2DAVA

Solution structure of the first ig-like domain of myosin-binding protein c, slow-type
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
126
structure length
126
Chain Sequence
GSSGSSGILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein, contractile protein
molecule keywords Myosin-binding protein C, slow-type
publication title Solution structure of the first ig-like domain of Myosin-binding protein C, slow-type
rcsb
source organism Homo sapiens
total genus 16
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2davA01
3SGJA 3VFUA 3QB7C 3MRFA 4KPHH 4NQVA 4TUJB 1EUTA 4YDLC 3QXDB 2PNDA 4PLKD 3SKMB 1RJLB 4PYGA 4NBXB 3WFBL 4X6EA 4Z95H 1C16B 4MXVF 4EI5C 1JIBA 5C86A 2GW5A 4KUZH 3ZO0A 4EN3A 3MV9E 4BK5A 5I73C 4Z8FL 4KZDH 2YC1B 3AREA 4KUZL 5F88B 4MD0B 3VDCA 4OV5A 4JANA 1B3JA 1YUHB 4XNQB 3VH8A 5BOPA 3RZCD 4K9EC 5F1IA 5IB5A 2VZTA 3T4AB 3AU1A 2GUOA 5I1IL 3ARGD 2DTSA 4KKAD 4NUJB 4NO5B 5C71A 3RA7H 1CFQB 1KEGL 4YFDB 1KTDB 4QKXB 5B39G 1JFQH 3AS1A 4EUPH 2Q1EA 1CGXA 1AQDA 3EZJB 1KT2A 3RA7L 3OX8A 3VFMB 3IDIB 4MD4B 5D1XA 5ADPH 2JF1A 5DJ0A 5IVXF 1YY9D 1HXMB 2XZAH 5DA0B 1IEAA 2XZCH 5ADPL 4I48A 4WW1A 5LAXA 5FYJD 3QEQD 1T20A 4NRXB 3NAAL 3KPTA 2FR4B 1NLDL 2CDFB 5D1QB 3IDUA 3T1FA 1UKQA 3OXSA 1K85A 4HFUL 1ZGLA 4IRSD 5F1NA 1YEIH 4JM4L 4NQSB 3VRLE 3TBVB 1R0AL 2ZP0T 4XVJL 4ZO7A 4PJ7E 4I77L 3SCMC 4UV4H 5IEKA 3WYRA 5D72H 3WNMA 4O2FA 1CBVH 4E0RB 1PSKL 1PKQB 4WFGE 2YD1A 4DAGL 3KR3L 1Q38A 5GJSL 1F5WA 3L3IA 1RIUL 4PJGF 4L3CB 4HXAH 5LGHH 1T1WB 5DJZB 1AGBA 4PB9H 5EU4A 3P30L 5C0DA 2WQ8A 4GJTB 4ZSOB 2FATH 1WIPA 2Z8VC 5KSVA 3V0WH 4DZBB 4JCMA 3SKOA 1RULL 2FATL 3BPLB 5I18H 3O3AA 2E7BA 4EDXA 1AC6A 4KTDH 3ZHKA 4IRJA 4YZFE 1XEDA 4KKAC 4YHYC 1EO8L 1C1EL 1OLLA 5DD0H 3GO1H 1HILA 4LVEA 3NACL 1EEYA 2GITA 2BVQA 4RQQB 1I8MA 1T1ZB 1EHXA 4BZYA 3GO1L 1KIPA 3UZVB 5IJVA 5KS9F 1XGUA 3GKZA 1PBYA 4AH2A 5F7WC 3HC0B 2RCSL 5BV7H 1A1NA 5HDOA 4ZFGH 4KV5E 1NCUA 4TVSa 1Q9WA 4R26H 2EE3A 2NMSA 4ZFGL 5GGUA 4N0YH 5DQJA 1TZIB 4R26L 3DRTB 3HR5A 1FNEB 3EO0B 2ITCB 3SO3C 4IRSC 4F7TB 4YQXH 1N4XH 2UY6A 1QRNA 1QLFA 4RX4A 4LCIL 5LGKA 2HN7A 4NQCA 2Z92B 3MGTA 1HSBB 5HD8D 3WIIH 3DXAE 3IS1X 3RWFA 3MRBA 2NPLX 3HZKB 5HY9B 2L7UA 3H7LA 1JE6A 3EZ8A 4FOMA 4JN1H 2VSDA 3FT4A 2A74B 2EDEA 5INCB 3H3PL 4QXGH 4JN1L 3H3BC 4XP5L 4C55A 4XH2B 4IBLT 4EDWL 5I19L 1UXWB 4N0FB 2FX7L 5SWQB 2E9BA 4ZG1A 1NLBL 4R9HA 5C6WH 4P2OA 5HHOE 4LCCA 2BC4A 3SE4C 4R0LC 1OSPH 5LBSL 4ZDHA 5FXCH 3QJFB 1HYSD 1IQWH 1WGOA 1OSPL 2BFVH 3PHOA 2IEPA 5TE4H 2MCPH 1CLYH 1IQWL 1M1SA 1TPXC 3QI9B 2MCPL 3FAXA 1EPFA 4YXKH 3RY6C 5FECB 5ID0A 2GI7A 4HDIB 2E8YA 1K5NB 1JF6A 4YXKL 2NW2A 5BS0B 1WTLA 4JFDD 4NCC2 3DUUA 3H9SE 1JJUA 1ZANH 5LQBL 4XGZB 2X42A 2F54B 3MGOA 1MFBH 1VADB 2RHEA 1FJ1B 4PV8B 3DURA 4EI6B 1E6OH 2GEEA 4BKLA 4FQHA 2R69L 4ODHL 3NCYP 4ODBD 1E6OL 1U8KA 3VGDA 2X7LB 1Z3GL 2VQTA 3IS0X 3ZDXE 2IH1A 1UKTA 5JXEC 4PRHB 5E7FA 1JWMB 4PREB 2V2XA 5HD8C 1SEBB 2NYYC 1FNSL 4LSUL 5IOPA 4D9RE 4WUUB 4Y19A 4P48A 1ZWIB 3S8WA 3ULVE 4YFLI 1TLKA 1KV3A 1A3RL 1MHCA 4I3GA 1JGVL 4HIJA 4OZHA 2EDJA 1FGVH 3DGGB 3HN3A 4KGJA 2FLBT 1IAII 3L3KB 4OJFH 3X11A 4XBPA 1KJ2H 4Y4FB 2EDTA 4L1DA 1RK0A 1FE8H 4PB0H 4OJFL 2FJGB 4NCC1 1KJ2L 1Y6NR 4MDJA 2NNAB 5IQ7H 2AXGB 2OSLB 4K71C 4K7PX 5ERWA 3G5XA 3HNSH 3P9LB 1A7PL 5IQ7L 4YHNA 3W5NA 5DEGA 4NWUL 3HZVB 5GGTH 1HYSC 5IMMA 3NZ8B 4BFEA 5MHSE 2VDMH 5GGTL 2FH6A 5DJ8A 2R56L 4J7RA 3L5XL 4HS3A 3L3DA 4MWFA 2DTML 4NP4H 3LV3B 5EUOE 2VDML 5KAQG 1I8IA 3PWJB 4MXWL 2WIMA 4YBLB 1Z2KA 5BVJA 2H26A 1F3DJ 4PJGE 5CHNB 3QHTC 4L9LC 1KN4L 1ZT4A 5CS7A 1IILE 3AS2A 5I1LB 1S7TB 2MKLC 3QDAA 4OF3A 3TNNB 4Q6IC 4TUJA 5EBMA 2DWDB 1AXTH 3QXDA 1FPTH 3SKMA 1RJLA 4OV6F 4HWNA 1GGBL 1AXTL 2Z93B 4FFZH 1NCDH 4CN4A 1C16A 1TCRB 1Z5LB 2DJUA 2CMRL 1GGIL 2YC1A 5F88A 5C08D 4MD0A 3RHWF 3AY4C 2Q7NA 3MBEB 2P1YA 1YUHA 4XNQA 2CGRH 3LRHA 1GH7A 5F9DC 2ARJB 2F58H 3T4AA 1EO5A 5JW3L 2NY5L 2Q3ZA 1CWVA 4NUJA 4NO5A 3BPCB 4AJ0A 1CFQA 4CRPA 2HA1A 1KTDA 3WXWH 2BVUA 1NSNL 3NIDE 4FFVD 3V79C 3LCYA 3VFMA 3MFFA 3IDIA 1SJVA 4MD4A 1HXMA 1P7QB 4BFGA 2M1KA 2FX9H 1A7OL 4KI5D 4OZGE 4RWYH 4HUWB 3OMZA 4CJ0A 3QIUC 4IIQB 4JFXB 4NRXA 3D3VD 2CDFA 2OMBA 2VLJB 5JR1H 4JRXE 4NUGH 3S37L 3MV8B 1CK0L 4NWTH 4XP6H 3KLAB 3WUZA 5IGXH 5DZOA 3NCJL 5EDXA 5HYJD 1CDCA 4NQSA 3TBVA 2Y06L 3QDMB 2JIXD 5T1DL 4F8QA 3VMOA 3BMVA 1L7IL 2O5YH 3BP4B 1TVHB 4XMPL 1J1OL 3VRJB 2V5YA 4ODWB 2BNRD 4E0RA 4FQPA 4LHUG 4XI5D 2BVOB 2BP3A 4NNYB 4LPCA 1F2QA 2AJVL 2LVEA 2E7MA 5JA8B 1U3ZA 4L3CA 3TVMC 3ARXA 4UTAH 1TETH 5DJZA 2HT3D 2P5EE 5FKAB 1WZMA 4HKXA 3RWDB 3EDEA 4F9LC 1AKJB 4DZBA 4ZPTA 4TTGA 2H2PD 4Y1AD 2LABA 4ONGH 1WFUA 3FB5B 3LKPB 2ENYA 4OLYL 4F7MA 4X6BA 2DMKA 4F7PB 1JYWA 5C6TH 5DURB 3O4OB 5KSAD 2J6EH 2BVEA 4Z7UF 3MLYL 3HAEH 5EG6C 5A3IC 2IG2L 2HFGL 5C6TL 2V5MA 4X80H 4Z7WF 4HCRA 3FZUD 4RQQA 1T1ZA 1C7SA 4FFVC 5C09E 5DI8B 3QCUH 3CPLB 3ZHDA 1F42A 4DQOL 1B0GA 4G7YH 4LSQH 2IAMD 1MCOL 4OQTH 3HC0A 2WP3T 4OUOA 4OGZA 5D70H 5GRJL 1A6TB 3BISA 1RY7B 4TSCH 5T1MB 1TZIA 1SHMA 4AYFA 4P4KB 1RSFA 3DRTA 3E3QC 1DVFB 1I3RB 1FNEA 3EO0A 2ITCA 4TSCL 4F7TA 2XIDA 3K81A 2X1XR 1SBBA 2V5TA 5GRXG 3V6OE 4F57H 3PQYD 4Z18A 3NGBB 1QFWM 1NBVL 2Z92A 1HSBA 1SMAA 4L4TD 4XI5C 3HZKA 4G6JH 4UMGA 5HY9A 1P84J 1MCPH 5EBLB 1XGPB 4G6JL 1IKFH 2Z0BA 1A4JA 2A74A 3KPSE 1MJUL 1JGUL 2FSEA 1IKFL 4XH2A 4M1DL 3C6LB 3MZGB 4N0FA 3W0WD 2IGFH 2YK1H 5SWQA 3QPXH 2DYPD 2IQAB 2H2PC 2KDGA 1JV5B 4JPWH 4FABL 1G6RH 3QPXL 1R5IB 5BXFA 5KSAC 4OQTA 4JPWL 2OXHA 1FORH 3QJFA 4RGOL 3W39B 2NY5C 2VLRD 1CFTB 4JM2D 5T3XE 4FFYL 1CD1B 3K7UA 1FORL 4LLDB 4E41E 3FZUC 4BUHA 3QI9A 5GISH 5GRUL 1U58B 4PLJD 3QFJE 5KSBE 5FECA 2R29L 4HDIA 3FB8B 2IAMC 1KYOK 1K5NA 4RMRA 1QSFA 3WO3B 4X5LA 5FO7A 5BS0A 3BQUD 4X5XB 4KRPD 5EFIA 4XGZA 1YYLH 3TT1H 2F54A 3SDAC 1VADA 4PV8A 1D3CA 4EI6A 4X7CC 2XI9A 3QHFH 3U9PL 4F80A 3SDDB 1MHEB 3F5WB 5FHBH 3BZEB 3L3GB 2X7LA 4TNWK 3CXDL 5DZLA 4EQ3A 4OAWB 4PRHA 5FHBL 4NC1E 3ZTJH 1JWMA 4PREA 5D7LD 1YNTB 4WV1A 1SEBA 4ZFOB 1U3HA 4M6OH 4NFBA 1LK3L 1OGTB 4KUCD 4WUUA 5A1AA 1ZWIA 5DVLA 3SDYL 3RPIB 1CL7I 4M5ZH 1I9IL 1IFHH 3DGGA 5JW4N 4DUXA 3LAFA 3L3KA 4OI9A 3EW3B 4Y4FA 3WLBB 4QRPB 2WBJD 4X7SH 1T7ZA 2FJGA 4W6WB 3BKYH 2NNAA 5JW5A 1EDQA 2AXGA 2D3VA 2OSLA 4GG6E 2VO5A 3HHRB 5CJBA 4K3DH 1J5OH 5EOQL 3BKYL 1OGAB 4JJHA 2X2YA 3PIQB 2DLTA 2Q8AL 3GIZL 4K3DL 2G5RA 3HZVA 3V0AC 5AUMB 3O45B 1V8HA 2V7NA 4LP5A 3NZ8A 4FQ1H 3VGBA 2Z31B 2VYRE 4JM2C 3PDDA 4MNQD 4FQ1L 4TOYH 3LV3A 3VFVB 4U0RB 1SQ2N 3PWJA 4MD5B 2X1QA 3LN9A 4PLJC 4TOYL 2NY4B 3ME0A 5CHNA 4YPGB 5E8DL 2N56A 5I1LA 1INEL 4NN5B 1S7TA 3BQUC 3TNNA 4KRPC 1JGLL 2DWDA 2V6HA 2W92A 2CIIB 3TO4C 2UWEB 4OLWL 2MQ3A 4U1JB 4OZ4B 5IHUH 5C07E 4FQLH 5C1MB 5DJDB 5L2KD 3W2DH 4ZS7L 1MCCA 5IHUL 4FQLL 5C0AD 3W2DL 1TCRA 3TBTB 1Z5LA 1BP3B 3RGVD 3MFGB 5IV2A 4PRPB 1VFBB 3SDXF 3MBEA 4BJLA 3KPPA 2I60H 2ARJA 2VC2L 4JFPB 3QUMB 2A2QT 4GKSB 2VZVA 5J6HB 4NYLB 3ZKMC 4NNXB 1I85A 3F7RA 4KJYB 5JW4Q 5TDOB 2Z4QB 4JDTH 1IKNA 5BRZE 1TVBB 4NKDB 4WO4A 1KTRL 1J8HE 1IEBB 2WBJC 3VMPA 4RCAA 2NY0B 4YDJB 4Q9RH 1P7QA 2P8LB 1RV6X 4D3CH 3TESA 2EICA 4HUWA 4O58H 3MLUH 3BHBB 4IIQA 4JFXA 4DKFL 5L9DL 1MFDL 2VLJA 2O26U 2ZCKH 1TNNA 3MV8A 4AG4H 5FO9B 4NZUH 3KLAA 3MREB 1AGFA 4AG4L 3U7WH 3QDMA 3IDJB 3UTSB 2HFEB 2W65B 2AI0L 3BP4A 4XBGB 1TVHA 4JFFE 2AJSH 4ODWA 1UJ3C 2WW8A 2BVOA 3QNZB 4NNYA 2AJSL 1EZVY 1OD9A 2DWEB 2XNAB 2QR0B 1TJHH 4OIBA 1QSZA 5F7EH 3VE0B 3RGVC 5GGRB 5FKAA 1V5JA 3UZEA 3RWDA 3VFGH 1X5XA 2UY7A 1AKJA 3MROB 1D5XB 1A1MB 1GPOH 3P9MA 5IQ9B 3ROOB 4QLRA 5SWZD 3FB5A 2ZSVB 3LKPA 1NFKA 1GPOL 4F7PA 2HFFB 4YHYB 3V7MA 3C9NB 2DQGL 1MEXL 2CJUL 3KPMB 4S2SB 3MJ8A 5DI8A 4NGHH 2XQBH 3CNKA 5JUEL 1RUMH 3CPLA 4YXHH 5ELIA 5GRWA 4KRMB 5IUSA 4NGHL 5GRVL 2XQBL 4QTHB 4YXHL 1BM3H 2DQJL 4MS8D 4YHPB 1A6TA 4HXBH 4UTBH 1BM3L 1E4WH 1VGEL 4XVTH 3LN4B 5T1MA 2F5AL 1XFPA 3V5KB 4UTBL 4IRSB 3SO3B 4P4KA 1DVFA 3OF6A 5H94B 1I3RA 1A6WL 4P5KB 3P4NB 3T0WA 5C9KA 4NJAL 2P5WD 1T80A 3KGRA 4DZ8B 4WFEE 1YNLH 1SVZA 1D5BB 3QDGD 3OAZK 1YNLL 4JQVA 2C9AA 1K3ZA 4I3RL 4LSRH 4OCXL 3MRRB 5JNYB 4NJ9H 3ALXA 1I3GH 3CK0H 5EBLA 1XGPA 5CSZB 5M7QA 1HIMH 3CK0L 2YD6A 3MRLB 1IC4L 4PJBB 5CAYB 3C6LA 3EJYD 5BMFL 4TVPE 4ZTOL 2DQTH 3VXQB 2IQAA 1RUQL 5C0CB 4R0LB 1BVLB 1JV5A 3PWNB 4J4PA 1R5IA 2VLKE 3OB8A 1I7ZB 3ECBB 1JZ8A 3W39A 2A0LC 4YX2H 2ZCLL 1CFTA 3RGHA 1TTGA 2F19L 4DOHB 1CD1A 4LLDA 1TPXB 1S5HB 4YX2L 5DMGD 3OAZH 5JORB 2VXUL 1U58A 4FHBD 5AYUH 2L0DA 5HYIA 3K8KA 3FB8A 2J8OA 2VDQL 3UAJD 1BQLH 1ZLUK 5AYUL 3SDXE 1QBLH 3WBDA 4X5XA 1CDBA 3W5MA 1MLBB 2A77H 1BQLL 4CJ1A 4H1LH 3H8NA 1MRFH 3BH9B 1QBLL 1OPGL 2WM0A 2SEBB 1JMXA 5DFVD 4Z9KB 4NNPL 3VWKB 1SEQL 3GI8H 35C8H 4C58B 4JG1H 1MHEA 3F5WA 3LKNB 3N1MC 3BZEA 2R1WB 3L3GA 5E8PB 1CT8B 35C8L 2BXZA 1XGYL 4JG1L 3D85B 4OAWA 1MAMH 1EJ6A 1YNTA 2XACC 2ZOKB 5DJCB 4ZFOA 1OGTA 1F97A 5DT1L 5EB9A 3RPIA 4NM8L 2BSSB 5DVKA 2QSCH 5T5NF 4HAGA 2FD6H 1FZMB 4XX1E 2NY1D 1OW0A 1VEOA 4N0UE 4HPOH 4K55A 1ZLUH 1UC6A 5IIEB 3WLBA 4WW2C 1R3LB 2FZ3B 4K7PL 4K71B 4PJIF 1QFPA 2OMNA 1L7TH 4LEXH 1A14L 2EDRA 3D48R 1OGAA 3VI3E 1L7TL 1S7SB 3PIQA 4LEXL 1WK0A 4Y5XB 5AUMA 3O45A 4ZAKD 2Z31A 3WDIA 2KUTA 3VFVA 4OCSL 5K9JL 4MD5A 1ZEAL 4L9LB 3MOQA 2N4IA 3DPBA 1RK1B 4YPGA 3KPLB 5D93C 3LH2L 1OWRM 3V9FA 2CIIA 1KGCD 2UWEA 4JB9H 4U1JA 4OZ4A 1IAIL 5FCUL 3UTTD 5MP6H 5DJDA 1NCAH 4JB9L 5DFVC 2Y5TB 1NCAL 4NQEE 5C0BE 3W82A 3BRGC 3TBTA 1RHFA 4YBQD 1ZVHA 4XNZC 4UDTB 4PRPA 1MCKA 2DM4A 2EE6A 1E0OB 1VFBA 2EDKA 3BI9X 3G5VB 3IKKA 5DHVH 4P5TD 3PL6D 1BFOB 2WINB 1UZ8B 1DEEB 3FB6B 1ZT1B 2BVTA 2OS7A 3K80A 3QUMA 1DE4B 4GKSA 3K2UH 4Y5VC 2R2HB 1KPUB 4NNXA 5JOPE 2BK8A 4KJYA 2A6JB 5TDOA 2Z4QA 2NY1C 2N1KA 2XN9E 1TVBA 2EIZB 4JO2L 4P46B 4NKDA 5IFHH 1IEBA 1CR9H 4Z7NF 4YDJA 3VFWB 1KXTB 1Q9KB 2F8OA 5GGVL 3FFCB 5DJYB 5IFHL 4WI7A 5I0DA 1KEMH 2P8LA 4JJ5A 3R0NA 3QIUB 4TYUA 3UJJL 4PYHA 4QOKD 5DD5H 5DD3L 1MHHB 4P59H 2NY7H 1RURH 4QRSB 4ZAKC 3QCTL 4RAUB 5CZKA 1XIWB 4P59L 1HNFA 2NY7L 5FO9A 4PJEE 4R7NB 1IT9H 3UJTH 3MREA 5T1LB 1IT9L 1RVFL 3PGCB 2P8PB 1I9RL 3IDJA 2YRZA 4RMTA 3UTSA 1CDJA 2HFEA 2W65A 4XBGA 3S34H 3MLVL 5GIRB 1U9KA 2NY6C 3VMNA 2VQUA 2WWMD 4EXKA 3QNZA 1CZ8L 2XTJC 2DWEA 1N8ZB 2XNAA 2I26N 3TVMB 4S1DD 1A8JH 4LPWA 2IBZX 4FTVD 3BIAX 4MJIE 2QR0A 4EVNB 1AE6L 3BZDA 1GCFA 1HI6B 4J3OC 4I8DA 2Z35B 4YBQC 1ORSB 3VE0A 5C08B 2JB6B 5GGRA 1A02N 1SJHB 4PD4J 4K94L 4PGEB 5TGBB 3MROA 4U49A 1D5XA 3GMOB 1A1MA 5IQ9A 3ROOA 2C3VB 1IGIL 4XRCA 2Z8SA 2ZSVA 2YPLB 4QXTB 3O6ML 3T8XB 1KB9K 5MEND 1OAZH 2HFFA 2JJUA 5CEZL 2QQNH 4P2RD 4NSKB 2WUBH 2H32H 4FRWA 3C9NA 2OK0H 1BQUA 2QQNL 3KPMA 4R4BB 3U4EB 3TO2B 2WUBL 3JVGC 3KS0H 4S2SA 5JIIA 3D69B 3P0YL 5SWSD 4LLYB 3QEQA 3HZYB 4QTHA 5IK3B 3OJMB 5JW4R 4ONFL 4JKMA 3CUPB 4YHPA 1A64A 3B6SB 1K8DB 1N64L 1SBSL 5E0QA 2FWOA 4XWGL 5ECJE 1TQBC 3V5KA 4IRSA 2JJSA 1MI5E 5H94A 4NKMB 5EU7C 5HYJB 1KBGH 4P5KA 3D39B 2A9MH 3SQBA 1KLFA 4HHAB 1DBKH 5DA4A 3V4UH 2XFXB 2A9ML 3VW3H 4DZ8A 3C87A 3PJSB 3DLQR 2R9HD 5IFAH 4KH2A 1V3LA 1D5BA 2VZUA 2ICWI 1XCQA 4PJIE 5IFAL 3I6LE 2D03H 2WWMC 1FP5A 3AM8C 2HWZL 3ARDD 3MRRA 5JNYA 1YPZB 1AY1H 5CIPB 4TSBL 3TWCL 2ZZUT 5CSZA 1WWBX 4IRZH 1AY1L 4D0BB 1N0XH 1A7QL 4U1GC 1X3DA 1C8PA 4UNTA 1IGML 3INUL 2KBGA 3MRLA 4PJBA 5KN5B 5EU6D 1N5YL 4PG2A 1E4XH 4XNUH 1IRAY 3VXQA 1I8KB 3SE4A 4WWKD 2PO6D 3M07A 5C0CA 4R0LA 3HI1B 4XNUL 4XVSH 3PWNA 3GJEB 2ITDB 1I7ZA 3ECBA 4KMTH 1VGKB 1RUAH 4QRRB 5CEZD 1F58L 2VLLB 2GK0B 4OB5H 1OD7A 3UROR 2NY2D 3HCVB 2DMBA 1S5HA 4KI5F 4MA3B 5HHME 2RBLA 1NJ9B 1NAKH 5D8JH 5JORA 3RY6A 4HGKC 2H2SD 4L3EB 5KOVC 4POUB 1E4KA 1JPGB 3SGDH 1FYHB 4PRID 3SDAB 1MLBA 2OI9C 5CGYD 3BH9A 3TIEB 4BZ1L 3U48A 2CXGA 5IJKA 4R4ND 2SEBA 2B2XL 4DN4H 1QRNE 4LU5H 1B6DA 4TSAH 3VWKA 4LDOB 4HG4K 2YD3A 4ODUB 3BZFB 3PQYB 4YE4L 4KJWD 3LKNA 3EOAB 4LU5L 2R1WA 4TSAL 5E8PA 3ZT5A 5IWLC 5JXEA 3I50L 1CT8A 2R9HC 4NQCE 4OI8A 3D85A 1N0LA 2W59A 1S3KH 3T0EC 4QTIL 4QRQB 4Z7NE 3GSNB 4AL8H 3ZDYF 2ZOKA 5DJCA 1KFAH 1K4DB 5CEXB 1S3KL 3ARDC 2NY3C 4PJXB 2RB8A 3TC9A 5L0QC 5C70A 1FZMA 1JRHI 2J88L 4Q0XL 1QBMH 4A6YB 1V3KA 4ZOBA 3NFPB 5IIEA 2CRZA 1MUJB 5FDYA 3F6LA 1R3LA 1ZLVK 1Q0XH 2FZ3A 4K94C 4M8QB 4ZFFB 1UWGH 3NFSL 3PG2A 1D6VH 4WWKC 2PO6C 3CFJB 1RZKC 1EUUA 2FX8L 1S7SA 3C2AL 5E5MA 1OARL 4TUKH 3P4LA 3HG1D 4Y5XA 3TYGL 4RGNE 1T7VA 1UYWL 1FVCB 1CXFA 2PR4H 3ELAT 2VH5L 2PR4L 1YMMD 4UIKH 3MV7E 4L9LA 4PS4H 5EH1A 4G8FA 1RK1A 5L8JB 4PS4L 2F8VA 3HNVH 4JFDA 1CL7L 3TO4B 4OBSA 5ALCL 1FG9C 3K46A 5J56B 4P5MB 5D6CB 1K6QL 3CLFL 1FFQA 4TRPL 1JZ5A 1NBYB 4JVUA 4KK5C 4M48H 2Y5TA 5J06A 4G8GE 2YOCA 4UT9H 1KCLA 1P4BH 4XAWH 4KJWC 1UB6B 1HYRC 4OD3H 4M48L 4UDTA 3QIWD 3AY4A 2CLRB 2KKQA 4XAWL 3G5VA 4OD3L 1BFOA 4BH7B 5FV2A 1UZ8A 1DN2A 1DEEA 4Y19E 3FB6A 4R7DB 3IRPX 5JIHA 1DE4A 4GUPB 2R2HA 1KPUA 4TULH 4OZHE 5MI0B 3JXAA 3GHEH 2AJYH 3FQNB 3C2SA 2A6JA 1ODAA 5IF0B 3GHEL 3LVEA 1TJGH 2B1AH 2J7LA 4JREB 4WEBL 2WBJB 2EIZA 4P46A 5F7UA 5SV3A 5L2JB 4JFZL 1ACYH 2B1AL 3VFWA 1Q9KA 1V7ML 4YUEH 3FFCA 5DJYA 1ACYL 1P4IH 4ERSH 4YUEL 4MMXC 4JM2F 1E6JH 3QIUA 2HLFD 1P4IL 4LCYB 4OZFG 4ERSL 3H2WA 4L8CB 2AJZB 1MHHA 1NBZB 1R3KA 3UO1H 4QRSA 1YQVH 4EXPX 4FZ8H 5EUKB 3TA3D 4KKLC 3CD4A 4R7NA 3PP3K 1EVTC 5E1AA 3ZE0E 1G1YA 4KHXH 1IC5H 4RZCB 1W0WB 3PGCA 2BERA 5CGMA 1V3JA 2P8PA 1JNJA 1G7PA 1UJ3B 4KHTL 4L5FH 5GIRA 1HQRB 5D4QA 4IOSD 1UCBH 2OZ4H 3PWPB 4WGWB 1G84A 1N8ZA 1JHKL 4JO4H 3TVMA 4AM0B 4F58H 3HB3C 1QSED 3VXSB 2OZ4L 2B5IC 4EVNA 2WSKA 3TNMB 1HOCB 1HI6A 2WV3A 4HAFA 2Z35A 1ORSA 1T2XA 2JB6A 5C08A 1KCSL 1SJHA 3QIWC 1WFOA 2EYRA 4F9LA 5D6DC 4ELMB 3MCLL 1P69B 5E2UH 4PGEA 1RZJH 3CJJA 1NCWL 4BZ2L 5TGBA 1JPSL 3WIHL 5CD5D 3GMOA 1EFQA 1FVDB 5E2UL 5EA0H 3FQWB 2C3VA 5CILH 3MUHL 3PP3H 4KK9D 2YPLA 4QXTA 2IH3B 3T8XA 2R4SH 2Y23A 5E03A 1MAJA 2MCG1 2MJWA 3MLRL 4PUBL 5J13B 2IPKB 3SQOL 4DGVL 4NSKA 1BBDH 1P53A 3LQAL 4R4BA 3U4EA 1CIDA 3TO2A 4XC1L 1F4YL 3VWJB 2KH2B 1JGDB 3D69A 4Y16C 4WEUD 4XCNA 4DVRL 1WWAX 3ARVA 4LLYA 4Y89A 1FNHA 2MSPA 3HZMB 3HZYA 3NCCB 3GMQB 3D3VA 5IK3A 3B83A 2HLFC 4WHYH 4U1IB 3BXNB 2HH0H 3CUPA 3B6SA 3ZDYE 4PY7A 1MCSA 1KOAA 3BDYL 3TA3C 2Q8BH 1DQQB 4JQIH 5HYJA 3O2DH 3D39A 1QNZL 2PCPB 2P24A 3IKCA 4HHAA 4LHUD 4UQ3B 4DKEH 2IAND 5DUBB 3A67H 4JQIL 1SM3L 5IMKB 2XFXA 3S35H 1O5DT 2ZOLB 3PJSA 5ICXB 2VIRB 4WTZG 1FZKB 2BNRA 2JCCF 3QSKB 5JHDD 5FYLE 2OCFD 3VFPB 2XZQH 1PKQE 2VR9A 2H3NB 3VXRD 1KXVC 2E8ZA 4FA8A 1S9YB 1CE1H 3ET9F 1HCVA 3FQTA 1YPZA 2WQRA 1PX4A 2DLGA 3DARA 5CIPA 5L88L 2PYED 1T2QH 4GW4B 4HF5L 2CLVB 4OZIB 1LHZA 1AXSB 3BRFA 2VOTA 3T65B 3GSNH 5EOTB 4ZSOE 2ESVB 4LEOB 5KN5A 3WXVH 2YA2A 5IKCB 3OAUH 5CD5C 2BMKB 3ARBD 1I8KA 5TE7H 1JZ7A 2Y72A 5C0RH 3HI1A 2DB8A 4DUVA 1G9ML 2AK4D 3GUTB 5TE7L 2MQCA 2ITDA 4A6YH 1VGKA 5E2TL 1DLFL 4QRRA 2VLLA 3GBNH 3BKJL 3HCVA 3LEYH 4MA3A 2ZSWB 3GBNL 4UBDC 1BJ1H 2IAMA 2XG4A 5IBTH 4L3EA 1D7FA 2OR9H 1JPGA 3OJDB 2WWKO 2AJXL 1U36A 2QSQA 4NO3A 5ACZB 3SDAA 2OR9L 3K3QA 2HRPH 4TNWF 2ARJQ 4S1SL 1QUNA 3TIEA 3FMGL 3C5ZD 1NEUA 3GZKA 1NGZB 4L4VD 1IAOA 4ODUA 4NHCH 2ADIA 3BZFA 3PQYA 3CMOL 1U93A 3EOAA 3G5ZB 5EU5B 4I3SH 4GQ9L 4QRQA 3GSNA 1OAKL 3TIDA 1K4DA 5CEXA 4I3SL 1DUZB 1FNGB 2HTKC 4D0CB 5KVMC 1VKXA 4G6KH 1J0IA 2DIBA 2IFGA 4PJXA 5FGCB 3I6KB 1FO0H 4GW5B 1YEEH 1FHGA 1REIA 1F8TL 1FO0L 1J8KA 3NFPA 4WW2B 1MUJA 5F89B 4E42B 5D2NC 5E24E 15C8L 4ZFFA 1YA5A 1INDH 5HHVH 4KMQA 3CFJA 4GMTH 1X6LA 1QA9B 4X8JB 1MAKA 4GMTL 4KI1A 4W4NA 1FVCA 1NMBL 3PV6A 4HLJA 5FUZL 1QLRB 4S1QL 1KENH 3IDNB 2X89D 4RFNC 4FQ2H 1UA6L 3LQAC 4MA1C 5IMLB 2DQIL 2BRRH 4WFFE 1NL0H 2BZDA 1SMOA 4HWEH 4KTEL 5CBAB 4XX1G 3BQUA 5D93B 2BRRL 5BS0E 4QHMA 3TO4A 1P2CB 4PFEA 3LZFH 3IU4H 2F53E 3O4LD 4P5MA 3STLB 5D6CA 1MCNA 3RP1A 4LLMB 4URTB 5I66B 3C5ZC 2IWGA 5I1KH 1NBYA 5F7DB 4PG9B 4O00A 2UZIL 4D9LH 2W0LA 4XNZB 4YBHA 5I1KL 1UB6A 5CJ8A 2CLRA 3NA9H 1P1ZB 1YN7B 4OGXH 4BH7A 1TMCB 3IETB 1WICA 4Y4HD 3HI6L 1FBIH 4WUUE 1BD2B 1WFNA 1Z0NA 4R7DA 4Y5VB 3B9DA 2QSVA 4MA7H 2X4OB 4GUPA 1CICD 1FBIL 3T0AA 2DKSA 1UENA 3FQNA 4MA7L 2FEDD 4YGVB 5IF0A 4I5BB 1AR1D 5EZIH 2WBJA 4R3SB 1PJ9A 5BVPH 5L2JA 4JHWH 4CDGC 1S5IH 3H7BB 3P11H 2DQEL 4NPYA 2R23B 4LSPL 3VG0L 4WI8A 1GZPB 2D0FA 2D7TH 3IU3B 1A7NL 5JQ6L 3D18B 1RZ8B 4PJ8D 2BVYA 2VN4A 2D7TL 4LCUB 1FLRH 2VWEE 3O0RH 1CXEA 4LCYA 1P7HL 4L8CA 2AJZA 3GMPB 4K2UH 1GJIA 1G9MC 1NBZA 4JFEB 3LB6D 3O0RL 5TF1L 1CXKA 1CGTA 3B2VL 5EUKA 4OUUB 1IGCH 2A38A 3MA9H 4DVBB 2E6JA 5DHXB 3SGEH 1IBGL 1E4JA 4D8PB 1IJ9A 1HSAB 4RZCA 4GRLB 1U0QA 3QEGH 4HUKB 3MLZH 2A9NH 5ILTH 4ZNEA 2R0WL 2XWTB 1UJ3A 3FRPG 4JPKL 5EORH 2NY6B 3GMRB 1OQXA 1ZE3C 2A9NL 3UTTB 5A40E 1HQRA 2XTJB 5JIKA 4Y5YB 4XCFH 1BOGB 5F6IC 3RWGB 2W9EH 3CX5J 4AM0A 1KTKE 1MOEA 1I1CA 3S4SB 3VXSA 2B8OT 2VABB 1HOCA 3LMJH 4G8IB 4X6CF 3CDGB 5I17A 3QYCA 4ELMA 4RMVA 5IBUB 1Y6MR 5JA9A 2A1WH 3AS0A 5AZEH 1FVDA 5D71L 1Q72L 3FQWA 3KJ4C 2P42B 2IH3A 1GZQA 5DJAB 5AZEL 1CICC 2Y36H 4KVNH 1JZ2A 3RX5A 5IBLD 1QP1A 2IPKA 1AR1C 3ZKXC 3IFOB 1KB5L 3MOBH 3JWNC 3MV9D 3VWJA 2VXTL 1JGDA 4J6RH 4MVBD 1TJIH 4I18C 4PRDB 2D7OA 3HZMA 1I7RB 3GMQA 3KPRB 2AJUL 4M6NL 4TQEH 4U1IA 5C9JB 3BXNA 1PYWB 2VLJE 3C5JB 4PJCF 3MRNA 1KJMB 4TQEL 1TQBB 2VL4A 3VH8G 1CFVL 3MV8E 2I9LB 2Q87A 3MRJB 4LCWB 1DQQA 5F93C 3O41B 4UOJA 2IJ0C 1ZT7B 2PCPA 3RAJH 3BKCH 3QDME 5FCSH 5DUBA 3QIBB 4M7KH 2R2BA 5IMKA 5GGQL 3DRQB 4WIQA 2ZOLA 5ICXA 2QL1A 2VIRA 4CMHC 1DTUA 2QV2A 1FZKA 3LRGA 2FB4H 3QR2A 3GMMB 4WI4A 3VGGA 3VFPA 1XF5B 5IT2H 2M2DA 2H3NA 1S78D 1S9YA 1I8LC 2FB4L 5J57B 5IT2L 4JHZA 1UH3A 4YH6A 1ZLSH 4FTVB 1LDSA 4IMKC 4K3EH 4GW4A 4RISH 3MACH 4P3CH 2CLVA 4OZIA 1AXSA 4WUKH 2E6QA 2EDXA 3T65A 5EOTA 4LEOA 1H3UA 1F6FB 1B6UA 5IKCA 3NCFB 2C3HA 2BMKA 3VXMB 3LHPL 3EYUH 5IB2B 1IC7L 4U1NB 3GUTA 1A4KB 4OGAC 4WFGD 3N1FC 4B53A 4X7FC 3MJ6A 1NUGA 2DICA 5ID1B 4HUVB 2ZSWA 2YD8A 4OBRA 4TTDD 1I1YB 1DQTA 2R0LH 5SWSB 4OCWH 4O51A 1SJXA 2H6PA 1NC4D 1GGUA 3PF2A 4OCWL 4OCRH 5I1JH 3WE6B 2NX5B 4HS6A 2OI9B 3TBYB 1K3IA 1LEIB 3OZ9H 5ACZA 1IAIM 1YEGH 3DSNA 5HHXH 1MWAH 1EZVX 4GBXD 4EUPG 5FKPB 1FCGA 4LVOB 3RQ3A 1E27B 1BGXL 4JFYB 4JZJB 1J1XH 3U7AA 1NGZA 1T0PB 1R24B 4XXCC 5C92A 1AJ7H 2P46B 4AEEA 3PHQB 3GNML 1NGWB 4YFLF 3G5ZA 1AJ7L 5EU5A 3T0EB 1LO4L 5D7JB 2NTFB 5HYSG 3MO1B 2EDFA 2P4AB 2O5ZL 3MC0A 1MPAH 1DUZA 1FNGA 2NY3B 5H35B 5EOCJ 4D0CA 3RBGA 2Y6SD 2D7QA 2ZUSA 5L0QB 2K3TA 1JNLL 1MPAL 3IGAA 3I6KA 4HJJL 5B22A 5DMYA 5F9JB 1HEZB 3ZYZA 2BDNL 2LE9A 4WW2A 5F1KC 5MERB 2WZPD 5F89A 5DR5L 4E42A 1OWWA 3WHE1 3ULVH 4NCDA 4WWKB 2PO6B 4NT6B 1MRCL 2W0PA 3ULVL 3DXAD 3WDHA 2X10A 3CDCA 5KVFL 4NO0B 3NIFE 2IPTH 1JNNH 1QA9A 5C2UB 4X8JA 4AQ1B 6FABH 2F8XC 1QR4A 5IG7B 3MBXL 1QLRA 6FABL 3IDNA 5F97E 4NKOB 3OQ3B 4HEPG 1BJMA 5IMLA 4NC2B 3AFLA 4FXGB 5F9AC 5E00A 4X6CE 1CGSL 1FQ9C 3MMEB 5HHOD 1P2CA 5LCVH 2Q6WB 5KTEL 3RKDC 2DDQL 4BM7A 1EEZB 1QG3A 3F7PC 4GBXC 4LLMA 5AYQA 5LCVL 5I66A 3IDYC 2ED7A 3ZTNL 4LRIC 5DVNA 4ZO8A 4U7MA 5DC0A 3V6ZB 5F7DA 4TPRL 3V52L 4PG9A 2UVFA 3V4PL 4AQOA 4MQXD 3DSFH 4MB3A 3FN9A 1P1ZA 1YN7A 3BJ91 2HP4A 1NMCC 2F5BH 5IVZB 1ZXQA 3E2HC 5KVDL 4UT6H 3IETA 1VSCA 4H8WH 1BD2A 1I9JL 2APWA 4OF5A 4Y5VA 1MHPH 1CF8H 3H9SD 2HMIC 2X4OA 3MRPB 2Y6SC 4FQIL 2VDPH 1AHWC 4YGVA 3DVNB 4I5BA 2VDPL 3GDBA 4PGBB 4R3SA 4G6MH 4QRPE 4GSDH 1LO2L 4C56B 1X5LA 2EDOA 4G9FB 1Q1JL 2R23A 1GZPA 3IU3A 4FS0A 3U2SB 5JOEA 2HKFH 5J6GB 1DL7H 2E3VA 3D18A 1RZ8A 1OGAE 1G9NL 4OCMC 3VXPB 2HKFL 1DL7L 5B21A 4D9RD 4PTUA 3ULVD 1UM5L 3GMPA 4QGYA 5HDQL 4JFEA 3OKOB 3SOBH 4PJBF 2BY0A 5I76B 4OUUA 1LO3L 4HIEB 5F7LB 4DVBA 5GGRY 4OTXH 3O6FB 4JY5H 3VD4A 4D8PA 5DRWB 1MRDL 4OTXL 4GRLA 3DNKA 4QRTB 3OXRB 4NQTA 7CGTA 3O3DB 2VDRH 2XWTA 2DS4A 2JE8A 2VNCA 2B4CH 5KW9L 3GMRA 4LQFH 2UWEE 3MNVB 3UTTA 3RVUD 3KPNB 5C3TA 1BOGA 5I1CH 4LQFL 1JI1A 2AEQH 3RWGA 3KYMB 5MHSD 4NZTH 2CDEB 2B5IB 2OLDA 3LIZL 3WHE0 5DRNB 1LMKA 4NZTL 5HI3D 3K74B 2JB5H 2VABA 4CN6A 4G8IA 4PRPE 3TLRA 4HMDA 1A6VL 3CDGA 1FIGH 3PGFL 3RIFK 3BGFC 3GKWH 1CFSB 3WFZA 3DYPA 4XP4L 1UCTA 2PKDA 4NOBA 5DJAA 4XPFH 1S7VB 1HWHB 4MXQD 3PHSA 3D5OF 3VU2A 3TJEH 5CCKL 1X5AA 1JYNA 1LE5B 3JVGA 4LFHD 2WBKA 1FC1A 3IFOA 3OPZL 3WHXB 3MNWB 4XPGH 4Y16B 4UV7H 3JWOC 3MUZ1 1U42A 2VL5B 3QWOB 2VZOA 1ADQL 4UV7L 4PRDA 1HCFX 5I74C 3FB7B 5ISZE 5JTWA 5A43C 2LU7A 1UKSA 3KPRA 2OTWB 3QUYB 4Q97A 5C9JA 1PYWA 3DO3A 3C5JA 1KJMA 2C3GA 3TA3B 4U6XB 4GXUM 5IHZB 2BRQA 5E9DE 2I9LA 3B9KB 3MRJA 5H37H 4MAYD 1NMAL 3L1OL 3O41A 4ODSL 3U1SH 3RX7A 3MTRA 3VGAC 1XF3B 4JVWA 1ZT7A 1IM9D 3QIBA 3VCLB 3DRQA 3UTSE 1GL4B 2VDNL 2HVJB 3IB4A 3MRQB 3GMMA 4ONOA 1KG0B 1XF5A 3AVEA 3VA2C 1LP9B 2ZPKL 3RVUC 5HI4D 4DW2H 3WLWD 5LKNA 4QXUH 2YMXL 4FTVA 4JRXD 3OKDB 1OP3K 2PW2A 4JKPH 3MLWL 5IMOB 1VENA 4KK6D 3EYQD 3BP7B 4J1UB 4L8DB 1X5GA 4MCYB 3SE3C 3ALWA 5E99L 3VXMA 5IB2A 3MGAA 4U1NA 1RZFL 1A4KA 1NCTA 4XPTH 3D9AH 4PJ5B 4MXQC 4S10A 1H15B 2FEEI 2Y1VA 4FNLL 3ARZA 1J7VR 5DJ2B 4WY7L 4QRUB 5IVNA 5TPWL 3D9AL 3ZT7A 3HI5H 1A7RH 3MJGX 5ID1A 4HUVA 1DBMH 4OD1H 2P5ED 1W72B 5SWSA 3FO0L 4QT5B 1AFVL 3MXWL 1OP3H 1T03H 3BH8B 3G9VA 2NX5A 3WE6A 1X4ZA 1YEJH 5T3XH 3TBYA 3U0PB 1G9NC 3JZ7A 1LEIA 1T03L 1M05A 4JGUA 3X3GL 5E6ID 4PRAB 5FKPA 1HWGB 4R2GD 1E27A 1ROWA 3QDHA 2YXMA 4JFYA 4JZJA 3GJFB 3HLAB 4MAYC 5E8EB 1R24A 3V6FB 1ES0B 2IALB 3LQZB 2GJ6B 5DFTA 1U8QB 5IWLA 1FZOB 1BEYL 3PHQA 1NGWA 5C09D 2BSTB 4HK3N 1UACH 2ICCA 3T0EA 4KDTC 5JHDB 4AT6B 2NTFA 3MO1A 4QYOA 5CJQH 4MYWB 3ARDA 5H35A 1F3DH 3WLWC 2HTLD 1PQZB 1EBPA 1X5KA 5F9JA 1HEZA 3EYQC 3V4VH 1J11A 4PJBE 4PRBB 5D2NB 3BSZL 5MERA 3CFCL 3V4VL 3EFFB 4HC1H 4WWKA 4QEGA 2PO6A 4I2XB 4YWGL 4NT6A 5C0CE 5TJWK 4HMCA 2AK4B 4PJHB 4GXVL 3HMXH 1RJCA 3TZVB 5SV4A 5I8OL 2GSIB 1IGTB 2E7HA 4DOHE 4RFNB 4XWOD 5IG7A 1A6UL 3QWRA 4MQ7B 2Q20A 5J0BA 5ADOH 3KPSD 4NKOA 1HHGB 3BGMA 4MA8L 1QFUH 1F4AA 32C2B 4FMFA 5BW7C 3OGCB 1A9EB 1CXIA 4FXGA 3QUZD 4U3XA 4GRWB 1C5CH 3CXHJ 5E6ZA 4R97B 4XMKH 3DBXB 3J8F7 4GAGL 2JJVA 3HAEG 4ORZC 3MMEA 1C5CL 1S7UB 2Q6WA 3ZE2F 4KWUA 1BFTA 5E6IC 1EEZA 1MFAL 4H26B 1NQBA 4L4VB 4R2GC 5T3XD 3V6ZA 4E41D 5DUML 4UIMB 5DMJB 1JWUB 5HYQB 4CADA 2CO6B 5DMIL 3GSWB 2W9DH 3O8XC 2CRYA 2DM7A 4MJ2A 3QFJD 3UDWA 5IVZA 3VXTB 2RJMA 4LKCB 3WKMH 5GS1C 4FQCL 2JKXA 1CG9B 1NGPH 4WFHE 3UBXB 2VAAB 4ALAL 3MRPA 2GJZB 1NGPL 2HTLC 3HMXA 4EBQH 2QTEA 3DX6B 3DVNA 3IFLH 1IGJB 4PGBA 5JPNB 4C56A 1LWRA 4G9FA 1JPTH 1T7YA 25C8H 4V2CB 2ENSA 2PXYD 4HBQA 2NZIA 1U91B 1OQOA 5J6GA 4EKXA 25C8L 1AIFB 3IFNL 3RTQD 1YPZF 2VB5A 3VXPA 4HZAA 5D2LF 4OF0A 1O0VA 3O6LH 5HGBB 1MFCH 3I3BA 1XMWA 1ZVYA 3VXUE 1FGNL 3OKOA 3O6LL 3PXJA 4WDIB 2R2EB 5I76A 5AZ2H 3CFEB 5ESQB 2O93L 3B5HA 3WJLC 1I4FB 3O6FA 5AZ2L 2R0ZL 1W8NA 5DRWA 4W6YB 2NCMA 1YYMH 3QUZC 5JQHC 1P6AB 3LS4H 4QRTA 3OXRA 2AVGA 1KPVB 1YYML 3O3DA 4JLRB 1IGFH 5TQ0H 1BREA 4POZD 3MNVA 5GXBB 1YNKL 3KPNA 5TQ0L 1CLOH 1F4XL 5T3ZH 3DV4B 1H3PL 3IXAB 3LPGA 4LSVH 2CDEA 1CLOL 5K59E 1YEKL 1WSST 1HZHL 2Z8RA 5DRNA 3AB0C 3EOBB 3WS6C 5D6DA 5EZJB 3RVWD 2J8UB 4JPVL 1B4JL 3RFZC 4FG6D 3DVGB 4A2LA 2R1XB 1CFSA 3EYOB 2P47B 3KJ4B 1U2CA 2QLVB 3QDJE 3FFDB 4LDEB 4IMLB 1BWMA 1CICB 1AQKH 5C0FB 4KROB 3KAAA 1DQDL 1S7VA 5C07D 1BZ9A 4LLQB 4PJFB 1AQKL 4Y4KD 1PEWA 3ZKXB 5B8CC 1T21B 1CLCA 5FHAH 2QQKH 3GJFK 1OAYH 2EO9A 2FGWL 3LKRB 5GJTL 3WHXA 3ZTJG 3MNWA 5FDWB 4Y16A 5T5FH 3W11D 3FFCE 1HDMB 4I18B 1L0YA 4Y2DB 2VL5A 3CVHB 3QWOA 4NC1C 1NH6A 5ALBH 3FB7A 4KAQH 3MV11 1U8LB 2EH7L 4WI5A 2OTWA 3OKLB 4BELD 1SY6L 1F2XK 1U6AL 2WLYA 5ITFB 3TA3A 4U6XA 1NKRA 2APBA 2HVKB 3T3PF 4WRLA 1W72H 3B9KA 5LG1A 4KMLB 2MNUA 1J87A 4Y2OA 5BRZD 2DQFB 1T5XB 1XF3A 2FJFB 4X7TB 1J8HD 1G7HB 4LAJH 5I2IB 3VCLA 4CMHB 5GZOD 3HMWH 3MRMB 4JQXC 4RSVA 3HC4H 3SJVB 4APQC 3BPNC 3ARRA 2HVJA 4I0KA 3MRQA 4LMQE 4PY8J 2BHZA 2XKSA 3HMWL 1KG0A 4POZC 3HC4L 4K23H 2R8SL 1LP9A 1PY9A 3GJFH 4YIQB 1MY5A 5D7IF 2A73B 4CKVX 3F58L 1QRKA 3ZLQC 1YC7A 4M43L 1M7DB 2CK0H 3OKDA 4NZRH 5BO1H 3HE6C 2DQCL 3ALPA 4HD9A 3A6CH 5IMOA 4LOUD 2RQ8A 2RR3A 2AEPL 2K1MA 3Q6FB 3AREB 4FFWC 2EDLA 4FQQB 3RVWC 3QG7L 4J1UA 4LSTL 2I5YH 4Q74A 3LKOB 4AIZB 3B8YA 2QADD 3KWWB 4MCYA 3SE9L 5F1IB 4LPUA 4HWBA 3HE7B 5KVEH 5CP3H 2FHBA 3O6KH 3MLPA 4OLVL 2YPLE 4JFFD 3T09A 3K0WA 1M4KA 3I9GL 3EOTL 2VXSH 2AK1H 4PJ5A 3QHZH 2M8XA 1H15A 4LPVA 4Y4KC 12E8H 5DJ2A 5CZVL 4QRUA 3UTQB 1JI2A 5L6YH 3MRCB 2OP4H 3SE8L 3PWLB 4TVPL 5DJ0B 3K4ZA 4O5LL 1W72A 4OKVB 4QT5A 4I48B 1I1AB 4NRZB 5FYJU 4TUOB 1QFOA 3BP5B 3EJZC 2W0KA 1IM3B 1VESA 5DQDH 1OM3H 5JMRA 3U0PA 2DL9A 1WV7T 3KPOB 3E3QE 1OM3L 3OXSB 4PRAA 4M7LT 4P23D 3GJFA 3HLAA 3D39E 5E8EA 2XRAH 3WNLA 3V6FA 1ES0A 2IALA 3LQZA 2VQ1B 2GJ6A 1U8QA 2G5BB 1FZOA 5LGJA 5D96C 2BSTA 5HPMB 5GZOC 5JHDA 1QLEL 4M03A 4AT6A 2KZ1B 4MNGB 2I24N 2B20A 4QHUB 3MODL 4FN0A 1JHLL 5DF0A 1RJZB 4I0PD 1PLGL 4LLVB 4QCIB 1YPZE 2YA0A 1ERNA 5E7BA 2V17L 4O4YL 1PQZA 4O2CB 4LOUC 1WF5A 4PRBA 5D2NA 2QADC 1KYOJ 3EFFA 2J4WH 3FN0L 4WFED 2YN5A 3U46B 4I2XA 3LOWA 3T4YB 3VJ6A 4MAUL 2AK4A 4M7JL 4PJHA 4YHLH 2X9XA 3WFEL 2D2OA 3TZVA 2GSIA 3I85A 1ED3B 1IGTA 3WSQH 4EOWL 4QRRE 4KZEH 1HILB 5HDBE 1EH9A 2GITB 3CH8A 1GIGH 3S98A 1A7BA 1I8MB 4KZEL 2GIYA 2DQDL 1YDPB 3G6JB 1KB5B 1HHGA 2IBBA 1M7IB 32C2A 3OGCA 1A9EA 3HUJB 1T3FB 2ERJC 3S7GA 4K3JL 4L3EE 4TVPD 5K9OB 3BE1L 5EZOH 3S3PA 3U0WL 2EXYD 1VA9A 3DBXA 1XF1A 3I2CH 4HT1H 1S7UA 3BMWA 4GBXB 3HR6A 3IDYB 2VLKD 5I8EB 3RWHB 4F7EB 4H26A 4L4VA 1QBAA 3AROA 4HBCH 4YNYB 3KHOA 4UIMA 4MQSB 1JWUA 5HYQA 4P9HL 3GSWA 3T77B 1XF4B 1KIRB 5JHLH 3E2HB 3RDTC 2NW3B 3HFMH 3QWQB 3VXTA 1FDLH 4LKCA 1BOYA 1CG9A 4RA0C 5E56A 1LQSR 4I0PC 3UBXA 3RL2B 2VAAA 1ND0A 4PBXA 4PJXE 2GJZA 3L95B 5LVEA 1X44A 1TQCB 1H8SA 4PJ7F 2YZ8A 3ES6A 3DX6A 1MCLA 5A2JH 1IGJA 4U33A 3T3PE 3JV4B 5JPNA 1MF2H 2ADFH 2EEBA 5LJYH 1BAFL 3F12B 1U91A 4UUJB 3ZL4H 4RAVA 1MF2L 1FYTE 4LCCB 3DXAB 1AIFA 2YPVH 3CFIC 3V7AE 4AEHL 1R5VB 4LASL 2YPVL 3RUGB 5BZWB 5HGBA 3PHOB 5HGDA 4OZIF 4HIXL 3ULUH 4N0RA 5CKAA 4WDIA 2R2EA 4NN6C 3QCVH 3CFEA 1YECL 4HWZB 5ESQA 3CVHH 5KOMC 1I4FA 1QEWB 4K7FB 4Q9QH 2GTWB 1X4YA 1VACB 3SKUD 3D2UB 1WAAA 4FQJH 4YDIH 4ZUWB 3GSXB 2EXYC 1KPVA 4HX1B 3DUUB 4JLRA 5I75C 4Q7DA 1B88A 1RU9L 3WUWG 3KHQA 3IXAA 4XXDB 1KCKA 4XB7A 4K3HA 1UADC 5ENWB 1WJ3A 3EOBA 3G5YB 3MRDB 4X5WB 1EFXB 1NANI 2NXZB 5EZJA 2X41A 3BGFB 2J8UA 5DHYB 2V2XB 5E2WH 3DVGA 4UB0L 3QA3A 5J1AB 2R1XA 3KYOB 3IJHB 3H9SB 3FFDA 1GSMA 4IMLA 4JAMB 5I1GH 1CICA 4W81A 3KYKH 3MNZB 4M5YL 5C0FA 2HT4D 5C0EB 4LLQA 4PJFA 2QHRL 5J12B 4XBPB 1CDGA 1EGJL 4DTGL 4NQED 1T21A 5C0BD 1D9KD 1KULA 5EO0A 3EDJA 3LKRA 3QQ4B 5SX4H 5FDWA 1HXYB 1HDMA 3MRHB 4I18A 4UNVA 1KELL 5ERWB 3CVHA 1KCVL 4M9OA 2VXVH 3WFDL 5IVXB 1U8LA 2EXWD 2VXVL 2VDOH 1ZA3B 5JOPD 2BOBA 3OV6A 5ITFA 3L3DB 2H8PA 2HVKA 4QHNB 4RFOH 4FQXC 4OSUL 3VGAB 4LPYA 3RX8A 5CP7B 2DQFA 2XN9D 3C08H 5CJ5A 1T5XA 4UOW1 4RFOL 4X7TA 3C60D 3OG6B 2B7DT 4DGIH 5I2IA 3C08L 5JXAL 3MRMA 4ZNEE 4NM4H 3SJVA 5EBMB 4J3VA 4NZJA 1OP9A 3GSRB 1I8LA 4F9PC 4KPHL 4OFPA 4B50A 4YIQA 3PWPE 2A73A 2L4OA 4IMKA 3QAZC 1M7DA 4Z95L 2C3XA 3VXSE 5F72S 1PG7H 2O5XH 4HZLB 4PJGB 3Q6FA 4FQQA 2O5XL 4N5UA 4KZDL 3LKOA 4AIZA 3FL7A 3DJ9A 3U0TB 1KCUH 3KWWA 3MUJA 4P9HC 3HE7A 3TFKC 1HNGA 3JSSA 5C0JB 5GGSB 5T33H 5TDNB 3RI5K 5DJXB 1V7NH 2HT4C 1NUDA 1S7XB 3WNPA 1V7NL 2E7CA 1YEFH 3ESUF 3ZDXF 3UTQA 5EIQA 3MRCA 4MJID 1JVKA 1YY8B 3WL9B 4EN3D 3MFFB 3ARFB 3NH7H 1JFQL 3PWLA 4BQ8A 4Z77B 2E9WA 3S5LG 4OKVA 1NGQH 3KXFB 3ULVF 1BZ7B 3NH7L 5I15H 4LLWB 1I1AA 4NRZA 2OM5A 3IDMB 4TUOA 5KS9B 3BP5A 2XZAL 4OCLC 1IM3A 4UILH 2XZCL 4ZO6A 3V5HB 2EXWC 5I15L 3NCEB 4NO2B 3ZHLA 2DI9A 2ZG1A 4LAQH 4QF1B 3KPOA 1CVRA 2W91A 1EHLH 4MAYB 4NFDA 4G3YH 4OF8A 3C8HA 4FMKA 4XXCA 5ANMB 5FOBB 3D0LA 3ZZ1A 1EHLL 1IM9B 2VQ1A 4OLUH 1YEIL 3C60C 2G5BA 5E1HB 3NIGF 2QBWA 2X05A 5HPMA 4OLUL 4BSWB 1SYSB 1RZ7H 4MNGA 4PLKC 4UV4L 4QHUA 1M71B 1GRWA 3EFDH 4M02A 5D72L 2FEEL 1RZ7L 1RJZA 1Z6JT 1CBVL 5EUOF 4LLVA 4QCIA 3EFDL 4X83A 1QHOA 2YD5A 3I84A 2ED8A 5GQBA 5IB1B 4MNHB 4O2CA 5MEOB 1MI5D 3A6BH 4PGCB 2GFBB 4HKXB 4HXAL 4OZIE 4JRWA 5LGHL 5F6HI 1QO3A 4O2EA 2ESVE 2PTTB 4U7KA 4PB9L 5CMAB 3RZCC 1QYGH 4FP8H 1PVHA 1KLGB 4U7SA 4ZPTB 3RJQB 5A2IH 4C57C 2BCKB 3U46A 3SGJC 3T4YA 3V0WL 1QYGL 4FP8L 4F7MB 4X6BB 3ARGC 2GY5A 5I71C 3I6LD 5I18L 3BWAB 1JTPA 4KTDL 4YC2C 3TEUA 1ED3A 4UOW0 2CDGB 5ICZB 2P45B 1JF1B 5DD0L 3Q1SH 1YDPA 1I75A 2E27H 3G6JA 1KB5A 1YY9C 1M7IA 1B0GB 4X4ZA 2E27L 3HUJA 1T3FA 1L0QA 5K9OA 4OF6A 3VD9A 5BJTB 1WFTA 4MJ4A 3LN5B 4YJZL 4C59B 1OHQA 5BV7L 5HXMA 4GBXA 4IRJD 5LXGH 3NIDF 5I8EA 4CDHA 1LO0H 1QBBA 3RWHA 4F7EA 2Y07H 4LRIA 4N0YL 1T22B 3WIFB 4YNYA 2AQ2A 5HHMD 4YQXL 1N4XL 3O8XB 4OZGF 1RI8A 1XCTB 4C54A 4F15C 4ODVH 1J12A 4WEMB 3T77A 3FT3B 1XF4A 1KIRA 2NW3A 5GS1B 2EE9A 5I1HH 3VFRA 3WIIL 3WO4C 4MZ3A 3RL2A 3SY0B 1ZS8B 1EVUA 5FGCE 3L95A 5FGRA 4QO1A 1F02I 1A4JB 1IQDB 2LAAA 4OLZH 4YHKH 2UZXB 3UJIH 2FSEB 1QRND 1BQHG 4U6VH 3ZKND 4YHKL 1H8OA 3JV4A 4QXGL 3UJIL 1Z9SA 4CW1A 1RMFH 3P3YA 4K3GA 2ZUQC 3F12A 4GKZB 1VB9A 4UUJA 2FH8A 4NQCD 4GT7A 1C5BH 3DXAA 1QFHA 3N85H 4MSWA 1IGYB 5EZLB 5BXFB 1YJDH 3H42H 1C5BL 1R5VA 3RUGA 5BZWA 1RZIB 4X4XB 4YXLH 3JV6A 4YO0A 3WEXB 2BFVL 2D9QB 2IFFH 4YXLL 5TE4L 1CLYL 4HWZA 4XTRD 1QEWA 4K7FA 1EA9C 2B1HH 2XTLA 2GTWA 1ZAGA 1QSFB 1VACA 2NQCA 3D2UA 4Q6YA 4ZUWA 4P2OD 5FO7B 3WJJC 3GSXA 4Z78B 4HX1A 4RAHA 5EFIB 4GAJH 4HWUA 4P3DA 3RVTD 1FZJA 3FOLB 1ZANL 4Z7VF 1MFBL 7FABH 4RGND 1PW3A 3RIFF 4XXDA 3MCKB 5F9OH 3AB0B 1JK8B 5E2VH 1F00I 5ENWA 5FM4A 3G5YA 3MRDA 4J12A 1EFXA 4X5WA 1X5YA 5E2VL 2DBLH 3PP4H 4K7PY 3TPKA 3MV7D 5BOZG 3BEWB 5DHYA 4CVUA 4WV1B 1U3HB 5EULV 1TNMA 5J1AA 3MRIB 1DQMH 1PEZA 3FQXB 2CPCA 3KYOA 4L3AA 5F7HA 3IJHA 1BD2E 5DVMA 3H9SA 4JAMA 2V9QA 1AO7B 3HPLB 3MNZA 3TYFA 43CAA 5JIPA 4AMKH 5C0EA 3BOVA 3QXWA 4OFYD 5J11C 3T2NH 2X4TB 1FGVL 3TPUB 3LKQB 4U1KB 2UUDK 4LGRB 1I7UB 3L7EB 3ZKNC 4G8GD 1KF9B 2LFGA 3QQ4A 1QKZH 3EO1B 2IMMA 5JW5B 5HVHC 1FE8L 1HXYA 1MREH 3MRHA 4PB0L 1G7JB 4XCCH 4HKZB 3NIGE 1MREL 2VZ1A 4P9MH 4ZUUB 5IVXA 4XCCL 3H9HB 3HNSL 4Y19D 4F8TA 2V7NB 2PTVA 3GSVB 5CUSH 5HPOA 2AV1B 4J3SA 4JFEE 2VUYA 1ZA3A 1L9NA 3TCLA 4QHNA 1GC1H 3VXNB 2PETA 5CP7A 4NP4L 3BPOC 3JWDH 5MEPA 4APQB 4LLAA 2DQHH 5A2FA 2UUDH 3GSRA 3DTXB 2XTJE 1FPTL 5BV7C 1H3XA 1NUNB 4V1DB 4RGNC 1H8NA 3HE6B 5BQ7B 4YHOH 3ZT6A 1A22B 5KSBF 3M1BB 4FFZL 3E6FB 1NCDL 2BNQB 1KUMA 5IV2B 4HZLA 4PJGA 4XNXH 4M6MH 5FYLH 5GGVY 3VD5A 3TBWB 3SE3A 3KPPB 4I1NB 3U0TA 4M6ML 5FYLL 1UWEH 2CGRL 5J8OA 5C0JA 1R3IH 5GGSA 3R4DA 3NTCH 2F58L 3BVNB 5DJXA 5TDNA 1FC2D 4JRYE 1S7XA 3IT8D 3ZE1E 5K9QG 5B4MD 3NTCL 2X4RB 4Z7UB 3L7FB 5C0ND 4WO4B 4OZFB 1YY8A 3WL9A 3ARFA 3WXWL 1BF8A 3RWJB 4Z77A 1C08B 4Z7WB 4GXUN 5E5RB 3KXFA 2D7NA 1BZ7A 5CINH 4KY1H 4LLWA 3IDMA 5KS9A 2FX9L 3KPRE 4LPXA 5DMKB 3V5HA 3AMKA 4Q9CA 1YN6B 4NO2A 4RWYL 3WNNA 1JTTA 4HCRH 4WENB 3UTPE 4QF1A 1PX3A 1OCWH 1H3GA 1O7VA 1U3JA 1JF5A 3BIBX 4HCRL 4MAYA 4BH8A 5JR1L 4QNPF 5BRZB 4LCWE 4NUGL 4NIKB 1AGFB 1OCWL 5ANMA 3BUYB 5FOBA 4NWTL 4XP6L 4GG6F 1IM9A 5IGXL 5D96B 2AERT 5HGAB 4EQ2A 4OGYH 3V6BR 5T1KD 1WTGT 4KDTA 5CJXA 4OGYL 4BSWA 1SYSA 2R15A 2R39A 1M71A 2O5YL 2ICEB 5IHBA 1PDKA 5F96H 5D1QD 4JRXA 1DSFH 2ARWA 4DCQB 3L5JA 3O2WH 5E4IA 5IB1A 4MNHA 2GHWB 3M8OH 5MEOA 2JJWA 4PGCA 1UM4H 2GFBA 4NBYB 1ACZA 2XWBB 4UTAL 2WLZA 1TETL 2QADB 2PTTA 5TDPB 5CMAA 2W07A 3P9MB 1KLGA 4X4YB 3VXME 1EJOH 2BCKA 3T0BA 4HGWB 2EC8A 5D7SH 5FYLD 4OD2B 3TN0B 4ONGL 4QGTA 2AQ3A 3BWAA 3U36B 5B4MC 2BVPB 2J6EL 4RIRB 3TJHD 2CDGA 5ICZA 5C0NC 1JF1A 4Z7VE 3AMLA 1UZ6E 4KDWA 4R96B 4X80L 3MJ8B 5DGQA 1I3UA 3R0MA 4KI5C 3QCUL 2H1PH 1J0ZA 4PIRF 5BJTA 1ADQA 2DLFH 4G7YL 2NX5E 5CD3B 4LSQL 3IJSB 3LN5A 4MHHG 4OQTL 2CKBB 3CAFA 2H1PL 3MPCA 2D4FA 5E6IA 1E4XI 5D70L 5CWSB 4F37K 3DMMB 1T22A 1MJ8H 3K4DA 1DZBA 3WIFA 1OLZA 1FNLA 3O8XA 4X6FB 3DYMA 1UM6H 1XCTA 3T0EE 4F57L 3RDTB 1TZGH 3FT3A 4WHYG 5GS1A 1JBJA 3UPCA 3U6RB 1TZGL 2DD8H 5KZCB 4I0PB 4ZD3H 3SY0A 1ZS8A 5D1QC 4ZD3L 3SGDI 4M6AA 1IQDA 1MCPL 2VAJA 2HT3C 4LRNH 3I02B 1DFBH 2JJTA 4LRNL 4Q58C 3GRWA 2YUXA 3NFNB 4GKZA 3TH3T 3BEVB 3DYOA 2IGFL 2YK1L 3K8MA 1IGYA 4P2QB 5EZLA 2VTFA 2ZJSH 4W68A 1G6RL 1KCRH 1RZIA 3ILQD 3ARUA 4X4XA 3EAKA 4WTXA 1KCRL 3WEXA 5HGHB 3WJLA 2GT9B 3MOAH 1NFDF 4YDKH 4G43B 3NA4A 5GISL 3MOAL 2CUMA 3BPLC 4Z78A 5I75B 4CVXB 4LARH 2MMXA 1CFNB 5GS0H 43C9B 3B5TA 3UTOA 3FOLA 1YYLL 3TT1L 5GS0L 2EIDA 1DLHB 3REWA 5ESVB 5DRZB 3B4NA 3MCKA 3X13B 1J0YA 4G7VH 1JK8A 3BAEH 3V7AG 3QHFL 3QI9D 3WS6A 4X4ME 2R4RH 3BAEL 3EYVB 3BEWA 5GSRA 4WFFD 3WKNA 4P57B 1GAFH 3LRSB 2XPGB 3MRIA 2R4RL 3FQXA 4NN7C 4IJ3B 5BS0D 4NQXB 5IB4B 4M6OL 1AO7A 3HPLA 4WHDA 2F53D 4HKBA 4M5ZL 3OJVC 5IB3B 2DJ4A 2X4TA 4M1GH 3TPUA 3LKQA 4U1KA 1IFHL 4G6FD 3DVFA 1I7UA 3L7EA 4RBPK 4C56E 1NAMB 1FLTX 4G9FE 3FO9A 4QNPE 3EO1A 5B3JF 4X7DC 4X7SL 1G7JA 4B7IA 4HKZA 5K9QI 2EDYA 4DFIA 1CQKA 3RNKB 4ZUUA 4P2YA 3OKMB 1UJTA 3H9HA 1J5OL 4WUUD 2X09A 4LMQI 4DK3A 2DLEA 3GSVA 3ILQC 2AV1A 1N26A 1NANH 1J86A 4FQXB 2OL3B 1AI1H 5IHLB 1OF2B 2O61B 5AG9A 3VXNA 1Q9LB 3L3HB 4PJHF 2DMCA 3X12B 3ORJA 4S1RH 5F3HA 3IAGC 4APQA 4G9DB 4YDLB 4LF3B 3V0VB 1T89C 1JN6B 3C6SB 1LD9B 3DTXA 5F70A 4RBPH 4GLRI 2KPNA 4EI5B 1U8OB 4V1DA 1ZMYA 3QJHB 1BQSA 3F6IA 3HE6A 5BQ7A 4CBPA 5I73B 3M1BA 4UT7H 5GS0D 3E6FA 3DROB 2BNQA 4HUNB 1KACB 1YQ2A 4UT7L 3TBWA 5EIVA 2DI8A 4LSSH 5FM5M 1FRGH 3VFTB 3TV3H 4F7CB 4NQDB 3VFOB 2I60L 4LSSL 3BVNA 1EAJA 4OCNC 2AV7B 1N7MH 3IYLW 1TDQA 1GGCH 5E08H 2X4RA 4OI7A 3F7VB 4Z7UA 5GRZA 3L7FA 4JDTL 1B2WH 1QFWH 5DUPH 1N59B 3RNQB 4OZFA 2LAGB 2D7PA 3NVQA 3EOYG 3RWJA 1T7XA 4Z7WA 1C08A 2MHAB 4KXZI 3MBED 4JO1H 1OL0A 4JJ5B 2VUOA 5EWIH 4Q9RL 5B3NA 4HH9A 5EWIL 5DMKA 3RY4A 4D3CL 2DIJA 3QRGH 1YN6A 1DQLH 4O58L 3MLUL 4PGDB 2CIKB 3WFCH 5IEHB 4MGXA 2XN9B 2ZCKL 5BRZA 2W9LA 4MB5A 3BUYA 1KN2H 5T3ZE 3C60B 3SCMB 4NZUL 4MHHI 5HGAA 3VI3F 5IESH 3U7WL 1P7QD 4BFIB 2YD7A 5E5UB 1D5IH 2ICEA 5I30H 3SKNB 2BJMH 2VWEC 4A2MA 2VLJD 1KSRA 1D5IL 5I30L 4BQBA 3MV8D 4DCQA 5I6XC 4ENED 5FEBA 3R1GH 1INQB 4YBLC 2EDBA 1TJHL 2XWBA 3RZCB 5F7EL 3QDMD 3W9EB 5TDPA 3Q48A 4X4YA 5F1SA 3VFGL 1NFDE 4HGWA 4XRCB 5F7KC 3ARGB 3P2TA 5I71B 3C5SB 3D87B 4OD2A 3TN0A 3S9DB 2HJKB 4YC2B 4JN2B 4PJ5E 4RNRB 3U36A 2BVPA 4MJIB 4RIRA 3OHXB 3QEUB 2ED9A 4R96A 1G9EA 1TXKA 4RDQF 4GAFB 3MBEC 3QEQB 4M7LH 3HC3H 1F90H 1RUML 4M7ZC 3ISWA 1X5HA 5CD3A 1MY7A 4M7LL 3IJSA 3HC3L 2ZUUA 2CKBA 1CFBA 3WV0A 8CGTA 1IE5A 2FWOB 1JYVA 1OTUD 1T6VN 1I85C 4N90E 5DURD 1SY6A 4HXBL 4WTZA 3CX5K 3QXVA 4H88H 1JZ4A 1E4WL 4XVTL 1VDGA 1IKNC 5CWSA 3DMMA 4PLOB 4UINH 2GJ6E 1IZJA 4F15B 3S88H 3ZMRA 1CXHA 4X6FA 4UINL 3EKCA 2GSGB 5E8OB 5TQ2H 3RDTA 3S88L 1FAIH 3QG6B 3W81A 3SO5A 1XCQB 3U6RA 5B3JE 2MFNA 3S35X 5F71A 4I0PA 4IIQC 4PJEF 1WVZA 4LSRL 4ENEC 1MI5B 4NJ9L 1DVFD 3OF6D 1IAKB 1I3GL 4OIIH 5EBGA 5FA4B 1CVSC 3I02A 1HIML 3VGFA 2ZUQB 1XR8B 3BN9D 2EKSB 4ZFOL 5M95B 2ATKB 3NFNA 4I2XE 3BEVA 4PJHE 2DQTL 2EKJA 4PJIB 5ETUB 4P2QA 3ZYIA 2GTZB 4BK4A 1YEHH 1HH9B 3RY5A 2UV3A 5DDHB 1K2DB 2DI7A 3EYFB 5HGHA 3UP1A 1Z9OA 2EYSB 1IARB 1VERA 2GT9A 2DOCA 3S97C 2ORBH 4G43A 1MH5B 4EUPB 4GRWE 2J1KA 2ORBL 4XPHH 1RFDH 4MS8C 5IW1B 4WHTA 2VISB 2AEWA 5F1OB 3MXVH 4CVXA 1DR9A 1CFNA 43C9A 1OTUC 1A2YB 5KVGH 2A77L 5HYSB 1MRFL 4K07A 2N7AA 1DLHA 5ESVA 5DRZA 5KVGL 2AKRB 1P4LB 1MCQA 3N1QC 1C7TA 5D9SB 3X13A 1T1YB 5GHWH 1EMTH 3EO9H 3GI8L 1IL1B 5HI5D 3RJDA 5GHWL 3EYVA 2XICA 4Z0XB 3EO9L 4P57A 3LRSA 3T0XA 2XPGA 4P2CG 1MAML 3GBMH 4JCLA 2OTPA 4NQXA 5IB4A 2WAHA 4XHJD 3T2QA 5J11B 3BD5A 3CZFB 2QSCL 3ARSA 1DVFC 4N0CD 1PZ5B 2FD6L 5IB3A 4K9EH 4BSJA 4PGJA 4XP9H 5DJ6B 5JPMB 5EN2A 3SDDD 3BT2H 3EJYC 1NAMA 4HPOL 2EH8H 4K9EL 3QUMH 5HYFA 3GI9H 3NGBC 4Z7OE 1L0XA 1QPPA 3O3BB 3RNKA 4GS7C 1FAKT 5E5MB 3OKMA 2IADB 1OOAA 1Z9LA 3MJ9A 4WCYH 3V8CA 3LS5H 2VDKH 2X40A 1MCRA 4FQXA 2OL3A 4N0UA 1EIBA 2KQNA 4WCYL 1OF2A 5DMGC 2O61A 3BPOB 1U41A 1Q9LA 4G8FB 3L3HA 4QRPD 2RIKA 4Z0BH 3X12A 3UMTA 1F11B 1JZ3A 4JFDB 2R2CA 4Q6IB 3UAJC 1ZTXH 3A6OA 4JR9H 2WUCH 4G9DA 4LF3A 3V0VA 3AGVA 1OGAD 1N3NA 4F9PA 1JN6A 3C6SA 4JKKA 1LD9A 1LK2B 2WUCL 5FB8B 4YHIB 4BSVB 4EI5A 1U8OA 3G6JF 3QJHA 5MP6L 2Z31D 4E9LA 1JPFB 2Q76B 2BXYA 4U6HB 3IVKA 3DROA 1KIQB 1LVEA 3MV7B 3RI5F 5HI5C 2J8UE 2NY4D 1DBJH 4AENB 5DQ9B 4YLQT 1KJVB 1BFSA 1QACA 3NCYS 1N6QH 3SGEI 3VFTA 2VR5A 1ZHLB 4F7CA 4NQDA 4UAOC 3VFOA 2EDWA 2GKIA 3BYTA 1N6QL 2AABH 3K2UL 4ODTH 4XHJC 2AV7A 1UT9A 3F7VA 3GB7B 4G8GB 1AP2B 3ULUE 3SDDC 1N59A 5C2BH 2LTQC 3RNQA 1VHPA 2EEAA 5EOCH 4PRPD 1CR9L 2MHAA 4XHQA 2Y25A 1RIVH 4R90H 2ICWJ 4LFHG 1KEML 3S4SG 4C4KO 5I8KH 2ZUYA 2YEZB 4XAKE 1R3KB 1CLZH 5DD5L 4ZTPH 4PGDA 5FK9B 1RZGB 4N68A 1RURL 5K9KB 2CIKA 5IEHA 3TCXA 3FRPA 4O9HH 2XN9A 5E1AB 4ZTPL 3WS3B 1C5DB 5FYJH 3C60A 3IDXH 2OQJB 3SCMA 2VLME 2BOCB 3UJTL 4QHKI 1MQKH 2NY0D 4D0DB 2CR3A 4ETQB 3S36H 3QXAB 1MJ7H 2HJLB 1G7PB 3SJVE 1H0DB 1WBZB 1QHPA 4BFIA 5DFWH 3KLHD 3QZWG 3S36L 5ISZD 1MJ7L 5A16B 3P0VH 3S34L 3SKNA 1B9ZA 2AS5M 5HHNB 3N06B 3LEVH 5E9DD 3G04B 1INQA 4I4WB 4ZXBD 3MR9B 2EYRB 3Q0HA 2NY4C 3RZCA 4P5TC 3W9EA 3FT2B 3PL6C 4NQUA 2Z9TA 4NN5C 3WFBH 5DK2B 3UTSD 4ZPVA 2PUQT 3QNYB 3ARGA 1UH2A 3C5SA 4IEFB 1UVQB 2HJKA 5DS8B 4JN2A 1I7TA 5E6YA 1OAZL 3CLEH 4RNRA 4Z8FH 2EDNA 4RMQA 2G2RB 4MJIA 1F3JA 3OHXA 3CLEL 3QEUA 1BJ8A 4IM8A 1EGJA 1FH5H 2YZ1A 2OK0L 1AD0B 4XCNB 1KJ2B 4MCZA 2WWKT 1FH5L 5I1IH 4O02H 4DKAA 4OZHF 1LO5B 3D3VB 1OB1B 4O02L 5C0IB 4PY7B 1KEGH 1XR9B 3T2OA 3VFNB 1HKFA 2XY1A 4PTTB 2P24B 3IKCB 2JIXB 3I3EA 1PD6A 1UEYA 4ZOEA 1KBGL 5T1KB 3TGXA 1N6VA 2NY0C 3GFUA 1DBKL 1VFOA 2GSGA 5E8OA 3NAAH 3V4UL 3QG6A 2BNRB 1NLDH 3HS0B 4MNGE 3VW3L 3KLHC 2C4XA 5AD0B 1JCKA 4XBEH 3G6AB 1CU4H 3QQ3B 4HFUH 5H37G 3FQTB 2D03L 4JM4H 3ZE0F 4XVUD 3FQUB 4XBEL 4S1DC 1CU4L 1R0AH 4XVJH 3T1WA 1MI5A 2LU4A 4I77H 1IAKA 4ZXBC 5FA4A 3ULSB 4IRZL 3DIFA 1N0XL 1GGTA 1CYGA 1XR8A 1HQ4B 5IROC 1PSKH 4Y1AB 1P5VA 2EKSA 4DAGH 2DBJA 3KR3H 2ATKA 2YD4A 4QXWA 1E4XL 5KSAB 5GJSH 4PJIA 1OSZA 1RIUH 1JMZA 5ETUA 2ZUWA 5FGBC 3RVVD 3MJ7B 2GTZA 4XVSL 3FN3A 1HH9A 4N9GB 5DDHA 2JK5B 3P30H 4JY4B 4ZOAA 1K2DA 4KMTL 2P48B 3FOMB 4JFQB 1RUAL 3EYFA 4Y7MA 2EYSA 2YSSB 4OB5L 1NCBH 3G6JE 3OTTA 2QJDA 4X9BA 1RULH 2ICES 2V9RA 4M1CD 5F7NC 1ZK9A 2IAMB 1S9KC 1NAKL 1MH5A 3HUJE 5D8JL 1NCBL 4EUPA 5L8LB 3MX0A 5D7KE 3WJJA 1V05A 5IW1A 5C0CD 2P7TB 4NO3B 2VISA 4NRYB 1EO8H 1C1EH 4R8WH 3NACH 1Z9MA 5CLWA 1A2YA 2YUWA 3GGWB 4R8WL 5HYSA 2X1OA 1WZKA 3SHSA 2KQMA 2CH8A 1IAOB 5CEYB 2AKRA 1P4LA 5D9SA 4JEGB 2ADIB 1EEQA 2XXCB 4DN4L 3UZQA 1U93B 1T1YA 2NLJB 5EU3A 2RCSH 2MWCA 2WMPA 1IL1A 2QSTA 1GVIA 4L4TB 2ZKHH 4Z0XA 4NN7B 3V2AR 3TIDB 2ZKHL 4AL8L 3LEXA 1VKXB 3Q6GH 1KFAL 2A6KB 2XA8H 4XVUC 1NFIB 3CZFA 3Q6GL 4JDZB 4U4BA 2JJSC 4LCIH 2XA8L 1PZ5A 2ILLA 3VWKD 3DX8B 5DJ6A 4GFTB 5JPMA 1QBML 3W0WB 1DN0B 5JXED 2DYPB 3D85D 1SYVB 2NYYD 1Q0XL 2XOTA 1BF2A 9CGTA 4HLZH 3O3BA 1UWGL 3N1GC 4LLUB 1D6VL 3RVVC 2IADA 3MYJB 4P4RA 3RUGE 2VLRB 4WFHD 4WI3A 1CDHA 4JM2B 4LIQE 3H3PH 2PN5A 3PV6B 4XP5H 2OR8A 4TUKL 2NY2C 2P49B 4ETYA 4EDWH 1PAMA 3HAEB 5I19H 3PV7A 2FX7H 3FONB 1DBAH 1NLBH 4M1CC 4PJDB 1VFUA 4U31A 3DV6B 2H2SC 2X4SB 4PG2C 1DBAL 4UIKL 1F11A 3BQUB 4Q6IA 5LBSH 2QQLH 4KRPB 4QHMB 1II4E 2X1PA 5GGSY 1BBJA 4DKDC 3HNVL 5EPMB 2QQLL 5CGYC 4CVZB 5D1ZD 2FLRT 1LK2A 1YC8A 5FB8A 4YHIA 4BSVA 1ZLVH 4R4NC 1UEMA 1TFHA 2V2TB 4Y8AA 5FYKE 3TH2T 5EIIB 3VXUD 1JPFA 2Q76A 3AS3A 3HKFA 4U6HA 1N5AB 1XGQB 4MXVE 1KIQA 3ZYJA 3MV7A 4UT9L 1P4BL 1UXSB 4WNQB 5D7LB 5INDA 1GOGA 1DQJB 4AENA 5DQ9A 5LQBH 1AR2A 3PUCA 1YEDB 4MJ6B 1TZHB 1E4KC 1KJVA 3ESVF 1ZHLA 2AQ1A 2F53B 2AJ3B 2R69H 4ODHH 4OFYA 1MCWW 4TULL 5IJKC 1Z3GH 4ZYKA 2AJYL 4G6FB 1WBXB 1JGEB 1WEJH 3VWKC 3LKSB 3GB7A 4G8GA 3SEPA 1AP2A 4NPYB 1TJGL 4LNRB 1WEJL 2QHLA 3CFKB 1FNSH 2CR6A 4LSUH 1XH3B 3MSPA 4GLRH 1G1CA 5SX5K 3H0TB 2GAZB 1A3RH 3CXHK 5IVXE 1JGVH 3QDJD 4OIAA 2YEZA 1E6JL 3FCTB 3FQRB 4MNQB 3LDBC 1G6RB 5FK9A 3C8KB 1RZGA 3UO1L 5K9KA 1YQVL 3WS3A 1C5DA 4FZ8L 4P46D 2BY2A 5CZXD 2OQJA 2BOCA 1A7PH 4D0DA 4KHXL 3FFCD 4ETQA 1IC5L 4MMZC 3D0VB 4NWUH 3QXAA 2HJLA 4YEFA 1H0DA 1WBZA 3QIUD 5L2KB 5D1ZC 2OJZH 2R56H 5A16A 3L5XH 2JCCB 2DTMH 2PTUA 3OKYA 1BMGA 4Y5XC 4L5FL 3OKKB 5C0AB 3QUXD 4MXWH 5HHNA 3QULA 2OJZL 5I6XB 4UI2A 4KXZH 5SX5H 1XIWD 1UCBL 3RGVB 3G04A 1XAUA 1KN4H 4JO4L 4F58L 1CDYA 4I4WA 3MR9A 2LU3A 5T1LD 1EO7A 5I17B 1MLCB 1NEZG 4S11A 1UH4A 3FT2A 3QEHB 2AGJH 3THMH 1RZJL 1S9XB 5DK2A 5CIPH 1GGBH 3THML 2AGJL 3QNYA 1GZQB 5EA0L 2VXQH 1A6ZB 1UVQA 5CILL 5DS8A 5C7XH 5CBEB 2CD0A 4ZQKB 2R4SL 2WK2A 3OL2A 2VXQL 2CMRH 4PJAB 1GGIH 3TVMD 2G2RA 5C7XL 3JV5A 1BBDL 2JELH 5KG9B 1AD0A 3ZSSA 3KDMB 1KJ2A 3KXFE 2X9WA 2YWZA 1URLA 2JELL 5JW3H 4M7ZB 3O3UN 2NY5H 5KS9E 2BSRB 4F37F 1LO5A 5JDJA 1OB1A 5C0IA 3V5DB 3MRNB 1JPST 2YPLD 4GAYB 5J1SC 1TCMA 1F6LL 1XR9A 2AEIT 1DANU 2HH0L 3VFNA 4ELKB 5A3ID 1NSNH 2XQYK 5GGTA 3OWEA 4N9OB 2V7HB 4PTTA 5ANME 1HHHB 3QXTA 4P46C 2JIXA 2Q8BL 5CZXC 4CMMB 1A7OH 2D0HA 2R2BB 1Q8MA 3BX7C 5T1KA 3F7YB 4KFZC 3O2DL 3SDCD 1RHHB 4DKEL 3A67L 2FIKB 2W0FB 5D5MB 3MCG1 3ROLB 3HS0A 3S35L 1F3RB 1CS6A 3S37H 2FR4A 3WCYA 1CK0H 1MCFA 5AD0A 2G9HB 2XZQL 3C8DA 3G6AA 5D1QA 3QQ3A 3QUXC 4BQCA 2FHCA 1CE1L 2Y7QB 3NCJH 4AZ8A 3NPZB 3FQUA 2Y06H 1XIWC 5T1DH 1LNUB 3ULSA 1L7IH 3D39D 1T2QL 4OM0H 1WT5C 5K33A 4XMPH 1J1OH 3ZDZF 4J3TA 1T0NB 1HQ4A 3GSNL 4Y1AA 4OM0L 5SWZB 3WXVL 5C6PB 3OAUL 2AJVH 4KK9C 1PKQA 5KSAA 2FJHB 5C0RL 3MJ7A 4CU6A 1G7IB 2A6DB 4N9GA 2JK5A 2YS4A 4A6YL 4JY4A 3FOMA 1T1WA 4JFQA 4N8PA 5DK0B 4ZOCA 2YSSA 2X5PA 3UX9B 4O51B 2H6PB 3K4AA 3LEYL 1MSPA 4ZSOA 3O11B 4X8XA 3L5HA 3MLTB 4OLYH 5JMOC 1J88A 4HS6B 3MLYH 5IBTL 1W2KT 2P7TA 2IG2H 2HFGH 4KJQD 4NRYA 2L7JA 4H0HB 1ONQB 2QQQA