2DAVA

Solution structure of the first ig-like domain of myosin-binding protein c, slow-type
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
126
structure length
126
Chain Sequence
b'GSSGSSGILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-binding protein C, slow-type
publication title Solution structure of the first ig-like domain of Myosin-binding protein C, slow-type
rcsb
source organism Homo sapiens
molecule tags Structural protein, contractile protein
total genus 16
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2davA01
4ZUVB 4ODUA 4MJ2A 4MNGA 3REWB 5CBEB 2D7OA 3LH2L 3QP3A 3V79C 1JZ3A 3NPZB 2R69H 4GUPB 3PXHA 3OR6A 5DRZB 4HQQL 4LKXA 2ZCLL 2PYEE 3VRLE 5CHNB 4DGIL 2NNAB 5DMIL 2F9BT 5F7HA 4RFEB 1YPZF 4XPHL 3MNWA 3L5XH 1NQBA 1FL3B 3GJEA 4M5ZH 1I7RB 2VDPH 4QRPD 1KFAH 2WUCH 3MLVH 2DL2A 4QT5A 4KROC 4NQDB 4Y4HB 3MR9A 1LE5A 1L9MA 3QXVA 3VWJC 2DQUL 3VFMA 4TVSa 2FIKB 4HWUA 1CLZL 1DUZA 1ZA6A 3BIBX 4WFFE 4J1UA 2DQFA 1A6TB 4MLSA 3BO8B 4HEME 3UTZB 5CCKL 4NQDE 3RY6A 1SYSB 1FZOB 3ZZ1A 5KN5A 4RAUA 1WIOA 4LFHD 5KVGH 4GG6F 4PY7A 5FB8B 4OZFA 3JTTB 4EZMA 1K5NA 1RZ8B 5I16A 5TH2B 1QG3A 1J1PL 1GCFA 4MAYC 2A77L 3QDGA 4FG6D 4LSUL 5IJKA 4ZXBC 4GAYB 3WIFB 5I1GH 4DOHB 3O6LL 3QQ4B 1WBZA 4GBXB 3GZKA 3ZO0A 3ALXA 4KK6C 1URLA 3FCTB 3LS4H 1ORQA 1XH3A 5AUMA 5JIHA 5GRUH 4DOHE 4Y7MA 4I77H 1ZS8A 5I66B 4GKNA 1JGEA 2EZ0C 3H42H 3K4AA 3NH7L 4NQUA 4HHAB 4GKSB 4HKBA 5H37G 1XR9A 3HUJB 2AV7B 2NZIA 2BDNL 2WK2A 4Q74A 3NFPA 1C12A 1WT5C 1CXIA 1SYVA 1KELL 2AGJH 4DZBA 4ORZC 4JDVA 3OKDB 4L3CB 1FC2D 3IS0X 1WBYA 4GXVL 1BHGA 3B4NA 5KSAB 1CD1B 2BNQE 1A7BA 3DVGA 1AFVL 3OB0H 4WHCA 3W82A 2O5ZH 4R97B 3MROA 3BKYH 4TTDD 1BX2B 2UWEA 1BOGA 2ZSWB 3MGOA 3PGFL 2XA3A 4LEXH 2L7UA 3KYNB 2AI0L 4Q0XL 1BVLA 4XVSH 4U1LA 4ZO8A 4PR5B 4LHJB 5D2LB 3STLA 3DVIA 3TLRA 4RBPH 2G60H 2AKRB 2UZYB 1AXIB 2VN7A 2QL1A 3NTCL 1RUQL 1OGTB 1JHLL 2RCSL 4V2BA 5FUCE 4PJ9C 1CGXA 3QO0A 3TV3H 5D2LE 1R3LB 3MGTA 3TYGH 4OLXH 4N0FA 3PQYA 4GKOA 1ZAGA 4G7YH 4Z8FH 3F6IA 2PO6B 4OUUA 3PJSB 1BD2A 5GZND 1AGFA 3VJ6A 5HI3C 5INDB 5K9OB 3TCXA 2B20A 1JE6A 1N0LA 5T1LA 5ALBH 5KTEH 4JQVC 1IC5H 4JFED 1YNLH 5TFSL 3VWJB 4DN3L 3NIGF 3GSQB 2OLDA 1NMBH 4X6BB 4L5FH 1SEQL 4XAKE 3LOWA 4HFUL 2E27H 1KJ2A 1PSKL 4Y5VC 1E0OB 5C0NC 2C5DC 4RISL 2VH5H 1UACH 1SMOA 3H3BC 3ROLA 4JEGB 1J86A 5DJDA 3O2DH 4PS4H 5D1XC 5I1JH 4X4XA 1F6AB 5DS8A 4PGEA 4MAYB 5EZOH 1T0MB 1EJOH 3P4MA 1QR1B 1Y6NR 1L7IH 4PLJD 1OB1B 2E5EA 1DVFD 5F6HJ 4D0CB 1NCBH 3LD8C 3AROA 3QZWG 1U3HA 4X8JA 4PJ7A 1KIUA 3BRDA 3RA7H 2HTLC 2JJTC 4WI3A 1CFSB 2FDBP 4UDTA 4JG1L 1F58L 3QZWB 2VDOL 1IT9L 1EUUA 4IMLB 1N0XH 4N90D 5D7SL 1KPUA 2LVEA 3QUMH 1RVFH 3QEQD 1HH9A 4JPKL 3LPWA 3QNYA 1FLTX 3RJDA 1U91B 2YZ1A 3LSOB 2GTWA 4EN3C 5T3ZD 3CC5A 5C0IB 1X4XA 3AAZA 1ZLSH 5FCUL 1B4RA 1NH6A 3IF1B 2PETA 4OCYH 4U6XA 4NC1E 1FL5A 3L9RA 4ZFGL 1KN4L 3SPVB 2CDGA 5HHOE 32C2A 2R9HD 2Y1VA 2Y5EA 2J8OA 2E7LA 3EIFA 1MEXL 1AD0B 4YHNA 2CIIB 4K71C 4KK9C 1H3VA 5JOPD 4JANB 5D7LA 3OXRA 2J6EL 2HFEA 4PJ9B 4U1JB 2OCFD 2FO4A 3RWCA 2VLKB 5I19L 4FQLL 4NZRH 5J56B 1V8HA 4QNPF 3NVQA 4NM8L 3ARXA 3ARED 3OG4B 2R56L 3GSVA 4FQXC 5EBGA 1KTRL 4JFYA 1MHPL 4UT7H 3I6GA 2FWOA 5F21B 5LBSH 3N1PC 1PD6A 3X3FL 2VQ1A 1FGNL 3B8SA 2VLKE 3H3PH 3X11B 3CK0H 3BGFC 5E5MB 1S9XA 3IU3B 4ENED 3NIDE 3DETD 1MI5D 5FAAA 1FIEA 1KULA 2R1XA 2Y5TB 3S4SG 3CFBB 1N26A 2D7PA 3MLYH 2CDEA 3EDJA 1H3XA 5EU6A 1JYVA 1XGQB 1IQDB 3BRGC 3T2NL 4Y5VB 4PLKD 1IKNC 3DUHA 1YEHL 4LMQE 4ODWB 2X2YA 1CFTA 3S4SB 2F19H 4ZS7H 5D1XB 5C6TH 4IIQC 4NQVA 1DTUA 2X70A 4OFVA 3VI4F 5GRXG 4Q2ZB 1AXTH 3SQBA 3DO7B 4UAOB 5CILL 1QHOA 2EXWC 1HZHH 3CDFA 4LQFH 4OZHF 1UWXH 2V5YA 3QEHA 3OG6B 4PJBA 5DMGD 2DF3A 3ARGA 2BVQA 2B4CH 4OLEA 3LD8B 4ZAKD 1QBAA 3AXLB 2DLEA 4K7PY 3CFCH 4M6OL 3RVXD 5I15L 5HJ3B 2A73B 4NQEA 4HJ0D 4JPIA 3MJ7A 2BSTB 2OM5A 4NKMA 4Y5XC 2QSCH 1PG7H 3DWTA 3OJVC 2VE6A 4LLWA 3AUVA 1KV3A 1QFHA 1ZTXH 2EDDA 3CFJA 4RGND 1TJIH 4MZ3A 3V0VA 5EWIH 3IYLW 3L6FA 4Y19E 4IMKC 1HHKB 2J3SA 4HULB 4EN3B 5AWNH 5I1KH 1I8IB 3ZE2F 3T8XB 1CD8A 4XP4H 1UWEH 4G8FB 3EAKA 4XNXH 2VDKL 5LXGH 4I0PD 1XFPA 5KS9B 3TPKA 2DRUA 2CLZB 4LSPH 2X10A 4YDLC 4XP5L 1A3LH 3MTRA 2DLGA 1EDQA 1H3UA 1LK2B 3EYOB 3UBXG 5KS9E 4Q9QL 5C08B 4NO0A 4HT1L 1MCLA 3H2WA 5HD8D 2QJDA 3UO1L 3D2UB 3L95A 5CGTA 3GBMH 1CF8H 4CDGC 2AXFA 1G9EA 2DLFL 4K71B 4OZGA 3UBXB 1LDPH 3VXOB 4DUVA 2VL5A 3S34L 5C08E 1S9YB 3AC0A 5I1LB 3QXUA 4YZFE 3SDDD 5T1DH 1TLKA 3MRGA 4HIIA 4RNRA 3TT1H 3FQXA 2BJMH 1XF5B 4HX1A 1S7UB 4KFZC 1O7SA 1ED3A 3O41A 4FQXB 3SJVE 1S7TB 1R3JB 5JW4R 1XIWD 4LSSL 4XXCA 2EIBA 4ZFOA 1RUAH 4HIXL 4JG0L 5FM5M 3TP4A 3GK8H 3CUPA 4DN4H 2BY2A 3BGFB 4GSDL 1GIGH 4HXAH 5C3LD 5IQ9B 3RX7A 4NYLB 2CQVA 5K33A 4LHUG 5EBMA 3OGCB 1MCHA 4MCZA 1LK3L 4X6DB 3QULA 3SQOH 4W81A 1VFOA 2I25N 3G5XB 3VU2A 5FKAB 43C9B 4AY0A 4PTTB 4LHUB 1L6ZA 3U9PH 4HIHB 3B9KD 3LRGA 4K3JL 1WQVT 1T22A 3RL1B 2V9TA 4ALAL 4PJ7F 3QQ9D 4X6DE 2IBGA 3DGGB 1N8ZB 4HAFA 1KLGA 3F5WA 3JTSB 3ET9F 3PABB 1KXVC 4I18C 4PB9H 5GGTA 5I8EB 3MRPB 4OF0A 2Q87A 4PRIA 5FV2A 1FN4B 2X44D 2Y36H 5FYKE 3VXRA 4TTDC 4X6FB 4NKDA 2Y07H 5B39A 4I0KA 4WWKA 2PCPA 1R24A 2GFBA 2XZQH 4Y5XB 2ZNXA 4P0DA 5DJ8B 3WKNA 4DFIA 5C0JB 1IBGH 4ZYKB 2XQYK 3Q6FA 3ULUH 3VGBA 3GI9H 3P73B 3IDUA 2FGZA 3UJJH 3F62A 3KYKH 3G6DH 3T1FA 2EH7L 2DKSA 5GRJH 3PV7A 2X4SB 4X7CC 3L3IA 4PRPA 2QLVB 1J12A 2W60B 3MJ8B 5LVEA 4JPVL 4Z7NE 4TOYH 1S7XA 2DM4A 1BM3H 3L3KA 4G9DB 4BQBA 3VWKD 5DI8A 4YDLB 4LLDB 5GS2D 1REIA 3T0DA 4QRPB 1G9NH 4MD4A 4LQ1A 1J0JA 3AMLA 4LFHG 5IR1A 1FNLA 5E9DB 3QFJB 4TSAH 4HDIB 1S9KC 4OF7A 4N0YL 1A6ZB 4X5WA 1IMHC 3A6CH 4QRPE 1F8TH 5EIVA 2I60H 3DO3A 3KPNA 4TNWF 3VXMA 4HGWA 1WZ1L 2EDXA 3LKNA 4F7EB 2Z8SA 3GBNL 1LO2L 5SX5H 1ETZB 4LSQL 4HH8A 1UCTA 1MIMH 1V3KA 4PP1C 3GIVA 4KJPD 5FO7B 3UEZA 1D5IH 4YNYB 3ES6A 4JN1H 4QTHA 3LS5H 4M6NH 4YHZH 5I1HH 2VOTA 3MACH 1FFRA 3RRQA 2NY4D 4UUJA 3OSKA 2VSDA 4PLJC 5GXBB 3B3IA 1DVFC 1CT8B 2BOCB 2XN9D 3SBWA 4A6YH 5C70A 4MJ6B 5CIPA 2PYFB 4YQXL 3D69A 4ZUWB 4IOIA 3TN0A 1U8HB 4HUXA 4KXZI 1A7QH 2A83A 3U2SA 1KLUA 2XQBL 3UMTA 3N1FC 3N0PB 3K80A 3QRGL 3IKKA 3SGKA 1S7WA 4NDMA 4ZUTB 4KMTH 5DRWA 5FIEA 3X14A 4J4PC 5D1QA 5CD5D 1YC8A 4IJ3B 3VMOA 4H26B 2DQGH 3V2AR 4OTXH 3WN5A 1B4JH 3MLWH 4PJBF 3IDGB 3RWHA 1WCBB 4OM0L 2FHBA 3TVMA 3V0WH 1TCRB 3HPJB 3QCVH 5AAWA 4YR6A 5IB2B 2OJZH 3GKWL 4WFHD 3U1SH 4JKWA 5EUKB 3UZVB 2NX5A 1T4KA 2FATL 4I18B 3KWWB 2WINA 3QRFM 1CIUA 5C7XL 4S1DD 3DRQB 5TGBA 4LBEA 3QH3B 3ZE1F 2D03H 4PJIF 3TBTA 5A2FA 4ODXA 3AY4A 4MD5B 1YNKL 1EX0A 4JKMA 2I9LB 4NKOA 3PHQA 3WLBA 3QI9A 1I9RL 4RAVB 3V5DB 1JK8B 1VCAA 4J8RA 4HUVA 3SKMA 1G7IB 1BEYL 2AABH 5LGHH 3IVKB 4U0RC 3ESVF 1ZVSA 3IJHA 2F8OA 1WK0A 2EC9U 4O2CB 3GJFH 3T0VA 1XGPA 3BHBA 5ITFA 2AJXH 1NFIB 4S1SL 2H3NB 1RK0B 4Y1AA 5J06A 2A74A 1LO3L 1WCQA 4MNQD 2CJUH 5JOFB 1H0DB 3MPCA 3UBXI 1A5FH 2H2SD 3FFCB 4HCRL 3AREC 5HDBE 3R0NA 4MVBD 4C57C 2VISA 5JR1H 3JV4A 5FYJU 3V4PL 1AD9A 1CZ8H 2QKIB 4MA8L 1NMCC 1ZLUK 2AS5M 2R1YB 2X7LA 1F90L 4OZGF 4JO4H 4LL9A 1IM9D 1OP5K 5DFVD 1G7HB 2V2WB 1INEH 4JFEB 5C0BA 3TBVA 4ENEC 3DETC 4EVNA 1S7SA 3WE6A 1S7QA 3CFKA 1WC7A 1I1FA 1DBJL 2V6HA 3NMEA 1OSPL 4JFXB 3N9GL 4PLKC 4ODVL 1GZPB 2ZUWA 4JFEE 2JK5B 5DYOA 3X12B 4LASH 1KG0B 3BE1H 1I7ZB 3OXSA 4EIGB 4Z77B 12E8H 5ISZD 4K7FA 2VXUL 3QSKB 5J89A 3EJYD 1DVFB 4WO4D 4ZAKC 1C5CL 2BNUA 2DQEH 3GO1L 3NZHH 1ZOXA 2EDEA 3RVXC 2JJUA 3FOLA 3VXTB 5TE6H 1PEZA 3S8WA 4N1EA 3OGOE 4K7PH 1EEQA 1D9KD 1RURH 1R3HA 3NFNA 4D9RD 1K4DA 1MJUL 5CZVH 2YD9A 3OKLA 5J1AB 1KCLA 3QA3B 3RWFA 4FP8H 3TNNA 3V95A 1N4XH 1VGKB 2DYPD 3BPCB 3O2WH 3QEQB 5DQ9A 4ZD3L 3U0TA 2Z92B 4PGZA 5CEZL 4OLVH 3NN8B 4EI5D 5EUOE 3VI3E 5JPNB 3PV6A 4N90E 5CUSL 5EOQL 3VD5A 4HFWB 4I0PC 1OAXH 3FN3A 3QEQE 3ZT6A 4PJGA 1OOAA 3BOVA 1MLBB 2H32A 4Z0BL 1G6RA 1ZLWH 4KMLB 5T3ZE 2HRPH 5MI0B 2A38A 1FRGL 1MVFA 1KB5A 1UZ8B 1YMHA 4HK3N 3SDCD 1A3RH 2JJSA 1OHQA 3HAEB 3VXPA 1MQKL 4NC2B 1DL7L 1WEJL 5DRXA 5IK3B 1ZEAH 5HD8C 4L4TD 5C0CB 1NGPL 4KQ3L 1AQKH 4H20H 2H1PL 3S96B 2EYTB 4XWOD 4HS8L 5CLWA 1P7KA 5DTFB 1SBSL 4RIRB 4U0RB 3O8XD 1JTPA 3GSOB 4BJLA 1KGCD 1JF5A 3SDDC 4PJCB 5L88L 1T04B 4U6VH 3OB0K 5CBAA 3RX8A 5JOPE 3ORJA 3M8OL 1DFBL 3AREB 1MCPL 2Q7NA 4KGJA 3FQWB 5AEAA 4L9LA 5FHBH 1NMCB 4ZOCA 2P44B 1BVZA 4RBPK 3C5ZD 4Y4FC 4ELMA 3AS1A 1KBGL 4XHQA 1G7LA 1MI5B 3NACH 4KVNH 1A9BB 8FABB 2KUTA 1PBYA 1SEBA 3PWUB 4MDIB 1F4HA 4XX1E 2A1WH 2BMKA 2Z93A 5I76A 1LDSA 1Q1JH 2ICWB 1KIPA 1MI5E 5SV4A 3B9KC 2SEBB 1B88A 2V7NB 2HT4C 1I3GH 2Z31A 3QQ9C 4GJTB 3IFLH 2RFXA 3DX7A 3MQIA 4HJJH 4BH8A 2OK0H 3FONB 4B41A 3GSUB 4ZAKB 5IESH 2VXTH 2DI7A 1O0VA 3VXQB 1KIQB 3QWRA 3WIHH 3RIFK 2VXQH 5H37H 3A67H 3IU4L 4PJHA 5ERWB 3TIEB 2A6IB 4BFGA 4P49A 4C83B 1K2DB 5DJ2A 2YRLA 4RGNB 2XXMB 4WFEE 4F57L 4QXWA 5BQ7B 4M7JL 3TNMA 2BVPA 3MREB 3BWAB 3ALPA 5D1ZD 4JDTH 2FJGA 3M17B 1CDGA 1CIDA 4RGNE 3RGVA 2AAVA 4I0PB 4O4YL 1TNNA 2C1OB 1FE8H 1FO0B 1KTDB 4X7EC 1JF1B 3NCJH 1A4KA 2OTPA 4YHIA 1KTKE 1DBBL 4AM0B 3L3GA 1HH6A 5IFJA 1QNZL 3FO0L 2YUZA 3MV8D 4JKKA 4L9DA 5GISL 3E0GA 1BWMA 5DJCB 2WIIA 3BISA 4GAGH 3G04B 3FAWA 4Y5YA 1ZSDB 2Z8VC 5BO1L 3O3EB 4FFYL 2W0FB 3TO4D 4U0QB 1OW0C 4H25A 4L4VD 3CVHB 3G9VA 3UZQA 4X5XA 3SDDB 4HMCA 1K4CA 1HSAB 4BA8A 2A0LD 3EZJB 1X5YA 4KJPC 3HG1A 4K8RC 4YBHA 3TO2A 4KY1L 4HWNA 1MCWM 3C9NB 1RIVH 3ZDXE 1YN6A 4XNQA 4Z7UB 4YWGH 2Y06L 5L7XL 1QRND 3DUUA 1FNGA 3OKKA 4KKAD 3VW3L 5KSBA 1XIWB 4P2YA 2X89A 3LHPL 5E8OA 2GQHA 3PL6A 5F89B 4E5XB 1UA6H 3DYMA 5J1TC 1S5HB 5FUZL 3WS6A 2L7JA 3T77B 1QEWA 4L8SA 3R8QA 1AIFA 1Q0YL 3ZKXC 3BKJL 5DT1L 3L5WA 2F53D 2AEPL 3NAAH 3KPPB 3SHSA 4I3SL 3DUSB 4PJAA 3VFUB 3GSWA 5BRZB 3UP1A 2VB5A 1XF3A 5IG7B 3F7QA 3SE8H 3CMOL 5IKCB 2HJFB 1UG9A 3B9KB 2IH3A 3E2HC 4KUZH 1IGYA 5E2TL 2CUMA 1GC1L 2Q6WB 4FFZL 1MCOH 3HI1A 1CFQA 5E08H 4PB0H 2N7AA 3DRTB 5D70H 4LLAA 5GRVK 3TZVC 5IMMB 3O6FA 3QG7H 1IGMH 3UTQB 4YC2C 3EOTL 4OSUH 4QHMA 4P9MH 4XTRD 3D39A 3NZ8A 4G6JH 5D7KD 5ESVB 4BUHA 4IHOA 4Q58C 5DQJA 3FQTA 2EO1A 2YUWA 1QLEH 2UY6A 1WBXB 1I1CA 2BNRD 5DVOA 4ZMAT 2ICEB 5HYJD 2B2XH 1CL7L 1RUML 3WCYA 4OM1H 2HKHL 2NW2B 5F7NC 5DSCA 4ZUUA 3CSYA 4LNRA 4L29A 1Y0LA 5D2NC 2H2SC 5DD1H 2GKIA 1UYWL 3GM8A 4MVBC 3FO1B 3MZGB 1Q0XL 4TYUA 4ZUVA 2VNCA 5EOTB 2IGFL 4KTDL 1FNSL 4GUPA 4F8TA 1ZHKB 5ADOL 1FFPB 3MV01 3WS3A 2CLVB 5GGRY 1FVCB 4JVWA 2CIKB 5CHNA 4U7KA 2NNAA 4XP9H 5M95B 4RFEA 4TTGA 3H9HB 1A7RL 1I75A 3EDKA 3MBEC 1S7VB 3QXDA 2ZP0T 1HYSC 5F9WC 1PLGL 3MRDB 5IMLB 3ZL4H 4NQDA 3C6SA 3S5LG 4JO1H 1PX3A 1GGIH 3IFNL 1CLYL 4WHTA 4M00A 3BSZL 4HWBH 4MQXD 5GJSH 5IUSA 2ED8A 3LN4A 5ICZA 3BO8A 4ELMF 2NY4B 1SYSA 1FZOA 5IMKB 2ICWI 2WUBH 3L3OA 3BP7B 1AP2A 3B2VL 3T4YB 1EO7A 1FL6A 3Q0HA 4WO4C 4LU5H 1KENL 1IVLA 5DO2D 5JQHC 1RZ8A 5DEFA 1T03H 5TH2A 2X5PA 1ONQB 1X5AA 4KXZH 2JCCA 1RQ5A 1D9KC 3ZKXB 4R0LA 4XAWL 2XN9E 4HK3J 1DQJA 3LMJH 5CP7A 5JUEH 5IB3B 1NFDF 3IGAB 4GAYA 1AJ7L 3WIFA 4F7MB 4K3EH 5DDHB 1U95A 3QQ4A 2WBJC 4UB0H 1HKFA 5D7IF 3P30L 4GBXA 3M1BA 1DQDH 4EI5C 4J2XA 4P3DB 2IPTH 3E2HB 3FCTA 1U8NB 2X4OB 4R6UA 1U2HA 4R7DB 4MGXA 1Q8MA 3LEXA 4QEGA 1JHKL 4HHAA 1SJHB 4PJHF 4M5YL 3RKDD 5T1MA 4N8VB 3TZVB 5C6WH 5JW3H 2EDBA 3SDCC 3ZDYF 2BNQA 1J5OL 4XCFH 4WFHE 1T1YA 4YC2B 1SJEB 4XMPH 3IFPB 5CINH 3RU8L 3HRPA 3OKDA 2ZCHL 4XWOC 3ILQD 3J7HA 1P1ZB 1CD1A 2K7PA 3O8XC 1K6QL 5EZLB 5CJQH 1G7MB 1UADC 4AJ0A 2ZSWA 3NFSL 1SY6L 4MNQB 5TQ2H 3KYNA 1N2RB 5D2NB 1OTUD 4LSTH 3HE7C 5I8OH 1A1MB 3TH4T 4EJ1C 1G7QB 4M4PA 2HVJB 5EO1B 3T0WA 4MA7H 5MP6L 2MCPL 2D9CA 4MNQE 1BQHB 3HNSH 5A16B 1OGTA 1LO5A 1IM9B 5D2NE 5C9KA 5E99H 5DURD 1ADQH 3C5ZC 2C3GA 4NGHL 1JTTA 1A6UH 3QQ3B 4OB5H 4YDKL 1VFAA 5MEPA 3VGHA 4OD2B 2PO6A 2APVA 4R8WH 1NBZB 1AO7D 4AIXA 3MBEB 3V6FB 4TUJA 3O4OC 4OBSA 2DIAA 5F9WB 3QJHB 3GSXB 3HMXL 4GRLD 4PRBB 4K3DH 3QWQB 1RJZB 2F5AH 4M1DL 5K93A 5KSBF 3GSQA 3MJ9L 1L4IA 3BPLB 3HPLB 3I6KB 4XP6L 4TPRL 3W2DL 4JZJC 2DTSA 4OIIH 5KVFL 3BRFA 4X9FA 2FJFB 4WO4B 1Q9KA 1OY3B 4NQCD 1N6QL 3N85H 5TE7L 4PJAF 4K94L 3C8HA 1U58B 1VSCA 4NNXA 2A9MH 4GRWE 1HHHA 1NCTA 5ISZE 4R96A 1CDBA 2AJ3A 5DWUL 3W11D 5SX5K 2PW1B 1D9KB 1XEDA 2QADC 5JZ7D 4PRNA 3VCLB 1UB6A 5EU4A 2FX9L 5CSZB 3MNZB 3C5JB 5GPRA 5FDYA 3DBXB 2DDQL 2EYRB 4P4KD 2OX5A 2DYPB 4KAQH 5BW7C 3VXUB 1T66D 5DUMH 3QFDA 4EI5B 3IS1X 3IDXL 4O58H 4D9RE 5K9JL 1OWWA 3KYMA 1JWUB 4DVBB 2VKWA 3SDAD 1A02N 3HZVA 4WHDA 3LKSB 4IMLA 1PZUB 2XOTA 5E95B 1OQXA 4OF5A 1A22B 5DUBA 4E0RB 3RUGA 3S36L 1AH1A 3GMRA 3ARUA 1X9QA 1J1XL 4X9IA 5IWLC 5F44A 5FF6A 3FB7B 2XZCH 3LSOA 3SDCB 5C0IA 1ZWIB 2MCG1 5HHOA 3IF1A 2R0ZL 4P2OA 2DQHH 5DD6B 1LEIA 2YBRA 3CGTA 5AD0A 3O45A 3MXVH 4MNHB 4Z7QE 1GHFH 3UPRA 3HTLX 1YC7A 3BUYB 3QCTL 3TO4C 3O8XB 1AGBA 3HS0B 4L4TE 3GUTB 4EQ3A 4E9LA 4KI5C 1UCBL 4PRHB 1AD0A 1NGXA 1NAMH 5BV7L 5IF0B 5JDSB 3SE9L 4OV5A 3WYRA 1KGCE 6FABL 5DD0H 3ZSTA 3ARRA 5F96H 3QHFH 4KKAC 4YFLI 2EEAA 4NT6B 3DMMD 4J3WA 4PTUB 2NXYD 4CVXA 4PJ9A 3C5ZB 3RAJL 3OAUH 5JMRA 4O9HL 4W68A 3FQNA 2DQUH 1RZGB 1J0KA 2X4PB 3WXWL 1JGDB 3SY0B 3T65B 4XGZB 4EQ2A 4KJQC 1QUNA 2ZUXA 3O4OB 1G9MC 4KDVA 2O26U 1ZMYA 3BPNC 2ZPKH 2GITB 4JKPL 1TETL 3WEXB 2BFVL 3IDNB 1JPGA 5CSBA 2QEJA 4L1HA 3D3VD 3EGSA 5KOVC 3CFBA 4POZD 2VIRB 1U8OA 4XPGL 4XVJL 3ILPA 1XGQA 4OKVB 4G3YL 1U2CA 2JCCF 4BK5A 1XGRB 2CSPA 5D96C 1MCNA 1VPOH 4OQTA 5JHDA 2BXZA 3JUYA 3RPIB 1QSED 3DXAD 5D6CA 2VABB 3BEVB 4XTRC 1K85A 4B53A 3IDYC 5F9OH 2AJZB 4YH6A 5GS0H 3KVQA 1LEGA 2FL5B 4RMTA 5DUPL 5HXMA 5T3XL 3LB6C 4WNQA 5C07A 4DKEL 4ORGB 1NCAL 2J5LC 5TF0A 3WJLC 3DYOA 4FXKB 5MEOB 1R5IB 3I50H 1C5BH 3QUZD 4U1NA 4JFDD 4Y19A 5I9QC 1LE9A 5D1ZB 2BDNH 1T20B 4KTYA 2R4SH 4HPYL 1EGJA 1EAJA 2Z91B 2QTEA 2MHAB 3EFFB 4MQ7A 3H7BB 2OZ4A 4XNYL 3BP6B 1AR1D 1MWAB 1J1OL 3VD4A 3IFOB 4QY8B 1T2QH 4HEPG 1DBAH 4LPWA 1I8IA 3P2TA 1MREH 1H5BA 1I9JL 3MV8B 4B7LA 5T5NF 1LEKA 1AE6H 4LSVL 5AYQA 3EDFA 3T04D 3EYFB 3RZCA 4AT6B 2CLZA 3UYPA 3F58L 5IIEB 2WANA 2NY3D 1C7SA 5JTWA 1MRDL 3TO4B 3MV8E 1V3MA 4L4VB 1AQDA 3CH1B 1LK2A 4N0UA 3EYOA 1I3UA 4FQ2L 5ITBL 3DGCR 4GW4B 5DJZA 1Q9OB 1ZLWK 1IAKB 1JFQH 1YEEH 3EO1B 2FEDD 1ZA3B 3OJDA 4MQXC 4P2CG 5SWQB 4L4VE 1RZJL 2IBZY 4KC3B 5I1LA 1QRNB 3HRZB 2ZKHL 5LCVH 5FA3B 4P59L 3SJVA 1UQSB 4JAMB 4UI2A 3STZA 2VDRH 4X99A 1X5HA 2H9GB 5FHAH 2GYSA 2AQ3A 4I3RH 4Y2OA 2XFXB 5JQ6H 4YE4L 2YMXH 1Z3GH 5DJ0A 1QRNE 4HLZG 4FQXA 2F53B 5C09A 4X6EB 3DHMA 1DQMH 1ZT7A 1CR9H 1PSKH 4G8EB 3WIIL 5ID1A 3BPNB 2PXYC 4RISH 3S3SA 3FT2A 5GRYA 2DKUA 2F53E 2YXMA 3L1OH 3OPZL 4XP1L 5BJTB 3DSFH 4P46D 1PKQB 2UYLB 2NYYD 3Q3GA 5F1IA 1UM6H 2XPGA 1TJHH 3RKDC 4YBLB 3LKPB 2H6PA 1UM4H 2C4FT 3OQ3B 3GGWB 5FKAA 4PTTA 1LP9F 1WWWX 1DSFH 5D96B 1U3HD 2X9YA 2AP2A 1NAKL 5IEHB 1PKQE 3UJTL 5F93C 2DN7A 2DWDA 2L4OA 2XY1A 2VAAB 3GSNL 4HPOH 2ZCKL 4UT9H 4JG1H 3ILQC 3IDYB 2CGRH 1EVUA 2BNRB 5KANG 4PRDA 5I18L 5HYJB 4YO0A 3PDOA 1JCKA 2J5LB 3K1KC 2XWTB 4NUJB 5D7KE 4J12A 4OI7A 3RUGF 1DLHB 2VERN 5I9QB 3MRJB 4JJHA 4Y5XA 3JSSA 2VXSH 2AEWA 2AERT 1W0WA 2BNRE 1OTUC 5FCUH 1XZ0A 5HYJE 2YR3A 3MNVA 2HG5B 3P73A 4LCCA 4BKLB 3SGDI 2JELH 3DROB 4U1IB 4ZFGH 4NCC1 1J0ZA 1F4AA 4HK0B 1BMGA 3FN9A 3CNKA 3VD3A 5LGJB 4N1CA 2HAZA 2FH6A 3HZKA 4A2LA 5DEGA 3MLXH 2YD6A 4F7PB 3S7GA 1MEXH 1GXEA 4ZOEA 4S0TD 3L5XL 1H3GA 1K9TA 4M5ZL 3UXFA 4CKVX 2EE3A 3QXTA 2DOCA 4X9HA 2DQCL 2VDPL 1E6OH 1KFAL 2WUCL 3MLVL 4QRPA 4ZPVA 4GRLC 1N64L 1YPZE 5J11C 1X3DA 3RIAF 4XBGB 4HDIA 1KEMH 1NKRA 3Q6GH 4IDLA 2HJKB 2R56H 4GG6B 4R26H 5C0EB 5KVGL 1MHPH 4E41D 1FGVH 2B0SH 2LAGB 1ETZA 4UTBH 1LMKA 5F1OB 3RWGB 2J8UF 4EKXA 5A3ID 5E2VH 2YD5A 4OAWB 5L2JB 4IM8A 1BQSA 3W11C 4GG6E 2XV6B 2Z9TA 5JZ7C 1I8KB 3THMH 1R6VA 5I1GL 1CT8A 4MJ6A 4P4KC 4XCEB 3IXTA 2PYFA 1N59A 4ZUWA 5D8JL 1QVOB 4H1LG 2PXYB 4NQXB 2YUXA 3LS4L 5HVHC 4KGLA 1CGSH 2NQCA 4WFGD 2NMSA 4HGKC 5GRUL 3SDAC 5E7BA 1JN6A 4I77L 2Q3AA 2O5XH 4ZUTA 5I17B 1U8KA 1X5KA 3DVNA 3UPAA 2P24B 4QF1A 4H26A 4QYOB 3ARGD 4QRQB 3MYJB 4JQXC 4QWWC 1INDH 1WCBA 3TBYB 5C0DB 3AS2A 4GW1B 2N4IA 4LKCB 2AGJL 4NQED 3FN0L 4IRSA 5EUKA 2ICWJ 3LKRA 5DRNA 1KCSH 5KAQF 1OAQH 4I18A 4HG4K 1I85C 1ULVA 1HDMA 2O5ZL 5JLZB 3RP1A 3QDAA 1WVZA 3BKYL 4N1HB 4EDXA 4N5ED 2R0KH 2ZJSH 2CKBA 4J7RA 5HHXH 4LEXL 2EYSA 4LEOB 1EPFA 3DSNA 1FDLH 3Q1SH 1H8OA 2H45A 3V5DA 4RAVA 1VFMA 4XVSL 1JK8A 1T3FB 2EDOA 1D5MA 5F7YC 3BN9D 1KPVA 3IVKA 4HWZB 1DUYB 3MA7B 3CVHH 4YXHL 2G60L 3O9WD 2DM7A 4FQJH 4PUBL 4MQTB 1Q9WB 1NFIA 1X5JA 1RK0A 2D31B 2ITDB 1GGTA 1HOCA 4UDUB 3D18A 4BSVB 2RIKA 2NXYC 2DAVA 5F7UA 3TV3L 5DURB 1H0DA 3UAJD 5IV2B 1T1XA 4NO0D 4I5BA 4MDJB 4OFIA 3TYGL 4OLXL 3ZDZF 4HT1H 4ODHH 4G7YL 4D0DA 1AO7B 3S6CA 3UC0H 1EFXD 3RY6C 1A0QL 1RZIB 3X13A 5ALBL 5KTEL 4GRLB 1ACYH 1G7HA 4P23D 1IC5L 1YNLL 4OFDA 1P2CB 4Z78B 2I27N 1KF9B 3JWDC 1NMBL 4YHPA 1AO7E 2ITCB 3MUJA 4L5FL 5DK2B 5J11B 5F8RC 4POZC 5I1IH 2FD6H 2VDLH 5IJKC 3NIGE 5HYIA 4UQ3B 1GZPA 1EHLH 4PV8B 4XNUH 4NRXB 2VH5L 1UACL 3O2DL 4PS4L 2JK5A 5I1JL 3JWNC 4XCCH 1KG0A 3C2SA 3TEUA 1X5FA 4MWFA 2OQJB 5EZOL 1A21A 1EJOL 4MX7A 1L7IL 5DJXA 1JPFA 3CDCA 1ZHNA 4NQCE 1JHTB 4LPUA 1NCBL 4OF3A 4P4KB 2AXHA 3PIQB 3RA7L 4TVPH 5ACZB 4JY5L 4NKIL 1UH2A 3QUYA 1HK6A 5J6HA 3FQRB 5HVHB 2GUOB 5EUOA 3P4OA 4K3JH 3SDAB 5L6YH 1N0XL 3QG6B 2DM3A 2A6KA 1NLBH 3QUML 1RVFL 3QEQA 1AR1C 3BPCA 3WD5L 4WJ5B 4BQCA 2B39A 4PRID 1WJ3A 2EH8H 1RI8A 2ID5A 2P8MA 5KANI 1ZLSL 3CDYA 3VXRD 3FRUA 1J88A 4HFWA 4OCYL 4WW1A 4FTVA 1JPSH 3Q2CA 3FZUD 5EO0B 2DBLH 2NY3C 3VA6A 2IQAA 4PP2B 1CQYA 1T2JA 1A47A 4MSWA 3UJIH 4ODUB 4HKJB 1CL7I 2DQTH 2FEEL 4MYWB 4M1CD 4U49A 2G75A 1N7MH 2XICA 3OR6B 2FEDC 4PRPD 4LKXB 1P5VA 2DI8A 3MZTA 4QKXB 3MRBB 5DTFA 4RIRA 2E3VA 2AQ2A 3GSOA 4XH2A 3TF7C 1BJMA 1B2WH 3GJEB 4K8RH 4K3HA 1T04A 3DMMB 1ZGLA 2NXYB 1RZKC 4QT5B 3MR9B 1Y6MR 2APBA 1LE5B 2WWKT 1EIBA 1VERA 3CD4A 3T1WA 3WHXA 2Y6SD 4D0BA 3AREA 1F5WA 4Z7OF 4UT7L 1DUZB 1J0IA 1JI2A 5LBSL 2DB8A 4J1UB 3FQWA 3EDEA 2DQFB 3VFTA 5GZOD 3H3PL 3VXMD 4QNPE 3CK0L 5IVXF 5KN5B 4RAUB 1PVHA 4PY7B 4KKBD 4OZFB 4LSQH 1A1OA 5I16B 5GRVL 4P46C 3MLYL 3U83A 2NYYC 4F37K 3D9AH 1CBVH 3PGDB 1Z2KA 3MSPA 2UV3A 3D3VE 5GJTH 3TH2T 2AJSH 1U3HC 2F19L 5J3HD 1WBZB 5C6TL 4ZG1A 1EHXA 4YX2L 3TN0D 3DXAB 1YYLH 2J12B 2XKNA 1ORQB 5AUMB 4ZOAA 4LQFL 1KNOA 5TPWH 1UKQA 5CEZD 1ZS8B 2B4CL 1JGEB 3VI4E 3GSUA 2AK1H 1QSEE 4JCLA 3DXAE 3WNMA 3CFCL 4HKBB 1XR9B 4OZHE 1RIHL 1EUTA 1IAII 2QSCL 4AK1A 4X98A 3NFPB 3ZMRA 1PG7L 2A6IA 3MRRB 3TVMD 5E2UH 5L8LB 2D0FA 1ZTXL 4DZBB 5EWIL 2NX5D 1WBYB 4JFDE 5FGRA 5BQ7A 2RAMA 4HZAA 1GGCH 5FK9A 4AIZB 3DVGB 1GYAA 4HAGA 5AWNL 5I1KL 3MROB 1W0YT 2J4WH 4ETQA 4XP4L 1XMWA 1UWEL 1E6JH 2LU7A 2CRIA 4XNXL 1BOGB 1KCRH 5LXGL 2O5YL 1NC4D 1YNKH 3D0VA 4JB9H 1FO0A 1DEEA 4LSPL 1I9RH 3ZE2E 1BVLB 1A3LL 4FHBD 2NY3B 3PG2A 3DIFA 4U1LB 3TJHC 2R2EA 3STLB 1TFHA 1WIUA 3E1F1 2K1MA 1W8OA 1UKTA 3D25A 2HTKC 2FJHA 4S1SH 2V9RA 1E4XI 3ARPA 4UBDD 4Y1AD 5D4QA 3GBML 4NO2B 1CF8L 3ZKQD 2FIRT 2QV2A 3G04A 5J1SC 3SKOA 5D93C 4GG8A 1ZSDA 2XWBA 3MGTB 3U4BH 1TVHA 4KPHH 1LDPL 2XWJA 2W0FA 1T1ZB 2P8LA 2GSGA 1TXKA 5T1DL 3K2MC 1FQ9C 3FO2A 2CK2A 4LP4A 3H0TB 3TT1L 1HXYA 2BJML 3ZSSA 1NEZB 3H3KA 3QIUA 5C0BD 4A6YA 5CKGA 1J7VR 2R39A 5HVGB 2YXFA 1VDGA 3CJJA 4ONFH 3ZT7A 4R90H 4Z76A 1U3JA 3MLTA 4O2FA 3MA9H 1KJ2B 1XIWA 3B9DA 2X1PA 1T7ZA 1RUAL 5F89A 1U3YA 1MELA 3GK8L 4OGZA 4HXAL 4DN4L 1GIGL 2Q76A 1S5HA 7FABL 1QFWI 2DMBA 1GAFH 3T77A 4UIMB 5DJDB 5T5FH 2QQLH 2WMPA 5BCAA 1TZIA 4P46B 5IBTH 5DS8B 4ONGH 3SQOL 2L0DA 4H8WL 3DECA 4P57A 4IDJH 3MGAA 3ARGC 3U9PL 1U3HB 4G42A 3TWCH 4X8JB 4PJ7B 1OD7A 3WDJA 2Q6WA 1S7RA 5I75C 1CG9A 4O51A 4ONHA 2V2TA 2DTMH 2VLMD 4UDTB 2ADGA 3VXNB 4PB9L 1NC2D 1BJ8A 4JN2A 3IETA 4PJ7E 1KPUB 1BLNA 2Y36L 3UTQA 4N5EC 3BP4B 3QNYB 3O81A 5I2IB 4UINH 5JA8B 3DLQR 2XZQL 3RHWF 5TDOA 3CC5B 1TCMA 3AAZB 1CS6A 4WEBH 2UZXB 3GJFA 3BN9C 3EYVA 2Y23A 4MAUH 4QCIA 1FL5B 4NNYA 3UJJL 1VEMA 2WW8A 3G6DL 3SGDH 2VDNH 5GRJL 2P46B 1FRGH 3GSRB 32C2B 3VFPB 1M7IA 3UAJC 4GRMA 1XCQA 1UVQA 1WEJH 4TOYL 2OL3L 3MOAL 3FO1A 1BM3L 1WGOA 3VWKA 3TT3H 1RJLA 4Y0GA 4YHNB 4HXBH 5EOTA 4HS8H 5FV1L 3T0ED 1JZ6A 3ISWA 1G9NL 2XYCA 1FFPA 4CN4A 1PEWA 1FVCA 1JNHA 1NLDH 2P7TA 3ZT5A 2HFEB 3RWCB 2FO4B 3KPTA 4CU7A 4TSAL 3QEGL 5D93B 2I60L 5FECA 3GSVB 1D5BB 4JFYB 3I6GB 4JRYA 5TF1H 4E41B 5FYJH 3BDYL 4XXCC 2EDFA 4JN1L 3W5NA 3UROR 3LS5L 3MRQB 4M6NL 4YHZL 5I1HL 4BH7A 2HLAA 3K74B 3MACL 1S9XB 1N3NB 5DVKA 3ZKMD 1OTTC 1U8MA 4NZUH 1J8HD 4E41E 1M71B 3MCG1 2R1XB 5IFHH 3BP7A 1A6WH 3BUTA 2CDEB 4XC3L 2XN9A 1NGQL 3G5YB 4S11A 1NDGB 3G6AA 1CFTB 1A7QL 3G9AB 4U6TA 5ELIA 1IC4L 3P9MB 4NQVB 2X70B 3IGAA 3D0LA 4KMTL 1NCDL 4NRZA 1CQKA 3KR3H 3BZDA 2DQGL 4PJBB 4YUEH 3ARGB 4OTXL 1B4JL 3MLWL 4WFGE 3GIZH 1EFQA 4HUWB 2XY2A 3V0WL 5EH1A 1U8NA 1EVTC 3QCVL 3P77A 4NQEB 2DBJA 4WWKC 4JPIB 2EIEA 3MJ7B 4X6CF 4NKMB 1C5DA 1MFEH 1RD6A 2R0LH 3FZUC 4PJBE 1MWAH 3EO0A 3ULUF 4W4OA 3ULVD 2VE6B 1MCDA 1CXLA 5JHLH 5E24E 2EO9A 3CFJB 4PJIB 3V0VB 3P0VH 2D03L 3L6FB 1BF2A 3H9SA 4NQEE 4M7JH 3DPBA 3RI5K 1YY8B 2VLJD 3IFPA 2F74B 3ZE1E 4PJIE 2AABL 4OGAD 3O9WB 3JWOC 2AJXL 5EZLA 5BZDA 1F45A 3NCBB 1U41A 2CJUL 4KZDH 4MNQA 4I0CC 4KKLD 4MS8C 4RDQG 1A5FL 4NO0B 2AK4A 2Y6SC 4TUOA 2UY7A 3L95B 5JR1L 4TQEH 1A1MA 1RK1B 4UV4L 2AXFB 2HVJA 1CZ8L 5BO1H 4OZGB 3DJ9A 2JIXA 1JPST 1BQHA 1SJVA 1JYXA 2E9WA 3HC3H 4JO4L 1QLFA 4YXKH 2JE8A 4P23B 1INEL 4U2ZA 5L2KA 1TIUA 4KKBC 1KJVA 4HIIB 4RNRB 3HG1D 3FFDA 4AMKH 4OZGE 1DR9A 3KPQB 4TSBH 4HX1B 2CKNA 1NUGA 1ED3B 1CGYA 1G9MH 3O41B 4OV6F 1UM5H 5E7FA 1JNNH 4HMDA 1V05A 4HLZH 1BBDH 2D4FA 5L7XH 3KPSD 3QJHA 3GSXA 3SBWC 5J3HC 1EEYA 4ZFOB 2R29H 3KS0H 3PL6D 4LASL 3BE1L 3TN0C 4K9EC 3CUPB 12E8L 1CDUA 3RVTD 5ISZA 4WI2A 4MXQD 4R4BA 5EBMB 3SGKC 4ESKA 2AEPH 4MCZB 1EJ6A 3JXAA 3QULB 2DQEL 3NZHL 1OSZA 4DK6A 1U58A 2GW5A 5B8CA 2LVCA 5KVEL 3WN5C 3JV6A 1B0GB 2X4TA 5TE6L 1OLZA 4K7PL 5IOPA 2PW1A 3TVMC 2JB5H 5CZVL 4NO5B 2CK0H 1P84K 4FFZH 3HNVL 3B43A 4FP8L 4EUPB 2EYRA 2XT1B 3O2WL 3TJEH 1KLGB 2DYPA 1QACA 5CS7A 1MSPA 4OLVL 4R7NA 3FJTA 3CSBA 5IBUG 4PRIB 4EI5A 3O6FD 3HZYB 2MQCA 5IB4A 3VXRB 5I1AA 1JWUA 4DVBA 4PJEA 1HCFX 3AY4C 4JGMA 5BOPA 1OAXL 2GAZA 5DXWA 5B39B 3GRWH 3V6OE 4WWKB 5EPMB 1R24B 2GFBB 5IBUB 3DV4A 3QI9C 5IW1A 1NANI 4FQ1H 2HRPL 4PRIE 4W4NA 4UOW1 3R06A 1GOGA 3HNTH 5A2LH 3Q6FB 3VXRE 5DZOA 3FB7A 1A3RL 3KS0J 1CL7H 4WUUD 1ZEAL 3T1FB 5CFHA 1WLHA 4UBDC 4L4TA 1RZ7H 1YJDC 1AQKL 3L3IB 4H20L 5DD6A 4PRPB 2QBWA 3WO3B 2IQ9H 1UYWH 1IM3B 2V2XA 1S7XB 4KK8C 1I4FB 3VRIA 1FZMA 2NR6D 3HS0A 4DTGH 4RMRA 3GUTA 2IGFH 4PRPE 1FNSH 1MCCA 3FT3A 4I13B 4CVWA 4KHXH 2Y72A 4GKZA 1OTSC 2W0LA 5LQBL 4MD4B 5LKNA 2X4UA 5ESAA 5IR1B 2R0WH 4S0SD 3RFZC 4JFHD 5FHBL 1D5ZA 3V7AG 4X5WB 3KPNB 3VXMB 3ZKSD 4NT6A 4HZLB 3LKNB 4PTUA 1BBJA 1JMZA 2QHRH 1GGBH 4OCMC 2CPCA 3I3BA 4KVNL 4QTHB 3TA3A 3VXME 1YEIH 2XG5A 5F9DC 2A1WL 3K7UA 1C1EH 4UUJB 2P49B 4HC1H 3V4VH 1WAAF 1MPAL 3P9WB 2GITA 3B2VH 3V7AE 4DKFH 2ZOLB 3WEXA 5CIPB 4I4WB 4LIQH 3D69B 4ZSOE 1I3GL 3U30C 4BFEA 3TN0B 5DMKA 1DZBA 3IFLL 4HJJL 4HUXB 2A83B 2OK0L 3U2SB 1KLUB 3IRPX 4H1LH 3QQNA 3SDXF 5KW9L 1MCSA 1J0YA 3EDDA 2JB6A 4TSCH 4KU1A 1S7WB 5JO5B 4NDMB 5IESL 1YEGH 1XGRA 5DRWB 1C16B 3X14B 4WVRA 4YBQD 3WIHL 2QSVA 4CW1A 3P30H 2YPLA 4PG9A 1TVDA 1OGAA 4LPTA 4M1GL 1IAIH 3RWHB 3OJMB 5CEZE 3TVMB 5EBLB 2AJZA 4YR6B 2RB8A 3HR6A 4HBQA 1TJGH 2NX5B 3CXHJ 4NBYB 1T4KB 3VDAA 3K8KA 2WINB 2VWEE 4FXKA 5TGBB 1AKJD 4LBEB 5LWYH 4JDTL 2JJSC 5D1ZA 2EEDA 3TBTB 4ODXB 3E3QE 2Z91A 3CFDA 2IFFL 1MCBA 2VXVH 4M6AA 1PFCA 3PHQB 2NX5E 3QI9B 4GFTB 1F11B 1EV2E 3NCJL 4J8RB 4HUVB 3SKMB 4WI9A 4UU9A 3NCMA 5FUOH 1ZVSB 3IJHB 3U36A 5FFLA 1UXWB 3BHBB 4U3CA 1K6QH 4HV8A 4WRLA 2OXGA 4QOKD 4Y1AB 4YAQA 1E4XH 4GAGL 2HA1A 2C3VB 2X05A 5EU7C 2ENSA 2D4DA 2VISB 2IBBA 3EOAA 4L3AA 4L4VA 3JUZA 3JV4B 4CVUA 2YC1A 1TDQA 1R3KA 4Y1AE 4L9LC 1AD9B 1IGCH 2DJUA 3KXFA 1QLRB 2G5BA 1EEUA 1TZGL 3VFOB 1YZZA 1RIVL 3B2UC 3BDXA 5C0BB 3TBVB 4EVNB 3QHZL 1S7SB 4XXDA 4F9PC 1I1FB 1QRNA 3EYQD 3HRZA 3G6JA 3H9YA 2M2DA 1T7YA 2ZWLT 1UA6L 35C8H 5D6DA 5C0BE 5IEKA 2H9GA 3TESA 1LQSR 1QFWH 2EC9T 5DYOB 2GIYA 2VLLB 2Z31C 3BAEH 3NAAL 4X6EA 1CK0H 3PUCA 2B1HH 3HUJF 5DR5H 2VDMH 3W2DH 2FZ3B 4JREC 1BQUA 4K7FB 3SE8L 4G8EA 4KUZL 1FBIH 3ESUF 5B21A 1FHGA 4Y4KD 1DQTA 3U30B 2ESVD 1MCOL 1QR4A 2EKSA 2VDQH 3FOLB 2UYLA 5E08L 1WZMA 2G9HA 2V9QA 4PB0L 5DWUH 5EOCH 5J0BA 5T3XD 1LGVA 3NFNB 3ULVC 1NC2B 1K4DB 5D70L 3RWEB 3OKLB 3QG7L 3RWFB 2DJ4A 1IGML 4QHNA 2DDQH 3WKMH 3U0TB 2VLME 3BIKA 4OSUL 3J8F7 3MMEA 1CFVH 1ROWA 4ZDHB 4JFQB 4P2RD 5D5MA 4G6JL 2VAAA 3AU1A 3EYSH 4M48H 5FXCH 3RGVC 1FNAA 1KXQE 1QLEL 4PJEF 1MAMH 2IALA 5EIIA 2B2XL 2AJUH 2H32B 4OM1L 2HLFC 3V6BR 3HMWH 1J1XH 3MRNA 1FCGA 1KB5B 1YMHB 3MRJA 4KKLC 3VXPB 5DD1L 5DRXB 4G6MH 3PP4H 4P2OD 4D3CH 3LPFA 1JTOA 3VFGH 2BC4A 4Y5YC 3HE6A 4RRPA 3WUWA 1LNUA 3VRJA 1HHIB 1LD9B 2NY2D 1P7KB 3OHXA 4Z0XA 3WLWD 4DCQA 4YFEA 1I1YA 5LGJA 1A6AA 1O7VA 3V8OA 3QUXA 5EOCJ 4XP9L 1YPZA 5CBAB 2VYRE 2MJWA 5FGCB 3T0EE 2BHUA 4JQIL 2J8HA 5MEND 2HJLA 4NO3A 2NZ9D 3ZL4L 4EEEA 1HNFA 2I9TA 1U92A 4L9LB 4JO1L 1GGIL 3RWDA 3JWDH 4C56A 3PL6C 5FGCE 3NA4A 2HH0H 5EU7E 4HWBL 5GJSL 4ELMB 3WS6C 4ZUSA 4L8SC 3RVTC 1G7LB 2WUBL 4GG6A 4F80A 3LEYH 1AC0A 3S88H 1FNHA 4LU5L 1SEBB 1F4WH 5SWSD 2BVEA 2XA8H 1WWBX 1T03L 2Z93B 5I76B 1OAKH 5FYKU 4ELME 3ABZA 1UEMA 1KIPB 3QAZC 3O3AA 1J8HE 5L2JA 4WW2A 4NQSB 1NFDB 2JLLA 4X7TA 3LMJL 4BQ9A 2Z31B 5JUEL 1F00I 3HB3C 3S3PA 5D7IB 2RFXB 3DX7B 5B38B 4BH8B 4K3EL 25C8H 4XVJH 4UB0L 2ATPA 4XCEA 4JREB 1DQDL 1U36A 1QVOA 3O6FC 1NFDE 2IPTL 4JDZA 5H94A 5JHDD 5D7IE 1TTUA 1W72A 4DW2H 5JA9A 2KDGA 4KUCF 2W1NA 4PJHB 5I1DA 1MF2H 2AJYH 1HQ4A 1KC5H 5JW3L 5EA0L 5C71A 5F7LB 4AG4L 2LU3A 3I9GH 5C07D 5C2BH 2GJJA 4XCFL 5I8CB 5C0DA 5GSVB 4Y2DD 1LO0H 3S98A 4PJHE 2P5ED 4LKCA 4XMPL 2VLJB 3D85A 1NUDA 5CINL 3ULVE 5C8JB 4XVUC 3ZDYE 1M1SA 3SGEI 4HD9A 3RGVB 5HTSA 4NFDA 2KKQA 1XF4A 5JLZA 3O3BB 5CJQL 2NR6C 5DLMH 5SV3A 4MA3A 2VLJE 1A4KB 4YHIB 3I84A 3FRPA 3KLHD 4WTWA 3L3GB 1HH6B 1OPGH 4AENA 1BFVH 1XAUA 4LSTL 5I8OL 1T3FA 1JV5A 1MRCH 3BJ91 4HWZA 1DUYA 5B4MC 3RZCD 4M62H 4MA7L 4HJGB 5K9QG 1L0XA 4U6YA 3MV7D 2PR4L 1MRDH 1P9MA 2Q3ZA 4UDUA 1K8DB 1RZKH 4H25B 5E99L 5F7EH 1T89A 1ADQL 4X5XB 2LV4A 1YDPA 1K4CB 3RVUC 1A6UL 4MDJA 4OB5L 2OR9L 1H9VA 3HG1B 3TO2B 4OZIF 4R8WL 2ZUTA 1AO7A 5BZWA 1T6WA 1KJ2H 3C09C 4HW6A 4XNQB 5IW3A 3KPSB 1A7OH 1FNGB 3HG1E 4K3DL 3OKKB 3ZTJG 1P2CA 4XB7A 5KSBB 3G6JF 5BOZG 2F5AL 3MUHL 1JPTH 4Z78A 3PL6B 5DK2A 2FX8H 3I6LD 2E6QA 4OFPA 4CADA 1DN0A 5CMAA 1QEWB 3L7EA 4L8SB 1AIFB 4R0LC 3KPSE 4OIIL 5C09D 5DVMA 3JVGA 4UQ3A 5KSBE 4PV8A 3QIBD 3DYPA 4PJAB 5FGBA 4Y8AA 2NY1D 3GSWB 4NQCA 3IXAB 1V3JA 3T0BA 1W2KT 4YBQC 1XF3B 5CEYB 2X40A 1X4YA 4YPJA 2A9ML 5I0DA 4H88H 3QAZB 1XR8A 4G9FA 2IH3B 1IGYB 1YEKH 3NCEB 4DZ8B 2XTJD 4Y89A 3MC0A 3U4AA 4PJAE 1B6UA 4I3GA 1JHTA 3HI1B 1CFQB 5FA4A 2P8PA 4KAQL 3PIQA 1RHHA 5ESQA 3S35H 5ACZA 1KB9K 5DUML 3O6FB 4O58L 3FQRA 1L7TH 1U6AL 4FMKA 2GUOA 4AL8H 1FJ1A 2X1OA 3VXSD 3BIAX 1EXUB 5D5MF 1IARB 2ZCKH 1NANH 5DQJB 3FQTB 4WJ5A 4S1QH 1ZLVH 4YDIH 5DHVB 1I1RA 1IZJA 3V6ZA 4EXKA 3WNNA 1YQ2A 3I3DA 1X6LA 3F8UB 1H3WM 5HHNA 5BV7C 2GT9A 4NN5B 2VZTA 3UTSA 2DQHL 3WJJA 1IGJA 3CSYB 4LNRB 1Y0LB 3MXVL 1GHFL 1I3VA 1WITA 1I85A 4PLNC 1OP5H 4N68A 4WUUE 4PREA 4HKJA 1UEYA 4OJFL 2RBLA 4PJ8D 2GEEA 3S37H 3WXVH 1LHZA 3WS3B 1NAML 3RVWC 5D71H 4Z7VA 3QUKA 4JVPA 3EO9H 3MRBA 5DD0L 2YA1A 4PYHA 5TJWK 1JGVH 1NBQA 5BS0A 4OCWH 4FXLA 3EYQC 2PO6C 5F96L 3QHFL 4NFBA 1X5XA 1FFNA 3QXDB 3W9DA 3DMMA 3QDJD 4M43H 2DQCH 4UTAH 3OAUL 3C6SB 1N64H 4JFHE 3U48A 4WHTB 4X6DF 3T09A 5ETUA 3OR7A 3LN4B 1QBLL 3C09B 5ICZB 1RZFH 4EDWH 3NCYP 3L3OB 4NC0B 2ZPKL 1AP2B 4F7TA 1FL6B 2V5TA 3BXNA 3PWNB 5J6GA 3L3HA 2CD0A 4V1DA 5DEFB 1MHEB 3D3VA 3KJ4C 1ZKAA 2JCCB 4H0HB 4R0LB 4WW2F 1DQJB 3FOMB 5CP7B 3PGDA 3H7LA 2X4QA 2UZIH 4FQIH 1VPOL 1U95B 3GMNA 3MLZH 4NP4H 3U7WH 3M1BB 2JCCE 1QSEA 3DXAA 3VH8A 5D8JH 3N1MC 5EC2A 3GMQA 4PD4K 4OZHA 4V2CB 5F9OL 5GS0L 3X3GH 1HCVA 2FO1A 2X09A 2IMMA 5CP3A 4F8QA 4YEEA 5C0GA 3LEXB 1IGIH 5T1MB 3UYOD 4NC1C 2AEIT 3SN6N 3I50L 1C5BL 3LZFH 1AKJB 3QUZA 3UPCA 3D87B 4JFDA 2C3XA 3REVA 5HBBA 2BNQB 3SOBH 2R4SL 3MRRA 5GRZA 3BVNB 1T1YB 4P2OC 3FN0H 4IRSD 3U7AA 2NY2C 1T2QL 4AIZA 4BQ6A 1DBAL 5JW5A 2G2RA 1MREL 4U4BA 3JBG7 2JTDA 4XPAL 1MUJB 1AE6L 3PDGA 4QOKB 4MXWH 1EZVX 5BV7B 3SKNA 2GK2A 5BMFH 4U6HA 1X5ZA 4G7VH 1MCEA 2HN7B 2NTSP 3UTTA 3BYTA 1S78D 2NZ9C 1CXHA 1U8PA 4QOKE 4C4KT 4YXHH 2J6EA 4JRXA 4PUBH 1KCVH 5K9QI 1JFQL 1YEEL 3SE3C 3B5GA 3WV0A 2VQUA 4LLYA 1LO5B 4NO2A 4X83A 1TTFA 4CJ0A 2W9DH 2NLJA 2BERA 1HHJA 1CD9B 1VFAB 5MEPB 5JDJA 1F97A 4LVEA 1T1ZA 5I73C 5LCVL 3ECBA 1IAIM 1EMTL 1IL1A 3HZMB 4TUJB 3H0TA 2VDRL 4U1SA 5D7JA 4QRTA 1A0QH 5FHAL 1NEZA 5TQ0H 4I3RL 5JQ6L 2ZG3A 1CLOH 2YMXL 1Z3GL 3N1QC 4F7CA 3CZFB 4IRJA 1DBKH 3BI9X 4YGAB 1DQML 4NN7C 2CMRH 4RMSA 1BAFL 1CR9L 3BEWA 3NIFF 4GMSH 5E5RB 1Q9KB 3L1OL 5IMOB 1WFTA 4UIMA 1WV7T 4Y4KB 4XBEH 4NNXB 2ESVB 3DSFL 4BYHA 4P46A 1HHHB 3KJ4B 4R96B 1FAKT 3CXHK 1UM6L 2AJ3B 4UAOC 2DQDH 4G5ZL 3DURA 1TJHL 4APQA 1YNTB 4PRNB 5GGTH 1UB6B 5EU4B 2BY3A 1UM4L 1LP9B 2OR7A 1S9VA 5T3ZL 2OS7A 4OFKA 1DE4A 1DSFL 2YS4A 2ESVE 1T2XA 4LHQB 4ZO9A 3QFDB 4JY5H 4P2RB 4NKIH 5T3XE 1M7DA 3HR5A 3QUYD 1ZHBA 4HPOL 1T0NA 5SX4I 4UT9L 3KYMB 3NGBC 3VXNA 1LP9E 2CGRL 3HZVB 1MNUL 1N5AB 1Z0NA 2APXA 2FH8A 5TE4H 4L8CA 5DUBB 1F6LL 3FMGH 3TFKD 4G6FB 3RUGB 4P2RE 3BP4A 3GMRB 3WD5H 5I2IA 4G43B 5FF6B 1KYOK 2VXSL 5DJ6B 1H5BC 5L8JB 5HHOB 1JRHL 1H3TA 5DC4B 1JIBA 4P2OB 2Y7QA 4FTVD 3RUGE 1JZ5A 3RY5A 1LEIB 3RZCC 2YBRB 3JWOH 3ZKND 5AD0B 3O45B 1QFWM 3P40A 2JELL 5C3TA 3WFHA 2NY2B 3UPRB 1K8IA 3GSRA 3VFPA 1AGBB 4P48A 2VLRA 4JM2A 5HHVL 5IP4A 2GCYA 2PTTB 5FOBA 3WL9A 3MLXL 4DGYH 4L8DB 4PJXF 1NGXB 5KSUA 3HI5H 5ANME 2X9WA 5EBWA 4OV5B 4Z7VF 3GKZA 5MENB 4TN9A 1E6OL 1LVEA 1N6UA 2E7MA 4X4MA 1QFUH 3K8MA 5JMOC 4LSRH 3C8DA 4CVXB 3CIQA 5DC0A 1KEML 5EZIH 5MENE 2Y4SA 3Q6GL 3IAGC 3FQNB 4GLRI 1A7PH 4R26L 1D5BA 5I73B 3EYUH 4E41A 2OBGA 1FGVL 2B0SL 3QIBC 3OX8A 2NY1C 5CIPH 4UTBL 4U7SA 3PHSA 5E2VL 4K9EH 3MRQA 4OCRH 1JPGB 4NZJA 1N3NA 3WFCL 4Q6IA 3C6LD 3EGSB 1M71A 5SWSE 3THML 1XGUA 4NN7B 2J8UE 1U8OB 1E4KC 3ILPB 5IHZB 2GI7A 4OI9A 4HUNB 1F3RB 3G5YA 4JY4A 1ES0B 1NDGA 1FLRH 1CGSL 5DFTA 1L0QA 2WP3T 5JHDB 3P9MA 2EDRA 3GFUA 4YX2H 1QSFD 2O5XL 5D6CB 1IFHH 1HNGA 1Q94A 1NCCH 5FYLH 1LEGB 3IDMA 4TNVF 2ZNWA 5JHDE 4WNQB 4HUWA 1INDL 5C07B 3MRIB 1AGCA 3BFOA 4Q6YA 4Y2DB 4WFED 2P5EB 4UNTA 1PJ9A 2EDLA 4U1NB 4Y19B 1LE9B 1RIHH 3ULUD 3NGBB 5M7QA 1KCSL 1H3PH 1OAQL 3BKMH 3LIZH 3SGEH 4M3KB 5C07E 4PJCF 4MQ7B 4PJIA 4G8IB 2P5EE 1CVSC 4LCCC 5MEQB 5ECJE 2R0KL 2ZJSL 4F33A 5HHXL 3G5VA 2EDJA 1YJDH 1YY8A 1FDLL 3Q1SL 1H5BB 4NNPH 3TBWB 4JZNA 2NPLX 4PPTA 2F74A 1LEKB 2O5YH 4W6WB 2ZUSA 3CVHL 5CGYD 4FQJL 3RZCB 5HYQA 3O9WA 4R2GD 3MRCA 1KJMA 3BD3A 1AQDB 4N0UB 3L5JA 3BGMA 3KLAB 5DJZB 4ODHL 1Q38A 3ZE0F 1CE6A 3PGCA 1ZXQA 1RK1A 4LDEB 3OJDB 5F72S 3MV7E 3UC0L 5JORA 1M6OA 4JFOA 4R3SA 1EFXA 4N0UE 3WFZA 1DP0A 3ZDZE 1MFDH 4PJDF 1TVBB 4CMMA 2AW2A 1ACYL 3KPLB 4P23A 5KVDH 3SJVB 3STZB 3DARA 3SGJA 1CXFA 4X99B 1JZ4A 3KPQA 1MHCA 3VMNA 3QIUD 5I1IL 2FD6L 2VDLL 1CN4A 4X8XA 4FG6C 5DJ0B 5C09B 1EHLL 1BFTA 4IRZH 5A1AA 4XNUL 1HWGB 3DX6B 3QIBB 3MCKA 2NY1B 1AHWA 3ZHLA 3I6LE 1ZT7B 4I9WD 2MPAH 4OFYA 4XCCL 2ED7A 5ID1B 3MLPA 3D6GA 3FT2B 7FABH 5C09E 2XTJB 2UVEA 3O6KH 3Q3GB 5F1IB 2XPGB 2F58H 4U31A 1JWMA 4H8WH 4TVPL 2H6PB 4IJ3C 2XTJE 1B0GA 3BH9B 3KPMB 2AXGB 5L6YL 2EE9A 4NO5A 2DWDB 3VXSB 1NLBL 5E00A 5J4MA 3GMOA 2H32H 4IRSC 3V6OA 1G6RH 4EUPA 5JXEA 4D9LL 1AI1H 4M7LH 2EH8L 1KB5H 4PRDB 3HZYA 5LAXA 4YO0B 3PDOB 2IPUK 1BZQK 3VXSE 3KJ6L 1YEFH 4RMVA 1LWRA 2HKFH 5EPMA 1JPSL 4WDIB 5JNYA 2DBLL 1W0WB 1P4BH 3QXWA 1NJ9A 2FLRT 1XZ0B 1QBML 3MNVB 3UJIL 4DAGH 5CJXC 5T1KD 4LCCB 1B90A 1QKZH 2DQTL 4YEFA 1N7ML 2Y25A 2E6PA 4HCRA 3ZTNH 4IBLT 4FQHA 1MH5A 4UQ2A 4C59B 4Z7UF 5DC9B 3HZKB 4JM2F 1KSRA 1IM3A 2OL3H 5DEGB 3MOAH 1BQLL 1I4FA 2NY5H 3E6HA 5GZNC 4XCYA 1B2WL 4JHZA 4K8RL 3T0AA 4DUWA 5CZXD 4U3XA 4ZPVB 5IM7B 4M7KL 1OAUL 4RAHA 1A3QA 3QEGH 1HSBA 3QDJE 4YFDB 2ARJA 5IVXB 1FORH 4IEFB 4HZLA 4WI7A 1UC6A 4Z7OE 4JRYD 4LMQI 3BDYH 3BZFB 1WIPA 3LQZA 4AQOA 1TMCB 5IVXE 4GAJH 4ZSOA 5F3HB 3WNOA 3D9AL 1CBVL 1G1YA 2YKLH 4XC3H 5GJTL 1FPTH 1IC7H 2AJSL 2ZOLA 3K3QA 3S36X 3IXTB 3VGEA 4AEIH 1N59B 3MJ6A 4I4WA 4BZ1H 1WZKA 1HHGA 1NGQH 1NMAL 1JWSB 2D3VA 3QUYC 1YYLL 3DTXA 1XF2A 5GGVH 2B5IB 3QUMB 3ULVH 1IC4H 1P6AB 5TPWL 1JN6B 1Z0MA 3W9EB 4ETYA 2OR8A 2XG4A 3U9UA 7CGTA 4KVCH 4U33A 5DVNA 5JO5A 2AK1L 4PV9A 1C16A 4P9HC 1NCDH 1U8KB 3RKPA 3TFKC 5F7FA 3U6RA 1CE1H 3DVNB 4QF1B 3VFVB 3LEVL 4JHWH 3BP5B 5E2UL 2RQ8A 4P5KA 2XKSA 5EBLA 4F3FA 1U8QB 1XT5A 3I02A 3ZKNC 4IRSB 4LVNC 3LKRB 5DRNB 1NSNH 2FLBT 1ZHLB 1GGCL 4OF8A 2Z4QA 4ODSH 5MI0C 3OL2A 1HDMB 2J4WL 4BSWB 1E6JL 2R9HC 2IWGA 4EDXB 2PF6A 3H9SD 1EEZB 1KCRL 2CKBB 2X1QA 1NC4A 2EYSB 4JB9L 4EIZC 5E6IA 1F11A 5A43C 1D5MB 4J3SA 1KPVB 1UXWA 4YFLF 2R2BA 1VEOA 1BFSA 3SCMA 1EH9A 5A2KH 4DUXA 1HOCB 4ODTH 3D18B 1ZLVK 1X4ZA 2NTFA 15C8H 1R0AH 3HHRB 1T1XB 2F5BL 4I5BB 3U4BL 2C3VA 4KPHL 3MOBH 2AK4D 1FH5H 5GGSB 3R1GH 4UV4H 2VZSA 4D0DB 1KIRA 4PGJA 1X7QA 2W9EH 1T83A 2E8ZA 2JIXD 4Z6AT 1QLRA 4XHJD 3VFOA 3X13B 1VENA 1F6FB 5L2KD 3ETBF 1BIHA 3ZTJH 4YHPB 4XPTH 4ONFL 4R90L 1EO5A 3MA9L 4LRNH 4ZTOL 4TNWK 3EFDH 2O61B 1U8JA 3FTGA 1GAFL 2Z35B 2VITB 5T5FL 1OT1A 2QQLL 5KZCD 1YY9D 2VLLA 1DLFH 5HI4D 5IBTL 5D9SA 1U93B 4MWFB 1IEAB 4WIQA 4ONGL 4MX7B 2FZ3A 2DWEB 1JPFB 4IDJL 5DJXB 1ZHNB 4Y88A 5DMGC 1U8LB 5FO8A 3RNKA 1NUFA 4JJ5B 3TWCL 4P5MA 5HDQH 5E8PA 2DTML 4HJ0C 3QUYB 5F7MC 5J6HB 5KVEH 3ULUC 3GHBH 2ADFL 5EC1A 3VG9C 2EIZA 5EUOB 5SX4H 3P4OB 5CZKA 5F70A 1NC2A 5LGKA 3RWEA 4RGNC 2A6KB 4MHHG 3HNVH 3IAQA 4GXUM 1CDYA 4KV5F 1BECA 2R2HB 3MFGB 4UINL 4ZDHA 4GOSA 4JFQA 5HHQB 2P8MB 5IJVA 4WEBL 4FA8A 3FRUB 4WW1B 4FTVB 3MLUH 3L3DB 5CGYC 4MAUL 3HAEG 1P7QA 4LVNB 4WI8A 4R2GC 4I48A 1U3ZA 2VDNL 2IQAB 4MSWB 4HKZA 4MJ4A 2BHZA 4FTVE 4JM4H 5KSVB 4NBZB 2G75B 3JV0A 2I5YH 4HF5H 4NPYA 3BWUC 4CVZA 2DS4A 5HGHA 3TT3L 4HXBL 4KROD 2I07A 1HHIA 1LD9A 3OKMB 3T0EA 3WSQH 4XH2B 4FN0A 1NLDL 4FQCH 4HBCH 1I9IH 4P4RA 1ZGLB 2YA0A 3QIUC 1F4YH 5LQBH 3WHXB 4D0BB 4XX1G 4GLRH 2ZUVA 1ZK9A 5TF1L 5FYJL 2R1WA 2PNDA 4FS0A 3VFTB 1RSFA 4MAYD 1XIWC 2OYPA 3R8BB 2X4RA 3CU1A 4ZXBD 3BD4A 5HSFA 1B0WA 4NZUL 1A1OB 3F12A 4CUCA 1J8HA 5IFHL 1MY7A 1A6WL 4F9PA 3TA3D 1T21A 2NY7H 5ILTL 5IHLB 1FIGH 3V4UL 1MPAH 2EZ0D 5I1CL 3OB8A 4NQSA 1NFDA 1WTGT 1QSFB 5D7IA 5B38A 2XKNB 3KR3L 5KW9H 2XI9A 1ZT1A 1KNOB 4YUEL 4FQQB 3V52H 2VR9A 1ITCA 3GIZL 3QEUB 3LKQA 1QSFE 4X6CB 4XPFL 4KUCD 1IC1A 4X5LA 2YPLD 1PGRB 1H15A 1OGAD 5I74C 3LDBB 1MFEL 4X98B 2R0LL 5F9JA 4M1GH 3VG9B 1MWAL 4DWHA 5CAYB 4TULH 2P48B 3S3JA 5JHLL 4PRAA 3QXAB 4X6CE 3P0VL 1V7MH 5C92A 5IROA 5I8CA 5GSVA 4K2UH 4BZYA 2EIDA 4XBPB 1FAIH 5FK9B 3ULUE 5HHPB 1YEJH 1R3IH 4ETQB 2VLJA 4ZNEE 5C8JA 3K81A 3D0VB 5C2UB 1UZ6F 2IFFH 1FVDA 4MXVF 1YMMA 3O3BA 1DEEB 4OZ4A 3VWKC 4R2GB 3DIFB 2R2EB 1EO8H 5HGAB 5FDWA 4B5EA 5CZXC 2AQ1A 4KZDL 5TDNA 4M7LT 2EDTA 3D25B 2FJHB 1DANU 3WFEL 4TQEL 4UOJA 4CU6A 5HI3D 2FX7H 3SKOB 1TPXC 4EXPX 4GG8B 4GT7A 2XWBB 1TVHB 4HJGA 2XWJB 5F3BB 2X42A 4M8QA 3HC3L 2P8LB 2DI9A 2GSGB 4YXKL 1K8DA 2CO7B 1FG2B 1JNLH 2A6DA 3FO2B 5J9PB 3GMPA 4HH9A 2X4NA 3KXFD 1FYTA 4QHUA 5EZJA 1HXYB 4AMKL 1VKXA 2QR0A 1TZGH 4HKXA 4YHMH 4TSBL 1PZ5B 2E7BA 3QIUB 4A6YB 1E4WH 1G9ML 2NY4C 1UM5L 3QHZH 3RX5A 1JNNL 4YLQT 4Z76B 1BBDL 3KPSA 3MLTB 4O2FB 4MJID 4N9GB 3G08A 4KZEH 4QXTA 2R29L 5GIRA 2Q76B 1DQLH 3U0PA 1SBBA 2P42B 2ZUQC 4HIJB 1TZIB 2HTLD 3ULSA 4I9WE 3IXAA 5CD5C 4P57B 5CEYA 2ORBH 1KTLA 3W39A 2G5RA 2VAJA 3V8CA 4G42B 2FECL 5JIIA 2UVFA 2JB5L 4GS7C 4DZ8A 2A6JA 1ZE3C 2CDFB 2MKWA 4JLRA 1S7RB 1CG9B 4O51B 2CK0L 4ONHB 2V2TB 2F54A 2XKUA 3TJEL 4U3HA 2ADGB 1FFQA 5CJOH 4MD0A 4KJYA 5EFIB 4W4OC 3WNLA 4E42A 4JN2B 1U8IB 3IETB 4S1DC 1BLNB 4YJZL 4LCIH 1CI5A 4MHHI 1I8MB 2QQNH 2COQA 3DI3B 3GRWL 4JY6A 4B7IA 1F02I 3OKNB 3U46B 3INUH 3MV9D 3ME0A 3BYYA 5TDOB 5I74B 2QHLA 4FQ1L 1JGUH 5EN2A 1EXUA 3GJFB 1CTNA 3HNTL 3LQAC 1MJ8L 3EYVB 3L5HA 5DHVA 3A6BH 4CN1A 4DKAA 1QP1A 3D2UD 5T1KB 4QCIB 1SY6A 4NNYB 1T6VN 4M9PA 1KCUH 4KI5F 4WUUA 3C08H 1RZ7L 4KK9D 2BSSA 1M7IB 2ZSVA 3NABH 4GRMB 5IBLD 1JRHI 1XCQB 1UVQB 2IQ9L 2GSIB 1OF2A 4UIKH 5JXAH 2FSEA 4LK4A 3HE6D 3VWKB 1RJLB 4DTGL 2EDWA 2GJ6D 4KHXL 4HG4J 5DFVC 3MRFA 1O5DT 2KL6A 1JNHB 5H2BB 4P2QE 5HDOA 1G7PA 3QUXD 2R0WL 2P7TB 1K3ZA 1TPXB 1UWGL 3ELAT 1MFBH 4Q9RH 5MERA 3HMXA 1YECH 5FECB 4QHLA 5H35A 4JQIH 3RDTA 1T5WA 2V5RA 4JRYB 4RCAA 4J3OC 1TZHB 2QHRL 3MJ9A 1GGBL 1F13A 5HY9B 5I1EH 5C0AA 1YY9C 4C56D 3T08A 5HI4C 4BH7B 3KPRD 2HLAB 1YEIL 3SKJH 3BPLC 4LHUD 1YEDA 1KEGH 1LO4H 1NCNA 5HPMB 1C1EL 4JRYE 1U8MB 4HC1L 1GGYA 4AEHH 3V4VL 5F7DA 2PTUA 1XGYH 2CUHA 1MAJA 3EJYC 4WEMB 3V7MA 4DKFL 2XN9B 3KNBA 3PWNA 4PLOB 2XIDA 1MHHB 4LIQL 4OQTH 1MHEA 4FXGA 4I1NB 5B8CC 4QO1A 2V17H 3G6AB 1NGYA 3PWVA 3KHOA 4L3EA 1MFAL 4OT1H 2ZUQB 3NOIA 4TSCL 3Q5TA 3FOMA 5AYUH 1QSVA 1F4XH 3D0LB 1YEGL 4NRZB 2BSED 4YXLH 3SDXE 3WFBH 2BOBA 3O3DB 2WLYA 4LCYB 1SM3H 4LLMA 5HGBB 1IAIL 4DGVH 1RMFH 1EGJH 4GS7B 3WNKA 4N8VG 4XI5D 3P77B 3EOYG 1TITA 1C5DB 1TJGL 4AH2B 2YPVH 2OZ4H 4Z95H 3EO0B 2Q20A 4L4JA 4LLQA 5LWYL 1IGFL 1AKJA 1ACZA 5EA0H 3LQMA 4AG4H 4X4YA 3H9SB 4KDTA 2P1YA 3BVNA 2VXVL 1AGDB 5ICYB 1RHFA 3D85D 4LGRB 2RJMA 3CMGA 3QPXH 4NFCA 4D2NA 5FUOL 2VC2H 3IAPA 1S5IH 3H9SE 2A9NH 3MRMA 5E9DD 3IJSA 5BZDB 1I8LA 3QFJD 5B3JF 1MUJA 4QOKA 5A2JH 2E6JA 4JHAH 1E4XL 1JUFB 3MRHA 5DA0B 1BQHG 4QRUA 1OM3H 2HN7A 4O02H 2AK4B 4TUOB 4XZUA 1C7TA 1JGLH 4UNUA 3T4AA 5IT2H 3HA0A 4FABL 3M07A 4OLWL 1IGCL 2JIXB 4L8BA 2WWKO 5ADPH 3G5ZA 2PR4H 3BESR 1QLFB 2AK4E 5E8NA 1A64A 1M4KA 3LRHA 5L2KB 1KJVB 2OR9H 3FFDB 4NUGH 3MO1B 3TA3C 1RY7B 2R23A 3ARQA 3HZMA 2VZUA 1DBML 1BOYA 4Z7WA 35C8L 5L2KE 2MTPA 3DX8A 4H5SA 2QSQA 4LCWD 1QFWL 2BVUA 3QJFA 5DVLA 1EEYB 3OKOA 5KZCB 3CZFA 4DVRH 4XRCA 4FFWD 3BAEL 5IVZA 1CK0L 1OARH 3CDGB 1OVZA 1PG7X 1R5VA 2B1HL 5DR5L 2VDML 3DOSA 4LRIA 5DJAA 2VZ1A 4GRWB 3AVEA 4OCXH 5IVNA 2R4RH 5ISZB 1YUHA 4R4BB 5H8DA 3AGVA 1FZJA 4NOFA 3ALWA 1FBIL 1FZKA 5IMOA 1AY1H 3O11B 1OSZB 3HUJE 4ZQKA 2D7TH 5FYKH 4Y4KA 5B8CB 2ESVA 1CFBA 2VDQL 5GS0D 3JV6B 2X4TB 4G9FD 4OD1H 2OP4H 5EOCL 5IOPB 4OLUL 2LABA 1YNTA 5F88A 1LP9A 1IAOB 3WKML 3P9LA 3HFMH 1OT2A 4R7NB 1CFVL 2K9UA 1S8DA 4EI6B 4P2RA 2D7MA 5D1ZC 1TQCC 2H26A 2P47B 3EYSL 5IB4B 5I1AB 4PJEB 3WFDH 1U6AH 4M48L 2GAZB 1N5AA 1MAML 4XB8A 3DV4B 1EERB 5IW1B 2AJUL 1QA9A 1A9EA 3R06B 1Q9LA 2MQ0A 3HMWL 3FFCD 3FT4A 3LV3A 4FNLL 4G43A 5BVPH 4PJEE 4PJFA 5DJ6A 1HIMH 4G6ML 3PP4L 4D3CL 1N6VA 1NCWH 4L4TB 3IJYA 3UTSD 4ERSH 2YPKA 3VFGL 1D6EB 3LKOA 4JE4B 5FO9B 4KROB 1IILE 1UKSA 2V2XB 5LJYH 5ANMA 1OWRM 3VRIB 1FZMB 1FSKC 2A0LC 4OJFH 2PTTA 3PNWB 3FT3B 2B1AL 4LAJH 5SWZD 4GKZB 4L8DA 5HYSA 2ARJQ 1CD0A 2X4UB 2IH1A 5ESAB 5MENA 2IG2H 4PP1D 4XMKH 5BS0D 3CLFL 1D5ZB 3KLDA 3OF6D 3JWDL 5DMJB 3SE3A 2HH0L 5D6DC 1BBJB 4ZXBB 5DK0A 4F9LA 4CRPA 3LEYL 3EW3B 3S88L 3TA3B 1F4WL 1RPQA 1DDHB 2XA8L 5SWSA 3IRZA 1QBLH 3LN5A 2J8UA 3KGRA 1OAKL 5IHBA 2VO5A 4ELKA 1MCFA 1T0PB 4UT6L 1VADB 2ENYA 1OQOA 4JO3H 3BQUA 4V1DD 4J4PD 2HFGH 4QXUL 4Y16A 5CJ8A 5DMKB 25C8L 5IGXH 5IHZA 2C1PB 4WU5A 2JB6B 4YBLC 4LARH 1Y18B 1ES0A 5DEZA 5EG6C 1HN1A 3X17A 4DQOH 2HRLA 3GSNA 4CW1B 4J6RH 2YPLB 4PG9B 4DW2L 3ZYIA 1OGAB 1MF2L 2AJYL 1KC5L 4YIQB 1ZANH 3P0YH 3O0RH 5C0CD 3JZ7A 3I9GL 4PGDA 5C2BL 3MRIA 2YPLE 3MXWH 1LO0L 2CKBH 4Y2DA 1OGAE 3QDMA 2P5EA 1UENA 1BIIB 1V7NH 3W0WD 2C4XA 3VFSA 3PWLA 3B6SA 4GMTH 3DHJA 1TQCB 4M93C 2IPKB 5IBLC 5IFAH 4OGXH 3CFDB 1F2QA 1Z9OA 3NA9L 3DX9A 2XRAH 4UMGA 1CGVA 4YDJB 2XTLA 3HE6C 4G8IA 5DLML 5MEQA 3ARSA 2BVYA 3K4DA 4UU9B 5INCB 2BCKB 3U36B 1CGTA 3ZLQC 1SVCP 1X6NA 1OPGL 4OCSL 3TBWA 1BFVL 4HV8B 4XPAH 2QSTA 3QUXC 1MRCL 4YAQB 5C0RH 4M62L 1YN7A 2J1KA 5E4EC 3ROOA 1S3KH 3UTTD 3MV7A 5F7EL 1RZKL 3EOAB 3I2CH 2YC1B 1BJ1H 1R3KB 3NBNA 4JRXD 1E28A 4OZIB 3KLAA 1FSKB 5BXFA 3KXFB 5E03A 1I7TB 2G5BB 2C26A 5F1SA 4XC1H 4BM7A 1A2YB 2OMBA 1ZVHA 1KJ2L 5E94A 4XXDB 4OZIE 1TVBA 1A7OL 3QBTB 4NHUA 3V5KA 3BGAA 3KXFE 3G6JB 2ZG1A 3KPLA 3QB7C 4MJIB 1EMTH 4JRWA 5CKAA 1ITBB 1JPTL 5DO2C 4QHKI 1PX4A 3MYZA 5D7JD 2FX8L 3WDHA 5IEKB 4Z7WF 3VDCA 5L9DH 4WW2C 3ZYZA 1FVEB 1NKOA 4IRJD 3P11H 1BGXL 1I3RA 3G6JE 3MCLH 4MJIE 4NIKB 4J3VA 3QIBA 3DX6A 3UDWA 3O4LD 2HT2D 5IQ7H 4NRYB 1BAFH 5EU3A 2DLIA 4H88L 1PDKA 4PJ5A 5JW4N 1YEKL 3RBGA 4XI5C 4N0RA 2EKSB 3KAAA 1E4KA 2G9HB 4P9HH 4G5ZH 3BD5A 4APQD 1BJ1J 3EKCA 2FNBA 3S35L 4NWUH 5T3ZH 1SMAA 2UWEF 1X5IA 1L7TL 4QHNB 1GH7A 3BH9A 3MBXL 3KPMA 4AL8L 2AXGA 1SHMA 3BIKB 1CDJA 3MMEB 3C87A 3MV9B 2ADJA 1R5WB 5E1AA 3VG0H 5D5MB 5TDPA 3VXSA 3AU1B 2CLRA 5GGUA 3MRKA 2EDKA 4Z5RA 1DQQA 1OP3K 4S1QL 1UJ3A 4YDIL 4NM4H 1MNUH 2ED9A 1FV1A 2VZVA 4YPGA 1BWWA 2IALB 3OKEA 5EIIB 4U1HA 3HAEH 1JJUA 5I30H 3MV9E 5D5ME 5IB5A 4RZCA 3MRNB 4RMQA 4RRPG 4M4RA 3WUWG 2C9AA 4WDIA 3A6OA 4M93B 1PY9A 1JRHH 4PJFF 4D9QD 1UXSA 4ZPTB 3ARDA 2UUDH 3DNKA 3FO9B 2BC4B 3VFWA 1Q72H 3HE6B 4HIEB 4HUUA 3WUWB 1LNUB 3VRJB 3IDIA 4PJ8A 1VHPA 2GJ6B 1WF5A 3S37L 1P9MC 5I6XC 1CTOA 4XCNA 3OHXB 4LCUB 3WXVL 4Z0XB 1T89C 4DCQB 3BW9A 4PBVC 4M03A 1I1YB 5D71L 5ABDE 2VLRD 4JM2D 1A6AB 3RZWA 4RGMC 5HHVH 3QUXB 3EO9L 1JGVL 1YPZB 4OCWL 4XT1C 5JPMB 2D7QA 2GJ6E 5E4EB 4D8PA 4ZO7A 1RU9H 4Y4FD 4W6XB 2HJLB 4NO3B 4M43L 1JZ2A 4UTAL 3QDJA 5KG9A 2I9TB 1U92B 3TIDA 4OIAA 4OKDA 1QTYT 3RWDB 4WEUD 5BRZD 4C56B 5IM7A 4FFWC 3BH8B 4PG2C 3KPRB 4K7PX 4UNVA 3PWPA 4ZUSB 1N5YH 1HQRA 1RZFL