1E5ZA

Azurin from pseudomonas aeruginosa, reduced form, ph 9.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title Rontgenkristallographische Strukturaufklarung Von Azurin Aus Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e5zA00
3ABLB 2I7SA 2IWEA 1M57B 2BWDA 1JVOA 4AKPA 2PCYA 1AQ8A 1NPNA 3FU9A 1OF0A 3PPSA 1E5ZA 4E9YA 4BWUA 1V54B 3TA4D 1AS8A 2EIKB 3NJJA 3SBRA 4UANA 1OOWA 3S8GB 4NB7A 1J5DA 3ZX1A 4Q8BA 1AZBA 5D4HA 3U25A 1BXAA 3IN0A 1ASOA 4YSAA 3NJIA 3OMNB 4GP4B 2BW4A 2CUAA 1IKOP 3UADA 2BW5A 2EINB 4F7KA 3T71A 1OE3A 1OCRB 2HXAA 4DPAX 3NJFA 1YLBB 5I26A 3TU6A 5I6OA 4DP0X 1AS7A 2VN3A 1QHQA 3EHBB 4BWTA 3PAUA 3FQ1A 2BZ7A 2PPAA 1NDTA 2I7OA 3NJNA 2AVFA 4A2EA 1GY2A 5ANHA 1SHWA 3BQVA 1SFDA 4HAKA 3WG7B 3PLYA 2HLEB 4MFHA 2FT8A 2CAKA 2QPDB 4UF7C 3QJTB 3IN2A 1AZCA 1ZV2A 3NP3A 2BHFA 2XUWA 4E9TA 4G7QB 3HB3B 5TK2A 1SF3A 3PXLA 2VSKB 4JHUA 2MTAA 3S3BB 1I53A 1ILUA 3IBOA 2YXWA 4E9SA 2AZUA 3N55A 3HEIB 2UX7A 1IUZA 1SHXA 1UATA 1TEGA 1AZRA 4HCFA 1JXFA 2HX7A 2AANA 2AFNA 2XX1A 1AZUA 1IC0A 2QT6A 1RCYA 3QJRB 4PAZA 4YSCA 2GI0A 4CSZA 3QQXA 4GY4A 2XV3A 3NSDA 3FU7B 4A2FA 2J57A 1E5YA 3FSAA 2IDTA 1RZPA 2CBPA 3FU7A 3KW7A 5I5IA 1N68A 3CG8A 5B1AB 3DIVA 4WTQA 1BXVA 3FYIB 3X1NA 4DP6X 3AG1B 3ERXA 1JZIA 2VM4A 4YSEA 3WKQA 1GSKA 3FYEB 4GYBA 4HCIA 4YVUA 2QDVA 1PLCA 3SQRA 1BEXA 1KBWA 1W6WA 2ZXWB 3FQ2A 4GP5B 2GIMA 1NIFA 2FTAA 1WS8A 2P80A 2IAAC 3QJSB 2IDSA 2EIJB 4E9WA 1PNCA 1SFHA 2WSDA 1N70A 1M9WA 2QPEB 1BQKA 4AI7A 4PCYA 3S3DB 3EH3B 2FQEA 1A4BA 2PPFA 4AZUA 2H5UA 1PLBA 2J56A 5I5MA 1PAZA 3WIAA 3ZBMA 2Y69B 1JZHA 1ET7A 4YVNA 4N8UA 4DPBX 4G72B 4A68A 4DP7X 1ID2A 4KNTA 4DPCX 4QLWA 3NJGA 1ZIAA 3NSYA 1FA4A 5I6NA 1HFUA 2QDWA 3AG2B 4GP8B 2PPDA 3PAVA 1WAEA 3JTBA 2IWKA 1KDJA 2Q9OA 1RZQA 2OCCB 3V9CA 4F2EA 3KW8A 1DZ0A 3H4HA 5AKRA 2H3XC 2IDUA 4KO5A 2IDQA 1XMEB 3FQYA 2JKWA 5D4IA 5LDUA 3FPYA 1PY0A 4G7RB 4HALA 1W8EA 1BXUA 2JXMA 1XB3A 4G71B 5I28A 3NSFA 4KOCA 3T6ZA 3DKHA 2DYSB 3T6WA 4G7SB 2PPCA 3SBQA 3X1BA 1OE1A 2A3TA 4WKXA 2VSMB 7PAZA 1J9TA 1PZCA 4TXVB 4YSOA 4L0PB 2GBAA 3NJLA 3CVDA 2HRGA 1JZFA 2Q5BA 1IBYA 3UACA 1J9QA 1TKWA 4F2FA 1WA1X 1WS7A 1PCSA 1TEFA 2AZAA 4G70B 4DP9X 4YSUA 4KO9A 3FSZA 2R7EB 2NRDA 5B1KA 3TBCA 3ZIYA 2R7EA 4DP8X 5B1JA 1L9OA 4AX3A 2CJ3A 2UXGA 3H56A 2GC7C 2HRHA 3X1EA 4BK5C 3G5WA 3ASNB 2FQFA 1CUOA 1XB8A 3ABMB 2XV2A 2DYRB 2X87A 4YSPA 5B1BB 5IY5B 3QJQB 1NZRA 3GYRA 3UAAA 2XWZA 2XXFA 3EH5B 2PP9A 6PAZA 1JZEA 4DP5X 4Q89A 4YSSA 2WO2B 3AG4B 2EIMB 1IBZA 4BWWA 1A8ZA 3X2QB 1X9RA 4KO6A 3DTUB 4KOBA 2BWIA 3V9EA 4FA7B 4YSRA 1JZJA 1EHKB 1JXDA 1MG2C 6PCYA 3CVCA 5B7FA 3UAEA 2DWTA 1KCWA 2E86A 2CALA 4P5SA 3S3CB 4A66A 1A4AA 4UAHA 4JKNA 3T9WA 1CYXA 1ADWA 1ETJA 2B3IA 2W88A 2HZHA 3CVBA 4BXSV 2B08A 1VLXA 3FS9A 2OV0A 1PMYA 2FNWA 4A2GA 3TBBA 1DYZA 4HHWA 1AG6A 3FT0A 2I85A 1KYAA 2IWFA 5EHFA 2IH8A 4EF3A 2GHZA 4M4RB 1E30A 1PLAA 2DY2A 1L9RA 2VW6A 3QPKA 3MBWB 5TK4A 1L9SA 4P5RA 1J9SA 2XV0A 2X88A 4E9VA 5B7MA 2TSAA 3OM3B 3UGEA 3ZDWA 4HHGA 1NIEA 1B3IA 3H4FA 1WA2X 2YARA 3ASOB 2ZOOA 2WO3B 1GS6X 1WA0X 1ZDSA 3AW5A 3WKPA 4A67A 1CYWA 3NSCA 3AZUA 1NIBA 1OV8A 4DP4X 5FC9A 1AZNA 2GSMB 3D12B 3NJMA 1URIA 2YAEA 1FFTB 2PP8A 4A2HA 4E9RA 5PAZA 5I6KA 2YAHA 1ZPUA 2RACA 7PCYA 1BAWA 1L9QA 1A4CA 1V55B 2PP7A 1R1CA 2BO0A 1ZIBA 3AG3B 3L45A 4YSTA 2PLTA 2YXVA 5I6PA 1MZYA 2CCWA 1AS6A 4AKOA 1NINA 1RKRA 4FAAB 4CSPA 2FT7A 3GXUB 3FSWA 3WI9A 1QLEB 4E9XA 2IDFA 3GDCA 2GB2A 1JERA 2W8CA 1MDAA 5B7EA 3NT0A 1KDIA 2J5WA 3PAZA 2YQBA 8PAZA 1JZGA 3FPXA 1J5CA 1EZLA 4KNSA 1AAJA 1GW0A 3N2JA 1J9RA 2FWLB 4N4YB 2YAFA 1SF5A 3JT2A 1GS7A 3QJVB 1ILSA 2BP8B 1ASPA 1NWOA 1NICA 4NAJA 2BP8A 3NP4A 2IH9A 2UXVA 2UXTA 3NJHA 2TSBA 3CZUB 1AG0A 2PCFA 1MZZA 2XX0A 4HIPA 3ABGA 3TASA 3QJUB 3FSVA 1ASQA 3EH4B 1KV7A 1BYPA 3FU8A 3WNJA 1OCOB 5I6LA 1ZDQA 2BP0B 1BYOA 3X1FA 1T5KA 2BP0A 2P80D 4QKTA 2BZCA 2FT6A 5F7BA 4K9JA 4YL4A 2YAPA 3SBPA 1QNIA 1ET5A 3T6VA 4BDVB 3IEAA 2XLLA 4HZ1A 1A65A 2VW4A 4BDVA 1PNDA 1OCZB 2YAOA 5I6MA 2ZWNA 3OQRA 1NIDA 3OMIB 4W1TA 4DP1X 3C75A 2YAMA 3CDZB 1BQ5A 4M3HA 2DWSA 1KGYE 3CDZA 1KBVA 1CC3A 1L9TA 3PCYA 5PCYA 2JFCA 1V10A 2UXFA 2HX9A 1FWXA 4RH4A 4YSDA 3WNIA 1PZBA 1AACA 1SJMA 1F56A 4BXVA 1SNRA 2VM3A 1NWPA 3NYKA 1X9UA 2VW7A 1BQRA 2XXGA 2YAQA 2LLNA 3ABKB 2ZONA 3X1GA 1JVLA 2MRYA 4JHVA 4W9ZA 9PCYA 1AOZA 1PZAA 1NIAA 1GS8A 3BVDB 1L9PA 4NERA 4E9QA 3OD3A 2XYBA 1XB6A 2J55A 1HAWA 4GXFA 1ET8A 5D4JA 5AFAA 1E67A 2OJ1A 2N0MA 2Y1AA 4KO7A 1TU2A 1W6LA 2XU9A 5I5JA 3T6XA 1GYCA 1MG3C 5AZUA 1JOIA 3RYMA 3EF4A 5E9NA 1GR7A 1AANA 1NTDA 1AR1B 1PF3A 2UX6A 4ENZA 3UABA 4YSQA 3AY2A 4KNUA 5A7EA 5B1JC 2VMJA 1HAUA 1E65A 2EILB 2XVBA 1CURA 2PPEA 2FQDA 4HCGA 1NPJA 1GY1A 1OCCB 3NJKA 1KCBA 1A3ZA 1SDDB 4ZK8A 1SDDA 3MX0B 2HX8A 4DP2X 5B3SB 1OE2A 2DV6A 2FQGA 1JXGA 1AIZA 5F7AA 2H47C 3OMAB 4AKQA 2FJSA 3S8FB 2GC4C 1M56B 3IE9A 4X4KA 4A2DA
chains in the Genus database with same CATH superfamily
4UQDA 3IKCA 2BNRD 4YR6A 3UTTD 3ZQXA 5FW7A 2ZAGA 5E1HB 4U6VH 4AQ8C 5KAQG 4Q9QL 4PH8A 2WLJA 1A3LL 4RDQG 2IAMA 1MHPL 4E9YA 3CLEH 2OMTA 3HHSB 3TZVC 5ENWA 2EICA 4XE0A 3RGVB 3NCCB 2QGEA 4LESA 2EDJA 1SGKA 1T7YA 3TA4D 1PEZA 1IBGH 3T5WA 4GG6F 3FTXA 2AK1L 3T4YB 2JKSA 3LZFH 4JQVC 2NY4D 5JXAL 1XHHA 5GGSB 3NQIA 3VXOA 2IWGA 3NIDF 4M8QB 3X14A 3MUGA 3NEOA 4X4YA 4WUUD 5SX5H 1JTPA 1ZE3C 4JRYA 2BW5A 2AKRA 3DUSB 2EIZB 1O7SA 3LKOA 1LM8V 4H44C 1QLRB 4LU5H 1N67A 4N0CC 1NGPH 3ZE0E 4Q9CA 3I9AA 4IRZA 2GBTA 1A6ZB 5IJDC 3LEXB 3DX6A 3V2AR 4L8SC 5KUMA 1RLBA 5D1QA 3HG1A 3NJNA 5MENE 3I2CH 4JLRB 4AJVA 3RVXD 1A9BB 5BZDB 1D2OA 2WXKA 2NXZD 5F9DC 2CCLA 2EIDA 1GTFA 3OF6A 1TQUA 4NUMA 1MAML 2EDBA 2EYRA 2N7SA 5KN5B 2CIIA 2DM4A 5DMJB 3GM0A 4RMUA 1UWGL 2FHBA 2E47A 2XN9E 32C2B 4U1NA 4Y1AB 2LTQB 3BPNC 4HD9A 5HGBA 1NCGA 4IIQA 4BZ2A 1CQKA 4X6DA 1QSFD 3WIHA 3FB5A 1JG9A 4D9RE 3GZOA 4ATTA 2MTAA 3UAJA 2BNQB 1H3XA 2D7NA 2XPYA 1RPQA 2YXWA 1U8KB 1AHWA 4L3EB 2Z93B 3ZDXE 5DZOA 3BLBA 4XCNA 5CJBA 2CNYA 1OGAE 2WBJA 1VPOL 1SM3L 3TVMD 4TUKH 2Q2EB 3LZRA 4YHKH 2NNXA 1F6LL 1MW3A 5DUPH 4PB0L 2FX7H 2F7PA 4Z95L 1KBBA 2KLSA 3WXVL 4HFWB 1E5YA 6FABL 2Z1KA 2O5ZL 1YYMH 1YMMB 2C9UA 3DMMD 3GMOB 1XF4A 2WMPB 4JKWA 1R3JA 2EUWA 2K3HA 1UM4L 4P2QA 3FYIB 3GS7A 3VCLA 1ZSHA 1ROCA 4JFUA 4NN6B 1JBJA 5B4MC 4DEPB 4UBDD 3G6JF 4QXGH 4HCIA 3UFIA 3LPPA 1ORSB 1QFWM 3HMXA 3MREA 4NKIH 5B3JE 3B9KD 1RK0A 4XB7A 3UTSB 2EEXA 5CINL 1VA9A 4MS8C 3WHE0 1TCRA 4HUCA 4NENA 2Z35B 5AB0A 5TE4H 1F4AA 1A5FH 1UT2A 3LY6A 1M9WA 5HJ3A 3LN9A 3PL6D 4YEEA 3KCPB 5HYSG 2Y7MA 2YLKA 2FLMA 3VDBA 4N85A 1J1PH 3CFUA 2K6YA 4P04A 3ZKXC 4IBZA 2A73B 1JZ3A 2LFGA 3HI6H 2YGVA 2R1YA 3SDCD 3FRUA 1YNTF 3NFNA 3IB4A 5CAYB 4XNZB 3BZEA 3A6CH 2RR3A 1BVLB 3QT2A 4OLXL 3HI1A 2ESVA 4FFTA 4Y5YC 5CEXA 2E6PA 3PXHA 2QDWA 4GP8B 2PPDA 2H32A 4L8BA 5JW3L 4UQAA 35C8H 1MCPH 3MNZB 1YPZB 2E7DA 5CZXC 1DZ0A 3TPUA 4EOWH 1IGMH 4XPAH 1U9KA 3OKKA 4H2CA 5AYTA 1BZ7A 2WQXA 4EIUA 1NCAL 1Z6JT 2CHZA 2B0SH 4HJ0C 2EH8H 5E6IA 4JG9A 4PJHB 2P5EB 4QHLA 2F19L 2ICEC 3PWPA 4LCUB 1XB3A 3B2UD 2ZOUA 3HUJE 5I74B 1U58B 1CK0L 2XKNA 5EWIL 5I30H 4YUEH 5E8NA 2E27L 1G9NL 1L5GB 5D9SA 1BVZA 1R3KB 2CQVA 3BKJL 2O4EA 2KH2B 1O9ZA 4N22A 3RWFA 3FCTA 3MLXH 1Q0XL 2Q5BA 1V27A 4HJ1A 5F72S 3LQAC 1SXAA 3II3A 3VRJA 3L54A 2F6AA 4DP9X 4TSBH 3JTSB 4IU2B 3MZGB 4AEFA 2Z7YA 3MLZH 2X4SB 5B1KA 3QDJB 4IK7A 4PMEA 2ADGB 3KYOB 1X44A 2A9AA 2CJ3A 3PPEA 4UI2A 2CA3A 2HFFB 4OKVB 1FSKC 2VC2L 4UUJB 1J1XH 3UO1L 1FNSH 1XB8A 4NM8H 3C08L 3N41B 3WO4B 5DYFA 1WBXB 2WQSA 2WNKA 3BPLC 4MCYB 1JK9B 4NRZA 2WGNB 2CDGB 3BLKA 3FFCA 2J44A 5AOLA 4JRYE 2I9TB 3HE7B 4E41D 2WOYA 2B39A 4B9CA 2WO2B 3AG4B 3DGCR 4J8QA 1Z5YD 3KYNA 1EAPB 2YN3A 1FH2A 4KOBA 4IHOB 5F1SA 5ACMA 2QKSA 5C07E 4DQOH 1IFRA 4FZEL 4ENED 2BS71 2JVUA 3UGUA 5LGJB 3MLWH 3HG1E 3NFSL 1JRHH 4XMTA 4AXWA 2E86A 3C87A 5DHDA 1XGUA 2EUXA 2O6CA 4FXKC 3ULVF 1ZVHA 3UTOA 2LLGA 5ETUA 3VI4A 4LLYB 4UOQA 4MMZA 1ZGLB 4OQTH 2WUCL 3GMNB 3IFPB 2IVFC 1O5PA 2WXIA 4H0LC 1RH8A 3MN8A 2OSYA 4JZJB 3TCLA 4U1GB 3BUYB 2W80C 2IAMC 4DKAA 1FAKT 1EV2E 3HAEA 4HWBL 2I85A 5FOJA 3RL1B 3TM6A 1KJ3H 1EJOL 4NFBA 3RGVD 1AY1H 2X4QA 4PWFA 1PG7W 1RUQL 2XN2A 3LPOA 3QULA 3DI2B 3FK3A 4HIJA 3ETBJ 4MD4B 4XTRD 3MLSH 4PRAA 4YXKH 3QA3A 1TTCA 4Z5RA 3MBWA 2DMKA 3BX7C 4FRWA 2EDFA 4W6XB 3WN5C 5KSBB 3LS4H 1F90H 3DTXA 3RIFF 3X11A 4XN9A 3FFDA 5ESVA 2GCYB 1CD1A 5DA4A 2W9DL 3BN3B 3POHA 5JZ7C 2VITB 3RWIA 4KVNL 4ZG1A 3WKPA 4F33A 2UY6B 4F7PA 3E0GA 4DN3H 1NL0L 4YQXH 2GFBA 2AQ1A 1NIBA 5CP3A 12E8H 1F8TL 3Q8EA 3BSZA 4KVCL 4O00A 2J43A 1CD8A 4D2NA 5I6KA 4Y4HB 1Q0EA 5HJBA 4PUBH 3DETC 1RK1B 1F13A 5DD0H 4F8PA 2OQJB 5I75B 4DVRH 3OBAA 3DYMA 3P9MB 3QPQD 5DK0B 5SWSB 2FGWH 2N4IA 3SE4A 5CKAA 2K3TA 2ZUYA 3OKDB 4Y1AD 3UZQA 3FF8A 3SE8L 4HWNA 4N2BA 1SEQL 5HGAB 2WM0A 3MLTA 4ZMNA 4JRXE 1S7VA 2HFEA 5H2BB 4DO5A 4YXLL 2BNQD 1YC8A 1CDCA 4ELME 2ESVE 4L3ED 4AYGA 4PW4A 4FF9A 2EDOA 4OCXH 2WBJC 5TDPA 3F7YA 3S2AA 5FYJU 4GW4A 3R18A 5GZOA 2YZ1A 3V7AE 4YHMH 1CLVA 3DURB 3EYSL 5EMYA 3V4VL 3MNVB 4I48B 4NQQA 1ZXQA 4IRJA 1YMMD 4I18A 4GKSA 4RNRB 3TJEH 1I1YB 3PWPE 3FW6A 2B1AL 5D6CA 3WFCL 3L3HB 3VFSA 5B39B 3GLAA 5BZXA 4QRSB 1FJ1B 3JXAA 4CMMB 2H9GA 4FI7A 3K2KA 4UT6H 1J5IA 3T8XA 1WLHA 3FQTA 1S9XB 2VMCA 4HOMA 1BWMA 3T0DA 1UOKA 5CILL 1CLZH 4FEMA 4BYHA 3VD0A 2Z4QA 4YL4A 1X5HA 2Q8BL 1YEDB 3DOIA 1OP5H 2ZXQA 4M00A 3FOMB 4HZ1A 1USQA 4P2OA 1DQLL 2GEQA 1GC1L 4P9HC 5BW7C 1T3FA 3TWCH 3SQOL 1BQ5A 4OFIA 4P5TB 4BFGA 1G6RB 1ZVNA 4GQZA 3DOHA 4HT1H 4JFEA 4QRPE 4NNPH 2V5RA 3TYFB 1A6UL 4KJQC 5H4YA 5JOEA 1BIIB 3WUZA 3RTQC 1XGYH 4LPCA 3V8OA 5BQ7B 1K2DB 1XV8A 4YHNA 1MI5E 3W81A 3ET9F 2N1KA 2BVQA 3FFCE 4HMCA 5AVQB 4Q9RL 2XY1A 3QNZB 1JV5B 1UKQA 2E3VA 5L2KA 2YD3A 3PABB 1TJGH 3FUJA 3OR7B 4KQ0A 5E6IC 4XNYL 1SHMA 3ABKB 1R75A 4HGWA 3IGKA 1X5KA 5J9PB 1XIWA 3B5TA 1P5UB 4TSCH 5KVEH 2P5ED 3JYBA 5ANMA 3HNVL 3MRHB 3X17A 4JAMB 2H8PA 4B9ZA 2CKBA 2ZQKA 1EEZA 3P77A 3CSYB 4Y89A 4HG4J 5G5DA 3KAAA 1YPZF 3Q6FB 4WU7A 5D7KD 1MCKA 5K9OA 1CZ8H 4XP1H 1J7VR 3QO1A 4R3SB 5IB2B 4AQ1A 4LFHG 2X38A 2YJQA 1GR7A 1CLOH 3U6XS 4TTDD 5I2IA 2YUXA 3CSTA 3IRPX 3QUZA 3RB5A 4MZ3A 1WGVA 1I7ZB 1X5FA 3MRJB 3QDJD 1A6WL 1B2WH 4L37B 4ELDA 1LWHA 3OKYA 4H8HA 5AKVA 1OP3H 1WZAA 1BF5A 4FCAA 5GS1C 4BFNA 1J86A 4LP5A 1KMGA 1PKQB 1S4IA 4EKXA 2BSED 1NDGA 1WTLA 4FQXB 3U4AA 1JGEA 5IVXA 2BLFA 3NJKA 3MR9A 4M93C 3ZTEA 1K5NB 1WV7T 1PTZA 1PSKH 2FUTA 4HKZA 4Z76B 3KPQA 3HE7D 3BH8A 3QIWB 5ID0A 1FCGA 1HTYA 4BEIA 3BGFC 5DWPA 2GW5A 4LP8A 4M43L 1D3CA 1NJ9A 3V0AC 2WLKA 3AGVA 4NP4H 1JGDA 3VWJC 2P28B 2W0LA 3IE9A 4NM4L 3P0YH 2BOCA 2CO4A 3D4ZA 1PG7L 3N41F 4FC3E 5T1JA 5EEYA 5TE6H 1AH1A 1DVQA 4E36A 5C1MB 4J6RL 3H0TA 5JMRA 2WIIB 1MJUH 4ZFGH 2R0LL 3T4AC 3V52H 4ZFZB 1U33A 3KYKH 4IBLT 4P2RB 4IOSA 5DR5H 1V54B 4I7ZC 4TUJA 4EUPA 2X0WA 3SBRA 5C0GB 5ICYB 2VMDA 1UXSA 2GY5A 2OR9L 3KJ4C 3O6KL 4NI3A 1U3HB 4DW2H 4NB7A 4X8JB 4CC4A 2ENQA 5D1ZA 1AQKL 4R7DB 1RVFH 1FHGA 4KY2A 4A7TA 2HVKB 3L4XA 4XP4L 1X7QB 5IBTH 4GRLA 5FCUH 4XWGL 1E4KA 3CU1A 2CUAA 2EINB 5E56A 1IKFL 4KBPA 1MREH 1XH2A 3APFA 1F4XH 2O5XL 2NYYC 3WHE1 2B1HL 4UYQA 1KC5H 2H26A 1DE4B 4N8CH 5FR3A 4F37K 2CBQA 1Z7JA 1K72A 4AYFB 4OLZL 3VE0A 1EDHA 5D1XA 1NAMH 4JX0A 2X9WA 3HZ3A 4IKJA 4YNYA 3AITA 3NCJH 4NQVB 5CJ5A 5E5LA 1UYWH 3WIIL 3NCYP 1K3ZA 5KSBF 4Y4HD 5F0JB 4Y4FA 1IEAA 3L3GA 5J1TC 3C5ZA 3B2PA 4WW1A 3ZYIA 4G8EA 2GSGA 3GSUB 1CIUA 4KH9A 5EC1B 4Q2ZA 3JBG7 5AKTA 3SE4C 5SWSD 2EXWD 4ES8A 1SY6H 2W0FA 3QO0B 5LXGH 3LN5A 4Y4KC 2I5YH 2EVIA 1BMWA 1YEGH 4ZUUA 5A2LH 5C0EA 4HEMA 2IPTL 4JFEE 5DRWB 2E7MA 1WFUA 1U8LA 4NBZB 2B5IC 2MCPH 3FTVA 2IBZX 5AUMA 3C2AL 1U2CA 4PJBB 3DGDA 3SYCA 4MRBA 3FUHA 2CUHA 1ZLVH 3VI3B 4DEUA 1O0VA 4MA8H 1BHGA 2CRYA 3QDMB 1HHGB 4FLHA 4LSTH 3LNFA 3BGMB 3A4EA 1X5MA 4KKCC 4AQAA 3UOAB 2DW5A 3CG8A 5L2KE 5HVWA 2MIZA 4KKBD 5MEOA 1TSRA 2X10A 1AJ7H 3UBXI 1D7CA 4GMSL 4ZTOH 3IFLL 3OAYK 1RY7B 3FYEB 1HWGB 3EYFB 3HZMA 3ES6A 4JPIA 4U1SA 1RP8A 5ANME 4BFBD 4BSJA 1CU4H 5A1AA 1OGPA 4YL9A 5SWQB 3GBEA 5DEJA 1Z9PA 1WHOA 2FWOA 4PBDA 1RJCA 3DI3B 2Z65C 1JE6A 4MJ6B 4RWYH 4FXGA 1A3RH 1MCNA 3IJ7A 1UB6B 2AJVH 5IR1A 1R5IA 4NKOB 3I6LD 1ND0A 2Y69B 2FR4A 4O2EB 2ZYHA 4KKPA 1P7QB 2ATKB 4G72B 2VRQA 4K8RH 4LASH 4KZDL 3CZNA 4B5ZA 5ADPL 4Z23A 3NIGB 5CCJA 1LMKA 4P5TD 1MQKH 1PD6A 2CO7B 3NACL 1OAYL 1P84J 4Y5XB 3IDJA 5C0RL 2QKIB 1CXEA 1QP1A 1MCJA 1TQCB 2F7OA 4MAUL 5CGTA 5E94A 5EDSA 4FQ1L 4XGZA 2PR4H 5A3ID 1KBKA 1WPCA 2Y7SA 2IDUA 1T21A 1R33A 1KTDA 4M5YH 4I89A 2G0LA 4LVNC 3DSNB 3MRKB 3VFPA 1T1WB 4G71B 2WXHA 2CO1A 3OJ2C 4KOCA 4ZMVA 3QQ9D 1BVKB 1VIWA 3CMGA 5DRNA 3ROOA 3AS0A 5AOZA 1LDPL 3D08A 2I32A 2VDNL 1ZHBB 1MJ8H 3B2XA 1IE4A 4MA3B 3IMWA 2HRGA 2HWZH 5MEPA 5F8RC 3TL5A 4HBCL 4I4WA 1OPOA 1ITCA 3ZE1F 4NJAH 2ZAHA 1HIML 4HUWA 5JR1H 2R7EB 4OZHA 3GMLB 5E9AA 3IMBA 4F7MB 2FL5B 4X7TA 2Z7WA 3PIQA 4GO9A 5FXCH 2EXYC 1NC2B 3ARDA 1QYGH 4FQIH 4PJAA 4X42A 3TV3L 4D0CB 3EJUA 3QUZC 1BX2A 4PTTB 3IETA 4JR9L 5KTEH 1QSEE 4HLEA 5JHLA 4LCCC 4YHIB 1MNUL 4E9LA 4YSPA 1LEIA 2BFVH 1NZRA 2AQRA 4W9CC 3T77A 5TDNA 5H94A 1E27A 4JDZB 3BDYL 2XXFA 1X5JA 3WFEL 4PJ8A 4MNGB 4FQXD 4HKJA 5M95B 2L04A 2RJMA 3WS3A 4UIMA 3O6MH 2E7CA 3S36H 3MJ7B 4PIBA 2X89A 5CD5D 5AYUL 5D1XE 1KTKE 3QIWD 5LXVA 3NRQA 5DMIH 1IGFL 2FYVA 4G43A 4I5BA 2IADB 3LXBA 4P9ML 1BDYA 1BEYL 2QZQA 4MB4A 4YBQD 4YPGA 5ECJE 1DN0B 4PG9A 5GRUL 3LZNA 3RQ3A 1JZDC 4FP8H 5IQ7L 2X12A 2PWHA 4XMPL 3I74A 1NA8A 2VE6B 3KHOA 2H1XA 4KROC 4N8VG 2OL3H 1T83A 1FRGH 4LPXA 3BO8B 3WN6A 4AITA 1S7RA 4OLUL 4FTDA 5KOMC 1NKRA 4NUQA 1A1MA 5EZIL 4X6BB 4P2RD 4LEXH 2BHZA 1DQJB 2IWFA 4JO1L 1KZQA 1AGCA 4PV9A 4DGYH 1OQOA 2D03H 4HEME 3OKNA 4JFOA 2UVFA 2G2RA 1MIMH 3UG3A 2FIKA 1NAMB 1U3HD 2LR4A 4CC4C 3GI8H 1HEHC 3QORC 5GGRA 1KN2H 3RFRA 4K5NA 1FGVL 3DHMA 1B3IA 2EDNA 1YEIL 1NAKL 2XQYA 3O0LA 5C0ND 2D0GA 2LVEA 4KMLB 1ZDSA 4OI8A 5FGCE 4U6XB 3LRGA 2FZ3A 2QLYA 5HJDA 1FZJA 2JB5L 4XP5H 3BUTA 2JWYA 2OMWB 4XAWH 4M62L 1S5IL 4NN5C 1GKEA 4PJCE 3MRMA 3LH8A 3RNKB 3P02A 4ZDHA 2WXFA 2YAHA 4YXHL 3WY4A 4AT6A 4HWBA 2KZ1B 5DD6A 4ODSH 4TNFA 4HKBA 1XQ4A 4ODVH 4AKOA 1WAAA 2H0JA 2ZCKL 4Y4FC 3C5ZC 2FT7A 4B50A 2Z7UA 4K15A 3MACH 1CD0A 3TBYA 2F8VA 5CJ8A 2IDFA 2WNWA 1SXBA 3B2MA 4J4PD 1OCWH 1S8DB 2J1YA 3C6EA 3KPRB 3K7UA 5CUSH 5EZLA 1KDIA 3RIAK 5I1AA 2J5WA 1AC0A 5HHPA 5CGMA 4EZKA 2O5NA 3WTTA 5JPNB 1JPFB 3W9EA 1X5AA 4P8QA 5FYLL 3BPCB 4KJWD 1FO0B 3L2MA 2NNAA 5BV7L 1OLZA 4W9HC 5DO8A 4WI4A 4IJ3C 1HQ4B 4Q6IC 4GW1A 2UXTA 3RAJH 4QD2E 3UPAA 3P2BA 3RZCC 3QDMD 1K8DA 1AG0A 3J27A 2BDNH 2QVMA 1KBGH 1Z3GH 4PI0A 3HS8A 3IJYB 4P3DB 3NOIA 1PX8A 2Q2LA 2WN3A 1NMBH 3EH4B 4L18A 5I5RA 3ZKQD 5IEKA 2BOBA 4K71B 2AEPL 2VYRE 4F7MA 4ZYKA 2IANA 5BVPL 4OCRH 1Z0MA 5DVKA 2MPAH 5DYOA 5E2TL 3RY6C 1R3IL 2YD8A 3NA9H 3U0TB 3SBPA 3VI3F 5L0QC 1ET5A 2C7UA 2CJUH 2HTKD 2AI0L 1RL1A 3RBGA 3L9BA 3MRBB 3STZA 3BMVA 2OI9C 2ZIDA 1R0AL 2Q3AA 4JZNB 4X9GA 1EA9C 3GNMH 4OZHE 2ZWNA 1OPGL 3WIFA 5DVNA 1BQLH 5BS0B 4FXGC 2AQPA 3EGDB 2V17H 4CBZA 1N6QH 1RLWA 3MRIA 3MCLL 2NNFA 1B0IA 2VAJA 3JV5A 2D7TL 4UQIM 2QBWA 4WFFD 5PCYA 2IJ0C 3V4VA 3ZKMC 1P7QD 3HZYB 3M7FB 1N18A 4KKQA 1ZJAA 2WN2A 1AMXA 4FFYL 4Z7OB 2L7QA 2QZ5A 1RZIB 4PHZA 3KPMB 1N5AA 3CQFA 4U3HA 4F92B 1NGYA 5KYWA 3FQWB 5FYJH 3RVTD 4IOIA 2ID5A 3N0AA 1ZY9A 4I2XB 5D7JC 5I18H 2XXGA 3W0WA 4XC3H 5J57B 3HVNA 2B8OT 2EC9U 4JS7A 2J6EA 4JHVA 1PZAA 4QOKE 1ED3B 4MJ4A 4NO3B 2ZX9A 1QFUH 4IBUA 1GGBL 3E6HA 1TDQA 1AI1L 3FU5A 3NIGF 3QUYC 5FCSH 4XNXH 2VISB 1C1EL 3IJ9A 4GXFA 1KCUL 5DJAB 4LLVB 1U92B 1H3VA 5EU4A 4GQQA 1VEMA 3RLSA 4MD0B 4WK2B 1GYCA 1G6VK 4N1CA 4GUCA 2WZPD 4G8GB 5E9NA 5IMKB 3FQXB 1ZLDA 1N64H 4NUGH 2YQGA 4TN9A 3CZFB 1XCXA 4IMKC 4DAGH 5IBUB 4HIEA 4DFIA 4TQEH 1NC2D 2VLJE 1PDKA 4LCYA 2EILB 1UACL 4G9FE 1V8HA 1B0RA 1WICA 2X4TA 4DGUA 1SYVA 3BXNB 4HCGA 1N4XH 1HCYA 3KE0A 4LCVA 3WLWC 5CJQL 3QCTH 4U7SA 3FQUB 4XMZA 3FCGA 3EFOA 4MXWL 2ED7A 3ZL2A 1F5WA 1T7VA 4LLMA 2OYPA 3HS0A 3KGRA 1KOAA 2WLLA 4PJ8C 2B15A 3MYZA 1Y1UA 4S0TD 3ENEA 1AIZA 3LXAA 4JRWA 3CXHK 4Y9FA 4GKNB 1I9EA 4YH6A 4AENA 3SE6A 4HJIA 2FEDD 3P4LA 2Z1PA 5EU6A 3TT1H 5L4FA 3BCFA 1ZLSL 2WKOF 3C5SA 4PB9L 2Y2YA 5IROC 1GYAA 2GEEA 3L7EB 1HKLL 4OU3A 3QZWA 1QX1A 1GHFL 1G1CA 3UBXG 3L3IB 3W5NA 5JXED 2RFXA 2ZUXA 5EUOA 4XPFL 2VLRB 2M8XA 2W92A 5AW4B 3SDYH 4BWUA 1FHNA 1RSYA 3CN3A 1HN1A 4XN1A 3PHOB 3M6DA 5H37H 3CC5A 1IRAY 2EIKB 4OFDA 3QQ4A 4LSPL 4O2CA 2WUBH 4ZXBA 3G5XA 2QR0A 3ZKND 3QUXB 4KK6C 4NRYA 2DKUA 3ZE2B 2ZSVB 2CU9A 3UZVA 1DBKL 3AXLA 3LRSB 2JJSC 2VXQH 3NJIA 1MRFL 4GP4B 5DJYB 5FX3A 4DPRA 3Q8BA 4RA3A 3ZSSA 1I3VA 3IMRA 4F7KA 3KPSA 3ARGC 3B2VH 2GIXA 3DSFH 1UZ6F 1YLBB 4K7PX 1MCHA 1SPDA 1UVQA 4CSTA 5T1MB 3WNLA 4PRPE 5ESQB 2CDFA 4ANUA 4E42A 4K9EC 4KDWA 5E95B 4GRMB 4QO1A 5A6IA 5IW6B 4W9DC 3LKRA 3NCWA 5ANHA 2YEZA 1JXJA 4GT7A 4WI2A 1YUHA 2F8XC 3IFNL 1KLUB 3AQYA 4MBOA 3NESA 4N0FB 3ATEA 4Y9BA 1OTSC 1PYWA 2IANE 4DK3A 5IIEB 4LOEA 3AM8A 4WTWA 5GHWH 2RMNA 2CAKA 3GSNH 1QI3A 2JJVA 1B88A 1HSBA 43CAB 1ERNA 2DL9A 3D69B 1LD9A 3QUKB 5GS0H 4KRLB 1FAIL 2IFFL 5F9WC 1JGLH 4E5XB 3GJEB 3QRBA 5EOQL 1BPLB 1HEJC 3MLRL 5EEZA 3H7LA 3HEIB 3PP4L 4NN7B 2XVLA 4I77L 3LIZH 4NFCA 3SO5A 4CL7A 2P24A 3KPRD 1TQBC 2EQDA 3IDGB 1XGQA 4G5AA 2UZIH 3MRNB 4OFQA 1DBJL 2DQIL 4XNUL 2WWKT 4L05A 3IJEB 3LN4A 3TN0A 1RZPA 3VGHA 4MBRA 2HRPH 2MPVA 2J12B 2WY3B 1OAUH 5EBWB 1RZJL 1M05B 1TMCB 4PJ7E 4M7KL 2ROXA 1GH7A 1C12A 2Y5TA 3P73B 2M1KA 1JHTA 1TO5A 4PWJA 4AYBA 4XMKL 4JJ5A 4B3EA 2AV1B 1ONQA 4GG8B 3EXLA 3JWDL 2P80A 1YEEL 1I8AA 3NK4A 3ARFB 4YOKA 3V0GA 1IO4C 2ATPB 5TE7L 2Y6TE 5TTRA 2XZQL 3F3HA 1SFHA 3SYQA 4K8RD 4ZUTB 2WQUA 3G5ZA 4QF1A 4BIKA 1J5OH 3B7YA 2VDOH 4O9HL 1T2JA 1VFUA 3N42F 3D85B 3CUPB 4AZUA 2WYZA 1DBBL 3GBNL 2WP3O 1LL1A 4LHUA 1HZHH 3T0EA 3JV0A 5IT2L 5BVJA 1M7IB 5AW2B 4AC4A 3ECWA 4S2SB 1XR8A 4RGNE 5BS0D 4KNTA 5AVTB 5D6DA 4LEBA 4OJDH 4U0QB 5D2LE 3QXAA 4TRPH 1V3LA 4JQIL 43C9A 2XTSA 3VD5A 2YK1H 5JPMC 4PYGA 5C0CB 3ARXA 2DICA 4R2GC 1T22B 5JQ6H 1UD2A 3SDXA 4IRZH 2ARJA 4HKXA 3HC4H 1LWRA 1SLVA 1MDTA 3GSOA 4JL1A 1FLRH 1FBIL 3BH9B 3QBTB 1TNMA 2DQDL 4DN4H 1LO5A 1PY0A 3TNNB 5JHDA 3RFZA 2GK2A 4W6YB 4ZMQA 3VD1A 3HMWL 4OZ4B 3DVNA 3U4EB 5EA0H 1JGIA 3APNA 4WHTA 5EU6E 5A2IH 1CICB 1VACB 1CFQB 1G94A 4CMHB 2CBTA 1KYOJ 3DX4A 4L0YA 3R19A 5BUGA 3GM8A 6TAAA 1AXTL 4KKAD 3NJLA 5FAAA 3I6GB 1I31A 5JQIB 2OTUA 3IU3B 1GGYA 1T4WA 1ZA6A 4Z7OF 4OBSA 3BMWA 3HRZA 3I50H 4ABQA 1A9EB 1KIRB 2R56H 4U1HB 2D7PA 5FHBL 4G7VL 1WS7A 2IH3B 2CUMA 2IOMA 4PW3A 3TO2B 4N2CA 3FSZA 4KKLD 2VRKA 3BRFA 5DQ9A 2X2JA 3OVUB 1H3WM 5I1LA 4JHWH 2WZAA 2VMEA 1XDTT 2NYKA 4G8GD 3FH8A 3OKMA 4G6JL 2NW3A 4UINL 3N40P 2JCCB 3MUZ1 3ZHLA 1HILB 4QCIA 3LKQA 4P49A 4Y2NA 3V4UH 3R1GL 4RETB 3X3GL 2APVA 1ES0B 4YMPA 5EOTA 1BCIA 2DQEL 1MCSA 2MQ3A 5FK9A 1PX4A 4JDTH 1Y18A 3PQYA 4N6RB 4C4UA 3UX9B 3J8F7 4HUMB 5C0IB 1SBSL 2D3JA 5G2NA 1DVYA 1K9TA 1RERA 1KIQA 5C0BA 5CMAA 2X6CA 5FW6A 4JPVL 3HS0C 1QUNB 3X2QB 3DTUB 3NPZB 3PS6A 5DS8A 5DO2C 4WTZG 3I02A 1JZJA 1V7NH 1DSWA 1MFCH 1Q9LB 2PR9A 4PI2A 3RWGA 2CIKA 4QEGA 2WVUA 3AUWB 4GW5A 3MRFA 3O2WH 4A66A 5HHQA 5ILTL 5FA3A 5AVSB 3OJMB 1TCMA 2E9GA 4Z9KB 3F7KA 3H55A 4JFDB 5DLLA 5INDA 3V4LA 3TTSA 4NPJA 2O30A 4GS7C 2IEPA 4XBEH 2J88H 2MEJB 3E2HB 5AW7B 1DUYA 1EO8L 1HOCB 4Y88A 3V6OA 5EOCH 2VDRL 1KEGL 3PXJA 5IKCB 1AG6A 2VLRD 2ZZUT 4XO3A 3APCA 3SN6N 4A04A 3KLAA 3NPSC 4I9XA 2E74C 4CU8A 2D3NA 1YEJH 2CBOA 3MBEC 4HG4K 1VSCA 1WZKA 4DVBB 4P5RA 3GB7B 3FQ4A 3HC3L 1HZLA 3QUXD 4J5VA 2J8HA 2NR6A 1H6EA 1CFTB 1EAJA 2X4UA 2XTLA 3SCMA 1RZKH 3HR5A 3C09B 4DWHA 3S5LG 2WO3B 4Z1PA 3R0MA 1TJXA 3GSNB 5BZZA 2J25A 3TCXA 4FKHA 1LXMA 1NLDH 2OTWB 4NX0A 3SSGA 5BNXD 5DTFB 3ZO9A 1AGFA 2ZUVA 4D9LH 2YBRA 2GSMB 3D12B 4RMTA 1KZYA 1RUKH 3LEYL 3NJMA 4BQCA 4ODWB 1JHLH 4JNXA 2PP8A 3ZE2F 3GINA 2YA1A 4LPVA 3P4MB 3U1QA 1O6TA 4TL4A 4AQEA 5DHYA 2IBBA 2UWEB 2Z31B 2HG0A 3P3UA 4HEPG 3PGDA 4EZJA 3AG3B 4AYMC 5I6PA 3WUWA 1UA6L 4FAAB 4IDJH 1U8PA 3ZY7A 2YPVH 5BZWB 1TVBB 5DGRA 4LSRH 4HWZB 4OCSL 4YAQB 4U1LA 1T7ZA 2WLIA 2RIKA 2F18A 3KXFB 3MO1A 4C8XA 1N26A 1MDAA 4CADB 3NCFB 3RWJA 2JQMA 5I71C 2WLZA 1VFBA 1RMFL 1YO4A 2QQKH 2E9IA 1ZTXE 1FV1B 3MV9B 5HPMA 3LPWA 4XVJH 5IFJA 2V5TA 3RA7H 3I85A 1U8CB 4P46A 2ENYA 3JT2A 3EUUA 5L4IA 2XWRA 2AJXL 3PY9A 5CGYD 3SDXE 3GC3A 2AJ3B 2OLDA 3SPIA 3UPRB 4OM1H 4RAUA 3QCUH 3OTTA 3CHQA 4FG0A 2CPUA 4C56E 3DV6B 2GJ6A 5JHDE 3ZMRA 1P1VA 4XOCA 3CPLB 3QR1A 2LLLA 2PABA 4O02B 1JP5A 3BW9A 2PN5A 4XWOC 5C0AB 1WEJH 1SZNA 3SDDB 3MBXL 4ZW3A 2WQRA 1RUML 4LARH 3LMJH 1PZ5B 5C86A 1CFMA 2XG4A 2YOCA 3X3FH 3DRQA 4MB5A 3U36B 4XPGH 1S9KC 1FI8C 1NCCL 4S1DD 3ARFD 1H5BB 4F1SA 4BDVB 1QQDB 5EF3A 2EUZA 3S3JA 3JSSA 1A65A 4JG5A 4UQ9A 4X80L 2VL5B 3OSVA 5I6MA 3KCWA 4ZFOL 3D85D 3OR6B 5CU9A 3C75A 1HHHB 3AXHA 3CDZB 2HJLB 3P2TA 4FMVA 4W4NA 4NQCB 5FYJD 1KIUB 3FT4B 5GRVL 5EEUA 5BOZG 3TBTB 1S7SB 4NYLA 3PGFL 2ZICA 3MCKA 5LNDA 2BIMA 1AACA 4IS6B 2YGQA 3EO9L 4OCWH 4UDUB 1IMHC 3PG2A 2BSCA 1DVFA 3M1OA 1IC4L 4XP6H 5E5RB 5C0CD 1ZV9A 3IGAA 3PYCA 3GKZA 4WJG3 2QSCH 2FBOJ 2ILLA 1GTNA 4WY7H 5SV4A 2NQCA 2V7HA 3EJZD 3O8XA 4JG0L 4UIKH 1XWVA 4OTXH 3RFZC 3ULVL 4OD3H 3VXUA 4WSGA 4YFLF 3GSXB 3H2PA 1MFDH 3MGAA 2G9HA 3VVVA 3TBVA 1QOKA 1R24A 3QQDA 4QRRB 2R2EA 3ECBA 1CICD 2KZWA 4JFZH 3RWCB 3T8MA 1O9VA 2VMFA 4C4BA 3MNWA 4A7QA 1QWNA 5C0DA 3N3EA 3REVA 2X40A 4N2AA 3HRZC 4XI5D 5E1IA 1BOGB 4TPRL 4BCZA 4R97B 3WNNA 1EGJA 1P5VA 1F3DH 2AJZB 4LSVL 4UDTB 1CT8B 4PJDB 3P0GB 3GTNA 4FFYA 4ANXA 1FLTX 4OF8A 1RHHA 5E8PB 3VA2C 2NDGA 3FO9A 3NZUA 4P48A 1NC4B 1A7PH 1WUZA 4Z3FA 2XVBA 2VXSH 2EYTB 1WZ1H 4XMUA 1ORQA 1OAXH 4L23A 4R83A 5HVGB 5T1DL 1MW2A 3LZPA 4C83B 4J3OG 4D7PA 1S9VB 4XVOA 2R39A 3ME0B 2PTVA 3PWUA 3WJLA 3QUML 1VADA 5ICZB 4XN7A 2H4EA 3PAYA 3MX0B 2V2TB 2R15A 3FTZA 4R96A 3MLVH 4YDVA 4HDIA 1UWEH 4AZ8B 5CEYA 1P84K 1S2EA 4YDJB 2W59A 2JCCF 3QEQA 1BOYA 1WFOA 4RAVA 4ETQA 1OTTD 2XA8H 4EBQH 4AL8L 1OSZB 4MB1A 4CVXB 3MU3A 2ZF8A 1INQB 2R23A 1JNLL 2D31A 1E7VA 1FIGL 1IAOB 5LCVH 3V4PA 1PFOA 2WHVA 3EJRA 1NBVH 1I7TA 2Z4TA 2FWSA 4FHKA 2BWQA 4PGDB 2HPTA 3VFNB 3BVNA 3O2VH 4PSRA 1CF8L 3CFTA 4JFDD 5GRWA 4FTVE 4L5FE 2AEOA 3N85L 3BUIA 1BVNP 2I60H 1AS8A 3DV4A 2UZXB 4ZMXA 4Y5VB 2VN5A 1T7XA 2B9BA 1WD9A 1UJ3A 3ZX1A 3MYJB 4B97A 1T5XA 3UG5A 3H8NA 4XNQA 4PJ5B 2X9ZA 1LE9A 3IDUA 2Y23A 3OMNB 2FRGP 4U49A 4YDMA 5GIRA 1MFAL 4UV7H 4DOHE 2H1PH 4U1JA 2NR6C 5CNHA 2AP2A 5LO7A 5A16A 4H8VA 3QFJA 5HHVH 2ZXAA 1C5BL 2GPZA 1B9KA 4P4KA 5I1EL 1SOQA 5ITBH 3ALXA 1AKPA 2A74B 2HTLD 4G9DB 3ZJAA 3JZ7A 5D70L 3WENA 1D5MA 4KK5D 3PAUA 4FQHA 3O41A 3UPCA 1P2CA 2HAZA 2AVFA 3S35H 5F7UA 3D06A 2X2YA 5DZNA 2NY1C 3LKPA 4I0CC 2CDEB 3BQVA 4JUTA 4C55A 4MJ2A 2VDMH 3I9IA 1M6UA 2EDRA 5DJ2A 1NBQA 3O4OC 4QXTB 5KYUB 3MLPA 5DEFB 2H6PB 5I9QC 4G1EA 5DHVB 5CBAA 1Q1JH 4DKFL 4UF7C 5LVEA 2PUQT 2W81C 3PNRB 4Z8FH 1HH9B 5AW8B 3PV6A 3VXMA 4K3DH 5DK2B 2BHFA 2XUWA 3BISA 4NT6B 2HLAB 5FYLE 4EIBA 2VSKB 4WNQB 1BFVH 4JKPH 3QWRD 2YA2A 4U0RC 4UQ3A 3KXFD 4QMEA 3LHPH 1AQDA 3O6LL 1J8SA 5KWYC 4OAWB 2YD2A 4GQPH 3ZPDA 4I88A 4J3TA 4XCFL 2VUYA 4AVHA 3QJRB 4MD5B 4XOEA 3WE1A 2YEVB 3MV9D 3QHFH 4GXUM 4OGYH 3VXQB 4ZMZA 3N9GH 1BAFL 2X0VA 3VDAA 1YEKL 3HLAB 4QYAA 1II4E 4KI5D 4X7DC 4S1SL 3CFCH 3LV3A 4LNRA 5CP7A 4H20L 3D25B 1BZOA 1VFAA 1QBAA 3FCSB 3BIAX 4Z78B 1EHLH 1JZIA 1OVZA 4PRBB 1UUNA 4B9IA 5HYQA 1HQRA 2DM2A 4Y9CA 3VXUE 3C5JA 3WE6A 3L3DB 1BLNA 3FUFA 3MLYL 1CG9A 3RX9A 3QEUA 3E9UA 3AMLA 4AH2B 1BLIA 1OM3H 3CFNA 4KI5F 5C0AD 1NGWB 2VABA 4KHXH 3SDDD 4CVZB 4E9WA 1NCHA 1IZKA 3L5XL 3DJ9A 4GINA 3QC6X 2QPEB 3L7FB 5J6GB 1RZ7H 2OZNA 5IZ7A 4YK4B 1MRDL 4LBEB 3BT2H 3AGWA 1GYWA 1JN6B 3PJSB 1JHKL 5E2WL 2RCSH 3O81A 4EQ2A 5CJXC 3VFUA 2X28A 4J1UB 3GKWH 1HH6B 3WCYA 5I17B 5AZ2H 2ENSA 3IU4H 4B95C 1RIVH 4N3TA 1A21A 3RWDA 2VRAA 2P5WB 4NQSB 5FOBA 2O93L 4AGOA 5DMGC 1F97A 5EU5A 1HFUA 4NQCD 1DLFL 1HX0A 1JGUH 1LILA 4OB5L 3BD5A 2CGRH 2Q9OA 4ZT1A 4UT7L 1XZ0B 4XBGA 3T2NL 1HCZA 1U95B 4GAYA 2YMXH 4ZPVB 1A0QL 1A3LH 1W8EA 3CXDH 4LOUC 1AE6H 3NSFA 1AQHA 4ZTPL 1BFTA 1H0DA 1YYLL 2DYSB 3O8XC 4RFNC 3WS6C 1OE1A 2A3TA 3FMGH 3T1WA 5FHAH 4ONGH 4J7RA 1RUAH 1FVCA 1KPUA 2R69A 4U6VL 4CW1B 2XWBB 1VGKA 3VD2A 3BP5B 3CHRA 2X4NA 2VM9A 4QRRD 2OKMA 3LRKA 5JNYB 3CLEL 4GLRH 4O4YH 5K1VA 1TKWA 1HCVA 3EFFB 3QJOA 4YSUA 1G7MA 4QIRA 1FFPA 3I6SA 4WO4B 1IJ9A 4JQIA 1IBGL 1B90A 3LZFL 4NKDB 5T3ZD 5KW9H 5HYSB 4O51A 1O75A 3O3BA 1QZ1A 2P8PB 2UYLA 4BK5C 3NCBB 4LVOB 3MRGA 3V0DA 2OR8A 3BN9D 3T8VA 4M7ZB 3SKNB 3BAEH 1NC4D 4JDEA 2AXGB 3FTUA 2A6KB 2DL2A 4LU5L 5KANI 2LQRA 1DEEA 1NGPL 1KV3A 1U8QB 3KLLA 2AVGA 3U0PA 3QFJE 2R1XB 1MCLA 3UTQB 4PJEE 4EAEA 3WTUA 2N1TE 1EEQA 4XODA 4PJDF 1TETH 2RB8A 1KB5H 1MG2C 1PEWA 3C60B 3QIUC 2ICWB 3GWJA 4DCQA 1I8MA 1JMXA 2ZX7A 1O5DT 3MV8B 3S97C 1AGEB 1KCWA 4GG6A 4LAQH 2BNRA 1GXEA 3UTTA 1AD9A 2KBGA 1N8ZA 1QEWA 3VYOA 2OX5B 3PGCA 5DZVA 3WKML 1J8HE 1YQ2A 4HJUA 1Y1DA 3NAAH 1A6TA 2KZKA 3GUTA 4AC2A 2NT1A 3CDGB 4L9LC 2NT0A 2QFRA 3QG6A 5DVPA 2OV0A 3WNMA 1IM9B 2WXJA 3EO1B 3VXME 5BJTA 2WZ6A 1MQ8A 3ZGIA 4M9PA 2Y25A 3F01A 3B8SA 2CR3A 3MRLB 2YKLH 5AENA 4CU7A 2YC1A 2EXTA 4U6TA 1FVDA 1TT6A 3REWB 5KJ7E 3F83A 4TUKL 1E40A 5FLUA 3MUHL 2KLTA 2DQTH 5DUPL 4OJEH 1UJ3C 3K8KA 2JF1A 4PJFB 4LHJB 3ZTNH 1KN4H 3BP4B 5BO1H 3U6XA 1YYML 4RZKA 2ZCHL 4JFFB 4OGQC 4PJ5D 5AVYB 2VDMB 2C26A 4WI5A 3CSBA 4PP1C 2QVKA 4PVBA 3K91A 4FQCH 3AW5A 3EOBB 1B4JH 2CM6A 5EZPA 4R7NA 2NLJB 3UJTH 2APFA 3BDXA 2K7PA 1ZHKB 5E4OA 4O2FB 3STLB 1XMWA 4NKIL 3KWWB 2JB6B 2CZNA 5KYXB 1U91A 4BRVA 4DF9A 5FFOA 2NY5L 5KSVA 3P4NA 5TE4L 1A5FL 3P3YA 3A4AA 5E9DB 4CJ0A 1DANT 1ZD6A 1J1PL 3ESVF 4HIHA 2FYYB 2EC9T 4U6HA 2VZ1A 5FM8A 3QXWA 5E5UB 1AYRA 2P5PA 3HI6L 4BHUA 5E5MA 2VIRA 1QSFA 5TPWH 3GXUB 3AROA 3SGEI 4CN6A 2FJHB 5ERWA 3WLBB 3A6CL 2PYEA 1IGJB 5JHLH 2VZ3A 4BQ8A 1XGPB 1OY3B 1LWJA 2A9CA 2F19H 1KJ2A 1TZ8A 3G6JA 4UZSA 5F88B 2E7LA 35C8L 3G04B 1MCPL 1BECA 2P46B 1EZLA 4YBLC 3TVMA 2BRRH 1ZPLA 2VXVL 5EWIH 4GUQA 3FBKA 4N4YB 4EOWL 1SF5A 4XPAL 3UJJH 1FZOA 1ILSA 5D71H 1JTOA 2C4FU 2B0SL 4BSVA 2EH8L 2MHAA 3DMMA 4LLQB 3BT0A 3NP4A 1F4YH 1H3UA 5TDOA 3T08A 3AS3A 3P9LB 2GKIA 4WV1C 5GRYA 3UGXA 5I30L 4YUEL 1RV6X 4HIPA 1PZUB 1QSVA 4Y1SA 5KAQF 2VXTH 2E6QA 1ASQA 1YNTA 4RDQF 2F5BH 3MLXL 1L3WA 1FNAA 3B9KA 3WNOA 4X4MA 2VC2H 2W60A 1T5WA 1F42A 5DHXB 1ZRUA 1BQHG 4NZRH 4TSBL 3PL6A 4U4BA 4K9JA 4N2FA 1IKNA 3T2QA 1MCRA 3K8MA 5I66A 3MLZL 3OC8A 4AK2A 2BVPA 3ZVVA 1SMAA 5A40E 1D9KB 3SDCA 1ZSDA 2EVFA 2BSTA 2SEBA 4GKZA 4LE8A 4LSDA 1NCDH 2NY7H 2YAMA 4OI9A 1KSRA 3C2SA 2DWSA 2NQ3A 4NM8L 1TMQA 1C16A 1OT2A 2GAZA 3EYOB 1G5GA 1SJEA 4TQPA 3LXUX 4OF6A 2CGYA 2P5WD 1PZBA 1OL0A 1RZJC 2BS8A 1Z9MA 4RISH 5IFHH 1BF8A 1UZ8B 3UZEC 4PRHB 3SPVB 2JNZA 2VL4A 3B7RL 4PPTA 2YD5A 1JRHL 3SE9L 4I0PB 5EIIG 5HI5C 2HVJB 1HI6B 2Z92B 2ODHA 5I82A 4AMKH 3CFIC 3N1GC 4UQEA 2RAMA 2OS7A 1L9PA 2E9JA 3L3KB 4D8OA 4GG6E 1J0KA 4LRNH 2Y7NA 4OQTL 2XYBA 1NGZB 2CO2A 4PBWD 3M17A 4ZFOA 1H9VA 3TJHD 4Y8DC 4TQIA 2ZOLA 3V6FA 2VKXA 3C9NA 1DDHB 2PW2B 1LEGB 1KJ3L 2XIBA 4PCSA 4HS3B 2XWJA 4J12A 4LK4A 1AY1L 4XBMA 3CX5J 3F58H 4WO4D 1AR1B 2AW2A 1FG2A 2DWYA 3VM7A 4YXKL 1U6AL 4C57C 3WKNA 4KNUA 3OJDB 4MDJB 1MH5A 1KB5B 4RIRA 5DRXB 4ALAL 5F7HA 2EEFA 4KVCH 3DX8B 4G6AD 4WZ9A 2EVJA 3LS4L 1F90L 4ZAKB 1DLHB 5E6UB 2PTTB 3DX7A 4ZW5A 4YE0A 4E41A 1KCBA 4GKOA 3B34A 4DN3L 5CGBA 4YQXL 3FT3B 12E8L 2NCMA 1OE2A 5LWYH 1LQBC 5C7XH 1W0WB 1HKFA 3M7OA 2Q76A 2KI6A 3U2JA 3KS0H 4JREC 4PUBL 1XGRA 4C58B 5DD0L 4TULH 4ONHA 3BPOC 1OIOA 4HIXH 3C60D 5CZRA 3JV4A 5DFAA 3EJSA 5CCGE 2CLVA 3VFMA 4K5PA 4Y1TA 4AM0Q 3ABLB 3MV8D 4LIQL 3WDJA 3IMSA 5HI4D 1YVLA 1JVOA 3RILA 1VZIA 1IBHA 5F1NB 1FGNH 4F9PA 2O6FA 3QCVH 3TP4A 1AGDB 1MFUA 2C3GA 2ZX5A 4LGPB 3HHSA 3V4VH 2PYEE 1KYOK 3V5DA 3RGVA 1IM9D 5J11C 5KVDL 1OOWA 2NUTB 3QUMA 3ZU8A 4WI0B 4IBQA 3G6JE 4WW2C 3U25A 1CE1H 4OCXL 3WFCH 2GYSA 3VG9C 1E4WH 5GGSA 4MRCA 4Y2DB 1TYEB 3BZDA 1RXLA 4M8QA 3H42L 2Q8AH 4OJAA 5F7KC 2VXUH 1SYSB 2J6EH 1I8LC 1DVUA 4KJYB 4PJGB 1OE3A 3C6LB 4JFFD 3DUSA 3HBGA 3G7TA 4TUOB 3TJEL 2EIZA 4FNSA 3U46B 2I24N 1VFMA 4LLDB 4BWTA 4C4KT 4WHYG 3UCRA 1NSNH 1YN6B 2OMXB 2XETA 4POZD 4QHMB 2PMZA 4UT6L 3SODB 3VU2A 1GC1H 1A6ZA 3WELA 1LE5B 1JK8B 3LEXA 1AVAA 4I3RL 1ZEAH 3AWEA 5HDLA 1CLZL 3RVXC 5FKAA 4X4ME 1YYCA 4PJFF 1A6UH 3E9TA 3KL3A 1BJ8A 1A9BA 4JLRA 1KFGA 4ZOCA 5BZDA 1XD0A 3PHQB 4EVNB 5EORH 3I6KB 5KN5A 3PP3K 3KZ8A 5E9DD 5C9JB 32C2A 4DFHA 4Y1AA 2WLMA 3LPGA 4E9TA 5JORB 1VDGA 4PREB 2XIDA 4HT1L 4ACPA 3Q7JA 4NNPL 3S3BB 3UIZA 3IBOA 2BNQA 4V1DE 1XGYL 2JSFA 4HX1B 5GPRA 3BHBB 4L3EA 2Z93A 1EZUA 4L4VB 1TEGA 5HVHC 1N2RB 1F4HA 5CJOL 1EAOA 1NBZB 3QAZC 2GI0A 1ITBB 2DJSA 1E9PB 5LG6A 1KFAL 5FO8B 2PWGA 2J57A 4Q14A 1QRKA 4HFWA 1CVSC 1YMMA 4G8FB 4ZUWB 4X2UA 3GMOA 2WMPA 4TSCL 5KVEL 5I0WA 5KANG 4NZUL 4FQQB 1MCWW 3D18B 3CZSA 3N04A 4TL5A 3GEWB 4FYTA 3I75B 1XCQB 3O45A 1GCYA 2QDVA 1VERA 3SQRA 4PRIA 1S78D 1DEDA 1ORSA 2FTAA 3A47A 1A22B 3D52A 1HYSC 2O6EA 3HPLB 4XP1L 5F97E 1K3IA 2Z35A 3PL6C 1CLOL 1IKNC 5IQ9B 3KCPA 3VAEA 2NSMA 2VDLH 1M71B 2YD4A 2ITDB 2YIHA 3LVTA 5I5MA 1B2WL 2V2WB 2P9RA 1D9KD 3GBDA 4F15B 4DPBX 5T3XE 4GAJH 3NJGA 3B7TA 1V3JA 1X9LA 4UM8B 2YQ3A 5JW5B 3KEDA 1FYTB 4QYOB 2ERJB 4NM4H 1YDPB 1PG7H 2FH6A 4MMXB 1GSMA 1HHKB 3MXWH 4QRQB 1KDJA 2ZXDA 3ULVE 1PSKL 3UCQA 3MNZA 4E41E 4HJEA 1YPZA 1U21A 5AKRA 4X0NA 2R0LH 3FB8B 1JDDA 3PE9A 2BHYA 3FKUS 4G7RB 2F15A 2C9VA 3E7JA 4FULA 4PRHD 4NP4L 4PJHA 4NQXB 2P5EA 3P0YL 4YDLB 3ABZA 3CDFA 4LCUA 4RMWA 5TE6L 3RWHB 4JDVB 4WKXA 1U58A 2CBMA 4HYTB 2OR9H 5GQBA 3O6KH 4I0PD 2VSMB 4IBVA 1IX2A 2YJLA 1MJUL 1L5GA 3V52L 4ZFGL 2GBAA 1R3KA 4MMYB 3SO3C 1PZ2A 1YG9A 2APWA 3H9SB 4XP4H 1QSZA 3KYKL 3MMEB 5DC9B 3UACA 2ROYA 5DR5L 1H3PH 3DVGB 2NY3C 3QWQB 2ZD0A 3MRCB 5G55A 4F58H 3P9WB 1IKFH 3JTSA 4IU2A 5DUJA 2O5XH 4DW2L 2K6WA 4HK3N 2B1HH 4AGMA 2X4SA 1RVFL 3QDJA 3JWOC 4I1RA 1XO8A 2AABL 2ADJB 4OLZH 4O5LH 3X1EA 1MLCB 1ZE3H 3KYOA 5FS5A 1AR1D 1J0HA 1TYJA 4OKVA 2HFFA 5FCUL 2Y07H 5IBTL 4R4NC 4XO8A 4UUJA 2BSEA 2OULB 3DX9B 2O6PA 1IAMA 1MREL 2X1XR 1F4XL 1WBXA 1U8IB 4Z3IA 1D7BA 4MCYA 1JK9A 4GXVH 2FH8A 1KC5L 2CDGA 3BWUF 4ZAKD 3ULVC 3EH5B 4N8CL 3VD4A 1JZEA 4DP5X 1AC6A 2I9TA 3HE7A 1TVHA 5D93B 5L2JB 2XHNA 5K9JL 1JV2B 3VG0H 1NAML 4N5EC 2BWIA 1EAPA 5BRZB 5F0LB 4XNMB 5F7FA 4IHOA 4L1SA 5HDBB 4M6NH 2AEQL 1DUZB 1GGIH 4R0LB 3GHPA 5IB3B 4JMXA 1JNHB 2WCSA 3F6LA 4JKNA 1XH3B 2VDPB 4Q9BA 3C2AH 2NNCA 2BMKB 4LLYA 1ZGLA 3DJSA 4DKTA 2Y9RT 3GMNA 3IFPA 3D3VE 1SY6L 2I5YL 4Z3EA 1YEGL 3OAZK 4OD1H 1X5YA 3BUYA 2MCPL 3AACA 3RL1A 3KPTA 4QRAA 3UL4A 4L3EE 4N2LA 5JIDA 1DJWA 5SWZE 2YHGA 5DVMA 4MA8L 4MD4A 2X88A 3BAJA 4LFHD 2TSAA 2V9UA 4AW7A 1BIHA 4HHGA 1XXFC 4LSTL 4OZFG 4MA1C 3ZLQC 5KSBA 5L8JB 4Y2DD 4QHNB 4L4TB 2YPLA 2EE9A 2GCYA 5EO9B 2VITA 1YMME 4NIYE 4K7PY 4AL8C 2UY6A 4I0KA 4MHHI 3C6LD 4RMQA 1OV8A 5GS2D 3VFVB 1F4WH 1FO0L 1CU4L 4MDIB 3L4ZA 3V6ZB 1BD2B 4HC1H 4JUSA 5DGQA 4PRIE 1IC7L 5ADPH 4Y4HA 2C3HA 1L9QA 4PWEA 1RK1A 4MNHB 1ZIBA 2OQJA 4YSTA 3FT2B 4NCC1 4RWYL 3D6GA 2HSIA 4QY8B 1A3RL 2NY2C 2HT3D 2R83A 1IAII 3DIFB 3P9MA 4PJGF 2AJVL 2IV9A 4H8WL 4CSPA 5B8CC 5DK0A 1L0PA 4E9XA 5SWSA 4EXKA 3U7WL 4P23B 2LTQC 4K8RL 4LASL 1I85C 4KUZH 4N8VB 4OFVA 1MQKL 5F8QC 5HGAA 4HUNB 1HXYB 4IMLA 4X6CB 5H2BA 1KCSH 4N2MA 1E43A 2DMCA 3QJZA 1JWUB 1X7TA 1I75A 4QNPF 2Z8VC 3GXDA 4L4VD 2OMBA 2VDNH 4MQ7B 2KQNA 2BY2A 4M5YL 1NCWL 3Q1SH 1YPZE 3LNIA 1FUNA 2V9TA 2IMNA 2C1OB 1MJJB 4NQUA 4YIQB 3DURA 4BFRA 4YHYB 3MNVA 4XAKD 4I48A 1GYVA 2WQAA 3LD8C 4YX2H 2K9FB 3QH3B 2VDLB 2P5EE 1UM6H 4RNRA 1I1YA 2H2PC 2ZF9A 2EEDA 3LQAH 5HY9B 1Y0LB 2A6IB 2HWZL 3L3HA 5B39A 4QRSA 1FJ1A 4HPHA 1M3JA 2KUTA 1T5KA 4NJAL 4M5ZH 1HESA 1X4XA 4JBSA 4UU9A 5D7KE 4DUXA 5IM7B 1S9XA 2F54B 1CFSB 2W07B 5I24A 1IGCH 1MNUH 4GSDH 5JR1L 5KVGE 1N0LB 2VDKH 1DJGA 1YEDA 1T66D 4M7LH 3B9AA 4KRPC 4MVBD 1QYGL 4FQIL 3WAJA 2AV7B 3TA3B 3FOMA 3NZSA 2EZ0C 3RHWK 2Q7YB 3VGGA 5KTEL 3D9AH 3GJFK 2G3XA 3JWNE 4P5TA 3WD5L 5AYUH 3TYFA 4ORGB 4LEEA 2WXLA 1T0MB 2BFVL 1GZHA 1BIIA 1J0ZA 5EZOH 4EKJA 3LXCA 2O61B 4H8PA 5BQ7A 4P9MH 1X5GA 4NOBA 4QWWD 1FYTD 3TZVB 1SEBB 2IQ9H 1SJMA 5E7FA 1Q9WA 3O6ML 3QNZA 1JV5A 2YR3A 5F1IB 3OR7A 2IOOA 1MIEH 1NIAA 3U30B 2F61A 4JO1H 4ERSH 5J9PA 3K6IA 4OCYH 4TOYH 1P5UA 3MA7A 4FP8L 3MRHA 4AYSA 1LVEA 2JQZA 3DA0A 2FJGA 1HAWA 3L08A 4JAMA 4L8CB 3D09A 4QRBA 2OL3L 1FRGL 5L4MA 1KULA 1F6AB 1A1NB 3CSYA 3S5YA 3Q6FA 1I3GH 1U93B 5AB1A 2X41A 1FGVH 3GXPA 3DDFA 3EGXB 3H9SD 4RMRA 1FC1A 4LEXL 2Y2TA 4TYUA 2BC4B 1O6SB 3PUUA 4JL2A 4DGYL 4R3SA 5IB2A 4TTDC 4F2ME 1E28B 4OIIL 1HL5A 2OXHB 1P4LB 3GLDA 3TPKA 3U0WH 1L0XA 1MIML 4RA0C 3V0VB 4Z3HA 4LPYA 4OV6F 5IMMB 3GI8L 2VMJA 1RIUH 4L2YA 1I7ZA 3JWNC 4N86A 4L37A 4HH9B 2H3NB 5J1AA 5C7ZA 2DJ4A 2Z8WC 4FFVC 2VJXA 4KVPA 1QMUA 3MROB 4YXHH 3BPNB 5DUMH 1TENA 3P11H 4FQXA 2EC8A 5DS1A 4XP5L 2YPLE 1K5NA 3BUPA 1UWFA 3GEFA 2ZG2A 3OJVC 2Y6SD 3IJSB 2H47C 2OW6A 4Z76A 1LK2B 3WEBA 1FFNA 1MEXH 3OHMB 3QIWA 5JQHC 3ISWA 4FABH 1BZEA 3UXFA 2H2SC 5BRZD 5ACZB 3N1FC 2X6BA 4X4KA 4NO2B 1KXQA 1ML0A 2HUHA 1FDLH 2EDHA 1CGXA 1MCWM 3MCYA 4ODSL 4ODVL 4JE0A 2OTPA 2DBJA 4DUVA 5J06A 3MACL 4K4KA 3ZE0B 2WIIA 4ZQTA 3KEHA 4PV1C 5BV7H 4ZFZA 5HXMA 1OCWL 1RZGB 5CUSL 4P2RA 5LAXB 5JA8B 3NJJA 1TIUA 4N2HA 3VFTB 2XJKA 2G0KA 1U8NB 5C0GA 5MENB 1QPKA 3TGXA 2KT6A 2VR6A 5HDBF 1AZBA 3EDFA 1NFKA 1R4XA 3CH8A 4DO6A 5J13C 4X8JA 3QR2A 3T09A 2EE6A 4R7DA 1T6VN 4GSXA 5AKSA 2HVKA 1BJ1J 1SRDA 2XN9B 1X7QA 4Z0XB 3ZKXB 1WBZA 1GZPB 3IJHB 4KAQH 1A14H 3CNKA 1Y6KR 3S8WA 2HXAA 1R3IH 2KQMA 3NJFA 2BDNL 1KBGL 1Z3GL 1E8YA 4OCNC 5I6OA 4YHLL 1AS7A 1JMZA 4L4TD 1BG9A 1NMBL 4R7XA 1R0AH 1DE4A 5LBGA 2G75B 4Y5YB 4G80B 3VFGH 1CCZA 1TTGA 1A4JB 5E51A 3ZDXB 2PETA 4AYFA 5F3BB 5E4EB 2V5MA 2KYIA 2MPAL 3Q6GH 5C09B 3NA9L 1BD2D 5CEZH 1ZT4B 1IAIM 3OXSB 1EGJH 4NQVA 2CJUL 3SGDH 2C3VB 4AIZB 2VWEE 4Y4HC 3L9RB 4P9HH 5AOMA 3GNML 3VSVA 1X5IA 5I75C 2ZSWB 1AZCA 3W38A 1BQLL 2VERA 3UROR 5EIVA 2ICEB 2V17L 3O9WC 2ZKYA 1K5WA 3UBXB 1N7MH 3CU7A 3NDZE 3GSUA 1RFDH 2V8LA 1WFTA 3PXLA 4J4PA 4NKQB 3NGBC 5I76B 1IB5A 5EEVA 4HUXB 3NBNA 3QO0A 2OAAA 1REIA 2XT1B 4XMVA 5E03A 5GZNC 5DRWA 5CU5A 5HHOE 4JJHA 2AANA 2AFNA 5D96C 2WTPA 2FECL 2ZWKA 4NC2B 2J72A 1T20B 4RMVA 4GFTB 4UT6A 3BFOA 4PJBA 4X9IA 5FYJL 5I18L 2HT2C 3VI3A 3VMNA 4B0MM 2R8SH 3ZE1E 4KKRA 2VR4A 4Z7WB 4P07A 3VJ6B 3QDMA 1HHGA 3BGMA 3GRGA 5F9OH 1WUNT 4DP6X 4KKBC 3HTLX 1FSKB 2B14A 1QFUL 3V4PH 1NMAH 2UV3A 4MX7B 4ZNCD 4P5MB 1BQUA 1F86A 1Y6NR 1JZ2A 5D8JH 1PLCA 1UUSA 3BPLB 1W6WA 3EYFA 4GP5B 3VXPB 1WS8A 5IUCA 3STBA 5SWQA 4XP9H 4JY5H 5G4OA 2WSDA 4QXVA 1YY9D 2VWEC 2WBKA 1N64L 3F62A 2F54D 4NUGL 2B7DT 5IESH 2XBDA 2WBXA 4KXZI 1Z9SB 1AMYA 2PPFA 4DAGL 1IGTB 4MJ6A 1AO7B 1PAZA 3DX3A 1CDUA 4XRCB 4A7GF 3TA3D 4N8UA 1RD6A 4YZFF 2JMRA 1XF5B 3W9DB 4FXKB 1O7DE 4O2EA 4ZS6D 4D0BB 1ZIAA 1N4XL 1P7QA 2ATKA 2WKLA 3FUMA 2LGNA 3DHUA 3JQOB 3L5WB 4MXVF 2G2NA 3QCTL 1IAKB 4K5LA 4MJJA 3ILPB 4ADJA 2FJUB 4GOSA 1GZHC 2CO7A 4Y5XA 2WWMC 2QKIA 2ZWZA 3TBWB 5A3IC 2IAMB 2N7AA 4W9EC 3FQYA 2A2QT 5GGVY 1NUDA 3TZVD 4I13B 3IDYC 4K23H 1EPFA 2OR7A 4HALA 3TT1L 1FFQA 4N90D 1HK6A 3DSNA 3HB3C 5I28A 3MRKA 4XVUC 1EXUB 1TZGH 2FEEI 4LSPH 2DLGA 1BVKA 3PWJB 1XEDA 1DJXA 4AJWA 3OZ9H 3WN5B 4MHHG 4X4YB 3GIZH 4PY7B 1KXQE 2ZKWA 3CE1A 1DBKH 3EDJA 5I0VA 1ZHBA 4F37F 1JXKA 4JRYB 4MA3A 3MVSA 5L9DH 4ZMWA 3WEMA 1MRFH 2H0PA 1H6TA 3Q48A 1M3IA 4MKMA 2ZOTA 1PD0A 1TEFA 3TYGL 4B9GA 4N0CD 3U6RB 4N0YH 2WUBL 1ZHLB 1GOGA 5EC2B 4YBHA 1ZLEA 4KK8D 3TBCA 2R7EA 5C07B 3GMLA 4R26H 2DQHH 4DP8X 4OFKA 2FL5A 2VJ8A 1JF6A 4TLTA 4D3CH 2D3VA 4AX3A 4DGVH 1E5UI 1NC2A 2D8KA 4M7LT 1JYVA 2VXQL 4D0CA 3CV5A 2WKOA 1E2ZA 4PTTA 3C8KB 4UQ2B 1TUPA 2AK4E 2X7LA 1K85A 1LP9B 3B2VL 2AXJA 3DSFL 3GT6A 5F3HB 3VO0A 5F9JB 4YHIA 4U1NB 3OXRB 2E8YA 1RK7A 5LHDA 1XF2B 5IB1B 1JWSB 1NKGA 4JDZA 3ZRCC 4YLCA 1A47A 4MNGA 3UC0H 1BAGA 1I8IB 4N0UE 3H9HB 3CK0H 5EULV 2GJJA 3H9ZA 4R7VA 4S1RH 1TZIB 4NUJB 4IKIA 4XR8C 3MJ7A 2IFFH 3QIWC 4HAFA 4RGMC 3A23A 4KGLA 2I07B 2B4CH 3IM1A 4P5SA 5GHWL 4WEMB 2IADA 3GSNL 1JZ5A 2OCFD 1Z5LB 1DN0A 5JXEA 4N3UA 3T9WA 3SPCA 2E8ZA 4UNUA 2B3IA 3CDYA 3NSJA 1CO1A 1VRSA 1VLXA 2VE6A 1JAEA 5I1JH 1PMYA 2M2DA 2X09A 3NFPB 3BO8A 2OP4H 3TBBA 2NCEA 1WWBX 4TF4A 5C70A 3EJTA 4OLWL 1PZ3A 5B4MD 4ODUB 4NNYB 4OGXH 2D7OA 4X6BA 4ZOEA 1Q4NX 1DQJA 4X99B 3CZLA 2UZIL 2LVCA 5HYJB 4ZRGA 1KXTB 1KGCD 5MEND 2E9BA 4Z7UF 1PAMA 2OZ4L 4MS8D 4PTUA 3ZRFC 4PJ9C 1NAMA 4B41A 3JWDH 3S34L 5L88L 4YE4L 2HRPL 2ITEA 2YRLA 1OAUL 1T1XB 2P45B 2DYPB 3CX5K 3ZE0F 2XN9D 3VI3E 3WO3B 4BKSC 5C0NC 3BE1L 1WA0X 2R2BB 2DN7A 3QJFB 4U6XA 4D9RD 3BZEB 2R69H 5I1KH 3NG5A 3QFDB 4JRXB 5FC9A 3RIFK 1K8IB 1JPST 1NCUA 3RTQB 1IGIL 4ELMB 2H0EA 3HI1B 1IQWL 2OMWA 1SY6A 4EI5C 2DQFB 3KPLB 1XFPA 3VNZA 2KDYA 1ZPUA 3EFDH 2RACA 1FZMB 3RNKA 3JT0A 1J5OL 2VDOL 2DLFH 3BUDA 2XA3A 1G0XA 5JW4M 2CLZB 3TPUB 5C09D 5CZXD 1CDHA 2Z8RA 1BZ7B 2WIMA 4J3OH 5E6IB 1HZHL 4ZTEA 3VH8G 2V3DA 5I1GH 2P52A 4HJ0D 3PWPB 1FBIH 1G7LB 4UAOB 5LN4A 1QWHA 4TRPL 3ZDXF 3FTWA 1S8DA 1SXNA 2Y3AA 4BQ6A 4PCKA 2VZUA 2YK1L 5D9SB 1JZGA 1BFOB 1W2KT 3EOTL 4TNWK 3RWFB 3FCTB 4KNSA 5JQ6L 3VM5A 5JPNA 1JPFA 3BESR 3N2JA 3NIGE 1KACB 4KJWC 5I1HL 5KVEE 4A39A 3BPCA 1AXTH 1YNLL 2V33A 1FO0A 1FLRL 5C3IA 4DN4L 3HE6C 4NAJA 2ZOKB 1FYHB 2X53A 1C08B 1FNEB 1A25A 3L4VA 5FHBH 1BXXA 1HQ4A 2MQCA 5EA0L 4FE9A 4UYPA 5A2BA 3APMA 3ZYZA 4QRPB 4BD4A 3TASA 3QJUB 7CGTA 1M9SA 3S5LB 3IJYA 4P3DA 5GS1B 2QHLA 2NZIA 5HD8C 5I6LA 3UC2A 3W11C 4R4FH 3I50L 1BYOA 1A7NH 2R56L 3EBIA 4M93B 2Z8SA 1MI5B 4NJ9H 2CJSA 2BZCA 3T3PE 2RD0A 3D0AA 4JHWL 3U0TA 5MI0C 2HYMA 3BGFB 1VZHA 4Z7WF 2VDQB 3SBWA 1A6AB 3MRBA 4KHTH 2CA4A 1EUUA 1FNHA 3AUVA 3ISRA 4P2CG 4JZNA 2HMID 3VWJB 5BS0A 3V4UL 4LKXB 2NW2B 3BWAB 3EGDA 1AO7D 1KJMB 2R29H 2HH0L 2IPKB 1ZHNB 2UXFA 3T4AB 4MSWB 3HZYA 3DXAE 4MS6A 4WK0B 5DHEA 3V0HA 5ILTH 1RZIA 5LGKA 3HPJB 3KPMA 2ZXGA 3P69A 4F8NA 5J6SA 1X9UA 3FQWA 1BQRA 5J4MA 3KJ4B 1NGQH 2YAQA 4I2XA 1CL7I 1OW0C 2AJYH 5KSAC 4MQXC 2GSIB 2VCOA 4HHAB 1W72H 3O2WL 1GS8A 5L6YH 3BP6B 1MWOA 4APQA 4HIJB 2YUWA 1ED3A 4E9QA 1O9WA 4NO3A 2QJDA 5KS9B 3L3JB 1K4CA 1NFAA 4P3CH 3MJGX 4HMDA 1M7UA 5I1IH 4XBEL 1ET8A 2J88L 2VISA 5DURB 3VRIB 4FHJA 8FABB 3O11B 2Y1AA 4CJ1A 5EOCL 4L1DA 3C5XA 4LLVA 1U92A 5DJAA 2NX5B 1OOAA 5JZ7D 4JRYD 4WFED 2B20A 4WKZB 1KJ2H 3RVUC 1EJ6A 4G8GA 1UZ6E 1Q9KA 5IMKA 5D5ME 3FQXA 1YEJL 5D2NE 4HZLA 1I9IH 3CZFA 2MNWA 4Y0GA 5EN2B 5C07D 4POYA 1ZOXA 2GT9A 5IHUH 4RGOL 4QHUB 4JFSA 5T5NG 3CBKB 5DFWH 1RZKL 2HJFB 5AW1B 1I3UA 3DETD 1M6OB 2C9SA 1XX9C 5D7HA 3BXNA 2GI7A 3CN0A 2MCG1 3RIAF 3FQUA 1NLDL 4PVMA 4DP2X 4Y4KB 1U2YA 4D9LL 3ZW3A 5F7AA 1H3TA 1RUKL 1YNKH 2A9BA 1CLYH 3PU7A 1JHLL 2OL3A 2B5IB 4OCSH 2Q0ZX 5DJ8A 1HXKA 2DI9A 4GKNA 5CCKH 4NQDB 3GPSA 1JNNH 4KV5E 1CXFA 3GXFA 5ICUA 3HCVB 1M2VA 5JDJA 3L7EA 1PIGA 1LP9F 4IDJL 4PSPA 3QXDB 5FW8A 3L3IA 5H8DA 2YPVL 4LSRL 1XSJA 2PCYA 4X5LA 2BSSB 3FO1B 3HC0A 3S2CA 1AD0B 2EDMA 3QWOB 2VLRA 3ZE1B 3Q3GB 2QQKL 1XAKA 1CN4A 3Q43A 3PHOA 3KWXA 2QQLH 4MJIE 4XVJL 3BAKA 3ESMA 5D2NC 3RA7L 1URLA 3QIBB 2Z0UA 3T8XB 2VUKA 4A7VA 3QUGA 5AVWB 3DJZA 1UA7A 3IPEA 3QUXA 1YY8A 2ZSVA 2LW3A 3MBXH 3LRSA 4FYRA 1DCLA 4M8VA 4PP2B 1RUMH 5HYJD 4OM1L 3BQUC 5F89B 4F91B 2I9LB 4FZ8H 5DJYA 3D87B 3PRZA 4PJXB 4F7TB 3G9AB 3D39E 5JOPD 4DPAX 2NDFA 3V5HA 5CEZD 1P7HL 2ZXCA 5MERB 2BIPA 2DYPD 3QQNA 5FGRA 1WEJL 5KYNA 2VLMD 5T1MA 4XMWA 5IFAL 3LMJL 3QDGE 5ESQA 1A7OL 1WP6A 2X70B 4GRMA 3X3FL 1ZGLP 2IH1A 4JRXD 5IW6A 3VFRA 3RTQD 4XPGL 3CZEA 5DD3H 4YHNB 1KLUA 4N0FA 2BP5M 3RWEB 3WU1A 5IIEA 3QJTB 3EO9H 4HK0B 5L2KB 1MRCH 4LVNB 5AW9B 5GISH 1C7SA 3FN9A 43CAA 5EFIB 3D69A 2D4FA 3NZ8B 5E6ID 1MY5A 3QUKA 4HLZG 3KYMB 1Z3RA 5BS0E 2AZUA 3UMNA 3PWPD 4ELMF 4M61A 2W65A 3VSUA 4E5XA 3GJEA 4PS8A 1SHXA 2Y5QA 4HFUL 3TFKC 2HX7A 4OCWL 1EEZB 2XX1A 3TO4C 3IDGA 4XP6L 5F7MC 4NQTA 3WNPA 3EH2A 5K9OB 1YECH 5KVMC 1CFNB 3MRNA 3K4DA 3SKOA 3ZMNA 3O3AB 3POCA 1UEMA 1H8OA 2LOEA 3IJEA 4UIKL 4WY7L 2J7LA 2JQAA 2UY7B 4OTXL 4TQHA 3VU1A 4BH7B 4OD3L 5F7EH 4WTQA 5EBWA 1MFDL 1M05A 4I2XE 4J3UA 1MFNA 3WKQA 4YSEA 3CVHB 1G9HA 4KX7A 3MFFB 4JFZL 2PO6C 4LCCB 1QBLH 4QRPD 3SE3A 1T89A 3P73A 2GVYA 5HSFA 1NCNA 2AV1A 3QJSB 4GG8A 1NDGB 4Z77B 3FOLB 1PNCA 4G3YL 3ARFA 2ATPA 4K8RC 1MI5D 2MQGA 1CGSH 3IE4A 4NHCH 1HL4A 4ZUTA 5AG8A 5ID0B 4F5CE 2H5UA 1PLBA 1A7QL 3RTLA 4G8GE 2DJMA 4PS7A 2C34A 1A7PL 3EHBD 5IJKC 1XGTB 4ZQKB 1G7QB 2CNZA 2VXSL 1ETZA 1WZ1L 2X3BA 5ESAB 1M7IA 1OAXL 3VWJD 4S2SA 4HQQH 1W72B 3RPIB 3L9EA 4G6KH 4GJTB 1JNLH 2EO9A 4OQ1A 1JZ4A 5D72H 2HRLA 1T22A 3L1EA 3TV8A 1EHXA 5DF0A 3QK0A 2IDQA 3MLVL 3KHQA 1TO4A 4RESB 1UWEL 5D4IA 2JXMB 3E8UH 4H1LG 3BH9A 5AVRB 1J18A 2R0ZH 3TNNA 1ZT7B 3N91A 3VXSB 4EBQL 3D33A 3LAFA 5E6YA 4OZ4A 4UV4H 5F7NC 3DKHA 3U4EA 5LCVL 3DUUB 3ZHFA 3S36X 1QSEB 3QORB 1CICA 3AREC 2AITA 1VACA 7PAZA 1NBVL 3NN8B 3C8DA 4APQC 2O72A 4JO8A 3FUEA 4YSOA 1ZANH 1IBYA 4MLSA 2VR8A 3O2VL 4WIQA 3I6GA 3IU3A 1MFAH 2DBLH 4X5WB 4Y7OC 4FX5A 5DURD 3VQ1C 1A9EA 1KIRA 4H0IA 2I60L 4TVPH 4WFGD 4U1HA 2E46A 2H26B 3OSKA 2IH3A 3TO2A 4KKLC 2NX5D 2VLRE 1JD7A 1ZT1B 1IJNA 3S9DB 3VGAC 5B1JA 4NN5B 3WJJC 2CRZA 3OHXA 5K39B 1SXCA 2JCCA 3ASNB 4YDIH 3BRGC 4UV7L 5J7CC 5KS9F 1HILA 2H1PL 4U7MA 1QFWI 4JCLA 1E50A 1ES0A 5HHVL 2DIJA