1E5ZA

Azurin from pseudomonas aeruginosa, reduced form, ph 9.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Rontgenkristallographische Strukturaufklarung Von Azurin Aus Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e5zA00
1CUOA 1ZIAA 3NJNA 1OCCB 2B08A 2IDTA 4ENZA 3QJQB 2P80A 2CBPA 1NINA 2FTAA 4A2HA 2IWFA 2NRDA 1CYWA 1PCSA 1AIZA 3JT2A 1KDIA 1OCOB 1AG6A 1GS6X 3KW8A 3QJVB 2XUWA 2FNWA 1ADWA 3FPYA 3T71A 1ASOA 1ZDQA 2JFCA 2J56A 1MG2C 1N70A 2GBAA 3MBWB 3IEAA 4UF7C 2VMJA 2XV0A 1E5YA 1BYPA 2DV6A 3AG3B 1AOZA 5B7EA 2PPEA 5AZUA 1OE3A 5F7BA 3ASNB 1GS8A 4NERA 5AKRA 1ZPUA 5B1BB 3HB3B 2GHZA 2EIKB 1GY2A 3IE9A 1PY0A 1CC3A 7PAZA 1IC0A 2XXGA 1ET5A 3CDZA 1JVOA 1MZZA 2PP9A 1OCZB 2DWSA 1SFDA 4HALA 1RCYA 4KNUA 3H4FA 3JTBA 1L9QA 4CSPA 1ET8A 3NSDA 1A4AA 1AS8A 4NAJA 3TA4D 1WA0X 2BP0A 2P80D 2AVFA 2BZ7A 2IDUA 3QPKA 4BWTA 4KO7A 3NJIA 2OCCB 2EILB 1X9UA 5ANHA 2HX7A 2CUAA 2XV2A 1PZCA 3QQXA 4NB7A 1SDDA 1BQ5A 2OV0A 5I6MA 1JZHA 4E9XA 3X1NA 4F2FA 1QLEB 5E9NA 4DPCX 3NT0A 1TEFA 3ABLB 4BK5C 1ASQA 2UXVA 2IWKA 1KV7A 1IBYA 1KYAA 1NPJA 4G7SB 1PLAA 1AZCA 3TASA 3NJHA 1URIA 2X88A 1RZQA 2PPCA 3QJTB 1AANA 6PAZA 3UACA 4DP6X 4A66A 5I6OA 1E5ZA 2PP8A 1AQ8A 2RACA 2GC7C 3FPXA 4DP7X 1NDTA 1AS6A 4DP4X 2FQFA 2VSMB 4G72B 1PMYA 3L45A 3ABMB 3DTUB 3OMAB 3D12B 1VLXA 3UAAA 3N55A 4KNSA 3WIAA 1JZFA 1JOIA 3WNJA 4DP2X 2AANA 3FYEB 3X1BA 3CVCA 2IWEA 5TK4A 5A7EA 4E9YA 1XB3A 3NJLA 1HAWA 1PNDA 2HXAA 1R1CA 3NP3A 1SJMA 1OCRB 1V54B 1KDJA 3WNIA 1XMEB 9PCYA 1YLBB 3UGEA 3X1EA 1E67A 1V55B 5IY5B 1ZDSA 2Q5BA 3FU8A 3GXUB 3S3DB 2GSMB 1OE1A 3CG8A 3NJFA 5I6PA 2I7SA 2GC4C 4PCYA 3UAEA 4A2FA 3DIVA 5I5MA 2W8CA 2Q9OA 2BP0B 2IDFA 4YSQA 1L9OA 3ABKB 4P5SA 1XB8A 2AFNA 3PAVA 4HCIA 4P5RA 1KCWA 5I6NA 3QJRB 3X2QB 1SDDB 2YXWA 5B1JC 2JXMA 4E9RA 1V10A 3GYRA 2HLEB 2FQEA 2XWZA 4YL4A 2QT6A 2YAPA 3WKQA 1J9SA 3QJUB 4L0PB 3PAUA 1UATA 2VW7A 5PCYA 4FAAB 2QPDB 2CJ3A 4BXSV 1T5KA 1JXGA 3V9CA 2FJSA 3TU6A 2H47C 1DZ0A 2FQDA 3FU7B 2Y1AA 1JXDA 2HRHA 1N68A 4GXFA 4A2DA 1WA2X 1FA4A 4YSEA 1W6WA 3NSCA 1ETJA 3DKHA 4A67A 1WS8A 2VW4A 1NWPA 2YQBA 3V9EA 2N0MA 3ZBMA 1AZBA 1KGYE 3T6WA 1SHWA 4HAKA 2PCYA 2OJ1A 1PZBA 2I7OA 2CALA 5EHFA 2YAMA 1KCBA 2PP7A 2EINB 3ASOB 3UABA 1BEXA 3NJKA 2BO0A 2XXFA 1AG0A 1AZUA 4GP5B 4QLWA 3QJSB 3NSYA 1GY1A 4N4YB 3FQYA 1WA1X 1MG3C 1OE2A 3CZUB 4KO6A 1AACA 4M4RB 4HCGA 3RYMA 3UADA 2WSDA 3NJGA 4WTQA 1MDAA 4YSCA 3FSAA 3WKPA 1WS7A 2J55A 3IN0A 1F56A 1PLCA 1J5CA 5D4JA 1M56B 1NIBA 3PLYA 2BW5A 1SF5A 2PPFA 3WG7B 1GYCA 1JZIA 2UXGA 4A2EA 2J5WA 3FU7A 4N8UA 1FWXA 1BAWA 4GP4B 4YSPA 2YAEA 4G7RB 3FQ2A 2TSBA 2ZONA 4DP0X 2I85A 1RZPA 3MX0B 4FA7B 1CYXA 1M57B 1SNRA 4M3HA 5F7AA 2DY2A 2PPAA 4GP8B 5B3SB 4TXVB 2CCWA 3ZDWA 2BP8A 1A4CA 5I26A 5LDUA 5AFAA 3T6XA 3AY2A 4ZK8A 1BQKA 1FFTB 3FU9A 2FQGA 4Q8BA 1OV8A 1ILSA 1ID2A 2R7EA 4AKPA 3IBOA 1EHKB 2UXFA 1NIEA 3NSFA 5D4HA 4HCFA 2HX9A 3AG2B 1NTDA 2VSKB 1JXFA 4KO5A 4UANA 1I53A 4DPAX 3FSVA 3EH4B 3SBQA 4DP5X 4EF3A 3HEIB 4GYBA 3EHBB 1BXAA 1A3ZA 2IH9A 3S3BB 4E9TA 7PCYA 4HHWA 1HAUA 1QHQA 2ZXWB 5B1JA 1IUZA 1GS7A 1ASPA 1KBWA 4E9VA 3TBBA 4YSSA 1PF3A 3AW5A 4UAHA 4W1TA 2VM3A 3ZIYA 2XVBA 4PAZA 3NP4A 2YXVA 2IDSA 3FYIB 1SHXA 5I5IA 2BW4A 4G7QB 3EH3B 2YAQA 4CSZA 3WI9A 5B7MA 2HZHA 4A2GA 4AX3A 2MRYA 4BDVB 4YSDA 3SBPA 5I6LA 4JHUA 1L9TA 3PPSA 2BZCA 2PPDA 2YAHA 4DP9X 3BVDB 1QNIA 5I5JA 3TBCA 1X9RA 5PAZA 3FSWA 5I6KA 2BWIA 2J57A 1J9TA 3SBRA 1AAJA 1GR7A 2XV3A 3H56A 3T9WA 4AKQA 1ZIBA 2HX8A 2EIMB 2EIJB 2XYBA 1HFUA 5D4IA 2FT8A 1NZRA 2BP8B 1NICA 3CVDA 3OM3B 1DYZA 4W9ZA 4E9QA 4MFHA 1JZEA 3PXLA 2WO3B 2AZUA 1A65A 3FQ1A 1AZNA 2H5UA 5I28A 4GY4A 1RKRA 5B1AB 1ILUA 2R7EB 2XX0A 1ZV2A 2A3TA 4YSOA 4YSTA 2PCFA 1W8EA 4DP1X 1OOWA 4JKNA 3U25A 3ERXA 4DPBX 3X1GA 4K9JA 4YSRA 2AZAA 2JKWA 1L9RA 3GDCA 2ZWNA 8PAZA 1IKOP 2VM4A 2IDQA 2WO2B 1MZYA 2BHFA 4F2EA 3FT0A 3S8FB 2B3IA 2IH8A 4BDVA 2GI0A 4E9SA 3OQRA 4YVNA 1IBZA 1BQRA 4E9WA 3G5WA 4HIPA 2DYRB 1WAEA 1JZGA 2CAKA 3FS9A 2H3XC 2QDWA 2MTAA 3NJMA 2HRGA 4WKXA 1GSKA 1L9SA 2FT7A 3AG1B 5B1KA 1PAZA 1E65A 2LLNA 1W6LA 3OMNB 2QDVA 4G71B 1SF3A 1E30A 1AS7A 4HZ1A 2UXTA 1NIFA 4KOBA 1NPNA 4AZUA 2GB2A 1JERA 2W88A 3AZUA 1BYOA 2Y69B 1AZRA 1J9RA 2DWTA 3CVBA 2DYSB 3PAZA 1PZAA 2QPEB 1JZJA 3SQRA 1XB6A 3OD3A 3NJJA 1GW0A 2BWDA 1J5DA 4DP8X 1JVLA 4HHGA 1EZLA 6PCYA 1L9PA 3BQVA 2YAFA 5FC9A 5TK2A 3PCYA 1SFHA 1OF0A 3OMIB 3T6ZA 2GIMA 4KOCA 3S3CB 1M9WA 4G70B 3C75A 2XU9A 4RH4A 4F7KA 4YSAA 4X4KA 3X1FA 3AG4B 3ZX1A 1CURA 2XLLA 2ZOOA 3T6VA 4BWWA 4YSUA 3EH5B 1KBVA 2UX6A 2XX1A 3KW7A 3ABGA 1A8ZA 2PLTA 4AKOA 2X87A 3IN2A 1PLBA 4KO9A 1TEGA 1BXVA 4QKTA 2YARA 4Q89A 1NWOA 3EF4A 2VN3A 3NYKA 2E86A 1A4BA 3N2JA 2UX7A 4KNTA 4A68A 1TU2A 2VW6A 2YAOA 1PNCA 3CDZB 4AI7A 2FT6A 1B3IA 1TKWA 2TSAA 3FSZA 4BXVA 1NIDA 1BXUA 2FWLB 3S8GB 1AR1B 1ET7A 4YVUA 2IAAC 4JHVA 1NIAA 1J9QA 5B7FA 4BWUA 3H4HA
chains in the Genus database with same CATH superfamily
2B1HL 3LQAC 4OV6F 1XF5A 1F4HA 2EYTB 4MQXC 4FJZA 1EJOH 5EO0B 1Y18B 3FDWA 1PCSA 1LYQA 2FB4L 3QIUD 1C16A 3C60A 5AKSA 3WHXA 4UAOB 3CD4A 3D69B 4G5AA 4IK6A 2Z35B 5CZXC 5FCUH 3WUWG 3GDBA 1RZ7L 5I15H 3FULA 3NABL 3L2MA 1MWAH 3FO9B 4FFVD 4RX4D 3T65B 1N70A 1XCQA 2OTUA 4BGLA 5FYJE 4NQCE 2B5IB 2VRKA 1P5UA 4UF7C 1QAWA 1S2EA 1E5YA 5C0BD 2JKIS 1CT8B 1OIOA 4EO5A 1KYUA 2IOOA 1OE3A 5CCHE 2AW2A 4N0UB 4NERA 4XVTL 1ZPUA 2UWEF 2A6JA 4RETB 4MDJA 1ZLUK 4KQ3L 3KGUA 2C4FT 3UG4A 7PAZA 1JYVA 1WFTA 3QWRD 4BUHA 3R4DA 4P46B 5F71A 1KEML 1NANI 2HFEA 3P3TA 1U30A 4Z7WE 5HDRA 2V6HA 4M29A 1BIHA 5E2JA 1HI6B 3BGMA 5J0BA 3C6LD 1ET8A 4WEMB 3VXSD 2ORBH 4AV0A 3BWAA 4ALAL 3QDJB 3C2AL 4AEHH 1C5BL 1KCRH 4Z18A 5DZOA 3NFPB 5C0CE 4XO8A 1LQBC 2XNAA 1FSKB 3F12B 4UM9A 1TTFA 1BQ5A 1BG9A 1G7JB 3EOAA 3SKNB 1YC7A 1R9FA 4KAQH 4ODBD 5FYLE 2W9LA 2UXVA 2AJXL 3QZWG 4ACTA 1I7RB 2CGRH 4HMCA 4WJ5B 2ADFH 1HOCB 4N0YH 4UZGA 5AW9B 4ZDHA 1GHFL 2PYEA 2YPVL 4UQ2A 4NQDA 1AR1C 3BUPA 3W9EA 3QWQB 3X14A 4N9GA 5L9DL 3DARA 4PTTA 3TBSA 4K7PL 3NJVA 1A7PL 2P5WB 3DWTA 4YBHA 5DVOA 4LIQE 1T20B 3KYMB 5CWSB 5GIRA 5L7XL 5IR1B 1KPUA 3PWPB 3OKOA 4XO9A 2HJKA 5IK3B 1RZFH 2ZCKH 4FQJL 4LAJH 4M7JL 4X7SH 1VFUA 2EICA 2ZSVA 3WENA 5IVXF 5DHXB 4I13B 5I1EH 3CDGB 1P84J 3Q01A 3OXRA 4N0FA 4TPRL 5E8DH 3PS6A 5B4MC 1VLXA 3HOGA 2IH3A 1N6VA 4NQSA 5HYQB 1K6QL 4I89A 3ARRA 3B7RL 3NCWA 1ETZA 2W9DL 3CPLA 1OGAB 3QJXA 4MX7A 5D1XB 3VE0B 3QHFH 4LNRB 3ULUD 3CMOH 5DD6B 5TK4A 3MVSA 4BFIB 3BE1H 1U91B 2DLTA 5K9QG 3OBAA 4AQAA 2QADC 3TURA 3KWWB 3EOBA 2P28B 1NOLA 3GPEA 1J8HD 5MEPA 4EI6B 3DVGA 4DWHA 3ATAA 1G9NH 1D5IL 3NH7L 4HQQL 2YBRA 2GJ6D 3OAYK 5DS2A 5IY5B 1UCBH 2VZSA 4GQ9H 4JFXB 4NUJA 2DQJH 3EOTH 4U1NA 4UT7H 2WVVA 5DA0B 2NY5H 1HDMA 4JO4H 4QHLB 5HHXL 1L5GA 2OMYB 4FDWA 4JDVB 3RGVD 3ZK0A 2ETWA 4QO1B 3EFFB 1ICTA 1OP4A 2BJML 1X4YA 1RUQH 5FYKL 3GSQA 4OZFA 1EJFA 3FBKA 4HCIA 4RDQF 5DHVH 4F37F 1ZCRA 1VPOL 3CHOA 4PWEA 1EO8L 4PVLA 3IK2A 4TUKH 2Y2TA 4ODSH 3UMTA 3JWNC 3REVA 2DQEL 3RP1A 3S4SB 3QG6A 4KRMB 2VDLL 1CXKA 2CPCA 2YEVB 3GSNA 3UPRB 4XE0A 1MFEL 3EYQC 2GEQA 2CMRH 1R6VA 1VIWA 5K1VA 2X4QA 5BVPL 4LFHD 5T8IA 4YBQD 1F00I 3V95A 3WUZA 1D7CA 4UQ9A 4DGVL 4EDXA 5A1AA 3WXVH 3GRWA 4KMLB 1IZJA 3A6BL 1T4KA 5GS1B 3ZSSA 3MGAA 2WINB 3VYPA 1CIUA 1PLGH 3NIFB 3K6DA 3F62A 1Z9PA 2R69A 4WJKB 3WY2A 2CG9X 1AD9B 7FABH 1E0OB 4OFYD 4DERA 4LSVL 4CSTA 4PB0H 2R59A 2FR4A 4AMWA 1OT2A 3O2WL 5HDWA 1N2RB 2LAGB 3WL9A 2YAMA 4JREB 3HE6C 1HZHL 5BOPA 3AXHA 4I0PB 2IGTA 3LRMA 4XI5D 3PNWA 4H8QA 3FO2B 2CJSA 2R0WH 2JB5H 4Y4KD 4AYDC 3H6JA 3BUIA 3HG1B 5F9WB 5E00B 3LS4H 1IO4C 2X41A 4NQDE 3US1A 3ARDA 4KNQA 4L18A 1O9ZA 5EU5A 1YY8B 3QJZA 1E6JH 5AG8A 5J13C 3UADA 12E8H 2G60H 2X4TB 2JB6A 3KDMB 3CFEB 3DECA 2QGEA 4GAGL 1CXFA 2Q86A 3PGDB 4NUMA 5FYJL 4F24A 1G9EA 4P5MB 5T3XD 3FTGB 1E9OA 3VFGH 1TZOA 4ISVB 3NCXA 2IFGA 4M3KB 4TSCL 4GW1A 1CTOA 3OC8A 2A7BA 2EDJA 4PWFA 5IBLC 1N0LB 2J25A 2FO1A 4IHOB 5ACLA 2VDKL 4BZ2L 2WYHA 3DX6B 4R7DA 1OTSC 1EAJA 1G7HA 1VRSA 8FABB 1HXYA 4BH7A 2DY2A 1TVDA 3OKNA 2VDRH 5HYJD 3L1EA 4PRID 5G4MA 4ZUUB 2FHBA 2V37A 4I3GA 4WKZA 4BIKA 1KIQB 4OZFG 5DFAA 1KXHA 1AMXA 1QLFB 5JW3L 2L7EA 2NY6D 4IJ3C 1QBAA 3CX5K 4JRYE 4BKTC 1KY6A 1H6UA 3DOSA 1FNLA 3M45A 3TA3C 3N1GC 1U8JA 4MJ2A 3FTXA 1IAOB 5KYNA 3HZKA 1XCWA 3U9UA 3IJEB 4Y1TA 1PG7X 4MA3B 5KS9F 1CBJA 3RPBA 3FHEA 5FYLL 1JMZA 1UACH 2JQAA 5AAPA 3H53A 5H4ZA 1FV1B 5LG6A 2IFFL 2WIMA 4MXWH 5HI5D 4E9TA 5DUPL 5E9DA 4OVVA 3TIDA 1RSFA 3HZ3A 4KK5C 4L4VA 1EAOA 3EO9L 3CFQA 5JZ7C 4K2UL 4JG0H 5E94A 3NAAL 4LIQL 1KENH 2Q76B 4YWGL 4JZNB 4IIQB 1XBRA 4A2GA 5I76B 3CVHH 4L4TE 5HYSA 1MEXH 1OM9A 5AYTA 4YSDA 2H1LM 4I18A 2WCSA 1EHNA 1D6EA 3B5GA 3M8OL 4XNUL 5IVZB 3MO1B 5A2LH 1UB5A 4L9LA 1IM9B 2QFPA 1J1OH 1MCNA 2AK4E 3FH8A 4HUKB 1QNZH 3IMVA 1DJXA 4Q4EA 1LDPH 3IMSA 4XGZA 4Y1AD 1Y1DA 3T9WA 2Q8BH 3OZLA 3ALXA 1S7SB 5CD3B 1E4KA 3SODB 1ULVA 4JQIL 4HBCL 3F58H 3B83A 4XB3A 1WF5A 2EYSA 1KJ2H 3GBLA 1HE7A 3L17A 3CZNA 4HS3B 4KJQD 3FQ1A 5EU6D 4M93C 1XSKA 1RKRA 4C4KT 2JI1A 4DHLA 1DJGA 4U7MA 4HIHA 1MFDL 4QYOB 4YSTA 5AYUH 1FVDB 2OJZH 3WFEH 3QUYB 1U33A 3CH1A 3GMOB 1BG1A 2G4GA 1YECH 3TO4D 4PG9A 3ERXA 1ZLVH 3TN0A 1R3JB 3DK0A 43C9B 4EIBA 2DM3A 4PW3A 5F9AC 4WI7A 3Q1EA 5F9DC 2VISB 1S3KH 1E4WH 3ZZSA 4FHBD 5EIQA 2GFBA 1KTLB 4U3SB 4FQXD 5EZLA 5AAMA 1G43A 3U0TB 4HS8L 4ELMA 5DJAA 1V05A 4JANA 1UD3A 2OKMA 4R90H 1NCTA 3ZT5A 4LF3A 1JNHA 2CHZA 4RBPK 4AITA 2WCPA 4Y19A 4YFDB 1U3HB 1PCXA 3FQNA 2DTMH 1OT1A 1LK3H 4PJIA 2GIXA 5DVNA 4F8QA 4XE5B 3SDDC 3UTTA 1JCKA 3EJPA 5FHBH 3MFFB 2X0UA 5C2UB 5IGXH 4I9WE 3IJYA 1JFQH 1M3IA 1YMHB 2HT3C 3Q48A 3JZ7A 5T33H 1MW1A 3I50H 3QEHB 3K1DA 4YN3A 3O0LA 4LAQH 3PHSA 3QI9C 3DVNA 1QBML 4J12A 3QQ4B 3PWUB 4KKCD 5DEFB 4F91B 3B43A 3HKFA 2VQ1A 4WJG3 4KROC 5I0DA 5HYSG 1NCHA 4HLEA 5KVDH 5CSZA 2FJGB 3HE6B 4DVRH 3DVIA 4TKWA 4G70B 5CEXB 4AJ0A 2X5PA 3LVTA 3JWOC 3P11L 5GSRA 3QXUA 4F20A 3S9DB 5E6IB 4PGDA 1WH0A 5HHOB 4P9HL 5E23A 2HMID 4IMKA 1H5BA 4XNBA 5C7XH 1I1RA 3QT2A 4FQLH 4PRDA 3SE3C 5J13B 1JTOA 4J3OD 1CLOL 3D85A 3EO0A 3APFA 1R0AL 1LXMA 4XCYB 2BNQB 2X4OA 1HSAB 3D0VB 5MENB 2YPLB 4GKLA 5ABZA 3K72B 1B3IA 4NWUH 5AVWB 2YMTA 2GPZA 4C58B 5D1ZI 5DMIL 2RJMA 3BLKA 3TIEA 1I4FB 4GG8B 2PCPB 4FFYL 3BMWA 5IF0B 3WTVA 5IHHA 2XG5A 1ANUA 4PLJC 3O3DA 3I6GB 2NCMA 2P47B 3EW3B 5IFJA 1S7UB 1KT2A 2DOCA 4AQZA 3BH8B 3TYFA 3AACA 2X38A 4H5SA 1MWAA 4HK0B 3W39A 1KYOJ 2IDTA 4K9EH 4NOFA 3EOYG 3LQZA 2B2XH 3PJNA 1BSIA 1G7IA 3HCVB 1QSZA 5I1IH 1CXHA 1A3LH 1CYWA 1BXXA 1Q9WB 1AIZA 2QR0A 4DZ8A 5IW3A 3FB7A 1OCOB 4AQ8C 1JGLH 3V4VL 3KYKL 2YRLA 1YYLH 1UT1A 3WN5C 5T1LB 4IJ3B 2AJ3A 3LKQA 1W15A 1ADWA 1O6TA 1BVOA 2XTJE 1Y0LA 1MIML 1ZDQA 2GT9A 4N5ED 2X6MA 3TA3B 5C09A 2Z4QA 1RUPH 4ZS7L 1SN2A 3GSNL 3NCEB 3PP3K 1YEWA 4Z3TA 5HI4D 3RWHB 2OMTB 3LOWA 3BQUC 5BO0D 3HC4L 5CGYD 1JPEA 4CVXA 2ZWLT 4D0DA 3VFVA 2KI6A 2C3XA 4N8VA 4PJCE 3V6BR 5KBPA 5LO7A 2B20A 3KLAA 2C1OB 4TLUA 1IAKB 5JR1L 4PJIE 4R8WH 1MZZA 2PP9A 3LKPB 3MACH 1WP6A 2LGNA 3QR2A 4IKIA 3UTTE 2XKNA 3RKPA 3VWKA 5CZVL 2QVTA 3LD8B 1N5YL 2B8OT 2BY0A 1DE4A 3VI3B 3ZE2B 4G9DB 2P26A 1A4AA 5L4IA 3D4GA 3DOIA 4JAMB 4MDIB 3WBDA 5F9OL 2RFXB 4ZUSB 4ALAC 1LTXA 1F2QA 1NCGA 3VXUD 5KSBF 5T1MB 4AC2A 3IETB 1X5LA 3KXFB 3QQ3A 4KUZH 4PP2A 3HAEB 2QPFA 3RTLA 4EUPH 5IOPB 2DTSA 1XAKA 4OF8A 5DQ9A 5A2BA 3QP3A 1E9QA 5C0JB 1ZTXE 5FHAH 1VEPA 5IEHB 1TEFA 3ABLB 4UQEA 3WIFA 1KLFB 3ECBA 4RIRB 1TZIB 4KJYB 1LLAA 3PHQA 3RURA 1BYNA 3MUHL 1R34A 3P4LA 1JV2A 3MBWA 1X7SA 3PDGA 3S36L 3CX5J 5LGJB 3MLWH 4ZW5A 2PR9A 3QJTB 2ITFA 1J0IA 3G5XB 1A1MA 2JXMB 1TZHB 2QKIC 2V3FA 3O4LD 4FG6C 4XMPH 2NX5E 4JFQB 2N7AA 4QHMB 5E70A 3ULUF 1EFXB 1ZT7A 4M93B 5F7DA 2KMWA 5EZIL 3V5KB 4Q52A 2GC7C 3QS3A 2O6PA 3GSWB 5GGTH 4UM8A 3GSOA 2G30A 2JCCB 3RBGA 3IDNB 1F6AB 3QIBA 4XNYH 3STLB 5BVJB 2OMXA 5T1DH 2Y7MA 1WQVT 3OMAB 3D12B 4LCWA 3H9HB 4K5PA 3FHQA 4OF6A 4GAAA 1JNLL 5ITBH 3PJSA 3LRSB 5FA4A 3CMGA 4FTVD 1ZHLA 4LZKA 3W2DH 4Z0XB 5JPNB 4JZJA 1TJIH 4J3UA 4UUJA 5CJOH 5HHMD 3DX8B 1RVFL 2P24A 4L29A 4RAUA 4X9YA 2OYKA 3UTSA 3HNVL 1UXLA 4FA6A 1OCRB 4O4YH 3FRUA 1A6AB 1IEBA 3Q8CA 2DQGL 2WTPA 4MSWB 5DHVA 1DBJH 5CJXC 4PLKC 4BH8A 4M4RA 1WV7T 3RDTA 3SPVB 5D9SA 5SV4A 5AOZA 4CJ1A 3S3DB 5LN8A 35C8L 3D05A 3IGLA 3GMQB 3SDDB 2MOQA 5IIEA 2XDHA 3KWUA 3IDXL 5C09E 4YSQA 2ZYIA 2NUPA 2KDYA 1DN0A 4N8VG 2ZSWA 2FIKB 2LLLA 4L8SA 4WSGA 3KCWA 2HLEB 4FNLH 3CX2A 5DJ8B 3TT1H 3KHOA 4G6AD 2GITB 2EIZA 3WKQA 5EFIA 3AS3A 1MH5B 4QRRA 2NYKA 4H25A 3QI9B 4R4BA 2VW7A 5PCYA 1YRKA 2XRAH 2FBRA 1T5KA 3N40P 2YD3A 4KROB 3QC5X 2BFVH 2HRPL 1AGEA 3EGSA 2EO9A 5GZOA 1ZKAA 2FQDA 4XVOA 5DJCB 3A6CL 4F5CA 32C2A 3DURB 1FE8H 2PO6A 1HN1A 3LHAA 5E6ZA 4D0BB 3CFIC 5F3BA 2ITDA 1JPTH 3N1PC 1FAIH 1PY4A 1AZZC 4A67A 3BH9A 1TQCC 5F6IC 2A9ML 1FNEB 3H2PA 3MJ6A 4IBSA 4YL9A 3ZT7A 4MCZA 1I7ZB 2HG5B 4KFZC 1JYWA 4Z7VA 2I24N 2KUTA 4RGOH 1RJYA 3LPWA 1KWKA 3MC0A 2Y07L 2YFNA 3IJ7A 5GS0D 3T0EA 4UOQA 4RMUA 4HKBA 3EDKA 4H8HA 3K71A 4EIUA 1MHHB 1CGVA 2HTKD 4OF3A 2QGDA 1AFVH 1X5KA 3A4FA 4X0NA 2GTZB 4R3SA 1SN5A 2WLIA 5JOPD 3FQYA 4PRPB 2FX7L 5L0QC 3TBTB 4FKEA 1CGYA 1TVBA 1HNFA 1A2YB 4WFGE 5JO5A 1X5AA 4X83A 3RU8L 4OZIF 1A7NH 2WSDA 3OJDA 2IPKA 3WIIH 2D0HA 5EOTA 4YSCA 5D7LA 4PJXA 4B27A 5C9JA 3MOBL 1F45A 1V7NL 2GY7B 5F1IB 2EDKA 2HJFA 3NESA 2VDNH 3LHPH 4LCWE 4X0KA 3T2PA 3PDDA 1HQRB 4N3UA 3SZKC 3WN5B 1PKOA 5JHDD 4N8UA 1EAPA 5AOKA 2VLME 1AXSA 4N8CL 1N7ML 3ARSA 1G9MH 2TSBA 4XPAH 1GGCH 1ZLEA 2DWXA 1RZPA 1SNRA 1EQWA 3C5ZA 5ENWA 5MERB 4AEIL 3ISRA 3ZKQD 4M48L 2AJYL 2CCWA 5HDBF 5I0YA 3BQUB 1QUNA 3SYOA 1E8YA 3ZZLA 1AE6L 4PWJA 1A66A 1DQQB 1PPIA 4ZW8A 4I3SL 4MHHG 4ZMTA 5IHLB 4XRCA 3MRFB 1MCWM 5DK0A 2W0FA 2NY0D 1A1NB 2X1WL 2ZXDA 5DRWB 1AXIB 4I88A 2WIIB 3DPBA 2A4CA 3SIKA 1IQDA 5TFSL 3IMUA 2WLJA 4YC2C 5D5ME 3FU5A 2FO4B 2ITCB 3G5VB 1OM3H 4LGPB 1YEIH 2SODB 4TQIA 2R2BB 5EN3A 3B56A 1ZTXL 2OTPA 4ZAKD 2NY2D 2VDQH 3CFKA 1Q0YL 2WBXA 2X9ZA 5TQ0H 1I3GL 4DW2L 1UEYA 4IHBA 3Q5YA 4MD0A 5JOFB 4AENB 3QARA 2QHLA 1MPAH 5ID0A 5KW9L 4EOWH 3CVHA 3EXJA 4LEOA 4E9VA 2FBJH 4WV1A 5J89A 4K71C 1RIHL 4ZFGL 3HS0A 3QNFA 4LHJB 3POCA 3LJ3A 3WJJC 1LEGA 5DMGD 3QUZD 1AO7E 1I8LC 3RWIB 1CBVL 3PL6D 1T66C 5DC4B 5K5YA 4ZMLA 3MX0A 3OPUA 5I1KL 3GIZL 1CVSC 4TYUA 2QKIB 1YEFL 2VH5H 1I8KB 4JHUA 1E28A 4ZO7A 2FSEA 1AHWC 1IM3D 1BOGB 2PPDA 3JV4A 4KQ4L 3NCJL 1SVZA 3FQUA 1KJ2A 4KY1L 2FLBT 4N22A 3RHWK 1KIUA 2HFGH 4I0CC 5FCUL 5I24A 1V7MH 2JELL 4LNVA 3SE8L 3UG3A 3VI4B 2E3VA 1BD2B 1IJNA 5ECGA 5CBAA 3G5YB 2LTQC 3BUQA 1ACXA 2ADJA 1UZ8B 1UVQB 1E50A 3MBXL 3VDBA 3Q43A 1J0JA 4O5LH 4P3CL 1DTUA 4R0LA 1JZ3A 1MCWW 3FUMA 5EN2A 1CL7L 3VFPA 3MYJA 3QDGE 3C60C 3V0VA 3OTTA 5I28A 2H5UA 3SO5A 2Q3ZA 2A6KA 4HT1L 4Z1PA 2CNZA 1IILE 3NZHL 43CAB 3FK3A 5CFAA 3FFCB 4PJXE 3HMXH 1HKFA 1ZLSH 2EC8A 1KIPA 1SVCP 2D3LA 1IKFH 1C5DA 1INQA 3T0VA 1I8UA 2XWBB 1NCCH 1P5UC 3QDAA 1EDYA 5HJ3A 2EIEA 4NEHB 2H2PD 2NY7L 4P23D 5E4EC 3L3GA 3O6FA 3VFOA 1ZHKA 1OK0A 4PJDF 1FO0A 1MVUB 3B6SB 2ORBL 4YPGB 1AKJA 1YMMB 3MCLH 4HW6A 3CN2A 1HYSC 2BVPB 4PJHE 1QSEE 4E9SA 5HHQB 3A4AA 4KZ0A 1BQRA 1C12A 3M88A 3D2UD 5BZZA 2WXNA 3WKMH 4APQD 3K81A 1NBYA 4DGIH 4OZHA 3WJMA 3US0A 4QCIB 3MV9D 4V33A 2WN3A 4YHMH 1OP5H 5C0GB 2V5MA 4H8WL 1FZOA 4MVBD 1SYVA 1GSKA 3OQ3B 1TQBC 4MNQB 1UM6H 1WK0A 5I1GH 4R83A 1MRCL 2X6VA 4XH2B 2APBA 3Q44A 2ADFL 4IDLA 1SF3A 5GGVL 3PF2A 5I1HL 2R9HD 1ZRUA 5A6LA 3B5HA 3A67H 3QQ9C 1NGZB 2AEIT 2ZOUA 4U2ZA 1TQCB 5F6IB 1N0XH 2EH7H 4HUMB 3VXMA 5I1AA 1WT5A 3ZTDC 4XWGH 3PAZA 4EE2A 5HVHC 1LO0L 2R23B 2CH8A 3WAKA 3C2SA 2C3WA 4HSQA 3SJVA 2QZQA 1QVOA 3VFWB 1FVEA 4UILH 1AP2B 2CRIA 2WXRA 4NO0A 4NKDA 5BS0A 3MFGB 2H2SD 3DX0A 4J3OF 1JVLA 1SJEA 1H0DA 2BS71 4HH9A 4MBRA 5E8DL 1I1FA 3IYLW 4CC0A 4URKA 5CFHA 1SFHA 1VHPA 1H3PH 4OLXL 4OF5A 5SX4H 4GFXA 4GRWH 2ADIB 2CHXA 3QHFL 3J8F7 3ME0B 4LB8A 4J7RA 5JXEC 2A9CA 5BOZG 4JS7A 3MNWA 1UH3A 1YN7A 4PGBB 2B9BA 1M1XA 5JHLA 1YY9C 4P9HC 2XETA 4XHJC 1A8ZA 2R56L 4KHXL 3IFPA 5CR8A 3MA7B 3ARGD 3WTWA 4UCFA 4JO1L 3QXWA 4X6CF 2E86A 2A6DB 1I82A 2VABB 3OG4B 3U6RB 5JIIA 3KDPB 3FQWA 4BV1A 5K9KA 4GQ9L 3FOLA 4FHJA 2M2DA 3EOTL 5IFAL 5EEYA 1ERNA 3RVWD 2H8PA 4NN7C 4NQCB 4ZOAA 3UX9B 4AE0A 4NSKB 4KJWC 4XVJH 3VTAA 3S8GB 2FWUA 2G5BB 4PRNB 3IVKA 3BUYB 3J07A 2OTWA 1QW9A 3FUKA 1XGRB 4FXGA 1L0PA 2KDGA 3WUWB 2QPSA 2IAAC 3CFCH 2UVFA 4TL4A 2NY1C 2VDKB 4JRXD 4HF5H 5T3ZE 4ODSL 1VZGA 2EO1A 4XWOD 1CI5A 2CWRA 3L1FA 3QUGA 5MHSE 5LAPA 4ZXBC 4D9QE 4ENZA 3TTYA 4P5TC 4WW2B 5EG6C 2E7LC 4Z7WB 1NOFA 3UPAA 5D70H 4KPHH 5DI8B 4QRTB 3AFLA 4I87A 4UV4H 2K4WA 3C8KB 3P4MA 4IMLA 3PWNB 4KKQA 1GZQA 2YWZA 4P46D 2ZP9A 4LLWB 3BD3A 1UXSA 4Y16A 5DD5H 2K6ZA 5EBGA 3EIFA 5C0CB 3HUJA 4OCXL 4YC2B 3AQYA 3IU3B 4NM4L 1JP5A 5AZEL 1M9SA 2Q2EB 1TVHA 2FJHB 1L4IA 1T4WA 1UH4A 2WK2A 1P7QB 5KSAA 4GW4B 4YEFA 3RX5A 4KKZA 1BCIA 4XXCA 4ONHA 3STZA 4U6VH 5ADOH 2CBOA 1C08B 4I8DA 2RD0A 4NO5A 1UM4H 2WXPA 5J1SC 1TOXA 4WTXA 1G7MA 1KJVB 3VSTA 4L2YA 3VU2A 6TAAA 1TUPA 5IB4A 1L7TL 1U8IA 3LEVL 4C57C 5EEUA 3FT4B 4EUPA 1Z66A 4QXGH 3UDWA 3P2DA 3LY6A 2JB5L 5HGBB 5LXGL 1I85C 1MCBA 1M6OB 3U7AA 4KNUA 3DIFB 5IVXE 2DF3A 3ZRSA 2Z31C 4PP1C 1P4LB 3LS4L 3QZWB 3R1GH 2Y22A 3H42H 3VQMA 1BJ8A 1AGCB 2BP0A 2FEDC 3RJDA 2IDUA 4JKMA 5FKPB 1URLA 1GOHA 2VLRA 3GLAA 1HHHB 3VXME 1G6RL 2P5WD 1KB3A 3SBWC 3VA6A 1NJ9B 2HKAA 3ISWA 3WFHB 3A0OA 4F2FA 5E9NA 2CUIA 5IM7B 2KZ1B 5E0FA 3MROB 1MFMA 3O9WC 4G11A 5GGTA 3ARDC 1KG0A 4FQPA 2WTRA 2WPGA 5IV2B 1BVLA 2VDMH 1CG9B 4N1CA 3IJSA 2YMXH 3LRHA 1OGAD 2LTQB 3L3JA 3FU3A 3LNIA 5D1XD 1CO1A 2C9XA 5DJXA 4AJWA 3X17A 1IGTA 4KHTH 3MTXA 4HAFA 2VDRL 4JKLA 3BKJH 3WHXB 1C16B 3C60B 2RACA 5A7BA 5IROD 4LVOC 1SXNA 3NSXA 4HPYH 1MXDA 1TZGL 2RQEA 4JCWA 2VSMB 5A3IC 1KJ3H 3RWCA 5KUMA 1OSPL 1MHCB 1KCLA 4NP4L 4YAQA 3M7FB 2OZ4H 5TTRA 1P5UB 4YHNB 4Q74A 4MMXC 5E6SB 5E4EB 1YQVH 3WNJA 4K3JL 3I6KB 4PJ8C 1XF2B 2A6JB 4P2OC 3T08A 2E6PA 5A7EA 3ARBA 5CGMA 4DIXA 1UQSA 1CYGA 1DR9A 1WZLA 2VXUH 3VVWA 4I1NB 4CW1A 3ZRFC 2HFEB 3GXDA 4M8RA 3UGEA 1TTUA 1E67A 1RK1B 3GMMA 3FU8A 3I9GH 4WWNA 1M3JA 4J27A 5E99L 1ZVNA 5EOCH 3UAEA 1MCDA 4PCYA 4R5VA 1K5NA 1N6UA 1TQBB 4ODXA 5DGQA 2Q9OA 4CU7A 3HNSH 3L6FA 1DZBA 2WCGA 3THMH 4DCQA 3EBGA 1JPGA 2XNAB 3BIBX 5BRPA 4GT7A 3CVHL 4TULL 5F7EH 2APXA 4U7SA 1JNNH 1HWWA 2APTA 4GBXA 4X6DF 5TPWH 2CKNA 4EUPG 4ZPVA 5DYOA 2WQVA 4O02L 3UIYA 3AXLB 2V2TB 4IRSC 1HHKB 1J1OL 3IDIB 4MLSA 2UYLA 2Z93A 1LDPL 1M05B 3VQLA 1UD6A 2Z7YA 2G75A 4ZDHB 3QCTH 2PYEB 1X5MA 4UQ2B 3LMJH 3PNRB 2MWCA 4NQDB 1J87A 4I18C 3BPCA 3X14B 2OMWA 5DFVD 1RHFA 3HG1D 5DMJB 1X5HA 3GI8L 2UVEA 4PTTB 3TBSB 4DGWC 3TFBA 4GIPD 5DEJA 5KBKA 1KJ2L 4L9LC 2Y7SA 4MLIA 2F54E 5GIRB 3NFNB 4ZUTB 1KPUB 3OKOB 1TMQA 2HJKB 1ZXQA 3EJZD 4YZFF 5D1QA 2R0ZL 2QMJA 2BXZA 3FQXA 3V9EA 4AMXA 3MCG1 4PJEF 4TLTA 5J9PA 3OXRB 2OJZL 1E4KC 4BQ8A 4S10A 1RIUL 3DJRA 4PWIA 4OFIA 2ED9A 4MQXD 3K6NA 5DUJA 5SWZE 4NQSB 4BFNA 4X5WA 2FX9H 2WKOF 3ML9A 4UMSA 4BINA 4EI5A 4XNQB 4MX7B 2CD0A 2EINB 4EZLA 3UABA 4PYGA 4NN7B 5T3ZL 3HBQA 2PW1B 4KKRA 3E38A 4AQAB 2XQYA 4OLWL 1MJ7H 4M62H 4WI3A 3ZHKA 1UENA 5MEPB 2E8ZA 3DVGB 5FO2A 1A0QL 1LE9A 5A6MA 1MG3C 2NY1B 2UZXA 2YBRB 3PU7A 2CDGB 4ONFH 3QPXH 4UQBA 4U1NB 5C0EA 4OSUH 2WVVB 5ITFA 4PY7B 1NFIA 1PZ3A 4ZXBB 5MEOA 1I7UA 1P2CA 4P5TB 2XTJC 1ZGLP 5I66B 3VD5A 1FO0L 5KS9E 3MGOA 2DEYX 1J5CA 2E47A 1M56B 4MA1B 1FFPA 2H0FA 4CMHB 5AAMC 4OZFB 5FHBL 4M7LL 3FZUD 2H0PA 4GMSH 3Q6GH 1FF5A 4YDVB 1A6VL 2E27L 3WNOA 4A7UA 4AIZB 1JFQL 4GSQA 2I85A 1NAMH 1JGUL 2W0PA 3REVB 1MFBL 4M3HA 4GSDH 2DJSA 3I50L 1KB9K 3GSNB 2YN3A 4I3RH 4LAQL 4YUEL 4EIZC 1RZJH 2XZQH 4H44C 3BO8B 4LSPH 1NC2A 5INDA 3T6XA 3WD5H 3D87B 5KVEE 2DQMA 2X9WA 1EBPA 1D3CA 5TE4H 1ZA6A 1JK9A 1I1CA 4ORGA 2R7EA 1ZOXA 2CIKB 3EKCA 4JM2A 4EDXB 1A6WH 2ZAIA 1N67A 2M8XA 3PWVA 1T1WB 2VN4A 3OX8A 3DJTA 4K3EL 4OCRH 1T4KB 2MJWA 3LX9A 4HG4K 4J4PA 3RVXD 1MFCL 3O8XD 3ZSTA 3DX2A 3NEOA 2K9FB 4JVUA 4Z7QE 2FYVA 1JXFA 1MLBB 3OPZH 3FSVA 4WUKL 3QQDA 3SBQA 2Z65C 2OP4L 1T89C 5FKAA 2FR4B 1DJYA 2DD8L 3S97C 3BAEL 3WL9B 1EDQA 4KMTL 1IM9D 3TBYA 4HHWA 1B4TA 3U83A 3PNWB 3CN1A 4AEEA 3M86A 4YR6A 5E2VH 3G6DL 4W9GC 5I0WA 4NWUL 1RFDH 4OY9A 1EVUA 2VXVL 4PY8J 5JHLL 3WGVB 2YD1A 3NP4A 3O9WB 4FL4C 5B4MD 3ARDB 5I5IA 2WXKA 4G7QB 5E8PB 4Q56A 1E9PB 5EU5B 2V5RA 4G8GA 4K73A 4O2CA 4GKNB 1JYXA 4HUVA 4FQ1L 2Q86B 3AS1A 4X4XB 1V3JA 4KU1A 3W0WD 1IT9L 1ZSDB 4KX9A 5HYFA 5C0DB 4LVOB 4XR8C 2APVA 3QUYD 2NUTA 4ZD3L 3KEDA 4ZG1A 2KZBA 3ZE1F 4NZTH 1U36A 1A7BA 2XPYA 3L5WB 4R7DB 2X4RB 1DBBL 4MMXB 3HMXA 3MLSH 2BOCA 1NZRA 4PVNA 3CVDA 2WC7A 3OM3B 3OKNB 1A7QH 2BVQB 4WFHD 3HR6A 4MFHA 1T83C 3IU4L 1BFVL 4P2OB 1LJMA 2X40A 1GPOL 2CO7A 5F70A 1OWWA 1FFRA 2J8HA 2VXSH 1MAKA 3QUKB 4NM8H 1DVUA 1I3UA 4GI6A 1H3WM 3O3BB 1I9IH 1U8JB 1U3HD 3MRPA 4JKNA 3GXNA 3MRRA 4TNVK 5D4QA 1XR8B 3HZKB 4AG4L 3BI9X 2JKWA 3U9UB 1K9TA 3KH4A 2PMZA 3GS4A 3NA9L 5DVKA 3T4YA 3B3IA 2HVKA 3UJTL 5IQ9A 1AJ7L 1UKSA 2DWYA 4L3ED 3RPIB 2J72A 4OD1H 3WAJA 5HYEA 2P46B 2GI0A 4K23L 5TF1L 4KUZL 5JQIB 2DYRB 3UYPA 2WY3B 3CFDA 3IWVA 4LLAA 5AENA 3MBEC 1DJSA 3IDUA 4LRNH 5E94B 1LO5A 2AQ1A 4PW4A 5FM5M 1EEYA 5FHAL 4WKXA 3G6JA 3ZHFA 4G59C 4H8WC 4FF9A 3B2UC 4ZQTA 3QUXC 3MRQA 4G1EA 4OM0L 3HE6D 1NCUA 3LKOB 4L1LA 4N90D 2QDVA 1BWMA 5HYSB 5JYLA 3Q0HA 2R0KL 1UH2A 1UKQA 4I18B 3BPNC 1FHGA 1VB9A 1D6EB 1S8DA 2BMKA 1QQDB 3GJEA 4FHKA 2CHDA 4GJTB 4XP6H 4N2GA 5E6ID 4IKLA 3A4EA 4L9LB 2PTVA 1OGTB 2MQGA 4FQCH 1AZRA 4XB7A 3FQTA 1SEQH 3V7MA 2XIBA 4X5PA 2DWTA 3D25A 5GRZA 3N44B 1Z3GH 4XX1G 1PJWA 2GCYA 3G7TA 2QPEB 3M1CA 4XGZB 2B16A 5IFHL 4FEMA 4FI8A 5H2BA 3ECWA 3G08A 1DVTA 4XNYL 1J48A 4L37A 4EDWL 4OW6A 5T1DL 2PXYD 5H37G 5MEND 2YPLD 1WAAA 5JOEA 2WWKO 3EJUA 4WO4C 2EYSB 4S1QH 4JHAH 2GIMA 1F1GA 2ADGA 1N3NB 4R2GD 4GO6B 3SCMA 3GXFA 1JS4A 2QQLL 4K5OA 5LCVH 1I8IA 4G8GE 1TT6A 2BNRD 4U6YA 5E51A 1OTSD 2WZPD 3DRQA 4NQVA 3CH1B 3LDBC 1MREH 2NY3C 4KO9A 3BHBA 4PG9B 1IKNC 5F7LB 4Q0XH 3CUPB 3QA3A 3P3SA 2XTJB 3KGSA 4NDMA 2AITA 3VXSE 3BUDA 3HVNA 3GTNA 1GJIA 4JZJC 2FT6A 4QF1A 2GFBB 5T1LD 5EZLB 5DUML 5CILH 2H9GA 4IBWA 4JX0A 4A7GF 1FAKT 1U2CA 5DJAB 3ORJA 4JANB 4JNXA 2G0LA 4NUPA 4OLUH 2VQUA 4I77H 1T0NA 4JHVA 4LF3B 1JNHB 3F5WA 1J9QA 4FNLL 4ODUA 4GRLD 4Y19B 3ARXA 2YD6A 4PJCB 1ZLWK 5I17A 2YSSA 2XZAH 4PJIB 4NN6C 3WMSA 3CQQA 2O5YH 5EUKA 1QLEH 3UTPD 3UTTB 3LZNA 5EC2A 1FL3B 2BFVL 4H13C 5CLTA 1Z2KA 4KK5D 3X12A 5EF0A 5GGSA 4GXVL 2RTTA 2A74A 3WSQL 3QGVA 4G6FB 1CE6A 3S37L 1HWGB 1JPTL 5D1ZC 3W11D 2XV0A 3DVNB 1J9CT 1UD4A 4K3GA 1NEZA 5AB2A 1GZHC 2K6YA 3IXTA 2MKLC 4KV5F 3CSYA 3KXFD 5GZOC 4OZGA 5CSZB 4TOYH 5DC2A 3SDXF 1HVXA 2VMFA 1LO2H 2ARWA 4OFKA 3NCFB 4P5KA 3RFZA 4R4NC 2PO6C 4YZWA 3ULUE 1RPQA 3G6JE 4G5ZH 5JQHC 1LP9A 2OXGA 2W94A 3BKCH 2D2CC 2AQ2A 1OF2B 5DDHB 1CXLA 2I07A 1UZGA 1AFVL 5KVFH 2NX5B 4I2XE 3E8UL 4PWHA 3MLXH 4H8VA 2MQCA 4PJGE 4NAJA 3ZKMD 1BX2A 2P80D 3KBEA 4L1TA 3QPKA 3D85B 3EJTA 4BQBA 3EO0B 4OGQC 1OHQA 3GMRA 1A7NL 2EILB 4LLYB 1EFXD 1X9UA 2X4OB 4GRWE 1GC1H 3VWJD 1F18A 5GGUA 3TIEB 2EDDA 4G6ML 3GHPA 1CDYA 2XG5B 3LHPL 3A3YB 4XN1A 1NFKA 5F96H 4OLVL 4S1SL 5IFJB 4F27A 4HUXA 3G04A 3L3KA 3KJ6H 4KI5D 1NEUA 2WOYA 3TASA 1GGBH 3KPSA 2PPCA 2OZ4A 3ZRCC 2AC0A 3FRPB 1YEHH 4HG4J 1E4XH 2VTFA 3UZQB 1E5ZA 4MAYA 1NLDH 3FB7B 2N1KA 4K15A 2DKUA 5CUSL 3TCLB 1KBKA 4ZRGA 2AJ3B 3JTTB 3LKQB 4Q9BA 3PIQA 2Y9RT 1KZQA 2AQSA 2YRZA 2GT9B 2AI0H 3VNYA 5HD8D 5C09B 2Z4QB 3SKJH 4FADA 2LLGA 3C5ZC 2VUYA 1EXUA 3MJGX 5IUSA 4JL1A 1X9QA 2VB5A 1K72A 1SDYA 4D0CA 2JJTC 3S96B 5DD1H 1OM3L 2GQHA 1YEIL 1U8KA 3CVCA 4GKOA 2IWEA 4F8OA 3GF8A 1RK0A 5AEAA 1M7DA 4CVXB 1CGXA 4NZ8A 2W65A 5TQ0L 3ETTA 3VFVB 4LOEA 2QSTA 1GIGH 4HXAH 3KLAB 3CSGA 1XMEB 3WTTA 3QI9D 1BV8A 3NIFF 2N01B 1ETA1 1MLCB 1YLBB 2FBJL 2XKNB 2YO3A 1GGTA 3SB3A 3SO3C 1DUYA 2FECL 1SGKA 5BRZA 4KROD 2FUQA 4YPJA 1HH6A 1B6DA 1NEZG 2H4EA 3VH8A 1DSWA 5IJVB 5LUMA 2H32H 3QUXB 5KYYA 3N43B 5A43C 3GPSA 1WFUA 1P7HL 4AV4A 2O5XL 4DKFL 3BPNB 1L9OA 3LCYA 4W81A 2AFNA 3PAVA 5DJ2B 3SOTA 4HA1A 5CU9A 2RCSH 5DQ9B 4LDCA 2VH5L 4NO3B 5T3XE 4WV1C 1MCPL 1E9QB 2D4DA 4G6KL 1R5IB 2OL3H 4MCYA 3I85A 4M5TA 3WIFB 3ECBB 4HDIA 4OZIE 3PHQB 4ZW6A 2ZXGA 1JV2B 1V7ML 2J88H 3NZSA 2J8UF 3LZOA 4WO4B 3INOA 2EDTA 4JFZH 5HYJE 4PRIE 1HJBC 4XC1L 1T22A 3R06A 1FA4A 4ODTL 4S1RL 1ZT7B 4Z3JA 5F7DB 5C0FA 4DQAA 4JBSA 4AGOA 4YGVA 3L3DB 4UM8B 3WXWH 1ZS2A 1HQ4A 3PWLA 1KNOB 4CU6A 4Z7NE 3D33A 2NY3B 3EYSH 4LCWB 3T2NH 4RDBA 4Y4FD 5B1CA 3PJSB 5CM1A 4M6AA 2J44A 5HDBE 5A16A 3QXTA 5DSCA 3U7WL 4ONGH 1KBGH 4JZJB 3HN5A 1NGYB 5DWUL 1I9RL 5BXFA 3BISA 1TF4A 2P24B 3H54A 4L29B 4RAUB 4ZW7A 5LVEA 1KGJA 1XIWA 1PZ2A 1P6WA 1A14H 2X1PA 1RUMH 2VC2H 1CFVH 5JUEL 1IEBB 2JSFA 2JK5A 4JCLA 3KLHC 3REWB 2A83A 4HMEA 4M4RB 1E6OL 1EMTL 3WKML 5D9SB 2W1NA 3BQUD 4Q6IC 4DGIL 1YUKB 1ZAGA 2BH0A 1NAMA 5J5EA 2ENPA 4WWKC 4NN6B 1B0IA 3O6FC 3KBFA 1A22B 2DQCL 5IIEB 4S1DC 2ZYRA 1F58H 2YD4A 3I9AA 5D5MB 4L5FH 3QEQA 4GQPH 1DN0B 2ZICA 3WDIA 1WD8A 4QWWD 4L8SB 3JV5A 5EORH 4ZTEA 3RX7A 4GNKB 5D8JH 2X1QA 3UIZA 4XPBH 1P1ZA 4G42A 2EIZB 4WCYL 1KJMA 2O1AA 3MV8A 4FOMA 2I9LA 4XODA 3VUAA 5JDJA 4O51A 4H25B 4AH2A 3ULUL 2LU7A 1N0XL 4R4BB 2I60H 3VH8G 3TNMA 2P1YA 5INCA 4ZI8A 2WZ0A 2HKFL 3QO0A 1W0WA 2J1WA 3FCTA 1EHXA 3EGSB 3BIKA 3Q8AA 1YNKL 3BYYA 4I48A 3OGCA 4X9GA 1RP8A 2QV4A 1AO7B 4F3FA 1BQHA 3HHSB 3EZJB 4NYLB 2ZT9C 2PO6B 4NC2B 5ACZA 1S9KC 3D39D 1J12A 2ITDB 3RUGA 1B88A 1FNGA 2UXFA 1UYWH 4QLRA 5EU6E 5D4HA 3U36A 1BZ9A 2OPCA 4KDTA 1WT5C 4D2NA 5BW7A 4MCZB 1RUKH 2BFGA 2X4NA 3OAZH 1X6LA 2OW6A 3T09A 1IZKA 4TUOA 2YMOA 4RRPM 5I18H 3P0YL 3FUNA 4IBTA 2XJLA 5J6GA 2XFXA 3UBXA 3QG7H 4LCYA 3BP4A 4XCNA 3RVTC 5IHWA 1A3ZA 3QXVA 3ROLB 4TVPH 3CIAA 1G6RB 4HKBB 5LGYA 5KSBA 2ICWA 3TWCH 2DW5A 1QHQA 5HHVL 4FYTA 3EYUH 3D2TA 1S5IH 3AW5A 3RGBA 4R3SB 2WLIB 3EDFA 2O61A 3H0TA 4M8QB 4U3HA 1MNUL 1T2QL 1XV8A 3GO1H 4JHWL 4LSUL 2XWTA 1BD2D 1WYJA 4QXUL 2VXTH 4JFDA 1TVBB 2NNFA 3QDGB 5JO5B 1FG9C 5DQJA 1INEL 3B2VH 3C6SA 3T1FA 3OJDB 5D7EA 1IAIH 1MCIA 3DBSA 1AVAA 4CMMB 4YDIH 1MHEA 3O3AA 4PJXB 1FRGH 4XAWH 4AMKH 1FZMA 4FMVA 5C9JB 1LO3H 3N0PB 4M43H 4PJDE 3PPSA 1IE5A 5C07A 2HJFB 4KJPC 4X0KB 3N91A 2VDRB 3SDYH 3FFCD 1HXKA 3DHUA 4R96B 1EAPB 1L7IL 4UV4L 4PLKD 2F58H 1AXSB 4FXGC 4IBYA 2J6EL 1MFAL 4AKQA 1ZHBA 3LNEA 4UDUA 3C5ZB 2EIMB 5ENWB 4C56A 2EIJB 2NNRA 4PJHB 3B4NA 1BJ1J 2WSPA 3EJJX 1F4YH 3SKMA 3QEUA 5C7ZA 3BRDA 4W9ZA 3NIGE 2NQCA 1YMMD 3L5HA 3V4LA 1JZEA 1PEWA 2WLZA 4DTGL 1KCUL 3IS1X 3HG3A 3HRZA 3NPZB 4UBDC 1WJ3A 4GY4A 4R5XA 2EDFA 1XH3A 3SDCC 4XRCB 5DK0B 3MV7A 3VFNB 5KYWB 2VERN 1UM4L 3DX4A 3LZFL 2XPGA 2ZOTA 4X7FC 4GXUN 3U25A 1IQDB 2ZUXA 3I02A 2IC2A 3IDYC 4FQIL 1QO3A 4PJ9D 3SO3B 3VCLA 4FABH 4BRJA 1JFHA 3K6IA 4XVUC 1WEJL 2RMNA 1V3MA 4HWEL 5T3XL 3FONA 2GBUA 4PB9H 4TRPL 4YH6A 3VD7A 3MJ7A 3QCUH 3IJHB 3QNZA 5E08L 1UB6A 3STBA 5I1DA 4PI2A 3OR6A 1A6ZA 2CO2A 2EC9T 3CC5B 1BQHG 4FMFA 3O2VH 3S8FB 5ID0B 4I9XA 2VZ1A 3CVHB 4LPTA 2FO8A 1B4JL 3IJ9A 3OQRA 5FECA 4X9FA 5GZNA 3HI1B 3NCCB 4WV1B 2ZG3A 4E68A 2DQHH 1JN6A 4OD2B 2CAKA 3OKYA 3UDWC 3T3MB 4O02B 2WV3A 1R46A 2IIJA 4ZO9A 3ZKND 1BF8A 1LEGB 1KY7A 4ZFFA 4CJ0A 1KLUA 2NT0A 3RE0A 4A7SA 5FW8A 1CF1A 1A02N 3UBXG 5HP5A 4X6CE 5CN3A 3C6EA 2MPVA 2F53A 3CFNA 4OLYH 5L8KB 1ADQL 2WB7A 1E28B 2FSEB 1OTTC 4U1GC 3JV4B 5JA8B 3SYCA 1VERA 4Z3FA 3NMEA 1J11A 1Q9OA 1KJ2B 3AU1A 3BKJL 3BD5A 1S9XA 1DQIA 1WWWX 4CN1A 2AK1H 2I5YH 5CZRA 5GSVA 3RY6A 5LCVA 4HIIA 5CBAB 3DSFH 4IBLT 2HJLB 1S9YB 1E7UA 2ADJB 1DVXA 2YR3A 1GTNA 3FUIA 3N85H 5FYJD 4LMQI 4N2HA 5TK2A 5J6SA 1CFSA 3F7QA 1OF0A 5AW1B 3T6ZA 4LQFL 4R0LB 1YQVL 2HLFD 2AJSH 3VFPB 3MA9H 4PYHA 4JFDE 3HZVA 5GS2D 1JWUA 3V0VB 2CLZA 1F4WL 3AG4B 4X80H 1BFTA 5AUMB 3OKLA 2A6KB 3P02A 4YSUA 3GUTB 3U6XA 1GL4B 1X7TA 4V1DA 2BSRA 4GKZA 4WFED 3SE9H 1KIPB 1RULH 1C5DB 1IGCH 5DA4A 3WFDL 3U6XS 4Q6IB 3GM8A 4XP1H 1RZIA 3CSPA 4KMQA 1M1SA 5HJ3B 4PS3A 1EGJL 4UT9A 1NM4A 3E9UA 3I9GL 3O6FB 3MRMB 1E4HA 1ZHKB 5EOCL 1A3RH 1FO0B 2WLHA 3E3QE 1V5JA 4AUYA 4TN9A 4UIMA 3HNSL 2YOCA 2I9TB 2A6IA 1LD9A 4XBMA 3EDEA 3RHWF 3A4DA 5J06A 3SY0B 1NBVH 1ECYA 1NBYB 3IFNH 3L9EA 1CGWA 5F7EL 2X6AA 4OZHB 3AADB 5D71H 3WJMB 4Z0BH 3VI3F 4P48A 4GO9A 4LEXH 2LU3A 3AXIA 2Q87A 3VFRA 3MLPA 1FZOB 2QVIA 1SYVB 4FE9A 5FO8B 3RNQB 2GHWB 3I9IA 4A7QA 3KZ8A 1CLZH 2WBKA 3X3GH 5ISZD 4DK3A 1U8QA 2ZPKH 1AG6A 3F6JA 3FT2A 3KPOA 3QCTL 5GGRA 5A2IH 3QZMA 4HCRA 4PJ5D 4H88H 3DUSA 4D3CL 1MG2C 4RSVA 3B9VA 2V4LA 4F2ME 3VXMB 5I1AB 1BMZA 1VCBC 2DJMA 4MCMA 5HSFA 2VMJA 5EWIL 3S35L 3PDOA 4LSTL 3SJVB 5JHBA 5GJSL 1HX0A 4NO0B 1RLWA 4Z7IA 4NKDB 4UTCA 5EOQH 3RVVD 1SJEB 4X5XA 4HH9B 4FTVE 1I1FB 2WTOA 1UGNA 1WISA 3DMMA 3B9KA 3TVMC 3INUH 2W59A 1TLKA 3U82B 2JCCF 2VAAA 2PYFA 4U1JA 3JTSA 2BIIA 1IBGH 4KK8C 2A9AA 3WS3A 4WW1B 1M1XB 3OVUB 5JXAH 4CSPA 4LLQA 1T04A 4MJ6A 1XGTA 4PV8A 4AQ1A 4AZ8A 1MJUH 4LP8A 3VNZA 4O9HL 1Q38A 3IFPB 4JY4B 5FFGA 2DIBA 4KI5F 1DDTA 4BBWA 4KO7A 2JNZA 3FQWB 3ZYZA 3QPXL 1E4JA 1CK0H 3FOLB 3C60D 2ZX7A 3TL5A 1DJIA 4PW9A 4BEIA 4WHYH 2D9QB 3K4DA 1J8KA 3EYOA 1UWGH 3N41B 4K8RD 1T80A 4NNPH 4PD4K 4IRJA 4QHUA 1IFHH 4LOFA 4FX5A 3B8SA 1OAQL 4BKLB 4FXGB 5GRJH 2F7OA 1RU9H 4YOKA 1E5CA 3HG4A 1K2DA 1NSNH 2MCPH 3TYGL 2KLRA 3L1OH 1NAML 3VXQA 2J8OA 3NRQA 4IRZH 5EA0H 2J3SA 3QUHA 4I3RL 4M56A 2FIRT 4V1DE 2CLRA 5I6OA 3EFDH 4OT1H 1MW3A 2AS5M 3P4MB 4IMLB 4LSPL 2JV6A 4DKTA 3WD5L 3SDCB 1GZQB 2IAMC 3OZ9H 4U3XA 3W1ZA 1UXSB 4X6DE 2PWGA 2B4CL 3EFOA 4M5YL 3O3UN 3VMNA 5H35A 4NQEA 4YFLF 3IDYB 4ZFQA 1D7DA 1RQ5A 2EVHA 2X3CA 1TVHB 1RPKA 1OCWH 3MLYL 3KYOA 5KSAB 2B1AH 4XNZB 3STZB 1A4JA 5CP3A 4LQ1A 4U7KA 3QQ9D 4UM9D 2A73B 3OPZL 4TQEL 1ED3A 3HI6L 5TDPA 4E42A 2H32A 4NO5B 2ENJA 5CINH 1R1CA 1WFIA 1G7MB 2Z1PA 5B22A 1ZVSA 5FGCB 4JM2C 5C9KA 1EK3A 1EX0A 2ZOWA 4G80A 4DAGL 5JOPE 2WXOA 4YZFE 3X1EA 1DFXA 4TSAH 5EBWA 1RFDL 1NMAL 3L8QA 3U0PB 3BT2L 4PJEE 2CSPA 1JZDC 2PYED 2W8CA 2F54B 2OL3A 4XO5A 1TG8A 4KTGA 4D94A 2BP0B 1OPGH 4NQDD 1HINH 4PPTA 4XCEA 1L0XA 3L4YA 4QTIH 4UNIA 2Q8AL 3QXDA 2ZUSA 2OMZA 4P5SA 4U1GB 1ZA3A 2MPAH 1R75A 3QSKB 1XR9A 1OO2A 5SWZB 4U1MA 2FL5A 4NJ9H 2K8MA 4XHJD 3RBSA 5JHDE 3FB6A 3KR3H 5D7IF 2P7TB 2O5NA 4ICXA 3C5XA 1RZGB 3ENEA 1KG0B 4I0KA 2X9YA 4WGVB 1BVLB 5D2LF 3L3JB 2H47C 3I2CH 3FTWA 3ARVA 3RDJA 5DJXB 2QVMA 2ZP8A 3NUKA 2OMNA 4OI8A 1F02I 1SJHB 3D30A 4KJWD 1QYGH 2FH8A 2D7PA 3CSFA 4XMKL 3GT6A 1YG9A 1QFWH 2D7TL 5DTFA 4AIEA 1F3DH 4CUCA 2R0LL 4HSAC 2ZXAA 2CR6A 3C6LC 5ANME 5J3HD 3EBAA 4AM0Q 2YQBA 2NY1D 5KS9B 1M4KA 3V6ZA 4BSJA 5L8JB 3RWCB 5DS1A 5LBSH 2N7BA 4YAQB 3MYZA 4P57B 2FEEL 1I9IL 4NZRL 1PZBA 4P5TD 3AROA 3V0FA 4LASH 1Q9LA 4WHCA 3LSOA 3M46A 3DO4A 4ODVH 4PMFA 2YC1A 1PQZB 2BO0A 4QTHB 3ESMA 1M2VB 4QLWA 3PUUA 4OJCA 3QJHA 3ARBB 4J3WA 2B7DT 1GY1A 3VYNA 4J3XA 4NUGH 5FUOL 4CW1B 2X6CA 1OT4A 4F57L 5JPMA 3GMMB 1TJGL 1IIIA 4UWQB 3L3OA 3P77B 3AY4C 7CGTA 4JEGB 3Q9QA 3JUYA 2FLMA 4ODXB 1EUUA 5D7HA 4OIFA 2V7HA 3L6FB 2QLVB 4DCQB 2DQTH 1B0RA 1ZLVK 5A6IA 2APSA 4RZCB 4NQEE 4JDZA 3SKUD 1JPGB 2D0FA 4DKAA 2ZCLH 4OGZA 3OR7B 3B7TA 4G3YH 4Z7QB 4XVSH 4WNJA 1IGFH 3WLWD 1PFCA 5E2TH 5ESQA 1OOAA 4ZPVB 3FQ2A 2C3GA 1YJDL 4X8CA 1FGVH 2Q7YA 2V9TA 3H55A 4ZSOA 4FA7B 3VMPA 5ID1A 1X6NA 1HHIA 4UQ3B 5FW6A 1EIBA 2PPAA 1DBKH 1QBLL 2FEDD 1SEQL 2Q7AA 2UYLB 3CVIH 5CJQH 2XOTA 2Z93B 3ULUC 2JJSC 1Z3GL 1FPTL 5JHMA 5LWYL 2X12A 2R1YA 3VFMA 3BVNA 5JIPA 2IVFC 4MMYA 2FATH 3BPCB 3DYPA 3TVMB 2AEWA 5FYJU 1JWSA 5AZ2H 2R29H 1K4CA 5T5FH 2G2RB 5EO9A 3S88H 1CD1A 1EHLH 1RIVH 1UWEH 2DBLL 3PP4L 3ARDD 3IPEA 2CNYA 3MPCA 4NN5C 4BCYA 1Q9KA 3VI4F 3PHOA 2FE0A 4FC3E 3TF4A 5DD0H 3ARTA 4RMVA 5J9PB 2ED7A 4K3DH 3B2PA 4UANA 2DJ4A 4B3VA 4J3TA 4AC4A 4X5WB 1JV5A 5I8OL 5GRUH 2CJUL 5JTWA 4E41A 1Z6JT 2P44B 3O6LH 1Q0XL 2QQNH 2VKWA 1ZMYA 3N1FC 3H2QA 3W9DA 5HHNA 2C9AA 3DC0A 2VDNB 2IDSA 5KG9B 1JHLH 5K69A 3AM8A 1LE9B 1JK8A 1K85A 4Y5XA 4LO9A 5B7MA 5ICXA 4UT9L 1EZSA 5ITFB 5L8LB 3MCYA 1NFIB 1FZKB 1H9VA 3NACH 4KK9D 1P2CB 3T0XA 4BDVB 4P2OD 4ZMVA 5MEOB 4FFZH 5I6LA 3EYFA 4N1HB 2BZCA 3O11B 3RAJH 1FFPB 4L4JA 1QLEL 3VG0L 5J7CC 1MQKH 5JDSA 3FCUB 2J57A 1CDGA 2ZUYA 3HG2A 1II4E 2GJZA 5DGRA 5HI3D 1AAJA 3DUHA 1R5VB 2F5AL 5I19H 1H6TA 4YXKH 4DSYA 5EO1B 1U42A 1G4RA 1K4DA 3JT0A 4XI5C 4U1SB 5C0IA 3U79A 4Y4KC 3EJQA 2X89A 5INDB 2WKLA 3OSVA 2VO8A 1NCAL 1E2VA 1JK9B 2OI9C 2RGSA 1CLCA 4ORGB 1CF8L 1FIGL 2R7EB 4HCRL 5B8CA 3KPNA 4JM2B 1VACA 1A5FH 3MRHA 1UOKA 2NR6A 3RA7L 3PWVB 3OX8B 3QWOA 5J1AB 2IQ9H 4X6BA 2EXWD 3AMKA 3MUUA 4PD4J 3T8XA 2IDQA 1NKOA 1YEEL 3MLXL 2BHFA 4JQXA 4ZSOE 3PPEA 3SY6A 5I8KH 3TBYB 1I3VA 1S7VB 3NDZE 2YBGA 3FSOA 3RFZC 3TZVA 1IBZA 1XF3A 3E6FA 4UYQA 3NPSC 1MQ8A 3G5WA 1DO6A 3FUFA 4UINH 1KN4L 4RDQG 4HAGA 5K9JH 4PJFF 3EXLA 2YKLL 4MAZA 4LVEA 1XXFC 4CL7A 2C9SA 5F96L 4MQSB 1T7VA 4JRXE 1TDQA 3WMQA 5DQDH 3LRGA 4G8GB 2EUWA 3BH4A 2B0SL 2NY6C 4O2CB 4G71B 1DDHA 4OFPA 3TFKC 4N0UE 5AVXB 4PJ7A 2J5LC 4HUVB 2FWOA 3I3BA 1GGBL 1QEWA 4MZRA 1WBZA 5DRNA 1TLMA 2GB2A 1A6UH 3BN3B 1E4XL 3U4AA 3VXSB 1D2PA 5IESH 5IB3B 3MJ8B 3OHXA 4QY8A 4CSSA 1NC4A 1XXDC 5FB8A 2XTJD 2AI0L 5CZKA 1UEMA 4WW2F 2BOCB 5HI5C 4NHUA 2IMNA 4QHNA 4Z7WF 1BAFL 1JF1B 1AI1H 1R47A 5JHAA 4YHZH 1EO5A 2WLKA 3CXFA 1ESOA 2CO7B 1U92A 5DF0A 3BFOA 3DO7A 1IGJB 5JA9A 4HZLB 4Y19D 2CK0H 2JI2A 1IBDA 4U6HA 1KCVH 3VFSA 2CIIA 1GOGA 4Q89A 2ZYHA 3CLEH 3NYKA 1M2OA 1U8NB 2Z0UA 2UX7A 4M8UA 3UTTD 5LXVA 2R15A 1P53A 3ZMRA 4KV5E 2M1KA 1CWVA 2HVKB 2NLJA 3OKMA 3WNPA 5IQ9B 3VACA 1NIDA 3SDXE 1JGEB 4JFFA 4ZT1A 2NDFA 4G6FD 2P5WE 2Z8VC 4MMZA 3QRGH 2MNWA 2AMUA 3NQKA 2PWEA 4KKNA 4RZKA 3ZN6A 4DKEH 5IHZB 2BVEA 2PR4H 4Y4HA 4F7CA 2RCSL 3ARFA 4FEIA 2WP3T 2UUDK 3R8BB 3X1NA 1PD1A 3GB7B 4OIBA 1EEYB 3G6JB 2E7MA 3A22A 5IBTH 3SGKC 2HWZL 3MRQB 4YE4H 1OGAE 3L08A 1KDIA 1LO4L 5ALCH 2XPZA 2BMKB 1UJTA 1JI1A 4TQ8A 1HJCA 4YXLH 2XUWA 4PJGB 3LNGA 3TO4C 2WUCH 3BKML 4CVUA 1G5AA 2NX5D 4O2EB 3FQTB 1CFMA 4NN5B 4YHKL 4F7PB 3D25B 1ORQA 4GRWB 4J3SA 1SXSA 1G7PB 2GCYB 2H6PA 5CMAB 3U0WL 5H2BB 3G08B 2AEQH 4Y2OA 3D85D 4GG6A 4RWYL 3FO0H 4L37B 3EG9A 3GEWB 2Y25A 5ESVA 4LL1A 4QRBA 4F1SA 1S46A 5B1BB 4HS6B 2OMUA 4PJAE 2AABL 4NRYA 4YK4B 2DM7A 3IB4A 3HPLA 2ADGB 1A7RL 4KKBC 3ULVH 3SGEH 1MJJA 5BMFL 1I8IB 1PYWA 4P9MH 4HWBH 4FLQA 3QEGL 1MCKA 4WEBL 5E1GA 4U6YB 5GQBA 3WO4C 3SHSA 3DRQB 3KVPA 1HSBB 4F8PA 1NH6A 1QHPA 1RUML 4ORZC 1AS8A 1FH5L 3AVEA 3V10A 3QA3B 1QW8A 1R3LB 4NDMB 3K80A 3DV6A 3T1WA 2WNKA 4TM9A 4QF1B 3TT3H 4IRZA 4XT1C 2P43B 1U8LA 4Q9QL 1U0QA 3GMLA 4O58L 3ILEA 4M02A 2H9GB 4KTEL 1UT2A 4OD3H 5C09D 2A1WL 4QRPE 2XQBH 1D5BA 4J23A 3DNKA 4JQVA 4P8QA 4PRBA 1T0NB 2Y3NA 3NIFE 5FW7A 4G7SB 3F5WB 4ODUB 3FUJA 1PLAA 5C6TH 3VXTA 2NYZA 3A23A 4WF7A 4LGRB 1K3ZA 4UTAH 3BDYH 2FX8H 2H41A 4HX1B 1QSFA 5K93A 3FCBA 2YXMA 4Y4KB 2PWFA 3FB8B 2I60L 4UQCA 5DMKA 5CKAA 2B14A 2WLNA 4XBGA 2OLDA 3GS7A 5EC2B 4L3AA 2AJZA 2HMIC 4XO3A 2LOEA 4DP7X 2XQYK 3X12B 5GGSB 2QSCL 3VWKD 4LHUA 3IM1A 1THCA 4J3OC 1D5ZA 1CE6B 2B4CC 3OLIA 1VGEL 4P4KC 4QRAA 5C0AA 3ZKXC 5L88H 1OAYH 2BS9A 3WYRA 3QUXD 2BVTA 4U1KA 2OR9L 2NXYD 1NEZB 3V7AG 4BQ9A 4IGBA 4U4IA 3IXTB 3MOAL 3DX7B 5AVRB 3CSYB 2JLPA 2C4FU 5C0BA 2J8UE 4HWZB 5C8JB 3TEWA 4OZIB 3RFZB 3RWDB 3NPSB 2V9RA 3UTZA 5I23A 3WNIA 2OXGB 3MRJB 4BE5A 1U9KA 3D3VA 3EYUL 1SHMA 2I07B 3NFSL 5AG9A 5HYJB 4PRIB 2DM4A 3FB5B 2VLJA 1OE1A 4HZAA 4ODWA 1PG7W 4AL8H 3NSJA 3VD9A 1Y6KR 5LBGA 3ALWA 4WFGD 1DN2A 4Z7NB 3FFOA 2J5LB 3GMRB 2VDMB 1QPPA 1VFMA 3MCKA 4S2SB 1YAIA 3U30C 1LO3L 4ODHL 5GGUB 1FI8C 2PNDA 4Y5VA 4GG6E 5HDBB 1BA9A 4WHYG 3QO1A 2YIHA 5HI4C 5GGQL 4LCWD 4L0PB 3FL7A 3MKGA 4DETA 1XGZA 2IV9A 4JMNA 3G04B 3L3KB 1SZNA 3HR5A 2OSYA 2FJSA 2MFNA 2VYRE 3FCSB 5CEZH 3S5ZA 5LBSA 3BUBA 3FU7B 4LSQL 2Y1AA 5ILTL 4HIXH 1N68A 1U8CA 3GKWH 4PHXA 1YNLL 4JPIA 1WG3A 2APFA 4BQCA 1KN2L 4XP5H 4RFOL 3UTSD 5AVSB 3MREA 1CIDA 4RFNB 4HYTB 1WS8A 1JGDA 5E2WL 4KKAC 3LKSB 3CDCA 2MCG1 1GJWA 3UTOA 3UTQA 3DOHA 3E3QC 1Z32X 4C59B 4NNYB 3NOIA 2OJ1A 1HXMA 4TUJA 2DLEA 4FNPA 1ACCA 1HESA 4FN0A 4FABL 1KCBA 2V0AA 3QCVH 1MCCA 4PB9L 2WUBH 4N9OB 1QFPA 2EIBA 2G9HB 1ZJBA 3HE7A 4OZ4A 1BBDH 1RK0B 2WKGA 1M7DB 1Q4NX 3JSSA 2R2HA 3HRZC 3BVTA 5F8RC 2XA3A 1HT6A 4N4YB 1DL7H 5IMOB 4TL5A 1RURH 2CJTA 4QRRD 5I30L 5D6CA 2DDQL 2FGZA 3F6IA 1E43A 1WAPA 4NFBA 4A63A 2DQHL 1AIFA 1DUYB 4H4NA 4HJGA 2K7QA 2BVUA 4NZUH 5BRZB 4YFLI 1HH6B 4X7TA 4JPVL 3FSAA 4E36A 5GZOD 5TE7H 3VH8B 5FX3A 4UQAA 2EEFA 3DK2A 4M9OA 2EACA 5KYYB 1F56A 4FI6A 3CXDH 1BZDA 4R4ND 2PO6D 1TCMA 4GQQA 5C0AE 4GOSA 2ROXA 1JZIA 3VXRE 2XZZA 4WU5A 2KYIA 5D7SH 1BAWA 1OAZH 4IEFA 4KFMA 3TO4B 1Q72H 5BQ7B 3W0WE 4YFEA 5GZNC 4FZ8L 4DP0X 3L81A 4ZUWA 1YJDC 2DWDA 2R29A 3I9PA 6CGTA 4GP8B 4NC1E 5T5FA 1MW0A 25C8H 2CGYA 4HDIB 2WBJA 1ZTMA 2X70A 1N6QH 3DRTA 3RKDD 3UO1H 3ZL4L 2HPTA 3QFDA 1DFBH 1Z5HA 2YKKA 4M61B 1OP5K 3CTTA 4WENB 1BZOA 3J27A 4APXA 2WBWB 3V6OA 3R06B 4ZX5A 2VLJE 2QSQA 4JN1H 3HW7A 2MOVA 3MLUL 4YGVB 4BZ1H 3H9ZA 2D7OA 4M1GL 5DT1L 5HGHA 3WO4B 1WBXB 4X80L 5BPPA 1T0PB 3GZPA 4M3JA 1O5PA 3RY6C 3QUML 4G8FB 4DPAX 5D7LD 2LR4A 3COOA 3SE9L 4QNPF 1CR9H 1IGCL 3NTCH 3KPLA 4I1RA 1FQ9C 4NT6B 1FVCA 4LT7A 5A16B 5DSCB 2BY1A 1YEGL 3S3BB 4QOKE 5LGHH 5GHWH 4G6AC 1SLUA 4PRHA 4PBVC 4WI2A 1GS7A 1TQSA 5E6RB 5BZWA 4F80A 5BXFB 5KSVB 1A3RL 4L3EE 1PF3A 4FFZA 4L2LA 2EUZA 3V5HA 3GBMH 1XIWB 1G0DA 3SN6N 4YBLC 3FT1A 3NIGB 4PAZA 1YEDA 3C5ZD 3IS0X 4DEPC 2YD8A 2XKUA 3WKNA 2GTQA 1JUFA 3WI9A 2W92A 3NA4A 3IFNL 1NAMB 3IAPA 4DZBA 1N26A 1QRNA 5GS0H 2CA4A 4ANWA 1TSRA 5AOIA 1I1AA 2OYLA 3BRFA 2IANA 3QEQB 2WNXA 1HCZA 2O26U 4IOIA 1AQKH 3UBFA 1O7DE 3CFJB 1BZ8A 1GR7A 1QFUH 2XV3A 1NCIA 3H56A 1P1ZB 3CJJA 4P4KB 4G42B 3ZKXB 5BZXA 4PGEA 3MV8B 2I9LB 3MV11 4AM0B 4KVNH 4AH2B 4OJFL 4YDKL 2VR4A 2AJUH 2Y06L 2HKHH 3TNMB 4L1SA 3QO0B 3S34H 1W0WB 3FCTB 3LPFA 5ERWA 3BIKB 4I48B 2AMGA 4LRIA 5MENE 4F3FB 4UDTB 1BQHB 4QXWA 3GS0A 5EOQL 1DEDA 2E4TA 2XX0A 3O6KL 3S6CA 5ETUA 3RUGB 4HSCX 1FNGB 4GFTB 3FQRB 1JHTB 1MAML 1UC6A 4W70A 4X6CB 4B3EA 3INUL 4DP1X 4PUBL 3U36B 4W9EC 5KBLA 4Y5YA 2BNRE 3MLZH 3UZVA 1IBGL 3VM7A 2AZAA 4TUOB 5JXAL 1CS6A 1JRHL 5C86A 1P9MA 2VM4A 3UZEC 5K39B 3KPPB 2VLKA 3UBXB 2XWCA 4LCYB 1XHHA 3EGDB 3BP4B 5KN5A 3AJ7A 4OCWL 1HE8A 4UT6H 3MXWH 2ICWB 1T6BX 3QIWC 5KSBB 3KPTA 4F93B 2W07A 1CFNB 2EKSA 2D7NA 3L2NA 3FOMB 3H0TB 1XGQA 3CBRA 3O0RL 3O6ML 5ICUA 2XWTB 5F97E 2VXQH 1IFHL 4UOW0 4G6JL 2MTAA 4AQ1C 4JFDB 4YX2H 2ZWZA 1AY1H 3P40A 3UAFA 2HLAA 5FF6A 4MZ2A 5DQJB 2ESVE 3S3SA 4XXDB 3C6SB 3C9NB 3GLZA 4Z7UA 1VZHA 4AT6A 4CADA 1NSNL 5DXWA 3O3AB 2JIXA 4JDTL 1F1DA 5TQ2H 2MCPL 2NY0C 1FZMB 1Z5LA 2HG0A 2LV4A 5T3ZD 5L2JB 1M7UA 5EA0L 3HIZA 4TNFA 5C07B 2M83A 3UTPE 4CC4A 2W88A 3MRCA 1T5XA 4UOJA 3TH3T 4ELMF 4M6NL 1N4XL 3OZKA 5FUZH 3KLHD 3PJLA 4HC1L 2ED8A 1CGSL 4QUOA 2ICEC 5F1SA 1XGYH 1BGXH 1XB6A 1ZHBB 4PRHE 4UDUB 5E03A 3UPCA 3O6FD 4C56B 4YMPA 4PJIF 4KXAA 4PGCA 4S1DD 4TVSa 5D72H 3ZDYB 1EZLA 3FO1A 1GAFH 4Y1AA 1TO5A 3BQVA 4FGMA 1FCGA 5EU7E 4JFTA 3GLEA 4U6XA 1IIKA 4N2KA 5G5DB 3ZYJA 3UGXA 5IG7A 4C8XA 5J1TC 3D08A 3KCPB 1UOLA 3KXFE 4XP9H 5CCGE 1D6VH 1YPZA 3HRZB 5DMGC 4Y9BA 1OZTG 1XH3B 3QUZC 1HHJA 5L6YH 3SKOA 3MV7B 1A6TA 3HS8A 4C4UA 5E5RB 4WI6A 2XPGB 5BO1H 4P2AA 3ILPA 3DJSA 3ARPA 3CZGA 3I02B 3L5XH 1QO3B 1H19A 4A37A 2VUOA 2VN3A 3EF4A 5EF3A 3FONB 1TU2A 4MQTB 3MJ7B 3CDZB 3QNZB 1UB6B 3H3PH 5I1DB 1CICC 4E5XA 4GQRA 4FG2A 5LQBH 5GISL 1OPGL 4OFQA 3J2PA 4LVNB 1BDYA 2NSMA 5E2UH 1K8DA 3RTQA 4PBXA 4MWFA 3VXMD 3BC9A 2ZWSA 1HCFX 2JCCE 3CN3A 4P2QA 4W93A 3PWJA 1JN6B 1SM3H 2MPAL 1PG7L 1T3FB 1VAHA 3ZXAC 4WK4B 3APCA 3M1BA 3MR9B 4NPYA 3SJVD 3I75A 5C2BH 4NO0D 1T2JA 3H4HA 4ZFFB 5EU3A 5BS0D 3PABA 1U93B 1WWAX 2DEWX 1KLUB 3QJQB 3TV3H 3WE1A 3IKCB 3RVTD 3EO1A 2WXLA 4KI5E 5CIPH 2IWFA 2G4EA 3UYRL 4FCHA 1MRFH 2Q1EA 2F53B 5TF0A 4AYMC 4DPRA 3FUHA 1BQLL 2FNBA 2J56A 1Q9OB 5FGBC 3AU1B 2VQTA 4TSBH 3MLTB 3OLGA 3IEAA 3HMWH 4OB5H 3B3BA 3HC2A 1DHKA 5GSVB 1AHMA 1JCVA 1PY9A 5TDOB 5IZ7A 3L16A 1UASA 5LBSL 3GXPA 2CLVA 4A6YH 2V17H 2E7DA 1S7RA 1FG2A 4APQC 1CFSB 3CHQA 4TNEA 1ET5A 4Z77B 2CLZB 4NIYE 1ZVHA 2Z91B 1KPVB 1SFDA 3OKLB 4YBLB 2BRRH 4LARH 3RWGA 2F61A 2CUHA 4V1DB 3G6AA 4DEPB 2CR0A 4GKZB 3JXAA 1BF2A 5AAWC 2G3ZA 4NUGL 4KRLB 2R9HC 4GS7B 4X6DB 4AYID 3TNNA 4YHPA 4UBDD 5FM5O 1BEYH 4UIMB 4RMSA 1DQLH 4LLMA 2DQTL 2VDPH 5E1QA 4JFEA 1CLYL 1DVQA 1QLEB 1GCYA 5T5NG 2WXQA 4Y7MA 4HV8A 4KZCA 4LLVA 1XCTA 1RL1A 4XVUD 2H2SC 2R4RH 3ROOA 3V4PH 5KSAD 2CCLA 2EZ0D 1LK2A 1URIA 1KTDA 2FYYA 4XMVA 3N43F 4YO0A 5F1NB 1TMCB 3D0LA 2EQDA 1DBKL 4E5XG 4UMGA 5C0ND 4N2MA 5D7JA 3B5TA 4AVIA 1SEBB 5FWQA 3TTSA 1IB5A 4DEUA 2VE6A 3RFRA 4LOVA 3N1QC 3KPOB 4GAJL 4EZKA 2FQFA 4L9DA 4ZTOL 5HGAA 1TJHH 3QYMA 2FATL 3ARGC 4FZEL 3BDXA 4TV3A 2CM5A 5L4JA 3P3YA 3OLEA 4XPFH 3BP5A 4W9FC 2D9CA 2WHVA 1H8LA 5D7IE 5SX5H 3O3EB 5ES4B 1F90L 1GGUA 1RIVL 1UWEL 2AEOA 3Q8BA 3RVWC 1LEIA 4IBVA 4PCSA 2FRGP 2HH0L 1DSFL 1GMIA 1F41A 1AGBA 5D2LE 4IDJL 5JHDB 4P2QE 1EBAA 4X5XB 4K3DL 1OGSA 1IEHA 3ATEA 2GAZB 4JR9L 1RJZA 2HXAA 3QIWB 5J57B 1KGCD 5SWZD 4MJIA 1IQWH 2BCKB 2PYFB 2W80C 4U1JB 5GRUL 1P0SE 3JTSB 4XWOC 2KKQA 2QQNL 4PV8B 4AQ1B 4AZ8B 4J6IA 3KPRA 3SOBL 5ADPL 3P0VL 5I5MA 3K2KA 3MRNA 1B9KA 5ANMB 1ZEAL 4PMEA 3TX4A 2NY0B 3RNKA 3NGBC 4HIEB 3ULVE 4HUWB 1R5WA 4KTDH 5I5RA 3J7HA 2DKSA 3KGRA 4FFZL 1V10A 3GYRA 3BESR 4W6XB 4ES9A 3EYOB 3VXUA 4YL4A