2DAVA

Solution structure of the first ig-like domain of myosin-binding protein c, slow-type
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
126
structure length
126
Chain Sequence
GSSGSSGILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-binding protein C, slow-type
publication title Solution structure of the first ig-like domain of Myosin-binding protein C, slow-type
rcsb
source organism Homo sapiens
molecule tags Structural protein, contractile protein
total genus 16
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2davA01
1FE8L 2VLRB 4HGMA 4IDLA 4K71C 2AJXH 3WFDH 3DIFA 3C5JA 1KJMB 3LKPA 3L3IB 4N5ED 1RZ8B 1VFAB 3LHPH 4ENEC 4M6OL 3S34L 5BO1L 5DJZA 1ZTXH 3MNZA 3HC3L 3VFUA 3CSYA 3BXNB 4WTZA 4JQXC 5D70H 4AT6B 4KJYB 3SE4C 5BZWA 2P5ED 2DTMH 4RMQA 4NPYB 2ORBL 2IPKA 4CADA 3KXFB 4V1DE 5CILH 5MERB 3PL6A 1EHNA 4RBPK 4RMTA 4PRBB 2DKUA 5HHOA 3SHSA 4MA3A 1A1MA 1WEJH 5J12C 5F7UA 4JLRB 1P4IH 5SWZD 1FRGL 3VRIA 4JKPH 3FL7A 3K8MA 5F1KC 1ZAGA 4L3EE 1NEZB 3U83A 5I74C 1LEGA 3VWJB 3ZDYF 1N4XL 3VXRD 3VXUD 4WHYG 5DS8A 1JJUA 3VXSB 1F6FB 4JFOB 3GSVA 4LHUG 1IC1A 1F4WL 4JPWL 4PJAB 1WFOA 4CL7A 4FABH 1A14H 2YWYA 1OAQL 4HCRL 1FZOB 1QBBA 4ZTOH 4U1SA 4G9FD 5KBNC 1E4KC 5HHQB 2X1OA 4AEHH 1KT2A 5EU3B 4OGAD 3PABA 1KCUL 3PP4L 3OGCA 3L1OH 4U6VL 1M05A 2UZIL 2OXHA 1KCVH 1AD0B 2BXYA 1CD1B 4O2CA 2C7UA 4L1HA 5EA0H 1T21B 4Y4FC 5GGVY 1H5BB 4P23D 4M00A 5A40E 4K3JH 1EFXB 4NO5A 2JKXA 2XZQH 4RGMC 4WFGE 4PJFB 2WWMD 4HKZB 4HLJA 4RAHA 2K9UA 4U6TA 3AS2A 5CD5D 4O51A 3B6SB 1ZXQA 2Z8WC 2X1PA 5H8DA 2VTFA 2EDKA 1MIMH 3OJ2C 1AIFB 4X6EB 1YQVL 3RVUD 1XF2A 4C4KT 4HXBL 4OLWL 1NGZB 1DQQA 1CQKA 1S78D 4YFLI 4HEPG 3QUKB 3QA3B 4XCNB 2N4IA 4IIQB 4PJIF 3VJ6A 5J1AA 3WIIH 2HFGH 2H45A 3ARGD 1BAFL 1YPZB 3O2WH 1RPQA 1W0WB 4Y5XC 1BX2B 5DWUL 4GRLC 3BHBA 4ZFGH 2F53E 5BV7B 2CXGA 2KH2B 5L88H 1K4DA 1L7TL 1VGKA 2I07B 3AREA 3D0VA 3D85D 3QDAA 4HKXB 4N0RA 3QG6B 1WIPA 4KGJA 1ORQB 4R8WL 2X42A 3K46A 4YO0B 4OF7A 5DUMH 4ZS7L 1G1YA 2VZSA 5EFIB 5EOCJ 4I8DA 3FQXA 3HNVH 4M3KB 1EXUA 2FEEI 5L2JB 1U91A 5D5MA 2KBGA 3X11A 1CFQA 4JKWA 1BVLA 2I27N 4WUUB 4KI5D 1MHCB 1GOFA 1S9YB 1MCOH 3X12A 3N85L 3QEQA 5DMGC 4R7DB 5DJCB 3RPIA 1K2DA 2A6DA 5D2LF 4KI5F 4KJWC 2CDFB 3B5HA 3HNSL 4JFEE 4OZHB 1S7RB 5FKAB 4J6RH 4Y2DC 4OFKA 2Z31B 1R3HA 1U8LB 2X2YA 1T5XA 1BD2E 3M17B 3I6GA 1S7QA 2GY5A 3PP3H 5GGTL 5GRVL 2V5MA 4BSWA 2HT3C 3IFNH 4UIMB 4NO0A 2I26N 2FDBP 3C5ZC 3O4LD 4P4RB 3GI8L 1ZLWH 4AENA 1A6UL 2ED9A 3VXTB 1WBXB 5IW3A 4M6NH 2UVEA 3U46A 3U0PA 2AXGB 2YD8A 4OLEA 3D6GA 3GBNH 2BCKB 4YDKH 1GC1L 1F4YL 1AGFA 3DX8B 2X44D 3T2QA 1T2XA 3QCUL 4FQ2H 1T3FB 1DE4A 4NJAL 4IRSD 1CI5A 4GRWE 5D1QA 4TOYH 2VLJA 1JFQH 1NDGB 3MLRL 2R1WB 4YHZH 1SJXA 4LAJH 1XAUA 1ZT4A 4BJLA 1TCRA 2HG5A 2R0KH 4UV4L 2VAAA 4PP2B 3CLEH 3GMPA 2IQ9H 3H9HB 1QNZH 5JHDA 3E2HB 1JHKH 2GI7A 3PQYB 2H32H 2DQHH 3CK0H 2LV4A 5E24E 5F1SA 1KULA 5IVXF 4XBGB 1U8JB 2HKHH 1J5OH 3L95B 5IB1B 5HSFA 5KSBF 3DUUA 1XGUA 1IGFH 2G75A 4MDJB 2LQRA 1HSAB 4Z7UA 3S4SB 4X4XA 4D0CB 1LNUB 3D39A 4K71B 1GZQA 4NQXA 5CINL 1R3JB 3P4NB 5KVMC 4P5MA 5K59E 5IEHB 1BQHB 4EN3C 2NZ9C 5IR1A 3MA9L 2DQUH 1OSZB 4P2OC 5DF0A 1VEMA 2YKLL 4NUJB 1CFSB 5FUZH 3S98A 3DRQB 5ICYB 1CXHA 5LQBL 1CE6B 3T0ED 3LS4H 3PDOB 1Z6JT 4OZ4A 1XR9A 5J12B 1MH5B 4WI6A 4Z0XA 5GZNC 5J1SC 2GT9A 4I2XA 3C60D 5FDWA 5GGTA 1OM3L 2MFNA 3VXMB 2AERT 3QWRA 4NNYA 5JIPA 3QHFL 2EYRB 4J3SA 2AI0H 1ZLUH 5I74B 4U1KA 3DVIA 3HI1A 4PLJC 3V0AC 3BP6A 3IF1B 2ZSWB 1RUPH 1T1ZA 4Q9BA 4I0CC 4YC2C 3WLWD 1SHMA 1BF8A 2F5BL 3UO1L 5F7HA 4LEOB 5EPMB 4N0CC 3ULVH 4F9PA 4OGYH 5ACLA 3SQOL 1N6QH 1RMFH 1L0YA 3MV8A 1M6OA 4MQ7B 2HYMA 3DPBA 4EDXB 1VFOA 1A7NH 2VDRH 1YYLH 3BW9B 1WAAE 3DO3A 4FP8L 2YPLE 1H3VA 5C2BH 4Y4FB 1EEUA 4B5EA 2DKSA 2Q86A 2VABA 2XY1A 1RUQL 3MZGB 5FCUL 3U7WH 4WI4A 1CR9L 3ARBD 2UZXB 4XXCA 3W82A 1CFVL 4NRYB 4DQOL 4QOKE 5TF1L 4RGMB 4RGNE 2DWDA 1MCRA 1YEGL 4KRPC 4F2MA 4I0PD 4Z7OF 3GHBH 3QI9C 1LO4L 1LP9E 1IAIL 3M1BB 1I7ZA 1UACH 4HIEA 3BO8A 3JV4B 2GTWB 3IS0X 3U48A 3W5MA 1QSEB 1GGIH 4H8WH 1FNEB 1IKFH 4LKXB 4QXUL 3QJFA 4JM4L 1WITA 1E4WL 5FYJU 5F9DC 1R3LB 1ONQB 3ESVF 4Q9QH 4IMLB 4HUXA 1YY8B 2DYPB 1UZ6E 2JB5L 1A7OH 5GGQL 4Y5XB 4LGRB 4GRLB 1J1XL 4KK8C 1I8IA 3BH8A 5CEYA 5KJRL 4YEEA 3B5TA 1RZJH 2GJ6B 4NZJA 4XWOD 4X8XA 2CMRL 2X4OA 2ZCLH 4LLQB 1NCAL 4JZNA 1JHTA 1JTPA 5F6IC 2ZG2A 4R3SB 1CL7L 3QIBA 2CDGB 2PYFA 4N8VG 5EC2A 4R4BA 3ULVD 3QEGL 1VHPA 1FFNB 1IEAB 4O2FA 4XNZB 3RL2A 1LO5A 1Q0XH 2Z8VC 4L4TD 3U1SL 3ZE0E 4UTBL 1D5MB 1REIA 2FX8L 4XPBH 3SE9L 4R2GB 4GO6B 1R5VB 3SOBL 1MEXL 3DBXA 3UTPE 4EIGB 4S1RH 4PP1C 2RAMA 1QSFD 3Q3GB 1BGXL 2ICEA 5BRZB 1C12A 2F54E 3AGVA 1WFUA 1B2WH 4XH2B 1KN4L 3U6RB 1I4FB 3C5ZB 2I9TB 1G7MA 5K9QI 4AK1A 1XMWA 4WO4D 4HBQA 3LB6D 5H94A 4EBQH 1UWEH 2F74B 5D7KE 4HULB 4CVZA 3O8XC 1GSMA 3GFUA 3I75B 3AS1A 5GJTL 3LEYL 3DVNB 4PY8J 4K7PX 2XN9D 2IGFH 4JM2D 4HS3A 4NO2B 2BNRB 3NZHL 3FFCD 1QVOA 3IJYA 3EYUH 1OAUL 4E41A 4Q74A 4PJFF 3EAKA 1KJVA 4M7KH 2DQIH 3PHSA 5GIRB 3SQBA 4DW2L 2CRZA 1RIVH 3F7VA 3BE1L 1CGYA 3FQNB 1LMKA 4NHUA 3FONB 3SGKA 2OTWA 4N0UB 3IDIA 5DEZA 3OF6A 2WWKT 3VA6A 1A6VH 1BBDH 4YXHH 5FGSA 3NZ8A 3MJ7A 5ID0B 3LKOB 1MVUA 1NGXB 3HCVB 2IAMA 3ZT7A 2YR3A 4ZUVA 1CGSL 4DN3L 3EGSA 3EDDA 3AS0A 1XGRB 2FJFA 3NFPB 4JE4B 5M95B 1JF1A 5EUOF 4ZG1A 1BWMA 3CFJB 1YPZF 4M62L 4OCSH 2BNQA 3UJIH 1S5HA 4EN3B 1M7DB 3M8OH 1J18A 4QXTA 3QCTL 3HE6A 4CU8A 4Q9RL 5E9DE 5IM7B 1R5WA 4OLXL 4P2OB 4K8RC 3MJ9L 4FFWC 3MBEA 1ITCA 1O7VA 3P0YL 2EH7L 4JQIL 1EGJL 4MNQE 4EUPA 1ZLVK 4CU6A 3QPXH 1GZPB 5KS9E 1SYSA 4OZIF 5IFJA 2XTJC 2FATH 1MFDH 2ATKA 3V5KB 3PWPA 3UBXG 3RBGA 3NIFF 2FB4H 4QWWC 4YBQD 5DJ2A 2VQ1A 1NCCL 3QFDA 3CMOH 1C5BH 3W2DH 3HE7A 1Q94A 2YWZA 4YC2B 1IAMA 2WSKA 1AHWB 3RA7L 4YHNB 2ZSVB 4B7IA 4U1GC 4OZGF 2A73A 1PX3A 4O02H 3JWOH 4TNWF 3DUSB 3BMWA 5DZOA 4ZDHB 1LO2L 5KVFL 4U33A 2LAGB 3OG6B 1TFHA 3S4SG 3MO1B 4JFDD 4QRQA 1JUFA 3U9PH 5I66B 2AJ3A 1Q9WB 3MJGX 4F33A 1NFDB 1RJYB 4TVPH 2PXYA 3H6JA 3FO9A 5F7LB 5AWNH 3RY6C 3REVB 4M93B 4LLYA 5TH2A 1JGUL 2DQDL 1OAYL 4PRAB 4XB7A 1DBJL 4KRPB 3QI9B 3RGVA 5A16A 3WIHL 2F19L 1UH4A 2I5YH 3KPRB 4ELKA 3TBTA 1GAFL 5DJ8B 3HHRB 2VXTL 3CVHB 3IDXH 5HI5D 4K7PL 3RU8H 1BJ1J 2OSLB 5DO2C 2YPVL 3K81A 4AEEA 4JO1L 1Q8MA 4LSSH 4TTDC 3VI3F 3UZEA 5E1HB 1OAZH 5FUOH 4UU9B 2VRAA 1BZ9B 1A6TB 1CS6A 3PGDA 3TBSB 4YEFA 2OS7A 3MJ9A 1WJ3A 2PYEE 3PWNB 4YE4H 4GAJH 1K8IB 1EGJA 2X70B 4NQCA 4FFZL 3LQZA 3C2AH 1FCGA 1OSPL 5E6IB 2VNCA 4Q58C 2DLFH 4W6WB 4XNMA 5F6IB 3T2OA 4UI2A 1X4XA 4X5WB 4Y19D 3UTZB 3X17A 1DN0B 4U3CA 5TDPA 4CGTA 2R69L 4LSTL 2PO6D 3P0GB 4GBXD 3BVNB 1MJJA 4KXZH 4U1IB 2RCSH 3ESUF 2ICWJ 4NKOB 4IRJC 3BT2L 1NDMB 2CR3A 2WP3O 4F3FA 1Q9LB 5BMFL 1NBYB 4X0KA 4G8EB 2VLKA 2W0KA 4ZMAT 1PEWA 5GS3A 3RUGB 3UDWC 4FQPA 4GG8B 1KLGA 1MLBB 4PV8A 5KVEL 4TVPD 5JNYA 2WBWB 1HEZB 4XVTL 1PY9A 1CIUA 1T7WA 5DJAB 1RHHA 4U7SA 2IFGA 1ZHNB 5CAYB 4RSVA 3D5OF 1KPUB 3PDGA 4XNUH 3O8XB 3FOMA 1DCLA 5EUKA 2NW3B 3D25B 5LCVH 3T77B 3TJEH 1YEFH 1QQDB 3HUJB 1NAKL 2X4SB 4YR6B 2DBLL 3DMMC 4P2QA 3G08A 2P5WA 1BHGA 2HFFB 2BK8A 4XAKE 5I1IH 1I85C 4ZO8A 3MRNA 4NQDB 3WIHA 5JW4N 4YGAB 3LD8B 3QFJD 2YN3A 2YRPA 5GGRB 2D4FA 1TNNA 2HMID 2Y7QA 3O11B 5DJYB 3VFNA 3G04A 4U3HA 2XZZA 3BP5B 3NPZB 3HPLA 1HINH 3GJEA 1AGCA 3GSQA 4O00A 1A64A 4D9RD 4RFEB 3AM8A 3GM8A 4GMTL 4GG6F 3VGAC 3W9EA 2H26A 4XTRD 3QRGH 3OB0K 4EEEA 3QAZC 3QDGE 1A1OA 5IESL 1S8DA 3DETD 1AJ7L 2XYCA 2ADGA 1U3HD 4H1LH 2BDNH 1ES0B 2R9HC 5DD5L 4MA8L 2W0LA 1S5IL 1IMHC 5J6GA 4O5LH 1I8LC 4K3DH 5HYJD 2DBJA 4GFTB 4GW1A 4JDZA 2WUCH 2Z92A 1V7MH 1HN1A 1U8IA 4HWBH 1X5FA 4PRPD 1IAKA 4G6MH 5TQ0L 4YJZL 4TULL 1INEL 2XTJB 4LLVA 3GM0A 3X3GL 5TQ2L 2ZJSL 4HLZG 1HHKA 4QLRA 4O58H 2PTUA 4K2UL 3TO2A 5FB8B 4W81A 1X44A 1QFWH 2WUBL 2DMKA 2O5ZH 3T0VA 5C08D 5LGJA 1KXVC 1NANH 4Y5YC 1VPOL 3OV6A 4LQ1A 1QFWM 2ZUVA 3WHXA 4M7LL 1CT8A 4NRXB 1XF4B 1P69B 4OB5L 4U1GB 4Y7MA 5C07B 4P57A 2P5EB 5IROA 4RAUB 4Z8FH 1D5ZB 3QDJB 1WTGT 4NSKB 2EXWD 1OTSD 2MMXA 4UILL 2FD6H 1F42A 4C56E 3ZT6A 3TYFA 1U58A 3SBWA 4NYLA 4DZ8A 1CFTA 1UM4H 4XXDB 5HDQL 4TSAH 2FX7L 1QP1A 1DLFH 1K8DB 12E8L 4LNRB 4QRRD 2OCFD 5FO8B 5HYEA 5KW9L 1BM3H 1UB6A 1FN4B 2PKDA 2IBZY 1XH3A 4OFYD 3WFBH 4U6XB 1S9XA 2OZ4H 3MRJB 5HHMB 2GJZB 3JWDL 1JWSB 3WFCL 2R2CA 4APQC 5D7LE 4PB9L 3SEPA 4CVWA 2XV6B 3P40A 1DR9A 1CDHA 1XIWD 5D1XC 3QULA 3BDXA 1EO8L 1IE5A 2NPLX 3MPCA 1I3GL 5D1ZD 3S96B 4D9QD 5EOQH 4I77H 1D7FA 1X6NA 2WANA 5K9KA 1C08B 3E6HB 3NA9H 5D6CB 1FZJB 5LGHL 3QO1A 5F96H 3C8KA 2MWCA 4JRYB 3IJHA 4QRTA 3DURA 4ZYKA 4QHKJ 4JG1H 1MHHA 4D3CH 5I8KL 2VDPH 5E8DL 3MYJB 1A9EA 3VG0H 4LSUH 5JOPD 4MA7L 1A0QH 1T0NB 4BSVB 4WDIB 4ZFZB 3OKEA 4WWKD 5JDSA 1L9NA 3I84A 1AKJA 1UCTA 3MNWA 3LKQA 3MCKB 3VXNB 2HJKB 3ZKMC 3T1WA 3L3DB 4LAQL 4BSJA 4NQEA 1U8MA 4KUZL 3QEUA 1U8NA 1CICD 3FN3A 1N5AB 1FPTL 4IRJB 3WNMA 1MUJB 4G6JL 1KIPB 5B38B 1MSPA 1T1YB 3QWQB 1JGVL 4XI5C 3RTQC 1F2XK 1JPST 3UTTB 4HH9B 4TUKL 4D8PB 3AAZA 1T66C 1FGNL 3MRKA 5F21B 3T1FB 3GMLA 3KLAB 3LN5B 2A83A 4BKLB 5HGDB 4U31A 3KYNA 4MD5A 5C8JA 4OFDA 5ALCH 2NW2B 3BEVA 3KPNA 1MPAH 4QF1B 2EKSA 4Z76B 5I1AB 4EVNA 3SDXE 3SJVD 4ELMA 2IG2H 2W59A 3OAUH 1CTNA 5FYKU 1H3PH 2JJUA 4CVXA 1QLRB 4OIBA 5IVOA 4N90D 5DR5L 3V0WH 1GHFH 1CTOA 4M7JH 3ULUH 1F6LL 1AO7D 1GIGL 3A6OA 5HXMA 3DMMB 3LS5H 1NFDF 2VZVA 3VFSB 4QXGL 4R4ND 5IWLC 2H3NA 4OJFH 2GSIB 4ALAH 4JDTH 5DI8B 4LKCB 2XG5A 3GI9H 3HI6L 1Z3GH 2MCPL 3EYOA 3BZFA 3ALXA 3V5HA 2C1OA 1YMMB 4MZ3A 3LVEA 5KSUA 1VKXB 1EEZB 2D0GA 4HMCA 2X1WL 4CNIB 4K3EL 3BKCL 4XMPL 3X14A 4CN6A 3QDMA 1ROWA 4XNQA 2BVYA 5ETUA 3PIQA 1QBLL 5C7XH 1IEBA 4U1LB 3VRJA 2JIXA 4H8WC 3VGAB 4HDIA 4QGTA 1INQA 2AEPL 5C0EA 5CKGA 1N59A 3VFPB 5K9OB 4YWGH 3WKMH 3QAZB 2IH1A 3MV9E 2R2BB 2W0FB 2K1MA 4MJ6A 5FM5M 3ELAT 4ORZC 4ZOAA 5EBLA 4IRSB 5I16A 1F4XL 3P2TA 3DV6A 1L4IA 3IJSA 4LPWA 2GHWB 3KYOB 4KK9D 1F45A 1RUAH 4D9LH 2EXYC 5EU5A 1RZJC 2RR3A 2V7HB 4KRMB 1BFTA 2F8OA 4ZNEA 1B9ZA 5D7IE 3JTSA 5FOBB 4F9LC 3DO7B 4I3SL 1F58H 4WY7H 5C0FA 2EDQA 5L2KB 5H2BA 2ILLA 4HUUB 3TWCL 3QWOB 3N1GC 4YIQA 5E00A 5JIIA 4PTTB 1IT9L 4DFHA 4P2RD 2UWEB 3ARRA 3G6JB 3MRHB 4UDUA 2XZAH 4Y5YB 1L6XA 2A77L 4OLZL 1P1ZA 5HYSG 2G5RA 4XP9H 5B39A 2O26U 5I19L 5CUSH 5T33L 3NCBB 4PJEB 2M1KA 3IETB 1J8HE 4R90L 3W5NA 1U95A 3G6DL 4KVCH 3U82B 3U0TA 4C54A 3V6FB 1NC2A 1JL8A 1NC4D 3FO0H 1T89C 1U6AH 3TO4C 5F8QC 1MHPH 2DM7A 5IB2B 1WFTA 1NMAL 3C60B 4HQQL 1C16A 3MFFA 3MRGA 2FL5B 3ETBF 1FGVL 1MELA 1UCBH 1DBAH 2CKBH 1ZHKB 4Y1AE 5KOVC 1PDKA 5CP3A 1G7PA 3IDMB 3Q6FB 5SX4H 2WQ8A 3FQUB 4LHUA 2FHFA 3O3EB 3L3OB 4LRNH 2HTKD 3BD4A 2DJSA 5JW3H 5MENB 3CU7A 4APQB 4G8FA 4HW6A 1TTGA 2IANE 1LD9A 5TFSL 5D1XB 5JPNA 3TBWA 5I6XB 4XBPA 4R4FL 5KVGL 3EYQC 4P46C 5F1OB 5I1GL 1XF5B 5F7DB 4MJ5A 5DURB 3ARBB 4KTYA 3BD3A 3HRZA 4PV9B 4I0KA 1E0OB 5GZOD 5EU6E 4DK6A 1MF2L 1BF2A 2F5AL 3KPLA 3MOBH 4G3YL 1GOGA 4H26A 3KNBB 4NFDA 3OB8A 4OZFH 1MAML 5H35B 1FG2B 1H3GA 1NUNB 3FHQA 2ARJB 3ILQC 4QRUB 3EFDH 4N0YH 1D6VL 1V3MA 5K9JL 4KK6C 5CHNA 3VW3H 2BRQA 3BRGC 2L4OA 3RX7A 3UXFA 4AMKL 4UQ2B 5EO0B 4ZSOB 2YBRB 4BQ8A 4U05A 4PJDB 4R0LB 3RTQB 2ZCHL 4XVUD 5DRXA 3HPJA 4GS7B 2AGJL 3SCMA 2AK1L 5SWZE 2X4PA 3ZDYE 1QBML 1JGLH 5IF0B 1DBBH 5I76A 4JAMB 3O3AA 4G8GA 2GCYA 3ZYOA 3RNQB 2O5YH 4JFFA 4BK5A 1JPFA 5E2TH 4RMRA 4QHNB 5JLZB 1ZOXA 2V2XB 4TUOA 3JWOC 1Z9OA 4MXWH 5C6TL 5BJTB 3CZFA 1QSZA 1YEKL 3NVQA 3O6MH 2Q1EA 4ZUUB 2JELH 3C6SB 4G9FE 5FUCE 4LCCC 3CC5B 1VEOA 4XPFL 5LXGH 4FZ8H 1A7QL 2QR0B 1CLYL 4JO2H 1KEML 1ZA6B 5HVFB 4EUPH 3CVIL 5CLWA 5E6YA 1AE6L 3K2UH 2B7DT 1KENH 1KFAL 1KJ2L 1CFNB 3LSOB 1Z2KA 1FH5L 4HS8L 3MREB 2O61A 1GCFA 1W72L 3BPLC 2V5SA 1A9BA 2DLHA 5EU7E 4XP4L 5I1JH 2XWJB 1E27A 2Q6WA 5EZOL 5HGBA 3F7PC 5E2JA 4J1UB 4IJ3C 1ODAA 5EO1B 5B38G 1YYML 3GSNA 4P5TA 1Z0MA 4ZXBA 4EIZC 3IDGA 3LY6A 3SKJH 2JCCA 2FO1A 5KSVA 1OD9A 3RIFF 1SJVA 2F9BT 1TZHB 4HZLA 4L3CB 2XG4A 4PJIE 4Y5VC 4JPKL 5CIPA 1PKQA 4FOMA 1ZSDA 4GOSA 1BBJA 5IP4A 3O3DA 1MRCH 2ESVB 1G6RA 3QUZD 2GUOA 1X5IA 4BFBD 3OKDA 5CKAA 4FQIH 1RZIA 3O0RH 4LCWB 4LLWA 1MLCA 2P1YA 1TMCB 2HN7A 2NLJB 1GGYA 1OQXA 3CIQA 3MRLA 1QHPA 3PDDA 3VWKD 5C0AB 2HFEB 1S9WB 4PGDA 3LZFL 4LASL 5DFWH 1SYVB 2VXQL 4PJ9C 1AFVH 5C71A 4DKAA 1OTTC 1KLUA 4Q0XH 3B9KC 4OLYH 4FQLH 1AH1A 1A7RH 4KHXH 2R29L 1RURL 3PGCA 2JK5A 1BZ7A 4KMQA 5D2LE 4KI5E 1XGPA 2APXA 3MV7A 1UG9A 4O4YH 4J4PC 4PJ5D 1NFIB 2DD8L 2FWOB 3LRHA 2HRLA 4PB0L 1JGEB 4G8IA 2MTPA 3DXAD 1I1YA 1AXTL 5C0CD 1NUFA 5ICXB 4RGOL 3ULSB 2R0ZL 1F97A 4PG2A 3TO4B 3QH3B 3OKLA 1CIDA 1A4JA 3O4LE 3K8LA 1EX0A 1QFWI 1CXLA 3LQAH 4PRNA 3TJHD 5DFVC 2GEEA 1NANI 1MCPL 1KJ2A 2BERA 4ZFOB 2V7NA 5IMLB 4IMKC 1Q1JL 4GAYB 1W72A 3FZUC 5T1MA 2WP3T 4YXKL 3I50H 1KG0A 2F58H 3D3VA 1A3LL 1M7XA 3MRPB 1IGCL 4QRPA 4DKDC 1K5NB 3GMMB 1BOGA 4KKAD 2D03L 3HFML 3NH7H 1LP9A 1LWRA 4PBVC 3Q0HA 4W6YB 1Z5LB 2ITCA 4M4RA 4TYUA 2MPAH 2F8XC 3NN8A 2VLRA 3ROLB 1NMBH 4S2SA 4FG6C 2BOCB 4U49A 2NY0D 4NBZB 4YH6A 1PLGL 4X80H 1RZ8A 3DV4B 1OAXL 1LK2A 1Q38A 4KY1H 4WV1B 4HKBB 1KELL 3MMEB 2BZDA 3H9SB 3TT1L 4AT6A 3OPZH 4ZQKB 5IVXE 4RBPH 3GIZL 4KJYA 1U0QA 1ITBB 2R2HA 4JFQB 5BV7L 5KSBE 4YXLH 5TPWL 3MLWH 3KPSD 4X99A 3TVMD 4KMTH 2YD3A 4NPYA 4ODXB 2K3TA 3DHJA 3KXFA 4J12A 5MERA 4GW5A 4PRBA 4PJBB 4L4JA 4DN4H 1P4LA 4CRPA 3P73B 1GPOL 5FHBL 2V6HA 5IKCB 5DVMA 4MJIB 1A6AB 5HBBA 2ZPKL 5AAMA 3MLSL 3VWJA 4B53A 5FYLD 4JRXB 3VXSA 2J8UB 5K33A 3TPUB 1T22B 4JFOA 5CEZL 3CDCA 1Z9LA 1FO0H 4Q7DA 1GYAA 5A2LH 4PJAA 1P7QB 5KZCD 1KPVB 3T0EE 4HT1H 1KB5B 5FIEA 3N1PC 1S7VA 3P4MB 3P9WB 1BREA 2QQLH 3GNMH 2PW1B 5HHQA 2NX5B 3EDKA 4R97C 4X98B 5SWSD 1FNHA 4RQQA 1U8HB 5HY9A 4LBEB 4F57L 4PJEF 1K4CA 1FNGA 3TM6A 4LLUB 1CD1A 1G6VK 4ODBD 3ZKSD 3I2CH 1T21A 3RVWD 1HH6B 1H5BA 4X6CB 5HD8C 4M1CC 1HIML 2WV3A 1EFXA 3H42H 4N8PA 5C0BD 5DQ9B 1E4XL 3SE8H 4I4WA 1TQBC 3BP4B 4L8CB 1LDPL 2FNBA 3BPOC 2Y6SC 4HKZA 4YDJA 2FYYB 2B0SL 4S1SH 4LCCB 2A6JB 4J7RA 3CPLB 3S35X 4C55A 2DQFB 1X4ZA 2A0LC 3AREC 1S7WA 5I8OH 1AIFA 2PR4L 4X6EA 5D8JL 1LK3L 4PIRF 2AP2A 2JB6B 4WVRA 4LSVL 1NGZA 1QRNE 2WLZA 3K4ZA 4P5KA 3QUKA 3QA3A 4I9WD 4XCNA 1DBKH 3BPLB 1JNNL 4Z7OE 1UKSA 3QO0A 4X7FC 4TN9A 5C09B 1MFCH 3QXDB 3RQ3A 5IEKB 1JPSL 4JFPB 4F8TA 3PV6A 4IJ3B 3KJ6H 3WE6B 4RRPG 4U6YB 3QXAB 3RVTD 3OXRB 3U4EA 5IMOB 1CDUA 2I07A 4HKXA 1IQDB 5C0DB 2CXKA 1ORQA 3HG1B 5DLMH 5AD0A 2EDDA 5EFIA 1HQ4B 3FAWA 4Y5VB 3QIUD 2QQNL 3ARFA 2J6EH 3CFCH 4TRPH 3K8KA 3D48R 3QXUA 4WUUA 1JI2A 5IGXH 5GRXG 3PWUB 2YK1H 1S9YA 4TSBL 1OWRM 3QUMH 4MAYD 2CK0H 4N0FA 4OZHA 4RA0C 1S7RA 5FKAA 3SDCD 1UWGH 1MQKL 1KB9K 1KNOB 3O9WC 2Z31A 4PJ9B 1U8LA 3DUHA 1AC0A 3WCYA 3WKNA 5I73C 4FFVC 3V6OA 3BQUD 4UIMA 3B9KB 3ZHDA 1IM9B 4DGIH 4P4RA 4MAUL 4PG9B 4S10A 5D1QC 4YQXL 1D9KC 2X4TB 1NBZB 25C8L 4JPIB 15C8L 5GS0D 2JE8A 1XCTA 4L4TE 4W4OA 3VXTA 4UINH 3KPPB 1WBXA 4JFZL 4M4PA 4F37K 1KB9J 5AAWA 3AXLA 4P9ML 1DQJB 3HB3D 3L3KB 4PRPB 2AXGA 4YGVB 1QSFE 3W0WD 3P9LB 5F3HB 3LV3A 2W38A 4NJ9H 2AJZA 4HG4K 3TPKA 3DX8A 1EERB 3MV11 1T3FA 4FQCH 5GRYA 4BK4A 3C5JB 3LKPB 3QZWB 2EIDA 2IBBA 1NDGA 2R1WA 3ULUC 1J1PH 3MNZB 4XPHH 1WQVT 1A4KB 1P5UA 1F02I 1YNLH 5EZIH 1PG7H 5EWIL 3WXWL 2XN9E 5C1MB 5BZWB 1JYNA 1MCHA 4HG4J 1NGYA 1L7IL 4OCRL 1EHLL 4PJFE 4CADB 3L7FB 2YMXH 4XBGA 4NOBA 5HHOB 1U8JA 2VZ3A 5IB1A 3G5ZA 3O41B 4ODHL 1CLZH 1RK1A 1X3DA 4LARL 4MDJA 4RX4D 3S4SA 3VRIB 4D0CA 1VDGA 4FN0A 1OGAD 3O2DA 1BQLL 4GSDL 1R3JA 3LKNB 1QKZL 5CJOL 1LEGB 3S35L 5IFAL 2Z91B 2X1QA 5IEHA 3NACL 5IHZB 4KHTL 4PJ7F 5SX4I 3GSVB 3F7YA 2NTFB 5CBAA 4JQXA 4B7LA 1J7VR 5ACZB 3BUTA 3SE4A 4HEME 3RVVC 1OL0A 3TP4A 5ICYA 1CE6A 5JW5B 4PJXF 3CXDH 2VDMH 3DVFA 4U1SB 5JUEL 2E7HA 3PDOA 1YPZE 3P11H 4L9DA 1PX4A 1OTUD 3U79A 3FFDA 3OGCB 3B5GA 5JA9A 3DI2B 2D3VA 3VXMA 2C7UB 4XP6L 4LU5L 3HKFA 2EYRA 1I9IH 2EECA 2ADFL 4KVNL 5T1LA 1PG7W 1AI1L 3IF1A 2ZSWA 4YHLH 4XXCC 4OZIE 4CMHC 1W8OA 2WBJD 3S36X 3MX0A 4LEOA 5EPMA 1N0XL 4XCEA 1T7ZA 1U36A 4AG4H 3ZL4H 3RAJL 3BP7B 1E4KA 2IBZX 4R97B 4EDXA 2DM2A 4NIKB 1QBAA 4Z95H 1IILE 2VDOH 4WWKB 2NXZC 1TETL 1F6AA 4FFYH 4LIQH 2DI8A 2MQ0A 3SDYL 4OGXH 2QSQA 4TPRH 3SO5A 1DFBL 3TC9A 3ARDD 4OZGE 1CYGA 4R6UA 1DQDL 4NRYA 2VE6B 3L3HB 4C59B 1TQBB 4HFUL 1IC5H 3BPOB 3HMXH 4MA1C 1VFUA 3BHBB 2BRRL 4GAGL 3RZCA 4UV7H 1D6EA 5IBTH 1VGKB 2H2SD 1KCLA 2B2XH 3D0VB 3JV4A 5CZXC 2GTWA 2CK2A 2NYYD 5T1KD 3OKYA 5T3ZL 1QSEA 3QSKB 1FNEA 1KOAA 4KQ3L 3HAEH 2D7OA 1YC7A 3LH2H 3KLHC 1EXUB 4UDTB 1JP5A 3X11B 1R3LA 1BVLB 4X7EC 1B6UA 3C08H 4IMLA 3TZVA 1MFBL 3G6AA 1O0VA 5E8PA 3KJ4C 3BPNC 3QEQB 35C8H 3RPIB 5F3BA 2A6DB 1HHGB 3EYQD 4FRWA 3MCLH 4H5SA 1JNLL 4YDIL 4OD3L 2FEEL 1AO7B 3PQYE 3V4VH 3RDTA 4M5ZL 3I6GB 1RZ7H 2BHZA 3GSXA 4UTAH 3GUTB 1D5BA 4IS6A 5J3HD 2X09A 3VI3E 4D94A 4OKVB 5IMMA 4R3SA 3PP3K 4AENB 4Z78B 1MREL 4NWUL 1FZMA 1IEAA 1PYWA 5BOPA 5HHNA 5ISZD 1ZLWK 3HZVB 5ESAA 3U0PB 4WHYH 2DM4A 3KLDA 2HWZL 2XQBH 3S37X 3IDNA 4UZGA 3C6LD 2Z9TA 3LEVL 2J8UF 3O9WB 4PRIA 1MY7A 5I73B 2EC9T 4XH2A 2MQ3A 3L5JA 3U6RA 1IQWH 2I9TA 2EEDA 3C5ZA 5D1QB 5HJ3A 1D9KB 2B1HL 4HWEH 4O9HL 2F74A 1QHOA 1TCRB 2HG5B 3SGKC 3D87B 4XC1H 4CJ0A 3QPQC 1PZ5A 3QEHB 2YHGA 1T2QH 5JHDB 3NTCH 1VESA 4DGVH 2CGRL 2KKQA 3DVNA 1OARL 2B39A 1X5JA 2IAMC 3QUYD 1YEIH 2BNRA 6FABH 3DHMA 4EDWL 4K23H 1EPFA 1XGUB 4PLKC 2YA2A 4KU1A 4U1NB 3GKWH 4Z7UB 4NGHL 1YZZA 3S36L 1A7PH 5DK3A 2NY1C 4NQXB 5DD0L 2E27H 1G9MH 4YHKL 3MACL 4P2RB 3MLZH 3BKMH 4NQSA 3FONA 1F2QA 5IR1B 1SVCP 2PNDA 1I9JL 1AR2A 5LBSH 3S3PA 3GK8H 4PRHA 3MLXL 3EOAB 4NZTH 2EDBA 5MP6H 2CQVA 2HTLD 5GXBB 4U1HB 3U0WH 1UWXK 4J3XA 1XGYH 5ID0A 4X6DF 2FJGA 1JYVA 1NGXA 1CVSC 2FIRT 3HCVA 4V2CB 3PWLB 3CVHL 1XR9B 4KGLA 4Z0XB 1HOCB 3NFPA 2R4SL 3BGMA 3T2NH 3BIAX 4JO3L 3CFJA 4PJ8A 4OSUL 4NNYB 2VWEC 2VISB 4U1KB 4EN3A 3BJ91 5FA4B 3F62A 3BKYH 1ZLVH 1T1ZB 4GG6E 4Q6IC 3VGEA 5ALBL 4P2OA 4Z7WB 1ZLUK 4D9RE 3F6IA 5J6HB 5F8RC 5TE4L 4BELD 4JR9L 2RFXA 1ZEAH 3TV3H 4AM0B 4RWHA 5D2NB 5L8KB 4X9GA 3VH8G 5EBWB 1MCBA 2APFA 1OT1A 4X7SL 4TNVF 3EOYG 5DFTA 1FNLA 3V5KA 2GJ6E 1ACYL 2AJUL 1FNAA 2VLME 5CCKH 4QCIA 2Q86B 1OAKL 4IOFC 1FZKA 1QSVA 4OTXL 3IFPB 4LHJB 2DWDB 5JQ6L 3OGOE 1AHWA 4FQXD 4GRWH 4GQ9L 3E8UL 5TGBA 2J4WL 1FV1A 2C4FU 3DUSA 3GHEL 4S1QL 3BO8B 4ZDHA 2BMKB 5GISH 4XMLL 3MOAL 3OR6B 4KKNA 5BRZE 2ZUSA 1B90A 2IPUG 2FLRT 3KR3L 1I1AD 3S37L 1XF1A 3MO1A 4YLQT 4JHBA 5C0ND 3D0LB 5I66A 4KH2A 3QCVL 1WZMA 4HSQA 1RJYA 1X5YA 3DYOA 1DTUA 4HUXB 2HJFA 4N1CA 1TJHH 5IHBA 1RJCA 3H3PL 2QL1A 5CIPH 4PRAA 1LO0H 4Q6YA 4MA1B 1QYGH 2MOVA 4WWID 3QI9A 4H0HB 1LO3L 3BH8B 1G6RH 4JFED 2BSTA 3LQAC 4FXGB 4LCIL 4JG0L 2V5YA 4DOHB 2DIBA 1RUML 2CKBB 3IKCA 3L5XL 4F7CB 4H1LG 3KPRA 1BD2D 4BFEA 1JI1A 1CZ8H 1B4JH 1JHTB 3PL6D 4X4YB 3RIAF 5BO1H 3IU4H 5E2WL 4ODUA 1TJIH 2VDNL 1DUYA 4QRRE 3RL2B 1LO5B 3BPNB 4UU9A 3U36B 4I3GA 1T2JA 4N0UE 4XPTH 3QIWA 1A6TA 1HH9A 4KTEL 1X7QA 3DBXB 1HKLL 1A5FL 2OL3L 3TFKD 5DJXA 2ZNXA 1C12B 1K8IA 5AZ2L 2X70A 3BN3B 2YUVA 1E6JH 2R8SL 5E6IA 3ME0A 4D9QE 1G7MB 3E1F1 4X5WA 3FT2B 3MJ6A 4OQTL 3BSZH 1VGEL 3BVNA 4K8RL 5D9SB 1FSKC 4HF5L 4MS8C 3R4DA 5DD3H 1HE7A 5GHWL 2G5BB 3IVKA 4X4ME 1NFKA 5HYFA 2NCMA 4WW1B 2EH8L 4NKOA 5INCA 4WTWA 4HCRH 4OZFB 4PUBH 3OJVC 1NDMA 4ZFFB 5JOPE 4MDIA 1DP0A 2VC2H 1KC5L 1QVOB 3SN6N 3MA7B 8FABA 1JMZA 3RUGA 4GG8A 4E41B 1QLFB 1N5YH 3E3QC 2AVGA 5DHYA 4OUOA 1KJVB 2AK4A 1HZHL 2ZOLB 2DL2A 4LHQB 4ZD3L 1NEUA 5DJAA 4NHUB 5J8OA 1DL7H 1ZHNA 5L9DH 1IGTA 1EEQA 4TNWK 1MI5A 5F6HI 1I1RA 2EDOA 3O8XA 1MHEA 5K59F 3BKJH 2E9JA 3D25A 5JR1L 2R4RH 1T80A 3NZ8B 1MVUB 1FBIH 1NGWA 3HUJA 4YR6A 1NBQA 1IGYB 4MQSB 2IAMB 5ANMB 1RIHL 4KJPC 1G9NH 3EGSB 2GITB 2FJFB 5FGCE 2N56A 4NQDA 2NTSP 2NY1B 4FTVB 1PAMA 1FYHB 1RHFA 3MUHL 4UOW1 5JZ7C 3A67L 4Y8DC 3SJVE 2RGSA 2XTLA 3O11A 1NUDA 5DJYA 4OLUH 4FA8A 1NFDE 4RISH 4PS4L 1PZUB 2E5EA 2BFVL 2Z93B 4EUPB 4BA8A 1F3DH 4RFEA 5D5MF 1C8PA 3FOLB 4RMVA 1RUKL 3EJZC 3I9GL 3TH3T 4WCYH 4HXAH 5DRWB 2OL3A 1FLRH 3TA3A 1JK8B 4XMKL 1E6OH 1S7TB 2A9NH 3VFRB 5DJ2B 1QRKA 3KPMB 4FNLH 4NO0D 3B9VA 2P8PB 4Z5RB 5IHLB 2IH3B 5F72S 5I0ZA 2J3SA 1F00I 1Q94B 4OQTA 4HAFA 3Q6GH 5BVPH 4Q6IB 1TLKA 3HNSH 3LCYA 1CDGA 5I1HL 4QOKD 1FDLH 2AJXL 3WFDL 1JZ6A 3LKSB 3LHPL 5IROC 3KGRA 2ENYA 1ZTXL 4A6YH 5FYJE 1OLZA 1EDQA 3QNYA 2LTQC 5CGTA 5D70L 2VN7A 2CJUH 5FB8A 3VXPA 2WW8A 2DTML 3MRMA 3SBWC 2B8OT 2NY0B 3SDAC 3WFHB 2AJ3B 4RMSA 4HMEA 3FT3A 4TSCH 5CILL 3WLBA 1WEJL 3FO9B 1FFPA 4L4VB 4NQUA 4JFXB 3RKDD 3IAGC 1P4IL 1XF4A 5JHLH 4JKPL 4PJHB 5C07A 4DFIA 2P5EA 1BOYA 4RAUA 1A2YB 4NSKA 2DLEA 4ELKB 2YUXA 4MQXC 2E7LC 3MLRH 5DRZB 5TDNA 4FABL 4KDWA 4GKSB 1SQ2N 1LVEA 4ZPTA 4YAQB 3D39D 1MY5A 3A6BL 4ZTOL 2VITB 4JQVA 4Z7UF 3VXRA 1X5HA 3CH1B 3MRDA 1Q0YH 4XPAL 3SO3C 3VXUA 4AEHL 1ORSA 1K8DA 1X5AA 3HRPA 3L1OL 4LNRA 5FO8A 3PGDB 1KCVL 1ADQH 3D2UB 1FN4A 5EA0L 4U6XA 3IDYC 3MRJA 5F88B 2C9AA 4NQCB 4K3JL 4ONHB 2C3GA 3LQZB 1CF8H 4JFYB 2XZQL 4XNMB 1KTKE 4NHCH 5TDPB 1FC2D 3S96A 1AQKH 2NY2D 1C08A 2AQ3A 3E6HA 4P4KD 1E4JA 2YKLH 1MIML 2H2PC 2H9GB 3KVQA 5DVLA 2HH0L 5FGRA 4F3FB 2VLKB 3MYJA 4GUPA 1T0NA 4L8SA 1KLGB 4BSVA 4WDIA 2PW2B 5IOPA 3WIIL 4ZFZA 5J11C 4XWGH 2HFGL 1JVKA 1LILA 1YMHB 3O2WL 3EHBC 4HBCL 3MCKA 4ZFGL 2HJKA 1JMXA 3Q5OA 4WTXA 5BS0E 4QXWA 4XX1G 3L3DA 1FSKB 5L88L 4LLMA 5EUKB 1XFPA 1IM3B 1N5AA 5L6YL 4HUWB 5DUML 2HLAB 4IRJA 3V6BR 1MUJA 5IJVA 1N7MH 3EJJX 3ARGA 5B38A 3HNVL 1T1YA 4P2QB 1P6AB 2EDHA 1U9KA 2J5LC 5J0BA 2D31B 2BSED 5DQJB 4BUGA 3UTTA 4HH9A 4D8PA 1MCOL 3D85A 3KLAA 3LN5A 2D7TH 2XTJE 4BKLA 5HGDA 1UM5H 4HH8A 4XX1E 3CDGA 3BMVA 2X7LA 1FO0B 3RNKB 2CKNA 4HD9A 3GMOA 2NW2A 2GQHA 4QF1A 4Z76A 5I1AA 1HWHB 4ONOA 3WJJC 1HQRB 1FORH 5F9AC 3O45B 1YEGH 2DN7A 3FN9A 1AGCB 3GJEB 3IFNL 1QLRA 5E9DD 3GSQB 3UTSE 2ZZUT 5E94A 4JEGB 2Y07H 4MAYB 2EDTA 2IPUK 2E7BA 4PJCA 3DMMA 1RZFH 2GJJA 2H26B 2OR9H 3TNNB 5GS1B 4LKCA 4M5YH 2DQTH 1A1OB 2HP4A 4M6NL 1IBGH 3QDJE 1ZGLP 1ZANH 4IM8A 1FFOB 2ADGB 4OM0H 1KCSH 3QQ3A 4BZ1H 4NQVB 1YY9D 1CCZA 3GBNL 4JFHE 4XNYL 1VKXA 1EEZA 3QIBD 1CLOL 4YDKL 4CNIA 4JDZB 3UJTL 4ZNCD 2EE2A 4FQ2L 1WWWX 4JGMA 1F8TH 4PGCB 3IGAB 4TOYL 5JXAH 2OX5A 4FZEH 4U1LA 1JFQL 2NY4D 4OZFG 3CX5K 4KKLD 4YHZL 1P7HL 1RZKH 1A47A 1CD9B 4D0BB 3CLEL 2H8PB 5DRNA 1QFHA 1HHKB 3VFPA 2UY7A 1QPXA 2IQ9L 3TO2B 3DRTB 1QNZL 3C2SA 1JHKL 2EIZA 2W0FA 1JCKA 2DQHL 3CK0L 5BVJA 5IB3B 4G6AC 4IRSA 4UT9H 2AKRB 2AABH 3S5LB 1CDIA 1J5OL 3WHXB 1KLFA 4YFDB 3KYOA 3VMNA 3CX5J 1IGFL 4OCMC 1AXIB 1UH3A 3MRCB 2V7HA 3D18A 3SOBH 1R24B 4LQFH 3UAJC 4UIKH 2C1PA 5FOBA 3DO7A 3QNZB 1BGXH 1Q9OA 5IVXA 1BQSA 1GGCH 2XKNA 3E0GA 5L2KA 2C26A 1EZVY 2DQUL 2LTQB 4M8VA 3QWOA 5F7KC 3OR7B 3TYFB 1U58B 4DZ8B 4PTTA 3WSQH 3QUMB 1G7IA 3SDAB 3LS4L 2UWEA 3G6JA 3MRHA 1A3RL 1IC7H 4OV5B 3DI3B 4GLRH 2UY6A 4R26H 3MLTB 2XICA 3KYKH 4R96B 1J1OL 5CS7A 5I15L 1WBYB 1HYSC 1S9XB 3OF6D 2AEQH 1SBSH 3VDCA 2PYED 1ETZA 1JZ3A 2RB8A 1DQLH 1RUPL 2DJUA 1WSST 2VKXA 3B4NA 3V6FA 4FXLA 2DLIA 2CLVB 4DVRL 5T5NF 2XKSA 3QULB 3ZTNL 1LDSA 2VR4A 4NCC2 3C60A 4PTUA 3RWEA 5EZLA 2YD9A 3G5YA 5K9KB 4OGYL 2VDKH 2P7TA 4F8QA 5I1CH 1N6QL 1RMFL 3DECA 1ZHKA 3QO1B 1OP5H 2BNQD 1Q9KB 4P2YA 3IDMA 5MEQB 3Q6FA 3U4AA 4PJ5E 2VDRL 5L8LB 1YYLL 4XHJC 3IJHB 3L3OA 2DF3A 4ZYKB 3HE6D 3DXAE 1MHHB 2FSEA 3IDYB 1A9EB 3MBED 5DMJB 5C0CE 1G9MC 4QY8B 5IVZB 4APQA 3U7WL 4HUKB 3F6LA 3PWVB 3OKEB 4ZUWA 5FCSH 3NCMA 2A1WH 3GHBL 3GMNB 3MNWB 5DD6A 4CBPA 4LVNC 1IC4H 4LSQL 3PWPD 3L9RA 2H32A 1UACL 1U8MB 4JO4H 1YMME 3STLB 1TIUA 5CJBA 3OJMB 5FOJA 1XF5A 2BY1A 5F7DA 3ARBA 1GGIL 4H8WL 1IKFL 4PV9A 3HE7D 5DA4A 4I0PA 3FB6B 5GRJH 2XKUA 1QOKA 2B5IC 4Q9QL 4XCCH 3HC0A 3V8OA 4PLNC 2YD2A 3MRKB 3KS0H 3SCMC 5DJ0A 5DK0B 4Q97A 5J11B 3UX9B 5JTWA 3VFWB 1HHIA 3KYNB 5H35A 1A7OL 3EUUA 5C8JB 4QRUA 3KPNB 3BEVB 3KWWB 3MXVH 3AU1B 2EKSB 4EVNB 1RZJL 5AZEH 3V8CA 3P4LA 4UMGA 5CD3A 1LE5A 2ZCLL 5GSVB 1ZMYA 2XIDA 1U92A 4G9DA 2E6PA 4OFVA 4UQ2A 5EO0A 4ZSOA 3CFEB 2PXYD 2YBRA 2W9LA 3KPSE 3H3KA 3WD5H 4M9PA 4RRPA 5B3NA 2J5LB 1MCSA 2GIYA 1OLLA 4R0LA 3RTQA 2IEPA 3MLYH 2EO9A 1Q0XL 2VXSH 3RGVD 5EC1A 3EYOB 4XRCB 3CX2A 3V5HB 5IF0A 4E0RB 3MBXH 3GB7A 4JAMA 4S1RL 5C0JA 5JMRA 3L3GA 5FYLE 1RIUH 4QHNA 5JLZA 1AR1C 2V2XA 5CJXA 5HVWA 4JY5H 2BOBA 1B2WL 4S0TD 4XNQB 5BJTA 5E0QA 3NABH 5C0IA 5MEOA 1IEBB 5HTSA 4EBQL 2F19H 5L8JB 1UWEL 3WL9B 5ESVB 4HDIB 3VMPA 3C6SA 5C0EB 4PJEE 2X89A 4OBRA 3HMWH 5SWSE 2QR0A 3SGEH 1N3NA 1RFDH 1ZA6A 3I85A 3BEWA 3S9DB 5EBLB 3ZE1F 4EI5D 4DTGL 2CUHA 2A38A 2IGFL 4JY6A 4M02A 2EE3A 3NIDF 4WO4A 4ZFOL 1CFNA 3LSOA 3H3BC 4WI2A 2J12B 3MREA 5GJSL 5ILTH 2Z8SA 4M7KL 5K93A 2DQIL 3JTSB 3MGTB 1RIVL 4CMMB 1I8KA 4RDQF 1CU4H 4JM2A 2E7CA 4MD0B 5EO1A 4OF8A 5DVNA 3FFCA 4V1DB 4YIQB 5E00B 5MENE 1A6VL 1BBDL 1KN2H 1N8ZA 1H8NA 2C3HA 4YXHL 2V5TA 1YECH 2Z4QA 2NY3C 1I7UB 2Y5EA 4UDUB 2VSCA 3BPCB 1BFVH 4L3EB 4ETQA 5E8EA 1R3IH 2ESVA 4PBWD 5LJYH 4OCSL 4F9LA 3UJIL 1Y6MR 3UEZA 2XZCH 2NLJA 4BFGA 3M8OL 5C0AA 3C87A 2APWA 4ZAKC 1PFCA 3UJJH 5ID1A 1S9WA 5FKPB 1NC2B 3T09A 5EUOA 1ZHBA 3QP3A 2EE6A 2P5WD 4DWHA 3GSWA 4XC3H 4KJQD 2WMPA 3GBLA 3STZA 1WLHA 5I1EH 2FATL 4HGKC 1MFDL 1KPRA 4LHUB 4Z7QF 4E42A 2OJEA 3V4UH 1MVFA 2DBLH 2W92A 1NFIA 2OI9B 3G5XB 5BZDB 3EOTH 2XFXB 1JGEA 4RGNC 4U7KA 2A9ML 4NM4H 4B50A 4LOUC 4P0DA 3R8BB 3CMOL 1C5BL 3W2DL 5ICXA 2FBOJ 4PJDE 4NC0B 2VXVH 3TO4A 5JPNB 3QH3A 2Y72A 4O02L 3JWOL 4UBDD 5EG6C 1MFAH 4NBXB 5CFHA 3S5LG 5C92A 1WIOA 4AEFA 4ZFOA 3O6FD 1G9NC 4MJ5B 2NY6D 1MCWM 3MLPA 3HRZB 4U7MA 1D5XB 1OT2A 2BY3A 2VUOA 3U9PL 1K5NA 3GRWH 4YDLC 4H26B 1Z5LA 2F53B 5AWNL 4RAVB 4XVSH 5FYKE 5LKNA 3I3BA 1M7IA 1BJ8A 4LVNB 5E6ZA 5IBLD 4PREB 3QBTB 4JFDA 1ZV5A 4NWTH 2FIKA 3DV4A 4WV1A 4HKBA 1B0RB 3IDXL 3MMEA 5GGSY 3RU8L 4BQ9A 1TCMA 4QHKI 4MB4A 4LSSL 4AY0A 5AUMB 2BVPB 3BDYH 1ED3B 3EJYC 4NFBA 4XP5H 4HK3N 3UCRA 5FUOL 5T3XE 3ARUA 2L7JA 5ELIA 3P73A 1BD2B 1OGAE 4HK0B 1VADB 3O3AB 4G6FD 1MCWW 4G8GB 4M7LH 4JFFB 4YE4L 5B4MC 1SM3H 4GAJL 1JPFB 3PNWB 4Z77A 2J7LA 1H5BC 1R0AH 3T0BA 3C2AL 4PJXE 2DLFL 4QHMB 3CZFB 2C4XA 3MV01 1P7QA 2KUTA 1KPVA 5JPMB 1JTTA 4AIZB 4MMXC 2RCSL 4ZPVB 2NXYD 2PW1A 3TLRA 3R06A 5CMAA 3QQ9D 1VA9A 1E4XI 2QADD 1U8HA 4LBEA 2CLRA 4LLUA 3UPRA 4Y19A 3UYPA 4MXQD 3FKUS 4UT6H 2FJHA 1HH6A 4GBXA 2QKIB 4X6CA 5KANG 3UBXI 1A9BB 3WS6A 2EYSA 3EO1B 2GKIA 4KZEH 2GAZA 5HGBB 3MXWH 4L8CA 1MCIA 3FAXA 4PB9H 2BHYA 3GSNB 2FEDD 2QSCH 5D7IF 4LCCA 3WBDA 4XNUL 3CPLA 2DQFA 3BZEA 1O7SA 1JV5B 4OLVH 3LKRB 1IGIH 1URLA 5LCVL 3TJEL 2NR6C 1YEFL 4GT7A 4IHOB 5CIPB 3ARFC 1PKQB 2VLLB 4CAGA 1BBJB 4KRLB 3O3DB 3O2VH 2KDGA 1G6RB 5I1IL 2GUOB 3B2VH 2IQAB 3OKDB 3O81A 1RZIB 4HJJH 4NQED 2EKJA 4LLWB 1MLCB 3QXDA 3RY5A 5IEKA 3H2WA 4RIRA 1MCFA 4BH8A 4JFPA 2WZPD 3MRLB 3DLQR 2KQNA 3FQTB 3WE6A 3QXAA 3OXRA 2Z31C 4C83B 1HINL 4FMFA 1NCWH 3F65A 1NGPH 4MHHG 3V6OC 9CGTA 1IQDA 5C0DA 2X4RA 3AB0C 3IFOB 3HG1A 4DVBB 3Q48A 2NY3B 2ICCA 2V2WA 3QFJA 4LPCA 5TJWK 1B3JA 4Y5VA 3PGCB 3SGDH 5D71H 43CAA 2JK5B 1FPTH 2OMBA 3N0PB 4YPGB 1HILA 1XGPB 4Y1AD 7CGTA 3QRGL 4UQ3B 4W4OC 3CCHB 3MV7B 3PXHA 3CDFA 3P0VH 2UV3A 4OF0A 5HI3D 2GK0A 3H9SE 2BDNL 1I1YB 5E8OA 4ELMF 1QFPA 4XZUA 4ZAKB 2LABA 4WEMB 2H1PH 4O5LL 4K3DL 4PJ9A 1PSKH 2WUCL 4GXUN 1V7ML 3K4AA 2IAND 3CFBA 1A4JB 4HWBL 4MNGA 3B9KA 4PJBE 5FO7B 5D7JD 4PGEA 4JANB 5IVNA 4G6ML 4XGZB 4PG9A 5ESQB 2JJTC 2YPLB 1A6WH 1U3HA 2X4TA 3P9MA 4MJIE 1ZT1B 4JPIA 2CSPA 3UC0H 3ZKQD 2V7NB 2FO4B 3B2UC 3KPPA 5ISZE 3DSNA 5IIEB 5HYJA 5T1MB 2G2RB 1QFWL 4JRXE 1KG0B 2J8UE 3D9AH 4QRPB 1VCAA 2O5ZL 3IU3B 4QOKB 4RGNB 1MRFH 1DQJA 3QDMD 4PRPA 4YGVA 1BOGB 1C5CH 5F3HA 4LP5A 3GJFH 3VH8A 1LP9B 5DT1H 1PGRB 3HAEG 2C3XA 1ACZA 3NN8B 2B1AL 3S6CA 5IB4B 4S2SB 4KROD 5JW4Q 2EE9A 2NX5E 2BX5A 4Z8FL 3QZWA 3BKCH 5C08A 1HK6A 4HJ0C 2HRPH 2IJ0C 4N1EA 1KCRH 1LK2B 1A4KA 1V7NH 4WEUD 2FD6L 4IMKA 1X5GA 2P44B 2R2HB 3T3PF 4X99B 4TSAL 1RSFA 3L7FA 4YDLB 4W4NA 4GW5B 1KUMA 1P4LB 3SKNB 3O41A 3TBYB 3WFBL 1YN6A 2NNAA 1WUNT 3T2PA 2OZ4L 1ZWIA 3LKNA 5DMYA 2UUDK 5MHSD 1CDYA 1X6LA 2BVOA 1OPGH 2Z91A 3EO0A 3O6KH 5IHZA 2XWTB 1RZKC 3H7LA 4NKQB 3VMOA 5C9JB 2NTFA 4X6DE 2D2OA 5ACZA 2MHAB 4N1HB 5TF0A 4CDHA 5EOQL 5C09E 4PJGA 4OFYA 3NA9L 5JW5A 1S7VB 4ISVB 5FHAH 3VGHA 3GO1H 2LVEA 3P4OB 4H1LA 3WO3B 3CFDB 5GS2H 1MCDA 1L0QA 4RQQB 2F54B 1IKNA 4P48A 5HY9B 1K4CB 1FNGB 5F7FA 4N8VB 1DVFD 4YDVB 4JG1L 4PGBB 4D3CL 1FYTE 2VDPL 2X40A 5D1ZA 3VG0L 4HWBA 4LSUL 1A0QL 5A2JH 3M07A 3DGGB 4P4KB 4A6YB 4BQCA 1ZVSB 1FFRA 3DGCR 4JDVA 4POZD 4I4WB 3RJDA 4MMZC 4YDJB 4X6BB 2BXZA 5FK9B 2VH5H 3RVXD 4K94H 3RZCC 2AQ1A 2I60H 3WIFB 1S7WB 3BP7A 3R0NA 4NCC1 5CSGA 1S7XA 3NAAH 4NN6C 4KV5F 4WWKA 3HZYA 4YHIB 3B9EA 2P45B 3ARSA 1T7YA 4ODSH 3RRQA 3MGOB 3LEXA 5AYUH 4P5KB 1NAMH 4XBEH 3GBMH 3QUXC 2X5PA 3KHOA 3QO0B 3FRPA 3TZVC 3W11D 2PETA 1N0LA 2UVFA 2VE6A 3L3HA 1MCLA 3ALWA 5ALCL 2IMMA 3PV6B 4G42A 1MPAL 4L5FH 5F89A 3RDTC 3U4EB 4YK4B 2IG2L 3OAUL 1H3PL 5DGQA 3MSPA 1QFUH 4WEBH 1G7HB 1GHFL 4M7JL 5AD0B 4WI3A 3ULUL 5HI4C 3ARFB 3HZMB 4TQEH 4OJFL 4UDTA 5DHVH 4ALAL 4JDTL 2OZ4A 4A2MA 3GI9L 1Z3GL 4XNZC 5GS2D 4MXVF 3DYPA 5E9DB 1MF2H 1HHGA 2XXCB 1P4BH 4R2GC 4N0FB 1AO7A 5BQ7B 4MNQB 3QQNA 1JZ7A 1M4KA 2J88H 3GUTA 4OBSA 4U4BA 4R7NB 3SGEI 1K3IA 2APBA 5HHOE 3ES6B 3AB0B 5C7XL 5K9JH 1MCEA 4QTIH 4OKVA 1SJEA 1MJ7H 4Z78A 4L8DA 1XCTB 5F6HJ 1TZGH 4YWGL 3WKML 4Y16C 3VFMA 5IT2H 1RVFH 3AXLB 4YFEA 3ROOB 3HZVA 5DD1H 1WGOA 2ZCHH 3LRSB 2NY4B 3LV3B 4LMQE 2AK1H 1QLEH 5C0GB 1RUAL 4D9LL 3O9WA 1D5IH 2AJZB 5CGYC 4QTHB 1NH6A 3UBXB 2G60H 3RHWK 1F58L 4RFNB 4WY7L 1D9KA 4J3WA 4EXKA 3BZ4A 1G7QB 1U3JA 4OCWH 3RWHB 3LN4B 3C8HA 3QEHA 1INDH 4ZUTA 3WYRA 1GGBH 2YC1A 5GRUH 1NGYB 4WFED 5ITBH 1JPTH 5JIHA 4HFWB 3DX7B 1UKTA 3G5ZB 4TUJA 1RK1B 2DMCA 4U1NA 4XP9L 4S1DC 5KSAD 3T8XB 5IHUH 4P5TD 4ZXBD 2ADIA 4PJ8C 4PY7B 1DBMH 3IDJB 4P2RA 4QHUA 4KVCL 1UWXH 2JCCF 3DX9A 4HKJA 3VRLE 3F7YB 5CBAB 1U6AL 1MHPL 2DQJH 5I2IA 4GAFB 3EOAA 2X4QB 4HC1H 4U1HA 2OBGA 1UCBL 1DBAL 2CKBL 3C09C 1ZGLA 4WGWB 3PWLA 3FFDB 2FX9H 4KKBC 4MJ2A 5JDJA 1HOCA 1YEHH 4LRNL 1EUTA 2WIIA 4HS6A 3AMLA 2X4UB 4W70A 2VISA 3ZKNC 5JW3L 5EIVA 3EYSH 1ND0B 5T1LB 1T1WB 3QRFM 5FA4A 5CJQH 3MRQB 4LK4A 5D5ME 4Z7WA 1AHWC 4J2XA 2HKFH 5J6HA 4NT6A 3MNVB 4OT1H 3BYYA 1ZK9A 4MLIA 1F11B 1HYRC 4XCEB 5DQDL 1HNFA 2IFFH 4AH2B 5FF6A 4AM0A 5D2NA 2C3WA 2Q7YA 1FVEA 5EBWA 1UQSB 4TTGA 1FQ9C 3BN9D 4DEPC 2DI7A 1F6AB 1W0VB 3MOBL 1QRND 3S7GA 4ZO6A 5TDOB 3K7UA 3IFPA 4AYFA 2P8MB 4M93C 2PUQT 2VQTA 2BJML 4G43B 3VFGH 3HZKA 4HIHA 4N0YL 4WI7A 5E99H 4L1DA 5KAQF 3RI5K 3RZCB 3OKMA 4RGOH 1D6EB 2EZ0C 3VW3L 3D3VD 4Y4HD 3W39A 5I9QB 2BMKA 3AFLA 3OR6A 2CDEA 5ADPH 4NN6B 2CPCA 4QNPF 1J0KA 4JHWH 4XHQA 1LE9B 3NCFB 2VLRD 4PGJA 3V52H 3D0LA 3QUXB 2VLJE 3TZVB 3G6AB 5E8PB 3R1GL 1JGLL 1DBBL 4BM7A 5F3BB 3QIWC 2QHRH 4H5SB 2O5YL 5JHDE 5E2TL 3RDTB 2ADJB 4FXGA 3GSXB 4MXWL 3PF2A 2CKBA 4JKLA 4F7CA 1D5BB 1T6WA 3CAFA 4IS6B 2P48B 3BUYB 4L9LB 5E6IC 3I02A 3KXFD 3QDGB 3O6ML 3SDDC 4Z7UE 5IMMB 1KGCD 4X4YA 4KUCD 5A3IC 3D39E 2JELL 4ZS6C 1I9RH 1IGMH 5LXGL 1FZMB 4FZ8L 4KUCF 3PHOB 2RJMA 4JO2L 2ERJC 1PYWB 3WN5C 2EDFA 5HHNB 3VWJD 5FM8A 4GKNB 4F7MB 3U36A 5ESAB 3K2UL 3TN0C 3UYOD 3CUPB 3IDNB 1MJUH 1SMOA 1GPOH 4PRIB 4UAOC 4XPGH 4MNHA 5I1JL 4PJAF 1MNUH 5JORB 4EI5B 1NQBA 5HJ3B 4I2XE 3FT2A 3GDBA 1XGQA 5D9SA 2ICES 1PZ5B 4Y16B 1T83C 4MQTB 3SKJL 1JNHA 5DC0A 1N2RA 2G5BA 2AW2A 2QSTA 4WW1A 2E6JA 1V3KA 1ZE3C 4OZFA 4ZFFA 4IBLT 2XA8H 1MRCL 3MA7A 4JB9H 5JXED 4JGJA 1SBBA 1QLFA 4FQIL 1X5KA 3O0RL 3MV8E 3LD8C 5DMIH 4N68A 1TQCC 3EBAA 2ZOLA 4EXPX 4C56B 1I3UA 5IB5A 3SGDI 4B41A 2COQA 5DEFB 4NQSB 3BWUC 4G7YL 4Z7VA 1AFVL 4PRHB 3N9GH 1LDPH 4Q0XL 4OLYL 2B0SH 4FQLL 1A7RL 4KHXL 2EEAA 2HT2D 4KKCD 1WICA 4Y4KC 2FJGB 3QISA 1IGYA 3EIFA 5ANMA 4MVBC 4WNQB 5C70A 4YPJA 2GITA 3CFKB 4O4YL 3BGMB 5D7LB 3TA3C 1BPVA 3F7RA 4PJ8B 4FTVA 1VFMA 5JOFB 4YHMH 3D69B 2FGZA 3NFSH 1NPUA 3WHE0 3CSBA 3I6LD 3LQAL 4WUUD 2RFXB 3F58L 2Z93A 3V4PH 3WFEH 3VCLB 1J88A 3C09B 4KK5D 3FOLA 5HHVH 3WNOA 4I5BB 1TJGH 4M6MH 1L9MA 1P53A 1K9TA 2XQYG 3CDYA 5CEZD 2VIRB 5DXWA 5DRWA 2HT4D 3I50L 2F58L 5T1DL 1EVUA 1JK8A 1YNTB 4OZHF 4X8JB 1S7TA 4KAQH 5F9OH 3VFRA 4QCIB 5B21A 3KPMA 4Z5RA 3NH7L 2P8PA 4N5EC 2IH3A 1FZKB 2LFGA 4HIXH 4H88H 4DGYH 2MPAL 3CFIC 4Q6IA 1ZVYA 4F15C 5TGBB 4X80L 1UFUA 4P9HH 4QRSB 3LKSA 2Q3AA 2XNAB 5DA0B 1FV1B 5H37G 1AGBB 2DB8A 3JV5A 1CLCA 4KY1L 3OPZL 4DEPB 3TH2T 2HLFD 4ODVH 4L8BB 3MLWL 4KMTL 3WFHA 4U0QB 1IAOB 5B8CC 4JQVC 4OUUA 4EQ2A 4DN4L 3V5DA 3SDXB 2HJFB 4L4VA 4JFXA 4NO3B 5E1AB 4LSPH 2OLDA 5KVDH 4AZ8A 4PJHA 3ECBA 1JZ8A 5FA3B 2BSTB 3C9NA 4BZ2H 3TVMA 3PQYD 1A2YA 3IKCB 5T5NG 1FO0L 4OGAC 3BIBX 4Z18A 2OJZH 5DRZA 4E41E 4HT1L 3WDIA 3GEWB 4FQHB 4GKSA 2AJVH 4ODUB 3H8NA 4YAQA 2AXFB 2VITA 2E3VA 3GNML 4W68A 1DUYB 4P23C 3CH1A 2E9IA 1PG7X 4ENED 5E5RB 3QIWB 4OF3A 1HH9B 4ERSH 1X7QB 3D2UA 2WWMC 3I2CL 3VXQA 5CD5C 5F88A 5DJXB 4K7FB 3X13A 4MLSA 4L8SC 3VD9A 3MUGB 2FZ3A 3H42L 4ONHA 4CN1A 3VE0B 1FAIH 4GSDH 4JFYA 1YJDH 3K1KC 3L5WB 3RVUC 3SDDB 3MV9B 1WC7B 2HAZA 4S1SL 1S78C 2BNQE 3VXMD 3PJSB 5I8OL 2ERJB 2H9GA 3WN5B 3IVKB 4XP1H 1M71B 1JHLH 1QD0A 4X9IA 5ADOH 5C0BA 5INCB 4RFOH 1JTOA 4M7ZC 3F12B 3TN0B 2XXMB 3ARGC 5EOCL 2I24N 4MDIB 4Z9KB 1UEYA 3BGAA 4UAOB 1DBKL 8FABB 3Q1SH 1HI6A 2PW2A 5DHYB 1MFCL 1J05A 2AK4B 4ZODA 1YMHA 2YEZA 1UYWH 3H0TB 3PWPE 4ETYA 1IGTB 3ALPA 3KJ6L 4AJ0A 1OP3K 1MI5B 3MLVH 2VWEE 1S7UA 1MHEB 4Y4FD 1IM3A 4G6KH 5HDLA 4HX1B 1OCWL 2BVEA 4KI5C 4HUWA 3MODH 5DLML 2HLAA 3TIDB 1XF3A 3RAJH 1NGWB 5HVGB 4G7VH 2J6EL 3CFCL 4TRPL 4RMUA 4ZTPH 4JRWA 3LIZH 2D31A 5IGXL 1JWMB 1J8HB 5DQJA 1DDHB 3QUML 2K7PA 1TQCB 3TBVB 1J0HA 2CK0L 1FO0A 3RNKA 2AAVA 1X5LA 3QIUA 1QSED 4QT5A 5HYSB 4K94C 1HQRA 5E2VH 3O45A 4LEXH 2BRRH 1A1NB 2BVTA 4DGIL 4WW2B 4Y8AA 2MNUA 4MAYA 4Y4KB 2DYPD 7FABH 1UM6L 1KIRB 3TNNA 5GS1A 4UINL 1ERNA 1H3TA 2OL3B 4GRLD 3TA3B 2OTPA 2ZP0T 3VU2A 4KI1A 4QHLB 1FFOA 1JE6A 2GJ6D 5D7JB 4IRSC 3AY4C 2VLMD 4NQVA 1DZBA 3UPAA 4XT1C 4NJ9L 1X5ZA 4FQCL 3L3JA 1F3DJ 4PGCA 4RDQG 4K7PY 3IGAA 2Z8RA 4Y88A 1OW0A 1RULH 2MSPA 4K3GA 1J1PL 5DMGD 4XPHL 5EU6B 3W0WA 3FQWB 3ZE1E 3QNYB 4KJWD 1YNLL 4R2GD 5EZIL 4D0BA 1PG7L 2H8PA 4LPTA 2DJ4A 3NIDE 3OMZA 4MCZA 4IRZH 3DRTA 4NQCE 4Y2DD 1F4HA 1QACA 3VXPB 1UJTA 3MRMB 5BRZD 1T20A 5IB3A 2HT3D 3FT3B 1NSNL 4HPOH 5KN5B 5DEGA 2AKRA 3S5LA 2YMXL 3WLBB 3C5ZD 1FFPB 1CLZL 5DK2B 5C6PB 1T4KA 3MRCA 5IFHH 1R24A 4F15B 3BX7C 3LEVH 3QNZA 3T0EC 2J6EA 2VLKE 2Q8AH 2BNRD 3T0AA 5SWZB 5TDNB 3OR7A 3C60C 1R3KB 1J12A 4ZPTB 5DJDA 3CXDL 3QUMA 3SDAA 1UJ3A 4PJ7A 4YFLF 5B8CB 3P11L 3VXRB 3MRDB 4OV5A 3VXUB 1ORSB 4WFHE 1H15A 2XOTA 3MLTA 3FB8A 4R96A 2XA3A 3WLWC 4LSDA 1WBYA 1I9IL 5T5FL 1FAKT 1QA9B 3PXJA 4P2QE 4G9FB 2P5WE 4YHLL 2E7LA 2CLVA 1H3UA 4DKFH 5I6XC 4JREB 4Z7QE 2B4CH 3ZL4L 4RZCA 2R2EA 4GMSH 3FO1B 4P23B 1Q9KA 3NCJH 5IBUG 3GJFB 5MEQA 3NCYS 4Z95L 2VDOL 3ARBC 4EN3D 1Y6NR 1U42A 2YUWA 2NZ9D 4FFYL 3LPWA 4IDJH 4LIQL 4M43H 5BOZG 4I0PC 4P2OD 4OGXL 4TPRL 2O5XH 1TITA 4GUPB 4JZJB 2R4SH 4L8SB 4EQ3A 4QY8A 2OP4H 5IVZA 1NUGA 1YNKH 5IOPB 3PWVA 2IMNA 2N7BA 3A0OA 1IC5L 3GMNA 2YN5A 4WU5B 5I1LA 1HHHB 4ZUSB 5GZND 4TVSa 4UV7L 5IBTL 3U7YH 2VB5A 4PJIB 5FYJH 3T4YB 5ALBH 5HYQB 2B2XL 4LLMB 5F7NC 3STLA 5TE4H 4JKMA 1XR8B 3KHQA 4HUVB 5CSZB 4ODTH 4PLJD 4M7ZB 5IJVB 3ARGB 3LH2L 3FTGA 1K6QH 3FB6A 5BCAA 4GQPH 4R0LC 5FV1L 3C08L 4N0CD 4DUXA 4XVJH 4GS7C 3BRDA 3D85B 1CVRA 2EO1A 1ZLSH 5DK0A 35C8L 4R9HA 2JJWA 2C3VB 4XWOC 1NCBL 3VFWA 4FQJH 4N5UA 3CDGB 3MCLL 2X7LB 1Q72H 3ZT5A 3GMOB 3DTXB 3KWWA 3AU1A 3V4VL 1RZ7L 3ULVC 5HVHC 4UTAL 4I48B 5CJXC 2IBGA 5D2LB 1KJ3H 3E8UH 4GQ9H 5GSVA 5EB9A 5E94B 1AY1L 3WS3A 3CFEA 1CK0H 1C5DA 1MIEH 4C58B 4PJCB 1G84A 2YA0A 3ZMRA 4KRPD 3TYGH 1EIBA 3QI9D 1ZS8B 3PUCA 2W60A 4OIIL 2X10A 4XRCA 4E0RA 3QQ3B 2XQBL 1U8QA 3KPRD 3O4LB 4WO4C 3LB6C 3QHZH 4ORGA 2ENSA 4AQ1B 3WJJA 1ZGLM 4FXKB 4D0DA 3FN0H 1GRWA 3JWNC 2VXUH 4KZDL 1IQWL 2WLYA 1AQDA 4LCYB 2AXHA 3EO9H 1SEQH 2WINA 4HWEL 4MD4B 1RUMH 3PG2A 5F1IB 3MUJA 5ESVA 4JM2C 3WL9A 3ARPA 3OTTA 5DC4B 4XC1L 2NQCA 5EIIB 1N6UA 5DRNB 1DSFH 3CU1A 5FYJD 1NAMB 4IOIB 1FJ1B 4KK8D 3OL2A 3FT4A 1T2QL 2Q8BH 3SPVA 5E2WH 3NTCL 2EIZB 4DGVL 3T0WA 5BVJB 5FECA 1FIEA 3MROB 1YEIL 1U8KB 3HMXA 4CN4A 6FABL 1XCQB 4K23L 5EBMB 3JV6B 3GKWL 2KQMA 2P46B 3D18B 1A7PL 1E28B 1HKLH 2C1PB 3MGTA 4FQ1H 1TTUA 2E27L 1G9ML 4JN1H 1Q9OB 4CMMA 5IVXB 4GRMA 3MLZL 2XKNB 5TE6H 5KSBB 3RZWA 3BKML 3MR9B 4MD0A 3HAEA 4M1GH 3QUYA 5LBSL 3GK8L 5F70A 4JVPA 5DHVB 4V1DA 1RI8A 2HVKB 4PP1D 4P3DB 4RWYH 1Y18A 5MP6L 4J3VA 3U0WL 5F9JB 1RU9L 3QG7H 1XGYL 2OM5A 1G7IB 1I7UA 3BPCA 1UVQB 3P3YA 3RUGF 4L3EA 2QQKH 1AC6A 3QDHA 1T7XA 1SJHA 4NQEE 1EJ6A 1YEEH 3RWJA 3T2NL 2PCPB 3WUWG 2VSDA 2E9WA 3O8XD 2YD1A 5IW1B 2WK2A 2IALB 3T0EB 1ETZB 3EDJA 3BKYL 3I3DA 3V2AR 4MX7B 5FKPA 3HR5A 5GGVL 3DROB 2ARJQ 4PTUB 3HUJF 3RWEB 5DZLA 1MFEH 1ZEAL 3TV3L 5EZLB 2IADB 3G5YB 2P7TB 4NQDD 4YBQC 4AL8L 3REWB 3S97C 4KTDH 4ELME 2DWEB 3L6FA 2MKWA 2C4FT 1OP5K 3ZSSA 3G5XA 5CCKL 3S3JA 2FSEB 5BZDA 1RK0B 2XFXA 1GL4B 1RV6X 4NOFA 1EMTH 4ZUWB 5INDB 5D7SH 1GXEA 5DD6B 4UT7H 5BXFA 2DQCH 5IQ9A 4BH7A 2VDQH 3L9RB 5A2KH 2H32B 2ED7A 8CGTA 5SWQB 4NZRH 5BS0D 4J8RB 5GISL 4WV1C 4BUHA 3KPQB 3F5WB 1EEYA 3GSNL 3QDME 2PF6A 1D5XA 3JSSA 3RL1B 3VD5A 2NY7H 4I0PB 4K8RD 4FFWD 1LGVA 1HXMB 3HC0B 1XZ0B 3MOQA 2F53A 5DJ0B 1TJHL 4RAVA 3TH4T 1HHIB 5F7EH 1LO0L 2XTJD 4JHAL 5HI5C 1QYGL 3MLUH 4KQ4H 4PREA 1G6RL 3JUZA 4X7TA 1DUZA 5CD3B 1LE5B 2AJSH 4QWWD 4HPYL 4Z0BH 4KDTA 2QEJA 1A6ZA 2W9EH 5I1HH 3T3PE 2R0LL 1CZ8L 1U92B 3KYAA 4G9DB 1B4JL 1B0RA 3SKOB 3UTSD 3IU4L 4ZNEE 3FB7A 1TJIL 1QFOA 5AUMA 2BVPA 4JFEA 1ED3A 5C07D 3KS0J 5B39G 1WZLA 5GQBA 4HAGA 1EO7A 5EC1B 1BD2A 1SY6H 1VSCA 4XPTL 5HHXH 3QDJD 4HK0A 3GB7B 3KPOA 4JZOA 1VADA 2FGWH 5MHSE 5D96C 1DEDA 5C0JB 3L3GB 3PNWA 2PO6C 3QB7C 5HVHB 4GBXC 4JFHD 4P9HC 1JRHH 1NLDH 3MC0A 4KXZI 3WS6C 1E6JL 4YUEH 2BOBB 3WJLC 2AEWA 4NKDB 4L4TB 3EW3B 4QHMA 5C0IB 5MEOB 2R56H 5CP7B 3IAPA 2X1XR 1XEDA 5JPMA 3BSZL 4AIZA 3SGJC 2ZNWA 1QSFB 5DD3L 1AGEA 4ZPVA 3OKKA 1N3NB 5HHMD 3BEWB 1KIUA 4NC1C 3WEXB 4PUBL 3A6BH 4JY6B 5B3JF 1JF6A 4WO4B 4XPAH 1RJLA 4F37F 2VC2L 2D7MA 2BVUA 2M2DA 3GSUA 2QKIA 3ZO0A 1PEZA 5DO2D 5F7MC 1RZGA 1N5YL 1CE1H 3JZ7A 2OXGA 2P47B 4PD4K 2AV1A 3UP1A 3EO1A 3FO2A 4TTDD 4LF3A 1S3KH 2UZYB 1I8KB 1IEHA 2XN9B 1DL7L 1G9EA 5L9DL 1T1XB 2FR4A 4JM2B 3BAEL 3ZTJH 4JRYD 3GKZA 1F3JA 4L3AA 4KV5E 4M8QA 2CLZA 3FFCB 3V6ZA 1U93A 4WHDA 1MWAH 3BKJL 5FGBC 5CSBA 1N8ZB 1JV5A 3LKRA 1MJ8H 2VZOA 2R4RL 2DMBA 2Z4QB 4PD4J 3OX8A 5JW4R 1FBIL 4IHOA 3ZE2F 2VLLA 5E8NA 1G9NL 4ETQB 5J7CC 5E8EB 2HMIC 4WI9A 2VDLH 2Y06L 2C5DC 1YEJH 2HH0H 1BVZA 2IQAA 4Y2OA 4NZUH 3IXAA 1YJDC 2ID5A 3SE3A 2WM0A 1NL0H 4IRJD 5GSRB 3FQTA 4LRIA 5ID1B 5EUOB 1ZHBB 4OLUL 4C83A 5IW6B 3ZYIA 4XTRC 4RISL 1EV2E 1OGTA 3C5SB 4HBCH 4NRZA 2BY0A 3GSWB 3DETC 3UTTD 1FG9C 3IFOA 4DVBA 3O6LH 1S9KC 3MCG1 3STZB 1U3HC 2J8OA 4MXVE 5EU4B 5L6YH 5E56A 5I8CA 1KIQB 4YPGA 4WCYL 4IOSD 4HWNA 4HXAL 4WHTA 1KPRB 4UQ3A 4E42B 1FLRL 5DSCB 2OJEB 1B0GB 3CCHA 3LPGA 2BNUA 1II4E 4JJ5B 4MCYA 2QLVB 2W9DH 1E6OL 3FJTA 2VMFA 2A9NL 4UNVA 4OZIB 4FNLL 5HPMB 5E4EB 5FYLH 4I3RH 2HA1A 4ZAKA 1HHJB 5JA8B 3Q6GL 1WBZA 2W07A 2YXMA 5BVPL 1IZJA 3DMMD 1FDLL 3QR2A 3T4AB 3U4BH 4PJCF 5FO7A 3RWFB 2D9QB 4JANA 5E08H 3THMH 4XGZA 1WAAA 5ESQA 4DK3A 2YPLA 4HCRA 4A6YL 4G8GE 1ZT1A 2OQJB 4JFFE 4GW4B 1YMMD 2CJUL 2FO4A 5J9PA 5IIEA 4OZGB 2G2RA 4XNXH 3SY0B 4P59H 1KEGH 1F13A 3NPSB 4QOKA 3IU3A 2XRAH 2BSRB 3N1FC 2OK0H 1B88A 4F58H 1EJOH 4TSCL 1C1EH 4NFCA 2EXWC 1OTSC 2E6QA 5JHLL 2VZUA 5E03A 3HTLX 5IB4A 4X4ZA 4XNYH 1M7IB 1FIGH 3U30C 1WZKA 4JFDB 1CLOH 3UJTH 2FIKB 5DUPH 2W65B 2R9HD 3RWGA 5I18L 4EOWL 4HUNB 1N64H 3HNTH 4WFEE 3AMKA 1PQZB 3JUYA 4HIIB 5HGAB 2HFTA 1U2HA 1Q0YL 4M7LT 2UUDH 3PWJA 3SKNA 2AJYL 1NBVH 1ZHLB 1IKNC 3TBYA 1ADQL 5L2KD 1XIWC 3Q2CA 4EKXA 4HV8B 2V2TB 2JCCE 3GMRA 5IQ7H 5D1ZC 4Z77B 1AXSB 4CKVX 2DKMA 1XGTA 1CF8L 1PKQE 2XWTA 4U2ZA 5KTEH 1DQMH 5C9JA 3X3FH 5HYIA 1GGTA 1YEDA 4NHCL 2MHAA 4OD2A 2AV7B 2UWEF 3GSRB 3G6JF 4KWUA 1AQKL 4ISVA 2D7QA 2V17H 3P4OA 4XCFL 3CFDA 3R06B 5CMAB 1RAMA 4K9EH 2F54A 2APVA 4WWKC 4NDMB 1A3RH 2CLRB 4N8VA 4YDVA 3UPRB 1HNGA 4PGBA 4M1DH 4Y19B 5D96B 2DRUA 3CH8A 2FJHB 1WFNA 2PO6B 4GBXB 5E7FA 1J1OH 3DGGA 5I15H 5M7QA 4OCXH 3DVGA 4P4KA 2EYSB 4A6YA 1CICC 2KZ1B 4XWGL 3VDBA 1ZVSA 2GAZB 2ZCKH 4ZO7A 3MV7E 5KAQG 3BYTA 5DYOB 2FH8A 4X6BA 2Y4SA 5FK9A 5GS0H 1FVCA 2IPTH 3WNPA 3EYFB 3RWDA 4DVRH 4LFHD 3ZTNH 3WIFA 3BZEB 1R6VA 1TZIA 4MSWB 5MEND 1T03H 4APQD 2I9LA 2EDYA 1N7ML 4V2BA 2LE9A 4YHIA 4X83A 3MGOA 5D1XD 3LDBC 1HXYB 2D7TL 5FYKH 3HLAB 1UM5L 4JVWA 5J89A 3RWCA 3VGFA 4RIRB 4BH8B 2W1NA 4QGYA 3VFVA 1BWWA 5DURD 3D3VE 4QRPE 4QNPE 3OZ9H 4R4NC 4M48H 2B4CC 1FORL 4DGYL 4WUKH 3O2DL 2OTUB 1YUHB 4F7PB 1UT9A 3CZJA 2E8ZA 1G7HA 2X4RB 4LSQH 2Y07L 3HC4H 5L7XL 2V2WB 3QFJB 4ONGH 2VLRE 43CAB 1RZFL 1ADQA 5DTFB 2OR9L 3HZMA 1HILB 3TNMB 5T3XH 4M5YL 2DQTL 3ZKMD 1IBGL 1ZANL 1UB5A 5E9DA 4GG6B 4NBYB 1NEZG 2GK0B 4OCYL 5FDYA 4OM0L 1KCSL 2XACC 4BZ1L 5E8OB 1LHZA 1FCCA 4XZUB 4LVEA 5BQ7A 4MNQA 3UTQB 1NGQH 5KS9A 2CH8A 3KXFE 4XI5D 3CFBB 4R7NA 4MNGB 1F8TL 3F8UB 1KGCE 3RTQD 3ES6A 4PGEB 5JXAL 4FZEL 5F1NB 1T66D 4HGWB 2YSSB 1RZKL 1U3HB 1XT5A 4PJDF 1G0YR 3P9MB 3TT3H 2NY5H 1VACB 1U41A 4KK9C 5E2UH 5HYJB 4PR5B 4NNPH 3VXSE 5IK3B 3ROOA 1Z0NA 4OD1H 3AS3A 3LRSA 4UB0H 4UT9L 2AABL 3ULVF 4PJAE 3VH8B 3VDAA 5C0GA 2EYTB 1MCNA 3CLFH 4PPTA 2Q3ZA 4HHAA 4QTHA 2LAAA 3UBXA 1FHGA 4LQFL 4UIKL 4Y2DB 2X89D 5FYKD 1V3JA 3GJFK 2Y36H 1TVHB 1GGCL 2JJTA 5C08B 5SV3A 1G7QA 3ARXA 1I75A 3RWHA 3LN4A 3BIKB 2GW5A 4F7TA 3QQ4B 3WSQL 1TVDA 1DANT 2BC4B 3GZKA 1V05A 1IC7L 3FCTB 3A6CH