1E5ZA

Azurin from pseudomonas aeruginosa, reduced form, ph 9.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Rontgenkristallographische Strukturaufklarung Von Azurin Aus Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e5zA00
5PAZA 1NICA 2UX7A 2AANA 3NJJA 3GYRA 5I28A 1JZGA 1ZIBA 2QT6A 2EINB 1TEFA 1NIFA 1XB6A 2BWIA 3QJRB 2YAEA 1SNRA 1A4BA 1KBVA 2XLLA 1PNDA 1V10A 1NTDA 2PCFA 2WO2B 4L0PB 4YVUA 5TK2A 1ZIAA 4HZ1A 5D4HA 2XV3A 3T71A 4QLWA 2HX7A 2P80A 3CVCA 4A2DA 4HAKA 4KO6A 1ET7A 2VM4A 3ZIYA 5I6MA 1SFHA 3IBOA 2HZHA 3ZDWA 1JXDA 1ET8A 3EH4B 1NWPA 1WS7A 1WA1X 3L45A 4KO7A 4W1TA 1JERA 2CCWA 1WA0X 1IKOP 3SBPA 4DPBX 2UX6A 3NSDA 1SHWA 2GC7C 3DKHA 4ZK8A 2FQFA 2B3IA 2GSMB 2IDUA 3CVBA 5I6KA 1SDDB 1ADWA 3WNJA 1I53A 2IWEA 3IN0A 3FSAA 1J9QA 2YXVA 4CSPA 4DPCX 2VW6A 1RKRA 4YL4A 5I6PA 9PCYA 4FA7B 4YSRA 4KOCA 3WKQA 2JKWA 2FT6A 3FPYA 3G5WA 3AG3B 4E9RA 1F56A 4YSDA 1JZEA 2WO3B 2XV0A 3T6VA 5I5MA 1E65A 2VSKB 1NPJA 3FU9A 1BYPA 3N55A 3T6XA 1NZRA 3EF4A 2XUWA 3CDZB 1GY1A 2PPCA 1AS6A 5B1AB 1QLEB 2IWFA 2HX9A 3C75A 4YSOA 1PLAA 5D4JA 1CYWA 1PAZA 3NP4A 3FYEB 4DP2X 3H56A 3NSFA 1PZAA 1GS6X 1OOWA 1W6LA 2DY2A 1JXGA 3AY2A 2CAKA 1L9OA 1AACA 2ZXWB 4X4KA 1QNIA 3NJIA 2EIKB 2BZ7A 1PLCA 1PCSA 4K9JA 1SFDA 3WKPA 3MBWB 4QKTA 2YXWA 3FU7A 2FT8A 2W88A 4DP1X 5PCYA 1BXUA 2UXVA 4UAHA 3NJFA 4DP5X 3BVDB 4M3HA 4A2EA 2E86A 3NJKA 2P80D 4JKNA 1AS7A 4NERA 4GXFA 4Q89A 3DIVA 4G7QB 3NJNA 2PPEA 1XB8A 1J9SA 3FSVA 2R7EA 1JZHA 1J9TA 5AZUA 1J9RA 1E5ZA 3QJUB 3FU8A 2I85A 1L9TA 3T6WA 2GI0A 2Y69B 1RCYA 5D4IA 2J5WA 4E9YA 3V9CA 1JVOA 2IAAC 1X9RA 1ASQA 1TU2A 1FFTB 1MZYA 2PPFA 2N0MA 5I5JA 2XWZA 2TSBA 3OD3A 3UAEA 3GDCA 3X1EA 5A7EA 2HRGA 2YARA 4HCFA 3UAAA 1JZFA 2FQGA 3N2JA 1B3IA 1NIEA 2XVBA 1PZBA 3TBBA 2IDSA 5B1JC 3JTBA 4HCIA 3QJQB 3QJTB 1ETJA 4F7KA 3X1NA 5I6OA 4BK5C 3EHBB 2HX8A 5B7FA 4JHUA 2HXAA 3EH5B 1GS7A 1M56B 2GBAA 4A68A 4FAAB 1SF5A 4G70B 2GIMA 2H5UA 4BWWA 1JVLA 1OCRB 4WTQA 3WG7B 5F7AA 3UACA 1AR1B 2QDVA 5B1JA 3S8GB 2X88A 3FSWA 4A2HA 3ZX1A 4M4RB 5EHFA 2PP8A 1OE3A 2OCCB 1KYAA 2YAMA 4A67A 3S3CB 4P5RA 1SDDA 1V54B 2IDFA 1BXAA 2IH8A 2J56A 1GR7A 4HIPA 2BP0B 5AFAA 5B3SB 2XX0A 4AX3A 2Q5BA 2JXMA 1A65A 1BYOA 2VN3A 3NJLA 1J5CA 3CZUB 2LLNA 4E9QA 2BP8B 1OF0A 1OE2A 2ZOOA 1MDAA 2BHFA 2IH9A 2QPEB 1L9SA 1IBZA 1KV7A 2GB2A 2BW4A 2EIJB 1W8EA 3CDZA 2OJ1A 1TEGA 2J55A 5I26A 1NIAA 5FC9A 3SBRA 3U25A 3CG8A 3OMIB 2CBPA 4KNUA 4YSPA 3FYIB 3QQXA 2WSDA 4WKXA 1NIBA 2FTAA 5B1BB 2BO0A 1AANA 3AG1B 3ERXA 8PAZA 2FJSA 1NWOA 5B7MA 2YAQA 1DZ0A 3NT0A 4GP5B 4GP4B 2ZWNA 4NAJA 4E9VA 4G7SB 2PPDA 2YAFA 3WI9A 1GS8A 2AVFA 2W8CA 1A8ZA 3FQ2A 1NIDA 5AKRA 1FA4A 3PAUA 3ASOB 2HLEB 4E9SA 2YAHA 5I5IA 1M9WA 2CJ3A 4AKPA 4BXSV 4G72B 2QPDB 2VSMB 4W9ZA 5I6NA 1NDTA 4PCYA 3X1GA 1BQKA 1E5YA 2IDTA 4YSTA 3DTUB 4HALA 3TU6A 2BZCA 2IWKA 5B1KA 3AZUA 1WA2X 5B7EA 4YSEA 2H3XC 3ABGA 3X1BA 3NSCA 1PY0A 2BW5A 1BQ5A 1KDIA 2H47C 3H4FA 7PCYA 2FQDA 3QPKA 2MRYA 1AZBA 1L9QA 2DWTA 2Y1AA 3AG2B 1ASPA 1XB3A 3PAZA 1ILUA 1AZNA 1PMYA 3UADA 1E67A 2QDWA 1ZDQA 1GSKA 2Q9OA 1GW0A 1QHQA 3S3BB 3QJSB 1JZJA 1JOIA 1BEXA 1ET5A 2CALA 6PCYA 1JXFA 3D12B 3ASNB 4KO5A 1AS8A 5E9NA 2TSAA 3IE9A 3SBQA 5IY5B 1MG3C 2EILB 1AZRA 4RH4A 1AZUA 3UABA 1X9UA 2CUAA 4HHGA 2RACA 1OE1A 3NJMA 1MZZA 4DP0X 4GY4A 1FWXA 3PLYA 3TASA 1A4CA 4F2FA 3IN2A 2UXGA 3NJGA 4YVNA 1E30A 1W6WA 3ABLB 4P5SA 1ZV2A 4UANA 1URIA 1OV8A 1AG0A 1OCOB 3FSZA 6PAZA 1HFUA 1NPNA 1EZLA 1ZDSA 1XMEB 3PCYA 2DYRB 2GHZA 1YLBB 4BDVB 1RZPA 2UXFA 1RZQA 3EH3B 1ASOA 2BP0A 4TXVB 4KNTA 2AZUA 3NJHA 4CSZA 4PAZA 1CC3A 4ENZA 3GXUB 1AQ8A 1WAEA 1ZPUA 4G71B 2BP8A 1WS8A 3X2QB 4A2GA 1PNCA 2I7OA 3FT0A 3WNIA 1HAUA 4DP8X 2XYBA 1JZIA 1L9RA 4E9TA 2DV6A 3X1FA 1KBWA 3ZBMA 4EF3A 1AG6A 2JFCA 3NP3A 4UF7C 4AZUA 5F7BA 2XV2A 2VMJA 2BWDA 4YSUA 4HHWA 1DYZA 5ANHA 2B08A 1AAJA 4DP9X 1IBYA 3AG4B 5LDUA 4YSSA 2GC4C 3HEIB 3FQ1A 3H4HA 2DYSB 2EIMB 4KNSA 1KCWA 4A2FA 1CUOA 3OQRA 1HAWA 1SF3A 1M57B 2X87A 2NRDA 4Q8BA 1R1CA 1TKWA 3CVDA 3OM3B 2PP9A 1AIZA 2J57A 1AOZA 1GY2A 1N68A 2FNWA 1ILSA 3QJVB 3NYKA 4MFHA 3MX0B 2PPAA 4DP4X 2UXTA 3FPXA 3WIAA 4JHVA 4YSQA 1T5KA 7PAZA 1KGYE 1N70A 4KOBA 4E9WA 3IEAA 2XXFA 3PXLA 3KW7A 4DP7X 1PZCA 1V55B 2VM3A 4N4YB 4NB7A 2HRHA 1BQRA 4AI7A 4YSAA 2ZONA 4N8UA 1KCBA 3HB3B 3BQVA 2I7SA 1GYCA 3ABKB 1MG2C 2PLTA 2PP7A 4BWUA 3TBCA 4A66A 4AKQA 2MTAA 2VW7A 3T6ZA 3FS9A 1J5DA 1KDJA 2AFNA 1EHKB 2YQBA 4KO9A 1IUZA 2XU9A 1BAWA 4GP8B 3KW8A 3S3DB 3NSYA 3ABMB 2YAPA 4DPAX 1VLXA 2DWSA 2A3TA 2FT7A 3FU7B 3PAVA 3S8FB 1AZCA 3RYMA 4DP6X 2IDQA 1L9PA 1SJMA 4G7RB 4GYBA 3T9WA 1SHXA 3AW5A 4YSCA 4BXVA 1IC0A 2FQEA 4AKOA 3UGEA 1ID2A 1UATA 2XX1A 1A3ZA 1BXVA 1A4AA 3JT2A 4HCGA 2AZAA 2PCYA 2VW4A 2R7EB 3FQYA 3SQRA 4BWTA 2XXGA 1PLBA 2YAOA 1CYXA 3TA4D 3V9EA 4BDVA 3PPSA 4F2EA 1OCCB 2FWLB 2OV0A 1CURA 3OMAB 3OMNB 1OCZB 4E9XA 5TK4A 1PF3A 1NINA 5I6LA
chains in the Genus database with same CATH superfamily
4XX1G 5DMJB 4IDLA 4WF7A 4HXBH 1ZLEA 3O0LA 4NQCE 3VFGL 3GYRA 1ORQA 3PNRB 4PV8A 1AI1H 3NCEB 1VFOA 1E50A 2CO6A 3H9ZA 4IBZA 4YQXH 3VH8B 3D69A 1SNRA 4B9JA 2NT1A 3GMMA 5IJCC 4N90E 3EJYC 2VMEA 1JGLH 2XLLA 4PP1D 5DWUL 3MGTA 1G9HA 4XH2A 1DHKA 5D5MA 3RKDD 2Z7UA 1JNLL 3AS0A 3FMGL 4UT9L 1WPCA 2DQEH 4K5OA 2BXZA 4QRPD 4XP5H 4ACTA 1CLVA 3QIBB 4A39A 1FO0A 1N3NB 1USQA 3IDXH 4EDWL 3PS6A 2XNAA 3DGGB 4C83B 1T80A 2BVTA 3GZPA 3S34H 2UUDK 3EYUH 4PCTA 1YDPA 2X42A 3B8SA 4OIIH 1TMQA 2K9FB 3QUXD 4LCUA 2Q6WB 4I3GA 2VDRL 1E6JL 3VD9A 5AW0B 1CT8B 1CPUA 3DBSA 2HWZH 5E1HB 1OL0A 1FFOA 3LV3B 1OAUH 3QHFH 4Y7MA 4IIQA 2XQYA 43C9B 2C9VA 3MRLA 1J86A 4FXKA 5B8CB 5I23A 3JSSA 5A2FA 3OC5A 3NH7H 4JRLA 4P5TD 3W11C 5IG7B 1CICB 3AREA 4ZFFB 3WEAA 4ODUB 1K4CB 4X4MA 4ZODA 1LO0L 5GRUH 2ZX6A 2F8IA 1X5GA 2HAZA 3FOLB 4OJDH 5IBTH 1DJSA 4PJDB 5I6PA 3KYMA 5TDNA 1XR9B 4DW2H 5KYNA 1QA9A 1NEZG 2A9CA 2EC8A 3ARWA 4P06A 2HFEA 3MLXH 4YSDA 3WD5H 1DVFD 4JO3L 2IGLA 3TVMA 1MHPH 3N40F 3ZGHA 5KSBB 1BYPA 1KV3A 2WZAA 2C3XA 3JWNE 5D71L 3RDTA 1DN0A 5ICXA 5EEUA 3AUVA 4LP4A 1KJVB 3QEUB 3E8UH 4KTEL 4M6NL 1H0DA 1Z66A 2R4SL 1UKTA 5HDLA 1OTUC 5C0NC 4XHQA 2XQBL 3HHSA 2CLVA 3GMRB 4IOSD 4OM0H 2DIJA 4P5MB 5GRVK 5CCGE 4HKBA 4GUPA 2N01B 4LT7A 2W60A 5EZLB 4ANXA 2B5IB 1DBMH 1UT9A 4UBDD 4JPKL 4OZ4A 3ARPA 1GCYA 1J1PH 3KLHC 1WEJL 3HN5A 5BQDA 4JKNA 1NOAA 1W9XA 1JZ8A 2Z1KA 3VDCA 2NY4C 3CLEH 5JPNB 1XB8A 3BAJA 3HRZB 2R2EA 2PO6D 1J11A 2DQGL 3FSVA 4ONGL 5HHNA 4DVRL 2E9GA 1MI5A 1T89A 2I24N 3HG5A 4Y8DC 3AB0C 4PHZA 4ZI8A 2I85A 4OFKA 2R9HC 4RQQA 4FQHB 2G5RA 5SWQA 2H32B 1YAIA 3LNIA 1NUGA 3RX5A 2C3WA 1BAFL 3VRJA 3F5WA 3HBGA 4WFHD 3RGVD 4XMUA 1XAKA 7FABH 1ERNA 3BE1H 2ALAA 1VFUA 3IXTB 2X4TB 3OD3A 4XPHL 4JG1L 2ED9A 3QIBC 2Z91A 4GAYB 1GYAA 1BSIA 2ZWSA 3TIEB 2VLLA 5BXFB 2Z7ZA 5E6IA 1HWGB 1PTZA 1PKQB 3FRPB 4QF1A 4X5WB 4OZGA 5C9KA 4RAUB 2QZQA 2ZCLL 3B83A 5HY9B 3CDYA 4MD0B 3MLSL 2X4UB 5B8CC 2F19H 4WWKA 5B7FA 4IU3B 3HR5B 4PRHE 4FADA 1Q9WA 2MPAH 1CICC 2Y1YA 2BZDA 3ZUNC 4NC1E 4OD2B 4JO8A 3UAFA 3S5LB 1JVLA 1YN6A 3FB8A 2CR0A 2WTRB 4QXUL 3RI5K 2VXSL 3MXVL 4H8HA 3U9UA 3MLRL 3A5VA 1I31A 4LP8A 1MIEL 4M4RB 2DWDB 3BUQA 2B1HH 3ULVH 2ADIA 3S3CB 3VWJC 3KE0A 1E5BA 5CJXA 3AS2A 2ORBL 4HKJB 5TE4H 4LCWE 3PL6C 3VWKB 2NXYD 4KJPD 3WEOA 2I69A 3AC0A 5ETUA 4PR5B 1U3HA 3HFML 3PGDB 1G9MC 2YGVA 5EG6C 3RP1A 3TCTA 3QQDB 2B39A 4CVZB 3TT3L 2BC4B 2BIHA 4FFTA 4CA4A 1BMGA 3HG2A 5AAPA 1PSKL 2GUOA 3QJFB 2XN9E 2JIXA 1WD9A 3B9AA 5CD5D 3TC9A 4UQ2B 2WJ7A 2VLMD 2ZYIA 3RZCA 1U93A 1A0QH 2NY5C 1M1SA 2FATL 1OCWL 3DTXA 4MMXB 5CSZA 3CZLA 1KB5H 4NUGL 5E1IA 2B5IC 2WMPB 3ULVD 4HGMA 5E6ZA 2WCPA 2XZCH 2WUCH 2Z31A 3ZRSA 4JGMA 4UYPA 5BJTB 1Y6MR 4WFFE 2XWBB 4HFUH 2LABA 1XX9C 3NCJH 2XG4B 1T4KB 3EW3B 1UT2A 5BZWA 5EU4B 4ZMXA 3QXAB 3MGOB 4IM8A 3HRZC 2ID5A 5DEJA 1MRFL 1CXHA 1MAMH 5AAMA 4P5KA 4GG6B 5I1LB 4JCWA 1MCPL 1I3GH 2ITDB 4G7SB 4Z7UB 2ZWYA 3UEQA 3E3QC 4S0SD 4BHUI 1EHNA 1VFAA 1E0OB 3V79C 1R47A 1T0MB 2WOBA 5BRQA 4OH2A 2Q86B 3FCSA 4M62L 1IAOB 3ASOB 4F5CA 2XWEA 2WLHA 5EN2A 3GGWB 4GBXB 1U8QA 5JQ6L 2CJ3A 1J8HE 3MLZL 4R26L 5FGBC 4HBCL 5C08E 1EUTA 5C0AB 4ISVA 3C08L 5BZZA 2FJFA 1B9KA 2D4FA 2ZYRA 3EGDA 4QTIL 4YNYA 3V4UL 4RAVA 3ZE0B 5IT2L 2FJHA 3KPSE 3GLAA 4JN2B 1SXNA 4K71B 3IAQA 5FDWA 3LKQA 2W80C 5B1KA 3EO0A 3G08B 3MLYH 5B7EA 1RUQL 4GT0A 1K4DA 1XGQA 1P84K 3PV6A 3RX7A 1G6RL 1PDKA 3RWDB 1OGAE 1F97A 1YYMH 1V7NL 2WWMC 2YJQA 1H8LA 3AG2B 2C7UA 3P77A 4U1MA 4KDWA 3SGJA 2UVEA 3HAEH 4IHBA 3OPZL 1BBJB 3PAZA 4LCIH 2GAZA 4PGCB 4P4KA 3QZLA 5EU6E 1GSKA 4XPGH 3T0VA 1MCJA 4OF6A 3S3BB 2H2SD 2Y0SA 3QSKB 1JOIA 2BVPB 1R3LA 1E27A 1IE4A 3QFJB 4MJIB 4WIQA 2VWEC 5EEXA 2X4OB 3TZVA 1S7VA 3CIAA 2VL4A 3MRDB 4MAUL 2ZZUT 3VX0A 5A6MA 3HC0A 4HHGA 2RACA 3VWKC 4BFRA 1OE1A 4H0IA 3DVIA 5D7LD 4ABQA 5AYUH 5ALCH 2G2RB 4AGMA 4G6MH 1ADQL 3NEOA 3U1QA 3FO9A 4YOKA 3RU8H 4UM9B 1IIKA 3MRNA 4YVNA 4AENA 3HN8A 3MA9L 1IV8A 2W0LA 1AD9B 1FNFA 2R4RH 3HMXA 4JJOA 4O9HH 5C2BL 4XNZC 1YEFH 3KPOA 4V2BA 2ZP8A 1CL7H 1KNOA 1KCLA 2L7JA 4KZDH 4MMXC 3X14B 4ODHH 1A1NB 2MQGA 4FFVD 1Y0LA 3EH3B 5DS8A 3UBFA 4P4RA 1JPSH 4YAQA 5EC1B 5I2IA 5I1GL 1E5AA 2WN2A 4TXVB 3VI3A 4W9FC 4HF5L 3BAYA 5FW8A 4XCNA 3MCLL 3VFRB 5E2WH 2NNFA 4QO1B 1YCSA 2BOBA 3N1QC 1XTLA 4GO6B 2Q20A 4R4NC 5CLXA 4HIQA 4WWOA 1D6VL 2BP8A 3AT8A 1BFOB 3TT1L 4GUOA 2JVUA 4OY9A 4M7LT 4PRNB 2V4LA 3EYFB 3OR7B 4UIMA 4P23B 2VLRA 2OLDA 5AZEH 5K9KB 4D9LL 2PTTB 1F3DJ 4Z3JA 5KSBA 3P3UA 4GBXC 4KAQL 1P4BL 1NBQA 1H6TA 3NUKA 4X9YA 1BVLA 1CBJA 3P4OA 3ZQ9A 4ERSL 1SRDA 4YHML 3NABL 2JLLA 2OL3L 2O5XH 5T8IA 3LN9A 2BWDA 5I30H 2Z7YA 1X5JA 4HHWA 1Q38A 5A3ID 2HVBA 4Z7IA 3GXIA 1XCQA 4X6CE 2B08A 3AS1A 4K71C 4X8JA 5L88L 3K2IA 1V7MH 4Q9RL 2BX5A 1DDHA 4C8XA 3D2UD 3WY2A 1QRKA 1FZMA 2EDXA 3AWFA 2EIDA 1R5IB 4EUPA 3FBKA 4FJZA 3QNXB 4WNSA 3CFBB 3QEQE 5GS0H 3ZHNA 4G82A 3K6NA 5D6DA 3ZDZB 4B9CA 5K1NA 5ISZA 1QBAA 2HSIA 3H9HB 4LLMB 4MJ5B 5HHOD 3ARVA 1IC7L 5BVJA 3KPRE 3TN0B 3VI4A 2BVOB 4N4YB 2IAMD 3STLB 1RZFH 4JFOA 5KVGL 2FSEA 3GBLA 3QRBA 3BQVA 5FWQA 1U58A 1MG2C 1BZQK 3ROLA 2EYRB 2HLAA 2VGLM 1FNGA 3ARQA 2VDNH 5D7SH 3MGAA 3RPIB 1Q0XH 2CA4A 4TNEA 3KDPB 3WOVA 2BMKA 5GS0D 3Q8AA 4BZ1H 5CZVH 4FNLH 4YE0A 2CUIA 3AXIA 3V6OE 4M93B 1SYVA 2O93L 2P42B 2M1KA 3H42L 3FO0L 5KANG 2YMOA 3B7TA 3WJMB 5DGRA 4AC2A 1FL3A 4ZXBB 2BHYA 1OZTG 3TIEA 4YEFA 2VAAA 3QZWB 5BXFA 2B0SL 4ZPTA 2GK0A 2VH5H 4NC2B 2Y23A 3FRPA 4X5WA 4HK0A 3V9FA 1AZCA 5DA0B 2ZUVA 4DP6X 4JMNA 4RWYL 1RURL 4IJ3C 1QSFD 2A9MH 1S9YB 2E59A 4LVNB 2OA9A 2D3VA 3KXFB 1DVTA 2FQEA 1N19A 4AW7A 1ID2A 2XX1A 2P5EB 2ICES 4LIQE 4L0ZA 1A4AA 4Y9CA 5JDSA 1HS6A 2DH3A 2DYPD 2PCYA 3W0WE 4Z7OF 1KJ2H 4X9FA 1PLBA 2ZCKL 4HJIA 3I9IA 5BV7B 4XXWC 4P23C 4WI2A 4XX5A 4W4OA 2C8NA 1P4UA 4K15A 4HZAA 3IU4H 1FH2A 1KIRA 1TZOA 4NZUL 2I9TA 1OGSA 3CN2A 4LO9A 4NM4H 3VFSA 1UOVA 1FV1A 5DI8B 2X5PA 4Y89A 5DJYA 3OKLA 1JZ5A 1KPUA 1QKZH 3GI9L 5KBLA 1ZIBA 1DBBL 2ZX9A 3GSNA 1Z9OA 3POHA 3FQTA 4ZTOH 1YNTB 3UTTE 3WEMA 2JE8A 2BIPA 3HS0B 4POYA 1BZ7A 4CVZA 2IBBA 1DQQB 2XA3A 4MA8L 4PV1C 3WLBB 3QJFA 1ECYA 3M1OA 3VTAA 2A38A 2PTVA 5D4HA 3EFFB 3P4NB 2ZG3A 3SYAA 5JOPD 1IFRA 1U4EA 4XMPL 5IEHA 4P04A 1OPOA 3MYJA 4HAKA 4K73A 3ECBA 2FO8A 4UTBH 5F3HA 3ZIYA 1EJ8A 4NKMB 4WEMB 2E75C 1SFHA 4X4XB 5IVZB 3MRQA 4IHOB 4Z7OE 1Q0YL 5FS5A 3ARXA 2XWBA 3D3VD 1NWPA 4J8RB 5E00B 1WA1X 5AVYB 2F68X 5FYLL 4BFIB 4F2MB 3RIAK 2AXHA 1CYGA 3FN0H 2V5RA 4KKCC 3BVVA 3PE9A 2P45B 1NCWH 5F9AC 2E7LC 5C0JB 1BZDA 5IJKC 4IRZA 3APMA 2UWEB 3B9VA 1NGZA 5L0QC 2IDUA 4IDJL 1T21B 1F4HA 1SDDB 2OCJA 4E5XB 4FFYL 2XBTA 3RB7A 3UJJL 1ND0A 1KCUL 2OW7A 1AJ7H 3DV4B 4HDIB 3V0FA 3QDGA 4G80A 4D7BA 4LK4A 2VISB 5KYUB 3HZKB 1XXFC 5F89B 5KANI 2R69L 4M93C 1KIPA 2BDNL 4LLVA 4FLOA 1QEWA 4MA7L 1E65A 2NXZB 1LP9B 3FU9A 4ZXBC 5CBAB 3ZT7A 4NNYB 5DR5L 1FGNL 3MJ8A 4PJGF 1ZA3B 1AS6A 3WFEH 4CILA 4GPVA 4JNXA 1RJYB 1CYWA 5D4JA 1R3IL 3B2VH 3LIZA 3T2QA 1UM6H 1CFMA 3O0RL 2Z1PA 4OFPA 4DGWC 5I0ZA 3QAZB 4YHLL 4DGYL 2QLVB 2C26A 4MD5A 1VPOH 1PCSA 3V5KA 4DKDC 4QAWA 3WKPA 3O2VH 4G8AC 5D1QB 1XCXA 1CFNA 4G8GE 1HE8A 4Z7VB 3FUJA 5BV7C 3CUPA 5IVNA 3SY0B 3C6SA 2N0KA 4M43L 1SXZA 3N40P 4XRCA 2ADGB 2WY3B 4ATTA 2CIKA 2X9WA 5FHAL 5H2BA 3V6ZB 1M2OA 3ZUCA 1LNUB 2F0CA 1PBYA 3O9WD 4GSRA 2F5BH 1IC4L 3PHSA 1D2PA 1J9RA 1NM4A 3FKUS 3LQAL 5JIHA 4BCXA 5C7XL 3B9DA 4TQPA 2DBJA 3ZY7A 3A6CH 2NSXA 4N5UA 3LEXB 5LXVA 1Q94B 2K8QA 4JY5H 4HOXA 3M8OL 2ZTBA 4ZMPA 2BS8A 1HQRB 2WXMA 1A5FL 3GJFK 3ZO9A 1S7RB 3DDFA 4OZIF 4P2RA 2BJML 1CWVA 1KBGH 4PWGA 2GYSA 1TSRA 5MENE 3M07A 6FABL 1F13A 4K94H 1S7TB 5IQ7L 5C0BE 1A4KA 1PZSA 1CK0H 3G6DL 1B2YA 2EVFA 1FFNA 1GYUA 1GKOA 1I8AA 2MNUA 4N5ED 2APFA 3BDBA 1I4FA 4EXPX 5J9PA 2KLRA 2E6PA 5K93A 1EUUA 5E8PB 2BNQA 3AITA 4JR9L 2E5EA 4OCSH 5EWIL 1QACA 3L4CA 3TEZA 4A7GF 4UINL 1D9KA 5C09E 4G1MB 5DK0B 3VXNB 4JJ5B 3NTCL 4GW5A 1EEZB 3C5ZA 3MRPA 3ECWA 1DJYA 4NSKA 4WUUD 5BRZB 3NAAL 2IQ9L 4QRTB 4TL4A 4FKEA 4MJ2A 4HC1A 5K1JA 1QTYT 1WYJA 2AV1B 3RAJH 1YEJL 1GZPA 2PP8A 5IJBC 3DO3A 5IJVB 4PJ5D 5E4AA 4OZIE 4I5BB 2DQHL 2A74A 2OXGB 3GKWH 2UVFA 5IV2A 2NXZC 5EUOA 4FD0A 3QT2A 2ZPKH 3SDAA 2AXJA 1Q0EA 4Y4FC 1QSVA 4NP4L 3IJEA 5F6HI 4G11A 3V6FB 3K80A 3GSUB 3QAZC 5F9JB 3CFBA 2GABA 2WXLA 4EUPG 2GCYB 4XP4H 2VRAA 4RISL 2HJFA 2NY2B 4HPOL 1LJMA 4P3WA 4I77H 1H3TA 3D39D 3BFWA 2QPEB 4M1GH 3ZT6A 4AH2A 5HYJE 1NBVL 3GSRB 1FQ9C 2VDMB 3E6HB 5D1QC 3TN0A 2V5MA 3CFDB 3TESA 5C0DB 2GEQA 2C9RA 1CQYA 4K23L 4FG0A 2RHEA 3R19A 1H5BB 1CFTA 5HDQH 1SEBB 2CNZA 2NDGA 3FU3A 1JP5A 4MAYA 2WWKO 5FV1L 1G7HB 3D4YA 5DC0A 4R84A 1CDGA 3FH7A 3AACA 1T20B 2K7PA 5E94B 2ADJB 5L9DL 3H53A 1MLBA 1NAMH 1R24A 4U6XA 5D72L 3SO5A 3VXRB 1J8KA 2PWHA 3D1MC 1W0WA 1A6WL 4GAJL 3S4SB 4F91B 5JIPA 4E9SA 1T5XB 1E5CA 1G94A 1M9WA 5IHBA 3PWPA 3VFPB 3HG4A 1RUKL 4OI7A 4LEEA 1G6VK 1XBRA 1WDAA 5CEYB 2VDOH 3UYPA 1JVKA 2IALA 2UUDH 2ZOKB 3GIVA 2BFGA 4PG2A 3U9PH 3ZRFC 5JW4R 3CX5J 4JDTL 3KXFA 3RWJA 5CAYB 4A1RA 3T0DA 1NEZB 2OMWB 4JFZL 1MWAL 3QNZB 2P5EA 3TU6A 1BX2B 2XZQL 4K7PY 2EKSA 3ABGA 3X1BA 4OGAD 2FQDA 2MRYA 1EIBA 2Y5TB 3VXSA 4RZCB 1ASPA 2H6UA 4XWOC 1YY8B 1D5ZA 1Q72H 5DZJA 3DO4A 3P73B 5MERB 3IS0X 3UBHA 5ESAB 3OWRA 2ITCA 3BIKA 2B14A 4HGWA 1H8OA 1ET5A 3GK8H 2Q8BL 4FQ2L 5EEZA 1S3KL 1FN4B 2W95A 4K07A 2XZAH 4N25A 4XVSH 4FZ8H 2EILB 1VZIA 5JXAL 1B2WH 5EV7A 2J43A 2H0JA 3VFMB 4WI0A 5HBBA 1X5ZA 3EYSH 3K6DA 4NLAA 3GB7A 1RVFH 4GOSA 1YYLL 4LARH 1NLDL 1YMHA 3L54A 4F7PB 4UV7L 4FXLA 3SOBL 1D6EB 3MNMA 4K9EL 3LRSA 3QDJB 2TAAA 5I24A 4JCMA 5F72S 2DDQH 2UXGA 2GJZA 1HYSC 3DUSB 2EDBA 4HIEA 1C16B 2VKWA 3SJVD 3LXBA 4Z9KB 1DFBL 1KSRA 1KJMB 2NY2C 2YPVA 2WB7A 3S36L 4ZFZA 4BDVB 1UWYA 4FQ1H 4O2FA 3DURA 2YSTA 3WFDH 4QWWD 4KMLB 32C2B 1P7QB 4AQ8A 2G75A 5HI5D 1D7BA 4FTVD 3K72A 4JFXA 5EC2B 4NQSA 4HG4K 4F58L 5BOZG 5IR1A 4N28A 3I50H 4NOBA 1IAIL 5J6GB 5I1CL 3OXRA 5CEXB 4OT1L 2UZXB 3G5XA 1GJWA 4UILH 2IQAB 4ADJA 1IO4C 4FHJA 4FMFA 4UDUB 4L0YA 4PJDE 1OM3H 5LKNA 4XZ4A 1JCKA 1T6BX 1R3JA 2KS0A 1OTSD 2V5SA 4W9LC 1URLA 3GSOB 3DBXA 4F80A 2DV6A 1DQMH 5GRJH 3TBYA 1HWWA 4HWEL 4LHUD 3T8VA 1AO7D 2BCKB 3WE1A 2EP6A 3BKYH 4Y2DA 5CGMA 4P46C 4KDVA 4D0DA 1PJWA 3O3AB 4M7LH 4WJ5B 4HMDA 2EDLA 4JDEB 3UTSD 3ULAB 5BS0A 5C92A 2DM2A 2B1OA 2Y06L 5LDUA 5TD4A 3WXWH 3N43B 3VE0B 4U4BA 5CNHA 3DXAA 4QHLA 4V2CB 4FLHA 4JPVL 4L4VB 1FVCB 3M46A 5AQ0A 1R1CA 1H6UA 3OM3B 5CCHE 2WV3A 1KLFA 3CDCA 1F4XH 3S35H 3V4PH 3WFCH 3GXMA 2R0WL 4JUTA 3B5TA 3LKNA 4IRSB 3QULA 2WLKA 1IM9B 4YSQA 4H1LA 3HBPA 3S96A 3PXLA 1O5PA 3I6LD 3KW7A 4GQRA 1XGYH 3IF1A 5E95B 4HIHA 2HFGH 2M2DA 5CZXD 2EEBA 1AGFA 4JPIB 1GYCA 1CVSC 1JE6A 1KELL 1TJIL 1P7KA 2PP7A 3ARGC 3E3QE 4OTXH 3MJ6A 4KROD 4QRPA 5IOKA 1EJFA 1GGBH 2F58L 3N1PC 4PJIB 4UUJA 4EIGB 1XTMA 1MIMH 3DPBA 2MTAA 1YQ2A 3FS9A 1EHLL 4JAMB 5ERWB 2VXQH 3TJPA 2XU9A 5D9SB 3QUXA 5J1SC 4N2HA 2VZVA 1GC1H 2QLYA 4TULL 3WDIA 3INUL 5ANME 3FTZA 1QZ1A 1ROWA 2CBOA 5CGBA 1EBPA 3GBNL 2DF3A 1OTTD 1UM5L 1PKQE 4FXGC 2NTFB 4JKWA 4LCYA 4O2CA 4P5TA 2IDQA 5EF1A 1DBKL 4AYSA 3QH3A 4OIFA 3MUHL 3UEZA 1U2CA 4AKOA 4P59L 1Z9PA 2AJ3B 4MXVF 4YDLC 4ZUUA 4M1DL 4G1EB 4JM2D 2BY0A 3QARA 2EXTA 4KJYB 1TNMA 3DHUA 1DVFA 3IM1A 3JTSA 3QIWB 4PRBA 1KOAA 4Y1SA 1A6ZB 2LR4A 3UOAB 4AYFA 5L6YL 2VWEE 1O9WA 1A8JH 1C08B 1J87A 1RUMH 3OMAB 3OMNB 2X4PA 5E4OA 1X9LA 4KJQD 1TU2B 1OSEA 2XKSA 3B7UX 2X9YA 2F7IA 3QUHA 1MJJB 5TK4A 1WTGT 1MFAH 3LXUX 5I6LA 1XIWC 4PGEB 2VXVL 2X6CA 3TTSA 5GZNC 4E68A 1IVLA 4GG6F 2BSRB 3CU1A 1RZ7L 1RZJC 5IUSA 5BRPA 3QS3A 4IOSA 1J05A 4LRNL 4PJ8B 3KBHE 2FYVA 4NCC2 1N6QH 1T1YB 4UV4L 3W2DL 1VGKA 4P49A 4ACPA 4CGUB 4I1PA 3TEWA 4PWHA 3VG9B 5IFAH 3DVNB 3GMPA 1U92B 2IH1A 5CGTA 3U7YL 3KR3H 3QQ9D 1HHGB 3CSFA 5T1MB 3F04A 4MXVE 4DCQB 5TH2A 1S7WB 3SGDI 3ZE0F 4MNQD 4HWBH 1J0KA 2HT2D 2NUPA 3HMWH 4CC0A 1IBDA 4U1JA 1BQLH 2FLBT 2PO6A 3AWGA 3GJEA 1CBVH 5EU5A 5IVOA 4OJFH 5KVMC 1UTDA 4IRSC 4IKKA 1A7PH 3MYZA 2OTPA 1A6VH 4TNWK 5SV4A 1KN4L 4JDVB 1OPGH 2DD8H 2ZP9A 2Z0BA 3RGVA 3U83A 2Y7OA 4CAGA 2ADJA 1BF2A 4GG6E 1ZHNB 3QIUB 4Z7UE 1FVDA 3E8VA 4DESA 4U05A 3VGHA 4MCMA 3UTPE 1IGIL 3H3PH 4X6EB 5LCVL 3IN0A 5EO0B 3W9EA 2KH2B 4ZFOB 1MELA 3IETA 3MV8B 5HHMB 4EQ3A 3KPMB 4XN1A 2WP3O 4N2OA 2HRPL 5C0AE 1PYWB 3T6VA 3ZE0E 1HH9B 2Q8AH 5I1JH 5AKTA 2WIIB 5DRWB 1FVEB 2A6JB 1BX2A 2IJ0C 2IC2A 3FCGA 2E9WA 1EXUB 4PVNA 2MOVA 1PCXA 3UYOD 1U4FA 2Y7QA 1SYSB 4IW4C 4J2QA 4LIQL 3WN5B 2XRAL 2Y5TA 1AOHA 4GNKB 1Y18A 5HJGA 1H9VA 1YY8A 4K8RL 3HC4H 2OMTB 3HS8A 3WJJA 2ITEA 2AF2A 3SE9H 4LPVA 4NKIL 3QBTB 5DJXB 4HGKC 5FWRA 1QWNA 1ZK9A 2XVGA 5I1AA 1RPUA 3O2DH 4B9KC 3KGRA 4XNMA 5LJYH 3HHMA 2EE9A 3IMVA 3LZFL 3QIWC 4P2OC 4Y16B 1WWCA 5HGAA 4ZFGL 2DLFL 3QFJE 4JHWL 2P80D 4MA3A 4MJIE 5EF0A 4L05A 4X0NA 1OT1A 2DMHA 1AGCA 3ZQXA 1SXSA 2ZF9A 1JYVA 3ZKNC 5K39A 2BSTB 1S8DA 4WRLA 3BYTA 3JV5A 2R7EA 3W5NA 4OCLC 4M00A 5FO7A 5L2KD 1KGCD 3FU8A 1IGMH 1F6FB 4PJ8C 1ZE3H 4IJTA 5DQ9B 3S37H 4WUKL 3T6WA 2NW3B 4XVUC 1UYWH 1DBJH 2D2OA 1YYCA 3FQ4A 3Q6GH 4QRQA 3PUUA 2NUTB 1YEIL 2IAAC 3TO2B 3VG9C 5FV2A 4AUJA 4JRYB 3RVXD 1W15A 4XNXL 1ZEAL 5EOQL 4DERA 2FX8H 1YO4A 1FAIH 1WZLA 2H26A 3ME0B 5E4EB 3PWNB 1FORH 2YARA 2C1OA 4EI5D 2W0FB 3HCVB 2F7QA 4UQEA 4WW1B 5KSUA 5HD8D 3V7AG 3AMLA 5HI3C 4HEME 3TBBA 5F7WC 3DRQA 3JTBA 3K2KA 2ATPA 2F15A 3ZT5A 1KB5A 4RX4D 4UT6L 3BZEA 4HH9A 4F7MB 2YUVA 2HX8A 5DDHB 2X6UA 3EGXB 4MS6A 3QIUC 1SF5A 2XOTA 3LD8B 2B7DT 4U1NB 5CGYD 4PJHB 3WG7B 3KPQB 1AR1B 2EC9T 3WEXB 1RJLB 2GT9B 4I8DA 5A2JH 3WFHB 4A2HA 1MFDH 2R15A 1IX2A 2BCKA 2ZUWA 3AREC 1KENH 4M8RA 1NCJA 2WANA 4AG4H 3O3AA 5H94B 1E5UI 4PPTA 3K4AA 1EZSA 2AK1H 4JDEA 1WWAX 5T5FH 4XHJC 3PF2A 4HUUB 4KKBC 4R96A 4KQ4H 2W59A 4RGND 3UJTH 3VGBA 3ECUA 1HTYA 1BBDL 3AU1A 2HJLA 3WN5C 2CJSA 3N85H 3TVMC 1MOEA 4OUUB 4NKQB 2JXMA 4JQXA 2ZCHH 4OLZL 4XN8A 1GRWA 4PW3A 3RNKB 4KDTC 2LLNA 4DEUA 4TSBL 4FQLH 1OE2A 3ZDZE 1JV5B 4EKJA 4OCRL 5E8DL 3DJRA 2LVCA 1BMZA 2BS71 5G2NA 1JGVH 3CN4A 4H1LG 4Y8AA 2CU9A 3DX2A 4Y16C 2VDQB 2WLYA 4AQAA 3KH4A 3DX3A 5D7LA 3AG1B 1LWHA 4Y4KD 5IMLA 1NEPA 4BD4A 1ZVHA 1EWHA 3V0GA 3CC5B 3EFOA 1EZVX 3L9EA 2YBRB 4PYGA 5D2LA 2P48B 3MBWA 4ODWA 2ZWNA 2XY1A 1NGPL 2VC2L 3MCYA 2NMSA 3NGBB 5FFOA 1C1EL 2JI2A 4WDIB 4JFTA 1AIFA 4P9HH 4AXWB 1EJOH 3TX4A 3KGSA 1UKSA 1P69B 3GSQA 4BXSV 4HUWB 1TKWB 1YNTF 4NRYA 2NLJA 2I25N 2QPDB 4JG9A 2VSDA 5IWLA 1KFAL 1TVHA 2EYTA 4LMQE 3SKNA 1YY9D 1IGJB 1M4KA 3DGCR 4HVBA 3UO1H 4UOQA 5TE6L 4AYMC 2VXUH 3M17B 1CXIA 3ZMRA 4XC1H 1OF2B 3HVDA 3ZKSD 4LLWA 4KI5F 4S1QH 3DX6A 2HTLD 4N0UA 3A23A 3MFFB 3VFGH 3VTTA 5ILTL 3OKOB 5I17A 3GI8L 2YQ2A 1QSZA 2J44A 2A6KB 2RFXA 4L8SB 1E67A 4EVNB 4L8BA 1RK1B 1QOKA 1E4XH 3CU7A 4G43B 1QHQA 5DWUH 3WDJA 4TKWA 4WFEE 3BVXA 4GB9A 1AR1C 1XF5B 4JK0D 6PCYA 1SHSA 4GSDL 4UT9H 1NGWA 3L7EA 1VKXA 3EJUA 3SBQA 2UWEF 4NRZA 1WITA 4BKTC 5HDBB 2PXYD 1OB0A 1ZT7A 1SLWA 4I18B 3D2UA 5JW3L 3HVNA 5F70A 1KY7A 3K2MC 4G6AC 1ODAA 2B16A 4ABWA 2XACC 3MREB 2PWGA 1SMAA 3F65A 2VDRH 1E6JH 5FOBB 3STZA 2CRYA 1RV6X 3QUKA 2W9LA 1U9KA 5AW4B 2EH8L 5CJXC 3VW3H 5HHOA 3ABLB 2DW5A 1FFRA 2IBGA 1OV8A 3BX7C 1BVZA 4G8EA 2IAMA 1I1YB 4WI5A 2YN3A 1NL0L 5D2NB 5DFVD 3FT1A 4F2ME 2XIDA 1LO0H 2GI7A 5JW5A 4NQED 3ZVVA 3EYQC 3P54A 2IBZX 1NMBL 3ESOA 4N3TA 1OWWA 3MNZA 4NQQA 1SJHB 5F6HJ 1ASOA 4YO0A 1AHWA 4HD9A 4PAZA 2UWEE 2AK4D 1M6UA 5CBEB 3C8HA 4FQIL 4MNGB 2KT6A 4JO3H 4CGTA 4Y9FA 4Q9QL 5C0IA 4H25A 4RLDA 3MMEA 4X7CC 5JHLH 5D71H 3B4NA 2H41A 3BWUC 4NI3A 4Z7VF 5EO0A 1QLFB 3WKYA 1YEEH 3L3JB 4ZT1A 2XPYA 2CQVA 4KTEH 1FFPA 1XH0A 3MZGB 3BO8A 3N9GL 4GS7B 2JKRM 3GIZL 3NGBC 1FYTD 2Y22A 5FF6B 3VVWA 2R4SH 5B38B 1KPRB 3N1MC 1BF8A 3TNNB 4R7XA 3QDMD 3GJFH 4ES9A 3ZBMA 5AAMC 4GRWB 1LP9E 1QSFA 3GNML 1BJMA 2E8YA 1FZKB 1NCDL 3LY6A 2WSKA 4HIJB 4QXTB 2H9GA 5F7DB 4BRVA 4Q74A 3MLVL 4PCKA 5F7BA 4FRWA 2LU7A 4MBRA 1I7TB 1XWVA 2DYPA 2DRUA 5AVTB 3TA3B 1KYFA 2L7QA 1HCVA 3HUJB 2PYFA 1DP0A 2QQNL 2ZXAA 3VD5A 4WKZB 3TIDA 3BSGA 5DJXA 2J6EH 2NY7L 1A3QA 4HWZA 4N0RA 2OMUB 3D34A 4NJAL 3UTOA 4C56D 5D1QE 4ONGH 4BH8A 3CVDA 3QWQB 5E8NB 2NTSP 4PJBA 1NSNL 2GSGB 4Z7VE 3P9MB 5C0GB 3CXFA 4L8SC 5DD5L 2F1EA 2W9DH 3MRHB 4PD4J 1FL5B 3RY6A 1FF5A 5IESL 1NLBL 1BOYA 1KTBA 4LNRA 2AAAA 3QG6A 5DQDH 2GBVA 1KJ2A 2ZONA 4HLEA 4XPHH 4JG1H 1JHLH 4N9OB 2ZX7A 5HGBB 3T1FA 2M8XA 2W65B 5T33L 3K8KA 4WCYH 1KULA 3GZQA 4I18C 5DMGD 3BT0A 1HC1A 5HYIA 1N12A 1QRND 4HS3B 2QGBA 5JO5B 1TZGL 4F93B 4KX9A 2ZXGA 4BELD 4Z7WF 4YDJA 3OGCB 3D3VA 4PB0L 3HI5L 3UP1A 1SY6H 2WXPA 2ZCLH 2O5YL 4FI6A 1T7ZA 3ESVF 5HHPA 1TG8A 5A16A 5I0YA 3KYNA 3ABMB 3MLSH 1TVDA 1NOLA 2K78A 3QISA 5DYFA 3UDWA 2J1XA 5C6TH 3VMNA 2WPGA 1XBDA 4QXWA 2Q7AA 2XWRA 1T03L 1AP2A 4HD5A 4F1ZA 4MQXD 3Q5YA 1W0VB 4QXUH 3K71A 1MHHB 5F1NB 4BQ8A 3H3BC 2OZ4A 4KKRA 4WWID 3BD3A 3MXVH 4AQ1A 1RP8A 2XWDA 4JO5A 4AMWA 3FT3B 3CSBA 1WZKA 4UTBA 3MQIA 1MIEH 4LSSH 1PG7L 1JGUH 4P07A 4TVUA 5ALBL 2ORBH 3KYOB 3OG6B 4HHAA 4NN7B 4XB8A 3L2LA 1JGEA 4LVHB 3EG9A 4PUBL 4MX7B 1NFAA 2VR3A 5BRZE 3HFMH 4JJHA 4O02A 5D1XD 2FIRT 3FB7B 4GS7C 2I60H 2Q76B 1F4YL 2R2BB 1EO8L 4IMLA 4AJVA 2X70A 4R5VA 1G9ML 1IAIM 4QGTA 4YDVA 2HT3C 2FATH 4GMTL 1OCWH 4HUUA 2ZXQA 4AQEA 4BUQA 1N7ML 1XB6A 4UIKH 4PYHA 4FQCL 3M1BA 5AW3B 5IB5B 1NBCA 2WXQA 2YAEA 3SPHA 4XX1E 3VFNA 5B3NA 4W9HC 4LB8A 2NY5L 3TA3C 3JTTA 3RBGA 1X44A 2BP5M 3Q3GB 1LE5B 1FLRH 2PCFA 3CPLB 4PG9B 1TSHA 2DPKA 5KVDH 4TL5A 2F53D 1PAMA 2V9UA 4MDJB 4LNVA 3ROOB 2FZ3A 3T71A 3MLUH 2ZSWB 3ELQA 5LVEA 4G7VH 2BVUA 1ITCA 1MRFH 4LSVL 1IKNA 3VFVB 3D5OF 4DSYA 3JV6A 3EH4B 3O9WA 1F2XK 1IU1A 3H1ZA 5LBSL 5A2BA 3OZLA 1JERA 5DZ9A 3H85A 1RHHA 2VDKH 3HG0A 1RJCA 1INQA 4XBEH 3HAEG 4H8WC 5J12B 1JDCA 3MLZH 1CVRA 2VDLB 3HW7A 3QUYA 4HBCH 5D1ZD 5D6DC 4DKAA 25C8L 3I02A 4ODXB 4JY6A 1NGQL 1IFHH 4PW4A 5EBMA 4QTIH 3V4UH 1UQSB 2Z7WA 3CFKB 3SDYL 2VXTL 3VXRE 4PWEA 1GA2A 4HJTA 3CD4A 5DJZA 5GRZA 4HS8L 4N8VG 5ENWB 3HG1D 2VW6A 3WN6A 1RUQH 3D06A 1TQSA 4FF9A 3R4RA 1QQDB 5E5MB 1EAQA 3TONA 4X5LA 3NMEA 3VD4A 1J1OL 2NY6D 4N86A 3T4YB 3W82A 5I5MA 3US9A 2DIEA 3OPZH 1P5UB 3CZNA 5DK3A 1QFWL 4I13B 3VA6A 3DJZA 1E8YA 5IHUL 2VOTA 1WRFA 1QLEB 1JK8B 2XBDA 4YBQC 3NP4A 4MLSA 3FYEB 2WVUA 2H6PB 2GSIB 4LAQL 4HJJL 4QYAA 4TF4A 5KN5A 2A6KA 1W6LA 5HGHB 2G5BB 4MGXA 4PLKD 3MRBB 3EO9L 4G9FD 4KFZC 4WUUA 3U36A 3ZYZA 2PCPB 4K9JA 3K6IA 3IDJB 4HIIB 4ORGB 4PJ5A 1NJ9B 1LM8V 2NY3B 2QKIB 5IEKA 1RZ8A 4HJUA 4LVHC 3CLFL 1ZGLM 4M3HA 3NJKA 4N2CA 3D18A 1DE4A 1DQKA 4MKTA 1HXKA 4JPWL 4R0LA 3MA9H 5C2BH 4ZUVB 3BVUA 8CGTA 3DIFB 4AJWA 1BPVA 1E7VA 4ORZC 2AJXH 2JKSA 3BH8B 1BW8A 1WD8A 1RPQA 4U1HB 2D0HA 3IGUA 3I6KA 3MRRA 4HUNB 5A1AA 5JDJA 1PLGL 5DFWH 1ZV5A 1U33A 2HG5B 3NCYS 3QDJE 2X05A 5C0RL 3RTQB 5DO2D 5ICYA 3ILDA 5GHWL 4E9YA 2BY3A 2FIKA 3HKZA 2IF7A 3MCLH 4LXFA 4JS7A 3RX8A 4IU2B 2BSBA 3QA3A 3FO2B 1D6VH 5D7IF 3TT1H 2J4WL 1A7NH 2CA3A 4ETYA 1XMWA 4UTCA 1UWGL 5DUBA 1C9SA 3CFEA 2ICEA 1HL8A 1UD5A 3OJ2C 3JZ7A 5IBLD 3BN3B 5K5YA 3QO1A 3BH9A 3NZ8B 1V3LA 2Q7NA 2WTPA 3WLWD 4MNGA 4D8PA 1X5YA 4Q6IB 3IK2A 4L3FA 1XGTB 4E36A 4CRPA 4M8QB 3NIDB 1P4BH 3PXHA 1INDH 2WLMA 1MAKA 1M7DB 3ZMEA 5CR8A 2AI0H 4ERSH 4YHMH 4AL8H 1NFDA 3N04A 2HFFB 4KJWD 4JPQA 4GUQA 2OL3H 1OIOA 1S7QA 5KJRL 2P8LB 1UZGA 2VIRA 3X3GH 3MACL 3JUZA 1TFPA 2HLFC 1KJ3L 3QORD 4KTDL 4C54A 3QRFM 4Q9RH 5EIIA 2H3KA 4ZX5A 4AIOA 1UZ6F 4H88H 3RWEA 5BO0D 3ALWA 4Z5RA 1OAQH 5I1HL 3ATBA 4N24A 2Q3AA 4UM8A 8FABA 4XN5A 5D7IE 1NAMA 3DX1A 1G7PA 3QUML 1U3JA 3HUJA 1P5UC 4ZSOA 1EDHA 4EN3B 1LEIB 3ZZLA 1DJHA 2J56A 1TZHB 5DMYA 1CL7I 1IC7H 3MNVB 5I8EA 3H0TA 1B0GA 4L4VE 1Z5HA 5EZIH 4GSQA 1T0NA 2AEWA 3QZBA 4AM0A 5KVGH 5G55A 4L9DA 4UTAH 4M7ZB 1K3IA 2A1WH 4RSYA 3QHZL 3GMOA 1A1OA 3VXOB 2OPCA 2BFVH 3EUUA 1F86A 1LO3L 1OB1B 2D7PA 4PJ9D 2NY3C 2QKIC 3DX7A 5MEPA 5IK3B 5CD3B 2E4TA 3PP4L 1BZ9A 4WKXA 1X7QB 1UZ6E 3H42H 2GJRA 3FO0H 3MODL 4AQZA 5HHXL 2EYSA 4X6BB 5JO5A 4PJIE 2B0SH 1NCAL 2AJSL 3FTXA 1M05A 2Y36L 1X4ZA 3VO0A 4JGJA 3L08A 3SJVA 3OKEA 3ZSTA 4YHYB 3U4BL 1B0RB 1J10A 1U8HA 4RWYH 4B95C 1OM9A 2E7HA 2W8CA 3BWAB 3RTQC 4B9FA 1KTDA 2XXCB 4DZBB 4PS4L 4FCAA 5DZAA 2IADA 3FO1B 1E2VA 1EFXB 2YFOA 3AXLA 4JW3A 4Z6AT 2VZUA 2RJMA 4L9LA 3A6BL 3W38A 1C12A 4XNAA 2QEJA 4M6MH 5E6SB 2ZCKH 3DC0A 1BQKA 3CZKA 2XT1B 4AOFA 5ACZB 5GZOD 1X5LA 2WVVB 5T1JA 3X13A 2NT0A 3PJSA 4HUVB 5SWZB 4KUCD 2IWKA 3K4ZA 2EVJA 2ZICA 4NZUH 4CL7A 4NO5A 4ETQA 3GWJA 4QOKD 2FO4A 2OM5A 4NNPL 3GI9H 2VJ0A 2AV7A 5D5MF 1W8NA 3LDBC 2F8XC 1DBBH 2WXRA 2FD6H 4X98A 4LHUA 1MXGA 1JFHA 1Z9SA 1S9VB 1AO7A 3FUEA 3H7BB 3WFZA 1YEKL 1NCBL 1T7WA 2Q76A 2C3VB 3AROA 4MA8H 3FH8A 3BLKA 1Z32X 3LSOB 5KYYA 3E7JA 1T5WB 3KLDA 5GGQH 2F7PA 4ZO6A 1LDPH 1MH5A 3UTSA 4XMPH 4W9KC 1WGOA 1K85A 1FZJA 1CTMA 1D9KC 2EE3A 3GHBH 5E2VL 1MKFA 4YLBA 1FG2A 4HWNA 3WTXA 1XCTB 1ED3B 4G9DB 3C5ZC 4A7UA 4MS8D 3BYYA 1DQDL 5FYLH 2J8UB 4EN3C 4JX0A 5JLZB 4AK2A 5H4ZA 4MDJA 5AOMA 4X7FC 5GGRB 4IRJB 1THAA 4F2FA 1HQ4B 5F9OL 1WCBA 5I71B 3IN2A 1XF3A 3APDA 5AW9B 5I74B 5HYSA 3BGMA 4W9CC 4M7ZC 5J06A 1URIA 4WO4B 3TCXA 2PUQT 3L95A 3PCYA 1BG9A 2GHZA 2DOCA 4FFYH 5EUKB 3WFBL 4NLHA 3UJJH 4U49A 3UPCA 3FUNA 1KCUH 1NCHA 4ZPVA 1E9PB 3L5WA 3LXCA 4FL4B 1NGYB 1ZLWH 3KNBA 3KJ6H 3LQZA 3D09A 5FYLD 5CIPH 2WVSA 4ZUTB 2OMZA 4HQQH 3CZFB 5FCSH 4MA7H 5KBMA 3SPJA 3V4PA 5GSVA 1EO5A 1ZPUA 2YGQA 1B0WA 1JZ2A 3CHQA 5EPMB 5DR5H 2J1WA 4MKMA 1RK0A 4KKAD 1KTLB 2Z34A 3NZHL 3MV8E 5HHME 3JWDC 1R3IH 3PWLA 1G7JB 2EDOA 4LU5H 3PU7A 3R4DA 1BLNB 2NOYA 1F6AB 4YHLH 3PWUA 4EF3A 4DGYH 4PJCB 5DJ2B 4JRXD 4KK8D 2C4XA 1RXLA 3SDDB 4ZMLA 4E41D 1EX0A 4N68A 5E08L 3VYNA 4PN6A 5AUMB 2VXQA 4NIYE 4JM2A 2YPLD 2YD3A 5IP4A 1ZA6A 1I8KA 2G5BA 3SPIA 3L2NA 3IGLA 2XKNA 3FRUA 3L3HA 4PRPB 5DVNA 2B9BA 2X6MA 3VXPB 3CXHK 2WZ5A 4RMQA 4A2FA 5MEOA 5BV7L 3MZTA 5EBWB 1HAWA 1MJ7L 1U8NA 3IDJA 4HIIA 4KVNL 4ZFQA 2GUYA 4G8FA 1NJ9A 1IC4H 3ZDXB 3QC5X 4OSUL 1YJDC 3TLRA 2HA1A 2OYKA 5CCJA 2WXOA 5GS2H 4U0RB 2FH8A 2UXTA 1WH0A 1TVBB 1KYOJ 2FBRA 3DIFA 4LBEB 4HKZB 2Y5EA 5DMKB 1LO2L 2AAVA 4DP7X 4XVOA 1T66D 2QSCL 3RVTD 2XA8H 3UMTA 3WKNA 1KACB 2BJMH 4LOUD 2DWEB 3EBHA 4NQCD 4X5QA 1YNKL 2V17L 1AQKL 4EZLA 4J3UA 2QGDA 3EGSB 4N90D 1LYQA 2SODB 4MNQA 1RP9A 3GBEA 4G3YH 5FAAA 3TTYA 4KZ0A 5IQ7H 5JHMA 3G6DH 2EVHA 1IQDB 3D30A 4JRYE 1KDJA 3E1F1 2OXHB 4PJXA 4X9IA 1GOFA 4NQXA 2D0FA 2BRRH 5GS2D 4IRJC 5DC9B 3S3DB 5I71C 3H7LA 1OEZW 5DURD 5I74C 1Y7VA 5T1LD 1VLXA 1RULL 5EWIH 4WO4C 1PZDA 2R0LH 2DIBA 5T3ZE 2APXA 4KFMA 1LWJA 4PGBB 2VN7A 3CZEA 3F6IA 1XGTA 4JE0A 4NPYB 1X5MA 2BSDA 1EGJH 4FZEL 3ZHFA 3E38A 4U1SA 1BF5A 2JJWA 1M7DA 4FL4C 2IQ9H 1RMFL 3O41B 1Z5YD 4HWBA 3JWNH 4NHCH 4JL2A 1YEWA 5IIEB 2ODIA 2VQ4A 3MRFA 4Y5YA 3OTTA 1TYRA 1SN5A 1Y07A 4WHDA 5DUPL 1JGDA 4PP2B 2HUHA 4PJHE 2ARJQ 1TZIA 4WTXA 1HXYA 2FWSA 4N1EA 4UMGA 5D6CA 1MCWW 4KZEL 3RWHA 4LOFA 1JXKA 4NP4H 1JPTH 4J12A 3Q06A 1FGVL 2J72A 4XCYB 3NK3A 4JMXA 1F42A 3BWUF 3RZWA 4RISH 3OZKA 4NJ9H 5PAZA 1NICA 4N0CD 3VACA 1MUJB 3SDDC 2D31A 4OM1L 3FFDB 5FEBA 1JFQL 1MW2A 5B3JF 2WLIB 3JVGA 1NBVH 1XEDA 1Q9LA 2OTUB 1HZHH 5IROC 1CLCA 5BW7A 4FABL 2NSMA 3MLTA 1AGBB 3QJHB 4K23H 5C70A 3ILPA 3A4EA 1ZS2A 4RBPK 1ETA1 3DPDA 2DWYA 3RL1A 1ESOA 5LAXB 5KSAB 5K33A 2P80A 1A25A 4YHNA 3EDJA 2YLKA 2PWEA 1JBJA 3UGXA 4GG8B 1KT2B 2H3NB 5IK3A 3WY3A 4F9LA 5CD3A 5IB1B 3B6SB 5FA3A 1WS7A 5L9DH 5GGTL 1YZZA 4DN3L 3MOAL 1CFSA 5D72H 4ZG1A 1S9KC 5DEZA 4PJFA 1A6WH 2CCWA 2I32A 3RY5A 3LN4B 5L2KA 1QFUL 2ESVB 1PW3A 3C60A 4G6FD 4IBVA 4Z3FA 4PIRF 2X4RA 1VEPA 4NO2A 1YMMB 1A7OL 1DUZA 2PF6A 1YG9A 3O2DA 1A3LH 3FOMB 3P2BA 4GKSA 4ZK8A 3QR0A 3GTNA 4R90H 2UZPA 1JNNH 1MFBL 4OLWL 2UZYB 2J7LA 3WNJA 3KPPA 4D3CL 1MWAH 4NUQA 1AKJD 3MX0A 4EI5A 1ZVYA 2XZQH 2W0KA 1ZSDA 1SUJA 2BNRB 1O9ZA 4CSPA 2G0LA 1D5MA 3CGTA 4OCYL 5HDBF 4DPCX 3MJ9L 4YBLB 5J5EA 3U82B 4DO5A 2DEXX 2XWTB 2YIHA 3HNVL 4P3CL 4JY4B 5HPOA 2XN0A 1UXWB 2H2PC 1XR8A 2VSKB 1MFMA 4OR1A 4HUVA 1BD2B 2XUWA 4XMTA 4HS6B 3LX9A 3CDZB 4ZAKD 2PPCA 3L16A 4QHMA 4N0FB 1NCGA 5DK2B 2A0LD 2Q8BH 2DQCL 4FQ2H 1CTOA 3ULSB 1NDMA 4YHOL 5B1CA 3UTQB 3QAQA 3AY2A 3K91A 4N26A 2ZUTA 2I9LA 3IVKA 3WO4B 1AXIB 1YAZA 4IS6A 1BWWA 4M03A 4PRHD 3G6JF 4F1SA 1DJXA 4QKTA 3V5HB 1YYLH 5PCYA 4MTMA 4UAHA 3RA7H 1G0DA 1QBML 2GKIA 3OAWA 4K9EH 3WS3B 1JJUA 5I75C 5HDBE 2CCVA 2J88H 3SBWC 2CCLA 3TJEL 4OFVA 4H8PA 4DK5A 3FQXB 2WQAA 2Z8WC 2EUZA 4CDGC 3K6FA 1DFBH 4L1LA 2ZOUA 4U3SA 3UC2A 4LCWD 1T3FA 2P24A 2ZX5A 5GSRA 3EJZD 1IFGA 2ICWA 5IW6B 2AP2A 1WZAA 4BSWA 5D4IA 4FQXB 4IGBB 5B4MD 2PCXA 3RG1C 4OF8A 5T5FA 3QRGL 1MZYA 4POZC 4X9BA 2XN9D 5KSAC 4LP5A 4XN7A 5I5JA 4NKOB 2RB8A 2XWZA 3BUDA 5D2NE 2ZSVA 1KG0A 3G6JE 5DGQA 3NACL 4C59B 5A7EA 4P3DA 4XNQA 4Y4KA 4OT1H 1DBAL 1MEXL 1NBZB 2X2UA 2DIAA 1WZ1L 2AABH 3NZSA 4QXGH 1T1ZB 4I9XA 4MQSB 5AVSB 2FQGA 3MU3A 1PZBA 4WFFD 3SYOA 3BVWA 2P46B 4XBGB 2PMZA 1BDYA 4IK6A 3EAKA 4HCIA 4HPYL 4HWEH 1D5BA 2P8PA 4WJG3 1PFCA 5CLTA 1XGPA 1ZOXA 4L37B 2G2NA 3OXSB 3EH5B 2LFEA 2O5NA 4P05A 3ZKQD 4BWWA 4GW4A 1JN6A 1H3PL 1FIEA 1HCFX 5CWSA 1F6AA 4JFSA 3UACA 3ZZQA 3CFJA 4MMZB 2VABB 1FJ1A 3L1OL 3KHOA 4L29A 5G5DB 4GRWE 1Z7JA 1JF1B 4NDMB 5F0MB 2V7HB 4X2UA 4QPEA 4JPVH 1G1YA 3IT8D 5E4IA 1J8HD 5IFHH 5L7XL 5C08D 5LLIC 3BUTA 3ULUE 2FEEI 1UC6A 2AJYH 3M6DA 3MRKA 1SBBA 5C07B 4HFWA 3SKUD 1QBLH 3VA2C 3IDNB 5GGUA 3L1GA 2R1YB 1CLZH 1DQIA 3KPSD 4NKDA 1WC7A 3MCG1 4PJ7B 3UC0H 4JN1H 5JMOC 2RA1A 3D25A 3FCUB 3F12B 3IDMA 4NO3A 2BP0B 4Y1AE 3K4DA 3U0PA 3OR6A 1N67A 4K2UH 4DGIL 3BUIA 1OGAD 4NENB 1QFWM 3CHRA 3R0NA 4NZ8A 3E6FB 3FJTA 3MI6A 1OF0A 3WO4C 4ZZKA 2IH9A 1XT5A 2F58H 2H1PH 3MRGB 3SDCB 3WTTA 3HI1B 5A40E 4R97C 2PXYA 4YGAB 5EU6D 5I26A 3TBSA 2OJ1A 4QTFA 3ZTDC 2WBWB 1EHLH 5C86A 1KCSH 1VACA 2F7OA 5C3LD 4EJ1C 3FDWA 3QQXA 3HTLX 5EBLB 3WNOA 5K9JH 3D0LB 4O2EB 5AG9A 4F9PA 4PJ6A 3AAZB 2EDQA 3CH1B 3V0AC 3QEHB 1CR9L 1H3XA 4WSJA 2AXFA 2LFGA 3FQNA 5FB8B 2YSSA 1UM5H 2ZXBA 4UT9A 5GGSB 3HAEB 3BZFA 2X3CA 3TCLB 1WFUA 2VR7A 4FQXC 4OB5L 4IGBC 3F2LA 1AE6L 4G8IA 4NQEA 1HHHB 3LKOB 2J5LB 1R46A 3L5XH 4ZQKB 3W3BA 1ZXKA 1ZLVK 5CD5C 4M1DH 5BMFH 5IQMA 1LEGA 3CFCH 3MV01 5DJCB 3QJOA 4W9ZA 4Z0BL 2AK4A 2ARJB 5TGBA 4R2GB 3S2AA 5I6NA 1LD9B 2K9UA 4LEOA 3FN3A 4ODTL 5L6YH 3MUGB 4XCCL 1M9SA 2H3XC 1TNNA 4PRIB 4GO8A 2LU5A 2VXVH 2APWA 1ZT1A 3L3DA 1FYTA 1MFEL 4W9JC 4FYTA 3MA7A 12E8L 3LHPL 2EAEA 3QDMA 1AD0A 1AGDB 4LRNH 3B2UD 3L9BA 3ZE2B 1NC2B 2HUEA 4UV4H 3W2DH 1IEAA 3QJSB 1RZJL 4L48A 3BAEL 2L4OA 3U7YH 3ASNB 4LSDA 4YGVA 2TSAA 1N26A 2E9JA 3O3DB 1CI5A 1HILA 5JA9A 1M71B 3NIGF 5L8KB 2RCSH 1OARH 4AJ0A 5SWSB 2N3JA 3RL2B 1UWFA 5LGYA 1BPLB 4Z77B 1JPGA 4C56A 5ESQA 2YD1A 1UHVA 1UJ3B 1FWXA 3GJFA 2XY2A 2O72A 5DZLA 2CIIA 3PXJA 3PABA 1R3KA 4AEEA 1E30A 3PUCA 3L17A 5E2UL 1WAAA 4PRDA 3D4ZA 3QEQD 2HFTA 5DWPA 1N0XL 4AEIH 3QJXA 1RZPA 3SCMD 4NUMA 5DHYB 4AT6B 5LCVH 2H2SC 4OJAA 2CLZB 2VZ1A 4F24A 2J6EA 4PSRA 1JAEA 1A6TB 1AXTH 4RMTA 3KPRD 1QRNA 4D8OA 2HRPH 2OJEB 4YUEL 1UENA 4X5PA 1O6SA 3OKNB 2FAUA 3FUIA 3NIGE 5MEQB 3SE6A 4WENB 5DLML 5CP7A 3LEVL 4LSUL 3X2QB 1PY4A 4A2GA 3Q5OA 3K81A 4HAFA 1JI2A 4MD4A 1UADC 4LF3A 5J3HD 3OKDA 4QTHB 5E1AA 3KJ4C 4LIQH 3WNIA 4RNRB 2XYBA 1RZGB 2DBLL 3WUWA 5F7YC 1OSZB 1BIIA 1VFBB 5KVEL 3TWCL 3UTZA 2Q7YB 3ARBD 2XPZA 4AIZB 4FYSA 3O6LL 1GTNA 3AQYA 4UF7C 2GJ6B 4DWHA 3D2TA 4FJYA 1NFKA 3QI9B 2QJDA 3OSKA 4JLRA 4R2GC 1L9MA 1SOXA 1SY6A 4YSUA 4FFVC 3LZFH 3GFUA 4WHTA 2JELH 5I9QC 1VESA 2ICCA 4I3RH 3EHBD 5FO2A 3ARFB 5CHNA 2VE6B 2EDTA 3GXNA 4NUJB 5D1XA 3ZYIA 2X87A 3W0WD 3P4LA 1B3JA 2PP9A 2B59A 3X3FL 3CIQA 4JFQB 4QRSA 1R0AL 3CHOA 5CO1A 4A55A 3NIDF 5C97A 5ES4B 2KMWA 1YA5A 5AOJA 4OF5A 2FX7L 3IXAA 3MV11 1ZEAH 2X40A 5EOQH 4JFDB 4Y19B 4YX2H 1A1MA 1RAMA 3UZQA 1U8PB 3ZHLA 2F53A 3LPFA 3UTTD 4NO0D 1VJSA 3OX8B 1MCDA 5ICZB 4AM0Q 4OFYA 4LZKA 5E9DE 4ZMAT 1UJ3C 2BSSA 3DROB 3LS5L 2CJUL 4XPAL 3GMQA 1IUZA 2A83B 2Y24A 1PU0A 4X7DC 3U6RB 2DM7A 1G9EA 5BQ7B 2EZ0D 2IANB 4L3EB 2P3YA 3ASWA 1INEL 1B0IA 3ZE1B 4R4BB 5I15H 2WWNA 5D1ZA 3SGKA 4EBQL 2Z92B 3UJIL 1L9PA 2A73A 2VKXA 1HXMB 2IPKB 5E6RB 3NIDE 4Z7AA 1EJ6A 4Q97A 1EEYB 5K9QG 2J1ZA 5LQBL 4QRRE 4HIXL 1CI3M 1JV2A 1X4XA 2IO5A 3HG1A 4GW1A 3U0TB 3K0WA 1HSAB 4OZHB 3SPCA 3W39B 3V0EA 4ALAL 2XDHA 4ZFOL 5AG8A 3DO7A 3GM0A 4MMZA 3A4FA 3EYOB 1I8MA 4G83A 1OAJA 2YEVB 5KYWA 1BBDH 1HH6B 1TCRB 1PQZA 2OR9L 1IC1A 1CF1A 4O4YL 4MZ3A 1FFQA 4JFFB 1KN2L 4R4FH 3WMPA 4OF7A 5LXGL 4XO3A 4OLZH 5C07A 1JUFB 4R8WH 3T1WA 4TSBH 5D7KE 1QUNB 1YEDA 2ZX8A 1UB6B 4LKXB 1X5IA 2V2XB 4S10A 5E8DH 3BQUB 4OLYL 3QI9C 3R8BB 1F90L 2FDBP 1G7LA 4QRUA 3P0GB 3B3BA 1CJYA 4DVBA 1SHMA 4UQDA 1G6RA 3DJ9A 3TS8A 1JNHB 2EXYD 3F8UB 2WO2B 3Q2CA 4K5LA 4LKCA 5TK2A 3ELAT 1YQVH 2HVKB 4O5LL 4B6ZA 2XV3A 3HPJB 3ARFC 4MHHI 1UH4A 3SDCA 4AV4A 4G6KH 1KEGL 4WY7H 3ESNA 3BP4B 4N2LA 3G5YB 3WL9A 1P1ZA 2QSQA 3VRIB 5TDOB 1ZS8B 1KLUA 4G8GD 3S2CA 2VC2H 4BSVA 3D0LA 4RETB 1C1EH 3UZEA 2Y2WA 4CC1A 5KG9B 4KH2A 3T3PF 3V5DB 3SBPA 1BQHG 4PRAA 5AWNL 3CSYB 2UX6A 4JFYB 1I7ZB 1IL1B 5F6IB 4GLRH 4RIRB 4H5SB 2ICWI 4DOHB 1ADQA 4ZDHA 1KFAH 2IFGA 2X41A 5BZDA 5I6KA 1C7TA 3QYMA 4FDWA 2QVTA 3OC8A 4KHXH 3HC3L 2IWEA 4MMYB 4X6DA 4NT6B 4FKHA 4FG6D 4U1IB 1ZLSL 2C7FA 3BPCB 1IJNA 3FPYA 4WGKA 2PWFA 5T3ZL 1F56A 5ILTH 4QY8A 3GI8H 4TPRL 2WO3B 3BP5A 1JRHH 1U8JA 5ACMA 2J8UF 1A47A 5FUZL 3CFIC 3GMNA 2AEOA 5DRZB 5INDB 5MEND 5SWZE 2E27H 5JOFA 5KS9B 4ZYKB 2D7OA 3HC2A 5I76A 1M6OB 5C0BD 4E0RA 1IBBA 4Z7NB 1A2YA 1X9QA 1PAZA 4HAGA 4M61B 1WBYA 1BVNP 1IGYA 5K9QI 2YD8A 1YNLH 3TFBA 2NQ3A 3DVFA 4I2XA 5D4QA 1CU4H 1JK9B 4WW2B 3O3EA 2ZUUA 4OGXL 4CMMA 3QORA 4FQQB 5T1DL 2CAKA 4MYWB 4ZOCA 4ICWA 3O6MH 4PW9A 2WD0A 4S2SB 2Q2LA 3E0GA 2MCPL 2BNUB 3LS4L 4JG0L 4M5YL 1T7YA 1E40A 1P2CB 1HEZB 3FUDA 1KTCA 2JCCA 5C09D 4J3XA 3LKPB 2RQEA 2X4NA 3ARYA 4TOYH 2X7LB 1KGUA 4ANVA 2A77H 4ZO8A 3KH3A 2CNYA 5ABAA 2EH8H 3KWTA 2G3ZA 2OL3A 5FA4B 2GITA 3KPLA 1HCYA 2PTUA 4FG2A 1U6AL 1FE8H 2AJZB 3EJYD 3F05A 4OKVA 4NYLA 4WLCA 5FECA 2J8UE 5KTEL 1NMCB 3DX0A 3BQUC 3JV4B 3WENA 1NMBH 5IMKB 5EO1A 2GI0A 1R5WB 3BVNA 3KDMA 2XN1A 3BH4A 1P0SE 4AK1A 3V9CA 4PJ9A 1X9RA 2ENPA 1OHQA 1N0LB 4FQIH 4KQ3L 5E8OA 4CMHB 1YUHB 1S9XA 1XH3B 3MRCB 4QHNB 2CK2A 3D39B 2VDQL 3T4AA 1FH5L 3KWWB 1QO3B 1XGRA 4BBWA 2VZTA 3DSNA 5HYJD 3EDKA 4Y2LA 3ZL4H 1UEMA 3GKZA 3B9KB 4ZX6A 3HPLA 4AMXA 3FB6B 5EORL 1JHKL 1WUNT 2DKMA 3F7YA 3W11D 3QJQB 1O7VA 3IDGB 5IM7B 1E4XI 1TETL 3ZDXF 4LFHD 4DGUA 5F88B 3BSZL 5EFIA 2XWJA 3MLVH 4NAQA 1ZTMA 4JHUA 5F6IC 5JIDA 1DL7L 1Y1DA 1GS7A 2VLJB 4J6RL 4LCCB 4A68A 1E3XA 2LHAA 3K6OA 4APQB 2FR4A 3ARDB 2OW6A 1OCRB 1PVHA 5IOPA 2OR8A 5IF0B 4WTQA 2RGSA 2B1AL 1MCHA 3LEYL 4DO6A 2QDVA 3MUY1 3WUWG 4U1LB 1D7CA 4C4KO 4ZS6D 5GZOA 4PJCE 2R1WA 1YPZB 2V7NA 4JFPB 4M7KL 4NGHH 3CX5K 1DUYA 3DX9B 3P11L 4QOKA 3A4AA 1EEUA 2CKBH 4LSTH 3CMOL 1A9VA 1SN0A 5DD5H 2WB1A 5CZKA 5GPRA 4CC4A 2YPKA 1NDGA 2Y6TE 4PRPE 1KXTA 3KYKL 1H6FA 1OTUD 3IFLH 5C0ND 3QO0A 5IESH 4QAMB 2VE6A 5DD6A 3SGEI 2Z35A 2HH0L 3HI6H 1S7XB 2ZE0A 2GJPA 3WIFA 4WW2C 3ZDXE 5I1DA 1A64A 5JIMA 3V6BR 2PW1B 4BJLA 1N10A 2FGWH 2CDGB 3KLHD 4UQCA 1N2RB 1W8EA 5A7BA 1NIAA 2NY4D 5CJ5A 4PB0H 3Q8BA 3G6AB 1U8LA 2KZKA 3D85B 3MRIA 4K94C 4JBSA 1K8DB 2QBWA 3F7VB 1KCVH 4K0OA 2CHXA 1AKPA 1X7SA 4H8UA 3CDGB 2R9HD 1IIIA 4U6TA 4BKLB 1QNZL 1MNUL 4NFDA 4CADB 5EOTB 2YAQA 1DZ0A 4H8QA 1NMCC 2J8HA 4DT2A 4E9VA 4R0LC 1JWMA 5I82A 3CX2A 5I18H 2RIKA 5DLLA 4RBPH 4YPGA 5AKRA 2F54B 2EDDA 5J13C 1YN7A 3QIBD 2GBTA 5D7JB 2VR5A 3QCVL 4BFOA 2GBUA 5ELIA 3R06B 4CMHC 3GD1C 5ALBH 3I75B 3O45B 1LK3L 3MV7B 1IT9H 2C9PA 3IB4A 2KDGA 1RJZB 4H26B 1E5YA 3BCFA 2Z93B 2Y3NA 4XXCA 3B9KC 4FTVB 3IRPX 2EUWA 5I16A 2CDFB 2P43B 5IB3A 3CVIH 5DEGB 1PY0A 1R19A 2KHAA 4FFYA 3KLKA 7PCYA 1CICD 4PBVC 1G9MH 3B2PA 5IW1B 5LGJB 1FNEA 3GXTA 4IIZA 3O11B 1PX8A 5FXCH 1N7MH 4FQCH 4JRXA 3BN9C 4EO5A 5E8EB 3DGDA 4JZNB 2NY5H 2R69A 4TSCL 5H37G 1M7IB 3U2IA 1JZJA 2H8PA 1JXFA 4X99A 1QBBA 2YPLA 3B1TA 3NDZE 4KRNA 3UPAA 4XOBA 4ZMOA 5J6HA 2CDEA 2N7BA 4F33A 4GIOA 5ABZA 1ZRUA 3QXDA 1JHTB 5LBSH 3RLSA 1F1DA 4HISA 1OAYH 1AYOA 1G7QA 5I1EL 2WYZA 3AT0A 3D0VA 3DVGB 4U7SA 4HJGB 5ITFA 3BP4A 3T5WA 4APXB 5AD0B 1XF2A 2H32H 4JFEB 1Z3GL 2I07A 3A67H 2HMIC 1NGQH 2WXNA 1HFUA 4H8WL 1N8ZB 2DQUL 2YOCA 3SDYH 4KBPA 4NQCA 5F44A 4AV0A 5I8OH 5CJ8A 2ESVE 4HS8H 1T83C 5M94B 4JPSA 2E6JA 3H9SB 1DJGA 1YMME 3K7UA 2JB6A 2YEZB 3FN9A 5AVXB 4F7EA 2NW2B 1EDYA 4KI1A 3IKKA 1MVFA 2UYLB 3GUTB 3KPNB 1ORSB 3CBRA 4FLQA 1QFWH 1S5IL 3EOAB 5DZPA 5IHUH 1RU9L 1I75A 1PIGA 3CSTA 3HZVA 4MQ7B 3AM8A 5T1LA 3FONB 4U1IA 4BSJA 2BNRE 1IM3B 3MOQA 3BAKA 1M1XA 1HAUA 1OQOA 4DP8X 1BM3L 3HLAB 2A6DB 5DJ6B 1MHCA 4L4TB 5D7JC 4G59C 2CGZA 3BZ4B 1RHFA 1BD2E 4YHKL 4ZYKA 5D1ZI 4JGUA 1G9NC 5CU9A 1G4MA 4BFKA 1Z5LA 2PYEB 4UDTB 1UM4L 4QT5A 1CFVL 1PKOA 5G4MA 1A9EA 1IAKB 1AAJA 5HI5C 2ATKA 3ATEA 4L9LC 2DQDH 1KPVB 2WWMD 4TS6A 2JTYA 4J8QA 3C5JB 5FHBH 4HLZH 2V37A 3R7QA 2SEBB 4KNSA 1G0XA 1KCWA 3VB9A 2C1PA 1UXMA 1HEZA 2E56A 4YK4B 4LOEA 1J18A 3PNWA 3LKPA 4EDXA 1MFCH 2VL5A 3QE5A 1EGJA 4U6HB 3L48A 1UA3A 1M53A 1QSEB 2WXIA 4JANB 2K70A 3WJLA 5LNEA 5C0RH 4A04A 5GHWH 2FB4L 3D33A 4GUCA 4RFOL 3S98A 5ID1A 7PAZA 4O51A 1KGYE 4KOBA 4N0YL 4PLOB 4A6YB 1XL6A 3SPGA 4NB7A 4YHPB 1TTRA 3BAIA 3VWKD 5IGXL 3HB3B 1R9FA 5H35B 2I7SA 1JNJA 4JHZA 4J3BA 4RMBA 4BWUA 3M7OA 3MNWA 1S3RA 3TBCA 2WKGA 5I66B 3MROB 3BIAX 3RNQB 3DOSB 2G9HA 1FNLA 2VW7A 5JORA 1G4RA 2WLLA 2KPWA 4KRPB 4M6OH 3GMLB 1BEYH 2NZIA 1QABA 5HHVL 3K8LA 1KLGA 1RL1A 3KWWA 4NC0B 2A4CA 3LZNA 3FTGA 4XPBH 3DK0A 4PJ7F 1QLRB 3IJSB 3PDOA 5KJRH 2YFNA 5EH1A 4J23A 1I7UB 4OD1L 4X5XA 2VDLL 4OLVL 3RYMA 5I1IL 3QNYB 1KJ3H 4KTDH 3LZPA 3Q2NA 4NOFA 1ZHKB 4X4YB 3U2SB 1WBZB 4R4ND 2AQTA 4CVXA 5I1HH 1AKJA 1IEBB 5J6SA 2P7TA 4PVLA 4APQA 1SOKA 4X7EC 4I9WE 5CN3A 5BUGA 5ID0B 2LW3A 1N59A 1LQBC 2MHAA 3L3OB 2OMNA 4G42B 4WU7A 1F6LL 1CYXA 3LIZH 3CBKB 3UTPD 2DJ4A 4F2EA 4OQTL 1CE6A 4OZFG 1I8IB 4GBXD 4N2DA 4ZAKA 4PV9B 2CHDA 3P3YA 4PGDA 5AVUB 3BUYA 5C0AD 1DVQA 1NINA 3UBGA 1QLEL 2JB5L 3G9VA 1VCAA 2D7QA 3QHZH 5KZCB 1DR9A 4PJ7E 1JZGA 1MWAA 2APBA 2J73A 3GSWA 4U1KA 4FQJL 3MN8A 4HZLB 1LO3H 3PHOB 2LVEA 3BD5A 3BXNA 1CD0A 4PRHA 5C0CB 3T08A 4I48A 4HOMA 5D2LF 2Y7MA 2F9BT 1UFUA 2ZQKA 3RWCB 1NTDA 1S78C 3HZYA 1CDIA 4LSPH 4F3FA 4A2DA 3CVCA 5HHXH 1F3DH 3IKCB 2V2WA 4JM2C 4YK4C 3VGFA 2AJSH 2W91A 2VERN 2BVQB 3IBOA 1RZKC 2XHNA 3F7RA 1GC1C 3CMGA 4L8DA 4TNFA 2VR8A 3AVEA 3GXFA 4KO7A 5EU3B 4LCWA 3UERA 3QFJD 2LU3A 4MJID 3S97C 2CO2A 4NP9A 2WNGA 4OAWA 4Z0XB 3TWYA 1TITA 4YLQT 3SE3A 4DPBX 3DI3B 3P9WB 1EMTL 5EO9B 3A6BH 3PQYB 3HB3C 2APSA 3IFPA 2XN9A 2JJSA 4CNIA 2QKSA 2ZOWA 3BWZA 4LESA 4UQ9A 6CGTA 2R8SH 4UM9D 4GKNB 2EKJA 3ZL1A 1DLFL 1ACCA 1J9QA 4YL4A 3TPUB 4KRPC 4FA7B 4TVPE 5A2CA 4TUKL 4KOCA 4NWTH 3NCMA 1UKQA 1O6VA 1VFMA 3BEWB 4NNPH 3C9NB 5HXMA 3OHXB 4NZFA 2APTA 1BOGB 4L4JA 5KYXB 1BJ8A 2XC8A 3OB0K 4X4ZA 2X4QB 1J5IA 2XXMB 3EF4A 3WNMA 4XMKH 1NCBH 3C2SA 5G4OA 5CINL 5B1AB 4JQVA 1W16A 5L4JA 3US0A 3ABZA 4ANKA 5F9DC 3ZLQC 1QFPA 4PRIE 3BRGC 3NSFA 4A2MA 1MHEA 1GS6X 1YEHL 4TQEL 3ORJA 1UOLA 1ZHBB 3RWIB 2AC0A 1NH6A 1UFGA 4F8NA 5KW9H 2IIJA 5E2VH 2BPBA 3QWRA 2BZ7A 1GIGL 3ZE2E 5AW6B 4NN5B 2EEAA 1SFDA 2F1BA 3DMMB 2FWOB 4P23D 1J8HA 1TO5A 3BAXA 3C5SB 5C08A 3H9YA 5TE7H 1WUZA 4DAGH 2W81C 4B3EA 1PZ5A 4L3AA 1QR1B 4OCMC 3KPSA 4NFBA 5F9OH 1S7UA 5F0JB 4GXFA 1TJXA 4HC1L 2OP4H 3SKMA 1AGEA 5SWSE 3OAZK 4J28A 2AEPL 2QELA 2IMNA 5H4YA 1M7UA 4N3UA 2VN6A 4MJ6A 3WFBH 3O8XB 1E5ZA 1OGAA 1LMKA 3RWGB 1L9TA 3K6SB 1T04B 2HRLA 3P1VA 3VQMA 1JWUB 2JTDA 3RWFB 4OLUL 1ODUA 5EU6A 3U1SH 3O81A 4ELDA 2HTKC 3UH8A 4KVCL 1H3VA 2ROXA 5CFAA 2WKOA 2PPFA 1U91A 3IFOB 3EXLA 3BKJL 4PY7A 5A43C 3VDAA 1DQJA 2YKLL 2QR0B 1ZLUH 1E9QA 2VO8A 3VXTA 4XGZA 1J0HA 5JYLA 4KKCD 1WICA 1JZFA 2MOGA 3TN0D 4CN6A 2XVBA 1AFVL 1DEEB 2V9TA 4LQFH 1KTJA 3CVHB 1K5NA 4HJ0D 2HT4C 3RB5A 1CXLA 2DS4A 3IPEA 3JWDL 4IOIB 4F7KA 4XP1H 4PJGB 5MI0B 1KYUA 4MQ7A 5E08H 3LH9A 1MJUL 5E24E 1D5XA 4YDNA 4M9OA 3NA9L 3RFZB 3S88L 4U1GB 4PJBF 3QQ3A 5HDWA 3KWXA 5BVPH 3CQQA 1W91A 1CDHA 1CF8L 3ZX1A 2ENJA 1UWXK 5DCCA 1NBYA 4ZXBD 2Y7NA 5BV7H 3B8YA 2GJ6E 2D3LA 4KRMB 3BEVB 4KVNH 4DUVA 3BZ5A 2ICWJ 4J4PC 3OHXC 4HUXB 3O2WL 3ZTEA 4JHBA 4P2CG 1T0PB 5CJQL 2OAAA 3QDAA 3DV6B 3UL4A 5AB0A 3CJJA 3KS0H 4PI2A 2I27N 5AW1B 1ZGLA 2BSCA 2HPTA 2CMRL 1NANI 3P9LB 5GISL 3SKOA 4IK7A 4D0CB 3KXFD 3U0WL 2CR3A 3IMRA 1YJDL 3E9UA 5IMMB 3OAUH 2P5ED 3MCKA