1BMWA

A fibronectin type iii fold in plant allergens: the solution structure of phl pii from timothy grass pollen, nmr, 38 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLLEN ALLERGEN PHL P2
publication title An Immunoglobulin-Like Fold in a Major Plant Allergen: The Solution Structure of Phl P 2 from Timothy Grass Pollen.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 5
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1998-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1bmwA00
1WHPA 4L48A 4JS7A 4FG4A 4FFTA 2HCZX 3D30A 2JNZA 2VXQA 4FERA 1WHOA 3FT9A 2BH0A 4FG2A 1BMWA 4JJOA 3FT1A 4JCWA 1N10A
chains in the Genus database with same CATH superfamily
4LGPB 3SBRA 3WAKA 3O6LL 1TLMA 1OW0C 4LLDA 4WNQB 2E3VA 3SKJL 4GQPH 2O61A 2EAEA 1Z9LA 2G3NA 1BLNA 1B6DA 3OLDA 1JYNA 4C58B 1Z66A 3RVUC 1FYTB 2XXMB 3D85A 3ILQD 2RTTA 3FAWA 3VXOA 1NEZB 1Y6NR 3CXDH 4KX9A 3GSRA 3QRLA 1T0MA 5HJDA 1N5AA 3PRZA 3VD4A 5C0AB 2COVD 3V8CA 2EYSB 4P5MB 3VGGA 5DUBA 4UQEA 2XWRA 4MMZC 3TCXA 2Y36L 4BXVA 2OZ4A 1NC2B 5EOQH 2VDKH 4WJ5B 4N8CL 4XVTL 1TKWA 5CEYB 5AKSA 3T2PA 3QZPA 3KS0J 5J1AA 1NCCH 1UEYA 2XSKA 2G3MA 5GGTA 1KBWA 2ENSA 3FU9A 1G4MA 1UFGA 1GZPB 1VGKB 2LLNA 3H7LA 1T1XB 3HS8A 4HLJA 2DYSB 1GAFL 1BECA 1O7VA 1TZOA 3BJLA 4HJ0D 1ZGLB 5D7EA 3FO1B 4NO3A 4GG6E 2VOTA 3RE0A 1L5GA 4YO0B 2P49B 4N22A 2NY6D 3GBNL 2PCYA 1JWMB 3IXAA 1BGXH 1UXWB 2GK0B 2NZ1A 2VE6A 3EGSA 2Y7OA 4KJYA 5HDBE 3HHSB 2UZPA 3AQZA 4FD0A 3UGUA 5JZ7C 5GZOD 4JG5A 2CLZB 4M62H 2X5PA 2FO4B 3B1UA 1Q0EA 3BSZL 1BZ9B 2QLVB 5I6LA 1AKJD 5BRZB 4MBRA 2ERJC 2ZXBA 3KYMB 4H25A 1N64L 4JPWH 4K5LA 3IDGB 3VH8B 4TNWK 1KCVH 4AT6A 4XCYA 5ITFA 3OMZA 3ARBA 1T22B 3L1GA 3VQLA 3TBTB 3BKCH 4NBXB 4GO8A 1MH5A 4OFPA 4HKXA 5DC9B 2BZ7A 4I9WE 1LEIA 5I1IH 2WP3T 3A6BL 5B38G 4JCWA 2OXHA 1L9PA 1FE8H 3MV8A 4UU9B 5H37H 4M7LT 3FN3A 4TNEA 4M43H 4IBVA 4TN9A 4GW5A 1ACCA 2ZOTA 3WUWB 3EXLA 2ADIB 2YSSB 3K71A 2Q76A 2E47A 1LDSA 2R1XA 4U1LA 2VQUA 3QDGE 4ZW5A 1XAUA 2CRMA 1UH2A 2ESVE 4NRYB 2CO7A 1U8MB 3NJHA 1JGDB 1KJVA 1KEML 2W60B 2FATL 2PNDA 4JRXE 2HRLA 5T3XD 1A6PA 3V5HA 3VWJA 4PRDA 5D7SL 1UQSA 4UT9A 1GR7A 3SO5A 4XVSH 1NFAA 2NYZA 4EXKA 2NY3B 3GHPA 4HKBA 3UJIL 4NPYB 4TQEL 4GRMA 5AAPA 5ES4B 1HYSC 4A6YH 1C5BH 1LK3L 3S3CB 4YSUA 1MW0A 5DHVH 5LBSH 2V7HA 4O2EB 4JL1A 4YH6A 3GSVA 3KLAA 3S4SG 4RWYL 2BSBA 1NSNL 2GEEA 2VGLM 3LNIA 3TTSA 1DUZA 1JZ2A 1JD9A 3VRLE 2E7LC 2X10A 2BW5A 1N18A 3UZVB 2F5AL 3LXUX 4MCNA 4J2XA 4AKPA 1AXSB 3CLFL 2YC1A 5CHNB 5I6KA 5ESVB 3AS2A 5DMYA 4CN1A 2Z1KA 5DMGD 2D9CA 4PUBL 1S3KL 2Y23A 4R7LA 1I7ZA 4Y19B 4X6DB 2Q6WA 1TXKA 1XGPA 3TFKC 1WS7A 1AD0B 3A4EA 4PB0H 3CN4A 3DPDA 1PSKL 3PQYA 4YSCA 2WK2A 3BGFC 1YMMB 4WU5B 4YDKH 2B1AH 3ZTJH 1A6UH 3I3DA 1CF8H 3O2VL 3QFJA 1WFIA 4K8RD 3ZHKA 2EE2A 1YPZA 2O4EA 3GXIA 5ISZB 3OJDB 4EIGB 1SGKA 1HXYB 5DVOA 4DPAX 5IFJA 4PJ8D 4DFIA 2X38A 2G75A 4IU3B 3UP6A 3TU6A 4DQOL 3HMXL 3GJEB 3B9AA 1KV7A 2CO6B 4L3EB 4WW2C 3VFTB 4FG4A 2J57A 3O6FC 4NKMB 4DZ8B 1UA3A 4IMLA 1NOAA 4QHNB 2F58H 3A22A 3JWOH 4WW1B 2G2RA 1AZNA 4U1IB 3US9A 4BELD 2R51A 3ZKSD 5DJ0B 4YLQT 1CE1H 1WHOA 5KSUA 1MFEH 2XX0A 2VMFA 1YNLH 3T6XA 5KYUA 4N68A 2EVHA 1H3TA 3VXUD 5SWZB 1YEHH 1AIZA 1UUSA 2WLHA 4M7LL 1MRDL 1A6TB 2X1OA 3OXRB 4JQVA 4XB3A 1NFDB 5KS9A 2DMBA 2UXFA 4KPHH 1F0LA 2FJSA 4G9FD 3UTTE 4E42A 1IAOB 3D2UB 3EFOB 4KU1A 4R0LA 3UFIA 1PY9A 5GGQL 5ABAA 2NX5D 2XQYA 3BRGC 3MV9D 3OZ9H 3QUZD 1LO0H 1JGUH 1RHHA 3X2QB 3TJEL 3LY6A 2K0RA 4UTBH 5TE7L 1MAKA 2VR5A 4V1DD 2WQAA 3QORA 5F6IB 1KCUH 1M7IB 4M61B 3O3BB 4AXWB 4FQIH 3SGJC 1HILA 2BCMA 2HJLB 1ZT7A 2KZ1B 2YK1L 4GNKB 3PS6A 1AS7A 1JCKA 4YVNA 3G6JF 4MDIA 3U9PL 2BIIA 5D2LE 2DLTA 4AE1A 1IC0A 1P4IL 1WAAA 1UWXH 3ARGB 1DCEA 1F58L 3QWRA 3UZEC 4GP8B 1T1WA 4QRAA 1I7RA 4DVBB 4HIJB 4F3FB 1CFTB 1G0DA 1ORQA 2OFQA 3QQXA 1F42A 2CKNA 1XXFC 3I3BA 3CDGA 3JZYA 4HK3N 3SE4A 4Y1AD 5CILH 4L8CB 5GHWL 1JZGA 3DARA 3HFFA 3PWLB 4KQ3H 3D48R 1CDIA 2RA1A 3LD8C 2NYYD 1R3KB 3POHA 5FM5M 5E2UH 5SV4A 1R17A 3QIBB 4HJTA 3VACA 1EHLL 1R1CA 2BSED 5C08D 4XR8C 3SZ6A 1SEQL 4MFHA 4YFLF 1HHHA 2VZUA 1KIUA 3K2UH 4LLMB 4YSDA 2HWZH 5AVYB 3K4DA 2D9QB 4OCMC 4O4YL 3ULVC 4N8VB 3MRKB 5ICXA 2EP6A 4KZEH 1PYWA 4NO2B 4JFHE 4NQVA 4S1QL 3LEYL 3RWHA 3NPSC 2CR6A 5KYYB 5BXFA 1RCYA 1XEDA 3QT2A 5KSBE 1DN0A 1JYXA 3EJSA 5F7KC 4JFZH 3GB7A 4E9LA 4WI2A 1JZFA 5M95B 2NY4C 3L7EB 3WXWH 1M1XA 1Q0XH 1LLAA 3BKJL 1SBSH 4UYQA 1YCSA 5F1OB 5F9AC 1NIFA 3WMQA 2AHIA 4CVXA 5JTWA 4HZLA 5T1KD 1UKQA 2JI2A 5GRJH 4HEPG 4JHAH 3MR9A 4WI0A 3WNLA 1A21A 2YAMA 4YBQC 5I6XB 3OKLA 4F7PA 3H42L 2XNAB 2HVKB 2R0WH 2GUYA 4B96A 5HVGB 4LVNC 4FQHB 5DZJA 5FFGA 3DBSA 2AANA 2IALA 3QI9C 4F58L 3WJMA 5FOBB 4FF9A 4D0BA 1U8NA 1TQUA 3D0VB 4CADB 2BSDA 3FB7B 5F88A 1N4XL 1OZUA 2BOLA 4G9DA 4PB9L 4Y4HA 1J8HA 2QADC 2F68X 3E2HB 4G72B 1WFUA 1OLLA 4F8NA 3HE6B 3DX3A 4YZFE 1USQA 12E8H 2LFEA 4JANB 4N1HB 3QUXB 3IN0A 2IDUA 5CINH 3BEVB 1J1XL 2J5WA 2P52A 3M7OA 1B0GA 5FLUA 2HG5B 1N10A 3BESR 2ZCHH 3QA3B 2PW2B 3TNNA 2E9JA 3FK3A 1WIOA 4JO1L 4XPTH 3DURA 5D70L 3V7MA 3DUSB 2CMRH 1HHIB 2MTPA 4M3KB 5DHYA 4FADA 4UTAH 4QHPA 1MG3C 2ZCLH 2JQZA 3HPLA 5DWPA 3ASOB 4WI9A 1EJFA 1OTSC 3WE6B 1RZJL 4BFFA 3S96A 3D52A 3UTQA 4GW4A 1JWUB 1JUFB 4UWQB 1VSCA 4FGMA 2FL5A 1AFVH 3JQOB 1RZ8A 3X14B 43CAB 5F7HA 1MFDH 2GI0A 1MKFA 2JJVA 5CU5A 4KI5F 1WEJH 2VLJB 2BZCA 3HTLX 3IRCA 3OZKA 1F18A 2FT6A 2Q8BL 1G6RA 4EIZC 3V4PA 4RGMC 1JPEA 3BD3A 3JUYA 5I73B 3D12B 2Y72A 1PG7H 4H2AA 2G9KA 4YE4H 5LGKA 3SDDA 4NQUA 1HH6B 1A6ZB 3V6OE 4LSDA 5D1XA 1F8TL 2X1PA 4AJ0A 3FTUA 4DO6A 3ECWA 4AVJA 2J8UE 3AQXA 4POUB 1N19A 5PAZA 5IMLB 4LBEB 1WBZB 1JNHB 3UROR 4LCCC 2ZKMX 1REIA 4X5XB 3RTQB 4LIQH 1VADB 4ZPVA 5FKAA 4CRPA 1NCDH 5J12C 3CZUB 4ABQA 3IDXL 4ZMLA 4HHWA 3MLPA 1WBYB 1HEJC 1FNFA 4PJCB 1TQVA 4UTCA 3LH9A 5EOCJ 5TFSH 4EUPA 4H2CA 2HPOA 5J06A 5I76A 4Q97A 3BW9A 4A7VA 4QAWA 3NFPA 4FA6A 4L18A 2L4OA 2EE9A 1KJ2L 3O3EB 4I3SH 3N0AA 3MUHL 2J2ZA 2QHRH 1NCBL 4XP4H 5C1MB 4MJ5B 4YIQB 5SX5K 4AQ8C 4K3DH 2CBOA 5BQ7B 3W9EA 3BVNB 1PKQE 4Y16D 1QUPA 3QJOA 2H0EA 2VDOB 1TVHA 2XWTB 4WCYH 5E95B 3NRPA 3LKPB 5JOPD 1HHGA 1JXKA 5DRZB 4ZMXA 2VLMD 2R2CA 5IJVA 3O2WH 4B3VA 1FNLA 1LP9F 4YUEH 4FNSA 1JNLL 3BP5B 3W2DH 3RIFF 3RJDA 4PGZA 1SVZA 2Y1AA 3L3OC 4BCZA 1C16A 1FI8C 3CHRA 3ROLA 3WJJC 1S9WA 4OQTA 3H9HA 3UBXB 4QRPD 5GGVH 2OI9B 4UILH 3C08H 2IANE 4UQCA 3MRLA 2EXYD 4QT5A 3LKSA 4PJFA 4Y8DC 2EKJA 1Q9WA 1NINA 5H94A 1T20B 3ARPA 2VLLB 2E7DA 3QWOB 2Y0SA 2YN5A 5D1ZC 2ZWZA 3C6LD 4XH2A 4A7QA 4CDGC 4N1CA 3EBHA 3DYPA 4FFVD 1TTBA 3N41F 1MFAH 4NGHL 3KXFA 1G1KA 4ZPTB 3FOLB 3IMVA 1WZLA 3SE6A 2CQVA 5FA4B 2YR3A 3EBGA 1MI5D 4ZFGL 3TWYA 3IVKA 5AW9B 2FLRT 1CDCA 2F7RA 2LLGA 3G5VA 1J05A 5L6YL 1AGBA 3WMPA 2XQ0A 1XF5B 4GYBA 1UB6A 4LASL 1PS3A 1DVFD 4E9XA 1QASA 3I6SA 5IW6B 4GEIA 1JIBA 3UBXG 4CW1A 4DKEL 3BGFB 2NY6B 1RZ7L 4N26A 5DEGA 1HI6A 4UDUA 4TULL 4EN3C 3TBVB 5KTEH 1LP9A 3SPJA 3T0EE 1D5IH 3GSUB 3RL1A 2VN3A 4GKSB 3PP4L 5I5IA 2NY1D 3TGXA 1Z9SA 1AKJB 4ICXA 1V3JA 1G7HA 4N4YB 1SDDA 5IM7A 5KYWB 4PRID 3MTXA 5IHLB 1P0SE 4FI6A 1XB3A 3O8XC 5KSVB 2X9YA 3WFBL 5CSZA 4ZZKA 3IMUA 4EN2A 1GGIH 2AQSA 5ERWB 5A7BA 3RZCC 4JM2F 3IPEA 5F1IB 3K6NA 2HKFL 4XP1L 2WQWA 4Z95L 4I2XE 3DPBA 2Y3AA 3LEXB 3C09C 3TXAA 4PR5B 3RU8H 5HJ3B 1JV5B 2IEPA 4O9HH 2ZOKB 1M7DA 1K9TA 1OK8A 4HPHA 5EWIH 1XH3A 1XF2A 4XHJC 1T2QH 1CL7I 3WIIL 1OALA 2W9DH 2X4QB 4FYRA 1CICA 4AYSA 2Y7QB 1AXTL 4FQLH 2BXZA 3QQ4A 1OGAE 5CJXC 4YS4A 5D72L 4M03A 1XGRB 2OTWB 3MLXH 5F7DA 3SO3C 1AH1A 2WGXA 3UJJH 1IAIH 2YMXH 3QO0A 1IAKB 3MA9L 1IFGA 1G7MA 3G7TA 5I8KH 2ZSWA 1G9NH 4K8RL 5JHDE 4AC2A 2IVFC 1NCOA 2C1OA 2ICWA 1CD8A 3NIDB 3IFLH 1UXLA 5E2TH 3QZWB 1B0RA 3SE8L 2LFGA 4DH2A 1KYOK 4NYLB 4NQEA 1BQUA 4L0ZA 5J1SC 2WZ6A 2ZKYA 4OLWH 3TV3L 3F7KA 4PJHE 1J5HA 2IGTA 1QSEE 1SFHA 2NY7H 2DBLH 5C9KA 2F1EA 3PHQA 4PTTA 5EC2A 1R0AL 2HTKC 2XG4B 1AP2A 3T65B 3PWPE 1IM9A 1XVSA 1RJLB 3QRGL 4WU7A 5A2JH 1L7TH 4TTDD 1CDJA 3FCGA 4QGTA 4XE0A 5E56A 5CJ8A 2AW2A 3HLAB 1INDH 3LD8B 4FFWC 1IAMA 1SJHB 4GKZB 4IIZA 2X1XR 5D1ZA 5DJ8A 3KL0A 1DLHB 9CGTA 3VD9A 4J5VA 5HYFA 3D4ZA 3WJLA 3B1TA 4GRWE 2OMZB 2YGPA 1AYOA 3IN2A 4GSQA 2BP8A 1S9YB 5D5MF 4GEJA 2WUBH 3MREA 4N5ED 4D9QE 4NM8L 1VGEL 3MLSL 5CMAB 1G7LB 4OGXL 4P57A 5IHUL 1E9PB 3IDMB 2VR4A 3S7GA 5DQJA 5KG9A 4PJ8B 4BIKA 3CHOA 2VSCA 1UD4A 2JXMA 3C2AH 3NPSB 5JPMA 1ZVYA 1AG6A 4W4NA 2XN9D 4UQBA 4Q74A 3PL6A 1KENH 3L4UA 1QTPA 3CFBA 3QRFM 3VGFA 1MREH 4AGLA 3MFGB 4O2FA 4XX5A 2D7QA 2R1YB 5J5EA 5FYKD 3MPCA 4YFEA 4NZDA 4KKPA 4PGCB 4YAQB 5EU3B 4UUJA 1GIGL 2FVNA 5KVFE 3N42B 1NDTA 1MFMA 4JJHA 3ABGA 5EO1A 3GLDA 3UTZB 3VXUB 1GHFL 5F9OL 4JRYE 1MJUL 4JO8A 3V0JA 1MRFL 3UAEA 2MNJB 5L0QB 1PDKB 1EXHA 1IC7L 2XY1A 3OKYA 3FT1A 4G9FB 4LCUB 3WNKA 2HTLD 5LCVH 3BH9A 4QHLA 1QYGL 3MV9B 2P8LB 4X5RA 1CC3A 2EYRA 1M2OA 3SQOL 1THAA 1YYMH 4LQFL 4V1DB 1BQHA 4IKIA 1EGJA 2OSWA 2EH8L 1U8JB 3NIGF 4BK5A 3N0PB 3AB0C 5I1EH 3AADB 3UADA 2W07A 3QIWA 4K5MA 4X8JB 2BXYA 3CLEL 2QQLH 4AQEA 1KNOB 3EJZD 5KSAD 4LLYA 2ZX6A 4PY7B 3Q8EA 2OJZL 3BRDA 1RURL 1YEDA 5CJXA 3ZRSA 1LEGA 1SHMA 1AZBA 4XPHH 2X7LA 2VRQA 3UPRA 5AW7B 5EUOE 4DGIH 1RZIB 3I9GH 4TQ8A 1HSBB 2N4IA 3A6CH 3IAQA 4TQHA 2OV0A 4Y1AB 4L29B 4RFNC 3ERXA 5IQLA 5L88H 4JRWA 4GRLC 5LBVA 1KPRB 1NIBA 4M6NL 3WOVA 5EEXA 2FDBP 4BSVA 5I24A 3WN5A 3ZQXA 5BOZG 2Y25A 4PRHE 2Q9OA 4JJ5B 4Z0XA 3T8MA 3A4FA 5I9QC 3DMMC 2B0SL 2NW3B 2Q2EB 3FN0H 1DJXA 4N2CA 5F7BA 1ZLSH 3MGOA 1WICA 3ZDYE 1G4RA 4J3BA 4D9LH 5C08B 2WLLB 5IMMA 1E4XI 4YPJA 3N50A 3UTSE 5L4MA 1RVFH 4Y5VC 1JPFB 2J6EL 2ZP8A 4ZS7H 2DM7A 1U8HB 2ZWLT 3RKDC 7TAAA 2PTVA 1K5NA 3ES6B 1KYAA 3VG0L 1NGQL 1Z3GH 3H7BB 4DKFH 4R4FL 1J0JA 4JFVA 3NP3A 5DD3H 2V5RA 4KUZH 2CD0A 4WSGA 1Y6KR 1O5PA 4M5YL 3N43B 4K94C 2HMID 3LS4H 5HPMA 4LPVA 2X44D 4JFQB 2QGDA 2IG2L 5AVZB 4FA7B 5FUZL 5DT1H 3RGBA 3FQTB 1I9EA 1I4FB 3EOTL 3FO2A 5HHPA 4MQ7B 1QFWH 4P9HL 3GRWA 2AXWA 1GA2A 1G1OA 4J3OF 5T1KB 4KVNL 1WVZA 1BXUA 2R59A 2YQGA 3HR5A 1IAIM 5FCUL 3VFRA 4DEUA 1KCRL 1SOQA 4UZGA 5FV1L 3ASWA 5FB8A 3DYMA 1KGCD 5L9DL 2EDTA 3DXAD 1XSJA 3BPNC 5E6UB 1CDHA 4L8SB 2WTRB 3EIFA 4U7SA 4GJTB 2QTEA 4MXQC 5K9JH 1EAJA 4KKLD 5AW2B 3RWEA 5ACLA 2EDDA 2CR0A 4R7NA 2I69A 4YNYB 2MMXA 5DLMH 3VI4B 4PJ5E 4GS7C 3DSFL 3RRQA 4QO1B 4W93A 1A1NA 4DN4H 1OPGH 1A7RH 3KYNA 3TT1H 5TH2A 4K7FA 3V6FB 1CYGA 3QWQB 4NQXB 4U6HB 1YSOA 4WWPA 5EBMB 3GC3A 3VGAC 2HJKB 3IGAA 2IXQB 3CXHJ 4HKJA 2PO6A 3B8YA 2G9HB 3B3BA 3BPLB 2LAGB 1HOCA 4XBEL 4XO8A 3DDFA 5C0CD 5I0ZA 1HZHH 4OBSA 1CXEA 4KKQA 3U0PB 3CZFB 2PCPB 3OV6A 2VAJA 1WA1X 3CN3A 4Z7UE 1WTLA 5EUKB 5EU5B 3GBDA 3PFUA 3TURA 1CI3M 4LK4A 2X70A 3EJTA 3JV6A 4J4PC 3SQBB 2GJRA 1BBJA 1NIDA 5CN2A 5DEFA 1E9OB 1Q9KB 3H9SB 2A74B 4TUJA 1TENA 3GBLA 1YUKB 2EDNA 2MPAL 3F83A 4I0PC 4MAZA 1XZ0A 1A4JB 4ODHH 4P99A 1T1ZA 2EIKB 2L3BA 5MENE 2XZCL 4M5SA 4FQJL 1EVTC 1NKOA 3H53A 4HF5H 4QF1B 4IOSA 3U7WH 4P5KB 4X9HA 4PBVC 3L3JB 2UWEE 3BI9X 3PGDB 4JPSA 3RWIA 3FZUD 1A8JH 4PWJA 3MRGB 1A1OA 4RZCB 4K2UH 4EIUA 4WFEE 4LEXL 1FZKB 4F2MA 1CI5A 4N90D 4GRLA 3JWNE 4OFYA 2HT2C 2CCLA 2YEZB 1MUJA 2FBRA 1XIWD 3BVXA 2VQ1B 3FQ1A 4QXTA 1U58A 2BWIA 3MV01 4IRZA 4JPVH 3ZR5A 1VCBC 1P7KA 1S7XB 3LNFA 5T3ZL 3ZTCC 1K4DB 1BZDA 1QO3B 1YEJH 4TF4A 2WBJD 5F70A 1B9KA 2WXNA 3QH3A 1T4KA 3LEVL 3ZHFA 1GMEA 4X6CB 5B1KA 2FHBA 3S8FB 1FO0H 2X2IA 2N7BA 4X7TA 1Z1WA 4LLUB 2JKLA 3M1BB 1SYVB 5EO9B 1BQSA 2I7SA 1BOGA 3DOSA 5G4OA 4EBQL 3QUMB 4DP7X 3P0GB 5DZLA 1DSFL 4JN2B 5IREA 3HAEH 3T4AA 2OK0H 4CUCA 2WWKT 3QPXL 5E94B 3JTTB 5EIIA 3CAFA 1T03H 3O8XB 1FV1A 3K0YA 3QQ3B 1HE8A 3FFDB 3IAGC 3FUKA 4LB8A 5E8NA 5CAYB 3PREA 2D7TL 4OT1L 4KROD 4FX5A 3CJJA 1KB3A 1IE5A 4XWGH 1AQKL 4Y16B 3QC6X 1KTLA 2ICWJ 3I50L 3E1ZA 2UUDK 1E2ZA 2YO3A 2ZCKH 3ZTEA 1DQDL 3F6IA 3PCYA 1IEBA 2AABL 2VN5A 4Y9GA 5CJBA 3QEGH 3C8KB 4H1LB 5INDB 1IM3A 3FNKA 3ECBA 4LBAA 1HWWA 3P4NB 1RJYA 1AC6A 4WO4A 1RSYA 1YEFH 3JBG7 1URIA 2OMUB 3TM6A 4Y2DC 1OP9A 4XX1G 5HHOA 3HRZC 1PKOA 1URLA 3IDIB 4ONFL 4XMXA 1JPST 2WSDA 2J44A 5F8QC 4XCNA 4F92B 5GZNC 4QRPB 1GTNA 5CSBA 2Y7NA 4ONHB 5FW7A 4JGNA 2ZX9A 4PH8A 5D1QD 5JXAH 1MCSA 5T1LA 3O0RH 1DUYA 4J6RL 2ARJB 5C6WH 5LN8A 3K8MA 2HUHA 1KBPA 5EF0A 5F71A 2KZKA 3C6LB 1H0DB 3C5ZD 2CBQA 2M26A 2BC4A 3BUYA 2E9WA 3FU0A 4DGUA 1M05A 3RWCA 3VAEA 5D71H 2WANA 1MI5B 3OSKA 2EYTB 1VAHA 4LP8A 2WWNA 4MAYD 1KGXA 3B7TA 4PJIE 2B08A 2VJXA 4HJSA 5FEBA 1VZIA 4OCRL 1BP3B 4FE9A 4S2SA 1QHOA 1XSOA 4MA3B 4NKQB 1QFWM 2EXWC 1DBAL 5F9WC 4BK4A 1DVFB 1X7TA 3OM3B 1VZGA 4DESA 5AZEL 1UADC 2AGJL 1I9RH 2R56H 4KY1L 4S10A 5DJ2B 4G8GE 1KWKA 5IMOA 3BDYL 1FGNH 1S8DB 4WUUA 3Q2CA 1OCOB 2NY1B 3NCCB 3L2NA 1OOWA 3HZKA 3VFMB 4KWUA 2GCYA 4PRIB 4RGOH 3IMSA 1DQLH 3GO1H 3GK8H 3VX0A 5AL0A 1CGSH 1AVAA 4LAQL 1FVCA 1QWHA 2GIMA 2J71A 2MTAA 4LL1A 3CZKA 2FGZA 1LO5A 1QQDA 2N1KA 1OQXA 1JD7A 2P5WD 3FT2A 4TPRL 4BE5A 1HQ4A 2D03L 4EJ1C 2XVBA 1BQ5A 1X5XA 3BFWA 3K7UA 5HY9B 1GC1L 2AK4E 3B5GA 5G55A 4YBLC 1OD9A 1PZ5B 1FYTA 4U1NA 4G6KH 5MI0B 1IGYB 3VGDA 1U3HC 4RISL 3GI9L 2NSQA 1P5UB 4N0YH 3H9YA 1ET5A 1E7UA 1ODUA 5CGYD 5C2BL 3ZE1E 5IW6A 2VISA 5C0AA 4PRPB 2EYSA 1XCXA 1GJUA 4MXVF 3QPKA 2FD6H 2WN3A 5GJTL 3WIFB 1JPSL 5F7LB 1IBGH 2PP7A 4M5ZL 4WJ5A 4HIEB 4RRPM 1K2DA 4F9LC 3B5HA 5DEJA 4R96B 3BGAA 1E4KC 3WKQA 1GZPA 1VGKA 4ZFZB 4PLKD 1MOEA 1U8OB 2DKSA 3ZIYA 5B38A 4JFDB 2Z92B 4KK6C 5I30L 3HRPA 3BIBX 3LTVA 4ZX3A 3GUTB 3MRQB 3MLRL 3FO1A 4Y2NA 3WY4A 3EYQC 4EEEA 1DBKH 5IF0B 1QTYT 3ZGHA 1JWMA 1LILA 1OK0A 1M4KA 1UXWA 2AEOA 3OAYK 3R0MA 4I7ZC 3RX9A 2YD3A 2KZBA 3T0VA 8FABB 4R7VA 1OCWH 5IP4A 1SRDA 2VLRE 3CQQA 1ZVNA 5T5FH 2FO4A 4L4JA 2DLFL 1BZ9A 3O4OB 2QSTA 1KIRB 5BRZA 5LUMA 5HXMA 2IGFL 3KYMA 3UC2A 2R0ZL 4HU2A 5TF1L 1IQWL 3UO1H 3O2DH 3OHXC 4M7JL 3VH8A 1AO7D 1AHMA 4MS6A 1R5VB 3GMNA 1KJMB 1T22A 2X3BA 4M1GH 3CSBA 2X41A 4KKBC 4BQBA 3TBTA 32C2B 4RMSA 4Y5VB 5BNXD 1JXJA 5JW4N 5GRUL 2H7WA 4HLZG 1T80A 3BAYA 4X9FA 3HNVH 1JV2B 2JKWA 3LKQB 4RBPH 4UU9A 4W9GC 3RHWK 3S4SA 4JKPL 4MVBC 1KZQA 2DJUA 1QVOA 1UD5A 2XN9B 3QUYC 5DK0B 2YSSA 3SZKC 4IBLT 1G6VK 4ELKB 5C6PB 2FQDA 4LSQL 3UEQA 5IGXH 4WFHE 3QULB 4NRYA 1WWBX 5CUSH 1U8MA 3QJSB 1JGDA 2V9TA 2W60A 2V2WA 5HVFB 1C5DB 2VC2L 3PDOB 3C6SA 3D69A 3ETTA 4GUCA 4GQRA 3BSZA 3LKNA 4HUXB 1YA5A 2VXVH 1ED3B 5DQ9A 1J9SA 1SY6L 3FQWA 4NPYA 5B3JE 4FP8L 4AW4A 2NCEA 4I1RA 2BIPA 2XHNA 4GSUA 3WIAA 2QVIA 4X2UA 3D18A 1P4BL 4JPQA 3SEPA 5AOZA 4O2EA 2APVA 2FX8H 3WMSA 2DAVA 2BNRD 5KVFH 5JDJA 3ZRFC 3S2AA 3BAKA 4R84A 1EFQA 4P2AA 4XNZB 3UZVA 1F4WL 1ZANH 3KPPB 2DF3A 3P9WB 5G4MA 1EHKB 2P46B 3HB3C 5B39B 1AXSA 2AEIT 1U93A 1MPAL 1QI3A 3IMWA 4MJ6A 2ZZUT 5ESVA 5TK2A 5TDNA 4TVUA 4HK3J 3AM8A 5KVEH 1U3HA 5KSAB 4NZUH 4NQCD 1FPTH 1LD9A 4PJ9D 1CVRA 4AL8L 4Y19A 3K80A 2BS8A 2VC2B 2Y1YA 4X6DA 5BQDA 4I87A 2ZKHH 1AD0A 3Q2VA 4PCKA 3GXDA 2XPYA 2VIRA 1S7VB 2D0GA 3T3MB 1BYNA 5CIPB 5C0JB 1YMMA 4WU5A 2HLAB 4QWWC 3MJ7A 4DP2X 1BFSA 1V05A 3F7PC 1XTLA 4FXGB 4BQ8A 4LSRH 1RMFL 1K3ZA 4GUOA 1RIVL 2HT3C 4YDZA 1T21B 2V5MA 3KYOB 3OJDA 3FUEA 2GABA 4I0PB 1HXYA 4QNPF 1GS7A 2KDGA 2J6WA 3C6EA 3VTMA 3D09A 4CVZB 4UOZA 2CO6A 2Z35A 3MACL 3NCFB 2AQNA 5D96B 3VFTA 3SGKA 4QHNA 4UIKL 1E27B 3ZKQD 4U1IA 1IT9H 5EOTA 2EUZA 1XH1A 3I84A 4AC4A 5L8KB 1OAZL 2YD2A 4ZMTA 4FQPA 4UT6H 3W38A 4OLXL 3QFDB 2X12A 3TBSB 4BZ2H 4F91B 2MOVA 4JDVB 5J11B 1DVUA 5FM4A 1A6TA 4L37A 2RCSH 3OXRA 5AB1A 1NFDA 3V0WL 3IFOA 3COOA 1EMTL 3KDMB 4P5SA 3ARVA 4ZX4A 2KH2B 3F62A 3EFOA 3OHXA 3GMOB 1YY9C 3WY2A 4ZUTB 5AOJA 4GO9A 3GSNH 1BFTA 4PCSA 2DKMA 4POZC 1VA9A 3PJLA 4XPBH 2CM5A 4QRRA 2PW1B 3BMVA 1R6VA 4HDIA 1E9QB 1IBDA 3W5NA 1NLDH 1SNRA 1YYLL 1DBML 5EBLA 1M6OB 4FQ2H 4HZAA 1M7IA 5BUAA 3E3QC 3O3BA 4XMLL 4AXWA 3HMXA 2NDFA 1FVDB 2ZXWB 5JW4Q 4MCMA 2HJLA 1VEMA 2OJEA 4M1CC 3F58H 3RUGE 2ATAA 3DXAB 4PJ7B 2ENJA 1IGFL 3GQFA 1KUMA 3KPLB 4NQQA 4JW3A 4BKTC 3LKOA 4GB9A 1YEEL 4WRLA 5CZVH 3U48A 5C6TL 3QYMA 4TNVF 4JFED 3KL5A 3PPSA 3CHXA 2ICCA 2BVPA 2EINB 1ZSDB 2EICA 4DVBA 4F3FA 2QL1A 5IROD 2WVVB 3L5IA 4U1KA 4OLVH 4PN6A 4OD3L 1FNSH 4PY8J 2WIMA 4F57L 4L8CA 1R3IH 3FTXA 3P54A 3SKMA 4B7IA 4OB5H 5IW1B 5IZ7A 2G0LA 2XI9A 3PWLA 4APQC 4XN9A 5C0CB 4QPEA 3W37A 3ZBMA 4XCEB 1F6LL 1R3KA 2BVQA 3GT6A 4HGKC 4KXCA 4JNXA 1KSRA 2AV7A 4I8DA 3HRZB 2VB5A 4HEPA 5HVHC 4JFSA 3QIBA 1JPTL 4XOEA 1HINH 5MHSE 2AJZB 4K9EC 4QGYA 4R26H 3D3VD 2J88L 4IHBA 2OULB 4N8VA 3MRKA 2W65B 4JO2L 2LVCA 1G5GA 3AY4C 4MB5A 2YXFA 3KGTA 3VFPB 1G7QA 4ZMPA 5JDSB 1XMWA 4L3FA 4M29A 4N2NA 5DD6A 5HD8C 2XDHA 3ROOB 1HJCA 2PPCA 1A4CA 1QRKA 3MROA 2BWDA 3PHOB 3Q3GB 4PD4K 4U6VH 2WQUA 3X3GL 4MA1B 1JZHA 2UX7A 3QDMA 3QEQD 4GQQA 2VN4A 4ODUB 1FORL 1XCTA 4MCYB 1HKLH 2QSQA 3FL7A 3EUDA 3L5XH 2Z4QB 5KEZA 1JGIA 1XIWB 3D39D 4KXAA 2JELL 3BHBB 1LO2L 1KLFA 3Q1SH 2ZG2A 1INQA 2JI1A 2HKHH 5F7UA 2WW8A 3VFWB 2FR4B 3IU4L 1KN4L 2E9BA 4NP4L 1BD2D 4G42A 3NPZB 2Z31C 3NAAL 1UURA 4KJPC 3OAZK 1HL4A 4IOFC 5FOBA 1BMWA 2ZYHA 4NI3A 5ALCL 4GI8A 5TK4A 3U1SL 3MU3A 3D0VA 1NJ9B 4Y5YC 4CADA 2Y1VA 3JWNH 3V6ZA 3N3EA 4DP1X 5I6NA 1BBDL 3GTTA 4F9PC 1UVQA 4RAVB 5I8OL 4PJ6A 2FX9L 3VFUB 4Q56A 2AAAA 5MEPB 2GY7B 3HE6A 4MZ2A 4UOJA 3IDNB 3OKDB 4W70A 5D2NB 4YXKL 1VFBB 1MDAA 4JANA 4DVRL 1OXYA 2VZOA 2SEBB 1LO4L 3BEVA 2VDQH 4GY4A 4NP9A 1JRHI 4NC1C 1P1ZB 4XB8A 4YN3A 1OPOA 3FRPB 2HG5A 4PJCF 1YNKH 4KROB 3QA3A 2PW2A 5IVZB 5IOPB 4G8FB 2OSLB 3BQUC 3G9VA 3HS9A 3BXNA 3Q8CA 3DUSA 1WFJA 5IROC 1CYWA 3EDJA 3HJEA 3PF2A 5AOIA 3AU1B 2V17L 3L4ZA 3MCLL 4M6OL 4IIQC 4HV8B 1CLOH 4KFMA 4L1SA 4PMEA 1FNEA 2N7SA 5C8JB 3GHBL 4ZUUB 1R47A 5I5RA 3WE6A 2WHVA 5EN2A 4J27A 1JWUA 4NQSB 1JUFA 2BRRH 2C3VB 3IGLA 1M9WA 5I2IB 2VR6A 3OKOA 4W9LC 1KTDB 2D31A 1UA7A 3RFZB 3LDBB 3ULUD 1A14H 4YEFA 3VXSD 1WCBA 5D7IA 2V5SA 3GMRB 2WVSA 3B2VL 4PW4A 1UJ3C 4OVUA 5I74B 1XX9C 5D1QB 4EKXA 2FSEB 1BSIA 2H5UA 4ZAKD 2ZKWA 2K3HA 1EAQA 1OAQH 4APQA 2A1WH 1VKXB 1A6ZA 3N1PC 2ZUVA 3AQDA 3HG1D 5AW5B 3C5ZB 4Z78A 2Q7AA 2ZIDA 3ZL4H 2DTML 4LBEA 1WBZA 1ZPLA 3E8UL 1EEYB 2O6FA 3IMRA 4APXA 3MYJB 3KMDA 3OWRA 4Q6IC 3QS3A 1OP3H 2UYLB 3DOIA 4F33B 2B59B 4MAYB 2BWQA 4J2QA 4HA1A 4TSBH 2IV8A 3MUZ1 4PJCA 2EE0A 2FSDA 4BE6A 1NAMH 3LS5H 1UD3A 5FO9A 3V52L 1LE9A 5F7YC 4M3JA 1U9KA 1Q0YH 3LIZL 4M4RB 5I0VA 5IT2H 4XMPH 2W80C 3O3EA 3D30A 3PQYE 3QCVH 4LP5A 4LARL 2YWZA 3KJ6H 3TEYA 3Q8BA 1EERB 1F4YH 4MJ5A 4RZKA 2ATKB 4YQXH 5BQ7A 2KERA 3QFJE 3BVNA 1YPZE 3NSFA 5AALA 3QAQA 1DVQA 3ABLB 2AEQL 1N70A 1M53A 3HC0A 3QEUB 2IAMA 2DI7A 3LKPA 4KHTH 1N6VA 4JEGB 1LHZA 5LXGH 4OIFA 3I74A 5EZOH 3HE7D 2YPVL 3SDCD 3E38A 1U2CA 1J5OL 4U1MB 1SOKA 3TN0C 1EJ6A 3BP5A 5HJGA 2P5PA 2XG5A 2XN2A 3REWB 4HJUA 4Y5YA 3NCMA 4UI2A 1QR1B 4EQ3A 5EMYA 2NZ9C 2B3RA 2P5WB 3Q8FA 3GS4A 1P9MA 4JY4B 3UBXA 5GSVB 2P7TB 3EGDB 2YRPA 4RQQB 4CSSA 1XH2A 5KS9E 5IBUG 1PQZA 5IQOA 3L1OL 1XBDA 4YSQA 3INUH 1NLBH 1T20A 1KJ2A 2VLLA 1IKNC 3ZTDC 3QZNA 3DX2A 1MLCB 3QWOA 1GPOH 1XR9B 4QEGA 5FHBL 3OPUA 4FJ6A 4LNRB 3ARFC 4P2OC 1WZMA 3SYCA 3BCFA 4G3YL 2VUOA 4XOCA 3PV6A 2NUTA 1QNZH 4ZPTA 3FOLA 4P59H 3HB3B 1ITCA 3DHUA 5FA4A 4JY6B 5BV7H 3WELA 2R29L 4ZAKC 2Q10A 3GLAA 3L5WB 2NNFA 2BOBB 1VACB 5B22A 1X5IA 2AS5M 3T9WA 1ZXQA 4TOYH 1RUQH 1H9DA 2QR0B 2NTSP 1WAAE 1Y0LA 1E28B 3TV8A 3V0DA 3OKNB 3P9LB 3VM5A 3CX2A 3VMNA 2FX7L 3IGKA 2ZUUA 4WHYH 3B83A 3NIDF 1IGTB 3QDHA 2OYLA 5I0DA 5GZOA 2Z0UA 2NNAB 2SODB 1QZ1A 4JG1H 4GKSA 2EDFA 4PS4L 2IH1A 2O26U 4Y4FA 1KB9K 2CO3A 5DS8B 3EJQA 3KPRD 4B5ZA 3MA7B 1AKJA 4OKDA 2A6JA 2MFNA 1HCYA 4K7PH 3CXDL 4JO4H 4JR9L 2B4CL 4KC3B 2F2HA 1AO7B 2WXFA 4AM0Q 4TUOB 1LGVA 5KSVA 1MCIA 1O9VA 3LZPA 3VG9B 2BIMA 2HP4A 1YEGH 4RAUB 1X7QB 5EOQL 2VDKL 4L9LB 4NENA 3V0IA 3RB7A 3V55A 1HL9A 1P53A 2Q3ZA 1CD1B 1DJWA 3CHSA 4BSJA 1E3FA 2QGCA 3DA0A 2AJXH 1YC7A 1NCCL 3LEXA 4HWUA 5GRWA 4PR5A 3NQKA 5HJ3A 4MWFA 5LXVA 5C0BD 1NOFA 1F56A 3D4YA 4QXGH 3L5JA 2V5YA 5EG6C 2F9BT 1TJIL 4U49A 3RPIB 3U6XA 3PPEA 5AW1B 4OLEA 5GS1C 3ZDXE 2P80D 3KM2A 4F8TA 1UZ6F 2Y7QA 5IJKA 4NUMA 4DKDC 2AMUA 1D5BB 4BBWA 4YLCA 4LFHD 2KS0A 1BGXL 1DFBH 4XWOC 3B9EA 3OJVC 1JYVA 2YQBA 3QJUB 3AS1A 3BDXA 4ZX6A 2OTWA 5IB2B 1Z3RA 2EIDA 3QJFA 1AGCB 3DX9B 4M62L 2PCXA 4AIEA 3ZL2A 3VXTB 3WGUB 3EBIA 1IZKA 2BNQD 3P9MB 4GAAA 3D33A 3IJHB 5KJ7E 4C56B 1Z0NA 4JPWL 4Y89A 1AI1H 1KCVL 1N59B 1I1AC 3N42F 5T1JA 4QI3A 3QZWA 1T0OA 2KZWA 1KELL 3ARWA 4XCFH 1QLEL 2D0HA 4WZ9A 3BKCL 1IL1B 1CFBA 5TF0A 1ACYH 2BNRB 5B7EA 1N8ZB 2XVLA 4G8IA 1T7VA 4ODWB 3BLKA 1M2VA 2GHZA 2O5XL 3ZT5A 4XNQB 1FE8L 4QD2E 2BSSA 1J8HE 3L3KB 3GXNA 4M43L 4EI5D 3FCSB 2CWRA 3ARTA 1YECH 4WV1C 3TX4A 4ELMF 4N9OB 5AB2A 4ZD3H 1QLRA 4KNQA 2BSRB 4WDIA 4A38A 2MNUA 4OY9A 4WIQA 4NQCB 4L3AA 4H4NA 1IQDB 4KK9C 4PJ9B 5C0GB 3FO0H 1IBZA 3ETBJ 5CEZE 1DLHA 3ARFA 4KOBA 4M6MH 4AWJC 1KTRL 4P2OA 1SDYA 2XTJD 4HG4J 4LKCA 3RVXC 3OBAA 2J25A 2OMZA 4DP0X 4XVSL 1FYHB 1NUNB 1TCMA 2VQTA 2WKGA 3S2CA 4LSTH 1GYCA 1R33A 1W91A 1ZOXA 5CMAA 4HW6A 1EQWA 4YSRA 1XDTT 3B9KD 4PJ8A 5ECJE 5A1AA 4A2MA 4WLCA 5J3HC 5FC9A 4Z3TA 1MFNA 2F1AA 1C5BL 2WN2A 4A6YL 1N2RB 2JCCA 5LNEA 4TVPL 2BVUA 5LBSL 5IMKB 1YHPA 5INCA 2GJPA 5E6IC 2O5YH 3MBED 3L1EA 1ACXA 5I1AB 5EFIB 3PWUA 2WKOA 3ECVA 2AEPH 3MC0A 4BFOA 3L5HA 2OCCB 1HEZA 3FQXB 3MVSA 3KZ8A 4P46D 4Z7AA 2I24N 3UTZA 2VO8A 2WLYA 3VXUA 4N1EA 3ILDA 4HIHB 1A3LH 3U9UB 1M7XA 4KO7A 5CSGA 2P43B 4G9FA 4HALA 5D1XE 3FTVA 4AZUA 1BZ7B 4X8CA 4W1TA 3X3FH 4W68A 5ANME 2F18A 1CG9A 4PG2C 2NX5A 5DS1A 2PYFB 3MV9A 3QUZA 4YDKL 1GZQA 1TTRA 1DJIA 1MCWW 2B1AL 2X4SA 4K3EH 1A6UL 5AENA 4PVLA 1CF8L 1E6JH 4O00A 4V1DA 5CGTA 1U8JA 1CGXA 4A6YB 3N43F 4FQXD 3N40F 5DHVB 4MAUH 4OZ4B 5H37G 1S4IA 3DETD 2QFRA 4KJWD 1D7CA 1RZKC 4X8JA 3KBEA 3IWUA 5K1JA 2DDQH 3SGEH 4PY7A 1GSKA 2F58L 3JWOL 1BWWA 4JFEB 1D5ZA 1F4AA 2ED6A 2RFXA 3KWWB 3PNRB 1CE1L 4TLUA 1MFEL 1UACH 1YNLL 4PJDA 1LTXA 2FEDC 1RZIA 2H8PB 1YEHL 1F6FB 3B43A 1HSBA 1GJIA 3DGCR 2I9TB 1DR9A 2PWDA 1JL8A 4KPHL 3RDJA 3MJ8A 3IF1B 2P26A 1I8LA 1ZE3H 4KI5E 3BZFA 3VI4F 5E51A 4ZRGA 5ELIA 3WYRA 3OZ9L 1LO0L 5FCSH 1JGUL 4JJ5A 1AR2A 4UTBL 1S9XB 2CBTA 2CLVB 2PKDA 2NW3A 2V2TB 1L9RA 3T3PE 2TAAA 5JORA 5C08A 1X5KA 4PLJC 1KCUL 2W5PA 3BLPX 4N8UA 3D3VB 4OZGA 1BCIA 2WLZA 3MLTB 4FQIL 4U6YB 4OFQA 1NMCC 2BIHA 3FSZA 1U8HA 1NICA 3RI5F 4RIRA 2DICA 1DZBA 3B9KC 3ES6A 3HI1B 2Z7UA 4PJFE 4G82A 2G5RA 3WFHB 1F4HA 2JKRM 2J20A 1DQJB 4TNGA 4E41B 3CQPA 2QVFB 3K2KA 1NFIB 2BM3A 1CJYA 1BVKA 4JFOB 3QEQB 3TEZA 4A66A 4KKNA 4X7CC 5J6GB 3TA3C 3KXFE 4HWZB 4JFQA 3RX5A 1TZHB 1LXMA 3G5YA 1YY8B 5DC4B 1RUMH 2ZP9A 3FQTA 4O2CB 1I4FA 1AMXA 4HFWA 2DL9A 5AOLA 5CILL 3ZTJG 4ANKA 3D39B 2OM5A 4Z7NB 4M9OA 4WNSA 5T1KA 4NAMA 4OGAD 4Z7VB 1MXDA 4KQ3L 4XPGH 3NABH 2V7NA 3ZDZF 2NY0C 5C9JB 4PJAB 5D6CA 5E2UL 4ACPA 1U8KB 4L8SA 2WTRA 1DVXA 1XR8B 2ETWA 1B4LA 2J6EA 2LE9A 2WWKO 5G4NA 1ZLUH 1QFPA 1UWXK 3K2UL 3VI4A 2HWZL 1G7PB 3K1DA 1JZ6A 3TIEA 2R9HC 1IKFH 4D7PA 4KZEL 1ZMYA 5FO8A 5IV2A 1F5WA 1L9SA 4MA8H 1RPUA 2C9QA 1DVZA 1T5WA 3E8VA 4G11A 4NQXA 2VXQH 2HJKA 1TETH 4U6HA 1U8LB 3GSOB 2CA3A 3L9BA 4X6CF 3CIAA 3DVNB 4IOIA 4LPUA 2G9HA 3FDWA 4PG2A 4AIOA 3NIFB 3RIAF 1Z5YD 1VFUA 2DN7A 4OZHB 3ZT6A 4JFZL 1MCJA 1WITA 2Z4TA 4Z7WF 3CZFA 4DPCX 4X7EC 2DIEA 3LN5A 5EUKA 4OH2A 3WXWL 2E6QA 1Q0XL 5EEZA 1SBSL 4S1SH 5EDSA 5IIEA 3FW6A 5JOEA 3SQBA 1WS8A 2G5BB 4HPYH 4M8UA 5GRJL 1E9OA 1Q9KA 4JHAL 2A74A 4NS0A 1LO3H 3KLHC 4F7EA 5D7LD 3R7QA 5DFTA 2OMTA 5J6SA 4X4ZA 1NCAH 3T2NH 2R0WL 4QF1A 4OF7A 5CZXC 3QE5A 5L8LB 4P5KA 3L3JA 4KX8A 4UM8B 1CU4H 3NEOA 3VXSB 3MRGA 2KDYA 4AQ1B 3HKFA 3N5AA 2AVFA 4PI0A 1E8ZA 1CBVH 1F1DA 4NZJA 4ZAKB 2WZPD 2NXYD 1SBBA 3DO4A 2EUWA 1FFPA 3A4AA 2PP8A 3P40A 3HZYB 1PD0A 2D0FA 2YEZA 12E8L 3F64A 4KNSA 2VQ1A 3RNQA 3NBNA 2HLFD 5TGBB 2B3IA 3IJ7A 5FYJH 2A4EA 1P4LA 4ZFFB 2W8CA 1EXGA 3HG1B 4HK0A 3OX8A 2APWA 4I13B 3T2LA 5JW3H 5MP6L 4CVWA 1K4DA 1DDHB 1YVLA 1QO3A 4H8HA 4P4KD 5I66B 4NQEE 5FIEA 2ZCHL 5HGDA 4XPTL 2WD0A 4LKXA 2YHGA 5FXCH 3QCTH 4AH2A 3IFPA 4UTAL 3BE1H 4LLUA 2UZIH 1VHPA 1MCEA 2ZCLL 5AL8A 3IK2A 1SYVA 5EO9A 1K3IA 3ATFA 4HP5A 1EDYA 4OZFG 4F15C 3TNMB 1DQIA 1FL6B 4RFEB 1FP5A 3OHMB 3EDFA 3BH8B 3UC0L 2K45A 1AFVL 1FFNA 5I1GH 5EIVA 3T0XA 3JTTA 4PJGB 1MFDL 3FFDA 2IPTH 1SLVA 2C4FT 5C3TA 1WEJL 3PGFH 4HSQA 2H26B 3MNDA 3IXTA 2BDNH 4OJEH 4PJXB 1M42A 4Y16A 2BHYA 4YE4L 5IWLC 5DJAB 3ZKXC 3BC9A 2X9ZA 1DSYA 1M1SA 3EYSH 1I7UB 1OLZA 3UO8B 4H1LA 5INDA 1T2JA 2Y7MA 4UIMB 3SDCB 3SE9H 2FT8A 4PJEF 1S7RB 2CJTA 2OMUA 5FA3A 4FMKA 1KC5H 1KYOJ 4LIQL 5AEAA 2A5UA 1RUAH 4PTUA 5AB0A 2PXYC 2TSBA 1NCDL 4JVWA 2ZXCA 3IDIA 4X7FC 4AMWA 4G2AA 1H3UA 3X1GA 4B9JA 4QRPA 2QDWA 1IJ9A 3PUUA 5TFSL 4ONHA 1TSHA 3P30H 2VDMH 4NUGH 4YVUA 4XMKH 2R8SH 5CCKH 3NN8A 5BO1H 3IDJB 3R0NA 4HGMA 3ESPA 5DJXB 2KKQA 5GSRB 3BYYA 4GI9A 4C4BA 4POYA 4I3SL 1UASA 1J0YA 2QHRL 4XP4L 4YE0A 5C0RH 3WBDA 4JRLA 4K3DL 2QPFA 2YXWA 1O9WA 4IBSA 2GIYA 1MI5A 2EYTA 2GSIA 1BVNT 1HNYA 1I82A 4YFDB 1R19A 4WCYL 1A6AB 3GIVB 4FL4B 1TQTA 3TEWA 4MA3A 1OY3B 4EVNB 3O2WL 3EG9B 2JVUA 3V7AE 3ARED 2WLMA 4R7DB 1DVFA 4YUEL 1J8SA 2R4SH 3FFCD 3W2DL 2X6AA 2R2HA 4JFPB 4FA8A 2Q7NA 3HOGA 1OARH 4JZOB 5FFOA 1NMBH 4E5XG 1AMYA 1NQBA 4AM0A 3TT3H 2CBMA 4OF6A 3T04D 2VDOH 3ALWA 2CM6A 4I18C 5GGVL 1S46A 2BP3A 2EDWA 4UILL 3C08L 5FYKU 4EDWH 1U41A 5I1LA 5AOMA 2EC9T 3DHJA 3HJ0A 1IMHC 2XWCA 4AV4A 2L7EA 2BHUA 3CFDA 3CSGA 3KPRB 2HXAA 3ARDC 3VFMA 4FYSA 4PRIA 1I8MB 3FTGA 1MCNA 1RIUH 3W3BA 2WXKA 1A2YB 3AG3B 5K59F 2LAAA 4JK0D 1HIMH 4FFYH 1MFAL 3ZMEA 3KCPB 4P4RA 1LQBC 1G94A 2OW6A 3E6HB 2V33A 3ZLQC 5HGBA 3S3JA 5C0BB 3FRUB 2OX5A 3QO1A 4QMEA 3AXIA 4MQXC 5HY9A 4HQQH 3U83A 1KLGB 4Y2LA 5E9AA 5AW3B 2DOCA 4IMKC 3BEWB 4GLRH 4FNQA 1PZ5A 5EEWA 2B15A 2VDRB 1IGYA 2DV6A 1AYRA 4HIPA 5GS0C 1P5UA 1C5CH 3V0EA 4ZODA 4L8BB 2WUCH 4P2QA 3ECUA 1AZRA 2IADB 3RY6A 4JGUA 5M7QA 2MIZA 5KTEL 3R19A 4EZJA 1XGYH 1D5IL 1CCZA 3WIFA 1AS8A 2KBGA 4YJZL 3FB8A 4HIEA 2V3EA 3GFUA 2BNQB 4LGRB 2NXZD 1WYJA 1MVUA 4NCDA 4OZIB 3PGCB 1ZTXE 2E74C 1GMIA 3TJPA 6CGTA 1U8OA 4X80L 1X6LA 1J0ZA 1GGIL 3NZ8B 1BA9A 2BHZA 4WEBH 3LZFH 1QSZA 3GUTA 3MRNA 3U25A 3UBGA 2IAND 4Q58C 1PZSA 3F7YA 1ETJA 6FABH 2G2NA 3OR7A 5IF0A 5CGMA 4KDVA 4GBXD 2H32H 4A7TA 4NC2B 1EPFA 1C08A 3ESOA 1FCCA 5DUJA 4EI5B 4O9HL 8FABA 2BOCB 4ZBJA 4FTDA 2WV3A 5EWIL 1BREA 4NLAA 2FECL 4PIBA 1T2QL 5I71B 2W38A 3AZUA 4NFBA 3VXQB 1G84A 2NW2B 3ABKB 5HGGS 5SX4H 2XTJB 5D8JH 1J9RA 3B5TA 3R1GH 1KJMA 4CILA 2NZIA 3PWNB 1NPNA 3MLXL 3UJJL 3CV5A 1Y18B 1IAIL 3V6OC 2YMXL 4K7PX 5SWSE 2FB4H 3H6AA 3KD4A 1NMCB 2EDOA 5I8KL 1G9NL 3C8DA 5GGSA 1D7FA 4GG6B 3B9KB 4BQCA 1JV2A 1BAWA 1U91B 4YSSA 4OIBA 4UBDC 2XWZA 1MCBA 4GKNA 5DK3A 1Q72H 3T3MF 2XN9A 1DHKA 2F8VA 3IFLL 5DK0A 5E2TL 3UZQA 4ELKA 5HDBB 5A2AA 1ETB1 2GFBB 3U36B 3T0ED 4OLWL 1DE4A 3ZHNA 5AW4B 4ZW7A 4DK6A 1HHJA 2NY7L 3F65A 2DBLL 5FGSA 1KMGA 3PHAA 5ANHA 4F8OA 3L48A 1C5DA 2J55A 3LV3A 3PDOA 4F2ME 1ZV2A 5ACZB 1QFUH 1ID2A 4HUXA 4NXSA 4RA0C 1L7TL 3REVA 4HBCH 3LRMA 4ZTPH 1GRWA 4LXFA 1OAYH 4PCTA 4BHUI 3EJYD 4FDWA 5JOFB 3Q1EA 1D9KC 3B7YA 1IBHA 2A3TA 2OAAA 3DJ9A 3L9EA 4FI8A 4R83A 4L4VD 3TCTA 5HYJD 5DZ9A 3KPSD 3VW3H 5DVLA 2WUBL 2BHFA 3U82B 2FWOB 1KIQA 4KO9A 1NCHA 2JKNA 4U1HB 3AS0A 2YBGA 3KPPA 3MV11 4IRJC 5SWQB 4FQXB 2CKBH 1QFOA 3C2AL 3VD0A 2H9GB 3QNYA 5EOCL 1EHAA 5IQNA 3EFFB 1KENL 4AY0A 1MREL 4JG0H 1SXBA 2DWYA 2IPUG 5KSAA 3NVQA 3QAZB 1UCTA 1W80A 3ULVH 4EMZA 2AAVA 1SMDA 1HU8A 3SDYH 3WG7B 3Q6GH 1SY6A 4PBWD 4PJ7F 1NWOA 2NLJB 4FXGA 2PMZA 2ZAIA 3IKCA 4RSVA 4BUQA 2KLSA 4JHWH 5LCVL 2GJ6D 1J88A 4KO6A 1USZA 4GAJH 4NJAH 4NHUB 3BMWA 4CVZA 5C0IB 3LB6C 3T08A 2QV2A 3FUNA 1YYML 1BM3H 3VFOA 1B90A 5IQ9B 4G1EA 3PWPD 4JBSA 5HHOE 4XXDB 3CPLB 1E27A 1TEYA 1NEPA 1YRKA 4QXWA 1SYSB 5HI4C 2FWSA 3F6LA 3OLEA 4FMVA 2XJKA 5I1EL 3ZHLA 3TBSA 4Z3EA 4H26B 1WFTA 2WXMA 3TC9A 4ETQB 3RWJB 1D5XB 5A7EA 2QQLL 2GKIA 5A2CA 2YQ3A 5H2BB 4U1JA 3OMIB 1AANA 3SIKA 3KDMA 5T1DH 3MRJA 3GMMB 2DTSA 4ZUTA 4PVMA 3S36H 1TPXC 4IJ3B 2JKTM 4P0DA 4XPHL 4JDTH 4DGIL 4JVUA 5I15H 3I9GL 2PW1A 1EEUA 3A6CL 3L2LA 2R7EA 3MV7D 3Q48A 5L88L 1A1MB 5DJCB 4XCCH 3Q06A 4JUSA 3P2TA 4HUUB 3DHPA 4I1NB 1QRNE 5J9PB 3DXAA 5CFAA 2P3YA 5DMKB 3LQAC 2DPKA 3FN0L 1ZLSL 1A4BA 3KPLA 3CK0H 4D9LL 4JM2D 4ORZC 1RVFL 3WTYA 1GKEA 3UTTB 4ZS7L 4AQAB 2DWEB 2WVVA 4GMSH 5F7NC 3ZKXB 4NZ8A 1NCWH 3DNKA 4WUUE 2CDEB 4PBXA 4DKFL 4MJID 1Z3GL 4OGZA 3P73B 3RJQB 4ABWA 3KJ4B 5DD3L 4KUZL 5IW1A 3NJGA 5H35B 5C0CA 2RB8A 4FS0A 1ECYA 1IC4H 2DL2A 3LS4L 3MRMB 3TPKA 2A0LD 2A4CA 1DQQB 2FYYB 2RMNA 2AJUH 2XZQH 4GG8A 4K0OA 5E2WH 4C47A 5E8DH 1WH0A 2XV3A 3IMTA 1YMHB 5DT1L 3L4XA 4TSAH 5D2LB 4FG0A 1QFWL 1XQ4A 2AJZA 4IRJA 4WO0A 4LVHC 5B21A 5AYTA 3SBPA 2W65A 5HYQB 3VFPA 1ZHLB 1A7PH 1Z9NA 4X9GA 3A67H 3RNKA 2ZWNA 3F84A 1R3HB 3ROOA 5FGRA 4LAJH 4P2CG 2CIIB 3B2XA 5HI3D 5BCAA 3Q3GA 3SKNB 4D94A 5K9JL 3L3GB 4Q52A 1A7OH 2VAAB 3JV4B 3S37H 5L9DH 1XWVA 1KCKA 1ZHNA 2MJWA 5DLML 3GUFA 5C0AE 5FLVA 1LK2B 1A6WH 1ZCRA 4FZ8H 4R97B 4A7GF 2E76C 1OPGL 1A7RL 3PV7A 3TT1L 4DN4L 2KLTA 4PRHD 2HX7A 4MCYA 2CHWA 2NXYB 4EDXA 2YAQA 3CDYA 2AI0H 1OAXH 2Z4QA 3CFNA 3D6GA 4X0NA 2A6IB 4XBGB 3BHBA 6TAAA 3O9WD 3CCHB 1HZHL 5BZWA 1JZJA 1MCDA 1T0PB 3VFWA 4BINA 3C5JB 4P4KB 3CH1B 5GS2D 4RMWA 2IOIA 4YK4B 1IVLA 2WBJA 2X3AA 3S3BB 1EZSA 5AG9A 4XGZA 3VXNB 4JN1L 4G80B 1AG0A 4JZJB 1UWGH 2NYKA 2OLDA 5KSBB 4LLAA 1J5DA 4OCXH 3W57A 4JX0A 2AJVH 2GYSA 4ODHL 4F37F 2IMMA 5IEKB 1IGMH 2VZVA 5MEPA 2ZUYA 4R4BA 3IDNA 3OKDA 1JGVH 5D2NA 4HF5L 5BRPA 1VFBA 2E7MA 3SE3A 4V33A 4QR7A 4OJDH 1P1ZA 4QRTB 2JB5H 2NDGA 4OSUH 4R4ND 5EU6D 5A6MA 4Z76B 4WGKA 4K2UL 3VSVA 5IVZA 1SOSA 2YAHA 4FRWA 4G8FA 3ZKND 3P77A 5DC0A 3EJRA 1CFMA 4YHZH 4JDEB 4JG9A 4HIQA 2JQAA 3CXFA 3NZHH 4HV8A 4JPVL 3OF6D 4AJWA 1EXUA 2ITFA 3DGGA 3IGFA 1BJ1H 1YEJL 4OCWH 1Q4NX 4KK8C 4Q8BA 2HLEB 5JPNB 3IJYB 2C3VA 5I19H 1M6UA 2J56A 3PU7A 3CFEA 2ZYSA 5I2IA 4PP1C 3BWAA 1FO0L 1TUPA 3STLB 5C86A 3D2TA 3RFZA 5GGSY 3S3PA 1JJUA 1RZGA 3VRJB 4JKLA 5C07E 4PV9B 3GMRA 3SDAC 3WY3A 1HXMA 1RK7A 1VEPA 1FH2A 1UM5H 2VXSH 5EEUA 4NPKA 2FSEA 4ODTH 1OEZW 3FT9A 3F5WB 4YHMH 2BNUB 2GTWB 2OK0L 1RZQA 3K8KA 4MNHA 1T03L 4A37A 4H0LC 3HFMH 4X7DC 4RNRB 5HHVH 3EYOB 3MXVH 4CC4C 1PL3A 1Y07A 3EH3B 1CVSC 5IUSA 5CD5D 1F6AA 2WZ5A 4GQ9L 1EEYA 4GSDH 4XWGL 3MYJA 3OQ3B 4PV8B 1D7DA 3V4VH 3QUMH 4AENB 1XH0A 2B59A 2ZCKL 2R4RH 4F33A 4IGBD 4AEEA 4XZUB 1U8CB 4B0MM 4Y5XB 1JTTA 3BWUC 2FEJA 5FYLH 3O3DB 3QEGL 4YSTA 2PR9A 5F7AA 1RJZB 3QQ9C 4GMTH 4JL2A 4J3XA 1R5IB 2BY0A 2H47C 3K91A 1DQMH 5KOMC 3AREB 3IT8D 1YEFL 5DRXA 4XC3H 3TZVC 2QBWA 1FO0B 3FFCB 3TS8A 3MRCA 1E6OH 3AT0A 3MCG1 4U3SB 1NH6A 5DDHA 4X6DE 1H5BC 3V4PL 4ILDA 4AYEC 1UEMA 4ISVB 2OW7A 2ICES 2ZWSA 3SGEI 5D4HA 3AXHA 1YMME 2P5EE 2Y69B 5EBWA 1BHGA 4KQ0A 4FLHA 1S78D 3HAEB 5F7WC 1E4JA 1S9KC 1WGOA 4KHXH 2J8UB 1T4WA 3Q6FB 5ESQB 5JXAL 3O0RL 4LDOB 3PIQB 4PWHA 4YXHH 4AJVA 3L17A 2LU5A 2F8XC 3ZT7A 3QEUA 2D4DA 2B4CC 3CX5K 1KFAH 3NCEB 5DMJB 4EF3A 2Z8SA 2XPGB 2Q3XA 4F7TB 5AG8A 4GXVH 1OB1A 5JIDA 3BIKA 3OB8A 1YC8A 3MLVH 2VM4A 2WYIA 1S7QB 4D9RE 1QR1A 4L5FH 3B2PA 4LVEA 1AZCA 2DQHH 3EBAA 1FG2A 4FQCH 1A3ZA 1U6AH 3HN8A 1OTTD 1I8KB 3X11B 5GSVA 3TBYB 1TZAA 2A73B 3EGDA 2BSTA 4RQQA 4U05A 3KBHE 3T77A 1NFDE 1O5DT 4ZO8A 5AW8B 3LIZA 4PREB 1S5HB 3P3TA 3P4OA 4LDEB 4XI5C 1G1CA 4DTGH 1MLCA 2FGWH 2FBOJ 3QS2A 1D6VH 4KRNA 1I9RL 2R56L 2QKIB 3UTOA 4LNRA 5CM1A 4QRRE 5FWRA 2YRLA 2IBBA 3KDPB 1I3VA 1PJWA 4I48B 4O5LH 1FGNL 3K5SA 2EACA 3PDDA 2P8MA 1EAOA 2J1XA 3CFKA 1WA2X 5GJSH 4P2RD 4RGOL 3L5WA 2CK0H 1RUPH 3VYPA 2EEXA 3FYEB 1C12B 2YPVA 5E5LA 1DQLL 2BOBA 3TVMD 3GO1L 5TE6H 5JQ6H 1TQCC 1ZSHA 1CGSL 3ATAA 5ACMA 1S6NA 1FSKC 1RAMA 2IANB 5I23A 5D7JC 3P9LA 2LGNA 3AG4B 5E8PB 4GBXB 3TYFA 5LNDA 5MERA 1UYWL 4OJFH 4PW3A 1I7TB 4NPJA 1IGTA 5LG1A 2OR7A 3DYOA 4FLSA 1FHNA 1ZTXH 3SD2A 3WKML 1C8QA 5DS8A 1SJEB 4PJBF 5CN1A 2EVIA 4G6KL 3MA7A 5AVWB 3U0TB 4Y4KC 2E59A 3QQDA 2WXIA 4N0YL 4X9IA 3GRGA 3B2UC 1AO7A 4GAYB 4XVUD 1PX4A 3QXVA 3VNZA 2HX9A 4H0IA 2FD6L 3FQNB 4RAUA 4FFZL 1J10A 1IBGL 1X7QA 3FSOA 4L9LA 3W82A 2R29A 4WWKC 4ABUA 3UAJC 4R2GD 5FGCE 1CXHA 2WVUA 4JLRA 4Z8FH 2EZ0D 5B1AB 1F45A 1HESA 4RETB 4EUPG 5IBTH 4OFIA 3F3HA 1MWAB 2J43A 4TKWA 2HFGH 3QYCA 5IK3A 4G8GD 5F7MC 3NGBC 4PGBB 3T0EB 2LQRA 3KLKA 1JXDA 2OJ1A 3QDME 1F3DH 1J0IA 1DBKL 1F90H 3VXMD 3DX8B 5L7XH 3CG8A 4XXWC 4XO3A 1PZCA 1JERA 4OJYA 3X1FA 1I8IB 1IJNA 1MCPH 4HPOH 1OCWL 5IB2A 3VFSB 2CSPA 4OD1H 1SXZA 3KEDA 3FTYA 5I18H 4XP6H 3OVUB 3DX9A 3RGVD 3VXTA 1UKSA 2PPFA 3P9MA 3STBA 3TO4C 4NUPA 3IJHA 1L0XA 4I2XB 1F1AA 4NBYB 3UO1L 3QEHA 3O2DL 3W0WD 1N59A 3A0OA 1SEBB 4L4VB 4M1GL 3KPSB 4JPIB 3NTCH 3BIAX 3KNBB 1JSYA 3ZW3A 1IL1A 2A9CA 4EOWH 3FQ2A 3AT9A 2AK4D 4QRUB 4WUKH 1OTUC 2GI7A 1TFPA 2AQRA 1A4KB 3F7RA 2BIOA 4LLVB 4XNQA 4H88H 3HNVL 3DIFB 3L3KA 1NWPA 4IKJA 4U6XA 1GYWA 4F7KA 4MD4B 3RIFK 2DEYX 1W0WB 2BSRA 4UQ2B 1KGUA 2AV1B 2JSFA 4LSVL 1DQTA 2Y7LA 4K55A 1F4XH 5IGXL 4P23C 4WFFD 1IQDA 4PJ9A 4UQIM 5CUSL 5C0GA 4AIXA 4XTRD 4NM4H 5EZIH 4X4XB 1ZS8B 3ZZLA 1H8LA 3NCBB 4UB0L 1AS6A 3BRFA 4PWKA 3QJHB 5ETUA 4NRZB 4N6QA 3OKEA 4IRSD 3E3QE 4N28A 3HG0A 5GGUB 2VXVL 1A7BA 4OJCA 2X4PB 2V9QA 3CDCA 1GSMA 3GZPA 1QSEB 3Q8AA 2VDNH 2GJ6B 4DPBX 3GMPA 1S7SB 1BQLH 1WP6A 3BISA 4ZW3A 2FX8L 4S1RH 3PWPB 4RGNC 5D7JA 3LXAA 3VWKC 3X1EA 2YOCA 1O7DE 3ZJAA 2VLRD 1CT8B 2ZAGA 5I1AA 5H37A 4AYFB 3E9TA 3O81A 4WAFA 3K6FA 1ZANL 5D7IE 1E5YA 3FQXA 2EDKA 4YGVA 2VR7A 4UMGA 3ORJA 4I3GA 1AD9B 1PW3A 2AXGB 3II1A 4J8RB 1XF3B 4HIHA 4TLKA 5AVQB 3U9UA 5KVEL 1MF2H 4I85A 3AG2B 4AYID 1JGLH 4NZUL 1FPTL 3CZSA 5LGHH 1BZ7A 4L3CA 5KBPA 2ZKHL 4LEBA 5FGBC 4M48H 5CD3A 4HJ1A 4NAJA 3JV5A 2MCMA 3GSXB 3ASNB 3S35H 4EI6B 3MCKB 4WWKA 5B1JA 4BA0A 3OB0H 1X5AA 4LSRL 4DO5A 1I9IL 3WEOA 4ZXBC 4WFHD 4A6YA 4B9FA 5I16B 3MGTA 2R0LH 5DK2A 2VMDA 4OZ4A 5LBSA 2A6DB 5F3HB 4OIAA 2WMPA 4U3XA 4E9SA 3SHSA 4JRYB 5AUMA 2YRBA 3EO1A 2NR6D 2X6UA 3GSWB 4NKOB 5CIPH 4Z7NF 2O6EA 2WO2B 3D9AH 4JFEA 2X4UB 3GMLA 3BP4A 1IC1A 3EOBA 3KM1A 5CWSB 3NFNB 3MBWA 4QTHA 5L4IA 4LP4A 3GWJA 4UT6L 4XOAA 1N0XH 2NT0A 4BZ2L 5ADOH 2H8PA 4L8DB 3U79A 4MJIB 4GXFA 4PJAF 1QWNA 2I9TA 5KAQF 1J1OH 2RCSL 3GBEA 4P3DA 4WVRA 1FGVH 4ZS6D 1NGZB 3IRPX 3BP7B 3IF1A 4AEFA 5EZLA 4N6RB 1QA9B 5BZDB 2R2BB 3UAAA 4ENEC 3GSNL 3D0AA 3KPNB 5E9DA 4XTRC 5GGRB 3FHEA 4MB4A 4N3TA 4LNVA 4XPBL 1CGTA 4R3SB 1LE5A 4U0RB 2O6CA 1ADQH 3EJPA 2V2TA 3TEUA 1AR1C 1NLDL 3MFFA 4P5TC 2NY5L 4FQ2L 3D3VA 4K23L 3S5LB 4DIXA 4OZHF 4LVOB 4LQ1A 3U2JA 1NA8A 3CZEA 4LU5H 2FZ3B 4OIIH 2OYKA 1AHWC 3KR3L 1WAEA 2B2XH 1FLTX 4BH7B 3GXTA 3F58L 5B8CC 2OMXB 1OSYA 1NGWB 1KGWA 3AUVA 3AUWB 3PAVA 5BMFL 3WFHA 5ITBH 5I8CB 4S0HA 4NC1E 4WEMB 2AJSH 4YMPA 1NFIA 2YPLA 4JFOA 3QEQA 4GLRI 5D9SB 1SUHA 3NSCA 2CLRB 4RESB 5J6GA 3TWCH 3NSXA 4PRHB 4QY8A 5L2KA 4XNMB 4OLVL 2JKSA 3HS0B 1OZTG 2G4GA 1JDCA 3NZSA 4PAZA 3RGHA 4ZG1A 4O2CA 1FNSL 1R3IL 3T6VA 2B9AA 4JM4H 3CMOH 2JJTA 4OB5L 4UQ9A 4X4KA 2JH2A 3C60C 4N9GB 4Z7VA 3GSNB 3SYQA 5JW4R 3ULUF 3PXLA 4UTBA 2GBUA 1L7IH 1BD2A 2HA1A 5L4JA 1X9UA 4D0DB 4OD2A 1L9NA 5C9JA 4Z23A 1U8KA 1E40A 1HINL 3C75A 4KRPD 3BUIA 4JFFE 1SN0A 1FQ9C 5J13B 2I60H 4R26L 4KV5E 1G7PA 1O0VA 4LCWD 1ZHKB 2ROXA 3TH2T 1WWWX 4HHAB 1EFXD 4N25A 3MNVA 4U6VL 4O02H 4X5QA 4Z3IA 5HGAA 5LDUA 5EU6B 2OZNA 4LEOB 3OQRA 3WD5H 3SKJH 1NIEA 2Q20A 5JHLH 3H3PH 5DZNA 2HJFA 3ULSB 4UQ3B 3ZYIA 5IHZB 1HKLL 3U7YH 4PMFA 3L5XL 5EO0B 3Q5TA 4L3ED 4Z77B 3UX9B 4PJGF 5ABZA 2G5BA 2VDPH 2G5UA 3AC0A 3P3YA 4UNIA 4GO6B 2HKHL 3LKRB 4ENZA 1KXTA 3M17A 4ZMNA 4YL4A 4HS3B 5DVMA 2MH4A 2VSMB 4I77H 4PJXF 2FWUA 2YAEA 5DZVA 1NMAH 4TLSA 5SWZD 4IHOB 3EGXB 4F1ZA 3DOHA 2Y1ZA 4QOKD 1BZEA 4MLIA 4UM8A 5C0NC 5HP5A 1E65A 1ZVHA 2LLLA 2GC7C 3VXSA 4FI7A 4AEHH 3D2UD 2P1YA 4AQ1A 3NIGB 4FFTA 3CIQA 3ZE0E 2G3ZA 5I1DB 1UB5B 1L6XA 3S37X 5DJ6A 1AQDA 4ZMVA 3U7AA 5IMKA 3HZYA 1XF1A 4QYOB 1D5MB 5E4AA 4KDTA 3KYKH 4ZFFA 1J11A 1G9MC 1KB9J 2VDQL 4KVCH 1KLUA 2VL4A 1FSKB 4WWID 1FL5A 1DDHA 5JW5B 3QVAA 1MCCA 1X4ZA 1B4TA 1YNKL 1HWGB 1FFOB 1F2XK 4CBZA 2Y5EA 4ZW6A 4RDQF 1PLBA 3LMJH 4JAMB 3L2MA 1HH9B 4IGBB 4ODXA 3HKZA 1CLOL 4JFXA 3IJSB 3VE0A 1NDMB 3RVVD 4FLQA 4XBMA 1QI5A 5DO8A 1UG9A 4RFEA 4U0QB 3APCA 4HMDA 3BH8A 5DFVC 2IDQA 2BRRL 5CZKA 2CO2A 4W9ZA 3J27A 4N2IA 2C1PB 3WNPA 35C8H 1A14L 4TL4A 3NJMA 2ATPB 3QG7H 4FXKC 1BQRA 1FIEA 2X4NB 4KZCA 1Y7VA 1FIGH 3HUJA 2XCMC 4LHUB 3C5SB 3ZQWA 2YS4A 3C60A 2XQBH 1OAQL 2VDQB 5I82A 5LVEA 4UZSA 1KEMH 1R34A 2A1WL 2FATH 1FZOB 3VTTA 1X3DA 3NGBB 1MCWM 1H8SA 5D4JA 5EB9A 3V4UH 4ZMYA 2JCCE 3FU6A 4NSKA 1BXVA 4HEMA 4UIMA 3ZL4L 5CR1A 3HE7A 2DJMA 2XXGA 4FULA 3SDCA 1AACA 4A2GA 1CL7H 5JLZA 4IYKA 3T8XA 1BVOA 4UTAA 3RDTC 1U95B 4I89A 2LW3A 4FNLH 3UJIH 5E4EC 2C4FU 4G7VH 3UERA 3VXUE 2A77H 1XD1A 4TSBL 5HVWA 3FB6A 2J1ZA 5IBLC 4XO9A 3RL2B 1KPUA 1NAML 4E5XA 3LS5L 1JVLA 5GS3A 4FEMA 2VERA 4G9FE 5A16B 5FUOL 2FJFB 1Q0YL 2LU3A 5IT2L 2QEJA 2BMKB 2F5AH 3IDJA 3NA9H 4XMPL 3L45A 5KJ4A 1T5XA 2EXSA 2NX5E 5E08H 3O6MH 1C1EH 4DEPC 1E2WA 2PR4L 3QCVL 3FB5B 3KJ6L 2D73A 5GXBB 2NSMA 1F4YL 3TTYA 1QEWB 1P2CB 2WXHA 3SBWC 2IMNA 3QXAA 4A2DA 4YQXL 5K9QI 2O5ZH 4V1DE 4H7VA 2NMSA 1QBLH 1EX0A 1KTBA 1N0LB 2FJGB 5FYJD 1OP3K 1A9BB 4FQ1H 2AJ3A 1A6AA 3ABZA 2FIKB 4JS7A 3T4YA 4A2HA 5LXGL 3TVMB 4EVNA 3HPJB 4NRXA 5EZOL 4V11A 3FQYA 1KTJA 4Q0XH 4J3OG 5DZOA 1JZ4A 2AQ1A 4JFPA 4WI7A 3FCTB 5F21B 4JZOA 5IVNA 1ES0A 1IRAY 4PJDE 3FPXA 3QUXD 2HFTA 1XCQB 5ALBH 2J3SA 4X6FB 2CHXA 3S48A 2WTPA 3QDJE 1KG0B 1WHPA 3INUL 5FO7B 2ICEB 1ROWA 1DEEB 1NLBL 3KPRA 1DBBH 4KUCF 4YDJB 1GPOL 1R5WB 1I8MA 4PJIB 3VWKB 1TEGA 1A2YA 5DD0H 2H1PH 1XZWA 1KIPA 3AMKA 1U21A 5C3LD 1EIBA 1KACB 5I75C 3UPCA 2ZWKA 3RVUD 1QNZL 4PGDB 4P59L 4UNTA 2F7QA 4H44C 1UWFA 4R2GB 1KXVA 3JYCA 4OZGE 1RK0A 4WFGD 5BV7L 1WD8A 2VDLH 3E6HA 3JVGA 4IKKA 4OJAA 3PQYD 4JRFA 1MRCH 2EEDA 1QG3A 5C0BA 5BJTB 2EC9U 4TOYL 1RUQL 2VLJD 3DI2B 4K71B 4G8GB 1IFRA 1F11B 4M7ZC 5T1MB 1KWGA 4ANVA 3BEWA 1QEXA 4A68A 3H85A 2P80A 1PFCA 2YZ8A 3M88A 1WFMA 3PY9A 4Y1TA 4GG6F 2W9EL 4C4KT 3T5WA 1QUNB 5MEQA 4FXKA 3VXMB 3RVWC 5TD4A 1HTYA 1MNUH 3SY0B 4CN4A 5IFAH 5HDBF 1DJHA 4N20A 3GMQB 1DN2A 4YHOH 4CVUA 4JG1L 4B3EA 3RGVB 3ARBC 4HIXH 2BNQA 3LAFA 4ZDHA 4M4PA 3FYIB 1MFBH 4XO4A 3BZEB 4K7PL 1VRSA 4JO4L 4MHHI 3DUUB 5KYNA 2C9PA 4OZIA 3PGCA 3W0WB 2QZ5A 5DGRA 1NBVH 5JZ7D 3NZ8A 4ATWA 1YEGL 1CFVH 4ACTA 5E1AA 1Q9OB 5C92A 4J39A 2AK4B 1OGTB 3CNKA 4A55A 5GHWH 3DBXA 3LN4B 4U1SB 1EAPB 2AJXL 4HUWB 1J9QA 3DROA 3NP4A 1BFOB 2X4TA 4W9CC 3ZE1B 2YD6A 2ZUTA 4QXGL 1B88A 3LNEA 3U4BH 3VWJC 1ZT1B 2NSXA 2W59A 1PTZA 1SEQH 3VXQA 4L1HA 2NW2A 2YUWA 1KCBA 4ONGH 1KEGH 3WLWC 4TQPA 4PGEB 5HDQH 2Y22A 3E1F1 3FCUB 4WQOA 4HX1B 4MJJA 2NQCA 3ZIMA 3L4TA 4IRSB 3IMBA 4DZBB 5FF6A 1WBXB 1E4XH 1LDPH 2NRDA 2ORBH 1UZ8B 1SHWA 2FQFA 3WL9A 4JKKA 1D3CA 1U91A 2CUHA 2N59A 5B8CB 1K4CA 3QJXA 1AGFB 1AI1L 5D93B 3S0PA 3X12B 5IW3A 5I6PA 5GRZA 2AK1H 1ADWA 4XCFL 1XF4A 3U36A 2HYMA 3QNXB 5D1ZI 1ACYL 3MBEA 2VLRB 1GS6X 3VRLF 4KH2A 4XAKD 4LDCA 5F72S 4HULB 1HYSD 3ALXA 4P46A 4QUOA 1AXIB 4WHYG 1YECL 1MEXH 3QNZB 2P45B 3SPVB 2UY6B 1QPKA 2X0WA 5DF0A 1GYUA 1KPVB 5DRNB 5LAPA 3WI9A 3ZE2E 2ADYA 3FO0L 3FTZA 2UVEA 4GOSA 4X9YA 4X98B 3VXRD 3IRZA 5JOFA 3U1PA 3L1FA 4M6ML 4M93B 2VR9A 3FULA 1FL3B 5C97A 2ZONA 4N8PA 3JZ7A 5A2FA 2FWOA 4LSTL 2XU9A 2ZJSH 3RX7A 3MMEB 1A22B 3TFKD 3DK2A 3GNML 2E9GA 2P4AB 4OLUH 5FS5A 1AIFB 5EH1A 5SWQA 4FQXA 1W6WA 4YL9A 4XX1E 2H9GA 4AGNA 4PWEA 3L6FB 2ZXGA 3PNWB 2L7JA 3EFFA 2B8OT 3BAEH 5DJYA 1NBZA 2O5YL 1NEZG 3TBCA 1NDGB 4QCIA 3K2MC 2AEPL 4K9EH 4JQVC 2XV0A 3HEIB 1ANUA 5A2LH 4W9FC 4XP5H 5CJ5A 2BP0B 3BSHA 2JCWA 4OF3A 4U7KA 2WNWA 3O6FD 3GDCA 3LXBA 3ZSTA 4R0LC 1A3LL 1MQKH 5ESAA 5T3ZE 2OA9A 4RSYA 1CE6B 5JOPE 1NGXA 4XN4A 4HS8H 5GIRB 2VLME 1KGYE 4E9YA 3QORC 3M86A 4NHUA 4NNPH 5C0IA 1TQBC 4OF8A 1RK1B 4X9BA 3UIZA 4K3EL 5GISH 4Y7OC 2EKSA 1E6JL 3PAZA 4XXDA 3TA4D 2FJUB 5KWYC 4PS3A 1SYSA 1JGEB 5HYSB 1UXSB 4QRPE 4MAUL 3MNWB 4GW1B 3TL5A 3TF7C 3K46A 4ETQA 2WNXA 2DMCA 2X40A 5D2LF 3KAAA 4MMXB 3VH8G 1PY0A 2JKXA 5KN5B 3SE4C 1HQRB 1UACL 1II4E 3PABB 3W9DB 1V3MA 2AMGA 3WENA 4OM1H 2XJLA 4HAKA 1MI5E 1O6VA 5EBGA 1Z9PA 4PCYA 1A1MA 5LCVA 1PZBA 1Y1UA 2X28A 1X5GA 3AVEA 3EH2A 4Y9BA 4MZRA 1AOZA 3S35X 3WUWG 1JHTB 4IQHA 2H1LM 2YLKA 3BZ4B 3ZTNH 3KWUA 1I1FB 4FG2A 3VFVA 2XWBB 5J9PA 1DBJH 2X9WA 2Q8AH 1P6WA 3RVTC 1A8ZA 1KN2H 4QRBA 1Q9LB 4KRPB 3JVFC 4NO0D 4B9GA 1KB5H 5D1XD 1DCLA 4WI8A 4ZYKB 3U4EB 2DWEA 4LCWB 4PHXA 4XBPB 3F7VB 2ZUQC 4JFWA 4F7CB 2CDEA 1RSFA 4E0RB 4U3CA 3VVVA 3TF4A 4FERA 4H20H 3P73A 4WWOA 1E4WH 3W1ZA 1EFXB 4HJEA 3MRHB 2PYEA 3ULVD 2BVTA 2Z3FA 1Z9OA 4HJIA 3QHZL 5KSBF 2JKIS 1N6UA 2CPCA 1O6SA 1Z0MA 3ME0B 3RDTB 2WB1A 4C83B 5TQ2H 5DMIH 2FYYA 3HMWH 4X6EA 1RUML 1YMHA 5DR5H 4S1DC 3RUGB 5AAWA 3LOWA 5D2LA 3BPOC 1ND0B 4WGVB 5DA0B 4TM9A 4J3WA 2MQ3A 3ZOAA 2E56A 4XPGL 3MXWH 5D7LA 2JNZA 5IB4A 4GXUM 4W9KC 2NY4D 3V0FA 1DFXA 1R3HA 3SPGA 2C7FA 2H2SC 2CIIA 4MQTB 4Y4HC 3H2PA 4I88A 4NNYA 3BO8B 1JWSB 3D25A 4QOKB 5DI8A 3L3GA 3SKNA 2VAAA 4P2QE 3BAJA 1I85A 2CIKA 3B6SB 2XICA 1RLWA 1SOXA 4YBQD 2EVFA 2DWDB 1LK2A 4FG6C 4AGMA 5B1BB 4MA8L 3TCLB 1BFVH 2WZPA 3QI9D 1TETL 5EPMB 4PLNC 2DQFB 2A6IA 2ZG3A 4YZFF 2VWEE 2C8NA 2WXJA 4OFKA 4XBGA 4Z7OE 2Y06H 4WSJA 3CCHA 2D3VA 4JKWA 1RZ7H 2QADD 5HYEA 3C5JA 5GGVY 1KOAA 2CR3A 5J56B 2O61B 1UOWA 1INEH 4JPKH 1AGEA 4S1SL 4JZJA 3A4DA 4HPYL 3EZ8A 2Y2TA 3NSYA 1LO3L 1A5FH 1T0MB 4CSTA 4HS6B 4UV7H 1DO6A 1RFDH 2OP4H 1NCAL 5DUBB 3T2NL 2R27A 1XMEB 1T0NA 4K5NA 1SMOA 1TKWB 4YDLC 3DX7A 5FDWB 5DD1L 1UM4H 1OTSD 1BAGA 4QRTA 1CU4L 4Z76A 2LHAA 3SDDC 1FCGA 4GP4B 5F8RC 2D7PA 1CBVL 5D1XC 1JMXA 1S7WA 4JDEA 3P4MA 2EIJB 1UH3A 1CLZH 4NO3B