PA 4ZMYA 4ZMWA 4XXWA 2YSTA 3K5RA 4ZMLA 3FF8A 1WYJA 4ZMZA 4AQEA 3K6IA 4ZTEA 1NCGA 1SUHA 4AQEB 2OMZB 5CO1A 1L3WA 2V37A 3UBGA 1ZVNA 4ZT1A 1OP4A 2O72A 1ZXKA 2OMWB 1NCJA 3Q2VA 3MVSA 5JYLA 3QRBA 2WD0A 5CZRA 4NQQA 4OY9A 3Q2LA 3Q2NA 4ZMPA 2QVFB 2YQGA 4AQ8A 2OMYB 2OMVB 3LNDA 3PPEA 4NUMA 2WHVA 3K5SA 2A4CA 4AQAB 4APXB 4ZMVA 3K6FA 4ZMTA 2OMUB 4AXWA 2WCPA 1WUZA 4XXWC 4APXA 3K6DA 3Q2WA 4ZMXA 4ZMNA 3LNFA
chains in the Genus database with same CATH superfamily
4NN7C 3P69A 3LNHA 3W0WD 2XKUA 1NLBL 4Z95L 3RGVB 3SJVE 3HZVB 2XN9A 3HAEB 3ZRSA 4DGYL 1RZFH 2J6EL 1NPUA 4U1HB 3HPJB 1OP3H 3RY5A 4BH8A 1A7PL 3CG8A 3W81A 5I2IB 3QEUB 2EE0A 1RU9L 2MKWA 5C6TH 3FTVA 5ABZA 1BIIB 1M05B 5ES4B 3NH7H 4B9ZA 1KLFA 1CDYA 3DO7A 1Z9OA 3MUGB 5TK4A 4D0BB 3CDCA 4YBHA 1E4WH 5FV1L 1AYRA 5HI5D 4YSSA 3HVNA 3DUSA 1MI5B 2FL5A 1WD8A 3IDJB 3QUXC 4IS6B 4AKQA 4E0RB 4O5LH 1DFXA 3X17A 1IUZA 5I8EB 1Q0YL 4EI5A 1Q0EA 2B1AH 2UWEE 4H25B 3QQ3A 2DTML 4HAFA 1QTPA 5F9JA 3VWKB 3MRNB 5ITFA 4PJIF 1A1NA 5JQ6L 1IKOP 1AYOA 3NIFE 4Y16C 4R7DB 1XB6A 1MAML 3GMOB 4LLYA 3X1EA 2ZOKA 4OLYH 4RGNE 1IGIL 2LHAA 3HI5H 2J6EH 4JFUA 4ODXB 4PJXB 1MRFL 3QXTA 3RPIA 5LKNA 2Y24A 4MLIA 1CG9B 4UQEA 3SQBB 5I6XB 4MSWB 4K3HA 4AZ8A 5H4ZA 1CYWA 5IBUG 5ENWB 2Y06L 3QIUD 4YHLH 4NIYE 2FX8H 5JW4M 1A6AB 4GW4B 4QY8B 1DFBL 2FQEA 4KH9A 3SY0B 1TIUA 2WZ6A 5KSAA 2Y5TB 3S5LG 4NDMB 2BC4B 1OGPA 2ZPKL 1YNKH 4JW3A 4NKIH 4P9ML 2NPLX 4H20L 5KW9L 2R2HB 3QFDB 2I5YH 3KEHA 1QSEE 2R0KL 5DQJA 1EXHA 5IOPA 3WG7B 4HWZB 1BBJB 2EYRA 2XWJA 3MX0B 1E67A 1OARH 4WI8A 3AS2A 2YUZA 3D08A 1X5IA 4RH4A 3DX8B 2FX8L 3AREB 1JZ7A 2EDDA 3EYQC 3O11A 3ULVE 2F2HA 5I6XC 3WFBH 3ARYA 4ZMVA 3IDMB 1DUZA 1PD0A 2OS7A 4YHLL 2JJSA 4Z0BH 5IREA 1HSBA 1OT4A 2ZXWB 4PH8A 3GB7B 4A2GA 4Y4KD 5CILH 4IKNA 5EBLA 4F3FA 1MG3C 2F53B 5CFAA 4PRDB 1DLHB 1FFPA 1T80A 2VZ1A 3FT4B 5CBAB 3CU1A 3MBEA 1RHFA 2ARJQ 2HVJB 3Q1EA 4J2QA 5EOCJ 3RU8L 1UURA 2VERN 3C09C 4YS4A 5C0CE 5I17B 5CEZD 4UNUA 2LU5A 1YNTA 4HGMA 2I9TB 4MWFA 1CT8B 3VXRA 2GSGA 1BD2B 2DQCL 4YSDA 1NANI 1D9KA 4EEEA 4K2UL 2ZCKH 3O3UN 4P4KC 5EFIB 5C0NC 5LN8A 3W82A 3QPXL 4G8EB 3TBTB 2UXFA 1H8SA 3ETTA 4KO5A 4DZBB 3APFA 3UO1L 4CKQA 1UKQA 2CRMA 1U95A 1QRNA 5JIPA 1QBLL 3FYEB 4LRNL 4TVPH 3ZUCA 2O5ZL 5F7LB 1LE5B 2VW7A 2XLLA 1FORL 4GMTH 4KQ4L 2V7HA 2ZYIA 4FXKB 3RL1A 1J9QA 2RQ8A 3QIWD 2CHWA 2ZG2A 2Z7ZA 3P54A 1A7NH 4QUOA 4KQ4H 1TZ8A 2X53A 1MFNA 4CKVX 2F5BL 4XTRC 1IC5H 4CVUA 2EZ0C 3M6DA 1OSPH 4YX2L 3AQYA 3CDYA 3SD5A 3ETSA 2ZSWA 4OZHA 4J3OH 4GO8A 1YQVH 4U7MA 1PU0A 4NN5C 2NSXA 2HXAA 3SYAA 4YSEA 3LXCA 3T0ED 3Q6FB 1T2QL 4KI5E 5F6IC 2RA1A 1BYNA 1KTBA 4FA7B 5KANG 5BRZE 3GM0A 3HBGA 2CO3A 3EH4B 2I07A 2VQUA 3B2UD 4HH8A 5DUPH 5F8QC 2PO6D 3IXAB 1MOEA 1PNCA 1P7KB 2R4RH 2M26A 4F7KA 4QRPD 1ZHKB 1I7TA 2J5LB 4W9DC 4BDVB 3O4LD 3FOLB 1J8RA 4JMXA 4QRSB 2AI0L 4Q9RH 2GTZB 1E27A 3RFRA 3HZVA 2F9BT 3OG4B 4M7JH 4PGDB 5HYJD 3I85A 4ZUTA 3OHMB 3GPSA 1WITA 3UADA 1E4KA 4WVRA 4K5OA 2DH3A 2HN7A 2Y72A 3DTDA 3QXAB 1W72B 1I8LA 2C3VA 1A4AA 5GRVL 3MRPA 5IWLC 2N7BA 5FS5A 1IBHA 1IL1B 4X4ZA 3D0AA 3QHZL 4NT6B 4HDIA 2RQEA 3MUGA 3C12A 4D0BA 2K6YA 2F54B 1D3CA 1CFTB 1HC1A 1WP6A 2C9RA 3QJHB 5JLZB 5JPNA 3FO1A 4Y4FA 4IOFD 1N3NB 5EIIA 2EDTA 1CB4A 1RIVH 4Q14A 4AITA 5KS9F 3C6LD 3ZDYE 4A55A 1MRDH 5FGCE 4NHUA 4GRWH 1L5GA 2LOEA 4ENED 1AY1L 3C2SA 3QQ3B 5F9JB 1G9EA 1J1OL 1TLKA 3SODB 2C7FA 5AVYB 2V7NB 4ADJA 3S5YA 4UCFA 1I8KA 3EBHA 1INDL 2Z31D 5DHYB 25C8L 2ZXDA 1CQKA 3IFLL 2PPDA 4QTIL 5H37A 1ZPUA 1MCWW 5KOVC 3LZFH 1YEKH 4XC3L 4PY7A 3QHZH 3O3EA 3JZ7A 1UWXK 4N2LA 3V4PL 3EYFB 3B3BA 1OIOA 4Q2ZA 1DQDH 2VH5H 2NDGA 4BFBD 2VC2B 2WKLA 3GMMA 3H4HA 4ZAKC 1P9MA 5TDPA 2EIBA 2JKRM 1MI5D 2XN9D 2P45B 3TJHD 4LF3A 3QHFH 4NIKB 5CWSA 3GTNA 5DWUH 2ENJA 5EZOL 3QDMA 2X05A 2Z8SA 1YSOA 3UH8A 4XNQA 3V0DA 4PJIA 5E99H 4CADB 1CFQA 2EABA 1EIBA 5GQBA 5C0BA 5IEHB 2HVBA 2V9QA 2IH1A 4FF9A 2ICEA 4ZMZA 2WSDA 4MVBD 4GFTB 3WYRA 4ZTEA 1OP5H 1AI1L 1OAQH 4OQTA 4WHCA 3S3JA 5HD8C 1KBPA 4MB3A 4OVUA 3CFKB 2XYCA 4B3EA 4F2EA 3QJSB 3O11B 1QLRB 4HSQA 1U8OB 3TBYA 4NERA 3WU1A 3FOMA 3H56A 5FYKE 4O2CA 3X1GA 1ECZA 1UCTA 2TSBA 3MJ9A 5HTSA 1S7UA 3BGFC 1DVQA 1AHMA 4JE0A 3B1UA 3Q5OA 3LPGA 4DP8X 1HFUA 3O6KH 1RZGB 3S35L 5I18L 5DJ6B 1R19A 1UCBL 4L1TA 1N7MH 3RX5A 2DICA 2AABH 2MQCA 3L48A 2VE6A 3MA9H 4UV7H 3WN5C 1S9XA 4RZCB 2F7QA 3GBLA 4LCIH 1YEEH 1Q9WA 1DLFL 2HWZH 5AB0A 5EV7A 4N0UE 3C6LA 4G8FB 4JFXA 1OPOA 2ZD0A 3LN4B 4P9HH 3DXAD 3FCTB 3B2MA 4KXZH 4RGMC 1IX2A 3T2PA 4CDHA 1BQKA 5AOJA 3B9VA 5IMOB 4MTMA 2JKJA 4XP6H 2NY2D 2H6UA 1HK6A 1CURA 2EDXA 4MJ5B 4AE1A 1I9RL 3KL3A 1BM3H 1DVTA 3NQKA 5GISH 3BPNC 4AXWA 3CVHL 1NAML 4ELME 1BX2A 3FONA 4R0LA 4MMZC 1PL3A 4R26L 3ERXA 1U95B 3QH3B 4AENB 2CDFA 4M1GL 3BKMH 1MJ8L 2HMIC 4FXGB 3PREA 5L7XH 4P4KD 2Z8WC 2XWRA 1YJDL 2BW4A 3I6GA 3MLYH 3O4LB 3QAQA 4MA7H 1UOVA 2RBLA 5I23A 3EHBD 3ZE1E 4Z7UE 4HX1A 4MXWH 4XNUL 3HS0C 4XGZB 3WUWA 5HP5A 4B9FA 1NEPA 1BIIA 4P0DA 1M05A 3CCHB 2F54D 2XN1A 1ZV2A 3HOGA 4PJ7E 4Q4IA 1QLEL 1NTDA 3K74B 4NQDE 5BS0E 1E3ZA 2JI2A 3QS2A 5F9WB 3UPRA 1BOGA 1NCIA 1HL8A 1VEOA 4ELDA 3LNIA 2OP4L 2Y5QA 1Y7VA 5FECB 2O61B 1XGQB 2Z6FA 3WJJA 1CL7L 3MLYL 4MA7L 4NJAH 3ZE2B 4ZXBD 2CBTA 3FUIA 4OB5L 1UA6H 1YDPB 1UC6A 1GKEA 1P1VA 3RWGB 3DMMB 4H13C 2RJMA 4Z78B 8FABA 4JFFA 1E90A 3EYQD 3LN5A 5D72L 1CL7H 4JFHE 2GVYA 1ET8A 3VVWA 4LOEA 3AY4C 3QORA 3WKQA 1KB5B 1LO0H 4PRIE 3SY6A 1AGBB 1DVYA 1Q38A 1NOFA 3EOTL 4OCYL 2EUWA 4P2QD 4OGYL 4FL4C 2CKBA 4PGDA 4ZUTB 4DP0X 3MSPA 4X5QA 4HCRA 4JGNA 2EIDA 1T1YA 4IGBB 2X4OB 4WU5A 5IMMB 2XVGA 5FYJD 4F8PA 2N1TE 2XG5B 5IB5B 3QI9A 1MLCA 1A64A 3M1BB 5T5FH 5C0BE 1URIA 4O9HL 3HG4A 4A6YL 5D96B 1HINL 4M3JA 5CP3H 5IT2L 3RVVD 1BXXA 1T5KA 2R2HA 1RUAL 3DETC 2OJZH 5DUMH 5EN3A 2EE2A 2H6PA 3F7PC 4J2XA 3ARXA 5EU6B 3APMA 1YNLH 3V0IA 5LAPA 2RMNA 3N0PB 2W1NA 4Y16D 3CX2A 3KL5A 3OPZH 4P2YA 3SGKC 4F1ZA 3JWDL 4MAYD 4KVNH 1JXDA 1AO7A 2BVQA 4B7IA 1MJUL 1YYLH 4WNJA 1WIPA 2EE3A 4JQIH 4WW2A 4DVBB 3RNQB 1MDAA 4DAGH 1NGXA 4N8PA 4F15B 4X6DA 3B5TA 3NRQA 2VR9A 1HCYA 3GLAA 2Z91A 4FQ1L 4QRPA 5IQNA 4PGZA 2ODHA 3OAUL 1TR7A 3AQDA 2YRBA 5I0DA 4GP5B 4G3YL 1P5VA 1IIKA 1LDPH 2GY5A 5ETUB 2J6WA 1JZJA 2O6EA 1AR2A 3CN2A 4N5UA 4GUPA 4I3RH 5DD0H 5IZ7A 2VR7A 1RZ8A 4ONFH 2E9BA 4UT9L 2ICEB 3VVVA 2IOMA 3P4NB 2JIXD 3SPCA 5ICYB 1LO4H 4CC4C 1R1CA 4LPVA 2GCYA 2ZXGA 4GT0A 3BWAA 3LX9A 1ZLVK 4KRPB 5KSBB 2EXSA 4KFZC 3T0AA 1MJ7L 2A4EA 1Q9LA 1HNYA 3D3VB 4G9DA 3KH4A 3PGDA 2ZP8A 5IB3B 5T1MB 3BFQG 3JVGC 4Z7WE 1E4HA 3RY6C 4ADIA 3ZDZF 2WWKT 4WNSA 1D6VL 4CGUB 3TN0A 2VLJE 3N9GL 3VACA 4FG6D 3MRKB 3MUJA 1XGUB 3G04B 1U8MB 1DEEA 1ZS8A 4OLUL 3VE0A 1Q1PA 1MCOL 3RDTD 2PCFB 2H26B 3F7QA 3MRCA 4UOW0 4CBPA 5IKCA 1EO8H 4GRMA 1V7NL 4L05A 1EEZB 4R8WL 5C0RL 1E3FA 4MLSA 2EQDA 4MNQD 3C8DA 3VRJB 3S34H 2JB6A 4P04A 4WUUD 1MVUB 1PLGL 5GRZA 5ILTH 4RWYH 3OLGA 4H1LG 2VQ1A 3UC0L 2WXRA 1N64L 4LCWB 4TL5A 3IRPX 3AT0A 3EXJA 1JRHI 1OP4A 1ET7A 4MQXD 1PG7H 3MV8E 1DTUA 3QUKA 3P3TA 4TSBH 2R7EB 4FQJL 4YHNB 1ZLWK 1AQKH 3QFJE 3MO1A 1OL0A 4URTB 4E0RA 2HJKA 3OGCA 3IKCB 3U2SB 2VN3A 4BDVA 3FOLA 3TU6A 1OGAA 4DERA 3VJ6B 4J3UA 1QRNE 3ETBJ 5EC2B 5FLVA 2MHAA 3B6SB 2X1QA 5JQIB 3VCLB 3ZZ1A 1OPGH 3R7QA 1UM6H 4M7KL 3GF8A 1FNFA 4I5BA 1LO5B 5DDHA 4CA4A 1IL1A 2YGVA 3AU1B 1HJBC 5LWYL 1S6NA 3HNTL 2Y2TA 5H2BB 3RWIB 2NNAB 4KI1A 4MJIB 2F54A 1LO3H 1HYSC 1LP9F 4N2CA 4LCCC 2XZCH 1F45A 4QY8A 4OCNC 3QUHA 3TO2B 1IGIH 3FT0A 1I8MA 3KYKL 5E9DB 4U1MB 1MY7A 5EEWA 1P7QA 2X2YA 2OW6A 4NZJA 3RWGA 2ZCHH 3DMMA 3LS4L 4L37B 2VXTL 2XBTA 3GMLB 4ODWB 4ICWA 3GHEH 1H3WM 3SO3B 3AADB 2ZWSA 4Q0XL 5IHZB 3BRFA 3MACL 4HKBB 3SCMD 5IOPB 2PWFA 5D5MB 1HEHC 3QISA 2AJUL 2MTAA 3CZFB 1XSIA 1IKNA 2JF1A 2KZKA 2H2PD 3MGTA 4MXQD 1SJVA 3EJZD 2LTQC 2QADB 3KPSD 4FI8A 4LBAA 4PY7B 4DGUA 3FT2B 1LEGA 5GRUH 3O3EB 3VI3A 4Z7IA 1JHTB 3T0EE 3DK0A 2C26A 2WLIA 1DUZB 2W8CA 3M17A 3WKNA 1NMBH 4FHJA 1R3IL 4PJ6A 3FAWA 1GW6A 5CJXC 1ZLUK 1G9MC 1BDYA 1BG9A 3CD4A 3EH1A 5IF0B 4AL8C 3CHPA 4YQXH 1QLFB 5I1IL 4LLQA 2N0MA 3GSNL 3IJ8A 3SE8H 1BWWA 1F0LA 5EZPA 2VC2L 5DS1A 1C7SA 4JQVC 1NPJA 1OAUL 2Q10A 4F33A 3IAPA 4YWGH 3WJMA 5GRUL 3FF8A 1ACYL 4XPBL 1CT8A 1EZVY 3TZVD 1UB6A 1HXYB 4KRMB 1K85A 4N28A 3FTSA 3QXVA 3B7RL 4M7ZB 4U31A 1MXDA 2QADC 5CEXB 3FOMB 4JVUA 3ZSTA 4KNUA 4U6TA 2VM4A 3HW7A 4Z5RB 3DJRA 2IFGA 5G2NA 5CHNB 2WOYA 3BH9B 4XVJL 1XSOA 5T1LD 3L6FB 4M1CD 4LCVA 1JFHA 2AAAA 1IQWL 4B3VA 1BF8A 1SJMA 2AITA 4RX4A 1NDMA 2PCXA 4W9ZA 4X6FB 3HI1A 2P43B 3IPFA 1T5WA 4DKFH 3VD0A 2VDQL 3F04A 3NJFA 3TOPA 2YPLD 5L2KD 4PWFA 3WEOA 4K3JH 3AITA 4HMDA 2XFGB 3FYIB 1XO8A 4HIQA 4HUXB 1CGTA 4OIFA 1NCUA 4TL4A 3WTSA 3SDAC 1VRSA 4P5SA 1BFOB 3BX7C 3HN3A 5EO9A 3L5JA 5E70A 1H8LA 1BREA 1ZANL 4M56A 5HJ3A 4YL4A 1A7QL 2BPBA 3QUGA 4QRRE 1GOFA 1JVLA 2DQTL 1EHAA 1T1WB 2IPTH 3HI5L 3MUUA 3JTSA 1I8IA 1TT6A 1EV2E 2I27N 1J0HA 2A83A 2EKSB 1ITBB 3N0AA 4HEPG 3CQPA 3K1DA 1CLVA 3PIQA 2WCPA 4HUWB 4PBWD 4R3SA 1MRCL 2H0EA 1I3RA 3HC4L 4WCYH 4PTTA 5T1LB 2VUYA 4D7PA 1N18A 2QT6A 4K94C 2NDFA 1ZHKA 4L29B 1KIQA 4Q6KA 4RDQF 5CCKH 3LH2H 3EUDA 3FTGB 3BUQA 4P4KB 2G5RA 3DO4A 5GJTL 1M6OB 4UYPA 1NGWA 1J8KA 5HJDA 2BP3A 3U4BL 3ZTJG 4RMSA 3GUTB 1VENA 4HFUL 4L3ED 4WI3A 2HN7B 3QXAA 3FSVA 5FCUL 5KSAC 4Y0GA 5LXGH 2FJGA 3A4FA 1UQSB 5IR1B 3ARDB 5D6DC 4B5ZA 3FQWB 4WO4D 4QEGA 3UBFA 1S7WB 2F5BH 4WTZG 1NGZA 3HHSA 5TPWH 1HL9A 1SLUA 2EVGA 1A22B 1A4KA 4M62H 5BZXA 4G5AA 1G0DA 1D9KD 4N0UA 4PS4L 5CEZH 4FXTA 2L7EA 4MCZB 1CTNA 2WAHA 3VXNA 4ICXA 1YZZA 3LIZA 5EIIB 2ZUVA 3MKKA 2DQHH 5TE7L 1KDJA 4H0IA 4KTYA 4AYGA 4M62L 1AGBA 2F1AA 3U46A 2ZWKA 2LFGA 1E5ZA 1G1OA 1KJ2L 1KN2H 1OGAB 3UYRL 3VJ6A 1EJOH 4Y19D 5ISZD 4Z7OE 4NQEE 1AJ7H 1ULVA 5EC2A 4KXBA 5CCKL 4NRZB 4M43H 3LKPB 3L3DA 1SF3A 2YO3A 1RIVL 1G9NC 5L2JA 1NC2D 3AB0B 3SN6N 2H3NB 4PJEB 3V0EA 1F4AA 3F00A 3S3PA 3Q6GL 3TYFB 2CDEA 1BEXA 1L3WA 2OMWA 4LSSL 5H2BA 3RWIA 1IB5A 3FKUS 5IIEA 3J27A 3HS9A 1UXWB 4MQTB 2VDLL 3QNXA 2WPGA 4L9LB 1U3NA 2NY7H 4GRLB 3S3DB 3SE4A 3UTPE 1Q9OA 3ZXAC 1S3RA 3D0LB 3AY2A 2IO5A 1JS4A 3BUYB 1PS3A 3GI9L 4ZG1A 3X12B 1Q1JL 4L37A 4FNPA 1BD2D 3KWWB 3LS5L 3CXDH 3GMLA 4ODWA 4XC3H 1X9UA 4LHUA 1YAIA 3GJFB 4WI4A 2N01B 4LCWD 4GAGH 1GR7A 3EZ8A 2UXVA 1AO7E 4H2CA 4YHML 1CK0H 2IH1B 1HE7A 4N87A 5F3HA 2OK0H 5B1CA 5SWZE 2QZQA 2OFQA 5C08D 3TF7C 5KSVB 3BW9A 1F1AA 2FECL 2VDLH 5E03A 1UEYA 3MGTB 3MZTA 2G2NA 3PYCA 2MRYA 4WW2C 4WY7L 1JNJA 1INQA 3QZWA 1G94A 1XZ0B 3L3JA 3Q6GH 4O58L 4U3HA 43CAB 3DURB 4M1CC 4FTVA 2Y5EA 2F8VA 3KD4A 2DAVA 2FNWA 1T2QH 3K2MC 2EKJA 4C83B 3VD7A 5CUSL 4R2GB 4YHPB 4G43A 5E2UH 2E8ZA 3ZE0E 3MJ9L 4E5XG 3ISRA 3S36H 2XTJD 3BP4B 3NSXA 5GGRY 4P2OD 5JHLH 2VLKE 1Q9WB 4WWKA 2E86A 3D52A 1FBIL 4BE6A 5JDJA 3WIIL 4NLAA 4R97B 4IOFC 1EDHA 4JRXA 1EX0A 2UZYB 5JHLL 1FNSH 1MWAL 1HXYA 4L8DA 4B50A 4M5YH 5IB3A 5JIKA 3CBRA 1CDIA 3SOBL 3U6RB 1WC7B 1DN0B 4FD0A 4Z5RA 1H6EA 2GW5A 2K7QA 4LIQE 4KK8D 3OHXC 4XCEB 2DL2A 3MYJA 4XO5A 3TVMB 1BQSA 3FU8A 4X6DF 1XAKA 1GS8A 3TJPA 1KOAA 3U7YH 4AENA 1NOAA 2ZG3A 4DNLA 1ZIAA 1X5MA 4LVNB 1CF8H 5T3XE 1HOEA 1NFDA 1ZHLB 3N1PC 3EJYC 4JKWA 1TJGL 4BHUI 1I8LC 2R2CA 1EFQA 1XL6A 2CK0L 5EBWA 2MQGA 1OLZA 3RPKA 1A6ZB 1YMHA 1JWUA 1NFIA 4LK4A 5IVXB 1FJ1B 4CDGC 1N7ML 4AOFA 3F58L 3MA9L 4LCWA 4RQQB 1JXKA 1QOKA 3O0RH 3EF4A 3U30B 3RKDC 3NJHA 4NKQB 4Y7MA 3U7YL 1FE8H 2YBRA 4LEOA 2E9JA 2QQKL 1NBZA 1V27A 1X5HA 3P30L 4FFYH 1XGQA 1HYSD 3WO3B 5F93C 5D70H 1OK0A 5BS0D 1Q72L 1Y18A 4U6VL 4JFZL 5TDNA 1JRHH 3MU3A 1ZTXH 4OY9A 1I7UA 1ZJBA 5I75C 4Q9CA 1HT6A 4AM0A 5C0CB 2X09A 4XN9A 3SKNA 1EK3A 4L2LA 1BECA 2CCWA 4AJWA 4WLCA 1TJGH 4RGMB 4XPAL 4QO1A 3BRDA 3AU1A 4PJBB 1QEXA 5D9SA 3D07A 3D09A 2P5WD 2ZUWA 5E2WL 3TH2T 3DSFH 3MNWB 4MJIA 5GS3A 4JRYB 1FZKA 3QULB 4NC1C 5D70L 3RB5A 3VM5A 1AQ8A 2XG5A 5IB5A 2PLTA 4UMGA 4MMZB 1A2YA 4MXWL 2NXZC 2DKUA 2WLKA 5DVPA 3C8KA 1K3ZA 3LKNB 5EBMA 5F7UA 3UTOA 1KYOK 4ERSH 4PV9A 1IBBA 3MXWH 2DQFA 1DDHA 1NGZB 3HHSB 4GXVH 4RFNC 4WKZB 1BQ5A 1PYWB 4XXWC 2E9GA 4KC3B 4AYID 1EPFA 4UQAA 4XXDB 3L3OC 2Q76B 4AYDC 4NSKA 3VXQA 5I9QB 3FO2A 4NP9A 4G6JH 3TWCH 3BSZH 5D5MA 4XPHH 4YVUA 4JQIA 2BNQE 2D7NA 1A02N 1FFNA 5T5NF 2EDYA 1OGTB 1THCA 2NZIA 1MHEA 3CPLB 3DPDA 3BSZL 2UXGA 4B60A 4XVUC 5T3ZE 2VR6A 3TCTA 2YN3A 1YHPA 1F4WH 1E8ZA 4OIBA 4UBDC 4GG8A 3QGVA 3BQUA 3QDHA 4ZYKB 3REWA 3RWFA 4QRRA 3VFWB 3MC0A 2CDEB 4JDVA 4PJ8C 3LNEA 4XO8A 1TSRA 4QXTA 3NRFA 3SYCA 2CA3A 3T6ZA 1TNNA 3RWCB 3ULAB 3QG7H 2ZF8A 4Z18A 4R26H 2AVGA 3X13B 1NCWH 1QA9A 2LU3A 1HEJC 5D6CA 4A38A 2CG9X 2RH0A 5IGXH 2EC8A 3WKYA 1KIRA 3X12A 1AOZA 4FQ2H 4DESA 1LMIA 3V0JA 4HLZH 2FGWH 4JO4H 4M03A 3T4YA 2NY2B 2M83A 4S1SL 5IJDC 1HE8A 3SKUD 1MCCA 2ZKMX 3NABH 5E5UB 3TH4T 1OCZB 2BFVL 3K4ZA 3P4NA 5T3ZD 2QQQA 3WTXA 5KVDE 1G6RH 1JV5A 1OAKH 5FEBA 3UGEA 1SJHA 2BY2A 2DMBA 3VWJA 2CUMA 1FCGA 4M7LL 3VG9C 3E3QC 3NFPA 3DVNA 3FZUC 2O93L 2K9FB 3IMSA 3VRIA 3GSOB 4LLVB 1WH0A 2B5IB 4HCRH 5GRXG 5BV7B 4X80L 4IEFB 5C71A 4P2RB 5C6WH 3TN0B 1BQHA 3JSSA 4JRFA 3QCUL 3ZW3A 4JN2A 1O9ZA 2WN2A 4IRSA 4BINA 5SX4I 3H55A 3WMPA 3IGLA 3D34A 3SJVA 1TYRA 3Q2LA 4N2FA 3ZYIA 3B8YA 3OF6A 4ES8A 4UM9D 2H2SC 3L7FB 1EZLA 1C16A 2YQGA 5GRJH 1BFOA 4B0MB 5J1SC 4EDXA 2GJPA 1J0ZA 1RURL 1I4FA 2P8PB 2MH4A 1LK2A 12E8L 1O7VA 4J3OG 3NABL 1MVUA 4ZS7L 5FOBA 2VR4A 2PYEB 4BD4A 5D2NE 3F85A 4UDUB 1FZOB 2X40A 3PIQB 2AEQL 3SDXE 3GRGA 2RFXA 1J8HD 3IJ9A 5FHAL 5ELIA 1DN0A 5T33H 3UTTD 2D03H 4B9YA 4G8GA 1N59A 4L8SC 5T5FL 1QHOA 1FPTH 4XNYL 3U4EB 2PMZA 1E0OB 3LXUX 1WF5A 4HV8B 1GGYA 2NLJA 5GS2H 4G8IB 4LL1A 2EUZA 2KI6A 4LQFL 5E0QA 3ELAT 5LBSA 3CFJA 4M8VA 2OMXB 3L4ZA 3MV7E 2VDPL 1LO5A 2XQBH 3MOAH 1NFIB 2AANA 1UQSA 4ODHL 1KYUA 1PJ9A 4N2AA 5ESAA 3TC9A 1OWRM 4GNKB 4YFDB 4ZXBC 4DP9X 1TZHB 4ZOEA 3PWPB 1A4KB 3ZDXF 3VU1A 5B22A 1MI5A 3PV7A 3BT2L 3GHBL 4ZO9A 3INUH 3O3DA 3TO2A 4E42B 1I8MB 1S8DA 3FQXB 4CAGA 1BIHA 4ODVH 3N43F 4EI5B 3MYZA 3V52H 3SPVB 1A6UL 1H0DB 4OJFH 2R0LL 3ALPA 4Z7QE 1JGUL 4NRZA 3NGBC 4QLWA 4B97A 4D2NA 3ZHFA 1PTZA 4HKBA 2Z0UA 2WUCH 4UQBA 5J8OA 4KKCD 4PCTA 5EIIG 4JGMA 1JHLL 4PJXA 1Z5HA 1JI1A 3DKHA 4X6EB 4PJBA 5D9SB 3DTXB 1JFQH 2AZAA 3Q5YA 3UEZA 2CAKA 1D5MA 2R56L 3EG9B 1FIGL 4UV4L 4UU9A 4WENB 1ZDSA 2QQNH 1IAOA 4P5KA 3M17B 4X0KA 1GZHC 3LV3B 2AEPL 3DBXA 1SBSL 3VTAA 3W37A 3R8BB 1CQYA 3EOBA 5D93B 5EBGA 5TGBB 1PYWA 4UDTA 2GC7C 5AENA 5KBNC 1V54B 3O4LE 3E8UL 1MRFH 4UQDA 3RNKA 5FPIA 3GJFA 4ZPTA 2GEQA 4JE4B 4OLXL 4HIXL 2DMHA 2K45A 4AEFA 1NMBL 2BVEA 3OV6A 2EYRB 3Q1SH 5GZOC 3DSNA 2FUTA 2IVFC 1FFNB 5IVOA 4E9RA 1MHEB 2ZCHL 3IN2A 4J39A 1INQB 3AXLB 2CO2A 5E6SB 3QZPA 2OTWB 3TBWB 4HXBH 4J5VA 4NB7A 5CHNA 2FEDD 4A2LA 4HEME 1KT2B 1LE9A 4WDIB 3V95A 1A6VH 2BCKB 4LIQL 1IRAY 1SEQL 2D4DA 3IRCA 4L3CA 2AW2A 2EIJB 5HD8D 1FO0L 1LDSA 4XVJH 4X7SH 3J07A 4TTDD 4MVBC 5KS9B 1X5XA 3EJRA 2DKSA 1YNTB 2KQMA 3CUPB 3CSGA 3QFJB 1QR1B 2IGTA 1ES0B 3EFFB 1NANH 3QDGD 1WC7A 4F1SA 2PYED 1OTTD 2HFEB 3FMGH 1DE4A 4YC2C 3L16A 3WL9A 1BVKA 4N5EC 3A24A 3QORC 4JZNA 1HXMA 1MAMH 1FL6B 2A74A 4K07A 5EO1A 4FXLA 4HZAA 3DVNB 3HE7D 1YUKB 3QA3A 2CWRA 2HCZX 3IGUA 4Y4FC 5AW2B 1OT1A 1I3RB 3F12A 2EECA 2IOOA 1HH9B 1JGLL 2NW3B 2IPTL 3L2NA 4DN4H 4PB0L 2WVSA 3RYMA 3QR1A 4FN0A 2QKIC 4YSUA 1FO0H 2ZUXA 3DJSA 3IPBA 4NNYA 3CXHJ 5ID0B 1M9SA 1FJ1A 4WKXA 3PL6D 3DX6A 1K2DB 3DRQB 4Y4HD 3NCMA 3I9AA 4X5LA 4UQIM 4Z23A 2EDMA 4ETYA 4WAFA 1ID5I 3KBEA 4HJTA 4S1DD 2DQGH 3ZKND 3P11H 1I53A 4MAUL 4RIRB 4YE0A 4V33A 2L7UA 5I73B 4AGQA 4NGHL 1FRGL 2FJGB 3IJYB 4FNUA 5D5ME 1KCVH 1T6WA 1SYSB 4P3CH 1A14H 2VSMB 2ZXBA 4CNIB 3BHBB 1JUFB 2ARJB 4GBXC 2JKSA 1F6FB 2IWGA 5AKSA 2Z35A 4ZD3L 4XMVA 7FABL 2O26U 1VGEH 2D9CA 2VQ4A 2HA1A 3R06B 4U1GC 2LW3A 3SE4C 4XP1H 5AB9A 3MNVA 1ORSB 5F7FA 2WB1A 5D6DA 1YEGH 3FQ2A 5DYOB 3SDAB 2V5SA 5FWRA 3VH8A 1U93B 5DMGD 3QHTC 4G8IA 2MOQA 1QBAA 4WHTB 4KPHL 1X4YA 5A2KH 2VC2H 4GG6A 3NEEA 4MS6A 2XTSA 1JP5A 5FYKL 1E6OH 4OD3H 4XMKH 15C8L 2W07A 3VTTA 4ZD3H 4JG1H 1ZHBB 2P7TA 2F53D 4NT6A 3O41B 3AXHA 2R4SH 5CP3A 1D5ZA 1GGIL 5K5YA 1N8ZA 3L8QA 2P26A 4ZXBA 2EVHA 4U1GB 5TE4H 3KWTA 1MCIA 3K72A 5SX5K 4M5SA 3OZKA 4OJCA 1DBAH 4O02A 3DXAE 1K3IA 4HPYH 2DIJA 5BW7A 5F8RC 2RGSA 3CPLA 4W4OC 4GSRA 3RTLA 3QG6B 1I8KB 5ANME 3SDCB 1NGQH 2ZWZA 5IHBA 3DTUB 4AT6A 3F7LA 1LMKA 4AQ1B 1O9VA 4QWWC 2VLLB 4TN9A 2OJEA 2N59A 2XY1A 1E43A 1Z32X 2XFXA 4DWHA 1GIGH 3UZQB 3E9UA 1TJIL 1CVSC 4H88H 4A37A 1WS8A 1XWVA 4LP8A 4ZMQA 1U58A 2FEEI 4NM8H 3WFCL 2ED9A 3OZLA 5DC4B 3GMMB 5TDPB 3FTYA 5KYUA 3IDNB 4UDTB 1MFVA 3NIDE 4HFWB 5E8DL 3IN0A 5M94B 3VAEA 4W9EC 1BZ8A 4YSPA 4PHXA 3G6JB 3KLAA 3U36B 5IEHA 5D1QC 3JV5A 1RP9A 4KUZH 2FR4B 4DN3H 2NQCA 4C4KT 4QXGH 1JV5B 2NY6D 3IMWA 4PFEA 4A1RA 1T6BX 3NDYE 4JRXB 1ZTXE 4GQ9H 3VWJC 2G4GA 2AK4D 5DD6A 2HG0A 1FUNA 1IQDB 2ITDA 2J5WA 2ADIA 3H1ZA 4I88A 3QHFL 5CO1A 3P4OB 1S7UB 1MAJA 2DDQH 2YHGA 3JTBA 3T4AB 1YQVL 4TSAL 1T04B 2DMKA 2OXHA 4L3FA 4PJFA 3KPSB 3S37X 1C16B 1TTCA 5IHWA 3QWQB 4A7SA 3DARA 3CSBA 3IBEA 2Q87A 4XH2B 5JOFA 5C0AA 3KJ6L 4DK5A 4G8FA 1D6EB 2J1ZA 2P80A 2K1MA 3IF1B 4G42A 4UT9A 5JW5B 3G5ZA 1ES0A 3EFFA 1GC1C 4NXKA 3SE9L 2AAVA 5IVXA 1CF8L 4AJVA 3P0GB 3MNZB 5C0BD 5EU7E 3KZ8A 4GOSA 3UPCA 5CJOH 3II1A 3OAYH 3W2DH 1DE4B 3OC5A 3ZUNC 4QKTA 4DEUA 2IGLA 1KXVC 4PUBH 3QUYB 3FONB 1MKFA 3TESA 5I6OA 2NX5A 1DUYA 1OF2A 1YEFH 4X8CA 5D1ZB 4ELKA 4GXFA 5FGBA 3NSCA 4KO7A 5AWNH 1KLUB 1NBVL 4W9HC 5HDQL 1J9CT 1OGAD 1KIPA 4NS0A 3WKMH 3WO4C 4B7LA 5TH2B 1U92A 1V55B 3OC8A 4IBSA 4M5ZH 3AXIA 2ZF9A 1CIUA 4HX1B 5HHOA 1FI8C 5AW9B 2GY7B 5ADPL 2CO6B 2APSA 4JS7A 5GHWL 3GBML 1HHKB 4NNYB 3BZFA 5ID0A 3CCHA 1U8HA 4K55A 4BWUA 4C57C 5INDA 5F71A 2P9RA 4GKNA 5HGDB 3KPNB 2GIYA 1YY8B 1NCAH 3RTQA 1N10A 3NEXA 2LE9A 4G1MA 4PRPE 1UHVA 5J1AA 1F8TL 1YJDH 5I24A 1BFVL 32C2B 1KV7A 1X5LA 4X99B 1ZLWH 1QASA 4JFYB 2QMJA 4MXQC 3AQZA 2UWEB 1TETH 4IW4C 3UG5A 1JUFA 2ARJA 4QHMA 4JO2L 2V2XA 5E6RB 4HLEA 5J06A 4YR6A 4HWBL 2Z9TA 5JHDD 4NSKB 3VXQB 5I74C 3DA0A 4KXAA 5FLUA 4IBUA 3MFFB 2YAEA 2JJVA 2CUHA 2LGNA 2FIKA 4WTXA 5C07A 4DF9A 4YX2H 3TO4A 1ZTXL 1UCBH 2B77A 1DQQA 4CVXA 4QRTB 5LVEA 4NNXB 2FHBA 5JW3H 2VWEE 1QHPA 3K6IA 2VERA 2D7TL 2HJLA 3GBEA 4OLEA 4EUPB 1DLFH 2YD8A 5L4FA 2CE6A 1BFSA 3EO0A 3EGSA 5I6NA 4CJ1A 5TFSH 3SOBH 4W1TA 3U2IA 5CZVH 3O41A 4LDCA 4ANVA 5GS0L 5F1NB 2G2RA 2HVKA 3IDIB 4M1GH 3PDOB 3HUJE 4ALAL 2GTWB 3PL6B 2FO4A 3B2VL 1S3KH 2CU9A 4FNLL 1HZKA 3X13A 1P2CB 3GMNA 1BM3L 1LILA 2VDMB 4NQQA 2DQIL 5D6CB 5DRZB 4EUPH 4UT7L 4WTZA 4J3SA 4JK0D 4BFIA 3BN3B 4KK5C 3B2XA 1OE3A 3QDAA 1KGXA 4LL9A 4O00A 5DD1L 2WKOF 3ZL1A 2AV7B 2PR4L 2CLRB 4NN6B 4GO6B 4G8GD 1JAEA 2Z92B 2AV1B 1CXKA 5AW7B 2MIZA 5E4EC 1T7XA 2XFXB 4WNQA 2OR8A 1ZJAA 2OCJA 3T04D 4MD0A 1KUMA 4RX4D 4IK6A 3UZQA 4LLDA 1XR8A 4LPWA 3VNYA 4NJAL 3Q3GA 3LMJH 1QKZL 1JPGB 3WKPA 5CU9A 2QHLA 4ZTPH 2BVOA 1BQHB 4NC1E 3TA3D 2QGBA 1RMFH 1EXGA 4IKKA 5EF3A 2CD0A 4NBXB 3T08A 1HHIA 1UATA 4OCWL 1UFUA 3DI3B 5C09A 1PZSA 4NQEB 5DRNA 2NY4C 3JUZA 2IAND 2HPOA 4K15A 1K4CA 2X42A 2JKLA 3UBXG 1HX0A 2NZ9D 4HVBA 1I4FB 1XR9B 2P8PA 2R0ZH 25C8H 2CRZA 3UBXI 2Z1PA 3BSZA 1Y0LA 3BWAB 1QTYT 3KPLA 5KSBA 4JKKA 1IE5A 3GDBA 5FOBB 1UT9A 1CGUA 5HHQA 2ZX9A 3SGDH 4X6BA 5DD6B 4DUVA 1PNDA 3B7TA 2EE9A 4Z7VA 2DYRB 3U0PB 4QGYA 4BCXA 4OV5B 4AV4A 1LDPL 4W6YB 1R34A 3OKMA 4CBZA 1AHWA 4FNQA 5GRYA 2EVIA 5CBEB 3WNNA 2FQDA 3G04A 1AP2A 1DEEB 3VX0A 3JV6A 5EU3B 3EJCA 1T4KA 3L4UA 4K9JA 3K0WA 3BUDA 3FPXA 3EGDA 4ODTH 1EBPA 2XDHA 3MLVH 3CV5A 4BH7B 1F5WA 5FFLA 2Q2EB 1KCBA 1NZRA 2DWDA 3GI8L 1AZVA 3F01A 3ABKB 4L2YA 3VRJA 1RZJL 1Q94A 3FUEA 4ETQB 4FQ1H 4EPSA 1RIHL 4ZUSB 3G5ZB 5LJYH 3S8WA 1NC4D 1HSAB 1PZ5A 4JHBA 5FYJE 4CNIA 3QZBA 2X1WL 4DAGL 4X4KA 4J1UA 1TZHA 2ENQA 3MRRA 1F11A 1RIHH 3QJTB 1ETB1 4DKAA 2MEJB 1KJMB 1OOWA 2EDFA 3C6SB 1B2WH 1IBFA 2I7OA 3TVMD 1EHKB 3O3DB 4G6FD 5F89A 4E42A 3KJ4B 3WDHA 3PV6B 2Q8AL 4D3CH 1JN6B 4XE0A 3LTVA 2XJKA 2VKWA 1KIPB 1U41A 4O9HH 4TPRH 5ID1A 1IT9L 4OZFG 1MCSA 4XMLH 4YLCA 1H5BC 1WFOA 3KM2A 5DJYB 2BP8A 1WUNT 1UZGA 4KX8A 2HFFB 3HBQA 3BZFB 2E76C 1CGWA 1ZHBA 2P7TB 4N9OB 4PB9L 4X7DC 2YMXH 2BXZA 5HGDA 1N70A 1ZOXA 2F0CA 2ICWI 3CWGA 4YHIA 4D9QE 5I16A 2X4PB 5F1IB 12E8H 2ICES 1GAFH 4G83A 3T0DA 1PLBA 1AGDA 3PJNA 3NCWA 1MJUH 1YYLL 1CFSB 2A4CA 4X0KB 4ZMTA 1B2WL 3FT3A 3C60B 3PHQA 5HYSA 1VFMA 1P7QB 4X8JB 1NEZG 4JKMA 5K9OA 5CN2A 2NZ9C 2Y22A 3DK2A 4IMKA 4BFOA 1G4MA 2IBZY 2XU9A 2Q6WB 4L9DA 1JDAA 1MCBA 3F6IA 3BDYH 2OYMA 2UX6A 4ZFGL 4P2RE 1KNOB 3BPLB 3P9MB 4PJCB 4UTBL 2Z1KA 3AMLA 3S34L 3TA3C 1K5NA 2FLMA 4OM1L 4TNVF 5C07B 4BZ2H 4OKVB 4NZRL 1XZWA 4UOZA 1TQUA 3V0GA 4CVXB 3WSQH 3US0A 4YL9A 5IM7B 2XWDA 5K9QG 1Z5LA 2QJDA 4GKZB 4FKHA 5F7HA 3PAVA 1C8PA 2QHRH 1YPZB 4RVBA 3T8XA 3L5WA 3R7RA 1I9EA 3QQ9C 5GS1C 2ZG1A 4F7CB 4I48B 3APNA 2XX0A 1BLNB 3TONA 5IFHH 4K23L 1UA6L 4A2FA 5J57B 2Y07H 4AGOA 2DLFH 5I1DB 1PLAA 3H9HA 4WFHE 3KHQA 1PJWA 3UAJD 3IJEA 3ZKMC 4AWJC 3FN3A 4KK5D 2QPSA 2YOCA 4BSJA 3V4LA 4IYKA 1H3VA 4DJMA 2YPLE 3T0BA 5GXBB 4L3EB 4Z6AT 3ARBC 5DMIL 2OMTA 3V52L 2A74C 3SDYL 2BWQA 3MLRL 2W81C 1UD6A 5DGRA 3U9UB 4FHKA 1Z9PA 5A43C 4K23H 3VDAA 1KSRA 3I2CH 2AGJH 1G9ML 3ABMB 1UWEH 4CSSA 4A68A 5TF0A 1J1XL 5GS1B 1E9QB 4QIRA 1E2WA 1HH6B 4MJ2A 3GSNH 2Z31A 5ISZA 2WIIA 2Y2YA 3QZNA 4MD0B 5DQ9B 4YEFA 4GAFB 3AUVA 5DZAA 2JQZA 2QQLL 1PZ3A 3I6SA 4BYHA 3TWYA 3HC2A 4XMZA 3F12B 2J8OA 1XH0A 3NCCB 5C6TL 3MR9A 1TVBB 2BSBA 2CIIA 3HC3L 3QRBA 1KGCE 4PJDB 5G5DA 2XQYK 4HUXA 4M6NH 5DRXA 5CSGA 3ZQXA 1E4WL 2RHEA 3T2OA 4HUUA 4K5PA 4WFHD 2ESVE 2BP0B 1Q0XH 3G6DH 4RFEA 2EIEA 4GAJL 1IQWH 3LNDA 3MA7A 4O5LL 1KBGL 1L0QA 1W6WA 3FHAA 4ELMB 5IFJB 3GZOA 1ZT4A 3T77B 5FFOA 4H8VA 4QHUA 4X6BB 1T3FA 4BFJA 4U3SA 5E4IA 3V5DA 5D1XE 3CN3A 2H1XA 2J25A 4ZODA 4R4NC 2ID5A 1X5AA 4XVOA 3WAKA 4Z3EA 3ARVA 4XPBH 2O6CA 1E2ZA 4UNIA 2XIBA 2BM3A 1WTGT 3ZE1B 3TBCA 4UNVA 4ODBD 4I1PA 3OAZH 4GAJH 1ORSA 1VCBC 1RH8A 2D31A 5KN5B 3LEVH 4F2MA 3WAJA 2WNXA 4TUKL 4ZMNA 5INDB 4ANKA 2OX5B 4LCCB 5ICZA 2XCMC 1E9PB 4X98B 5DVKA 5F2FA 4KKPA 4I2XE 1NGWB 1AZCA 3QO0B 3Q43A 5HHVH 5IVZB 3EZJB 3HFML 3PJLA 4WSJA 4UZUA 2G3MA 5KZCB 1EZUA 1H8NA 3QZLA 3VWKC 1ZRUA 1KENH 3HZYB 1S7SA 3GSWB 4YHZH 5E00B 2B3RA 2NY6C 2PTVA 2OYKA 3MRRB 1KTCA 1F11B 4KJWD 1E8WA 5F9OH 3H53A 1J0JA 4BK5C 1FC1A 3NSJA 4QYOA 3LKRA 5K9QI 4Z77B 3TBSB 4I3SH 3K72B 4YXLH 3O9WA 2YC1A 2BJMH 3D18A 3V7AE 4G6AC 2ODIA 3MRLA 1J9RA 1QFWL 2AQNA 5C0RH 5J13B 5DO2C 2AQRA 3Q06A 5ID1B 2ZUQC 5KYXB 4MA1C 3CHQA 1MUJA 4MCMA 4OUUA 2X87A 3P77B 4EN2A 5GGQH 4AT6B 3MJGX 5DEFA 4MDJB 4N2NA 2YPLA 4AQ1A 5DYFA 5EDXA 1R3LB 2H3NA 1KFAL 3CN1A 3ES6B 3TYFA 1NFKA 3SQOL 1L9OA 5CJQL 5I8CA 2HKFH 2F7OA 4ZFFB 4PBXA 1SUHA 3U1PA 1S7TB 2HKHL 3TIEA 2EXYD 1ROWA 4MZIA 1HXKA 5IB1A 4MBOA 3WLBB 2YAFA 1TZIB 2ZX8A 3UTPD 4OCXL 2CBMA 1ZVHA 3UJIH 4NQCD 3CFBA 3PGFL 4FMVA 3E6HB 3UTQA 4ZUVA 1WCQA 1CLYH 2YXVA 2YUVA 1GCFA 1ET5A 4D8OA 2HP4A 2FR4A 4G71B 3J8F7 4I1RA 1PLCA 1CLYL 4OSUH 4GXUM 2VMDA 3FQ4A 1CPUA 1BPLB 1SQ2N 5KYWB 1F3DH 5EZIL 3BEVA 2QV4A 4L8CB 4GW1B 2P46B 5EF2A 1AKPA 4Y9FA 3WIFA 2O5XH 5AVRB 5IMLA 4XMKL 3FFCA 3I02B 3DYPA 2FLRT 2B8OT 4L8BA 5F0JB 4G43B 4EXPX 2HX7A 2J3SA 5GS2D 4UM9A 4I77L 3KLDA 3N42B 4BA0A 5D7KE 2O4EA 3P2TA 5I1DA 1K4CB 1WBZA 2E5EA 1QNIA 3B34A 1IEBB 1BW8A 4IRZH 3RHWF 5C0AB 4A2HA 4WWKB 4GBXD 3DIFA 4HPOL 1Y0LB 3KPLB 4HSAC 4WUUB 3ZY7A 1D5RA 1PX4A 2AS5M 4IRZL 3I50H 5D7IE 4I3GA 4TMPA 2WSKA 3CZKA 5ITBL 4Z7VB 2VL5B 2RTTA 5I26A 4Z7WB 3U0PA 4OV5A 2FZ3A 4UUJA 3GS4A 4JFEE 1GYVA 4LGPB 1JF6A 1AAJA 1KXVA 4XVSL 4HUVB 4UAOC 4KGJA 3LQZB 4KVPA 4LMQI 3RA7H 4KK6C 5DQ9A 1FFQA 1RIUL 1T0NB 1HZLA 2EDHA 1BSIA 3X1NA 2R29H 1D2OA 4LT7A 2R0WH 2WWMC 4KHXL 1RJLA 3T0WA 3OKEA 1A65A 2GJ6E 1T03H 3PXJA 3UXFA 5CEZL 2E7HA 4FTVE 5MEPB 2CO6A 3OKOA 3QUMH 1ZK5A 3JWNG 1TQSA 5LBVA 5C0IB 5CJBA 5FAAA 4DPRA 1CLOL 3VFPB 3NDZE 1KBWA 1R3HA 4GW5A 1N4XH 5DVOA 1TQCB 3F8UB 4A6YB 4GKNB 2YBRB 4OQTH 1BZQK 3UJJL 4PVLA 2W5PA 2C7UB 5I0WA 4UIKL 1NLDH 1NBZB 3HJEA 1RPQA 1L6PA 4FQHA 4LCYA 4Q4EA 5EU7C 2ZNXA 1M57B 1QVOB 2OMZB 1G7PA 1JN6A 2WSPA 3FUNA 3KE0A 5AL0A 2WVUA 5MENE 4GAAA 4MZ3A 4XOCA 1U8KA 4HK0B 3U48A 3ME0A 1IZJA 3IFLH 2W38A 1IKFH 3ECUA 3N50A 3PHOA 4KRPD 4LQ1A 4CMHB 3PS6A 5FHBL 4KVCH 4FTVD 2JK5B 4XN4A 1OM9A 1OTSD 4KKRA 3TFKD 3LHAA 5EORL 1YJDC 4FQPA 5GS0C 2OX5A 2Z0BA 4LCCA 3JVFC 2OTUA 5ICZB 3QEQB 3K4AA 2YK1L 3MNWA 5I16B 2BNRE 1RKRA 4OZFB 3LRLA 4LPTA 1RZIA 1SY6H 5EEYA 2B4CC 4EUPA 2CO4A 3OKKA 5E9DE 3KNBA 2PKDA 3MDJA 4XWOC 3VXSD 4PV9B 4H0GA 1L7IL 4FKEA 4LARL 3TO4C 5CR1A 3AAZA 2YMOA 3ECBB 3FRPB 2ZUTA 1KTDB 1EEUA 2VMJA 3M8OL 1HWWA 4XBPA 2O1AA 1NAKL 3ESOA 4FS0A 2XOTA 3VXPB 3LIUA 1M6UA 1P2CA 4QTHB 1W9XA 2QR0B 2WKGA 4PJAA 4LASL 5DRZA 1G7IA 5AAWA 3L45A 1FE8L 3M8OH 2BXYA 2IQAA 2X9YA 3CLWA 4NPYB 2BNQA 4X7FC 3NCJL 3UJTH 5IW6A 3KPSE 4OUUB 1C5CL 4MKTA 5IM7A 3BKCH 1JTOA 1BEYL 2V9UA 3JWOC 3SBQA 2NUPB 2Z92A 4NHCL 3OMIB 4P48A 2NSMA 5AAMA 3IU4L 3TX4A 2VDLB 1KG0B 1EVUA 1GTNA 5L6YL 1THAA 3GQFA 5I8CB 2FATH 1A4BA 2PWDA 4BXVA 4JO5A 2OYLA 2QDVA 1Z9LA 3RJDA 4G6MH 4OFIA 5KSBE 4LEBA 2XETA 2BVOB 3D30A 3O6KL 1CUOA 5GZOD 5JXAL 4LSQL 4JG9A 1HHJB 3CH8A 3DSFL 3ARFD 1RI8A 4RGNC 3U1SL 4ODUB 3CFBB 1KN2L 1KJ2H 1AIZA 3PQYA 1YUHA 3DIDA 2AXHA 3RVXD 1XEDA 3OHXB 1G0XA 4OD2A 4Y5VA 1WWBX 4HISA 3ZZSA 1XR9A 3S4SB 1OWWA 1RUMH 4LNRA 2QFPA 5AOIA 3CXHK 3QIBD 1XVSA 3WN5B 5FO8A 3TURA 2E0PA 1AVAA 3ISWA 3U6XS 3KLHD 2RB8A 1N2RB 1P84J 3C5SA 4P46B 3L3GA 1BVNP 1C12B 1ZA6B 3KYNB 1AHWB 4MYWB 1MWOA 3O3BA 4N85A 4TLUA 3UBXA 4M6OL 1KN4L 1ERNA 4IBLT 3F7VB 4POZC 3SKJH 4E41D 5ESQA 1FO0A 2VIRB 4AK2A 4RMTA 4ALAH 3IFOA 1YG9A 2IDFA 1DVXA 4Y8AA 3IYLW 1XGTA 3LDBB 4F7EA 5L88H 1NWOA 4RFEB 4M7LH 1E5UI 4XBGB 2VM3A 2HT3D 3ZK0A 1QSZA 3D1MC 4QTFA 1PVHA 1QX1A 5DZJA 2WGNB 2WXQA 4DOHE 5FO7B 3SDXF 5A6MA 4EIUA 1Y1UA 3WXVL 3S35X 3K46A 3QG7L 3U7WH 1TQBC 2OMYA 1K8IB 4P5MB 1MFUA 1PCXA 4TQHA 3PJSA 4OD1H 1I1AD 4QHLA 3ZL4L 1IBYA 1UVQB 4R4FL 3VYPA 1IGJA 5E8PB 1O5PA 1IM3A 4F8LA 3NK4A 4PJ7F 3ZT7A 3WEMA 1TF4A 2D2CC 3AS1A 1RURH 5F89B 5IT2H 3G5WA 5C0FB 4MZRA 4F2MB 4RAHA 3CXFA 3LXAA 4URKA 3GKWL 3K2KA 4M6ML 3VFNB 2WVVB 3EFDH 1DQML 1GGBH 1U8CB 4H4NA 5SWZA 4UTCA 5HI3C 2YD1A 3CFJB 3PAZA 1ZT1B 4OCRH 3UC2A 5MEPA 3GKZA 4NQXA 1QQDA 1SDDB 2IV8A 4AEHL 3VMPA 5FOJA 2K9UA 4B9IA 1NA8A 5B8CB 4JFQB 3N42F 4AVHA 2ED7A 3BUTA 4MDRA 2AXWA 3GMPB 1ZAGA 5D7JA 3NPSB 5AOMA 4PJGF 3OKYA 2F5AL 3UTZB 3V0FA 4IBQA 1CFSA 4JM2D 3B83A 5J9PA 1DQMH 1SYVA 4FL4B 3CDGB 4PWIA 2AJVL 3BO8B 4DVRL 1MHHB 3QWNA 1KXTB 4Z7OB 3ESVF 1DJGA 1JZGA 4JKNA 4XNBA 5C08B 3T6WA 4PJCA 5JPMA 2ERJC 4J3BA 1UD8A 3OPZL 2VMEA 3ES6A 4FP8H 4RGOL 3W57A 3OF6D 3CLEH 5JR1L 1YPZA 4KHTH 5H94B 2VDKH 2I25N 3L5WB 4YPJA 3JVGA 1YEDB 2BFVH 3EO1A 2JELL 4QJ4B 4S0TD 5JOPD 4NZRH 3RL2A 3ECBA 2P8LB 1B4JL 2VXSH 2X4RB 3KPMA 4FJ6A 3I84A 4ZDHA 3QUZB 4HC1H 2J4WH 3ECQA 4XP4H 3QQ4B 4I1NB 4BFFA 3FRPG 4ONFL 2XKSA 2HMID 5IW6B 1CD9B 2K3HA 1WWAX 2APFA 4XB3A 4DK3A 1XEUA 4P4RA 2ZP0T 5DJZB 3WIFB 5AZ2H 3E3QE 4X5WA 5I8OL 4PRPB 3OZ9L 3ULSB 5JUEL 1X6LA 5IK3B 2IALA 1KT2A 3KR3H 1LE9B 2IDSA 1PFCA 2H4EA 1UWGH 3AG2B 1T1XB 1ONQA 4JG0L 4G7VL 1FAIH 1WBZB 3V0AC 5HHOD 4R5XA 2P47B 1JZ8A 2OMUB 2IMNA 2V3DA 2HFGH 3FQRB 1U42A 4MQ7A 4RA3A 3UMNA 5JXEA 4XPTH 4H8HA 5KVFL 1J05A 1JCKA 1JD9A 1QR1A 3HKZA 1H9DA 1GS6X 3N1GC 1PIFA 3PQYB 3D25A 1YUHB 2MKLC 3ZDWA 3UL4A 3EYSL 4AIOA 1SBSH 1P4UA 2FZ3B 4OBSA 2Y7OA 1M2OA 1BVKB 4FYTA 4KAQL 1CTMA 2IQ9H 3GBDA 1BZ9A 5FYJH 4NZUL 2XNAA 3T77A 1DQVA 3BAYA 1I3VA 2AFNA 4IU3B 3UTSD 5KVFH 3BRGC 2ZJSL 3LIZL 1QW8A 3FUKA 1FG2B 1ZV5A 5IEKA 1AXTH 3BAEH 3SDCD 3FDWA 2V8MA 5T1KA 3UYPA 3V4PA 3CH1B 1FO0B 2VIRA 4NI3A 1C9SA 2QLVB 2A0LC 4J3XA 3ULUE 3JTTA 2XWCA 2OV0A 1R3HB 2FB4H 4GW5B 4N2KA 4WO0A 2QSCH 4XBGA 4DQAA 4BFGA 3S98A 3RVUC 1AG6A 2DIAA 4OFKA 1IAIL 5F1KC 4RIRA 3RX9A 1KFGA 4PCSA 5I1GH 4DKEH 2PPFA 4E9VA 3O9WC 5T3XD 5L0QB 1G7PB 5FXCH 2FAUA 1PF3A 3CAFA 4XPFL 3NQIA 5I1JL 1NCGA 1UVQA 4KKQA 1W8NA 3OR7B 3P3RA 4AQEB 4HJJL 5KBLA 5DD3L 5E4OA 4PIBA 1W6LA 2KL6A 4PW3A 3ZR6A 3NFSH 2YJQA 1T0MA 1RVFH 3VD3A 3PLYA 4JPVH 5HGAB 1CF1A 4WRLA 1Y6NR 3DVIA 4MGXA 1RK7A 1U6AH 4PG9A 3VFNA 4DEPC 1MUJB 3BIAX 2VDNH 2EO7A 4ZMPA 3TLRA 3CVIH 1KCKA 2P48B 4Q7DA 1L6XA 5ERWB 4NQXB 2YPLB 3ILQD 5A1AA 1CC3A 3EH3B 1GJIA 1CBVL 5JMOC 1EBAA 3MCKA 4PJ8A 4TUKH 5B8CA 1HEZA 2YJLA 4K7FA 5CN1A 5DMJB 2IH3A 4KNQA 1D5ZB 3FSOA 3US9A 3CHXA 2KYIA 2JQAA 4QRPE 4HXBL 4KDTA 5D7LD 5IB1B 2FWSA 1VFOA 3K6FA 4HEMA 1UB5A 5DZLA 5E8NA 1UZ8B 5AZEL 1G7IB 4KROB 3S2AA 5EO0A 4DSYA 1AZRA 2CHDA 3SPHA 1VKXB 2BNQB 3G08B 2DTMH 1KXTA 2IG2L 3RURA 5EOTA 1B9ZA 3CHSA 3T1FB 4ZUVB 2EVFA 2Q3AA 1AZNA 3GMRB 2APVA 3QG6A 3SDCA 1N9PA 3HPLB 5EWIH 2YAPA 5C0GA 5D2NA 1JK9A 2KQNA 3EJPA 5EIQA 2WNKA 3O2DL 4EN3C 3HJ0A 2VLLA 4RBPH 3D87B 4N6RA 5I66B 1Q0XL 2X4SB 2J57A 3G6DL 4NUQA 5HYQB 2VLKB 2AXFA 4U1JA 4Z3JA 4TTGA 3W9EB 4LL4A 3VI3E 1G7HB 1QI3A 4Z7OF 3ULVF 3EF7A 3TPUA 2BK8A 3I9GH 4HWNA 5FGBC 5AAPA 5C0DB 7FABH 1GOGA 5F7AA 2B0SH 2WVTA 5E24E 4PD4J 4ODUA 4ZO7A 1ZANH 2Q5BA 2KPWA 3T2QA 2EDOA 1YNKL 2WQVA 1KLGB 2IANA 4QOKB 4U7KA 4CMMB 2E27L 5KW9H 5D1XB 1CE1L 4AYFB 4NAMA 3U36A 1TPXC 3E7JA 2HYMA 3MLXL 1HZHH 2LVCA 1TJIH 4JDTL 5LO7A 5M95B 1NM9A 5KBMA 4TSCH 3FFDB 3WY2A 3P4LA 5LN4A 1HYRC 4GQQA 5JDSB 2YGQA 5A16A 5FF6A 4JG1L 4LSPL 4YHOH 3H6AA 1A6TA 5KSAD 1F4XH 4PP1D 3FQUA 4JL1A 5F7EH 5JHDA 5D7HA 3IWVA 3FH5A 2YS4A 3N06B 4X4YA 1NCDH 3Q01A 5FA4A 4OAWA 2YXMA 1CE1H 5A2LH 3UFIA 2ZXAA 4FQIH 4OH2A 4YHZL 1LWHA 3KPTA 2NXYD 3UBGA 3OJDA 4Y2DA 3Q8BA 1GMIA 3TTYA 1FH2A 2NQDA 3LVTA 2XUWA 2XWTA 1PY4A 1DQKA 1RJLB 5TE7H 3VRLF 4YXLL 4YDJB 1TPXB 2FHCA 1AIFB 4OCSH 1GGIH 4ZSOE 3BC9A 3FQNB 2WO4A 1D7DA 5C07E 3BZ5A 1YRKA 2WQSA 3OKOB 2PYEE 5EEUA 3D25B 4WWPA 3LZNA 2GJ6D 4X0NA 4WJ5B 5J6HB 1HKFA 4JHAL 3ZR5A 2EICA 2H32H 2WKOA 4M93C 4EI5D 1KACB 3E2HB 2EEBA 3NA4A 5E9DD 4J27A 1DZBA 2VR3A 3KBFA 3AABA 3QUYA 4MASA 1MI5E 3FH7A 3MODH 1CICB 1IJNA 4X9FA 1QSED 4KY2A 3FTXA 4NKIL 4P9MH 1QBLH 1QRKA 1T83A 5DQDH 3UGUA 4I0PA 4DPBX 2APWA 1TNMA 3SJVD 3SCMB 1I7RA 3HBZA 2VYRE 3I6LD 2HFTA 3X11B 3B3IA 4N2BA 3AY4A 5GIRB 5HHOB 2F1EA 3CH1A 3GO1L 3MV11 3R19A 3DV4B 1HQRA 4XI5C 2AKRA 1DQJA 1SDDA 1UWFA 3KEDA 5E2VL 3S3BB 1BQHG 2C3HA 4LSUH 2AI0H 1O7DE 1DBAL 3RI5K 3T3MB 4NYLB 3QWRA 3K6OA 4OF7A 3DDGA 2IH8A 1NCHA 3KPOA 3RTQB 4EN3D 2AJSH 4XZUB 1CICC 2CBQA 4CC1A 5BMFH 1JF1B 3ARWA 4J3OD 1RUKH 3PWVA 4PS4H 3CDGA 5EZIH 4LSDA 3B9KD 1J8HB 4CSTA 1MHHA 1OB1B 4WFFD 3GO1H 3AVEA 4TQPA 1E4XI 5BMFL 1OCWL 3GGWA 1J5OH 3A47A 3SDAD 4BGDA 2X70B 3CLFH 2FYYA 3QWOA 2WBJD 5PAZA 1ZE3C 1ANUA 1R33A 1SDYA 4MD5B 4KFMA 1A8ZA 3VSQA 2R29L 3JWNE 1P4IH 1JZHA 5B3NA 1RJYA 1L7IH 3AB0C 3STLB 1KZQA 1B2YA 4FMFA 1H6FA 4PG9B 2AQTA 5EIVA 1HWGB 1MIEH 1AY1H 5HHMB 3A67L 1BM7A 3OVUB 1WCBB 4ZZKA 4F92B 1VESA 2Y7QB 4HPOH 4PWHA 4R5TA 3B2PA 5E6YA 3DX7B 3VFOA 4DQOL 3UERA 3VFGL 2NUPA 4JO2H 1IVLA 3L5XH 3G6AA 4H20H 2ATKA 43C9B 1JYVA 2H2PC 4GLRH 3RWEA 4JY4A 4K7FB 1ZGLM 1VZGA 1RUKL 5ACZA 4Q56A 1Z9NA 1MJJB 1WE5A 1LP9B 5IHLB 3MRIA 4JPSA 4CMHC 3KL0A 2DV6A 2EYTB 1UB5B 2OM5A 3LH9A 2BNRA 3O8XB 2V3FA 1G1KA 4S2SA 3RBGA 3ZTEA 3QQ4A 1GRWA 2F8OA 5AOZA 4CUCA 4WFFE 3OKDA 5F1OB 2WUBH 4E9YA 4E9SA 5CJ5A 5LQBL 4ZX5A 4WI2A 2PW2A 3HE7C 2ZP9A 3ZL2A 1S9VA 4IKJA 2AV7A 4RRPA 4S1RH 3WIIH 3BN9C 1J88A 1LNUA 2C1OA 4FFWC 1EH9A 4W9FC 1BMWA 2AV1A 3DPBB 4ESKA 1MDTA 5GGRA 4JFOA 3LN9A 5HGBA 2VLKA 3JWNC 5ANHA 1E40A 5CIPA 3WE6B 2A0LD 4JDZA 4NKOB 4PAZA 3D0VA 1XXFC 1ZA6A 1NCNA 2VWEC 2E6QA 2QPEB 1OW0C 3C75A 4TTDC 2WNWA 2YZ1A 3W2DL 3QSKB 2XWBB 2DZEA 4C56E 4CMMA 5KAQF 3TCLB 1VLXA 4APXA 2XTJE 1WISA 4X9YA 1P4LB 1KGIA 3SPJA 1B6DA 1A47A 3K8KA 4HF5L 1NDGB 4LOVA 3RY6A 1DBMH 1RHHB 4PLOB 3O45B 1KYAA 8CGTA 1AI1H 4HJGB 3OMAB 4OQ1A 2HWZL 3FC8A 4U2YA 4K8RD 5D5MF 3ZT6A 4YBQC 4L4VA 2BNUB 3EYOA 4Q9QL 5JDSA 4PD4K 1OP3K 3BVWA 5K1NA 1AGEB 1ED3B 3ESMA 3MNDA 1T1ZA 4R90L 1JNHA 2X2IA 3P30H 3TZVB 4KV5E 4F8NA 1WAAE 1CDHA 1AP2B 5HDOA 3VFTB 2Z8VC 3O6LL 3B7SA 1H19A 3DNKA 2NTSP 4V2CB 5T1KB 3UYPB 1A7OH 3FFOA 1XGPA 2ORBL 1C5BH 1FAKT 5BRZA 2CDGB 4F24A 5D7KD 3RDTC 4G2AA 3FCSA 4PRNB 4IGBC 1R5VB 5JPNC 4X8GA 1V05A 5BQ7B 4XPGL 2FWOB 3W9DB 4JPIA 1SHMA 2PR4H 3KG5A 4ETQA 4LPUA 2CA4A 1LXMA 3UGXA 2FUQA 1N6UA 5IY5B 2ZUSA 3D69A 4IBWA 1AMYA 4KX9A 4QXVA 4D0CB 4GSXA 1W72L 1DJSA 1FV1A 3PWLB 2I85A 2P8MB 5DFAA 5KJRL 3I74A 5E94B 4E9TA 5LNDA 3V5KB 3BGMB 3C2AH 1FDLH 2FATL 4NNPL 1R0AH 5G4OA 3ZDYB 5HGAA 1FNGB 4A6YH 1A7OL 5JIMA 2BSTA 2WC7A 3S8FB 4AC2A 1OGSA 1G84A 4OF8A 4TV3A 1RAMA 5AW0B 1N5AA 5JPMB 3D05A 1WSST 3WHXA 4PG2C 2ZCLH 4BZ1L 4W6WB 3PWUB 4P2OB 2YD0A 2VW6A 3S36X 3UAAA 3F7RA 2YD6A 3HRPA 4RFNB 4AG4H 4MJ6B 1VGKB 3FO0L 1BFTA 1RUML 5EZLA 4FFWD 2ZKHL 4OCRL 4J6RL 3A0OA 5EULV 1JYNA 1DANT 3E38A 5DC2A 3PWNB 5EO0B 3MLWH 4X8JA 4ZFQA 1VFAB 5AWNL 2JVUA 1WAAF 4YUEL 4KV5F 2L8AA 3UG3A 2PCYA 3C2AL 4ODTL 2GJ6B 5IGXL 1UXMA 1NGYA 5DHVB 4K94L 2NR6C 5T3ZH 4L3AA 2BIMA 4RAUA 4AYEC 3SE3C 4ZDHB 1BMZA 4BHUA 4Z8FL 2YKKA 4HJIA 4S1SH 2YEZA 4W70A 4UTAH 4NQTA 3HZ3A 4YDMA 5L4IA 2HRHA 3V79C 1G6RL 4GKZA 3O6FC 5I0ZA 3GBNH 4OJEH 3NJNA 1EEYB 2IAMA 4OF3A 2AF2A 4OZIE 1WT5C 2JE8A 4HKJA 4TUUA 3BP7B 3CVCA 4APQC 2G5BB 3ZE2F 1MJ8H 2J8HA 2EO1A 2K8QA 4FNSA 4L4TE 3MJ7B 2J8UB 5D1XA 1M3IA 4QHNB 5GSRB 3LB6D 4MQ7B 3B9EA 3QEUA 1RUPL 2EYTA 4OIIL 2B15A 4IRSD 3TP4A 3CDZA 2AMUA 2WWKO 5FHAH 2VDOB 5CEYB 2OMTB 3RZCA 3L4WA 3OKDB 2WLHA 3KDPB 2IBBA 4XX5A 4MNQE 1E5CA 2QGEA 4I3RL 2ESVA 2D3JA 5DD0L 3LHPL 4ENZA 4H26B 4XOBA 2VCOA 4MJ4A 2VAAB 3VFSA 5J6SA 4JFHD 3L1OL 3DOIA 5I6LA 2YXWA 4AIZB 1U8NA 3B37A 4UV7L 4HK3N 3IU3A 2XN9E 3BYYA 2A1WL 2VLJD 1AD9B 3ZE1F 3MPCA 5LDSA 3ZYOA 3D39A 1UWXH 4FOMA 3D85D 3BGFB 4K5NA 5AW1B 1BBDH 1KY6A 4JFTA 3BDYL 4ZT1A 1QNZH 4PJDA 5CD5C 1RJZB 2M2DA 5DRXB 1G9MH 1PSKL 3A6BH 1KV3A 4GQRA 2NNRA 5DGQA 3TCLA 4CRPA 5I15H 4YXKH 4F7MB 3WGUB 1OAZH 3LJ3A 2FT6A 1A6AA 2GB2A 4GW4A 1Z9SA 3H9SA 3NMEA 4JPWH 4LO9A 4AQ8A 1MELA 4IOIA 4HIIA 3U0WL 4OZFH 4BIKA 1WRFA 2GT9A 1G7QA 5E0FA 2Y5TA 2YD5A 1XSJA 4RGOH 4DGYH 2AK4B 1RP8A 1XIWA 5DZNA 2DYPA 2XKNB 3WNLA 2XVLA 3EFOA 3QFDA 3ZU8A 4BBWA 4Y16B 3MI6A 1PSKH 3A6BL 1DSFL 2VN4A 4AKPA 5DFTA 1QFWM 2H7WA 1ETZA 4B9GA 3L81A 1S78C 2XZCL 4ZW3A 1DSWA 3MV7D 3VA2C 1GMEA 1PX8A 1DQJB 4ZW7A 4Z7UF 3BLBA 3D9AH 3FN0H 1XCQA 1LWRA 3EW3B 3IDMA 4XPTL 3QO0A 1RZPA 4TM9A 3CHOA 2BZ7A 4XWGH 2N7AA 2ZXEB 2CRYA 1F13A 2OAAA 1LVEA 4UQ9A 2IDTA 4FCHA 4H8PA 5D72H 1WDAA 4P23D 1JGIA 4FEIA 2FWUA 1FYTB 2AEOA 3MOBH 3MBEB 1AGCB 3ARFA 4KAQH 5PCYA 3X1FA 4WSGA 4TVUA 2E4FA 3Q2CA 3GSVB 5TTRA 1FVDB 5SX5H 3POCA 3LKRB 2I9TA 3V5KA 3VXRE 1EAPA 3MOBL 4Y7OC 4R8WH 3D3VD 3EJUA 2R69L 1A1OA 3SDDB 1RCYA 4N0RA 1K8DB 4PJ5A 4V11A 4DOHB 1ZVSB 2ADFH 2PTTB 1UM6L 4HWBA 3FULA 3HPLA 5JQHC 1IBZA 1W0VB 3DHMA 1R3LA 1RZFL 1FIGH 3HZMB 4UV4H 1T89C 2ATKB 3RKDD 43C9A 4J3WA 2XSKA 1CDUA 3MXVH 5EPMA 1DBJL 4N68A 3K81A 4JFPB 4QT5B 4PRBA 3BVNA 1S7TA 3TIEB 3LQMA 2BIHA 2OSLA 4OLUH 2VDKB 3AT9A 3O81A 4UB0L 5HYJB 1KYOJ 4KJPC 3O8XA 4EJ1C 4GLRI 3D2UD 5DS8A 3FSWA 3V7MA 4ANWA 4YFLI 5IESH 4LZKA 4P5TB 5KYYB 3SGDI 1I1CA 3VXSA 1ZXKA 5LNGA 1RXLA 4JEGB 3MV9B 4F80A 4M7KH 5C97A 1MQ8A 2UZIH 1NBQA 3R1GL 5DMKA 1IAKB 4H44C 3K4DA 2NR6A 1AHKA 3D3VE 3IK2A 4PB9H 1E7VA 3ZGIA 2F19L 2QKSA 3CSTA 1JHKL 1I9JH 4JDZB 4NKOA 5DJ2A 3VWJD 5B7MA 5KUKA 1AQKL 5EWIL 1I7TB 2WQAA 3NESA 3CC5B 2Z31C 1P6FA 5CKGA 1FL5A 4OF5A 1UJ3A 2XQ0A 2BRRH 3EJQA 2QBWA 5JOPE 4F15C 3VM7A 3LS4H 2XTJC 4HKZB 2KERA 2WXPA 3VI3F 4APXB 3F3HA 2H32B 3IFPB 3L08A 4N86A 4E9LA 2RIKA 3CHRA 2GITA 1W72A 1F90H 2JMRA 4YDJA 2C9SA 1N6QL 4WCYL 4DHLA 4R7VA 5LDUA 4UTAA 1U6AL 2ZZUT 3HNTH 1NGPH 3OL2A 2FSDA 1T5XB 2F7IA 5LCVH 4Y4FB 2ZICA 2QKIB 15C8H 3IFNL 5JYMA 5DSCB 3NP3A 4HUVA 1TEFA 2P5EE 1PG7X 2FNBA 1ID2A 3W0WE 3FU3A 4XTRD 3VXUD 5LUMA 3GEFA 4PS7A 1AD9A 3JWDC 4MAYA 2CDGA 3UJIL 2PCPA 4Z0BL 4FZEL 1TCMA 2IBGA 3ESNA 3I9GL 3T8MA 5DHYA 4AJYV 1GJUA 5HHXL 2NY0C 2BVPA 3DOHA 2WTOA 4XE5B 5F9OL 1MCNA 2XG4A 2PO6C 5IBLC 1MH5A 4KPHH 5KAQG 5HJBA 2HAZA 1X5JA 1W0YT 1XV8A 1P7QD 4E5XB 2X1OA 1GVIA 4JM2B 4XN7A 4YDKL 2VISB 1KIUB 4NO0D 2QMKA 2F18A 5B1KA 1U3JA 3ATBA 1JZ2A 2A9ML 2DOCA 3NIFB 5AUMA 2IADB 4FA6A 1JPEA 1U91A 2OXGB 4HULB 1ZA3B 1G6RA 1OHQA 2OI9C 2VITA 4R7NB 4DZ8B 2VKXA 5CGMA 3FB5B 2WXJA 5IB4A 4N9GB 4GT7A 4CC0A 1CZ8L 3GINA 3MKGA 1TQWA 1IU1A 2IGFH 4OUOA 1SUJA 4J4PC 5BOJA 1TMCB 1C1EH 5T1JA 1WFTA 3FHQA 1VGKA 4XAKD 4BCYA 2VABB 3ULUF 4OZFA 2AQPA 2VDRH 4M43L 3S3SA 3F84A 1RZGA 2MNUA 1INEL 1TENA 2SEBB 4RWHA 3NFNA 4EIZC 2HLEB 4F8OA 1J5IA 1VDGA 2B1AL 5C0ND 1CU4H 5DO8A 3HC0A 5K59F 4K3JL 4PCYA 4JVPA 1JI2A 4DEWA 2CALA 1M2VB 3FCTA 1CU4L 1EAPB 3K1KC 4PJCE 2C1PB 5FUZL 4PJXF 4Y9BA 4L4VD 1RIUH 3NCXA 2Q86B 3EO9H 3MLUH 4Y4KC 1B0RB 1RK0A 2HRLA 4WO4A 1R3IH 1U8JA 1CYXA 4CW1A 3U4BH 4QXGL 3CLFL 4R7XA 1LNUB 1JZEA 3NACH 1BXVA 3QORD 1OLLA 3SBRA 3RFZA 4ZUUB 4P9HC 5I1IH 5T1DL 4CILA 5TPWL 4HH9A 3DYMA 4S0SD 1VACA 2Y7LA 4GIPD 1TZAA 2YAHA 3GIZH 3MRJA 3PAYA 3RKPA 1UENA 2XQYA 1QYGH 5F7WC 5BNXD 4EZLA 5AEAA 3WUWB 5ALCL 3X2QB 3EO9L 3MLUL 5FKAA 2YK1H 5F6IB 3GIZL 4NUJA 4L3EE 4KOCA 5CEYA 3RZCB 1F41A 4MFHA 5CJOL 1ASPA 3EBAA 3UTTA 4PGBB 3MRFA 3IU4H 4PGCA 4Y5VB 5CEZE 1NDGA 3ZYJA 4N8VG 1V7MH 3F7KA 3O6FD 4LAQH 4XN8A 4ZFOB 2W95A 3O45A 1CDGA 4XB8A 3VGHA 4OLVL 1NAMB 1P53A 2FEDC 2HH0H 3EOAB 4O4YL 3AG1B 4XXCA 1T21B 4IRJC 3T2LA 2B59A 2NR6D 3DX1A 3I3DA 2VQTA 2OTPA 5HDLA 5GHWH 1JNHB 1A4CA 3IGFA 3ATFA 5MENA 2EDBA 3QORB 4B41A 1KB5A 5GGTA 5HI3D 1SXBA 3D51A 4NAJA 1NAKH 1J5DA 2YD9A 4OQTL 3QNYA 3B5GA 5KUMA 4YO0A 1RJZA 1W80A 1N0LA 1U2YA 2Y6SD 4R97C 4K5MA 4HKZA 2FIRT 2O5NA 1RPUA 3QJFA 4LARH 3NEOA 3NIFF 3NJVA 1R5VA 4Y5VC 1P9MC 2Y69B 3QI9B 4Y5YA 2E46A 3MVSA 5BQ7A 4M61A 4NQDD 3TBBA 3JWOL 5A6LA 2COVD 2BDNL 4OBRA 1OV8A 4Z7UA 5C6PB 1SM3H 1OSZB 2R9HD 3GS7A 2APBA 3POHA 5L7XL 1N0XL 2V9RA 4WY7H 3A67H 4EQ2A 3MMEB 1SVBA 3DMMC 2ZAGA 4HHGA 1IAMA 5EORH 5IBTH 1R5WA 1E65A 2V4LA 2H6PB 3OLDA 4ANUA 4OGAC 1ZGLB 4PJ9D 4RDBA 5EU5A 5HPMA 4M48L 3WKML 2XV2A 5BZWA 4U1SB 5E1AB 2J21A 3VG0H 4X42A 5D1QA 3W39B 1IO4C 1Q72H 3SKOB 4PJDF 5K39A 4P9HL 4POZD 2FX7H 3Q8FA 2BSTB 3KGRA 5FM8A 4UTBA 1E7UA 2YD7A 3LZPA 5KJRH 3CVHA 3QQ9D 5E8EB 3UTSA 1U33A 3AREC 3QNZA 1EAOA 4PJHB 3HUJA 4IJ3B 2M1KA 3MRHB 4JFFE 5BVPL 5LQBH 2V2TA 4PJEE 3HBPA 4XBEL 2WP3O 1IC1A 2Z91B 4G5ZH 5HGHA 4LSRL 2Z7YA 3UACA 4XVSH 3GMPA 2B4CH 3HRZC 4XPGH 4BGLA 4F7PA 4EO5A 3ZRCC 2LLGA 3EFDL 2JJUA 3QXDA 1A3QA 3WS6C 3G5XA 4D9RD 1KMGA 3A6OA 1GL4B 1PZUB 2G60L 1K9TA 1F58L 4U6VH 4JFZH 1NMCC 4RSVA 4AG4L 3OSVA 4ERSL 1OD7A 2OXGA 2LR4A 3BVTA 4K7PY 3ARFC 5E1QA 3OXSA 1LGVA 4MJJA 3O6LH 3HVDA 1ZE3H 5IQ9A 5DHVA 2H8PA 5IB2B 5ADOH 5E56A 2V3EA 5IB4B 4N9GA 4PRIB 1GXEA 3RG1C 4MQXC 1FLTX 3IMTA 2QTEA 1MFBH 3WFDL 4U2ZA 3U7WL 1IGCH 4APQA 3RIAK 3MBWB 3D4YA 1XGYH 4P07A 5HHPB 5C0JB 5LNEA 1OTUC 2YPKB 3FTZA 5KVMC 4TNEA 4A7GF 1KCUL 2IAMC 2W91A 2CLVB 2XBDA 3MJ8A 3RTQD 4B6ZA 3LEXA 4PQXA 3L3OB 1M1XA 3DGDA 2H26A 3VFUB 4Y9GA 4PBDA 4OFPA 5DS8B 1NIDA 4UTAL 1FGVH 2I9LA 2BVUA 5EG6C 4N0FA 3RUGB 2CKBL 5I0VA 2HT2C 3EYVB 4X6CF 5CP7B 3Q8CA 2BSED 2D7PA 4JQIL 5HHOE 1T22B 4TUOA 1SJEA 1N5YL 1F4HA 1KTKE 1NCWL 4I0KA 5DMKB 5JPMC 4YSQA 2B1HH 4KZCA 4J8QA 3US1A 3B56A 2CR6A 2K7PA 5DJZA 5DJ2B 1Q9KB 5CINH 3BWZA 4H26A 1JZDC 3MO1B 2VAAA 3VFSB 2Y2WA 3KVPA 3V6FB 2DWYA 2HJKB 4G59C 5I71B 1F1GA 1J8HE 2J2ZB 2AQSA 1CR9H 1FL5B 4JANB 4A39A 4I9WE 5M7QA 1ZPLA 4GXVL 4HH9B 1VCAA 2FBJL 2E9WA 4PR5A 4XNAA 3RGVD 3TEZA 1HESA 1JGDB 3TFKC 4EQ3A 4FKKA 3HG1B 5FB8A 4U1HA 2X6BA 5DDHB 4A63A 3IM1A 5C0AE 1U3HB 1NIFA 2OULB 3CZGA 2JWYA 2QZ5A 3L13A 3CMGA 1RV6X 5CSZB 4P2QE 2UUDH 2OW7A 1VB9A 1G0YR 3MRFB 1OAYL 4FQ2L 3SZ6A 2NNAA 3HI6L 3ABZA 4LLMB 1O6TA 4XX1E 3T3PE 1VJSA 4FABL 2F6AA 1Z9SB 3H9SB 4D9QD 3H7LA 3IEAA 1F4WL 2A6DB 2KMWA 5E9DA 1TTBA 4NBZB 4O02H 1PEZA 1ZCRA 3MRBA 1T21A 2XXCB 4YEEA 4PI2A 2GIMA 4RRPG 4LVHB 3QQXA 4JUSA 1CR9L 4JR9H 1BMGA 1QSFB 4XP4L 3MGOA 2QSQA 3I9PA 4NWTL 3ASOB 4E41B 5D4IA 2WTRB 4ZW5A 3U0WH 5IEKB 2AJYH 4JO3H 5TF1H 1SF5A 1BJ8A 5I5IA 3SBWC 3U1QA 4R5VA 4YUEH 1D5IH 1SGKA 1RQ5A 1A1MB 3ZBMA 5CMAB 1OHZA 3S9DB 3H7BA 4KK6D 4A66A 1QAWA 4BWWA 4PJBE 3IPEA 3ZDZE 4KKBD 4X5RA 5LBSH 4JRYE 5GISL 5AZ2L 2WN3A 5CGBA 3SY0A 2O5YL 1A5FH 1D6VH 1X7SA 2P49B 3NN8B 1K6QH 4RMVA 4FNTA 2YMXL 3BQUC 4U6YB 4ZNEA 3P4MA 4MBRA 5AUMB 5I15L 2FWLB 1TSHA 4G6KL 4LLQB 1FYTA 1A5FL 2VT0A 1AGCA 4JPWL 4P2CG 4JX0A 2DJ4A 3SYOA 4HQQH 4JHZA 4YMPA 5I8OH 4DZ8A 4TPRL 3BZEA 2CZNA 2JIXA 5A2AA 1UB6B 1EMTH 1LWJA 1ZEAL 5DRWA 1S7VB 3ROLA 5JORA 2FRGP 4KTEL 4DKEL 3SDDA 1BBDL 2P42B 3BH9A 4EDWL 1QNZL 1PKQE 2YGOA 2FBRA 4HIXH 2DQUL 3VFVB 4BELD 1IARB 1IM9B 1YLBB 2V0AA 4JJ5A 4LKXB 3S96B 3GXDA 2ATPB 3HHMA 1GCYA 5IMKA 1K6QL 2XA3A 3D39E 3G7TA 2E3VA 5C09D 3A23A 4RWYL 5HGHB 2DWTA 4DK6A 4U3XA 4XNXL 1GSMA 4WZ9A 3V9CA 4NKMA