1BMWA

A fibronectin type iii fold in plant allergens: the solution structure of phl pii from timothy grass pollen, nmr, 38 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords POLLEN ALLERGEN PHL P2
publication title An Immunoglobulin-Like Fold in a Major Plant Allergen: The Solution Structure of Phl P 2 from Timothy Grass Pollen.
pubmed doi rcsb
source organism Phleum pratense
total genus 5
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1998-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1bmwA00
1WHPA 1BMWA 4L48A 4JJOA 4FERA 4FG4A 3D30A 1N10A 1WHOA 4JCWA 3FT1A 4FFTA 4JS7A 2HCZX 4FG2A 3FT9A 2BH0A 2JNZA 2VXQA
chains in the Genus database with same CATH superfamily
2RD0A 3QARA 2KYIA 5K9KA 5BW7C 4NN5C 5CN1A 3L1OH 3EFFA 2VKXA 5DZNA 4X0KA 3VWKD 1AGBA 3CVHA 4AUJA 2FBJH 1KJ2L 2N1KA 2FO8A 2YFNA 4KMLB 3PQYE 4WWOA 4DK5A 1CTOA 4FQXA 5FGRA 3P3YA 1D6VH 3Q5OA 4PIRF 5KVDH 3M1BA 2XY2A 4HH8A 3CK0L 3LKPB 5F7DA 1MIML 2UWEE 3PDGA 4N2IA 3Q2CA 3UP1A 1ZHNB 3V10A 4ZS7L 5D5ME 2I7OA 2G30A 5AZEL 4Y1AD 4IKIA 4Y5YB 4OZFH 4P2OC 4YDJB 3ULVH 1WJ3A 4MCZB 1IIIA 4KAQL 4BH8B 1VRSA 3SB3A 4B9KC 2D7MA 5L9DL 3O9WA 1TVBA 3U9PL 1HVXA 3KPLA 2H2PC 2VN6A 3C08H 1MCOH 3MV7A 4WY7H 3BP4A 2ZCLL 2FWLB 3NGBB 4DERA 4O5LL 1XB8A 2X89A 1UURA 3CG8A 1TJHH 3ZDZE 4YHYC 5FYKE 2NY0C 5HDQH 4G8AC 3C6SA 4IKKA 5EC2A 1X4ZA 4JFQB 4W9GC 2L04A 1RI8A 3HBGA 4NQDA 1R3HB 5I8EA 4Z78B 4YDVA 5FS5A 1S3RA 4GINA 3DUSB 5A16A 1F8TL 1WHOA 3KLAA 2XVBA 1D9KC 5KBMA 5DK3A 4KVCL 1RP9A 1Q4NX 1EIBA 4A7SA 2BVOB 4EBQH 1BM3H 1K4DB 1DJHA 1A7OH 1UZ6E 3B83A 5DEJA 3ESPA 2IG2H 5KTEL 1J05B 1T03L 3R7QA 2R0LH 2YXWA 4FNLH 1T1YA 2KPNA 1KLFA 2AXFB 3ZMRA 4YX2L 3FQWB 1BX2A 3C75A 4OD1L 3ZX1A 4YNYA 1WS8A 2A6JB 1TFHA 5KVGE 3T4AC 2DQFB 4GXVL 4KO9A 2DMGA 1B6DA 1QPKA 2LTQC 3J8F7 4TRPL 4AWJC 1CD1A 5AYQA 4KTDL 1DE4A 2JE8A 1HSBB 1C16B 1SHMA 1SEBA 4QO1A 4OCWL 3L48A 1LK2A 4MA1B 2XFXB 3MUGB 1YEEL 3REWA 1PZ5A 1MREL 4H0IA 4BYHA 5ELIA 1YMMD 2LFEA 5TE4H 2A6DA 4PRAA 1OAKL 1XR8A 4A7QA 4HH9A 3G5YA 3H9YA 3NSCA 4ZZFA 3OXSA 4QRPA 2UX7A 1DBJH 5I5RA 1RP8A 3CNKA 1BOYA 1QSEE 3U2JA 4E9QA 4HV8B 5CWSB 2NX5A 2WTOA 2AEQL 2JELH 5A3IC 4KUCF 4MVBD 3VX0A 3RJDA 4ZK8A 3T6WA 4BK8A 5BW7A 3HNVL 4UQDA 3GTTA 1A7BA 5C07B 3H9ZA 5IB2A 4Z7WA 4F15B 1WZLA 4HK0A 4UT7L 4ODWA 3C5ZD 4HIIB 4KQ0A 3KS0H 4G8EA 1W0VB 4PBWD 1JWSA 3VJ6B 4X9BA 3CBJB 5GGTA 3GPEA 4ABVA 1T4KA 2D2CC 2A73A 1MJJA 3STZB 2B1HH 2HWZH 5MENA 1W6LA 1U8IA 3ARVA 5F0JB 3CE1A 2BZ7A 3V2AR 3MLVL 4FLSA 3F62A 2ZXGA 2ENJA 1ACYL 4A2EA 4M43H 4P2OA 4X7TA 1TTFA 3U46A 5BUAA 1JE6A 4Z0XA 3T0EE 3U4AA 4P2RB 5DS8B 5IB4A 1E28A 1IEAA 4DGYH 2WY3B 4J27A 3BP6A 3ME0A 5JA9A 1OGTB 3B56A 3APDA 1WHPA 3OMAB 3QNYB 3DBXB 3WJLC 4Z3TA 5CD5C 3CXDL 4P57B 3FB5A 1FZJB 3H7BB 2DI7A 2BC4B 1LO0L 1IE4A 2XY1A 2QHLA 3OAYK 5IFHL 2WLYA 1J86A 2PXYC 4LEXH 1PZUB 5JHDE 1RZ7L 1ZLSH 4F7EA 2D8KA 2PW1B 1K85A 2VSKB 1QA9A 4D8PB 1QFWI 2HTLC 3U9UA 4LKCB 3S35H 3VFVB 2BSCA 2W0FB 5T33L 1GW6A 2OTUB 2WQRA 3AGVA 2C9AA 3DRTB 4JG1H 4Y2NA 1OGAE 3RWGB 5SWSB 3V4VA 2X7LA 1HJBC 3CH8A 1M2VA 1A3LL 1D9KA 2DLHA 1XF1A 2V9UA 1NWPA 3CTTA 4KK8C 4L8DA 2NY1B 4HS3B 3NCFB 3FONA 3EF7A 4PUBH 5IB5A 2W5PA 4JAMB 2AQNA 4XP5L 1AR1B 2QV2A 4F20A 5IJDC 3HS0A 3ISYA 1M7IB 3CDZA 3T4AA 4DPRA 5GSRB 5HYFA 1ACXA 3H0TA 1J8HB 4YSSA 3ES6A 3UTSD 4YE0A 5ESVB 4DP0X 3QR0A 4ICXA 4UUJA 1A6UH 3TNMB 3E2HC 3QQ4A 1A66A 3R18A 2VLKA 2NTFB 3NIFE 1HYRC 2AI0L 3VRJA 4RLDA 3WY2A 3ILQC 3D2UD 3LIZH 1ZVSA 2OMNA 4XNMB 2J8UB 1EEYB 1NFIB 4UQCA 4RGOH 2YRLA 5G4OA 5BO1L 1IC5H 1G7IA 1WS7A 3NSDA 2WP3O 1Z5LB 3WNLA 1CD8A 2MPVA 4UAOC 3D09A 4KZCA 4WGVB 3MR9B 1JPTL 2YEQA 3D50A 1F41A 3VXSE 3RX5A 3BKJH 2APVA 2R39A 4PI2A 3UZVA 4ZMOA 1DUYA 4Y4FD 1URZA 1RU9H 2Y7QA 1ESOA 3O6KL 3F7QA 3BGMA 1JUFA 1U6AH 1DBBL 4IM8A 1M9SA 3QB7C 3QC6X 4Z5RB 5GJTH 5A6IA 1HHJB 5EUOB 4CADA 3LQAC 1G7LA 2NY3C 2ZSVA 2J8UF 3D18A 2EXWD 3LEYL 5FGSA 2B9BA 1XGQB 3CDGB 4O58H 1WE5A 3D25B 5H37H 5K33A 2XIIA 5HYJE 2KDYA 2R8SL 1O9WA 1N9PA 4EZJA 2VDLH 3FOMB 3VG9C 5DJ8A 3IFPB 3HNTL 1FCGA 3MX0B 4NKQB 3IMUA 5DQ9B 1BF8A 1BIIA 3NRFA 1ZSHA 3ZMNA 4P46C 1A7NH 2Q7AA 3UZQA 1RSFA 1QUNB 1NBZB 4DOHE 1NKOA 1PKOA 5IBLD 3MGAA 4KI5F 1KLGB 3FKUS 4JQIH 1WD8A 1JXKA 2PN5A 1SN5A 3CSGA 3U0WH 5AUMA 4WFFE 4R97B 2PXYA 1A7RH 3KJ6L 1A65A 2JJVA 2EKJA 3U36A 2X41A 4Z7OE 2EDXA 4HJEA 4U1IA 1SJMA 1XF4A 3U7WL 1KBGL 1NH6A 3I75B 4GAFB 1JZDC 1WRFA 1E67A 3NFSH 4JE4B 4HISA 2JCWA 1SMAA 5ABZA 5FM4A 1WAAE 3EFFB 3MRPA 1AGBB 2YZ1A 2KERA 3CVHB 5GS2D 1B9KA 1E6OL 4FQXB 5C8JA 4BFRA 2YOCA 3S9DB 5MI0B 3M1BB 4WO4D 1BEXA 3QEQD 4JO5A 3NZUA 4KTYA 5F7DB 4OVUA 5FYJD 3LD8B 1AVAA 1B90A 3AQDA 3MUY1 2NUPA 2R2BA 4A2MA 4TLKA 2WN3A 3RJQB 3G5ZB 3O41A 4U1JB 4DIXA 3W9DA 2XN9D 3Q8FA 4AXWA 4X7SH 5LNDA 3A24A 3BAYA 1BD2E 1WZMA 4YLCA 1PLCA 4TUKH 4WTWA 1FZOA 4UDTB 2HMID 4NUGH 2H1LM 3TWYA 3SJVA 3O9WB 4TQEL 2PMZA 3KPLB 5D8JH 3NPZB 2Y7SA 2ITFA 4M3KB 4G72B 1PFOA 2YN5A 1MRDH 2WLZA 4RH4A 3VA6A 4Q9RH 3MV7B 3BP4B 1TYRA 1YHPA 1TYJA 1R0AL 3ZKMC 3TGXA 3POCA 4GT0A 5DC9B 4IU3A 3VNYA 3VWJC 1I8UA 4V1DD 5EC2B 4FQ2H 5TFSH 4DZBA 3PNWB 2BY0A 3O2DA 4KVPA 3THML 4A2DA 1HESA 3FO2A 1KPVB 4GQRA 3TF7C 3P69A 5JDSA 3J2PA 1S7RA 2B77A 2VM3A 4QHKI 4C8XA 1XAKA 2B4CC 4XX5A 3EJZD 5L4MA 1UB5A 4UQBA 2PABA 1KGCD 4NO5A 5I6XC 3AM8C 3OMIB 3N0PB 4Y8DC 2ZX9A 5F7YC 4I77H 3BWAA 2YD1A 5F1SA 3ZZLA 5AD0A 3QUXD 1YEFL 3C12A 1S9VA 1WISA 1JWUB 1IGIL 1OAUL 1T1YB 1UYWH 4OIIL 5FM5M 1KLFB 1JZJA 5CLXA 3K2KA 4OV5A 1AZUA 4YNYB 2DD8H 3RFRA 4ZS6D 3MCLL 1CS6A 5ANMA 2AV1A 4GBXA 2AEOA 1CD1B 2HG5A 2IAMC 4MA7L 2GB2A 1DE4B 1SEBB 2ZYHA 1VSCA 3DVIA 4QO1B 1NC4B 1LK2B 4XNQA 3EW3B 5GGSY 1MCWW 1GGCH 1XO8A 5T8IA 1PZ5B 1W8NA 1L7TL 3JQOB 4N9GB 1IMHC 5IZ7A 2N7SA 4PRAB 4KXZH 4IOFC 5CP7B 1T4WA 4PLKC 1NLBL 1U3HA 3G5YB 5D7KD 1AKJA 4CRPA 3OXSB 4QRPB 4JHWL 4Z3EA 2MTPA 4DW2L 1WUNT 2A9AA 3HA0A 1S7SA 2CAKA 1JS4A 5LDSA 1MHCA 4OCXH 1H3WM 2NX5B 5CZRA 5MEOA 2VSCA 4AEHH 4BQCA 2WWNA 1IBGL 5IB2B 5JIQA 3EUUA 4Z7WB 3E1ZA 1RAMA 4R4ND 4G82A 5DRXA 1JJUA 3QC5X 4ODWB 3SYAA 3RI5F 2ZUXA 5JR1H 1C5BL 1NCAH 1OTSC 2I25N 3I02A 4PB0H 5AAPA 5GQBA 5JPNA 3RVWD 1JWSB 3SCMD 3N43F 2DBLH 4AQAA 5C0AD 4JFOB 3FTWA 1GTNA 3ZLQC 2IQ9H 1RVFH 2A73B 1MXDA 3ECUA 3T2PA 5ICYA 4DAGL 5MENB 5EPMA 1SXSA 1U8IB 4Z7NE 3HE6C 1SBSL 1T5WB 1BBDH 5BMFH 1BPVA 1X9LA 2N0KA 4KHXL 3CFIC 4P2OB 2BWDA 1DJXA 1QRND 1HHHB 3QQ9D 3WGVB 1P6WA 5I0XA 5IB4B 3NSJA 4Z7WF 3FF8A 2IV9A 2J71A 3D85B 4PS7A 3BP6B 3DJRA 5ADPH 3GKZA 3JV4B 5LG1A 1V05A 5B1AB 3RL1A 5MEPA 1M56B 3WS3A 4TSCH 5FYLH 3QRBA 4K3HA 4GMTH 1I7ZA 4NZTH 3FB5B 1AO7D 3QUZA 1GSMA 4H20L 4TLTA 5ADOH 4N28A 4OM1L 3QJVB 5D7JC 4B9FA 2DIEA 2EE6A 3BDBA 1JVOA 1J9TA 2R2HB 1EHAA 3QEGH 5C0EA 3RTQD 2QPEB 4P49A 3AREA 1NAML 2F9BT 3B3IB 3K7UA 4QNPF 1M6OA 4GRWE 3RL2A 1RUAL 4AC4A 3RWJB 3KVPA 4N24A 3U9UB 1HNFA 4HUWB 5SX5K 4NKMB 3QDMA 3TEWA 3ECWA 3V4VB 2X7LB 5CZXC 5DJDA 1G7MA 2JKXA 3VE0A 4CSZA 5FYKD 4ZAKA 4NSKA 1NIDA 5CJQH 3EJPA 2ZAHA 2NQDA 3LMJL 4I9XA 4L8DB 3S35X 4L05A 3L16A 3BQVA 5IB5B 1SGKA 2ZX8A 3EF4A 1P7QD 4LSPH 4M1GL 3RBSA 5C3LD 4JFVA 2X0UA 3HS0B 3DXAA 3CDZB 3Q8CA 4I5BA 2YRPA 2Z91B 2ZXDA 3H0TB 4G5AA 3H7LA 5D1ZD 1GAFH 1EJFA 3FZUD 1TJMA 1T20A 3B9VA 4UUJB 3L1OL 2IXQA 4EIGB 2EVIA 4ZJ9A 1JK8A 4DZ8A 2ZZUT 1U36A 1U8QB 1FFOA 2NYYD 3K5RA 4QHLB 2VLKB 4NHCH 4OZGA 3NQKA 2WOBA 3VRJB 1CYXA 4CC4C 4KKZA 4UMSA 3V7AG 3LXBA 4GAAA 3V4VL 1ZVSB 4LRIA 3MRIA 5JHLA 5DD5H 1KY6A 5KVDL 1YQ2A 5I6NA 5D2LE 2WBJC 3VGFA 3VGBA 1G7IB 1IC0A 2VERN 3N6YA 3MLZH 3SDDD 1V7NH 1UJTA 4HLZG 3QRGH 2EECA 4PJBA 1T2QH 2XTJE 4IJ3C 3AXHA 3CFDB 3PHOA 3P4LA 1DUYB 1GH7A 5E9DD 1Z66A 3ULVL 2Y7QB 2ZWKA 4JFDB 4X6DE 3BGMB 1JUFB 3DGCR 4AH2A 1CDJA 1QSED 3TV3H 3V6OE 4CN1A 4CL7A 2ATAA 9CGTA 3C08L 1MCOL 4HGWA 2OMWB 1KCVH 1GCFA 2JB5L 3RNKA 1LQBC 3TA3D 5DJZB 3QE5A 4G9FD 3D18B 5AKTA 5EIIA 5KN5A 1CVRA 2E6QA 4M29A 4RMSA 3B8YA 4XO5A 2NUTA 3HE6A 3DK0A 5HDQL 1S78D 1JYVA 3NCWA 3FSOA 3FF7A 4XNYH 1P1VA 3DMMB 4M1CD 3BZEB 4IBSA 2OR7A 3ZUCA 5IUCA 4I85A 1FI8C 3GF8A 4G9DA 4IBVA 1HWHB 4NUMA 4DK6A 3PHQA 3UZQB 12E8L 5DZVA 1KUMA 2FLMA 3T09A 3KXFD 5L88H 1BM3L 2WYHA 2IG2L 2DM4A 3R1GH 3T0ED 1GL4B 4FNLL 5C0DA 2JCCE 5AUMB 2QGEA 4YHIA 5HHMB 1UD5A 3MO1A 1K4CA 1YECL 3MFFA 4U1IB 3QDGA 1XF4B 5HDBB 4U1KA 4N2DA 2ARJA 4OR1A 1YEKH 4YHNA 2JIXA 5I2IA 2X1OA 2GJRA 4H8HA 3QA3A 4LT7A 1HFUA 5HGBA 1L9RA 4RSYA 3NCYP 5EIIG 5J06A 3RWHA 3MRPB 3DVNB 3VQ1C 1R17A 3LXAA 1ZLWH 5JHDD 5EV7A 5C09A 5D6DC 4HU2A 4ABUA 5C8JB 3L4UA 2XTSA 3S3JA 2E3VA 3WNKA 2WWMD 3MRRA 1DBJL 3N1MC 3ALXA 1OGAD 4DUXA 5FGCE 3H2PA 1I9IH 2JELL 1AQMA 2WMPB 1TXKA 3VGHA 4UBDC 3BO8A 3QDJE 3O41B 3BKMH 3F04A 3W9DB 3VSTA 4BM7A 3OB0H 2CNYA 3PWPD 2VM9A 4JM2B 1CB4A 4KJYA 1A6VH 4PJCE 5C0FA 3RP1A 2DKSA 4FQJH 4P3CH 4QXWA 2X1WL 1AACA 3MACH 1MJ8H 2VN7A 5DHVH 1FZOB 1S9YB 4E41B 4YMPA 5F88B 4ZT1A 3O11B 4PS4H 2HWZL 2WBJA 4PJEA 3IJHA 1CYWA 4QHMA 1YUHA 4AVJA 2NY6B 2CGZA 2F53E 3ZDWA 5CCGE 1H8OA 2PKDA 4N0YH 4OIAA 4XX1E 4AYEC 1B4RA 1BXXA 1EK3A 4IU3B 5TQ0H 4M43L 3H53A 3KPNA 4DZBB 3PGFL 3FN3A 4KRNA 5TE6H 1N5AA 4KPHH 5DS1A 4BFEA 2YS4A 4DGYL 1AE6H 2IBZY 5FO8A 3LZOA 4X98A 3VD4A 4IMLA 2J4WH 2QDWA 4LPCA 4JE0A 4YGVB 2E7MA 3P0GB 1PY4A 1UB5B 4MB3A 2ZIDA 3VXSD 3N5AA 4NO5B 3WYRA 4KRLB 4Z95H 4AW4A 3UX9B 4OZHF 5FGBC 5KOVC 2XWJA 3BWAB 4CDGC 2VDRH 4LEXL 4A2GA 1KNOA 5E8DH 5AD0B 1S9VB 3HI1A 1ZLSL 2JXMB 2QADC 3HG4A 4RZCB 1RZIA 4OFYD 3OR7A 4OV5B 3S35L 5AQ0A 1EZVX 4JG1L 3HMWH 5IK3B 4UTBA 1TF4A 2AV1B 2YOAA 3IETB 1J10A 4GBXB 5C0JA 2HG5B 1QSFB 2A0LC 3T2QA 3AITA 4KNTA 1KEMH 4IMKC 2EEDA 1YAIA 3H9HA 4XNQB 2ZUYA 4PUBL 5DRWA 1CDIA 3GSUA 1WTLA 5F8RC 4H8WL 3CCHB 4JLRA 2UVFA 2Y6TE 1ZS2A 1U3HB 2GHWB 1MW2A 4YVUA 1UATA 1AKJB 4ZOEA 1CN4A 2EDJA 4S1RH 5TDPA 5IJKC 2X4RA 1FC2D 3AS2A 2HB0A 4Z9KB 2GSGB 4BUHA 1BQ5A 5MEOB 3SO3B 3SGEH 3ZE2E 5DD0H 3US0A 4R7VA 1CFQB 1KTDB 4GNKB 4BFFA 4F80A 5KJ4A 4WFFD 2ADJA 3EAKA 3LIZL 5DRXB 4PRBA 1T66C 5K5YA 3IFOA 3U4KA 2O93L 4RGOL 1AD0A 3I02B 1AQHA 1DBAL 5JPNB 3MLSH 3C60D 1MHHA 4AQAB 1IC5L 4XRCA 1RK1A 3PV7A 2CR0A 4J8QA 1I8KA 5EPMB 1MCFA 3SKMB 3P73A 4HUMB 4ORGB 3WO3B 2FT7A 3SYQA 4ANKA 1Z9LA 5J11B 2FTAA 3BKJL 4AYFA 4DKDC 4YDLB 2NSQA 3D39D 2HYMA 4YPJA 5AW4B 5KSVB 1RU9L 3GJFK 4XZUA 4NJAL 3FB6A 1U6AL 2WKGA 5GS1C 4L0YA 1EMTH 1JGVH 1MH5A 1RIVH 2BHUA 3RG1C 5DJ0A 5GJTL 1XZWA 1QACA 2XZAH 3Q6FA 5T1LA 2WD0A 1KTCA 2NSMA 3HC2A 3RL1B 4NI3A 4G6FD 3WS3B 1IB5A 1DVFC 3OZLA 5C3TA 4E9WA 1I7ZB 4O58L 4XNZC 3GHBL 4KJPD 3QUZB 1MI5E 5I18H 3IMSA 2SODB 3SGDH 5KVMC 2VDLL 5C0EB 3EH3B 3KLDA 1HZHH 1GW0A 3PXHA 4KKCC 3CBRA 3TCXA 5KVFE 1A6AA 1IAIH 3AREB 1JPSL 2PR9A 1DQLH 1M6OB 1PNCA 3C5SA 4NLAA 4ZMVA 3QUYC 4NQXA 4MB1A 4QTHB 2WKLA 3NSXA 4RMVA 2BHFA 4KQ3H 4PP2B 5EEVA 1D2OA 2EKSA 1IGFL 1A7NL 3VTAA 5HTSA 1B2WH 2NXYC 3LQMA 1FFRA 1ZCRA 4JMNA 2KS0A 5A40E 2GBUA 1G7MB 4JPKH 1TQUA 4W70A 2BP8A 3KPPA 4NSKB 4ZAKB 4JQIL 2EXYC 1P7HL 4YLQT 1MZZA 4LL9A 2VLRD 2W9EH 2L4OA 3QZBA 4H0HB 4XN8A 3UL4A 2QQNH 3U0WL 3SIKA 1CICA 2CGYA 3G9VA 4L8BA 5J89A 1A7RL 1OTTD 4KJQD 4WWNA 1WCBA 1JN6A 3ZZSA 3SQBA 2VJ8A 3TEXA 5D2NC 2QTVA 3DXAB 4I5BB 5LDUA 4WW2C 3NFSL 4LAQH 5K59F 1T20B 1EFQA 2IXQB 4Q4IA 2WXGA 1TSHA 2XVKA 1JK8B 1K2DB 2Y69B 4TLSA 5D7LA 3FTUA 3H56A 3LSOA 4Y19A 1FFOB 4B3VA 2NT0A 4D9LH 4OZGB 4PW4A 3VMOA 4QKXB 4HW6A 3DO3A 3MRIB 3BYYA 1C8PA 1OD9A 2X2YA 5JXAH 1XQ4A 4AUYA 4P2YA 5HBBA 2OFQA 4U1GB 4OZ4A 4I8DA 5ERWA 5E99H 4ZW3A 2CRZA 4LLQA 3I3BA 4PJBB 3TO2A 3ZN6A 4ERSH 1ZDSA 3ZZ1A 5CEYB 2VH5H 3W39B 1EDHA 4X7SL 5GRJL 2QGDA 4ZDHA 3HTLX 3DSNA 2JJTA 4JRWA 3TZVD 4YBQC 4LDEB 3CUPB 2Z92A 1KJ3H 1ETA1 1SM3H 4AH2B 2YD0A 5DD6B 3SBQA 2FH8A 4OZGF 4HGWB 1MRDL 5EA0H 2VXUH 4URKA 4X8JA 4J3VA 4C4KT 5KN5B 4S0HA 5IT2H 2NUTB 3GB7A 4HFUH 2D9CA 1S7QA 1QO3A 1DTUA 5E00B 4FQ2L 5TFSL 2BJML 3E9TA 1EAJA 3K8LA 2VW7A 4QOKA 2VE6B 4PJBF 1OXYA 2Y36H 4M7KH 3VDAA 5GS1A 5B21A 5DMKA 4XNUL 4NO3A 1GY1A 3WMPA 1BAGA 4MXQD 3KPRB 3PHQB 4Q6IA 4QHNA 1ZGLA 4I77L 3H3BC 4D3CH 1QLRA 1UYWL 4EN3A 1MUJB 3MBEA 4YHIB 3N1FC 2DD8L 3MO1B 1K4CB 4OLUL 4PRNB 1AH1A 3QDGB 5F3HA 1IBBA 4MMYA 4U1KB 3B2PA 3IMWA 4FLHA 1IBDA 4JG0H 4EUPH 1H3TA 4RFEB 2R1WA 2JIXB 4Y4KD 4YHNB 2BVEA 2R0WH 4FFZA 1PU0A 3MKKA 3QJTB 3VWKA 4B9CA 1GGCL 3F83A 3T0WA 2H5UA 4APQC 5G4NA 4OZIE 4PJAE 2JQAA 2HFGL 5C09B 3TJPA 2HFEA 2DEXX 2ZXBA 3CC5B 3MGOB 1NUFA 4DKFH 3GO1H 4W9CC 1XH3A 5CCKH 5K9OB 4QI3A 1BVKA 3V9EA 1UENA 3C87A 2G60H 3MLWL 3MRRB 3QXWA 3FRPB 1ACCA 2N56A 2VXSL 5GGUA 3WUWA 1BW8A 1P84J 4WW2A 1CG9B 1ET5A 4KKRA 5AWNH 1KY7A 5KYWA 2P49B 5F0PB 5FUCC 2D03H 4JX0A 2ZUTA 2XC8A 3BO8B 3WTTA 4Z77A 1G5AA 1U8MB 2H7WA 4E9YA 3PGDA 3QISA 4KJYB 5I8OH 5C0FB 2BCMA 3T0AA 4F2ME 3ULUE 1NCAL 3BCDA 6FABH 1SN0A 4PB0L 4POYA 5AKVA 2DBLL 3FQ1A 4LLAA 4MZ2A 2A6KA 2V4LA 2IQ9L 1A3ZA 1RVFL 7PAZA 1AKPA 3MKGA 2CUHA 2ALAA 4HJJH 1WAPA 5BQ7A 4P9HC 2WO3B 4PJEB 4KX7A 3JYCA 1W80A 4FFYH 4JDTH 4N90D 1YUHB 3CFUA 4QHMB 4NJ9H 5CLTA 4LP8A 5J9PB 5JXEC 4ELME 1BBDL 2Y0SA 4KGLA 5BMFL 3BCFA 2BSBA 1OT2A 1WEJH 3O3DA 2Z0BA 4GMSH 2UYLA 1HAUA 4RISH 2NYKA 3KPNB 4FADA 1N5AB 2CPUA 4GAGH 3HC4H 3UH8A 4FULA 5I71C 5A2BA 3Q8AA 5ADPL 5FO8B 2KMWA 3TT3H 4IMLB 1ITBB 3QRFM 4TSCL 5FYLL 4GMTL 3WUWG 2G3XA 2XTJD 3OL2A 1E5UI 3BT2H 2DIBA 2XWCA 3VGAB 3WJMA 2J6WA 5ISZB 3GRGA 3BUBA 2M2DA 5ADOL 5HVWA 3BSZH 5EU3A 4ZMPA 4MZ3A 4S11A 2XWJB 1CXEA 4OD2A 1KNOB 1II4E 1PGRB 2BOCA 3HI1B 1LP9A 1O7DC 4ZX6A 1GPOH 1NEUA 3JTTB 2WGNB 3JVGA 4JB9H 2PTUA 1BQHB 3H3PH 1AZNA 1RZIB 5AVRB 2DQTL 1TYEB 4HC1A 3BAEL 3VW3L 2XWRA 3AGWA 5IWLA 1VJSA 5C0JB 2AJ3A 3TM6A 4M9OA 4U31A 1D3CA 3I6LE 5FYJU 4C59B 3H9HB 2O61A 1YMMA 5DRWB 2EDDA 1R5IA 2N4IA 3D07A 4LSPL 4JLRB 4J8RA 3CSTA 1TITA 4YE4L 5TDPB 2ICEA 2X4RB 5DJCB 3ZE1B 4G1EB 4Z7QE 3GXFA 1GAFL 4G6MH 3TX4A 3O6FC 2PWEA 1ML0A 2W91A 3KAAA 3RHWF 2ZKYA 3CSPA 4NHCL 2ZUUA 4APQA 2BSRA 4LLDA 5TF1H 2ADJB 2Q5BA 4GP5B 4UTBL 1EJOH 5BS0E 5I73B 5IGXH 5DD5L 3IFOB 1ZHBA 1AD0B 2DMHA 1FGNH 2H3NB 3CXHK 4XRCB 3PL6D 3B2UC 1QHOA 2F7QA 4KTEH 3RY6A 3VYPA 3MLZL 4QJ3B 1V7NL 4BZ1A 4GOSA 3QRGL 4N2LA 4MBRA 3S3CB 3G3LA 4I4WA 2P26A 3CZFA 4I2XA 4XHJC 25C8L 5MEQB 4PMEA 4XCFH 1G1OA 4AYFB 4CU6A 3TVMD 3HZMA 4F58H 5E24E 3ZR6A 3LDBB 1F97A 1MFCH 3EDDA 4BINA 3FB6B 5FYJH 1UJ3C 3CH1A 1MH5B 1FCCA 3QWQB 4PLOB 4GIAA 3A6CL 4K0OA 3SBRA 5DJ0B 4DN3H 4JDZA 3V0GA 3Q6FB 1KCVL 2VMFA 3UAJD 1T7XA 3PAVA 5IQMA 3VRIB 3ROOA 2CK0L 1G7JA 3T6VA 2IJ0C 2Q20A 3K72B 4DP1X 5J6GA 1NGWA 1FG9C 4XXWC 2A1WL 4XCEB 2BMKA 4NIYE 4Q74A 3S97C 1T5XB 2Q0ZX 4G71B 2I9TA 4OV6F 2A74B 1XAUA 4LSTL 3UPRB 1NGQL 2H0FA 1BLNA 5T3XE 1A6AB 3ASWA 4ODXB 4LVEA 4O51A 3TPUA 5C6TH 2ZUSA 5B38B 4NQXB 1DBMH 3DYMA 3HLAA 2K8MA 1MW0A 4UINL 5KSUA 1L9SA 3PWUA 1OW0C 1X5MA 1SF3A 2EKSB 3ARDC 4NZDA 4C83B 3TN0C 1BWMA 1DANU 2CKBA 2F53D 3UYPA 5EBMA 3K74B 3U6RA 5L88L 3WIIL 1W15A 1GZQA 2BP8B 2IBGA 1SDAB 3R1GL 4OLWL 2FVNA 3HPLA 3KVQA 2CDGA 5D6CA 3B1TA 1CICB 4L8BB 3ARTA 3DPBA 2BPBA 5J3HD 1MFBH 4TUOA 1QEXA 1WCBB 3BAJA 3MRQA 3QUKA 1W8OA 4OCRH 3T5WA 4M7LT 4B0MM 1VZIA 1I1AC 3WN6A 1YEKL 4EKJA 1UD8A 1JHTA 1FO0A 1U42A 1WWAX 4A6YH 4OM0L 3T0VA 2AAAA 3T1WA 1XSIA 2B5IC 2KLRA 5E6IC 1KCKA 3C2SA 3QCVL 1JTOA 2NXZD 3D2UA 3GSVA 3U7YH 3IDGA 4FMFA 2Q3ZA 4QGYA 4UM8A 1YRKA 5HYSA 1UT1A 4IBUA 4FCHA 3K2UH 1MVUA 4E2OA 1KFGA 3WI9A 2CLZA 2GK0B 1TJIH 1AYOA 1KYFA 1DEDA 2P5PA 1KENH 4TQIA 4Y7MA 5DHDA 2YBGA 3AT8A 3GSXB 3RU8L 3O6FA 5ERWB 2QVKA 2HLAA 3CD4A 5E1HB 4LLQB 5LGYA 3BKML 4QRBA 4FTVE 2AHIA 3UACA 5IVXE 5I75C 4RETB 3VXQA 2ZKHH 1A6VL 4Y4FA 4M1DH 3DSNB 2W8CA 4FQJL 4P3CL 4ALAL 3L17A 1EQWA 1Z3GL 3EBAA 3AG3B 1X5GA 2J57A 1LLAA 3RGVB 4OLZH 1J5DA 3HB3D 5F9AC 4PS4L 2VDRB 3MNMA 3S0PA 1WV7T 4UV4H 4C56D 3KEDA 1M1SA 2IH3A 3L9YA 4PRID 4X8JB 1HYSC 5CEZD 5B8CC 5JZ7C 4N0YL 1XCXA 3GB7B 5DUBA 1GOGA 4AQ1C 5TQ0L 1S7QB 1TZGL 4WI9A 5IFAH 3WEMA 2Z65C 1U8KA 4W4OC 4QOKB 3GFUA 5TE6L 1MDTA 4KPHL 5IHHA 5JW4M 3NABH 5HYSG 1UJ3A 1AE6L 4W4NA 1TJGH 4PMFA 4NO3B 1QFPA 3MMEB 3V4PH 4PCSA 4WW1A 4I3SH 4ZUUA 1NCNA 3TO4B 4JO8A 3ETBJ 3P0YH 1KYOJ 3B34A 4Q6IB 4GG6E 4N5UA 2X6UA 4QHNB 4IOSA 1DQMH 2NTSP 5CSGA 4Z95L 3ZRFC 1FNFA 2O5NA 4K7PY 2PYEE 1ZGLB 5AVQB 4FOMA 1WWBX 2QVMA 2TSBA 2VDRL 4YL4A 2WINA 5E8DL 3RWIA 4JKNA 1H3PH 1QLRB 2C9QA 1X5ZA 2LAGB 3H8NA 4XOCA 3WE1A 4EN3B 3MBEB 4ECNA 5C9JB 4WNJA 3NJJA 1YEWA 5F0LB 4OJCA 3F85A 2XN1A 2PP7A 3H9SE 5HHQA 5E1AA 1ZT4A 5HJGA 3ZRSA 5F3HB 4MMYB 3F84A 1KN2H 3WTVA 2F7PA 3FQTB 3QI9C 1NFAA 1BGXH 2B16A 3RPBA 1VA9A 2WQXA 1KEML 2GSIA 1ASOA 1WA0X 5B1CA 3RVTC 5EC1A 1F6AB 4MTMA 4PJXA 5GISL 3VWKB 3ZTCC 43C9A 3WN5C 2FATH 2OYLA 4PBVC 5JIIA 1MFAH 2VAJA 1D5XA 4JEGB 3DX7A 2EVFA 2ED8A 2HFEB 2FQEA 4S1RL 3QEHB 4BWUA 3FO0H 1KGJA 2F0CA 4R0LA 1I1AA 4QMEA 1A5FH 3WUWB 1SLUA 1PLGH 1A0QH 1UVQA 5DD0L 3TFKD 3RX7A 2XN9A 3E80A 1CPUA 4P5TA 3M7FB 4Z77B 3PFQA 3GPSA 1UACH 4Y1AB 5E6IA 3EH4B 1D7BA 3WFEH 3MV01 5F89A 2DIAA 3TYFA 2FHFA 1Q0XH 2DQMA 4IKNA 2C4FU 1E3XA 2Z8VC 3MLSL 1WBZB 4FFZL 1R5VA 2IFGA 5LN4A 2A6KB 3VXPA 3DDGA 2CA3A 3VFTB 2X4OB 4OF5A 5A7EA 2YQ2A 1UWYA 5BQ7B 1BXVA 2C1PA 3FTZA 3CX5K 4HUVB 4HBQA 2DLFH 2EE3A 1SDDB 4WW2F 3O3DB 1VEMA 2YIHA 2UYLB 3HRZC 3BXNA 2QKSA 3WLWD 2XVLA 4K8RC 1EMTL 1JGVL 1RIVL 2EUXA 3UCRA 5EZJA 2XZAL 2PO6A 1QSVA 3STLA 4QR7A 4I3GA 4GSDL 3VXRA 4IKLA 1KG0A 4U4IA 1ZEAH 4AIZA 2MKLC 3BWUC 4CW1A 3FL7A 4X2UA 3LAFA 4Q52A 4JN2A 5BOZG 3W11D 1XFPA 2Q76A 2PCYA 2OJZH 3M1CA 1KBBA 4LIQH 5I18L 5EU3B 1WFJA 1WDAA 4AQ1A 2SEBA 1PZ2A 2VRAA 3FTVA 1HZHL 4RESB 2WXQA 1BZ9B 2Y7NA 4X5XA 4ZFOA 2OCJA 1IAIL 2BOCB 1DQLL 3NIGF 1CLOH 2XA3A 3BPCA 4AI7A 1TZIB 2ZE0A 3LNGA 1B2WL 1S3KH 3FT3B 3FOLA 1FZMB 4XXCA 5AW3B 4ODBD 4JPKL 2K78A 4I0PD 4J4PC 4XE5B 4IBLT 4RSVA 2AJ3B 3MTXA 4L48A 4X6FA 2EO9A 4F8NA 4FAAB 2O61B 1YMMB 4MMXA 3LN5A 4TVUA 2K45A 4O2EA 3WFCH 1R5IB 4X7DC 4YC2C 4Y88A 1ZT1A 1MJ7H 2V2XA 4PRHE 3M7OA 3GWJA 4FLOA 1SY6H 2VUYA 4W6WB 4Y2DA 2ICEB 5ESAA 3V0AC 3NK4A 4AGPA 2WQSA 1FC1A 1F02I 2N01B 2WUCL 1LP9F 3QHZL 4LAQL 3T9WA 1TZHA 1A1NB 2AEWA 4QRQA 4ZW6A 3VD2A 1T21A 2MOQA 4BRJA 1MW3A 4D9LL 3QXAB 4QRRE 1FIEA 2XQBH 4APQB 2BSRB 4NQUA 4GRMB 4LLDB 1EEUA 4HS8H 1LTXA 3I2CH 1HQRA 2WO4A 3TBSA 4G6JL 3LH2H 1SQ2N 4GO6B 1E65A 2EIZA 3SCMA 3VM7A 1ZHBB 5C0AA 2NNAB 1MRCH 5E08H 3BPLB 5JXAL 1REIA 4XVTH 4BBWA 1QFHA 1SNRA 2D9QB 2C9VA 1IVLA 4N8UA 3G6JF 5E99L 1S9XA 3CLFH 2QSCH 4I4WB 4I2XB 3PQYA 5DLMH 3W2DH 1KXQE 3HZMB 2HKAA 4F37F 4CVZA 1XXDC 2D2OA 5B3NA 4AYID 1WPCA 2ODHA 3QZPA 1KJ3L 1SM3L 4HEPG 3VMPA 3SSGA 4ZXBC 3U30B 2O6PA 2UWEA 2X88A 3ETSA 3C5XA 3NIDB 4IBWA 5EA0L 1S7TB 2VXUL 5D5MA 1PTZA 1M71B 3P9WB 4V2BA 5IT2L 4GQPH 4JFPA 3RURA 5J6GB 1NGWB 5IFJA 4HFUL 3E1F1 3O81A 3FB8A 4Q6YA 1TCMA 2H3XC 1V5JA 3AUVA 3MV9E 5A2FA 3HVNA 3RTQA 3QO0A 2I9TB 3D33A 3SGJA 1UASA 3BHBA 1XCQA 5JNYA 3S4SA 2Y36L 4JFFD 4M7KL 1BLNB 1UUNA 2X6BA 4LNVA 5LXGH 4OAWB 2JKTM 5FK9B 4YFLF 4UTAA 3TPUB 1NBQA 4LDLB 1KWGA 1PKQE 4LPVA 5KSUB 5EBLB 4X9HA 2VZOA 2AANA 5JIPA 1R4XA 1JZHA 2CKBB 3UYPB 5EBMB 4BKLA 1GIGH 9PCYA 1GZQB 3L3IA 4PLNC 1M3JA 3IJEA 4FKKA 1UH4A 3CGTA 3HPLB 5D6CB 2CDGB 2EADA 2GTZA 4Z7VF 3DPBB 1Y1DA 4XXDB 1E2WA 4ONOA 5K9JH 4TUOB 3MRQB 2APFA 5K9QI 2GJJA 3MRNA 5CBEA 2BNRA 4GXUN 3UTSB 2JMRA 5ICZA 2HT4D 2EE9A 1B0WA 2R0WL 1JHTB 1FLRH 1SEQH 2E7CA 1FO0B 3GMOA 1DVUA 3L4CA 2YUVA 1JP5A 3F6LA 3U7AA 3GC3A 5HHOE 5J12B 3D2UB 2HTKC 5BZXA 3GSVB 3W9EA 3WIFA 2IDQA 4FG2A 4UM8B 4NWTL 4DKFL 3GO1L 3S4SG 1MVUB 1TTAA 4DGVH 2FAUA 2G60L 4XCNB 4BK4A 1UADC 3RKDC 2CLZB 3GMPA 1A9BA 2RB8A 5AWNL 3SDDA 5CMAA 4U3CA 5E1GA 1WZAA 3I6LD 3QFDA 3QUMA 2W65A 2OM5A 1GZPA 1INQA 1I3RA 4YZFE 5LGHH 1XGYL 4KI5E 3IAGC 5I8OL 3VXQB 2R69A 4Y4FB 4PJ7B 5A2LH 1U92A 1FAIH 3MA7A 6FABL 1R9FA 1FO0L 5KBNC 1QSEA 5DRNB 5MP6H 2EYRA 1XMWA 3UBFA 3SE6A 4B9ZA 4K3GA 2X42A 1XF3A 2Q7NA 3OAYH 4HJJL 1W72A 1B3JA 3MROA 5T3ZD 4JDTL 1E0OB 3MODH 2IH3B 4NJ9L 4DO4A 3DSFH 5M95B 1W0WB 2F8OA 4PJIE 1WEJL 5E1QA 5DUBB 5M7QA 3ZO9A 4GMSL 4JFUA 4YHOL 4YH6A 1AXTL 3RI5K 3IJYB 5ID0A 2ENSA 1U8KB 3E9UA 5F1IA 5LCVA 3VB9A 4GAGL 3HC4L 4N8CH 5CM1A 2B1AL 1G6VK 1AIZA 5IW1A 4U2ZA 3TT3L 3ARWA 3SE9H 3S3PA 3ILPA 4KTGA 4ZUUB 3S8GB 3X13B 3BT2L 1E8XA 3MI6A 1EEZA 4TVPD 2R4SH 4OU3A 3BSZL 3LS4H 3O4OB 3JUZA 4MNGE 1EO5A 2EZ0C 2BP5M 3ZDYF 4QHPA 3T2LA 3RWIB 2WINB 4LRNH 4PJ5D 1TG8A 1GPOL 4NFBA 3MRJB 3H3PL 1N70A 5EU5B 3U25A 3L3DA 1IEBA 1UEYA 3SKOA 2CK2A 4E5XG 5HHQB 1KB9J 1ZT4B 5E1AB 5EEUA 1JSYA 3KYAA 4W9HC 1UWGH 3FUJA 3W82A 3KWUA 2GSIB 5LHDA 1BMWA 5EC1B 1IE5A 4WFED 1XGPB 2DTMH 1WZKA 1F56A 2KZ1B 1M7XA 3IGUA 3K80A 4FXLA 2GUYA 4K55A 3L54A 4OFDA 4XPHH 5M94B 1MELA 4UV7H 3DX7B 3IDYC 2FGZA 1OGAA 3RWDA 1E4HA 2BY2A 4WO4B 4M6MH 3CHSA 3QEQB 1J1XH 3O8XC 4YEFA 4G6ML 4R0LB 4WFGD 3F5WA 5CD3A 1NCHA 3GIVB 4KDTA 1PJ9A 1FF5A 1UVQB 4KHTH 2YKLH 4MCYA 4XI5D 5EO9A 2XN9B 3IXAA 4P5TB 4JQXA 4RNRA 4W68A 5TE7L 2J56A 5TF1L 1UCBH 2P8PA 2PPDA 3PV6A 5HGGS 5F89B 4L1HA 3TYFB 5I1AB 5IGXL 5F6HI 1XIWD 3BP7B 3FO1A 3P30L 2MKWA 4PJXF 1FGNL 3IRPX 5IMKA 1JIBA 5ITBH 1R5VB 2PTTB 3O45B 3BH4A 4KTEL 3VXPB 1MCSA 1IAMA 2Z31C 3BH9A 5DVKA 2G9HA 1RQ5A 2J5LC 4FFVC 4K23H 4UU9A 1Z5HA 2VR7A 1J0HA 5GGVY 2A99A 5FV2A 1G6RA 5GZOD 4F58L 3NCEB 4TSBH 4V1DB 4Q6KA 1MFCL 4KOBA 5FYJL 3PWLB 4H26B 5AW7B 3T0DA 4YWGL 3JV0A 1BA9A 4DN3L 2PO6B 1CGYA 1AIFB 5EOQH 4XNDA 5EBGA 2W94A 3ML9A 1HE7A 2OPCA 3VXRB 1H8NA 2OS7A 4AIZB 3VXSA 3OG6B 1AGCA 3FXIC 1NKRA 4GKZA 3RDTD 3CU1A 4NB7A 1AYRA 4B50A 1AQ8A 1NUNB 1JPGA 3QUXB 2SEBB 4LEBA 4ELKA 4XWOC 4A6YB 1O7VA 5CGMA 1AHWA 3TBVB 3QRLA 4IIQC 5C6TL 3AXIA 3WTSA 1DBML 3BPCB 3MC0A 3F7YA 4ZMAT 1TQWA 5BRPA 4YQXH 2NY5C 3ZSSA 4OIBA 4CKVX 5C9KA 4R26H 3FOLB 1KIPB 4YSPA 1AC6A 1J0KA 1DSWA 35C8H 5HYJA 1N59A 2XZZA 5I28A 4L3AA 4TM9A 4X6FB 4KNQA 1U8CA 3CWGA 2NNXA 3CN1A 3AVEA 4UNTA 2JI2A 4LVHC 3ILEA 4TF4A 2OL3H 1CGWA 2YRZA 1FVDA 2RQ8A 3LN5B 1UM5H 1MFBL 4MMXB 4O2EB 1R5WA 2DYSB 5EG6C 5LWYH 1ZT1B 2V2XB 2Z7UA 4OCRL 4P5MB 3A3YB 5FFLA 1ZGLP 4EIBA 2Y2WA 4Y2DB 5ESAB 4YS4A 3QJXA 1MSPA 4LDCA 2PYED 1TZHB 4A6YL 2YQ3A 4QAWA 5DZ9A 1Q1JL 2X4QB 4LF3A 4PV8A 3B5GA 1DVZA 3RX9A 1YNLL 2DAVA 3U7YL 1O9ZA 3QJSB 1X5XA 5DHMC 2RFXB 1JXJA 3CZJA 1TQCC 5HJBA 3K2UL 4W6YB 5B4MC 3H9SD 4QNPE 3C60A 3SCMB 1VB9A 2EIZB 1TJIL 5C0AB 2WZPD 4HALA 1KENL 2EC9U 2WTPA 3VD0A 4AMKH 5I1IH 1WAAA 5ETUB 1S9XB 3OLEA 5LAXA 1T22A 3V4PB 4Y7OC 3PQYB 4HIQA 1FFTB 4UDUA 3RE0A 4M1DL 3WY3A 3IU4H 5IW3A 4LSQH 1FP5A 1TETH 4EI6A 2VQ4A 2Q3XA 3VD3A 4OLZL 5LJYH 2PWDA 1MFMA 3O6LH 2YQGA 3BGFB 3C5JA 1KGWA 2ZJSH 3Q44A 4LFHD 4UANA 4NC1E 1WGVA 3T2OA 4MASA 4AYGA 1SXNA 4K9EL 2B20A 4JFPB 2HP4A 5DWUL 1BD2A 3N41F 3IYLW 4YBHA 4NERA 4WNQA 2ADYA 2AEPH 5HD8D 3GTNA 4KK6C 1F4YH 3BMVA 4FNUA 2YGVA 3QO0B 4Y2LA 3RTQB 3H2WA 3BHBB 5JNYB 1SBBA 4LOEA 1CLYL 5DK2A 1OOAA 3V4PL 2J1ZA 2JK5A 1V55B 1PL3A 1CL7H 1YEDA 2VAAA 1OALA 4MJIE 4DPAX 3N06B 3P0YL 3UTTE 1IGJA 4IHBA 1DQML 4D0DB 2N59A 3QXTA 3DJSA 1BZEA 2UWEF 3JSSA 3T4YA 3VQLA 1J5IA 2F15A 3L3IB 4G6KH 4KJWC 3IJEB 1H3PL 5D5MF 3ILDA 1MFEH 3VSVA 3D4YA 4IRZA 1GHFH 1E9PB 1P7QB 1PAZA 2GTZB 1NCCH 4P4RA 5CP3A 4C54A 5AAWC 3D05A 1IQDA 2VITA 3KS0J 2UVEA 3MRNB 2EYTA 2CRYA 4Q2ZB 4KY2A 5BCAA 5CBEB 1KN2L 3ARRA 4XPGH 4KUCD 2E74C 3CSYA 1DQQB 1N0LA 1BGXL 2EE2A 2W0LA 3QO1A 1N67A 3GMOB 3W81A 1R3IH 2A4CA 4N26A 2A77H 1EHKB 2X4UA 3OC5A 4HD9A 3VH8G 4UTAL 4JQVC 5BUGA 3IN2A 1MFAL 1LEIB 3ZDZF 3VDBA 1OAXL 3BWUF 3HCVB 1OM3L 3WIFB 1UD4A 2JLLA 4FD0A 1DQTA 4Z3GA 5FYKL 2W07A 3FO0L 1BF5A 2UY6A 4RWYL 1NBVH 5AALA 3GMPB 1A9BB 4Z1PA 1A5FL 1TNNA 5C0IA 5L0QC 3SDDB 3T2NH 3UC0H 1A0QL 5CMAB 3OV6A 4MJ6A 3QFDB 3QUMB 2JB6A 2W65B 2D31A 4JVWA 1I3RB 1INQB 1UACL 5F9JA 3CSBA 1KGYE 3WFEL 4N25A 3UABA 1Q0XL 3TZVA 1A6PA 1UZ6F 3MRLB 3QZWA 1FL5A 1QSEB 1INEH 3BX7C 2EYRB 4F33A 4LNRB 1XF3B 5IB3B 3TA3B 3VRLE 4HS6A 4PJ9C 5F7WC 4G9FB 1INDH 1R34A 5D7SH 2YA0A 2ERJC 2DLFL 3CFKA 3KM1A 3KBPA 5SX5H 2GY5A 2VDOH 5IM7B 1JZ6A 2C3VA 4ZFGH 4N2EA 3W0WD 5HHVL 1CR9L 3E6HA 5F1IB 5C0ND 5IR1B 3RFZC 4MLSA 1QFOA 1UGKA 3X3FH 4ZNEE 5IW1B 1YPZB 4Z7UB 4KITB 4P2RD 5G2NA 1ZEAL 3MUZ1 1IARB 1OVZA 4E0RA 4G2AA 5DD3H 2ENQA 4NGHH 3KXFB 1EEZB 2VLJE 4LIQL 1ZE3C 4UT9H 3EGSA 3FUIA 4XPAH 3OJDA 5FO7A 2EH7H 3T0EB 4B9JA 2WWKO 3TJHC 3WELA 4LPXA 1CLOL 3ENEA 4IYKA 3INOA 2WNXA 5FB8B 1JPFA 3P9LB 3NJLA 4GW4A 1KTKE 4QRTA 3NZ8A 5D7IE 3SKOB 1I8MA 1TUPA 1S3KL 4LARH 3UAAA 4Y4KA 1ZJBA 3QQDA 2H2SC 2GJ6A 2UV3A 1UZ8B 3A5VA 3HN3A 2I26N 3L3KA 4R7DA 3VO0A 1KGIA 2QLYA 4L1BA 3B37A 2KI6A 1FPTH 3ECVA 2B9AA 4PWHA 3FCTB 4IRSD 5JHDB 3LNHA 3D34A 2R29H 2FWSA 3WFCL 2Y1ZA 3OQRA 2DQUH 4XR8C 3B9KD 1MJ7L 3MAWA 4XMPH 4CGTA 4GG8B 1SY6L 5HSFA 3AQXA 4LBAA 1E27B 2Q8AL 3C6LD 1OGAB 1VERA 5AAWA 5F72S 4HG4K 2WZ0A 3KYMA 1CI5A 5CFAA 3F5WB 2OP4H 4HIEA 3SGKA 4ENEC 5CD3B 4M8UA 1J8HD 3L95B 4YUEL 4MCYB 3NCYS 3ELAT 5HXMA 3QFGA 4RNRB 3BZFA 2XQBL 5D1QD 4OZHE 3M17A 1NUDA 5SWZD 3T3ME 2KC0A 5I17B 4HS8L 3LH2L 1BMZA 5E08L 4MHHI 2HKHH 1MRCL 5IMKB 1CK0H 2CUIA 3QHTC 4GT7A 4CSTA 4XVTL 3DK2A 4Q58C 2X12A 4UIKH 5KBDA 1QD0A 5GZND 3BH9B 2G9HB 4BFJA 3CLFL 3A21A 4OQ1A 2QSCL 3F7VB 1CXFA 5HHOD 5DLML 4J3OC 3W2DL 1G6RB 4XO8A 1BSIA 1M2OA 3DURA 5E8PB 5J6SA 2W59A 43CAA 2DRUA 3RIAF 3EO0A 1IU1A 1HIMH 4WIQA 2WXJA 4W9LC 4K7FB 4K94L 4JZNA 3UGEA 1CUOA 1L9TA 3QCUH 5ENWB 3MRGB 3JVFC 4RZKA 4PJ9A 5H35B 3T0XA 3VXSB 3RIKA 1JI2A 1R24A 4KI5D 4A04A 1AGCB 2P24A 2XWEA 3P2DA 5EOCH 2Y23A 4QEGA 3R4RA 4WEMB 2JKJA 1RJYA 3FHEA 4MYPA 4NKOA 3D48R 3UO8B 1JPGB 5F71A 2CLVB 3V6OA 4ELKB 3KLKA 5I1AA 4JZJC 1AHWB 3NAAH 3NIFF 4HWBA 4FYRA 1NDTA 4U0RC 2P4AB 5L7XH 5HY9A 5CEZH 4QRAA 1QZ1A 5EZLB 3GXPA 4GXFA 4PJDF 3IKKA 4JREB 3FTYA 2CSPA 4JKMA 1EHNA 4RMTA 5CKGA 2EDKA 1GIGL 3KL5A 4G80A 3JTBA 5GSVA 5C0AE 3RNQA 2VIRB 1N59B 4WWKC 2CHXA 4O02A 1B0RA 4AZ8A 5IG7A 1K8IA 3B9EA 4MAZA 4BGLA 4FQ1H 2CUMA 2O26U 4R84A 4JPVH 5K9JL 1E40A 4I18B 1YEHH 1Z9SA 5KW9H 1PCXA 5IB1A 3ZKXB 2R0ZH 4GH7B 3TBYA 1FLRL 1SEQL 1LO3H 1OTUD 3IFLH 2NY4D 4YFEA 1P7KA 4LF3B 3DROB 1NEZA 4KOCA 4JFYB 2FR4A 5D1XE 2JCCA 3HKFA 4R2GB 1ORQA 2W38A 5IHUH 4CSSA 2CBOA 4Z7OB 3ZKND 2BCKA 4DGVL 1PS3A 2KZWA 3C60B 2UX6A 5AKSA 3ZYJA 1K6QH 4OFQA 5E2UH 1N6QL 4V2CB 4FQXD 1R3LA 3DUUB 3KYKH 3NEEA 1YLBB 1H6UA 4FE9A 1ZS8A 4JDVB 2CO6A 1DJYA 5LAXB 1J9SA 1FL6B 1T22B 4OF3A 5LGHL 2YD3A 3D39B 4OGZA 5GPRA 3IB4A 2IGFL 4CKQA 1FAIL 3H55A 2MNJB 4CVXA 1DCEA 4H25B 1H6EA 3GLEA 1TQBC 5MP6L 2JKRM 4FC3E 4LOUC 1DZBA 4UOQA 3UTZA 1WYJA 3PG2A 3V7AE 2VDNB 3HBZA 3LVTA 3NPSB 3QDJA 4JKPL 3MODL 1XF5A 5GHWH 2ZUVA 3DSFL 5D93B 4PJCA 3DGDA 2CIIA 4ZZKA 5MHSE 1BD2B 4ZFQA 1NEZG 2AK1H 4WNQB 2XCMC 4NYLA 4M5SA 1WAAF 3L3HA 2X89D 5F1OB 2B8OT 3DETD 3W57A 4N8CL 2AMUA 1X7QA 3NZHH 5DK2B 2GCYA 2JK5B 3Q9PA 3SO5A 3SE9L 4V11A 1U95A 4NQDD 3OAZH 3SDAA 2WGXA 2VAAB 2AERT 3HUJE 5IOPA 1IGJB 2ESVE 1VFOA 4QJ4B 1I1FA 3V6ZB 3ZBMA 3VXUE 3LS4L 3W1ZA 2WCSA 3AT0A 1UCTA 3LNIA 3DX0A 3CN4A 1M42A 2F7RA 4LRNL 3K4AA 3EXJA 1QSZA 3VI3B 2VDNL 3ARFC 4H8VA 1DLFH 4ENZA 4ODTH 5BVJA 4BZ2A 4UI2A 1AI1L 2OZ4H 4P4RB 1AG6A 1M9WA 4M5ZH 2OZNA 3HBQA 1RUQL 4HFWB 1IQDB 2VITB 4M7ZB 4U3SA 4WU7A 4G70B 3WXVH 2FUQA 3KCPA 3CSYB 1XF2A 3QO1B 4NFDA 1XV8A 4KKLC 1OP3K 4TNGA 3D08A 1IKOP 2D0FA 3N85H 1OWWA 1KB5H 2PLTA 3HE7D 2X4UB 3QYCA 4WWKA 2OSXA 4XPHL 1I7UA 4J3OG 2J6EA 4QGTA 3NACH 5TK2A 3CZGA 1V27A 2QVFB 3VSUA 4LVHB 1AG0A 3C5ZC 5I1LB 5DZAA 5F7AA 4DSYA 1LD9A 3ARGD 2XDHA 4FQQA 2C4XA 4B9YA 4M6ML 2N1TE 1J1XL 4DFIA 1YCSA 4HIPA 4N0RA 5E6RB 2CO2A 4YXHH 2P48B 4KHTL 5B7EA 2YKLL 4J1UA 3BH8A 4MJ6B 4TQHA 2WXOA 4XX1G 2JB6B 3T08A 4DVRH 3TL5A 1FDLH 4TUJB 2NX5D 3KYNA 5F9JB 3PPEA 4WHTA 1UCBL 2X4PA 1U8PA 3TZVB 3QZWB 2WSPA 2Q8BH 2NLJB 5SX4H 1FL5B 4QXTA 2VXTH 4A7TA 4ONHA 1LO5A 5A2AA 4NN6B 3FT2A 3GLAA 3DIVA 2I60H 2MRYA 3HC3H 4BHUI 4F33B 1WSST 2Q86A 4K23L 5H8DA 3VXOA 1ODAA 3KGRA 4PQXA 4HHGA 3RHWK 3S3SA 3EFDH 2ILLA 3CFNA 3CFKB 4NP4H 2ZXWB 4KKNA 2XZCL 1N2RB 2C3VB 4NNPH 2K7QA 4HJGA 4YK4B 1LO4H 1X5JA 4A55A 1IGTA 1EZLA 1FZKA 2AV7A 3I6SA 2FWOA 1MWAH 5EOQL 3G5VA 4P2OD 2BRRH 3A4DA 4FL4C 3PUUA 4F9PC 3WDJA 3SDXF 4Z7NB 5HVGB 1DP0A 4HJUA 4E0RB 1XWVA 4KXZI 2HJFA 4L9LC 3FQ4A 3EJRA 2JNZA 4NQCE 3UJIL 1NLDH 3EGSB 1IIKA 2H2PD 3OJDB 5AVTB 5FO7B 3GUFA 4E9LA 4JY4A 1BYNA 3TA4D 2ICWJ 3QXDA 4PSPA 1F11A 2GC4C 2IGTA 3ZDXF 3N50A 3FT4A 2JJUA 2NY0D 5F70A 4KKBC 4YQXL 4BSJA 3Q1SH 2VXQH 1X5KA 1L9NA 3NZ8B 1BJ8A 7CGTA 4R26L 1SRDA 3JYBA 2HLFC 4Y4KB 5I16B 3J07A 1VHPA 3QQDB 1MI5A 4IKJA 35C8L 4X6CE 2E7DA 3L3KB 5EIVA 6PCYA 4PTUA 1HN1A 4FXKC 2MCPL 1D5ZA 3LEXA 4KMTH 3RIFK 4HIJA 4ATTA 1OF2A 1D9KD 1UM5L 4GRWB 5CBAA 1IBHA 2XFGB 5LWYL 3ARFA 3BZ4A 4XODA 4O00A 3R8QA 4ETYA 5BNXD 2X53A 4YVNA 4CMMB 2YAQA 3DIFA 3UDWC 3BKYH 2EXSA 1OQOA 4HCRA 4RMUA 3KYMB 5JIHA 5F1NB 2FYYA 4KX8A 1AMYA 4NRYA 1ZLVK 1G9HA 2BIOA 1EGJA 4RFNC 4X7FC 4Y5VC 3BZFB 2JI1A 5D4JA 1QYGL 3K6SA 5T5FH 4UT6A 3MCYA 3L5HA 3P2TA 1E2VA 3S88H 4H88H 2XPGA 1MEXH 2DQGH 2HKFH 1ZPLA 5F96H 3UROR 4EAEA 4L9DA 1KJVA 2IDFA 1HTYA 1NFDE 4GRWF 4HK3N 4D2NA 2WNKA 3IKCB 4AMKL 2W1NA 4KROB 4CU8A 4LESA 4KXAA 5HVHB 4WK4B 2XG4A 4DWHA 5AVXB 1QKZH 1UFGA 3ZU8A 4BSVA 2DN7A 1P4BH 3ULUC 2L7UA 2YXFA 2IALA 1ZA6A 1EHLH 2ZNXA 3IU4L 4LSQL 3PABA 4QAMB 1TETL 4X0NA 5EO1A 3JWNH 2EYSA 5DVLA 5EN2A 1EO7A 3FUMA 3UJTL 3A23A 4Y1SA 1OE2A 3EO0B 5D2LB 3O6LL 4UMGA 4D9QD 3ZHLA 2APWA 5DURB 3CFCH 4NZRH 3UZEC 3V52L 1NGPH 2ZJSL 2JJSC 5D7EA 1SFDA 2MIZA 2NCEA 3QIWA 4LVNC 2XTJB 4OTXH 5EHFA 5CKAA 1QMUA 1U0QA 2NOYA 2CHDA 4PJ9B 3VFMA 2VL5A 3MXVH 1R24B 3MQIA 1R3KA 1N8ZA 4ZW5A 4F7CB 2J55A 3DOSA 4X6DB 1YMHA 1F4YL 4L4VE 3KPQA 4PM1A 4X7EC 3PDOA 4YOKA 2J44A 1EPFA 4ZUTA 1TKWA 5T3ZH 4NT6A 4RAHA 2YAEA 3SKUD 4TNWF 2UZXB 2ICWI 4IIZA 5DF0A 1CL7L 5HY9B 5IHBA 1OL0A 5IROC 4LSUH 3OKNA 4FXGA 1QEWB 2E9IA 2OQJA 3OLGA 5D55A 2QDVA 1FYTE 3RNQB 4G80B 2VT0A 2OMYA 3EDEA 3ECQA 4XBPB 2GI7A 2F19H 3APCA 4G6KL 4O02B 4AZ8B 5J1AB 1MFEL 2IOMA 3CHRA 3OMZA 3P11H 5IG7B 5CD5D 3OSKA 5KWYC 5HGAA 1U3JA 2ZOLA 2WLIB 1NCCL 2FH6A 3MTRA 5BRQA 4WJ5A 3MBWB 2HX8A 5FUOH 4NDMA 3FTXA 4YSQA 1LO2H 1QX1A 1Z9SB 4TVPH 6PAZA 4RGMB 3FNKA 1BZOA 5FA3A 2EJ1A 2PXYD 2C3GA 1KBVA 4L5FE 2YAFA 2VLJD 2HTLD 4W9EC 3LKSB 1P7KB 2A77L 2FR4B 4ZPTA 1E5YA 2JCCB 1J5OL 3HZKB 1IBZA 5JW4N 1FFNA 1ORQB 4P5KB 3STBA 4EOWH 3UTOA 2YD6A 2QKIC 4F91B 4KK8D 2BCKB 4PJ8C 2HMIC 3OX8B 3LHPH 4MNHB 3UCQA 1VCBC 4FG6D 3AROA 1NBVL 2VDOB 5B39A 3PL6B 2C1OB 3MLYH 5DVMA 3UDWA 5CJ5A 1R3LB 2DWDA 1QQDB 3QQNA 3T2NL 3EOYG 4WI5A 3UC0L 1C5CH 4HIHB 5DA4A 4HOXA 2CO6B 5C0BE 3ZE0E 3GI8L 3GBLA 4PJAA 3PHSA 4OZIA 4X6EA 3COOA 3TVMB 3GXDA 1C7TA 1NTDA 4Y5VA 3T0BA 2YUZA 5DFTA 8PAZA 4JFXA 4AM0A 1INEL 2FECL 1BQLH 3WFHA 2JCCF 5FGCB 4G5ZH 1ADWA 1WITA 3ILQD 3MBXH 4A67A 3UTZB 4NBYB 1INDL 4DF9A 1RZQA 1XF5B 2AJUH 2JTYA 3ECBA 3SJVD 1JRHH 4N2MA 4PJCB 5D71H 3VFOA 4F2MA 3LN4A 4MD5A 4XNAA 2VDOL 5CCJA 1RZFH 1E4KC 4NYLB 3L3HB 3WNPA 2LOEA 3LQZB 5FM8A 4DCQA 3X3FL 1JNHA 3BGAA 4LSDA 4ZS6C 3UZEA 4HIXH 5B39G 2YEZA 1U95B 1F6LL 3SDAB 4ELMA 1C12A 5DD3L 2F53B 3UGUA 5IOPB 4NGHL 4OQTH 4UT9L 3F7PC 3P9MA 3NJKA 1OB1A 2EH7L 3HFML 3FU0A 2A5UA 2ARWA 2FJFA 3ZL4H 2NY3D 4MMZC 3EO9H 1BXAA 2L7JA 5BVJB 4J3OF 2XNAA 5D7LE 3INUL 4F9LC 4LARL 3CAFA 4ODHH 4U3SB 5HPOA 3EO1B 3J7HA 4NRZB 2BSEA 5IROA 4BZYA 3EOAA 2FHBA 1CE6A 1E8ZA 3SODB 1XF2B 3EADA 4JY5H 1F1GA 4HKXA 4HOMA 3GZQA 4GBXD 4PRPE 5T1KA 2R29L 2NXZB 4XN9A 1J8RA 4CNIA 4Y0GA 1Z9PA 3TC9A 4HSAC 2FZ3A 3DKHA 4NAMA 4QJ5B 1D5BA 1ZWIA 3VGEA 3WL9A 4FQQB 3EOTH 2BS8A 3OGCA 2X09A 3CC1A 2BNUB 4QLRA 3D0LB 3TIEA 4HOWA 3CDCA 4LASH 4J1UB 3BH8B 3CK0H 1RPUA 4BZ2L 4L8SB 4NQVA 2M83A 1T1XB 3PWVA 1RL1A 1ZVHA 4WHTB 2X4PB 1WBXA 3L4TA 1GC1C 3FULA 4QTIH 1U8PB 3GDCA 3QH3A 4MAYC 4WDIA 2FSEA 1BFSA 4LU5H 5IP4A 5AZEH 2HKHL 1Q38A 2L8AA 1CK0L 3HB3B 2I27N 2P5WE 4QXTB 2ZOWA 1LO5B 4ONHB 4UIKL 3ATBA 2DEWX 3ZE2B 2Q86B 4I3RH 2DY2A 3VXOB 5L9DH 2MMXA 4PJ6A 5G55A 5AB0A 4UB0H 3WFZA 2YXVA 3I9AA 1VPOH 1TQTA 5E2TL 4N6QA 5BS0A 1PF3A 2X5PA 1WIPA 3NCCB 3OG4B 1I3UA 4HJGB 1NMCC 1HIML 3Q5TA 2KZBA 3MUJA 4DQAA 2OTPA 2EINB 3RWCA 4XC1H 2AV7B 1FZKB 2FT6A 3P54A 3V0JA 2FWOB 2E8ZA 4JNXA 2BVPA 3G5VB 3QCUL 1IL1A 1YYLH 15C8L 3EHBB 1KACB 3TXAA 2EDWA 3D9AH 4M4PA 1GOFA 1SYVB 4WVRA 1RUMH 5EOCL 1A4JB 4FQHA 5HYEA 1DSYA 1UD3A 3PP3K 3IPBA 3T71A 4EIZC 4JHZA 4JY4B 3VD7A 4FQPA 1E4KA 3NAAL 2EVGA 5L2KE 2V9QA 3ZKMD 2IWKA 2HAZA 5L7XL 5CEZL 3FT4B 2DWEA 3VWJD 5KTEH 1HU8A 4WFHE 5IQOA 4JHBA 1KZQA 4PGCA 3BQUC 4R96A 1KGUA 3FYIB 1CC3A 3GMQA 4JRLA 2E9WA 4OD1H 5D1ZC 3RPKA 2EVHA 4TSAL 3ATFA 1MI5B 3DIDA 4GXVH 2DH3A 1GYCA 5DVOA 5CFHA 4PW3A 4TRPH 1YN7B 1PYWB 3QDMD 1H0DA 1NMAH 4PTUB 4WEBH 1D5ZB 4KTDH 5I1EL 3LEXB 4FQ1L 5D2NE 3BAKA 4PD4J 4HIJB 1OF2B 3MRFA 3QG6A 4JPVL 4MMZA 5CBAB 3WO4B 4HKZB 1YEHL 3N91A 3BZ4B 1AXIB 5IMMA 4KV5F 4L3CA 2R0ZL 3DIFB 4IS6A 5C07E 2ESVD 5F6IC 1LO3L 3IFLL 3VXUD 2DF3A 2H3KA 1VLXA 4JCLA 4CMHC 3GQFA 4PG2C 2FYYB 4NRYB 4OF8A 1JGLL 1G7HA 2DEYX 4GFXA 4LCIL 2AEQH 4QRFA 5IHUL 2IAMD 4LCCC 1M7UA 3MRDB 3QAZB 4LLMA 1UWXK 1A9VA 4OI7A 1XCWA 2V3FA 2UZIL 5DYOA 4WQOA 4C4BA 2EUVA 3NIGE 3ZT7A 1K6QL 4HHWA 4M03A 1KJVB 3P2BA 3KYKL 4XOEA 4KXDA 3OKKA 3KNBA 4PLKD 2VW4A 1FFPB 2XG4B 2Z8WC 1IAII 1L7IH 1BPLB 2AVGA 1JZEA 3GMLA 4IHOB 5TDOA 4BH7A 4G11A 5GZOA 2Y3AA 3T8XA 4A7GA 2IALB 4WZ9A 1S78C 4IGBC 2D7TL 4JO4L 2ZSWA 5EN2B 2GITA 1F45A 4MAYA 4Y4HC 1ACYH 4ILDA 3R06A 3NH7H 1C08A 1FSKC 2WVUA 4GW1A 4FTVA 1RULH 3DYPA 1CXIA 1H8LA 3QIWB 1LP9E 4ZSOB 4H0LC 5GHWL 5IVXA 3IVKA 1CZ8H 3VB8A 3VFMB 4LSVH 5J0BA 1E8YA 3MJ9A 3WG7B 1R3KB 3SPGA 1N8ZB 5DI8A 3CIQA 1I31A 4G42A 4ZMQA 2O6DA 3FQNA 3SN6N 4PJGB 3HE6D 1KB5B 2JKNA 2XWXA 4EDXA 4OLYH 1XBDA 2ZG2A 3L4VA 3NZHL 3TPKA 5IFHH 1U41A 3VAEA 4MDJA 4BELD 1NANH 2O30A 1HSAB 1SOQA 4KO5A 3WS6C 1YNTF 5FCUH 2NPLX 1QFWM 4FXGB 4BSWA 1KDIA 2OQJB 3ABLB 4I0PB 3TBBA 1NM9A 3G6JE 2Y6SC 4BCZA 2H0PA 4JCWA 2OMYB 3S8FB 3U82B 3CZEA 1ILUA 3J27A 3GZKA 1SLWA 4HZLA 1OV8A 1DVQA 2BP0A 1A47A 2XQYA 5IQ9A 2H32H 1RZGA 1DLFL 4ODTL 2DB8A 3DX3A 3MA9H 1IT9H 2OZ4L 2XXFA 4FTDA 4UQEA 4M5ZL 1TU2A 4WJ5B 4N8VA 4WV1C 5D7JD 3TWCH 4M6AA 4GI6A 3D3VE 1RCYA 3WXVL 4GG6A 1S46A 3LVEA 5FA3B 4I89A 5HYQA 2K6ZA 2I32A 2Y5TA 3BQUA 2PYEA 3QORC 4OKVB 1GKEA 4P0DA 4YGAB 1U4FA 3QDGD 5KANI 3N85L 3SPVA 4BUGA 1KB5L 5CEXA 3WE6B 3TTYA 2CM5A 3NACL 2DS4A 3AWEA 1JNNL 4ACPA 5CZXD 4BRVA 2IEPA 4AKQA 4GS7C 2GIYA 3EGXA 1UD2A 3H9SA 3LRLA 3GEWB 2DV6A 3CN3A 1KIRA 2AI0H 3B8SA 4NBXB 5FUCE 3S36L 2WZPA 5B39B 2DWDB 4YXHL 3MJ6A 5FC9A 2D3VA 2Y25A 5BO1H 4DVRL 3Q8EA 5KS9E 1EZVY 1QP1A 4OZIB 4PJAB 2I85A 2K4AA 4X6EB 3BLBA 1E9QA 1KN4H 4N4YB 1QI3A 4RFNB 1B0GA 4GUPA 3BW9A 5I6KA 5EUOE 2XQYG 3BE1H 3ESMA 1RHFA 2Q8BL 4H1LA 1V3MA 4Z7VE 3L6FA 4AM0B 4GI9A 2VXTL 4BDVA 2QBWA 3WFHB 2VN4A 3RILA 1DO6A 5EDSA 1BBJB 3HC3L 1T83C 4RGNC 2HRLA 2QLVB 3BD3A 1QWHA 2JSFA 2CH8A 2P1YA 1DBBH 4H5SA 1F5WA 2MCAA 4MB5A 3KPSE 1V7MH 2PNDA 2DMCA 5K1JA 3T3PF 3ECBB 3EFDL 1AZRA 2XZQL 4M6OL 2WBJD 2K3HA 3VFOB 4NP4L 4F2MB 2UXGA 3FFCE 3LN4B 4HMEA 5E0QA 3EYVA 1XSJA 4IGBA 1LO4L 1NGYB 1P5VA 1VF5C 4ONGH 5G4MA 2YN3A 3L3GB 4JFFB 5TPWL 4OZIF 1WF5A 1VZGA 4PJAF 3MLRH 1TEGA 1E90A 2IIJA 4Z8FH 1MWAL 3E8VA 3MNWA 1JYNA 1JNHB 2B59B 3LKRB 2BRRL 4KXBA 2R8SH 2DQJH 4WI0B 2J43A 1L5GA 5J1TC 5HI3C 4ELMB 1K72A 1C12B 1P9MC 2FBRA 1H3UA 1IZKA 2IPKB 3N55A 1GCYA 1NLDL 3P9MB 3B2VH 1OB1B 2O4EA 2WXFA 2F58H 1HH9B 1JHKH 2FJFB 3NJFA 5EWIH 3FUHA 3UTQA 4ZUSB 5IJBC 5T5NG 4LKXA 3KPMA 1T0NB 3ASNB 1IC7H 3GBNH 4H1LG 4HJTA 1E6JH 4KKPA 3BFQG 5HHNB 3ULUF 2VXQL 2XOTA 1IGML 5DHXB 5J1SC 3V6FA 3O0RH 4BV1A 1M7DB 2GIXA 3H42H 3KJ6H 2V5SA 4HUUA 5ICXA 4BA0A 1BQSA 3EOAB 3HMXH 5H2BB 1NQBA 2V3EA 1F4HA 2VR9A 4GP8B 4L4VD 2YD2A 4XVOA 4HKXB 4U1LA 1XCTA 4LOFA 2WIMA 3BRGC 4KMTL 2D7PA 5DFVC 5SWQA 1FIGH 5T1KB 4ELMF 3LS5H 4QRUA 3VGGA 2FJHA 3U0PB 1YN6A 3A4AA 2FZ3B 4WTZA 5F1KC 1CXLA 2Z3FA 1ZWIB 2K1MA 3F58L 3HZ3A 3BKYL 3VD1A 2IH8A 2WCPA 1A7QL 1PG7W 1E6OH 4S10A 1VADA 3DDFA 3HNSH 3UBHA 2WXKA 3F12A 3QORA 3TIEB 5AYUH 4NCC2 2CGRH 4KNUA 4JKKA 2DL2A 4P8QA 3NYKA 5CGTA 4NQVB 2ZKWA 2G2RA 5T5FL 4P3DA 3H4HA 5IJVB 4PRHA 1G43A 1WBXB 3ZDYE 4PS8A 3KH3A 4GP4B 2XKSA 3QH3B 4H88L 3S88L 2FSEB 2DQGL 5F96L 1CXKA 2PP8A 4Q9BA 2QGBA 1Q94A 4GAJL 3VNZA 4YSUA 2LE9A 5FKAA 1BCIA 1QKZL 5BV7H 5GGQH 3CSFA 3D5OF 4QRRA 4TQEH 5DZOA 3CN0A 3G08A 1TLKA 1P1ZA 3HAEA 4NFCA 1JWMA 3CVHH 3Q8BA 1QVOA 1AZCA 2O1AA 1F86A 1CF1A 2O5YH 2ALWA 3VFNA 4XE0A 3RWEB 3CFCL 2F54E 3F64A 4WTZG 1LWHA 1SJHB 3QG7H 3QJQB 3F01A 5AL0A 1R1CA 1NGPL 5HGHA 2BVPB 1IL1B 1T83A 2AQTA 4UZGA 3GZPA 1PBYA 1E2ZA 5C0BD 1MQKH 2VLME 4ZRGA 1RXLA 1KXQA 2WN2A 2BWQA 5T1LD 1MCHA 4Z7QF 1KT2A 4W9ZA 4FQHB 2RJMA 1PLAA 1A22B 2EVJA 1EA9C 2XPZA 4HF5H 3BWZA 1U8LA 4YBLB 4X9IA 5E5MA 1VESA 5T3ZL 2X4NB 4GRLC 1N7MH 4MQ7A 2RIKA 4Y8AA 4AEIH 3QPQC 2VDKH 5C08E 3VFPA 4Z3IA 1OAUH 3DO4A 4LSUL 4PGCB 4R96B 1KEGH 3GMQB 5CR8A 1MF2H 5B3JE 3WNOA 2EDRA 1YQVH 3MCLH 3MV9A 2F19L 1CO1A 4FA7B 3QJZA 1F18A 1PDKA 2BIMA 4NM8L 3ULAB 4ATWA 1HOEA 3IGKA 1H0DB 1A8JH 4MA7H 3U2SA 1DR9A 2Y4SA 3P11L 1DVSA 3HAEG 2QV4A 4AJ0A 2O6FA 1S7UA 3BFWA 5HPMB 2BXZA 3B9KA 3MRFB 3QG6B 4KZ0A 3AT9A 4MMZB 3KWTA 5JHBA 5FUOL 1PKQA 3CZKA 4HJ0C 1LO2L 3LKOA 3X1BA 4TVPL 1CICD 5DJAA 5KBLA 4IS6B 1DQIA 5GS0H 2DJSA 1CFSB 5ESQA 1ES0A 2QADD 5J13B 3RA7H 3QCTH 5E7FA 3OR6A 4DFHA 2XXMB 1EDQA 2K3TA 1JV2B 3JV5A 1G7HB 1SVBA 2NNFA 3KBFA 4M7JH 3MCKB 3ASOB 3BPOB 3OHXB 5D7LD 1XIWB 1IBGH 3LHPL 5DYOB 4Y19D 5CGYC 3ZOAA 2OSWA 3MLYL 1SQMA 2IBZX 4D9RD 1C5CL 1L0QA 3OKKB 3FU7B 3KNBB 1RMFH 5HHOA 3WSQL 1SPDA 5EU4A 4QHUA 4NC0B 3GMLB 4BH7B 3VTTA 1RIUH 3IGLA 4ZD3L 4D94A 1BG1A 3TESA 2GITB 1KOAA 3Q01A 2R23B 3L5JA 4LL4A 4DP7X 4G5ZL 4F8TA 3QGVA 5CGBA 5FXCH 3QNZA 5IHZA 1T66D 3JWOH 3D0VA 4A37A 5I74B 5IVXB 4U6YA 1JRHL 3IVKB 1IQWH 3IWUA 5I6MA 3L9EA 2MHAA 3RDTB 3BEVA 5DI8B 3W38A 1RZFL 4G42B 2A2QT 3VACA 4PB9H 3Q6GL 5SV4A 3ATAA 1HCYA 2AXGB 4H20H 2OYPA 3G5XB 1OP4A 4EDXB 3AQZA 5ABDE 5GGTH 5KVDE 2YARA 3SE8H 4MJ4A 4HIXL 4MDJB 4QOKD 1I85C 4JANA 2ZAGA 1YVLA 3GXUB 4OQTL 1RUAH 4PJIA 2YA1A 4BSWB 4WUUE 4KQ4H 5FAAA 3T1FA 1MCJA 3VCLA 4X4ZA 4RMBA 4JVPA 4HZ1A 3MXWH 1DJIA 1DO5A 1DLHA 3ZL4L 1MDAA 3EO9L 4P04A 5C1MB 5IVXF 4HZLB 1DVFD 1Q90A 2LHAA 5IQ9B 1NIAA 1UQSA 4GEIA 3KW7A 2Q7YA 3GM0A 4ZMXA 1TU2B 2OMUA 4N8VB 4PCYA 2ZOTA 4ODHL 5JOEA 4DP6X 4GG6B 4KKCD 3MBED 4PBXA 4AITA 1BZQK 2H41A 4EQ2A 2CE6A 2NY2C 2PYEB 3FQRB 4MNGA 2ZX6A 3ZGIA 5FR3A 1PIFA 2PYFA 3BN9C 3OSVA 4RAUB 2Y22A 2CO3A 1JGDA 2H45A 1H3GA 3CZLA 4JFEE 5FF6B 2NXYD 3BIAX 5L2KD 3CFBA 5KYYA 4HCIA 3CLWA 1XTLA 2XKNA 2EXYD 5I0WA 3H9SB 2E46A 4KH9A 4LHQB 3EOTL 1KIRB 3R4DA 1IKNA 1FRGH 2XYBA 2EDFA 1MAJA 4K15A 3V4VH 2BNQA 2GAZB 3ESNA 4LASL 5FFOA 4AIXA 4JFDE 4RX4D 4QKTA 2EDNA 2XPYA 4GG6F 2LVCA 4NN7B 5DJ6A 3EDJA 3LPPA 1E9QB 5KZCD 4QTIL 4K9JA 4F1SA 1B0GB 4GUPB 5J7CC 1N19A 4LU5L 2F74B 1KF9B 4H1LB 4BDVB 3LTVA 4Y16C 2FK9A 4I3RL 3NMEA 4A63A 4J3UA 4PP1C 1F58H 3JV6A 5FUZL 4UB0L 3REVA 1VPOL 4FQCH 1U91B 3AWGA 2J72A 4U0QB 5AVUB 2JB5H 1ZANL 3QVAA 1HL5A 2GTQA 3MNVA 3EYVB 2BS71 4HHAB 4KKAC 4PGBA 3AS3A 1ERNA 2WOYA 4K3JH 4XC1L 1U3NA 4I7ZC 3MNWB 4NC1C 1WIOA 2DWSA 1V10A 2WVTA 1YYLL 4XN5A 2JKSA 4N0UA 5T5NF 1L5GB 3RWFA 1A2YB 1VFAA 2UXVA 4KDVA 3D9AL 1HHIA 4YBQD 1DL7H 1FNSH 5BZDA 5I1GH 4BKSC 1RUML 4TKWA 4P3WA 1A6ZB 3KGTA 4GIPD 4YZWA 5HHME 3GSNA 4V33A 12E8H 2BNRE 1PG7H 2DKUA 2GKIA 4F7TA 1BFOA 1FNHA 1M05B 3UTQB 4UILH 5IEKB 4IRJC 4KY1H 2F08A 4LKXB 3KPMB 5G5DA 1U33A 5KG9B 4EI5C 1XGTB 2R0KH 1MOEA 4IK6A 3D52A 5GRXG 4HT1H 5E5UB 2HJKA 5IV2A 4HUUB 1YECH 1H5BA 5ICXB 5KUKA 1LE5A 4PN6A 2Y7OA 3IGAA 3O3BB 5D1ZI 3TP4A 3HE7A 4J3WA 1J0JA 1NMAL 2NR6C 2X87A 4M8RA 4WEBL 4U1LB 1XCTB 1MG3C 4IEFB 5SWQB 2ITDA 5L8JB 4QRUB 5I76A 1YN6B 5DCCA 1CJYA 3ARGA 4QCIA 4YHZL 1OT1A 1OP9A 3SKNA 1T80A 2DWXA 4TL5A 1ORSB 4FHKA 2WYTA 3HBPA 1E4XL 5A2KH 3BVDB 3DV6B 3K71A 4ADIA 4DGUA 1RZ8A 3S98A 4ODVH 5KUMA 3F12B 3ZO0A 1OHZA 4G8FA 2AXWA 4E41E 4FG0A 5I9QC 1WC7A 1EAPA 5FDWA 5J56B 2G2RB 5E9NA 2XXCB 4P3DB 5DD1H 2HRGA 4HKJA 1X5IA 2OYKA 3D3VD 4HUCA 1XH2A 4L0ZA 4WGKA 2OSLA 4APQD 5B1BB 4QDGA 1Q94B 3B9AA 2R51A 1PX3A 3N9GH 4M56A 5FKAB 3QBTB 2J1KA 1L7IL 2EEXA 3V6BR 3G08B 4S1DC 2VDMB 1G84A 5J5EA 3HAEB 3EKCA 4CVUA 1JWMB 5FECA 1RY7B 1RHHA 2ICES 1QVOB 2OMVB 2CJTA 2BHZA 4NPYA 3NH7L 2W60A 5K69A 1QOKA 5HGHB 2PPEA 4P4KC 2G9KA 2BS9A 2H32B 3PGFH 3FW6A 1RULL 4R83A 3EOBA 4O4YH 1CZ8L 4LSVL 2VISA 3P0VH 4C58B 3VXTA 1KT2B 2WC7A 3B7SA 4XVSH 5IQLA 2CIKA 4X8XA 1A4CA 3UBXI 5E5MB 5I1KH 2YWYA 4OLYL 3UYRL 2OI9C 1A14H 4P07A 5JA8B 1QSFE 4Y1TA 4K3EH 4IOIB 4LCUA 1DN2A 4P2QA 1F90H 1G87A 3ESVF 3EYFA 5FCUL 3KPSD 4DVBA 4QYOA 4GKLA 1MHPH 2YO3A 4XBGB 1G7QA 2Z34A 2MNWA 3GIZH 3ZTNH 5B3SB 3FFCD 3MV9B 3V5DA 2XUWA 3PNRB 5BPPA 1PDKB 2B0SL 2CJ3A 4IRSB 2YLKA 4WI3A 3U2SB 1GGYA 1XHHA 5CJXC 3E8UH 3AADB 2HFTA 3O2DH 2DM2A 2YBRA 3B9KB 3IE9A 1GYUA 3MA9L 3P1VA 3U4EA 4B5ZA 1IT9L 1SMDA 4IRJA 1UKSA 1PKQB 2DJUA 3LKOB 3TWCL 4MJIA 3C6LB 3UTTA 2ETWA 3TCLB 2PPAA 4H8WH 4Y5XB 3DBSA 4GO8A 5DJAB 3KLHC 1Q9OA 3LH9A 1J0IA 5ESQB 1R75A 2YSTA 3L7FA 1ES0B 4LHUA 2VC2H 3LRGA 5D1QB 3FU3A 5SWZB 4DEPB 1TPXC 2LT9A 3I3DA 1G1KA 1JI1A 4DEWA 3Q05A 4YHPA 3T77A 1OZTG 1CGUA 1YY9C 5JPMB 3K5SA 3F05A 2APBA 2NW2A 2ODIA 3VFRB 5EZPA 1ZHKA 4PJDE 3RVXC 1MQ8A 3NFNB 2VXVL 1DBAH 4NC2B 4U3HA 1NICA 5HHOB 4QT5A 3ZY7A 4F57H 1KN4L 3OLDA 5JW4R 3O6FD 4WKZA 3U0TB 1MNNA 3BE1L 4JFHE 3D8MA 4JHAH 1ZMYA 6TAAA 5E8OA 2XN2A 4NJAH 2FCBA 3ZZQA 5E8EB 3QNZB 1TVDA 2MCG1 5IHZB 1E5BA 3D0VB 1V7ML 3W5NA 4U6YB 3X11A 4LHUG 4KRPC 3HC0A 2G5UA 3BEVB 4JZOB 1SHWA 1U2CA 4ONGL 1WA2X 1J0YA 2VUOA 4MQXC 4OCMC 2XVGA 5I19H 3GHBH