1BMWA

A fibronectin type iii fold in plant allergens: the solution structure of phl pii from timothy grass pollen, nmr, 38 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLLEN ALLERGEN PHL P2
publication title An Immunoglobulin-Like Fold in a Major Plant Allergen: The Solution Structure of Phl P 2 from Timothy Grass Pollen.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 5
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1998-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1bmwA00
4FERA 4FG2A 1BMWA 2VXQA 3D30A 4FFTA 1N10A 3FT1A 2HCZX 4L48A 4FG4A 1WHOA 4JCWA 3FT9A 2JNZA 4JJOA 4JS7A 1WHPA 2BH0A
chains in the Genus database with same CATH superfamily
3UIZA 3F5WA 3W5NA 3BUYB 1O7VA 1FV1B 5DVPA 1BOYA 3QUZC 2HLAA 3SDYL 4S1QH 1ITBB 2E59A 2X88A 1JGVH 1GHFH 1TZHB 2HZHA 2DICA 5L88L 3SGEI 1XEDA 4Z3FA 4YUEL 3MO1B 3RHWF 3O4LB 5A3ID 4HA1A 4QT5A 2WXFA 4PJGA 3VWJB 2GTQA 2MKWA 3E0GA 2EIBA 3AT8A 2YQ3A 3JQOB 1OF2B 3DOIA 4L3CB 4FA6A 4W9ZA 4ABQA 5I8OH 5L2KB 1TO4A 2XHNA 4BGLA 2EDWA 5C0EB 4X6CB 3W0WE 5B1BB 3PL6D 2W80C 4LQFL 3NP4A 3ZUNC 4MZ3A 2VYRE 1QLEH 1N12A 2BY0A 1QWHA 3QW9A 4QRFA 3W2DH 3ZE1E 3GSQB 4JDVB 4QRPB 2H6PB 4WV1B 5GGRB 2XUWA 3NDYE 1TYRA 5FPIA 2G5RA 3BE1H 4Z7WA 1EZVY 2VZ3A 3DECA 4ZFFA 3QYNA 4QOKD 5E4EC 4L3ED 3VYPA 2IADB 3CFJB 3ZYOA 4XPBL 2BVYA 4Q9BA 4G8FA 2MNJB 3SGKC 3TFKD 2P80A 1FYTE 3TN0D 3UZVA 5EEUA 5I28A 5IOPA 4C47A 3O3AA 1I3UA 1DN0B 1TENA 1MHEA 1H8NA 5F7NC 2FQFA 1NAMA 3DX6A 2N1KA 3QDGD 4QHMB 3C12A 1SM3L 2X1OA 1OCCB 1KV3A 4ZQKA 5K9JL 3T0XA 3RDTB 4CU8A 3BW9B 1EZLA 3DXAA 4NQQA 4LSTL 1P6WA 3ISWA 4YH6A 5ID1B 4OZGA 3RX7A 3PLYA 2CIKA 5AW8B 2H32B 3MUGA 5DHVH 6TAAA 4DEPC 4ZTEA 1FH5L 1KJVB 1RHFA 4QPEA 3QWNA 2CDFB 1QYGL 1N64L 5SWZD 4HKJA 3MUHL 2BNRA 1UGKA 4P2RA 4X4KA 3QDAA 2ZJSH 3SDXA 7FABH 5IJDC 3FT0A 1L7TH 2BDNH 4OUUA 4V1DE 5A3IC 1T66D 3DRQB 5HDRA 5JO5A 1MCEA 2K6ZA 1K8DA 1FZJB 5CSBA 2HFTA 1GVIA 3L9EA 4KRPB 4Z7OF 4M1GL 4OI7A 4OFYD 3UXFA 3QQ4A 4GG6B 5E1IA 4MNHA 3CX5J 1VFBA 1JTTA 5JIDA 3PL6C 3CCHB 1S5IL 1TCRB 2AC0A 2J5LC 1LK3H 4W9CC 4YDNA 3P40A 4WFED 5LCVA 3ZYIA 4QRBA 4U6VL 4DGIL 4EPSA 1HHJB 3P54A 2BP0A 2F1AA 1TJGH 3CH1A 2VXUL 3AREB 3HR6A 1A6TA 3GEWB 4UT9L 4WUKL 3DDFA 3K3QA 1BPVA 2JJTA 4ZZKA 3B37A 2UX7A 2Q9OA 5EFIB 5K33A 3RUGE 1IM3D 1KYOJ 4W81A 4AV0A 3S97C 1BAWA 3TFKC 4N0UE 1Q72L 4I2XA 5EZOH 3TN0C 3RX8A 1FG2B 3FTXA 5T33H 3U0PB 2J3SA 4MCNA 2HKFL 1CD8A 1OB1B 5K1VA 3WGUB 1AGEA 2C3XA 1S3RA 2VLLB 2VRKA 2DQIL 4LCWA 3VFRA 2XWBA 3EJUA 3ME0A 4BDVB 1BAFL 3ESMA 1MRDL 2XQYA 5ERWB 4FNRA 1HE7A 4CDGC 4BWTA 1C8PA 2VT0A 3LN4B 2X0UA 3WL9B 5ALBH 2WQRA 3QAQA 1U8HB 1M42A 3GSWB 1JTOA 1N10A 4KGJA 4LF3B 2W9DH 3KWUA 2X6CA 5HDBB 4PRHB 2OR9H 2VMCA 1TQVA 1KNOB 3FTYA 4F7CA 3WTWA 4WTQA 4Q7DA 5E99L 2WXIA 4I1PA 2NY7H 4LPYA 3V5KB 4EDXB 4Y88A 4XMLL 1GGBH 4LRNH 1ZLSL 3FN9A 3LHAA 2Q8AH 1KXVA 5F89B 3VI4A 1UQSA 1T66C 4YZFF 2DQEH 2A4ZA 3IAQA 3QHFL 1S4IA 1KGUA 4MJIB 1WCQA 4HULB 4JCMA 1RUML 2WAHA 4TSBL 4HF5H 4PY8I 3GMOA 3NIDF 4K94H 4N8VA 5F7UA 4MA8H 3IU4H 3SEPA 5BO1H 1K9TA 4NNYB 2Q1EA 4NHUB 3GBDA 2P8MA 3L3JA 3O0LA 1X7QB 2FYYB 1I31A 5IQLA 1NJ9A 4WWKD 5ESAB 2XKSA 4L9LC 4X6BB 2FZ3A 5EU7E 4Q89A 1OHZA 4G72B 1E4KC 3O6LL 5JQ6H 2BSED 1S3KH 4MCYB 1NOLA 1RIHL 4P2AA 3SDYH 3HUJB 2A74C 4ZX6A 5IFAL 2OSXA 4UANA 2JXMB 1CGUA 4GUCA 4UIMB 5L88H 1BXUA 4YUEH 2GJPA 2XETA 3ZMRA 3UZQA 5DHVA 2AKRB 5JDSB 1XB8A 4ZUSB 1DBJL 3GXFA 1BQHG 3BP7A 1JPST 4XBPA 3E6HB 3NGBB 4GXVH 3K5SA 3AU0A 3UBHA 4PJCF 5G4OA 5G5DB 4JZNB 2BSDA 2V17L 2Y5EA 3GMPA 4O5LL 4P4RA 2XU9A 5EF1A 3LEXB 5TE7H 3WFCL 1P9MC 4OIIL 4Z95H 2EEDA 3TNNB 3KWTA 4HYTB 5BZDA 3QORB 2OTUA 1N0LB 2XJLA 4Y2LA 1KTJA 2G2RA 1UGNA 2LU5A 5DUMH 4AM0Q 2XIDA 2WINA 3DETD 3QQ9D 4XOCA 4YHPA 4XPBH 4X99A 3WNKA 2TSAA 3H4HA 1FVEA 3GMNA 3NFPB 1A1OB 3NJKA 4X6CF 5DJ0A 5IJKA 4HSQA 4M6OL 4F92B 5F0JB 3A4DA 4CNIA 1PMYA 4PJ8A 1VACB 3SPVB 3U0WL 4WEMB 1DJSA 3CZNA 3STLB 4LVOC 1EK3A 4X5XA 1A22B 1D5XA 1OGAA 3IMRA 2D2CC 4WRLA 1E67A 3UTSA 2ZNWA 4ZUWA 4WO4A 4XBEL 5GRYA 2A6KB 4TVSa 3EYUH 5BOJA 4WY7L 3B6SA 2ZXEB 4MA7L 3VI3B 4WWKC 1I8KB 1BXXA 3D3VD 3J07A 2V3FA 1IU1A 4IJ3C 1QYGH 1N64H 1U95A 4AEIH 4EQ3A 4F7MB 5KOMC 3VFPA 3BFOA 4ETYA 3FUMA 4EOWH 2C9XA 4HEPA 5JIKA 1T0NB 2E47A 3BKYL 3C2SA 1KB5B 1OGSA 2BC4A 4APQA 2UUDK 3II2A 4QXVA 2V2WB 4N9OB 2EDTA 1FC1A 5KVDL 3X2QB 2BSRB 1A7NL 4JFFB 4NUJA 4G43A 1RERA 2GEQA 4QI3A 3PRZA 4IBZA 3GMMA 4M1GH 5DVMA 1MXGA 4A38A 4PRPE 5IWLA 3JV5A 3NJGA 2Q7YB 4WAFA 2CIIB 3DX4A 5IVZB 5TGBB 3VH8B 3ZR6A 1S5IH 4AMXA 5JPMA 2A77H 2AERT 1ET7A 3MDJA 2CA3A 3M1CA 3GRWL 4LL4A 3Q44A 3C6SA 2XPZA 4U6VH 3MV11 4PY7A 3MLZL 3QDMD 1NC2D 1Q9LB 3CV5A 5EC2B 3MV7A 4JO4L 3DETC 3QQ9C 1UENA 4JQIL 1WUNT 1U8LB 1LDSA 1QX1A 2R8SL 4NPKA 3A21A 5I8CA 5FW7A 2YOAA 5B7EA 3BDYH 3DTUB 4B50A 4GG6F 4Z7QE 2QHLA 3MHZA 3CQFA 1P69B 1TJMA 2K7QA 5KN5B 4OFIA 5EOCL 5CZVH 3HE6A 3SYCA 4DGUA 5E6IB 2P24B 3ILPA 1DYZA 5G55A 2G2NA 1MFAL 3EH3B 5D6CA 2VLKA 5DC0A 1BLNA 1HXMB 2F74A 2A83B 5F1SA 3W37A 4G7VL 3V9CA 4MB1A 3L4XA 5E6UB 1WBXB 3DROB 1BAFH 1KYFA 2P5PA 2Z7WA 5CJ8A 4LKCA 2PCFA 4Z7UB 4DP7X 4EVNA 4OV5B 3IXTA 3PGDA 3R8BB 1MF2L 1T1XA 2GKIA 5AB9A 2XVGA 3KPTA 3L9BA 1FVCA 1RZKC 3VGGA 2J73A 2PNDA 4UM9D 2NXYD 4M9OA 5FUZH 1TMQA 3CN0A 4HXAL 3C8KB 5E99H 5D7IB 1FE8L 3JTTA 1S7RA 4M3KB 5JXEA 2A6DA 4XMLH 5CJ5A 1GA2A 4G6MH 4KZEL 1ZIBA 4XO4A 1YJDC 4AXWA 4C56E 2COVD 2WP3T 2ZF8A 4QF1A 5HYQA 3ARBD 3QHFH 1KIUB 3F12A 4FHKA 4OLXL 4WI0A 4PCKA 3BUDA 3RZCD 2ARJB 9PCYA 1EFXD 2XZCL 1T0OA 1ETZA 1RUMH 3CX2A 3S35H 5DHMC 4BH8B 3RWEB 1EZUA 4EZJA 4URTB 2G75A 4Q6IC 3GJEA 1IL1B 1NUGA 3BPCA 2RALA 3D39D 1N9PA 4NSKB 1E9QB 1TQSA 4PBXA 1R3IL 2GT9B 2KUTA 1DVSA 4MJ6A 5JOFA 1J0YA 1OD9A 5D9SB 2IMNA 1KIRA 4KJPC 1AP2B 5HI5D 4BHUA 1KLFB 1QRNB 1T1WB 2QT6A 3C60B 3UPRA 4Z5RA 1RJYA 3FB6A 5C3LD 5CBEB 4GS7C 4PRAA 5IFAH 1OM9A 3QEQE 4OKVA 4H0LC 1JGUH 4JZJB 2X6UA 3CHQA 3EFFA 1UUSA 1DBJH 1OAKH 3RPIA 3WU1A 3V9EA 1IFGA 5A6IA 1EJOL 1UD4A 5T5FL 2E7CA 2V17H 4O5LH 5K59E 4NQDA 2N7AA 2WAQA 3HUJF 1KB5L 2CJUH 2YIHA 3RWFB 5HPMA 3DPDA 4AUYA 5KSBB 2O61A 3WJLC 1EWHA 4ZX5A 4TLTA 1MJJB 4O2EB 4DW2H 2NXYC 5DD6A 2Z93B 2OKMA 3P73B 4U6XA 1LWJA 4P5MB 3VUAA 4PJAE 2CO7B 5I16B 4NQCB 3QVAA 4WHDA 3L6FA 1VKXA 3U0WH 1Z66A 3ARBC 1DJYA 4Z76B 2OYMA 1EERB 2VN3A 4DGYL 2O5YL 3RZCC 2PO6D 1SMAA 2EVJA 5SWSB 1A9VA 2Q6WA 3SPCA 3S35X 4BK5A 1JS4A 4QKXB 3BMWA 4XBEH 3BIKA 2I60L 4S2SA 5DMYA 4P99A 4ZTPL 1U6AH 4WY7H 1SJHB 4PJ9B 5INCA 2WN3A 4MNQD 2YZ8A 1AHKA 4BK4A 1YCSA 2IDSA 1UJ3C 4MJ4A 5HI5C 4ABUA 2C4FU 3QUKA 4QGYA 1L6ZA 1OL0A 3BKYH 3BVWA 4PJCA 4XNXL 2RR3A 1FV1A 4F8TA 1F6AB 5C0BD 1CYXA 4DAGL 5T1DL 2ORBL 5A1AA 3W9EB 5DQDH 2OXGA 4G2AA 4R4BA 3J7HA 2EYSB 2FJHA 3WNJA 3VI3F 1H3UA 2W38A 4PV9B 2ITCB 5EUOB 3OKLB 5IW3A 3MUUA 1VA9A 2HKHH 3TPUB 3SY6A 3MLPA 1AVAA 2VXSL 3BFQG 5KVFE 1XF4A 3RWIB 3HVNA 2N0KA 1J5CA 1ZE3C 2CXKA 5IW1B 4F20A 4ZS7L 2B9AA 3VSUA 1X5AA 4XNMB 3AW5A 3K72B 4JQIH 1JWUB 5DSCA 3DUHA 4Y19E 1JV5A 2R8SH 3T1FB 1I85A 4TQIA 3U25A 3DJSA 5C0AB 3WIFB 4LVNC 1YEDB 5A16B 2LTQB 3JWOC 3IK2A 4XB7A 3H2PA 1XCQA 3I3BA 4X83A 3T8XB 1UZ8B 1X9UA 1T7XA 4GP8B 1CDYA 3IE9A 2MHAB 4WHCA 2HH0L 5FWRA 3GZQA 1A9BA 5HYJD 2PO6C 5B3SB 1J8HB 3OG4B 4L8DB 3B9AA 4G7VH 3RTQC 2Q76B 1LNUA 3ULUH 4M93B 4W9FC 1P5VB 3SDDD 1NM9A 5JZ7C 3S88H 2NNRA 1JI1A 5FUOL 2P7TB 1MF2H 4TLKA 1XWVA 1JPSH 2FECL 3L9YA 2OP4L 4AM0A 3QUXA 5B4MD 1AO7D 3FUJA 3P0VL 3GI9H 2CLVA 1I7ZA 4JKKA 1YYLL 5DO8A 5FW8A 3QNZB 3FSVA 1JCVA 4KJYA 1FE8H 5FW6A 1FORH 1C5BH 4P57A 1A6PA 2Y1AA 5EWIH 3QFJD 3TZVA 1BD2D 2ESVA 4KZEH 3RX9A 5BQDA 4JFPB 5MEPB 1AJ7H 2Y2YA 2HT4D 12E8H 4GSDH 4OLXH 4R6UA 4TVPD 3VD9A 2HRGA 3WS3B 2JVUA 2XA8L 2XZCH 5I1DB 1FGVL 3DRQA 3FU9A 3EGSB 4PD4K 3KYMA 2ZG1A 4JW3A 3DC0A 2ENQA 3DJTA 1S78D 2V5YA 3ABZA 1CDIA 1J0IA 2VO8A 2IO5A 3PIQB 1NFDE 2AS5M 3OHXC 4L48A 2VQUA 3EOYG 4DWHA 3D52A 4OF5A 2CBPA 4CILA 3OKKA 5FX3A 4C4BA 4EBQL 3MNZB 2EUXA 3DHUA 3UAFA 1JZJA 1SEQH 4LL1A 1HHHA 4O2FA 1VADA 1OSYA 4HPOL 2VL5A 2BVTA 2K6YA 4CKQA 1JMXA 4XP1H 4ZK8A 5EZLA 3H2WA 5EU3B 1BZOA 4QYOB 4GBXD 3V4PH 4JPVH 2EH8L 5EFIA 3SOBH 3OZ9H 5H35A 1IBBA 1NANH 3VFGH 1ZPLA 3CVCA 4P48A 3H56A 4ZXBB 1CUOA 4NENB 1SJEA 1EJOH 4HC1L 1W0YT 5ID0B 5J11C 1KPUA 4F7EB 3A4AA 3SDDC 3IJYA 1KB5H 3VG0L 4NJ9H 5DLML 4Z7NE 1DUZB 2RD0A 2K45A 3GSVB 2F8IA 1BVLB 3DIVA 1X5JA 2QZQA 2VE6B 5DJYA 5B4MC 3EJTA 1F3JB 4CVUA 1IC7H 2NZIA 3QZWB 2NY6D 1J86A 1C7TA 1BZDA 3IJ8A 2GC4C 4AQZA 3CN4A 1J8SA 3HEIB 4U3CA 4FXKC 3LH2H 4XMPH 4P4KB 5DD3L 2DMCA 2JV6A 3O11B 1OP3K 4M7KH 3T3MB 4PMFA 1GZPA 2VITA 1SLUA 2B1AL 1RFDL 5SWQB 4N3TA 2D0FA 3TA3A 3VGBA 2HT4C 4GIPD 1ZS8B 4JY6A 4ODXB 4U1JA 2O5YH 2X09A 5I1GL 5KSBF 2W1NA 5F70A 4QTIL 3PNWA 1T5WB 4Z7VA 4UNUA 3U9PH 4GKNB 4ZMNA 1MCOL 1RV6X 4OFQA 3AT0A 2XG4B 2C1OA 1JI2A 1FG9C 1P2CA 2N4IA 5LO7A 4ZTPH 4Y4HA 3DSFL 3U9UB 5FYLH 1SHMA 2FWSA 2Y0SA 4G9DA 3TV3L 3RURA 1E28A 4HUXB 4JFSA 3QIBB 1JZ5A 1GC1L 2K8QA 1JXKA 5E8DH 2NY4D 5E2VH 1M05B 5CWSA 1KENH 2W92A 3NDZE 2F9BT 2E7DA 4XNXH 4BFRA 2BRQA 2DLTA 2L04A 3KPLB 5MP6L 1FYTD 1PGRB 1Z7JA 3GHBL 4UOJA 4OJDH 3BHBB 3VX1A 1PBYA 1NA8A 3OKMA 3TFBA 2WYZA 3Q8CA 1CBJA 2ORBH 1XSKA 1F8TH 1ZT1B 4GBXC 4I4WB 5AUMA 4RNRB 5TF1H 3ZK0A 1UB5A 4AIEA 1KIPA 2VXQL 2EDMA 1MG2C 5GS1C 1ZD6A 3HPLA 1TZGH 2ZKHL 5EIIB 3M6DA 4PUBH 3VGEA 4RGNB 4PG9B 3NJIA 5GHWL 3VAEA 1MIEH 2DQTL 4YX2L 3ATEA 2VXSH 1ZHBB 4ODWB 2C4XA 2UZXA 3OAWA 4N1EA 1Q0XH 4ZFZA 3MVSA 3LEXA 2X2UA 2BERA 3Q2CA 2H0EA 4I9XA 4ZS7H 2ICEC 1AYOA 3SDCB 1TQCC 3LKQB 3ASOB 4ZUVB 2NY6C 2QLYA 3WSQH 2WN2A 5EULV 3BPLB 4X4YB 4LRIA 5L4FA 4XP5L 5KTEL 3B9VA 2MFNA 4YLQT 5D7SL 4JG5A 3VXMB 4LNRA 1XGRB 4IKIA 1PZCA 5C07E 2IBZY 3L5WB 1R3KB 3MBWB 4FJZA 2HH0H 4NO2A 3KZ8A 1CLOL 3LZFL 2EO1A 3DYMA 5CMAA 1NIEA 2CKNA 5D1XB 1N8ZA 3I9GL 3EBAA 1AQDA 4ZO8A 4BQ9A 3NJHA 1WZAA 2KKQA 3PPSA 5FUOH 3MJ8A 5FFOA 3KPRD 1QQDB 3HNSL 4QRRB 1D6EA 2OP4H 2OSLA 4IIQC 3V4PA 4RZCB 4WHTA 1CD0A 4Z78B 3H4FA 3VGAC 3O8XC 3H3KA 2NY4C 4EIZC 2XKUA 4FNQA 2EO7A 3OX8A 2X89D 3MBED 4L9DA 1NSNH 3VXRD 2XYBA 3TBTB 2CE6A 3BP5A 4ETQB 4PLKD 3CFBB 4ZUTA 4E9WA 3O3DB 3Q5OA 3NJLA 4FG6D 3G6JB 3ZE2F 1OD7A 3VD1A 4WJ5A 3VFUB 2F54E 1DQDL 1UWGL 4L4VB 1R9FA 2ZUXA 3HZKB 3WN5A 4UTBH 1D5IL 7PAZA 1Z9SB 5SX4I 4RAUB 1NMAL 4HT1L 5L6YL 5D55A 4ENZA 4JG1L 3BUIA 3VWKA 4JFEB 4AL8C 2ZX7A 2CNZA 4H1LG 5I1LA 4PJEB 1JPGA 4G82A 3RFRA 5F7LB 2BSCA 3NCFB 4HWZB 3JWDL 3OR7B 5TE6L 4R83A 1MNUH 5I6XB 5KVGH 2FHBA 3IF1B 3ZE0E 2IDQA 4HPOH 1QUNB 4A39A 3BQUA 1R5WA 4CC0A 3FT4A 1AXTH 3HB3B 4NZRH 2X05A 3A3YB 2Q3XA 2QMJA 1QA9A 3L4YA 5I71B 1CL7I 3P4NA 1LO0L 5BZXA 3QNXB 2CK0H 2F19L 4FRWA 4WTZA 1VRSA 4YE4H 4GB9A 3OR6B 2NY1D 4FQXA 3D18B 4HD5A 5DTFB 4ODSH 1ODAA 2QKIA 4RFNC 1HOCB 5DLMH 4J8QA 3V52L 3BVNB 1ZVSA 5E9NA 2H9GB 3AY2A 3WKML 5EB9A 5I2IA 4HP5A 4OV5A 3UJJL 3FT2B 1YUHA 3DX0A 2VM4A 1MDTA 2DQJL 5F2FA 4LSSL 3MBEC 2A9BA 3OJDB 4PJFE 5DD3H 2X4NA 3OAUL 2G9KA 3O6KL 3ZKXB 3C8KA 5GRUL 1KTKE 1RFDH 4YC2C 2OI9C 3HVDA 1TQBC 4FG6C 4YPGA 1J9TA 2OMYA 1THCA 2G3XA 1BZ9B 5INDA 1JYNA 5I1GH 1RZJL 3CVIH 2W5PA 3TCXA 4EF3A 1P1ZB 3CVHB 5E5RB 5C0FB 4XN4A 4XMTA 4CMMB 5AD0A 3DO4A 4G42B 5MENE 3DSFH 5IMLA 4JPWL 3T3MF 3HG1B 1QPKA 1XCTB 3I02B 2OZ4H 3QH3A 4JPIA 1Q9WA 3DWTA 3GUFA 5L4MA 2J8UB 3FQWB 4NN5B 1EHAA 1ZMYA 2VLRD 4KY1H 4LHQB 4AUUA 3QPXL 3K6NA 5KZCD 2OMZA 3LNGA 5MP6H 3V7AG 1E2ZA 1BYPA 1P0SE 3THMH 1YMME 3GHBH 2EC8A 3RA7L 4KTEL 3AABA 1G7IB 1MCJA 4X5WA 3DNKA 2MTAA 3JV4B 4JB9L 5F3HB 1FGNH 2VXQH 2ZWKA 3WS6C 1JHLL 1BQLL 3WIAA 1A4AA 3ZXAC 2JB6A 4LLWB 4WI9A 2ZKHH 5DDHB 4GEIA 1M9SA 2Y6SD 3O2DL 3C5ZA 3NN8B 4CC1A 2NY1C 2EICA 1WBZA 3KDMA 4P2QD 4F9PC 1QSEB 1AGBA 3D4CA 2DQTH 4JRYE 4YMPA 2E7BA 5E70A 2W60A 3HHMA 2ZIDA 3P02A 1UB6B 2D3NA 4FXGC 2D3LA 2X2YA 3IJHB 3MRCA 1NPNA 2K3HA 3O6FC 3IDIB 4G7YL 4Y4FD 3MJ9H 2BSTA 2YXFA 3HZ3A 3TO4D 5J6SA 4UTBA 4XP5H 4OZHA 1IMHC 1BVNP 1E9OB 2K9UA 2LW3A 5ICXA 1UA6L 5PAZA 3LZOA 4JO8A 2MIZA 2IANB 3IFNL 1DDHB 1M4KA 2G4GA 5FO2A 3NMEA 2ARWA 5HGDA 3TBSB 1JF6A 1JIBA 2DWEB 1CDCA 1GY1A 3I6KA 1AZNA 4DPAX 4E42B 3I9GH 4UMGA 2J44A 5LQBL 4LNVA 1ERNA 2HVKA 1DSYA 4K5MA 5D1ZB 2W07B 4BZ1H 2XFXA 3BZFA 3HNSH 2R29H 2Y72A 3EGDB 3QWRA 3HAEG 3M07A 4IRZL 2BNQE 1NC4B 3JTBA 4JY4B 4KKQA 2G9HB 3DMMB 3PFQA 4LAQH 5FA4A 2YLHA 1H0DB 3U48A 3TH2T 3WE1A 3PS6A 3FOLB 3BLBA 1KN4L 1NUFA 4WU7A 4CSZA 3PAVA 1JN6A 4UCFA 2D4DA 1XX9C 3SYQA 4B7IA 4B9FA 1UWGH 1A3LL 1U58A 3H9SA 2JMRA 4A7UA 1UWEL 1PKQA 3P77B 2Y6SC 1HQ4A 2AQ2A 3ML8A 4N8UA 2ZCZA 5DJ6A 5J89A 2CZNA 1XGUB 5JW5A 5L6YH 1DCLA 3TEXA 3KGSA 1IGYB 3DHMA 4YHMH 4HZ1A 1ZJAA 4U1LA 2R0WL 3RVTD 2GK2A 2BLFA 1HSAB 3FFOA 5F9JA 4BFEA 3EH5B 1ZVNA 3JWDH 4DZ8A 3DX9B 4Y5VC 5JLZB 2CRZA 2QZ5A 3ZGIA 4Y4FC 3TO4C 2NYYD 1I9IH 1JRHI 2UXGA 3FS9A 4HKXA 2CO6B 4JFYB 1K4CA 3CVHL 2AEPH 3GNMH 4F2EA 3WI9A 1XEUA 3PWNB 1XH0A 1NGZA 1CICA 1H3VA 3VRIA 3PV7A 1HL5A 2ZXAA 3ZQWA 4E5XB 3FQTB 1WAEA 2VN4A 4F93B 4J6IA 1YN7A 2NW2B 4B3EA 3E2HC 5L9DH 1JPFA 2IC2A 2Z1KA 4DKTA 2F19H 1M56B 5B8CB 2OZ4A 5B7MA 2GSIB 1ACYH 5D96B 5ANMB 3NRQA 3MCLL 1FC2D 5IVNA 1WCBA 3GRGA 4H8WL 1ET5A 4WW2B 2QKSA 3V52H 1HILA 3E1ZA 5KSAD 4NP4H 4QRTB 4EI0A 5F7BA 3WKMH 2XN9E 4GFXA 4HIQA 4J1UB 1YHPA 2W9LA 4PB9L 4OFDA 1J0ZA 2WNGA 4NO0B 5EU4A 3UJJH 5IESH 1Q94A 1XIWD 3TXAA 3X17A 2EVFA 1L0YA 4F37K 5TE4L 4OD1L 1IEAB 5LXVA 2RCSL 2EE6A 1BEYH 4RA3A 2FWOB 4U1GC 5K9OB 3AWFA 1U21A 2LE9A 5EDSA 3IYLW 1T20B 1GW6A 4OBRA 4IK6A 1E9PA 3UIYA 1M7DA 1ACXA 1R19A 5AOMA 1MQKL 1IAIM 4DERA 1M3IA 4LLAA 4OQ1A 4MD4B 4DP0X 1NEPA 5B38G 1Z9LA 3MJ9A 2FJGA 5BQ7A 5ICZA 3EGSA 3LZQA 4G7QB 2CHWA 1K3ZA 1ZTXE 2DWTA 4N86A 3RVTC 1M1SA 2YFNA 1TDQA 3HI1A 3L5HA 1XF3A 2X1WL 4LP8A 4FXLA 2WIMA 1IIKA 3CFCL 2NYYC 2VM9A 3NZHL 1I1FA 3HG5A 2Z7UA 3RIAK 3MNZA 4RMVA 1EA9C 4MMYA 1E8WA 3RA7H 4MMZC 4OCMC 4ONGL 1XL4A 4BZ1A 1JHLH 2R29A 4F27A 1ORQB 3Q01A 3QIWD 4PVLA 3KPOB 2R59A 3O2DH 5BW7A 2DQMA 3PJSB 3FSWA 3WENA 3WO4C 2X1PA 1KJ3L 2X4TB 2J8UF 2YAQA 5TQ2H 1B9ZA 5KSAC 1EZSA 2L0DA 2VLJD 4ZFGL 4GRLA 1B4TA 4JREC 4FS0A 4AQ1B 3QULA 3MFGB 1XIWC 4WDIA 4G7YH 4OM0H 1DBAH 2WVUA 2MPAH 3HMWL 3RJQB 4HEMA 4M6NL 4QYAA 5KVEE 5CJQL 2FWUA 4KQ0A 3SDAB 2LFEA 2IVFC 4IKJA 4OZFB 4X9YA 4GSUA 2DIEA 1E8XA 1WZLA 3TF7C 4NRXA 4B3VA 4RRPM 3V6OA 1QBBA 3CFNA 3D4ZA 2IPTH 3MYZA 4HFWB 2WNWA 5AVWB 4XB3A 2EEBA 3B9KD 3I6LE 2AXFA 3AM8A 1MEXH 1E43A 4IRZH 1GYCA 3FTVA 3WGVB 2DM7A 4FZEL 3NQIA 5FO9A 2I7OA 1T83A 4NAMA 1G7HA 3FO2B 3V5HB 5IIEB 1K72A 4B9CA 5LGKA 2PXYA 3GIZL 3MX0A 4JRXE 1IT9L 1P6AB 3V95A 3S36L 3VDAA 4AZ8A 4FHJA 4AMKH 5GSVB 3QCVH 1QSVA 3O3BA 5E4EB 2VB5A 3RAJH 2YGNA 3ZRCC 5FFGA 1T5XA 4BJLA 1S7SB 3BZ5A 3FU3A 1KT2B 4K8RL 5ADPL 3QAZB 1F4XL 2W9EL 5DJZA 3D2UB 5HJGA 2IBBA 3QIWC 1M7IA 1UWEH 2Y1VA 5KYWB 2VZSA 1XQ4A 1FZKA 2YKLH 4X0KB 4GJTB 1KGWA 4H5SB 4OF7A 4WJG3 2IWGA 5CZXD 3MLTB 3QS2A 1R24A 1AKJB 5CEXB 1JRHL 4PG9A 2IOIA 2FLRT 2R0WH 2WWOA 1QRKA 4P3DB 3FF7A 1M71A 1Z3GL 1WT5A 4BYHA 1WE5A 2HN7A 5I6NA 3AG2B 5JR1L 2J1XA 2P8PA 2QV4A 3H42L 3U46A 4YSEA 4XNYL 2YSSB 3CVHH 3X12B 5LNEA 4IGBB 3RBSA 4RMRA 2EIMB 1B3IA 2J55A 5HHNA 3Q6GH 4N4YB 3F58L 4ADIA 1KB9K 2XZZA 2FE0A 3D85A 4WU5B 5BXFB 2VIRA 1F58L 4GRWF 1F45A 2R1XB 1NM4A 4N6QA 3MCLH 4LU5H 2ODHA 5IB5B 4IRJD 4P59L 5EV7A 4H8WH 5BV7C 4AQAB 2YD8A 3F83A 2A6IA 3B9KC 5BRZD 1RZGB 1INDH 3GM0A 4NZUH 2JKJA 1JSYA 4F9LA 2ZCLH 4FLOA 2VGLM 2NY2D 5J6GB 5EN3A 4ORGA 3O41B 1QLFA 4RZCA 4M4RA 3P2BA 3O2DA 1H9DA 3U2IA 3WJMA 3BN3B 3PHAA 2GSGB 3BRDA 2JF1A 4QOKB 4JQVA 3LIZH 5JOEA 4GEJA 5GIRA 4N0YH 4WW2F 4HUWA 2VMDA 2Q2LA 4F5CE 1MQKH 1F02I 3MUJA 1GGYA 1E40A 3MOBH 3CWGA 4PYGA 4DIXA 4FKHA 1UXSA 3NEOA 2ZPKL 3WHXB 5AYUL 1NGYB 5AEAA 4YK4C 3G04B 3QDGB 5CZXC 4U49A 3AXHA 4XZUA 3GFUA 1GS8A 5L0QB 1IO4C 4BKSC 3GBLA 1WG3A 5TPWL 1A2YB 4NNPL 3GD1C 4LCIL 4P49A 3X14B 5DK0A 5LNDA 2VNCA 2YD5A 1RIVL 2FBJL 3C08L 2EZ0D 1U8NB 1EMTH 3TA4D 2EE0A 2X2JA 2ZCHH 3VRLE 1OF0A 5GZOD 1BVNT 3W57A 1KTDB 2CHNA 3IU3A 4ONGH 4Y1AE 4ZTOH 5ESQA 3KS0J 2X6AA 1CYGA 4G6KL 4XAWL 3ZU8A 2NTFA 4D0BB 2HFGH 2JTDA 5K9KB 4K7FA 4S0HA 1IGJB 1T03L 1CLYH 1RMFH 5EU5B 1W8NA 5IB2B 1WBYA 2XBZA 2OW6A 1FIGH 4IRJC 5BNXD 4I0KA 3WEOA 3CUPB 3T3PB 4PTTB 1QMUA 5FIEA 4FULA 1OP5K 3LKSA 2LABA 3UOAB 3A5VA 1M1XB 2Z9TA 5D7JC 3VGHA 2NY2C 2K9FB 5HY9B 5KAQG 2NNAB 1KXTB 4N90E 5F1IA 3N44B 4L9LB 1SBBA 3HMWH 3H1ZA 4Y5XC 2CLRA 4I9WD 4HJGA 3EO9H 4PTUB 3ROOA 5SX5K 2NMSA 3MNDA 1HU8A 4FJYA 4FF9A 3CDCA 3MRGA 2F54B 5ISZE 2OXHA 4M1CD 3UCQA 1V5JA 5AOIA 1B0WA 3G5WA 4GRWH 1PY9A 1Z9OA 5ABDE 1QR4A 5DU7A 4V33A 3HZVA 1P7QD 2APFA 1E0OB 1DQLL 1QFWL 1NLDL 2HJFB 3H0TA 3WFBL 5EOCJ 2IWKA 3LPOA 4P2OA 3OPZH 5T3ZH 5B1KA 1MW3A 5IR1B 3FCTB 3VXSA 2GFBA 4LT7A 1J7VR 2WBJD 4Z3EA 2WKGA 3N3EA 3R0MA 4PP2B 2F7QA 4FZEH 3BISA 4TM9A 4Y1TA 5CM1A 2LHAA 4PB0L 3AQYA 1X4XA 1KTLA 4KDWA 1SXNA 4MHHG 2EZ0C 3SYOA 3V0JA 3ALWA 3DIFB 1OP3H 4DCQA 2P44B 1O6SB 5GZOC 4W9DC 5C07D 3VXUB 1HKFA 3GIVA 2OJ1A 1E7VA 4M7ZC 3SBRA 1LEKB 1KTBA 2YD1A 3MPCA 4ORZC 4KQ4L 5ADPH 2W9EH 2F2HA 3ARDA 5LVEA 1QUPA 5JHBA 2WYTA 3EJPA 2HP4A 5FYJH 1AI1L 3SYAA 4PY8J 2IDFA 1U91A 3QPKA 1XH2A 4LVOB 4TNGA 4BSVA 3RWHA 1LVEA 2R4SH 4BFOA 5LKNA 2AV1B 4D9QE 1BQHA 1HL9A 2NYKA 3FU8A 3LIZA 4FFZL 4M6ML 5I74C 1MFVA 3VXPB 1WAAF 2Z64C 1EO7A 1MSPA 2ADJB 2Y2WA 4WWKB 2DS4A 4GQRA 4AG4L 4XX1G 2ICWB 5BZZA 4JFOB 1SBSL 3SHSA 5DWUH 4KC3B 3BD5A 2W59A 4MAYD 2X6VA 3F58H 5H37G 2I25N 2D0GA 1LE5A 1X7TA 1UZ6E 2APWA 3HCVB 4M1CC 2FTAA 1KPVB 3UC0L 4BK8A 3CZJA 1IIIA 5AALA 4LAJH 2CKBH 1T2QL 2A99A 5FR3A 2ZSWB 4XN9A 1ZSHA 1BVZA 3TBSA 3VDCA 1PNCA 4L8BA 2R23B 1FRGH 2BY3A 4O2CB 4KPHL 3TCLA 3FH7A 2WBJC 5D1ZA 1M6UA 2F53E 4OIAA 3MRKB 3OKEB 3S34H 4BCZA 4NBYB 4R96B 5TDNA 1EX0A 1JYVA 4YO0A 4C55A 4DKEL 4TOYH 3OMZA 4MJHA 5DQ9B 4P3CL 5GJTL 1KG0A 4TVUA 4NO3A 3ECUA 1KEGH 1EXUB 4QXUL 1Y6NR 4DN3L 1CD1B 1KCUL 2BFGA 3LNDA 1IV8A 2C3VA 3HNVH 3NH7H 1TQTA 5IT2L 1N19A 4U4BA 4ZMTA 3H85A 3T4AB 1A6ZA 4XPGH 1X6NA 4FG2A 5AYUH 2QQKL 5HD8D 3ZTEA 2DQGL 3IKCB 3DO3A 1N6QL 4JRLA 3QCUL 3LN5A 5BS0E 1IJNA 2W0PA 3JT0A 1U8OB 3PG2A 4FQCL 1OK0A 5J12C 5FAAA 3FULA 4NWUL 1QSFB 4LCIH 4MAZA 4UTAH 4ZS6D 3JTSB 4H1LB 1RIVH 3C08H 1GYAA 25C8H 3D3VB 3PWPA 1THAA 4G8EA 3U1PA 2VZUA 3IDXL 4PJ5E 1DUYB 2NUPA 4HUMB 1IC4L 4JFDA 3ARGA 3U4AA 4MAYC 3SODB 4JFYA 4Q9RL 4G6FD 2E46A 4JHZA 2FO4A 2XX1A 4HWBL 3L16A 1W6WA 2IH9A 1JK9A 3PJLA 1L9SA 4IKNA 1XDTT 1Z5LA 1ZPUA 3K81A 5AWNL 2R27A 4CUCA 3MYJA 4PEEA 1MCLA 2AV7A 2ED7A 5AL0A 1NEUA 4OIBA 2RQ8A 1E5BA 1T2XA 3BT2L 4N9GA 1G7JA 4LSPL 5MEND 2G3MA 3T77B 1ECZA 3IJEA 1RZFL 2L3BA 4L1HA 1RZ7L 4NN7C 1SOQA 5CJOL 1CE6A 4PGDB 2BNQB 3FZUD 4H2CA 2YK1L 3PGFL 4G6JL 3T6VA 5DEFA 3CIQA 1KCSL 2XIBA 4EAEA 1BREA 3ET9F 4UQBA 1GH7A 3KL3A 1KBGL 4JN2A 4ONHB 1M7XA 1QHOA 1NC2B 2WANA 3A22A 3MREB 5F7DA 5HHOE 4FI6A 4LLQB 3EOBB 5DJ8B 3U36B 5IW6B 1IEAA 2JJWA 1DJHA 2YAMA 4OLUH 3T3PF 1ZRUA 4N2AA 3OXSA 5E9DD 4BBWA 4AT6B 1ML0A 3FKUS 1NDMB 5HGGS 5FO7B 3ZDXB 1NMCC 1TXKA 3BWUC 5C0DA 1QFWH 1NLDH 4NAJA 4MSWA 2NY5L 3BZ4B 4JRYD 1HQRB 4PV1C 3MGTA 3P11L 5HD8C 1SHXA 2WLIB 2MCMA 15C8H 1A6AB 1F90H 3COOA 3MJGX 2PPCA 2A4CA 5DD1H 1DQJA 1BSIA 32C2A 4HBQA 1RUQL 4XNQB 1DEEA 5EBMA 1LDPL 3WIHL 4DT2A 1CXEA 3CFTA 4ODHL 5E0FA 2RIKA 4ZS6C 4RA0C 4CADB 2XTSA 4YHOH 5L4JA 3ATDA 2OJZH 2CKBA 5D8JH 2Y69B 2XIIA 3D25B 4U3SB 4XNUH 4PJIE 4UT6L 5FV1L 4G1MA 3MRNB 3U4BH 5MHSE 3A6CL 4KQ4H 1GSKA 5EC1B 2R69A 4A7QA 1DLFL 4P5SA 3IDJA 5F7MC 5E24E 1PKOA 5EOQL 5C9JB 1KBWA 3B8SA 5GS3A 1ANUA 1EFXB 3GBEA 2GBAA 2X4UB 2DI8A 3M8OL 1OWWA 1N8OE 4EUPG 3IETA 5TK4A 1RIUH 4PJHE 3FZUC 3M17A 3D39B 1RL1A 1IGTA 4ZFOB 1IVTA 4LVHC 5ECJE 3C6EA 1YPZE 3RWGB 1KF9B 1TSRA 3V0EA 2LLNA 1SBSH 4M03A 4LARH 3WAJA 1FF5A 4U1HB 4M61A 1UJ3B 2FHFA 5FM8A 2YPLE 1YEJL 4YHYB 3CXHK 1HJCA 2V9RA 3SGJC 4N24A 3QUZA 3SOTA 1TTUA 3FMGL 5J9PA 5B39G 3RJDA 3SN6N 2M1KA 4AKOA 4L37A 5AAWC 3GS0A 3C6LB 1WV7T 3QDJE 4UTAA 1KC5L 1T2QH 2PWHA 2BS71 1TTRA 1F3DH 1KPRB 3VACA 5DC4B 2R7EB 2XQBL 1MW2A 1GYUA 3EFOA 3IFLH 3KR3L 3LPWA 4PJXE 4Q0XH 4PS7A 4AYID 4B60A 1A4JB 2P8LB 3KPSA 4MXVF 5A40E 4AQEB 1Z5HA 1IC1A 4IMLB 3RVUD 3TOPA 4W70A 4B7LA 4WEBL 3GMRA 3OWEA 2Q8BL 4QRQB 1YJDL 3N06B 4F37F 4Q9QL 3HAEB 4Q6KA 1XD0A 2MQCA 3CHXA 3X13A 4FC3E 4BH7B 4NM8L 1PQZB 4QXUH 3R7RA 2E6JA 3C5SA 1TNMA 5AG9A 3L54A 4DN3H 2EDLA 1KCUH 4H88L 3T4YA 1NAKL 4XCFH 1OW0C 3ESPA 4FQPA 5FM5M 3OLDA 4P2RD 4HWEH 5IT2H 4OT1H 2P5EB 1KT2A 1PPIA 4PJBA 4CVXA 1A3QA 2X87A 1Q38A 3FHAA 2QQKH 4N8CL 3UTZA 2DQGH 2YQGA 3GJFK 5C0CA 3GT6A 2X70B 3QCUH 1AHWA 2IG2L 4FZ8H 3TV8A 4BFNA 5IB3A 1JFQL 1NQBA 3K4AA 1LO3H 4FQ2L 4MQXD 4NWUH 5CFHA 4OTXL 3MRMA 4F2MB 3NOIA 2YJQA 3T04D 3GM8A 1L9RA 1K4DA 2FD6L 3L3DA 1UZGA 1ZANL 4CSTA 1NCJA 2HJKA 3S96B 2Z8RA 5FUCE 1AQMA 2UZIH 2Y7QB 4MRCA 4YFDB 5HJ3A 4Q9RH 1B2YA 3X12A 4ZSOA 2WXOA 4IOIA 4G9FE 2RH0A 2YGPA 4EMZA 4X5PA 4MJ5A 4KKBD 4DFHA 1KXHA 4XP9L 4ZNEE 2LVCA 3OG6B 3ECBB 5IF0B 3EXLA 1Y6MR 2H2SD 1DR9A 2H45A 4XCNB 3BT2H 5BXFA 5I17A 3F85A 4LSPH 2DTML 1TZIA 3QDHA 1UM6H 3QIUA 5IVXE 1P5UB 1RZFH 2WMPA 3HRZB 1RZ7H 4OLYL 5CJOH 1BVOA 2BPBA 4HIHA 3QHZL 1G0DA 3PGFH 3N0AA 3TIDA 1RZGA 3RVUC 1KTCA 3MLXL 4JJHA 5HTSA 5HGAA 4CSPA 1WJ3A 3PL6A 3ESNA 4JRXB 4N6RA 4XAKD 5J6GA 4XBGB 1EVTC 1U3JA 1GGCL 3WTVA 3P30H 1P7KB 3FB5B 2Z92B 4Y5YB 2PTTA 2NUTB 1W0WA 3ALXA 2Z7YA 4PGZA 2G60H 2Y7MA 2RFXA 4HQQH 3UMNA 5D1QD 4UZGA 4L3EA 5BVJA 5MERB 3T0EA 1T0MB 4X7TB 4ZFOL 4DETA 1W72B 1OIOA 3REWB 2EP6A 4LPTA 2NY5H 1ITCA 4XNAA 2J1ZA 4FTVA 2VMFA 3TN0A 5HYJB 4EE2A 5AVZB 8FABB 1LE9A 3VXQB 4M8UA 5DZLA 3ZW3A 5B38B 1DHKA 3RYMA 4N22A 2Z6FA 3WIHH 4JFHD 4MQXC 2XWDA 4LLDB 5EEZA 4ODHH 2RJMA 1RVFL 3F6JA 3R1GH 2ED8A 2RHEA 3DSNA 4QXWA 2FIKA 2WQAA 1PZ5B 1A2YA 1DQQB 2AJVL 3FQ4A 4OCWH 4HCIA 2WUCL 2XZQH 2OTWA 4OCYH 3ZHFA 2VW7A 3ZYJA 1ZSDA 3KPNA 1U8NA 3ZY7A 3VJ6B 1AR2A 1GZHC 3A6CH 5SWZA 8CGTA 1LK2A 4DQOH 1BD2B 1LEIA 5A2JH 1MWAB 1AACA 4KKBC 4PRIB 2OMWB 4IU2A 2F7OA 4L2LA 1TZ8A 3CVDA 2GVYA 3KXFA 2H2SC 1NFIB 3P3RA 3AVEA 4YSDA 3X3FL 1Q1JL 5JOPE 2OMTA 3EJSA 2YS4A 3M8OH 5DZVA 2N56A 4LXFA 1S7XB 1ZT4B 3D69B 2AGJH 3LOWA 3DJ9A 1AD9A 4OFYA 4G5ZL 5DYOA 1F1GA 3CDGB 3CNKA 1UFGA 4LSUH 4X9HA 2KZBA 1M1XA 5KBNC 2IGLA 3NA9H 2NNAA 3VO0A 1CE1L 3GSOA 1JTPA 2ZT9C 2TRHA 1YEJH 2BOBB 3ARUA 1UWFA 2V9QA 3GKZA 3UO8B 3FAXA 4PTUA 3BQVA 1E4KA 1JUFA 4KZCA 3CSGA 5KYYA 3FMGH 3VD0A 3V4VH 2UWEB 3BVTA 4QHNA 5D1QC 1YVLA 5E5MA 2FQGA 5HVGB 1NCCL 4F3FA 2A74A 3GS7A 3ISYA 3TJPA 1IM3A 1JOIA 1S9XB 5GS1B 1CG9B 1WD8A 1NOAA 4H1LH 3KEHA 2DEXX 4X98A 1C5DB 1RZKH 1A4KA 3KR3H 3TBWB 4GKLA 5FYJU 5C0JA 4UILL 2R1WB 2ARJQ 4PWGA 3FO0L 3UTSD 2VJ8A 2VTFA 2E7MA 4WEBH 2X7LB 5D5ME 5CZKA 1J8KA 1XZ0B 2Q8BH 1IAKA 3V10A 1YJDH 1P9MA 4Q9QH 1Y0LB 4N3UA 3VG9C 2ICEB 2FL5B 2OJEA 1YEKH 4JKPL 1IAOA 1BBJA 4D9LH 2GBUA 2NZ9D 1NAKH 4MAUL 4KQ3H 4QRSA 5DXWA 2X2HA 3MLVH 4XCYA 3QA3B 2DYPD 3EBHA 3L1OH 3QT2A 2E6QA 1J88A 2I9LB 4HUNB 4NQEE 1MHCA 3B2MA 3NIFF 3RIFF 3KDPB 1G9ML 4X7TA 3MI6A 4IHBA 4JJ5B 3ZKMD 2EDRA 2QSCH 1ILUA 2PR9A 4OTXH 1AS7A 5E56A 4ZD3L 4A66A 4JO2L 4DUXA 3D09A 4YHIB 4IIQB 4LKXB 4BGDA 1W72L 4Q4IA 1RU9L 1Q9KB 3LRSB 2NY4B 3NCYP 2PP8A 2QQLH 3HFML 1U8PA 1YN6B 1CT8A 5I0DA 2BSEA 5DR5L 3VYNA 4C83A 3MNVB 5GJSL 1D9KA 3FFCB 1UM4L 3IJ7A 1HWWA 3MCG1 3WIIH 5JHLH 2DTMH 3S4SG 3AY4A 1IB5A 2VDQB 2N7SA 3P4MB 1NINA 1SGKA 4OLYH 3T9WA 3ZIYA 2P52A 3AAZB 3UP1A 5EO0B 2WB1A 1VDGA 2R0ZH 4H8UA 2ZXGA 4JE4B 5FCUL 1AANA 4NQTA 4NPYA 1X5KA 5BCAA 3FQ1A 5BPPA 1FDLH 4LBEB 2WLZA 4K2UH 2RQEA 1G7PB 2AEQL 2ZYSA 1MWAL 4CMHC 3KBPA 1HHGB 2X5PA 4PS8A 4BUQA 1FNSL 4R96A 3HBZA 3UJIL 2J21A 2Y06L 1GIGH 1RJZB 1F2QA 4I1NB 5F44A 5MI0C 2OBGA 2NZ9C 3VTAA 3TBVA 3BDBA 1XGPB 1EXUA 4QNPE 2OMBA 2P5WE 3WY4A 1IVLA 5JXED 5IV2B 2QTVA 4QRUA 4LLUB 43C9B 1BVKA 1KJ2B 4YLBA 1FPTH 4YFEA 1F4AA 1TU2B 1IEBB 3HJEA 2OMUA 1LMIA 3DVIA 4N90D 4S1RL 4QCIB 4R26H 3U0TB 3ZKMC 3QGVA 3V4VA 3KPRB 5KG9A 4YOKA 5EDXA 5DZ9A 2BVEA 5FDYA 2JJVA 4J3XA 5KS9E 3VFWA 4A2LA 3BZEA 3KM2A 1E3ZA 1IQDB 4B9YA 1BJMA 1YEHL 3D3VA 4AENB 5ISZD 4WI3A 3MBEB 2D03H 1ZV5A 3VXRB 2DDQL 3NJXA 1PZ2A 1NGQL 1E3XA 2FJUB 2IH3A 5F97E 2RTTA 4XC1L 3C9NB 4YC2B 2OI9B 4MDJB 4B9GA 1E65A 5FECA 4HS6A 4CSSA 3TNMA 1VEMA 4JDEB 4Y2DD 2GI0A 1YMHA 1Q1JH 2WUBH 3ERXA 3HAEH 1CLZH 1YDPA 4N8PA 5L2JA 5AVRB 4ZAKD 3L5IA 3E80A 5CEZL 5LBVA 3LKNB 4K4KA 4Q6IA 4X7EC 4NQDD 3NABL 3JWOH 3LPPA 1DL7H 1PIFA 4B9PA 4NI6A 3FTGA 1KIQB 3MROA 2DI7A 3S3PA 3QDMA 2XXMB 5IJCC 1K8IB 3LV3A 4WUUE 3EOBA 5I6MA 4Y9GA 2VR8A 2VCOA 2VZTA 4F58L 1QR1B 5JXEC 2GJ6D 4NX0A 2DWXA 4QD2E 2WIIB 5T3XL 1NDMA 1JZEA 2R2HA 3I50H 2CDEA 4YIQA 4UILH 4D9QD 4FYTA 4OGYH 2NY1B 4WEUD 4OFVA 2XN0A 2IV9A 2YBGA 3FO0H 2IALA 5I1KH 5CSZB 3BSZH 5BRQA 5I9QB 4YS4A 1K2DB 2UWEF 1YYMH 2HXAA 1HAUA 1ADWA 2X2IA 4JM2D 4LSRH 3WUZA 3Q0HA 4JHAH 2DWYA 5JHLA 3L3KB 4FFTA 4DKFL 2VDQL 3QFDB 1C08A 5AVYB 4UM9A 4I87A 3T2LA 3LXUX 4MAUH 1FCGA 2WOBA 3V7MA 1L5GB 4HLZG 3NTCL 3G5YB 4IYKA 5E2WL 1DSFH 1ICTA 1AFVL 1TTAA 4PW3A 4HK0A 4AL8L 2DBLL 3LS4H 4Y2DC 1WZMA 1HZHL 4GW5B 3MRJB 3ARBA 2C7UB 1ZLEA 2F53D 2IDCA 1EHKB 2WO4A 5FYKD 5CGBA 1U42A 2IAMB 3RZCA 4ZAKC 2QPFA 2HPTA 1QLRB 3MA9L 1GJIA 4QHPA 1KUMA 4JO2H 3IBOA 5HYFA 4ECNA 3MR9B 5IEHB 3KHOA 5HHVL 4ZFOA 3DV4B 2LU3A 1TEGA 1H8OA 4RQQB 5CEYA 1RU9H 2BIQA 1IJ9A 4U1NA 1KGJA 2VLRB 1KJ2L 1KYUA 4X6DE 5KZCB 1SUHA 3FB7A 4BD4A 3N55A 3ULVD 4NQSB 1IILE 1OAUL 4OLZL 4ANUA 5HPOA 5AVVB 3GB7A 4YHLL 3EXJA 5EBLA 1UM4H 3MMEB 2Z0BA 4QO1B 2BS9A 4MKMA 4ISVB 3LVEA 4XVTL 1JMZA 2V7NA 3GMQB 3MRDB 1AZZC 3WEBA 1ZGLP 2E9IA 4HPHA 3KJ6H 1V3JA 3EHBD 4EI6B 4BK5C 2H8PA 2I07A 3BH9B 4DPCX 4YWGH 4M43L 4PJ5D 4JM2C 3I75A 3UJIH 1HHKB 2VMEA 3LKPB 1HAWA 1EZVX 4WKZA 4NQXB 2QGDA 4TVPH 4PR5A 4W93A 4FN0A 1AGCB 4FP8H 1ADQH 3LDBC 5E4OA 3TWYA 3WUWB 4KROD 5CD3B 3K2UL 1NCWH 4YSPA 4KH2A 2O26U 3BWAB 2X9YA 2ESVD 2B20A 5HYSG 2EYRA 4BFIB 1I8UA 4JAMB 5DHDA 1LO5B 4NN6B 1HDMA 1CLCA 2ZX5A 4CN1A 1UT1A 4PWKA 3ARPA 3PPEA 2PO6A 3RTQA 1HXKA 4PYHA 4W4OC 5CUSH 5D7LA 2Z31B 3ZIMA 3BVVA 5I8KH 4LO9A 4KTDH 1FYHB 2KI6A 3T5WA 4S1SL 2CHDA 5I6PA 3LZRA 5IMOA 3UTTD 4MNGE 5HHMD 4MNQA 2AEOA 2WQVA 3QJUB 5BMFL 2KHAA 3ULVC 4QLRA 4TUJB 3UO1H 2X4RB 2O5XH 43CAA 5AW5B 4TNVK 3BSZA 1NEZB 3CPLA 5C0BA 2C3HA 2HRLA 1WFJA 2Y25A 4F2FA 1AGFA 4JGUA 4JFQB 2BH0A 4FFYH 1S9WB 3BEVB 4LGSB 3GBNL 3EHBC 2E7LC 3RUGF 3N42F 2EILB 3LZNA 1YEGL 3ZVVA 1XF5A 3FO1A 4PFEA 3TLRA 1YEIL 3FQRA 3PREA 1X5LA 1JXJA 3LKOB 3OHXA 1OAQH 2O6PA 2CSPA 5MHSD 5BZWA 1C12B 3F6LA 4ZDHB 4IOSD 3BX7C 4AGNA 1DBML 4KROC 5I75C 3WTXA 3O6ML 4F58H 5CLYA 3BH4A 3RU8H 5JIMA 4JMXA 3ECQA 4MB4A 5C2BH 5ACZB 4FYRA 4ODUB 5CHNB 3GSXB 5T3XH 4KZ0A 5MERA 4FNSA 5DUPL 3G6AA 3MOAL 3QWOA 2PYEA 5IBUG 4GG8A 1UOKA 1TKWB 2BOCB 1CFNB 3MRIA 1QTPA 5KAQF 3SBPA 5F96L 4EI5A 5L4IA 1TTBA 2A2QT 1JWMB 4HCGA 4HSCX 4PJGE 5ETUA 5B38A 5K39A 2HCZX 4MFHA 1HTYA 3SDDA 1ZXQA 4HV8B 4Y4HD 4YDLC 5F9OL 4YQXL 3EH4B 4MD0B 3J27A 3PWUA 4I18C 2XWTB 4JK0D 2VDQH 3EYVA 4LCYB 3V6ZB 1AO7A 1KBKA 1XO8A 4MJJA 5DZJA 2H7WA 1OAYH 1VCAA 2EYTA 1OQXA 4Z1PA 3PWJA 3QDJD 4N2IA 3OC8A 2A4EA 2Q86A 4FXKA 3ZL4L 3QFJA 1AFVH 4WFHE 4Z7WE 1FP5A 2DBLH 4JG9A 2WY3B 4AL8H 1B4JL 4K0OA 3LQAC 5IVXB 1OARL 2ZUWA 4KVNL 4NC2B 1HZHH 5KEZA 3RWJB 1EHLL 1GCFA 1N70A 3ARVA 2V9TA 2IPKB 1AR1B 2A5UA 5EO1A 4LHUB 1ADQA 4D3CL 4OVVA 4F7PB 2VRAA 2VR4A 4PGEB 2VAAB 4JVUA 4EUPB 4NIYE 3VXOB 4M02A 3AJ7A 1JGLL 4R97B 5HHVH 3DTDA 2F08A 2C26A 2GW5A 5DS8B 3I74A 3QZOA 1I8MB 4JFTA 3WTTA 1MFMA 1KJ2H 2A1WH 3IFOA 4U1MB 1KZYA 2BIHA 3BYTA 3V0HA 1RP9A 2L7QA 3ZO9A 3FN0L 1NBVH 1UASA 4OZGE 1G87A 3AB0C 4IRSB 1FNHA 4K9JA 4U6HA 1O5DT 3FONB 3VXTB 2PWDA 4UM8B 2OLDA 1WA2X 3RJOA 4XVTH 4GBXA 1A1MB 5BJTB 2RB8A 4KO6A 1IFRA 4W68A 2EACA 2JE8A 4XCEA 3DVNB 4XOAA 3CMGA 3ROLA 3EG9A 3SQOL 3D0VB 4C4KT 3VW3L 5C92A 4HKZA 3BH8A 2VERA 1X9RA 3VCLA 5J8OA 2V7HB 4ZMWA 4PGBA 4M43H 1QVOA 1ZHNB 2UZYB 4Y4HC 2CDGA 1IBZA 4HJ1A 1YNLH 2CLZA 1FL5B 3QZNA 1TFPA 4ZPTA 5GS0D 2NY3B 3IRZA 3MSPA 2O4EA 5DRWB 4KZDL 1X5ZA 1EHNA 3MJWA 1NCGA 4FFYA 5E03A 3HC0A 4BUGA 3LTVA 3ARZA 3OHMB 3T2NL 4A2EA 2COQA 1A9EB 3S2AA 1X9LA 3HKFA 1DEDA 1KTRL 2DB8A 4MTMA 5EUKA 4P46D 2GJJA 2I9LA 2Y6TE 1JWSB 4ZW6A 4GAYA 1UXMA 3Q8FA 2ZXDA 4L23A 2EIZA 3MCKA 2A9NH 2IMMA 2VDPH 4HXBH 3UBXG 4ZMOA 2P9RA 1EEYA 1GPOL 5C09E 3L1EA 4R8WL 4PGCA 3B2VL 4LCWE 1I4FB 1EJFA 4IIQA 5E1GA 3VU2A 4LKXA 1HHIB 5IQ7L 3MJ6A 3IT8D 3O8XA 1OSEA 3HBQA 4HEPG 3RPKA 2ZSVB 1XTLA 3RPBA 4LRIC 2FYVA 3FRUB 3FO9B 1FYTA 2AW2A 3DPBA 5HHPA 1CGXA 4PMEA 2B5IC 3HPJB 3QXTA 3FQNA 1LXMA 2EDNA 2IH1B 1S9KC 3GJFH 3SKUD 4IKKA 3PHQA 4YK4B 4OJAA 3GBNH 5G2NA 4RGMB 4JO1L 4FQXD 1YEGH 5CBAA 4Z7QF 4JY5L 3RY4A 2G3ZA 2OPCA 2X0VA 1YEIH 3CZKA 5BUPA 4CL7A 1I7RB 2NLJB 2EECA 4HOZA 2BSSB 3DVFA 4O02B 5A2CA 4CJ1A 5GS0C 2I5YL 2OL3H 3M7FB 5D2LF 1DBMH 5DHXB 4HIIB 5D71H 1B6UA 4NKDB 3B1TA 1V3KA 4QLWA 4JHWH 2NNXA 3Q1SL 1E4HA 4X8JA 3SYPA 1X3DA 4FFWD 3IDYB 4V1DA 5JOPD 1L4IA 3EJRA 1FI8C 4ONFL 5FK9B 5DUPH 1MHPH 3MOAH 3F7PC 5F3FA 4LLUA 2V3DA 4OZIF 1WK0A 43C9A 3QQDB 4P46C 1A25A 1QFUL 3BRGC 4TNWK 2QSQA 1J5OH 3PQYE 4LDLB 1F3DJ 2NW3B 1Q1PA 5BRZB 1N5AB 2WGXA 35C8L 4FJ6A 2OW7A 4OAWB 2R2EB 2NY2B 4YQXH 1OP9A 5F7EL 5H37H 3KPRA 3DX2A 5KYXB 4NKIL 4TMPA 4UV4H 3HG3A 3ZDYB 3U1QA 1DDTA 4EXPX 4FLSA 3MRQA 1PFCA 5ICYA 3CXDH 4MD5A 4ATTA 4BELD 1I1CA 3RUGA 2X89A 3MBEA 5D4JA 5EA0L 4JHVA 3ZL4H 2J12B 4ZZFA 4N0UA 5IHUL 1AIFB 2CMRL 4D8PA 1B4JH 5A2LH 3N40P 5C0ND 4AGMA 4KVNH 4HKBB 1GGTA 4HJUA 4F57L 1ZGLB 1OPOA 4MLIA 1CQYA 5FWQA 3Q1EA 3TBYB 3M1BA 4PJ7B 1RSFA 3AMLA 1EO5A 2MWCA 3IDMA 4M48L 4EJ1C 4U1KB 2IFFL 4LVEA 2ISDA 4D3CH 4FQXC 1ETB1 4WLCA 3LQZB 5E1QA 1O9WA 4AH2A 2QKIC 1JGLH 1A7BA 1E5CA 2YR3A 3UC2A 4U05A 5ESVA 4I0PD 1OGAE 3VQ2C 4DUVA 4X8CA 4Q6YA 3EUDA 1MIML 1VFOA 4HJEA 5LAPA 3JT2A 5C08D 1CTNA 3VRJA 4IS6A 4ERSL 3FN0H 2VKXA 4O4YH 5DHYB 2ALAA 4EDWL 5AW6B 4M7ZB 4C59B 1I1AA 1B0RB 4TN9A 5I0ZA 1AQ8A 3PFUA 4FFWC 1JD7A 2FUTA 1SYVB 3B5HA 3PABB 5FHAL 3K46A 1JZDC 1N7MH 1WC7B 1ZEAL 2CM6A 3OB0K 5KVMC 2YBRA 3WS6A 5JNYB 5HGBB 1WTGT 4K9EL 2GHZA 3AXLA 5C6TL 3DTXA 2CH8A 3F01A 5IBTL 1LO4H 4U1IB 5B7FA 3KBEA 5C6WH 3VW3H 4JGNA 1U8JB 2Q7NA 4I3SL 3ZT6A 3Q06A 4MX7A 4F9PA 5DI8A 5JW4R 2J72A 1JXFA 1W0VB 1V7MH 1ONQA 1PCXA 4FXGA 2EDXA 4M8VA 4ABWA 2YO3A 1FFQA 4G71B 1NCBL 3GJFA 3O6FA 4KV5F 4HWNA 4QHKI 2F5BL 4N2KA 4XMKL 3GLZA 4U6YA 5I5IA 5LJYH 3IJSB 1OSPH 3JZ7A 1P4LA 3L3KA 1E50A 3BMVA 3QFDA 3RY6C 5DQJA 5D2NB 3T2NH 2YQ2A 1B4LA 2WM0A 1RZ8A 4DOHE 5C0NC 3EBIA 1MPAL 3CZFB 4J3WA 3ELQA 4YAQB 1IARB 2NSQA 4XP6L 4O02L 2OL3A 2AJSH 1C16B 4CRPA 3LMJL 1MRFH 1I1YA 1IGCL 2ICWJ 1KMGA 4EXKA 1KEMH 3QO1A 1S5HA 1HNGA 1JXDA 4G11A 1XF2B 3BOVA 1OSZA 1G1CA 4I0PC 4WW1B 1COBA 5DK2B 2FQDA 5EBWA 1XR8A 2EH7L 3FC8A 3MR9A 1FZOA 4M5ZL 4OZ4B 2I24N 5ILTL 3MTXA 2NX5E 1NKRA 1QZNA 2WKOF 1U92A 3WFDL 1J05A 4G1EB 3C8HA 2XRAL 3CLFL 4X6EA 5F1OB 2ZAGA 3QJZA 3BUQA 4ZFQA 4KU1A 2DJSA 4Y2OB 4Z7OE 3SPIA 3MFFA 3QFGA 5H37A 5C8JB 5LDSA 4LDOB 1UOWA 2X0WA 1G43A 3S4SB 2X3BA 3N0PB 2W0LA 4JO1H 4APXB 4EN2A 2ZUSA 3QBTB 3IWVA 2KPNA 4JY5H 1TEYA 1XGYH 3ARFD 4P2QA 1L9MA 4XPFH 3CFDA 3D8MA 4WO0A 1AKPA 2PR4L 4WFGD 3PUUA 1F41A 3MJ7B 3BAWA 3PDOB 1XSOA 1IM9D 3U6XS 3QJSB 1EANA 1T21B 3X3GH 1L9OA 3A23A 4H20H 4Y5VA 2HFEB 1NOFA 1T89C 4Y4FA 3TO4A 1KZQA 3W5MA 3S37L 3Q1SH 2VR5A 4NGHL 2GTZA 2OK0L 1U8QB 1JGEB 1EXGA 3PHOA 4EUPH 2XKNB 2XG5A 3ML9A 4KK6D 4NS0A 4PJDB 5B3NA 1WDAA 2FJFB 3G5XA 4MWFB 1HN1A 1MCPH 1O9VA 4MZIA 4HGWA 4LOEA 2XNAB 1WISA 5KYNA 2EDEA 1UT9A 3C5JB 4PRPA 1LO5A 4DPBX 1JPTL 2YUZA 3NCJH 4P9HC 4E41D 5E08L 4NN7B 1DVFD 3APDA 4R0LB 2VR6A 3E6FB 2UY6B 1QKZL 2V5MA 3MRPA 5DJDB 1JDAA 4X7SL 2EDJA 2X4PA 4GW1A 4CBZA 1U3NA 4X6DB 1BYNA 3H9HA 1S9YA 2P28B 5C3IA 3SCMD 4MZ2A 4I77L 4U0RB 3NPSC 3CHRA 5AL8A 1Z2KA 3FQXB 3CZSA 1NFDF 1I7TA 4Q2ZA 4YZFE 1YUKB 4NHCL 3BAEL 1FL6B 2CMRH 2ITEA 2VQ1A 5C0RL 3MAWA 1BQKA 3HZYA 5FKAA 2HT2D 2YD2A 5HHXL 2G5BA 3NIDE 3F7RA 1VGEL 3LH9A 4KHXL 1ZY9A 3MBXL 2WZAA 4PS4L 2OFQA 3HS0C 2UXTA 2RA1A 5D2LA 4JR9L 1UXLA 5HDQH 3ZDYF 2JCCB 4A55A 5ITFA 3VMOA 2DQUL 5ENWA 1BZ8A 2D7QA 3ARFC 3BEVA 3OSKA 5FFLA 1P7HL 3FHEA 3UYRH 2JIXB 2E74C 3MV8E 3U7YH 1E4JA 3APMA 4Y16B 3CFEB 3EOAA 4NFBA 5J1AA 1FNEA 4B6ZA 4OZIA 5H94B 4HISA 1QEXA 1EO8L 1MVFA 1HVXA 2B4CC 4HFUH 5EU6E 4EDWH 5KVFH 1V27A 3GI8L 5BV7H 5FO8A 2JQMA 4Z7NF 2AMUA 2QSTA 1ZT7A 4AEEA 4C56A 5IQMA 1HNYA 1MKFA 5FHAH 1T6BX 4MMZA 4KK6C 3IMWA 2VISB 3LD8B 3BKCL 4HS3A 4YFLI 3DLQR 4K9EH 3KNBB 3Q9PA 4XX5A 5IFHH 3K6DA 4KNUA 1KDJA 4L1LA 4AIZB 3MLYL 4HHAA 1QNZH 4RX4D 3MACL 4FNTA 4I13B 1DVFC 2XLLA 3FU7B 3ZZQA 1TVBB 3O4LE 1ZLWK 2WWKT 1UADC 2R0KL 3BVUA 5KSAA 5E7BA 1NCBH 5L2KE 3NSJA 1XIWA 4LSVH 2F5BH 4X4XB 3J8F7 3JV6B 5TDPB 3SCMC 5CCJA 1DFBL 2YA0A 4X6CE 1KCWA 5GGTL 4DHLA 3S9DB 2NDFA 3G6DL 3FTWA 3Q5TA 5I1CH 4NZ8A 3HC4L 3LB6D 1G1YA 4QRPE 3UFIA 3ABGA 1INEL 2GAZB 1EVUA 1WUZA 1KCKA 2HT2C 1UKQA 3PCYA 1FJ1B 1MPAH 4B0MM 4Q9CA 5K69A 2AXHA 4Z3HA 5DRZA 4DTGH 4MA1C 4XP6H 4GIOA 5D93B 1EJ8A 3QR0A 3EW3B 4E68A 3I3EA 3CLEL 3LMJH 1INQA 2UY7A 3W9DB 3PV6A 3JWNE 4NI3A 1RK0B 5DEZA 3NEXA 2CUIA 3SBWC 4JFZH 4PGEA 3I6SA 1D7DA 2WV3A 3DX8B 1VPOH 4WTWA 5HJDA 3UO1L 5GGSA 2QV2A 4JS7A 5F3BA 5ILTH 2AQ3A 3QQ3A 3QUMB 3QJXA 3QR1A 2BHFA 3F5WB 2WJ7A 3A4EA 3DOHA 3M88A 1DFXA 3FBQA 4PJAA 1JNHA 3WKYA 2R2CA 2HLAB 2UVEA 4HS8L 3QJFA 4DP9X 2I85A 1CIUA 2VQ4A 4PREA 4XVSL 5F6IC 5B39A 5CIPA 3QIWA 1N3NA 4UF7C 4GIAA 4NWTH 4QT5B 4PJGB 3AROA 2Y22A 3O45A 5CGMA 3LVTA 2VSDA 2Y4SA 4LEOA 1BMGA 1I8IA 1T6VN 2WZ0A 5D7HA 3KPMA 1PCSA 3HJ0A 2VLJA 3NJNA 4POUB 3WEAA 4GKSA 3OD3A 3GSUA 1JGIA 3DKHA 2GSMB 1T83C 4GG6E 4TSAH 2YARA 3KPPB 3K71A 1L0QA 4G8GD 2AANA 3SO3C 1KWGA 4WWOA 5C3TA 1DBBL 4AVJA 4ZFFB 5AB2A 5EEWA 2OK0H 2IBZX 3LB6C 3OJVC 2DBJA 2BIMA 4G8FB 4YXLL 1V55B 3B7RL 4QXTA 4RMWA 2DMBA 1UURA 3UZVB 1TEFA 2APVA 2P47B 5IOPB 3MKGA 5E08H 3O3AB 1E4XL 4PRNA 1MHEB 4LPUA 3L3HA 3L4ZA 1JDDA 1NAMB 2Y36H 5E1HB 3V0VA 3DX6B 5PCYA 4DNLA 2XT1B 4ES8A 1O7SA 3B9KA 3LPFA 4ZQKB 4FQLL 4PHZA 3DXAB 2K3TA 4X4ME 2OCJA 4PJDF 2FAUA 2E7HA 4JKNA 2AK4D 4MBRA 4OZGB 1WT5C 5F9WC 2CIKB 3MUGB 5JIPA 1CXLA 1I9JL 1T22A 3QC5X 2AQRA 3N1PC 2EC9T 1YO4A 2BS8A 3GTTA 5IB1A 3ZDZB 1D6VL 4FG0A 1WZKA 4HKJB 4NHCH 1I3VA 1U3YA 2QDWA 5DRNA 5KVDE 2BNRB 3NEEA 1CDGA 1UEMA 5C0RH 4P2RB 4X5LA 1ZLDA 3L08A 5F9AC 1J1XL 1PLAA 3FRUA 3SDXB 3WMQA 3DGGA 3FO9A 3BGAA 5HDBE 1G4RA 4PRHE 1G9EA 3T2QA 1NMBL 4OUUB 2PYFA 4LCCC 4JR9H 5E1AA 3ZE0F 5AB0A 1C9SA 5JO5B 2ZWNA 1K8DB 2PPAA 2DQUH 4ELKA 2Y2TA 1WSST 1CGTA 3BWSA 3AADB 2YEZA 3GKWL 3K2IA 3QQ4B 4MNHB 1VFBB 4L4TD 1KELL 4JQXC 4MJIE 1CFMA 4HW6A 3VA2C 4MRBA 3ZUCA 1GTNA 4Q8BA 3BWUF 1X5GA 2NLJA 4R2GD 3U2SA 1UOLA 1AZCA 2VWEE 3NACL 2BP0B 5CJXC 3IGAA 3ZZLA 3CH1B 5C70A 2RGSA 1A6TB 3V55A 6FABL 1MCWM 2JCCF 4TV3A 1MAML 1DO5A 1E27A 3KE0A 4FYSA 2DWDA 3BKCH 4TS6A 3HHRB 3L3OC 2J43A 3OKOA 4I2XB 4WTZG 1URLA 3HUJE 3BUPA 3QJHA 2EIKB 5DHEA 3MLYH 3MACH 3QUML 1QHQA 1SHSA 4G3YL 5HYEA 4HPYH 4GI6A 3CU1A 4IRJA 1NFDA 5AZUA 4K3GA 5CZRA 1AGEB 1FVDA 3DDGA 3VXSD 2GY7B 4LCWB 3VFRB 1H5BC 2B0SL 2Y3AA 2XWBB 3ME0B 2DF3A 1L7IL 5D7JA 5IEKA 1KYAA 2R2EA 2J1WA 3GMLA 1MCRA 5IREA 3VTTA 5HJBA 1DFBH 2GUYA 2QDVA 4Y5XA 4KXAA 2FNBA 3G6DH 4POZD 1PZBA 4KOCA 4RISL 3HC4H 3O9WD 5I8EA 4F7CB 1PVHA 5D1QB 3ZHNA 1INEH 4F7TA 4Z77A 2A0LD 1N5YL 1JPEA 3TVMD 5E5UB 2K70A 1QLEB 4XZ4A 3Q48A 2MH4A 3CLEH 3VI4B 1UQSB 4UZUA 3QSKB 3U7WL 4GINA 1IKNC 4BXVA 4PHXA 3RGVD 4GXFA 4QTFA 2VXVH 1JZ8A 3GMOB 4N8VB 5JW4M 4WK4B 1PD0A 4KX8A 2MTPA 3WNOA 6PCYA 2YAPA 1VJSA 3QZBA 4Z0XA 1JV2A 1P4BH 2M8XA 2XDHA 3L3JB 4IBQA 3V79C 4JPSA 2VJ0A 2W0KA 1JZFA 2LFGA 2FZ3B 4R2GC 3RNKA 4S0SD 7TAAA 3GZOA 1DVZA 4XPTL 3SY0A 3DUSA 1OOWA 4Q58C 3VI3E 1CJYA 1RUPL 5GZOA 1NAML 2JKNA 1CGSL 2XVBA 1YYCA 2ZE0A 3PABA 5EBGA 2ZOLB 1KCVH 1E5UI 1KV7A 3RVXD 5BUAA 1JJUA 3UZQB 1MCKA 5DHVB 1OLLA 2VZOA 4OJCA 2F1EA 2CQVA 4XBPB 5E8EA 3MODL 2X3CA 4NJAL 4GYBA 1DP0A 5DVNA 1NBYA 2BMKA 3GMPB 4H0GA 4HH8A 4P4RB 5DMGD 2HMID 4JFFE 1ACZA 3RI5K 2MCPL 3NZ8A 5BZDB 4UMSA 2OTUB 1QSZA 2ZP9A 2G2RB 3I9PA 1UWXK 4POZC 1G94A 2WINB 3BPNC 3OAYH 1XD1A 3UG3A 3O9WC 4KI1A 1MRCH 2ZONA 2BNUA 2IWEA 1E90A 4YHPB 2A0LC 4X99B 4H0IA 1JNLL 1RK1A 3ABKB 3TVMC 5FOJA 1R0AL 1FVEB 3GMNB 4XXWC 5JHAA 1ULVA 5B3JF 3CSFA 4CNIB 3SKJL 1MY7A 4YZWA 1M57B 1P7QA 2YD3A 5GGQL 1E4XH 2YC1B 5LCVL 1C1EL 5HVFB 2Q5BA 3RGVC 4X5XB 1OTTD 1D5XB 1OGAB 3ZHLA 1I9EA 3GQFA 3UTSB 3N40F 4FQLH 4P0DA 4ZUWB 2BIPA 2WBJA 4WO4B 2F58H 3RY5A 2VW4A 3L95A 1M2VB 1CXHA 1FA4A 3B6SB 6PAZA 1AZBA 5A7BA 1FNGA 5CU9A 3PWPD 2B1OA 3PP3H 1D6VH 1U95B 2VDRH 5D70H 3VFPB 4JFDD 3ARGD 2SEBA 2AJ3A 5C07A 3U6RA 3IRCA 2YQBA 1J1XH 4NXKA 2Y1ZA 4GPVA 4APQB 4S1QL 1JGVL 1NMBH 1K5WA 4OSUL 5D7IE 1IUZA 1QBLL 1GHFL 1EAOA 1IBYA 2VERN 1F11A 4G80A 4NUJB 2QPDB 3KWXA 3ZGHA 1P4IL 1ZLVK 3ARTA 1I3GH 3ZDZF 5DMGC 5B21A 2ZICA 3G5VA 5ECGA 5I8OL 2HMIC 1ZCRA 4HLZH 4JM0A 1NKGA 3MJ7A 4KI5D 4OBSA 3SKNA 1U93A 4NRZA 3SDXF 1IE4A 3C6SB 1QLEL 4PY7B 2VN5A 3I6GA 2Z4TA 1FFPA 3MV7B 4AVHA 6FABH 5IY5B 5JYMA 1G1OA 1MAMH 1BDYA 3RP1A 4MAYA 2ZD0A 2NCEA 1ZA6A 3BE1L 3G9VA 3L4VA 1HCFX 2IXQA 4U1SA 3T0VA 1QRNE 4KNTA 3KVDD 2R0LL 3ILPB 1C5CL 2I9TA 4G3YH 5D6CB 2VLKB 1RXLA 2W94A 1BLNB 3ESVF 4IBUA 1BM3H 2F74B 4AJWA 1OTTC 4EN3D 2G3NA 2WQSA 2B0SH 3CX5K 3ESUF 1EBPA 2VUKA 3VFSA 1O6VA 4EVNB 1VFAA 2PCFB 4LKCB 3IXTB 1T1XB 2ZG2A 3C2AL 5FF6A 2Y5QA 1QFPA 2CJ3A 2BHUA 3DV6A 4UUJA 5E2TH 1FVCB 2Z91A 1HYRC 4BHUI 4EZMA 4ZODA 3HN8A 4GUOA 3QK0A 2WTPA 3ARGC 1SFDA 5KSBE 5I23A 2XA3A 5I5JA 1S6NA 3JTTB 1FWXA 1S7RB 4GAJL 1N5YH 2EADA 3CK0H 3TWCL 2IQ9L 3FQUA 4FA8A 4QF1B 1B88A 2DN7A 4JANA 1BIHA 2ZJSL 7FABL 5HYQB 3BD3A 3F12B 4WI0B 3U7WH 1B9KA 4NQCE 1HIMH 1L7TL 2OQJA 1ETZB 1W80A 2JCCA 1EH9A 1MUJA 2G75B 2ZXWB 3LRGA 3GJEB 5D4HA 5KVGE 3BPCB 3BSGA 4ALAL 1FNAA 1UKTA 4KI5C 5SWSE 1RZIA 4IJTA 3IPFA 4MJ6B 5JOFB 1TLKA 4TQ8A 4ZMVA 1LK3L 3SO5A 1KIRB 3PAZA 3VI4F 1ZWIA 4JN1H 3UPRB 4Z5RB 1RJYB 1NAMH 3FB6B 4JUSA 4PRAB 1PG7L 5G4NA 5HGHA 2B3RA 1UWYA 1U8KA 3PGCA 3F64A 4OKVB 3PWLA 1IZKA 1NL0H 5D7KD 2CCVA 1YEWA 3EFFB 2OZNA 4AW7A 2XYCA 3RPIB 1CFSA 1TSHA 5EZOL 5MENA 5FOBA 3BP4A 3H9SE 1ZVYA 4L8SC 4NJAH 1GZQA 3VFVA 3VFNA 4EN3C 1SXCA 3VB9A 3U83A 2Y7OA 3KYOA 4NQDB 1ASQA 5F9DC 5B1AB 5T5NG 5EUOE 1CK0L 2NX5D 4OQTH 5AZEH 4ZX4A 1BF2A 4AKPA 2DYSB 4KKLD 5HPMB 5I1HH 1QEWA 3L5XH 5C2UB 2O61B 2NT1A 5CP3A 4DN4L 3RWDA 1YMMA 4LP5A 5EN2A 2CO3A 5DD6B 1XH3A 1SOSA 4YSQA 4XXDA 4CW1A 4U6XB 5I1EH 1JNLH 3SGJA 4A7GF 3IDGA 2GJ6B 2YFOA 1R0AH 4WK2B 5E9DA 2GAZA 2WK2A 1B6DA 2NY7L 3L6FB 5AAWA 1VKXB 4P5TD 3SJVD 3B34A 4AVIA 1KDIA 3K2MC 1GGBL 5C0AE 1BWMA 4JRYA 3MV9D 1FHGA 4LRNL 5JW3H 1HWGB 3FU0A 5C0CD 1DQKA 3DI2B 2L4OA 3MRHA 2Q6WB 1XVSA 2DQEL 3OV6A 4AYDC 2JKIS 5DO2D 5LN4A 3OZKA 1RK0A 4GW4A 5CKGA 3BIKB 3WDJA 4S2SB 3VXNA 4HF5L 1DBKH 5TDOA 1PZSA 4MA8L 2DLEA 3IU4L 3P4LA 2V0AA 5INCB 4C58B 5I66A 2EUZA 3QO0A 3N6YA 4G5AA 4FEIA 2WKLA 2R56H 4TQHA 1ZTXH 3QUKB 2EE9A 4K71C 1AE6H 4PJCB 4K94C 5CCGE 1GOFA 5T1LD 5JQ6L 5DURD 1S3KL 1JK8B 1OW0A 2E27L 1TJHH 2SODB 5IMKA 4OSUH 4J28A 3UPAA 4D0CB 4AK1A 5CR1A 2HB0A 1QBLH 1T7YA 2OXGB 4NO5A 4R4BB 2FJHB 2DQDH 2IQAA 1I7UA 1X4ZA 3QIUD 1Q9OA 1P4IH 2YEVB 2L8AA 3BSHA 1BLIA 1HXYA 3WLBA 1CI5A 1IBDA 3GC3A 3QB7C 4GXVL 2EDHA 2KZKA 4TNFA 3SD5A 4AIXA 1T2JA 1XF4B 1XCXA 2YUVA 4KKLC 3W3BA 2YD4A 3BD4A 5TE7L 2KS0A 3S3SA 1MFUA 4Z95L 1J5IA 1L9PA 5DSCB 3KPPA 2GPZA 1JV5B 5JMRA 4KKAD 5DUML 3H54A 2ZUQB 1A6UL 3WEMA 3MCYA 3TH3T 1T1ZA 4WENB 4F8PA 3S5LG 4DP4X 3T0ED 4XH2A 1XCQB 2AABH 2H3XC 2R0LH 1C5CH 4P5TC 5KVEH 2FGZA 2WVVB 4RRPG 5HYSA 3LXAA 4FTVD 3BAKA 1HSBA 1A9BB 2H1PH 3EHBB 3S98A 3N43F 1AHWC 3OC5A 1LNUB 4P8QA 1IGMH 5ADOH 1BF5A 5DO2C 1BJ1J 3GWJA 1ASPA 3U7AA 1AHMA 4N0FA 3CSYA 3C2AH 4M5TA 2YXMA 5EU6D 4D2NA 3EJCA 4AM0B 3QUXB 1NH6A 3EYUL 4H26A 2DMGA 2CLVB 5EIVA 3G5ZA 1I7ZB 3V6FA 1NCNA 4KJYB 4P57B 4GAJH 4AEIL 1LQBC 3TZVB 2ESVB 3TWCH 2IQ9H 4FCHA 3HKZA 4I85A 4EOWL 2FQEA 3WFZA 2WLHA 4OQTA 2VR9A 1KLGA 3KXFD 3QZPA 2BVPA 3PP4L 5JTWA 3WNPA 4X6FB 3T3ME 2FIRT 2A73A 1YNTF 3OXRB 1FN4A 3VWJD 3QIUC 3H3BC 4FABL 3KYMB 2ATKA 3Q43A 4K07A 4OR1A 4JCLA 5L2KD 4ALAH 1TFHA 3BYYA 4ZMYA 1MAJA 3BO8A 5DMIH 3VYOA 1NIFA 5IJVB 1XB3A 3EUUA 3UTTB 5HHMB 1P6FA 3B56A 2A77L 3NZUA 4BV1A 2CBTA 3IMTA 3OKKB 4QRPD 3ATAA 2L7UA 2A3TA 2PWFA 4P07A 5LLIC 1HHHB 4O2FB 1DE4A 1VADB 4KKAC 2VL5B 2C3GA 1PG7H 1GZHA 1EUUA 5EZLB 4ODVL 4HHGA 3T0EC 2DLGA 2EINB 3GDBA 1E4WH 5H35B 3BDYL 4N2EA 4DP8X 4WSJA 5DCCA 3G9AB 5CZVL 1SJEB 1BP3B 4GQPH 5GSRA 2LVEA 1KPUB 4P23A 1FL3A 3CZEA 1G0XA 3IJYB 1CK0H 4MB3A 4OCSL 5I19H 1T3FA 4Z3TA 3RDTD 1ND0A 4UQAA 4RGNE 1WQVT 4XMZA 2J88L 4FFVD 5DJYB 3ZL1A 4HJ0D 4DN4H 3H7BA 1YQ2A 2HAZA 2FB4H 1WIUA 3B2UD 4OD2B 2F5AL 2GIXA 2V2TA 1UA3A 1AC6A 2ZF9A 5FYKL 3VD5A 3BKJH 3LX9A 1BZ7A 1GZPB 5FUZL 3GSNH 4NOBA 1PNDA 2VITB 3Q13A 1UKSA 5D1QA 5DJAA 5FKPB 4ELMF 3TA3B 4RMQA 3KYKL 1DJIA 4F33A 4G6ML 4DF9A 4JY6B 1SDDA 1NCIA 1UM5H 4U1JB 5DYFA 3IGFA 1MCIA 5E8NA 3N1QC 3VXME 3VWJC 3PNWB 4Z7VB 4U31A 3H53A 2C1OB 1NDGA 4KRPD 4ONOA 4JLRA 1P2CB 3S35L 3EKCA 4Y4HB 4B5ZA 5D1XE 4G9DB 1F00I 4AK2A 2GCYA 1CVSC 5I1AA 1E28B 2EEAA 3EO0A 3KGTA 5F0PB 4WV1C 5CWSB 4QRRE 4AEHL 3MA7A 3ARED 5IQNA 3ILDA 2XICA 1PG7X 2UXFA 2E27H 3IAGC 3OKMB 4IW4C 5AW3B 1D9KD 5AUMB 1SMOA 1MFBL 2YPVA 3JWNC 1UB5B 4JM2F 1KIPB 3VFTA 2J2ZA 2Y1YA 2ZOLA 1BQRA 4GMSH 4UINH 3IGUA 3HPLB 1JGUL 5IUSA 3T0DA 5D72H 3TO2A 1BQUA 1UZ6F 3G6JE 1OAKL 1EAPB 4L4VE 4PIRF 4A7GA 2YUXA 4ZX3A 1GAFL 1CDBA 2UZXB 3RDTC 1NGPL 4ZFZB 1ZHKA 2V2XA 4NKMA 5DD0H