1BMWA

A fibronectin type iii fold in plant allergens: the solution structure of phl pii from timothy grass pollen, nmr, 38 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Immunoglobulin-Like Fold in a Major Plant Allergen: The Solution Structure of Phl P 2 from Timothy Grass Pollen.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords POLLEN ALLERGEN PHL P2
total genus 5
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1998-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1bmwA00
3FT9A 3FT1A 4FERA 1WHPA 4JS7A 2HCZX 4L48A 2JNZA 4JCWA 1WHOA 4FFTA 2VXQA 4JJOA 4FG4A 4FG2A 1N10A 1BMWA 2BH0A 3D30A
chains in the Genus database with same CATH superfamily
3K4ZA 2J43A 1YUHB 5AD0A 4N1HB 4ELMA 2P43B 5I71C 2Z8VC 1YC7A 5BV7H 4X2UA 3H3PH 1WF5A 3L3IA 4MTMA 1UB6A 5GIRA 4Q7DA 3SPHA 4JCWA 1RK1B 3AMLA 4JFFE 4N8UA 4HS6A 1I85C 3D3VB 4XMXA 1JDDA 4KKZA 1QFWL 3M1CA 2ZWSA 3PABB 4B60A 4F7MB 5KSUB 3D34A 3O9WB 3BJLA 1DN0B 4HLEA 3UPAA 4L29A 5HDOA 2PPAA 3HUJF 1OGTA 1IIKA 5D7IE 4CU6A 1YEDB 5ANMA 3RAJL 1AHMA 4FRWA 2VDPH 5JW4M 2EABA 3R19A 1AGEB 2ICES 2ZT9C 1NL0H 5LBGA 3GLZA 3CN3A 3HAEA 4JFQA 1IZJA 1U8PA 4S1DD 1AXIB 1QLEL 2Y36H 4LDOB 4S1QH 1LE5A 4K71B 1JWSB 4POZC 3OB0K 4HKZB 2IGLA 1BXUA 3UTZA 4WTXA 3OHXC 3DJRA 3VG0H 3H85A 3L95B 4P5KB 3RY6C 1W8EA 2F68X 1ZSDA 4NHCH 3WLBB 1R3HA 4FXKB 3ZT7A 3IKCA 3LNIA 5E8PB 4DUXA 1WCBA 4RA0C 4PJ6A 3JSSA 5CJXC 1BQHB 1KENH 4HUXA 4AYSA 3FFCD 1MIML 5IROA 2PYEA 2ZE0A 4RFEB 5IR1B 2A1WH 2NXYC 3GM8A 2HG5B 3HB3D 1GGBH 3FQ4A 2X3CA 1P84K 5AL0A 1CO1A 1PLBA 5F9OL 1P5VB 2V7HA 5C0DA 1KPUA 3RU8H 3DPBA 2IPKA 3QUGA 1QABA 1VCAA 4HIIB 2NUPB 2LU4A 1ZPUA 3BPLB 1A02N 3TBSA 4EI6A 1WBXA 3C5ZC 4WJ5A 3LKQA 1SBBA 3NCYP 1OTTD 4R8WH 3SPCA 2E47A 2YOAA 4KBPA 1T20B 1MJUH 1D5IH 3TBTA 5E1AA 2XWEA 4QNPF 5DVKA 4F7PA 5D8JL 2NXZD 3LXUX 2P26A 4FCAA 4QGYA 4LHJB 3RWDA 4P2OC 5JO5A 4RSYA 3EJYD 3RJDA 5BS0D 1NGZA 2NXYB 3AT8A 1WAAE 4WV1C 3Q8CA 4F3FB 5IEKB 1SYVB 2VJ0A 3NSXA 1L9SA 4JKNA 2Y6SC 3QH3A 4G6KH 2W92A 5DRZB 1DBJL 4BFRA 4HOXA 3SGJA 4BFIA 2EIJB 5TK4A 4K3GA 4LLMA 2WIMA 3QUMA 1IM9A 3CK0H 4UOQA 4YHIA 4K0OA 1E6JL 4CMHC 3UTSA 2EXWC 4FG4A 4UOW1 1F3RB 3NFNA 4YEEA 5I8KH 5HJGA 3GJFK 1X7TA 3FUHA 3B9VA 1U8NA 4P46B 5DWPA 1CD8A 4FQCH 2BZCA 2DIJA 3RDTB 1HHGB 5GZOA 4DJMA 2FHBA 5EU5B 2APFA 3QCVL 3QQ4A 4H0IA 3CU1A 2DYPA 4NIYE 1XD1A 2R0LL 1INDL 1D9KA 5GISL 3TIDB 4OZHA 4FJ6A 3VXSE 3SKUD 3FTWA 4LEOB 4OD3L 3FMGH 2X89A 3ZRFC 2NT0A 4K71C 1J0YA 2EUWA 4GAGL 4NZFA 4GKSB 4ZT1A 2QHRL 3TS8A 4YSAA 4C47A 1KXQE 5CHNB 2XN9D 1SNRA 4DKFH 3IGAA 1I3RB 3BVNB 3U6XS 1NFDF 1ZA3B 1Q9KB 3FRPA 3G5ZB 4FYRA 3QORB 4HUKB 2VR8A 3ZGIA 1XF1A 2FO4A 2COQA 3D5OF 4KI5C 1OHQA 1IAIL 2KZWA 2IWGA 3BP4B 1AR1B 2NY0B 3EOYG 4PJXA 2RB8A 3CSGA 2CXKA 4AQ1A 5CJBA 3PHOB 4P2QB 4WJG3 1IM3A 5J4MA 4B9ZA 3PXHA 4FYQA 4XBMA 2VR9A 4JRXB 4DH2A 3BIKB 4EVNA 2MCMA 1JYXA 4RQQA 3CZJA 3MCYA 3H0TA 2PP9A 2AKRA 3NSFA 5CKGA 1AE6H 1E4KC 3TTSA 3C2AL 4FG2A 3BPNB 4GUCA 3ELAT 1MW1A 3SQBB 4AOFA 1JRHI 4R6UA 1CDIA 4LIQL 4Q2ZB 5IBUG 4DF9A 5JW4N 2H7WA 5BS0B 2VLJB 4RBPK 3VSVA 3L3DB 5BRZB 1DN0A 4IRJC 1THCA 4HWEH 1KT2A 4YHOL 4E5XA 2OXGA 3X1BA 4ZRGA 2BRRH 2O5YH 3MJ9H 3FBQA 4X8CA 3REVA 3U9UB 2NLJB 4DAGH 2OV0A 3M17A 1NAKH 4MCYB 5F9AC 4JRXA 2DIAA 4Z3IA 3OKOB 1ECYA 1EJ6A 3CE1A 3GSRA 4JRYE 4PJHA 4HD5A 2H32A 1QFUH 3GXFA 5BMFH 3KE0A 2BVOA 1U3HC 2O61A 2YAEA 2XWJB 4WWKA 3U1SL 1N0LA 5I1LB 4H8QA 2Q8BH 3FHAA 4XAKE 1XO8A 5JOPE 4WWKD 5D1QE 4KKCD 5D5MB 3HHRB 1J05B 3OSKA 1UM6L 3HB3B 1F1GA 2ZF9A 4L05A 3ARQA 4PGCB 4JO3L 5DDHB 2BSDA 4B9IA 3AY4C 3Q1SL 3IDXL 4GO9A 5MEPA 4ZSOB 1P9MC 4JCLA 4TVUA 1QLEB 1R3JB 2ZX9A 4PJ7B 3ZHNA 1QR1B 3O6LH 3JVFC 4XNAA 3U46A 3MYJA 3UH8A 2PPEA 3BDYH 1EDYA 1IGTA 2C34A 4FGMA 3E3QC 3ZR6A 3DNKA 3CU7A 4H4NA 3CUPA 1JWUA 3ZTJH 2KC0A 4LFHG 5D7IA 3VH8B 3I9PA 1JPGA 5ESVA 5F1NB 4ZJ9A 1RPKA 1E27B 2O5ZH 1R0AL 4QPEA 3D39D 3ILPA 1FA4A 2B1AH 4U1HB 3UJJL 4J39A 4M62L 1HEHC 2WQRA 2B3IA 3TA3C 5CLXA 1H3UA 2QQKL 3RUGA 1OAUL 2XA8H 1MREL 5H94A 2CRIA 2IWFA 2Y7SA 4LCVA 2AEWA 5D7LD 1AQMA 2GK0B 1E9PB 2VKWA 4MA8H 4K5MA 1OCCB 1S8DA 3BH9B 2WY3B 3AWEA 1Y1DA 2FNBA 3SPGA 3VFTB 2OAAA 3HRPA 4NUQA 5CR1A 1JZ2A 3V0VB 3V5HA 4CBZA 1FE8L 3Q2WA 5EO0B 3S3SA 1Q9OA 3FF8A 3TO4A 5LUMA 2O93L 1TYJA 5F88B 3QIBD 2YGNA 2CUMA 4QXGH 2DL2A 5HHQB 2UZPA 1E27A 2GJRA 1CG9A 2I07B 4UI2A 2GUOA 3QUKB 4OCSL 4IU2A 2Q2LA 4PLNC 2CKBL 4N2FA 4FI8A 4PRBA 5AOKA 1J9SA 3QQXA 4AGLA 1ACYL 1N6VA 5BV7C 4PRIE 3HRZA 2J6EL 2YD3A 1MH5A 2BC4A 1Z5HA 2BJML 3FU9A 3BEVA 2X4TA 2R69A 4NN7B 3KPSE 5DJ6A 4EEEA 5IB4A 3GMNB 5JW4R 3D2UB 4OD1H 2X4RA 5EOTB 2ITFA 4B9FA 4DP2X 1F2XK 2CA4A 5FGSA 3UIYA 3VXUE 1EO8H 1YNLH 1VFAB 4RETB 1G9HA 1QEWB 2VXVH 4YSDA 4R26L 2NY3D 2XN0A 1LK3H 4GYBA 2BOBA 4U1IA 4XPGH 3HFML 4HWBH 4YC2C 5AAMC 2QHRH 3WENA 1CG9B 4IOSA 4UNIA 3ARYA 5ECGA 4R7NA 3SDYH 4H88H 3L3JA 4LCUA 4WDIB 5CGYC 5SWQA 5C6TL 2OSXA 3FQWA 3WNJA 3QQ9D 4CC4A 3SCMC 2Y1VA 3BWAB 3O2DA 2PPFA 3BUQA 4R4BB 3S35H 3MCG1 4M1GL 5PAZA 3D8MA 4DP0X 1EO7A 4RAHA 4I3SH 5DYFA 4JGUA 3A6CL 4KRMB 4ABVA 1YN7B 3H2QA 3S5LA 5IHUH 4JM4L 4Z7OE 2MEJB 5DHMC 3LYRA 4LSQH 2ZIDA 3FH5A 1LDPL 2G2PA 3L4VA 3T04D 1D2OA 1HL4A 4I3SL 1EMTL 3VFPB 4G7QB 2DQUH 1A0QL 4OZHB 1QWHA 4YIQB 3DMMA 1YMMB 5DFAA 4E41E 1DQML 4N2MA 2PN5A 1CFQA 2E8ZA 3FO0L 5F93C 4H1LG 5C0CB 3KJ4C 4KK6D 2EO7A 3MRKA 5IGXL 3NK4A 5LBVA 4MXWL 3TV3H 4U6HA 1AH1A 2OLDA 1CK0H 5HVGB 1QRNA 4JG5A 4KRLB 4LMQI 5FECA 1ZA6A 2H6PB 2JCWA 2ZWZA 2WXQA 4HULB 3QDJA 4G9DA 3BKCH 1T03L 2OMVB 3QDMD 1Y6KR 3LEXA 2DM7A 4OLEA 5AZEL 2JJWA 2P5PA 2VSMB 4FE9A 5TE6H 5ITFA 4OM0H 4TUJA 3J27A 5DS8A 1UKQA 4JB9H 1ZMYA 3P40A 1R46A 3QWNA 4OLXL 1XXFC 1T83C 3AREC 5DHYA 3MTRA 2YR3A 4PJXE 3BDYL 4FNPA 4GP5B 5JOEA 3EO9H 1XZWA 2R9HC 1S2EA 3WEBA 3CPLB 5LCVA 3ULUH 4ZO7A 2Z8RA 3SJVA 2WZ6A 5IFAL 3D1MC 1QR4A 3KL3A 3HZYB 2CJUL 2DW5A 2XV6B 1KBGH 5KSBB 4AXWA 1XB3A 3I6LE 1WAPA 3ZTJG 1MCWW 1QQDB 5T5FL 4OD2A 1R0AH 2PXYC 2QFRA 4BUGA 1MW3A 1PZAA 3MLRH 2XVLA 1AHWC 1S9WA 2X09A 2WSDA 1BGXL 3UX9B 5F44A 3TBCA 4TLSA 1WGOA 3U83A 1GSMA 1NMCC 3TGXA 5EZIH 3SGKC 3STZA 2NNAA 5SWSA 2ENJA 1YPZB 3BIBX 1CDUA 4E5XB 1U9KA 1NCGA 1WYJA 1DZ0A 4WI4A 1EHXA 4H1LB 1LK2B 3BAWA 1E9QA 1WAAA 3ULVC 2WBJB 3K6SA 4WI6A 1OQOA 4L3ED 1DBAL 2YEVB 1JSYA 1OB0A 3BHBB 3P9LB 2DQ6A 3G5YA 3GFUA 3UG3A 1ET7A 4I9XA 4IOIB 3IDYB 3T2QA 3V6OE 5B7MA 4ZMZA 2FX8H 1UJ3C 3L8QA 3Q2NA 4NWUL 2CBOA 4G7VL 3JBG7 4Z7WA 3IFPA 4WI8A 5D70L 3KWUA 1P7QB 5GGSB 1YEIH 2VDLL 2CZNA 3N41B 5DGRA 1HH9A 1BXAA 1FZJA 4LQFH 5I0XA 2C8NA 4Q9QL 3GZOA 5AOIA 4TXVB 3EFOA 1XIWC 5C0CD 1JZJA 1AP2A 1WZMA 3MNZB 3QWQB 2YXVA 1SRDA 1IFRA 5GGUB 4JRYD 1KIPA 2R8SH 3JTTA 1JWMB 5FW6A 5LDUA 2KLTA 5E00A 3CZEA 1HHKA 1A4AA 1A6UH 2EZ0D 4PU2A 4UT6L 1ZTXH 1CFMA 1X5YA 5D4HA 2BP5M 4FQXC 2VWEE 3PNRB 4FA8A 4KNQA 5J5EA 3KWWB 3KNBA 1U8HB 4ALAH 3BO8B 2H1PL 2IDUA 1T6BX 4GRLC 2VSCA 3AADB 1BZOA 3BEVB 3FOMB 1IQWH 2FLRT 3ZHFA 2I85A 1USZA 3L81A 3KDPB 4FLSA 4G11A 4LU5H 1J1PH 1OZUA 3OAUH 1F4XH 1KELL 2QR0B 3ZZSA 3F7LA 4AYDC 4Y1AD 4MA7L 3A6CH 2AXFA 5JXED 4I8DA 3SD2A 4P4RA 4MJID 1RSFA 4XCYA 2F54D 2BMKA 1KJ2B 4FQHA 1A4KB 1KYUA 1XL6A 3CBJB 4M43L 3BZEB 2QFPA 4AM0A 3FU7A 4NP4H 3T0AA 3ZDYE 4PN6A 4A63A 2BP0B 1SXSA 3I6KA 1VKXB 4F8NA 2GBAA 1TEFA 3ABKB 5CCKL 1SGKA 1QYGL 2NQDA 3FO0H 4G42A 4WJ5B 5HY9B 4MAYD 2EDRA 1HZHH 3FCTB 3FB7A 3SBWA 3JWDC 1JK8A 3LIUA 2BDNL 4IRSC 5HYJB 2XPGB 5I1KL 5AVUB 3PWNB 2H26B 3FT0A 1CE6A 1GJWA 3HR5B 4LBAA 3V8CA 1Q0YH 3RTQA 3C5JB 1D9KD 2NDFA 4OSUH 4MBRA 5D1XB 1Z5LB 1OD9A 2UXVA 4XCYB 1FFTB 3CZFA 3IWUA 3MFGB 4MGXA 3KCWA 1CI3M 4MFHA 1RUAH 4TNWK 2P8PA 4NUMA 5AG9A 5HHVL 2ZUXA 2ZKHH 3WFDL 4BDVA 1UADC 1WZ1L 3VXSD 5EOQH 4LZKA 43C9B 4F57H 2BWDA 3CFEB 2CCLA 3ARDD 4JQVA 3V7AE 2YSSB 2Z92A 1ZLVH 2NUPA 2F19H 2ADYA 3L48A 5KW9L 4V1DB 3WUWG 1ID2A 5JQHC 1WPCA 2HJKA 4I48B 2VJ8A 3MLRL 3ECQA 4KAQH 4L4TE 5C97A 2ZOKA 2OR8A 1RUPL 4OIIH 4U1LB 3P73A 3FF7A 1OK0A 1OTSC 2YEQA 3AUVA 1EZVX 8FABB 1FH5L 4IBQA 5CO1A 5IJBC 4HMEA 4G6ML 1VDGA 4DPAX 1BLNA 3DRTA 1U8MB 3G6DL 4O58H 2HKHL 1RZJL 2JKWA 4KFMA 1C16A 4BQ6A 1SEQH 3B7YA 3L1OL 3L3KA 1S7UB 2IALA 4XWGH 4JRXD 1MHCA 4LHUB 1T7VA 1MELA 3JV0A 1X44A 3LPFA 3G7TA 2BHZA 3SSGA 4O4YH 4IIQC 3SE3C 4M61B 4MLSA 4XVSH 4G5ZH 3PV7A 4XODA 2XKNB 2ZSVA 5ADOH 1KXHA 4L8CA 2EVIA 1P4LB 5DC4B 4GRWH 4OB5L 4DUVA 3P3SA 2VR3A 3O4LB 3V6FA 3OXRA 1UWGH 2KDYA 1QHOA 1UM5L 3GSXA 3NDYE 2CO7B 3P4OB 1I7TB 2R59A 1TJIL 2Z31D 3QIWA 1A4BA 4DNLA 3OG6B 1YAZA 1GGYA 2LVCA 5E8EA 3VWKD 1C7TA 3NCFB 4MQXC 3R4RA 3X2QB 4OB5H 2C4FU 1K5NA 3TEWA 3MRNB 3D3VA 1UZ6F 1YMMD 3MA7A 1UM5H 4A7TA 4M1CC 5BPPA 4PR5A 3NZ8B 1DDHB 4PJAF 3PWPA 5DJ8B 4A7VA 2N7AA 3WELA 2VAAB 1U6AL 2B14A 1F6LL 5GRYA 5AW1B 2BS8A 2D8KA 4OFDA 4ZMOA 4MHHG 3PL6A 4LOUC 3QORC 5FYJH 2GIMA 5B22A 1D7CA 4Z78A 1MEXL 1W0WB 3ZL4H 2HWZH 4XGZA 1D5ZA 1UKTA 4DGWC 5E2JA 3ARGC 3F65A 4W68A 4LKXA 4MSWB 1S7QB 2QKIC 1HT6A 2A0LC 2CO6B 3LCYA 1ZSDB 3QG6B 1MVUB 4UANA 3GSRB 3PWUB 3RHWF 4OF6A 3SDYL 3U4BL 1BWMA 2R8SL 4Y19E 5DJZB 4FHJA 2DQGL 1DDHA 2XXMB 1JZFA 4LL4A 3BAEH 2NUTB 5FO8B 2GAZB 3QR1A 3K2UH 3KLHC 3RUGB 3DJSA 1TMQA 2CLVA 1AIZA 1TTGA 3IJSB 3ASOB 2AJVL 3HI1A 4NFDA 4ZAKD 4M8QA 4GXFA 3FQNA 3VFNA 2FVNA 4V2BA 4F58L 2YK1H 3Q6FB 5HHPA 3EJTA 4Y89A 1XGQA 3MXVL 4G70B 3T2LA 2EEXA 4DHLA 5TGBB 2WTPA 5GZOD 2R27A 3DK2A 4YBHA 1SXBA 1UA3A 2ZKMX 3VFSA 4AL8L 1YEEH 5EO9B 4XI5C 2G75B 4TTGA 2CLZB 5GGSA 2ZWNA 4KITB 2OCFD 4MXQD 3ATAA 1PEZA 1MZZA 2VERA 4RISH 5L4IA 4G6JH 2BY1A 1CXFA 5AZ2H 2B0SL 1KGCD 1EFXB 4FULA 1QHQA 5CS7A 5B7FA 1KCVH 1G1KA 3MUHL 1PDKB 3CGTA 2Y23A 1ZLUH 3X11A 5FDWA 3QIUB 5BVPH 2PYFB 5GS2H 5JHDE 3AQDA 1PZCA 4F3FA 2KZKA 2CNYA 3PDOB 4TF4A 4XAWH 2B0SH 1Q9LB 1J8HE 1TVBB 2R7EB 1B9KA 1DBKH 1CXKA 3Q9PA 2XQBH 4KKBC 2GABA 4KXZH 3VJ6B 4EIBA 4NPJA 4X5RA 1N7MH 4KKRA 2Q7YB 4RBPH 1TT6A 1VZIA 5MEOB 3MRHA 3N85L 2BNUB 3OGCB 1D6VH 5EULV 4BGDA 15C8H 2YGQA 3EJJX 3SE4C 1TFPA 4FD0A 1WZKA 4FZEH 5IBLC 3S5LG 3WO3B 3GZPA 3ZKSD 5E6YA 1PVHA 4S1RL 3I6SA 1BSIA 2Y7NA 4HS8H 3TBWB 4MQ7B 4JFQB 4PW3A 1KEGL 1IKFH 2GSMB 5M7QA 1BAGA 5DU7A 2X4NB 2Y3NA 3MROA 2WWKO 1X5XA 3U1SH 5C9KA 4YSSA 1SXAA 3GI9H 4PCTA 1QNZH 1X4ZA 2A74B 1BGXH 1MCSA 5I82A 2C3HA 1E43A 2P7TB 2AXGA 3GRGA 1CC3A 1JPGB 4NUGH 2VH5H 1XQ4A 2VTFA 5ESVB 3SBRA 4F15B 3DOIA 5I6KA 1A4CA 2WXNA 3RFRA 4EQ2A 2AABL 5HPMB 1R3HB 1FHGA 2R4SH 3FTSA 4L9LC 2JIXD 5ACMA 3PWLB 5KOMC 1KCSH 1Y7VA 4OKVB 5A7BA 2CUIA 2V5MA 3IGAB 2A9CA 5F7FA 5BOJA 1A64A 4X6FB 4KJWC 5FA4B 1A6TB 3VRIB 4PLOB 1TJIH 3TT3L 3LIZL 4YDJA 4W9EC 3TL5A 5ETUB 4CVUA 2J5LB 4S0SD 4GQZA 4N5ED 1AGFB 1C5CH 1T4KA 3WEAA 2NNXA 1OVZA 3ZDYF 5H2BA 1NC4D 5KSVB 4EDXB 2O26U 1JD7A 1F3JA 1J48A 3IMVA 4KDWA 3MRGA 5ANHA 4PV9B 1U8LB 2J1YA 1PG7X 2JI2A 4OGZA 1R24B 4WFED 4M3JA 1P4LA 5HHQA 1FO0L 1MCWM 4EUPA 4GG6A 2JCCB 4J27A 4HK0B 2IFFH 2J8UB 3MN8A 1TTUA 2NX5E 4L9LB 4X6CF 1AANA 3C2SA 4GFTB 5FHAH 1JNNH 3QJXA 4E9XA 4XXWA 1F42A 3GI8H 3D48R 4ORGB 4F1SA 4F80A 4K73A 3NAAH 2ICWJ 3IS1X 1MQKH 3IJHB 4HUVA 4FZ8H 2JIXB 5KSBA 3G6JE 3EADA 2C1PA 8FABA 3O0RH 3CSYA 2VRAA 3U30C 4BQBA 5K59E 2NY5H 1B4JL 2QVFB 3L5JA 4UAOB 3MBWB 4QRRA 1T7XA 4PJ5B 3CV5A 4HV8A 2HH0L 3VQMA 5FM5M 3RWFA 5I1JH 1W0WA 1TYEB 4BBWA 5MENA 2E59A 2NY0D 3M8OL 5C92A 2X5PA 4F7EA 4FFYH 1KN2L 3NFNB 4OF7A 2O61B 4PJ7E 1IAII 2HTLD 4K9EH 1U2YA 3O6MH 3VM5A 2HRPH 1EZLA 4XPAL 1SOQA 2VDOH 1W91A 1MVUA 2G9KA 3EKCA 3F7YB 2OJZH 2YQ2A 2E56A 3B4NA 1ACXA 3QJHA 4LSQL 3PL6D 1HZHL 1U3HB 5T5NG 2DLGA 3PP3H 1YG9A 5LQBH 1VA9A 2F54E 3O3EB 4MJIE 2BCKA 1E5BA 5BQDA 1DLFH 2VABA 3FRPB 2EIKB 4QIRA 1VGKB 4J3WA 3GMRB 1SJVA 4JN2B 4X4ME 4NN7C 1RLWA 1N6UA 1AR1D 1DLHB 2W9DL 5C08B 3FAXA 4PG9A 5AD0B 3MLVH 3NH7H 3C5SA 1WA2X 4KJPD 3EZ8A 4Y8DC 2XX0A 1JTOA 1DJGA 2WBJA 5H37G 4YO0B 2Q0ZX 1QP1A 1FL5A 1LO2L 1YQVH 4R4NC 2QDVA 4WFFD 1V05A 4ODHL 3O45A 4MQTB 4DP4X 1WT5A 4FFZL 3V0VA 3MODH 5CD5D 3DJ9A 3R0MA 4NWTH 3LN5B 5GGTH 2UXGA 4JO3H 3VGEA 1HU8A 2YWZA 1T1YB 1WBZA 4JPIB 2B4CL 5E99H 2GITB 1BFVH 4AXWB 1NMCB 2A2QT 2FJSA 4EO5A 1H6FA 1RJCA 4A7QA 1ONQA 4DN4H 2NY6C 4QCIA 3ZKXB 3T0EC 1CFSA 3O2WL 3S4SG 4ZOCA 4G8GE 4KXZI 1NCWL 3KL5A 2XYBA 5LN4A 1GTFA 1ECZA 4QRRD 1RP8A 4F7TB 4ZAKA 1TOXA 3WEMA 1A6AB 4AGNA 2ZSWA 1UD5A 3H55A 3IFOB 4ZPVB 1UZ8A 4MYPA 4Z7WE 3CMGA 4TUOB 3BLKA 3EH4B 2KYIA 3VRJB 1T1YA 5FOBA 4V33A 1ROCA 4RRPG 4FTVD 2GITA 2FQGA 1SJHB 1WFIA 4LBEB 4EUPH 4QRAA 4U4IA 3D06A 1DE4A 5EZOH 4QHUB 2QPFA 2Y0SA 4BSJA 3FTGA 2G2NA 5EZIL 2WPGA 3TP4A 3V6OC 25C8L 4M29A 3AQZA 4AX3A 2L0DA 3QPXL 1TIUA 4OT1L 3SDCA 3QI9D 4X6BB 5DZNA 5L9DL 3IMRA 3NGBC 3LKSA 5EU6E 2YMTA 1MUJB 2DJSA 5AKSA 3VH8A 2NR6D 1UWEH 3VSQA 2YLKA 3D4GA 4GAYA 1BF2A 1U8QA 4MX7A 1JK8B 3G6AA 1OE2A 2HAZA 1KOAA 3BGAA 4JR9L 1A3RH 1SJHA 5D1ZI 1FGNH 2EDXA 4ISVA 4KMTH 3E8VA 1HHIA 1FNAA 1OALA 2QGCA 2DBLH 3L3OC 1A6PA 3QIWC 5DD5H 1I8MA 2UWEE 4KHTL 4N25A 4KK9C 3OGOE 4U6HB 5CILH 2QKIA 1J1PL 2BVPA 1M6UA 4XVOA 4TSBH 1PZSA 4TUKL 5AVWB 4YXKH 3CCHA 3L3JB 4U1GC 3TCTA 5F6IB 3N41F 4JFDB 4YK4C 5D72L 3S37X 3WFCL 2AGJH 1RURH 3PL6C 3DGGA 5CUSL 4JG0H 1BIHA 4ZPTB 1ZTXL 3VI4E 4P5MB 1RZJC 3VACA 3NA9H 3FRUA 3IRCA 1B2WH 4WO4A 1DSFH 4XC1L 1OAZL 3D2UD 1UWXH 2W65B 3D07A 1L6PA 3BE1L 3V4VB 3TBVA 3QULA 2F7IA 5FF6B 3ZRSA 3H54A 4G42B 5IQOA 2QSVA 1MH5B 2BC4B 4CU7A 4I2XA 5JHLH 2A5UA 4QRTB 3VFVA 4EUPB 3RWCA 2X70B 3O6FD 3RVTC 2WB1A 3PAUA 1Q0YL 3TZVD 1A4JB 4UU9A 2JB5L 4WEUD 3TNNA 4OGQC 1YEJL 1LP9E 1KGJA 1PKOA 1FFNB 2XTJE 4PB0H 5I15H 1ND0A 1LD9A 5IGXH 1I1AD 1YPZE 1MIEH 3QRFM 3GEWB 4XN4A 3B6SB 4PUBH 4HUVB 3L3KB 4G6FB 2ZOOA 2APSA 3P2BA 2G5BB 1VCBC 2FSDA 1VGKA 1ZVSB 3C8HA 3FOLB 5FGCE 4ZW3A 1A8JH 2IV9A 3C87A 3GMRA 4N2LA 4XVUD 3C2AH 4YGAB 2DLTA 1TZAA 5E8NA 2H8PB 4B95C 4I3GA 3DV6B 5I1KH 4OZHE 3MV9B 3JZYA 3MA9H 3HVNA 4M5YL 3LN4A 4WI2A 4NBZB 2ZXAA 3CFBA 2BPBA 3UGXA 1WQVT 1L4IA 2CO7A 3HFFA 3KCPB 3P4OA 2OZNA 5G4OA 3UO1H 1ICTA 1GGCH 1N68A 5C0BE 3LH2H 5DI8A 5DZ9A 4AV4A 4EJ1C 4QXTA 1CZ8H 4UINH 1BD2E 3PXLA 1CMOA 5GGRY 3NEOA 1OAQL 2VOTA 1F86A 1LO2H 4XHJD 3H8NA 3E2HB 5DJ8A 1MCFA 2YN5A 5F7LB 4U1JA 4JKLA 2I24N 2I5YH 2IAND 2HTKD 1JGUH 4F7CA 4OLUL 2XQ0A 4M8UA 4QLRA 1A22B 2N01B 1F6AB 1XH3A 2W0FB 4KJWD 4UOJA 4XNBA 3S5ZA 5D7LE 5E00B 2X4SA 4HMCA 5FYJU 4DGUA 2R1XB 4B97A 3TV8A 3QDGE 3QFJB 1UD3A 1S78D 1U58B 3EGDA 4Z7UB 2WJ5A 3F3HA 2EUXA 2TRYA 2ZNXA 4LARL 5IMKA 4ZZKA 2ZX8A 4DCQA 5L2KE 5D5MA 3I9GH 3PDOA 3EIFA 1MCIA 2YA2A 4YSQA 3C5SB 2YD4A 5HGGS 1U8OA 2JKXA 3AJ7A 3ZX1A 1HKFA 3ABMB 4BZYA 3QA3B 5GRJL 3SBWC 2OCCB 2J12B 2GTZB 4I9WD 4JKWA 1SY6L 4FQQA 1MY5A 1YEGL 4XNUL 3MA7B 3HZYA 1F45A 3IJ8A 4GUQA 4HEME 4DKAA 5KJRL 1BZQK 1IGCL 2DQCH 3QUZC 1W15A 5MI0C 5TGBA 1U58A 2LFGA 1JNHA 1RVFL 4N24A 3QUYB 2CUHA 1ZHKB 3NACH 4JRYB 2BY2A 3NCEB 4ETQA 2Q3ZA 1OAUH 3PLYA 3N1MC 2B7DT 1LO3H 1KNOB 2V7NB 4BSVB 5F7DA 2C1OA 4KDVA 4DSYA 3K5SA 4F1ZA 3V0GA 3D0AA 3OKDB 1A6WL 2UZIL 2EINB 5I1JL 3QA3A 2QVTA 1SYSB 1YO4A 5HDBE 3O2DH 4IRSB 5I28A 3MZGB 5LVEA 4DPCX 4WO4C 2AK4D 1H6EA 4W81A 3WKNA 3SQOL 3MRPB 2F61A 1YY9D 3RPBA 3B2UD 5E6SB 1QNIA 2JKSA 3NTCL 3NJGA 1JNHB 4LASH 2UWEF 4TV3A 3UYPA 4BM7A 3KW7A 3O6FC 3QUYA 2AS5M 1L3NA 4XN8A 1J5IA 4D0DB 1KLFA 1CL7I 1ODAA 2OQJB 2EDHA 1UFGA 1SJXA 4HS3A 3RIAF 4TTDD 4ZO9A 3LSOB 5GS0H 4ZUUB 4FQIL 4N0YH 2HJLA 1IT9L 1ZLSH 1DE4B 3WJMA 3ZUNC 2WN2A 4QKTA 3Q13A 3SPIA 1PJ9A 2ARJB 5EWIL 2BNQA 1VFMA 2X4TB 3HKFA 4J4PD 3P3RA 2J1XA 3BYYA 1JTPA 3ZE2F 3F62A 2RQ8A 1BXXA 1G94A 2XJKA 3MRDA 1BP3B 1C08A 3LV3A 2R4RH 5BVPL 4D8PA 2JELH 3LZFL 1DJYA 5AVVB 4P5TD 3LMJL 3UYPB 2WBWB 3G5WA 1KDIA 3A3YB 4DETA 1G6RL 4IKJA 4XPBH 3K0YA 3MLVL 4AC4A 4KX7A 1TNMA 3MJ9L 3TC9A 4OZFH 1JD9A 4IS6B 1WV7T 2ODIA 3LQZA 4P3CH 2B3RA 3AG4B 6TAAA 4J4PC 3QDMA 1K4CB 3M1OA 3LH2L 2YGVA 4NN6B 4FNLH 5GRUH 4LCIL 5IHZB 3RHWK 4XX1G 2Y25A 3AG1B 5I74C 1JRHL 3JYCA 2VW4A 4HU8A 1DQTA 1A7RL 4ZS6C 3MRRB 2D73A 1T1WB 3OTTA 2HUHA 4OZGF 1BEYL 4CJ0A 1TZIA 5E8EB 5FV2A 1OD7A 4PV9A 3L16A 3ZE0E 2RACA 3KMDA 2VCOA 2Z31C 1MJJA 3TJEL 4YSEA 2XC8A 1REIA 5JXEA 3R06B 3ARGA 1HYSD 3VXUA 1NBZA 1OWWA 2VDQB 4GOSA 4PGBB 2JB6A 4PJFB 3QUXC 3RTQB 2X1PA 4RSVA 2HMIC 2FQDA 3DA0A 2K3HA 1GGCL 3VGAB 4Z77A 5LGJA 3LDBB 3SGDH 4ORGA 2AK4E 4JFFB 2CDEA 2AJ3A 1OK8A 2APBA 3QDJB 4HETA 1UT2A 1Z9OA 2OFQA 1WIPA 4KZCA 2FX9L 4Z23A 3TNMA 4GSUA 3L3GB 4N0UE 3V0EA 3DRQA 2I5YL 2W9EL 2WQUA 1HCFX 2KPNA 2WK2A 2Z91A 4PJHE 4PPTA 4BH8A 5DRNB 4EN3C 3F5WB 3VXME 1XGRB 3MFFB 5LCVL 4RGND 1ZRUA 2PCPB 4OCYH 3QRGL 1P4IL 4NRXB 1E67A 1H3PL 4Z9KB 3GBDA 5DHYB 32C2B 4JFHD 4P9HH 2ATAA 2A9NL 4Y5YB 2GTQA 2GFBA 4PJ8C 3VB9A 3IJ9A 2EYRA 3X3FH 3IGLA 1KB9J 3K72A 4OV5A 3F7YA 1KCUH 2E7LA 2HA1A 4ZXBD 4Y88A 3GF8A 5DZPA 1KGWA 1HNYA 1L5GA 4L2YA 1DQKA 3F58L 4L9LA 4Y4HD 1VJSA 4IDLA 1FE8H 4IOFC 4AYEC 3EAKA 2DEYX 4OKDA 4XH2A 3GI8L 3B2PA 1E28B 2YGPA 1D5BB 4RGMC 1U6AH 1C5CL 2MPVA 3O4OB 1OP3K 1MQKL 3C60C 3ZOAA 3Q3GA 4NKIL 5LJYH 5CZRA 2AAVA 3BKJL 4OGAD 1BD2A 4EOWL 2EO1A 4XGZB 4GSRA 1A7NL 5DMYA 4HKJB 2C7UA 5MERB 3CSYB 1YNTB 3OD3A 4YHZH 3HMXH 1Z1WA 3X11B 5TQ0L 4B9JA 1YDPB 4IRZA 1R19A 5ALBL 2NY2C 1DQLH 1T1ZA 4M6NL 3WNMA 4ODSL 4NBYB 1GZPA 3ZLQC 5DEGA 3TBYA 4BINA 1WFTA 3GBMH 4IRSD 3P4MA 2VDLH 3RGVD 3SHSA 5F7EL 4X9GA 4LT7A 2J8UF 4IBYA 2GCYA 1EERB 1UYWL 3NAAL 2DY2A 4W9FC 4BA0A 1G9EA 1PSKH 1FFOB 3MRHB 2CRMA 3HS0C 1F3DJ 3O2DL 3PGDB 3SDCC 1BD2D 5FOJA 2G3MA 3QYMA 3VFGH 3NABL 1IC7L 4AEEA 4POUB 5E9DE 4RFEA 5LBSA 4GAGH 4ZX5A 1AGDB 3OJVC 5DJ0A 1FAIL 3D7PA 2X9ZA 3N43F 5DJDA 3OWRA 2DKMA 1IC7H 2GB2A 3B7UX 4D9RE 2WOYA 3FU3A 1OM3L 1DJHA 4NQCB 3L3OA 5JPMB 1QX1A 2I69A 5HHOA 5IKCA 5IMOB 1G0YR 1XSOA 1FNSL 4GQQA 2X40A 4GNKB 4K5LA 5DVLA 4FNQA 5AVYB 1FPTH 4OUUA 1OY3B 1NUDA 1LNUB 3FH7A 4WI3A 4BK5A 4NM8H 2E46A 2RIKA 1AI1L 4KK8D 3S6CA 1EX0A 3I2CL 2HLFC 4YSTA 1I9IL 4M48H 4PJAE 4KUZL 4GUOA 3R7QA 3BQVA 1I8MB 3VI4B 3D25B 1TJGL 5CP7A 5EUOE 3C9NB 3DX8A 1H9VA 4J3OH 4KK9D 4I18B 1BF8A 4NEHB 4CVZB 2VW6A 3HUJE 4ZFGH 5HHOB 4N8VB 1JI2A 5DJ2A 5KVGE 4LIQH 4XVTL 3GDCA 5JR1L 1NGYA 5IFHL 5HY9A 2BP8B 4L5FE 1GVIA 3WG7B 4QHKJ 5CJ8A 3B8YA 2GJZA 3BMVA 5L4FA 2YOCA 2QTVA 4OLUH 1K8IA 2R1WA 3B2VL 3EHBC 2QPEB 3ES6A 4LAQL 1HHGA 4AM0Q 1G9ML 2LVEA 3UTQB 5CU5A 2PUQT 3KPSD 3A23A 4ODHH 3LVEA 4UDTB 3DO7B 4IK7A 2AF2A 3B2VH 1FV1A 4PLKC 4ISVB 3EOTH 3UAEA 4K5OA 2NY2D 2R69H 2WM0A 3DHJA 3LZQA 3WEXA 3X13B 3LRHA 5DJ2B 1RIHH 4NQDB 4XTRC 5A3ID 1MCLA 4XP4L 5LGJB 5IY5B 5KANG 1ND0B 4FP8H 3QCTH 2EDFA 4I0CC 5G5DA 2VW7A 4HIEA 4M7KH 4J12A 2DKSA 3EDDA 3IETA 4I85A 5I66A 2LFEA 1AS7A 1CLOH 2GIXA 3CCHB 3GMOB 4TPRH 3VI3E 2WINB 5I19L 4WVRA 2F58H 2HLAA 1JF6A 4UAOC 2R1WB 1K8IB 5F3BA 5SWZE 5KN5B 1WCQA 4H8WL 4LVNB 2MNJB 2WGNB 4H40A 1CDHA 5DGQA 4EPSA 4IBTA 3RURA 1E8WA 3FCUB 3SB3A 2OJEA 3BAJA 1G7HA 3OXSA 2W65A 2R39A 3F6JA 3CFCH 4Q74A 3WEXB 5DA4A 1PGRB 1ZT4A 4PJEA 3APCA 4XBPB 1F13A 3C8DA 3QUXD 4ZS7H 1WSST 3PQYA 1F0LA 5DMKB 3K5RA 1HH6B 4YBQD 4CDHA 2X2IA 3ECUA 1MFCL 3IU4H 4XMUA 1NBZB 1YY8A 5EBLB 3ZMRA 2JNZA 1MF2H 3CLEL 1CYGA 5AUMA 4D0BB 1AKJD 1QD0A 2WLNA 3ATFA 4MD0A 3GZQA 4NQDE 4K7PX 4Q2ZA 5ILTL 5B1CA 3GPEA 1DQIA 2JCCE 3OJDB 4U3HA 3WIIH 5CLYA 2FZ3A 2WUBH 5DQJB 1LO5A 4HJEA 5GJSH 4PG9B 1S5HB 5TF1L 3CN0A 3SCMB 1FIEA 4X99B 2WN3A 3ARFA 3FULA 3VCLB 2V6HA 4BSWB 3CXFA 4TSCL 2OL3A 3WFZA 1ZGLP 3JV4A 8CGTA 1XZ0A 3LJ3A 4LVHB 4CSPA 3HG1A 1R34A 1EQWA 5IVXB 5H37H 2KMWA 4GI6A 1LP9A 2DLEA 4XPFH 2KLRA 2J8UE 3DX1A 3HZMB 4TSCH 2WVTA 3VRLF 1M9WA 2BIMA 4D0BA 4GINA 4GI8A 3EYVA 4K8RH 4E5XG 3P4LA 1JCVA 5KSUA 1WBYA 3M7FB 3HE7B 3D12B 3H9SB 5D71H 4AJWA 2HRLA 3PJNA 1AKPA 3B37A 4C4BA 1DUZB 2AKRB 3HIZA 1L0YA 4XMLH 1KZYA 4HUWB 4BUQA 5EBMA 4F7CB 4JG1L 3UGUA 4YH6A 1L3WA 2MTPA 2MCAA 2RAMA 3WMSA 4JN2A 5DRWB 3FSVA 2WBJD 3MV7B 1A3LH 2CAKA 4JN1L 2ZCHL 3T3PB 1IE4A 2WVSA 3HE7D 3S34L 4KNUA 4ZMVA 3ABZA 1TTFA 1UEMA 3QDJE 2JJUA 2WW8A 3D52A 3NH7L 1KGIA 4NC2B 1MAJA 3MRQB 4GUPB 4YDIL 1ZLWK 1AP2B 2PYED 4GT0A 2C9RA 2CGZA 1BW8A 3W82A 2ADGA 3LN4B 3DMMC 4HWUA 4L37A 4LLQB 1OEZW 1XGUB 3VXMB 5J11B 1IILE 4NXKA 4MZRA 2O1AA 1FP5A 2C5DC 5TDPB 3L3IB 1JE6A 3GIVA 3OLEA 2CQVA 5DFWH 5I17B 3FU5A 4G6AD 4Z95L 2GK0A 3S3CB 4LKCB 4G82A 4NDMB 5CINH 4HWNA 1LO0L 1OCOB 7FABH 4BZ1L 1ZGLB 2ADJB 2ESVD 3CHQA 4CVZA 2EDYA 3VWKC 4XMPL 5E2WH 1MFDH 4X98B 5E4EB 1BFVL 5HGDB 2HJLB 4ADJA 5JTWA 4W9LC 3OAZK 5DJ0B 5L2KA 3ZYOA 1MFAH 3QZLA 4H0HB 4JDEA 5B21A 1XT5A 4R96B 4JQIH 1S7WA 2XN9E 3B2UC 1ILUA 4P5TA 2JJSC 3KWTA 2WO3B 5K5YA 1BREA 1E6OH 2QPDB 5LBSH 2VDML 5I30L 5AAMA 5LXGH 1NKOA 2OW6A 4B50A 1FBIH 1F56A 2PKDA 3RUGF 2OL3H 4LP4A 2V2WB 4Z7QB 4JG9A 4UQ2B 4MNGE 2J1ZA 4LAQH 2AC0A 5LXGL 1WRFA 4RH4A 2X89D 3ROOA 4KFZC 5CU9A 4JM4H 3WTWA 2X38A 1HE7A 2OR7A 2WLHA 4L8SB 3DETD 1NFAA 4ZW5A 2WANA 3IEAA 3APNA 4DGIL 2CO4A 5FGBA 4XX1E 3TBBA 5JZ7D 2CBPA 1RZQA 3AVEA 3QUZD 4YHYB 4MAUL 4AM0B 2EDMA 3F64A 3QUZA 2X2HA 1RJYB 3UYRL 2XZAL 3VGGA 5JIIA 1YMHB 3MRRA 3V5HB 3GB7B 1A21A 2PR9A 1H3TA 4JRLA 3MRFB 3BVWA 1CQKA 3W0WE 4I77H 2D2CC 4OGXL 3ULUC 4B27A 1UWEL 2E6QA 4XN5A 4PH8A 1A7NH 3E2HC 1ITCA 1TR7A 4LVEA 1HFUA 3O8XA 4WJKB 4FLHA 4E68A 5IHBA 3L1FA 1N6QL 4DUWA 4EBQL 5SV3A 3UEQA 4TUOA 1ZPLA 4Y5VC 1ZHLA 3ME0B 1E5AA 5HYQA 4PJCF 3T0VA 2AEPL 4Y2OA 4D7PA 4WWID 1JHTB 1FDLL 4HPOL 2EXYD 3FUDA 2LLNA 2QQLH 4I4WA 5DZAA 3OL2A 1MWAL 4WIQA 4C83B 3WBDA 1B0WA 1ZE3C 1CLVA 3HC4L 5KZCD 3DETC 4KOCA 4UILL 3V95A 4Q8BA 4RRPA 3S37H 4XMKL 1S7UA 2FT8A 5IB2A 5AZUA 5BRZE 1QSEB 4J2QA 4FZ8L 3LEXB 3DOHA 3WJMB 2I9LA 1N64H 1FNGB 1S3RA 4L5FL 4MNQE 5JQIB 2CHXA 3WIHA 3EDFA 4Y2OB 3G5VB 4W6WB 5DUMH 5DHEA 1OSZB 1JZHA 1RJZA 1IGIH 2GI7A 1FFPB 3MBEC 5TF0A 3HNTH 1FC2D 2CHZA 4IRJA 4AEIH 4MKTA 5AAWC 4JE0A 3VFWB 4D8PB 4HJGB 3K6NA 1KCWA 4N0RA 3NIFB 4P23A 4NSKB 1Q0XL 4K94H 1T66D 4QI3A 1HVXA 4H1LH 4JPKL 1HH6A 3TVMC 2X6CA 4Q6IB 3HNTL 3FSOA 4JFYB 3UACA 4M48L 3WO4C 1MHEB 3MRCA 3RAJH 2BVQA 2DWYA 1SN2A 3QZPA 1CDBA 3VFOA 2XG5B 1KGCE 3CVHA 4YL9A 2K70A 3FCSA 3V5DB 4F8TA 1S5IL 3RIAK 1PX4A 3WXWL 1UKSA 1LO5B 4Y4FD 4PJGA 1CFTA 4TNEA 3I9IA 4PB9L 2QMKA 4NZ8A 4RFOH 4QO1A 4OZ4B 1T03H 1LEIA 1MRDH 2VLMD 3GK8H 2JI3A 1G1OA 1RZPA 1H0DA 3L17A 1JZ7A 3HCVB 2FATH 3MJ6A 3U0PB 1J10A 2YPKA 4H2AA 2B4CC 4OFVA 4FNUA 2YD1A 1SXCA 3IF1B 2EADA 3N44B 2OSLA 4G5AA 3H0TB 2VL5A 4U0RB 1MCPL 1NCAL 5I9QB 3EYUH 4OQ1A 4HHWA 3K8KA 3ZQ9A 5E03A 2Y07L 3O8XD 5G2NA 4Z77B 4GW4B 3MV9E 3BW9A 3S0PA 1VACA 2IOOA 3BPLC 3QJOA 4JDZA 2Z1KA 3FT9A 5C0JB 1NAKL 4M6OH 1J1OH 1IC4H 1XGQB 4Z7UF 4BZ1H 1PCSA 1EH9A 1WZ1H 4WAFA 3QFJA 4L4VE 1YUKB 1BM3H 1I8KA 1YNKH 1PZUB 3GTNA 3RYMA 2EYTA 1NCBH 3H42L 5F2FA 3E6HA 1LNUA 2NYZA 4E2OA 4YVUA 3V6BR 2FYYA 3B5GA 5IEHA 3QORD 2QKSA 2LE9A 4MAUH 4XBGA 5AOJA 3P4MB 4WO4D 4YXLH 1R3LA 4NZJA 1BV8A 3LKRA 3GC3A 1PEWA 3IMUA 3L5HA 4U0RC 5C0FB 5IESL 2K9FB 1AY1L 3AWGA 2DMHA 3D50A 4MCZB 2EDDA 2G60L 4HZLA 2WXHA 2V7HB 2GJJA 1P5VA 1OKEA 1QBLL 3DX8B 4K5PA 5C3IA 1RL1A 1N4XL 1GC1H 1TJXA 4HS3B 1AHKA 1QWNA 4JVWA 2EH7H 2NR6C 4QHNA 4BCZA 1P7HL 1EV2E 4JFZH 5J13B 2ZAIA 5FYJD 4JS7A 2CK0H 3HC0A 3W5MA 2Z31B 3QEHA 5I1CH 4MZ3A 2W60B 3I6GB 3P9MB 5EORL 1BG9A 4M02A 3DUUB 4DN3H 3SO5A 5D4QA 4AYBA 4PGJA 5I2IA 4Y1TA 3RTQC 3ROLB 4A2FA 5CP3H 1JN6A 5T1MA 3WN5B 4UZSA 5I8EA 3FTZA 1FO0A 5FS5A 2QMJA 5GS3A 4PD4J 1UH4A 1OGAA 5JW3H 3FYEB 1A6VH 1RK0A 4KX8A 3B3BA 2C3WA 2W07B 4R5TA 1JZIA 1AIFA 4MA8L 3PYCA 1V54B 2D03H 3TYGL 1QFOA 3B9KD 3O2VH 2QDWA 2DIEA 4Y19A 4ZYKB 1WWCA 4JREB 3ULAB 3ZE1B 2P7TA 4WNJA 3VXPB 5D1XA 1RZIB 2GSGA 3GKWL 4BH7B 4PRHA 4N2KA 3ARBB 4FFYL 5E6ID 3N9GH 3IETB 1IGYB 2VUOA 1FH5H 1CL7L 5I23A 4G6MH 2Q3XA 4G8GA 2IVFC 3ZL4L 4JJ5B 4YFLF 4NAQA 4UQ3A 2ARJA 3BQUD 1QSED 1ADQL 5CFAA 5TPWL 3G6AB 1J87A 4O9HL 2YMXH 4TNVF 5F7EH 2NYKA 2H1LM 1ITBB 3QDHA 3ZU8A 4ECNA 4HJ0C 4L4VD 4AT6B 1U8IA 3TYFA 5T3ZH 4LESA 3O11A 5INCB 1B3IA 1PY4A 4PP2B 2RBLA 5FKPB 1G7PA 1MREH 4OFKA 5ESQB 4Z0XB 5IB3A 4JY4A 1GS6X 3EGSA 3BVNA 4HQQH 1OT4A 3IVKB 2OMNA 1CYWA 2AV1B 3WHE1 1HEJC 3F04A 1J8HA 3A22A 3TNMB 4ELME 5KS9B 1LYQA 5I5RA 5AB1A 5MENE 4NNXB 1E5CA 4P07A 3C6LD 2D9CA 3TEXA 1LWJA 2HTLC 2RJMA 3BMWA 1A9BB 4WUUD 4YQXL 4OZFA 2X2JA 3ZTNH 1FNSH 1VFOA 2P8PB 1JGIA 2A73A 5ISZD 5GGVH 4DAGL 2EH8H 2EE3A 3VWJB 4Y4FB 3SZKC 1WD8A 4JKKA 1SJEA 5B1KA 2NCEA 1V7NH 2FWSA 2P24B 3AUWB 2Q6WB 1IE5A 4LRNH 4B3EA 3ARDB 2V8LA 4PTUB 3KYAA 3RWCB 4DP1X 3HTLX 4X9IA 5CMAB 2IMMA 2YPLE 4J8QA 5D7SH 1HDMB 1E2WA 4QHKI 1UUSA 4AKQA 4RESB 3C09B 1IKOP 3HKZA 1O7SA 1Z3GH 2DICA 3AQXA 2PW1B 3QR0A 3T5WA 5C70A 5I18H 1MFNA 4PWJA 1JPFA 1L0XA 4NT6B 3WS6A 5B39G 1YVLA 2FWOA 4CGTA 4MDRA 4TQEL 1DVFA 3ULUF 3FT4A 3O2WH 3ZHKA 5ICYB 3HN3A 1HQRA 1WZAA 1I9JL 5FM4A 4EKJA 3Q2LA 3ECVA 5L8LB 3O0LA 1HHHA 3ULSB 5E9NA 1XGTB 5B3NA 2IH1A 4G3YL 3MCLL 3UC0L 5LGKA 3WXVL 2NNAB 3AU0A 2Y6TE 1XR9A 5SWSB 5JIQA 4N5EC 1ERNA 4IGBC 2VISA 1B90A 3FCGA 2XWBA 3QS3A 3HG5A 2YD9A 1M2VA 5ALCH 3GJFA 5GZNA 4OF3A 3GSNL 4IBZA 4JQXC 5TE7H 5I16A 2E9IA 2F1BA 5T1KB 1MCEA 3DJZA 3NFPA 1RHHB 3L5XL 4N2AA 4HP5A 1FVCB 2X4UB 3RIKA 4UB0L 1FIGL 3T8XB 1NCUA 1URIA 4PGBA 3CVIH 3BUTA 3UZEA 5M95B 1K4DB 5AENA 3BX7C 3K91A 1FYTB 3FCBA 3LD8C 1AR2A 1AY1H 4PWHA 3ULSA 1SDDA 2P28B 4U3XA 4LCWB 3S9DB 1NFKA 1UTDA 2ZUTA 1OXYA 4JGNA 3ULVD 2R9HD 1HH9B 3DBXA 4F9PC 1PAZA 3J07A 3Q48A 5EU3B 1A6WH 3QEQE 4JFZL 4JY6B 4ANUA 2DDQH 4KZEL 4L1HA 1BWWA 2DQEH 4PJHB 5AOLA 3W0WD 3NFPB 4ENED 1SEBB 1ZK9A 2XV0A 4KV5E 3FRPG 3SCMA 4QRUA 12E8L 1VHPA 3DDFA 4NZTH 4PJ8A 2CCVA 2FT7A 2ZCKL 1UZ6E 4IK6A 2LU7A 4LLYB 4X5LA 4KKBD 1RZKC 2XZZA 2ADGB 3BI9X 4W4NA 1RZ7H 5FCUL 4NGHL 1HXKA 4RGNB 2W38A 3FSWA 4GQ9H 5FHAL 4C54A 5EOCL 2VXSL 3T77A 5GS0L 3WFCH 4Z6AT 1E28A 5DK2A 5T5FH 2CLVB 3KYOA 2G0KA 4X7FC 3IFPB 4HZLB 2HTKC 3AXHA 4LKCA 3T1FB 2VMDA 1ZGLA 3O0RL 4A2LA 1DCEA 1SEBA 1Z9NA 1A14L 1IJ9A 5I75C 1GJIA 4F58H 5BJTA 1JZ5A 1JWSA 4P48A 1VKXA 2VXQH 4H20L 4ORZC 2IPUK 4BEIA 2FYVA 5D5ME 1EUTA 3IJYB 3RTQD 1BQUA 3WGUB 5IJKC 4PI2A 4P59L 2BS71 4X4MA 4UZUA 1EO5A 2FB4H 4BHUA 1UXLA 5FK9B 2E27L 3QZWG 4HJ1A 5C7XL 4RGNC 5C9JA 3MRQA 3UTTA 3LZPA 2GCYB 2VZVA 4KUZH 3U4KA 5FDWB 4ODWA 4PRIA 1NIDA 4ZUVB 3EJPA 1JTTA 1RK0B 4RGOH 5JYLA 2W88A 3MRJB 4LRNL 3QEUA 1S9XA 5E0QA 5HVHB 3RGVA 2BNQD 3CVHL 4QXUH 2OI9C 3EYFB 4KMLB 4X6FA 3BQUB 5ICZA 1G5AA 1U8JB 3L54A 3MUGB 4LHUD 5F9JA 2BSED 2XHNA 2QELA 2TRHA 1Z9MA 1U91B 3GIVB 1NGPH 4JO8A 5D7JC 4F20A 4PLJC 2ZCHH 3VDCA 3ZO9A 1JHLH 1QUNA 4N2DA 2ZCLH 4TVPE 3NIFF 3FDWA 3QDAA 4M7JL 4ODVL 3BWSA 3HI5H 2GUOB 1NUGA 2BDNH 3SCMD 3K2KA 4YXHL 5EZLB 5I1AB 4RAVA 4ZAKC 1F3JB 1BJ8A 1KTLA 4GXVH 5HDBB 3ZJAA 1AQ8A 2K0RA 3TFBA 2HJKB 5DMJB 5BV7L 2XFXA 2D0HA 4GJTB 1QO3A 4RVBA 3MRMB 2AK1L 1VADB 4HLJA 1W0YT 4PV1C 3FUKA 5IG7B 3MC0A 4WTZA 4ZS6D 1JGVH 3RG1C 2VM3A 4NO3B 3TM6A 4ZFFB 1MI5D 4XRCA 1S46A 3GSOA 4RMUA 3ENEA 4X4YA 1Q8MA 2YAOA 5F70A 3S5YA 1G7QB 2MHAA 3MV8B 1T80A 2C3GA 4MDIA 4OFIA 5ESQA 2NTFB 3GKZA 4PJCB 1G9NH 4KO6A 4JO5A 4NWTL 2JWYA 1IKNC 1MFBH 4RWHA 2VN3A 4P46A 4UB0H 5F3BB 2IWKA 4EI5C 4LCCB 3MOAH 3KLDA 1ZT7B 1GZHC 4L3CB 5A2JH 3IAPA 2HT3D 1I3UA 5K9KA 1KEML 4BA8A 1JF5A 4HZAA 1QA9A 3DC0A 2K6WA 1WS8A 3QNFA 4QAMB 1RUMH 3GSOB 2G5BA 1JJUA 3EF7A 2BNRE 3KWXA 3C8KA 1ORSB 4ZW7A 3MRFA 5DD0L 4Z8FH 2AVGA 2QT6A 4MNHB 1QLRB 1N6QH 4KKLD 4N8CH 4TS6A 5DK0B 5JW5B 4NLHA 5CMAA 2K7PA 1T66C 4QTHA 1DUZA 3U7YL 4IKKA 4O51A 1DFBH 4WFHD 5I0DA 1FFPA 4J1UB 5JHAA 4L1DA 1E7UA 5FM5O 4MD0B 2A6JB 2WNWA 4P9HL 3HLAB 4ENZA 2CDGA 3D2TA 5TFSL 1T0OA 5IW6A 1PJWA 5D6CB 2WKOF 3STZB 4GS7B 5I66B 3G6JF 1MHCB 2IBZX 4O2EA 2LV4A 3C6SB 3BC9A 4YE0A 3ZXAC 2RA1A 5JIMA 1COBA 2VZ1A 3VQLA 3HBQA 1OSEA 4GBXA 3D9AL 5D8JH 2C9VA 2NW2A 2XN2A 4H8WC 4B9GA 2LGNA 2OTUB 4N90D 4G8IB 5L9DH 5KVFH 1CF8H 3G9AB 3VW3H 1XGUA 3RZWA 1XR9B 4PJIA 3U9PH 1NUFA 3QO0A 3L08A 3MJ8A 4Y4HA 1GC1C 1F4HA 2EYSB 4Z7UA 2ODHA 4PRHE 4LE8A 4CSSA 3O6ML 2VXQA 1AGCB 4MMXA 1A3RL 1FLTX 1A1NA 3KXFE 4XNMB 3SDAD 4P57B 1XGPA 4QJ3B 4KVNH 1NC4B 3II1A 5B38G 4J4PA 4H0LC 4A2GA 1MWOA 2MKWA 2DV6A 4MMZA 4AIXA 5GSVA 2ZWKA 4LB8A 2N56A 4DFHA 5A40E 4JHAL 2BY3A 4FFVC 4YHLL 2PXYA 2KQMA 4CVWA 1VFBB 4UV7L 2VDKH 5DVMA 1CTOA 2AMUA 3S34H 1CQYA 1E8YA 5DT1H 1MXDA 3WXWH 1EZVY 9PCYA 4IGBA 1MHHB 1ZHKA 2VXQL 2NQCA 3FMGL 4H20H 3W11C 3BP6A 2YUZA 2OYPA 1J05A 3AB0B 4ZTOH 1DQDH 4UTAH 5KVGH 3S3PA 3CAFA 2JI1A 1WE5A 4O02H 4DQAA 1TSHA 1VRSA 1FUNA 1F6FB 1L7TH 2NUTA 4YXHH 5EDSA 1O9WA 4HBCH 1SYSA 4MCZA 3US0A 4Y5XA 5L4MA 1A1OA 3IU3A 3P54A 3ALPA 5KVGL 3L3HB 4F37F 2OCJA 1JYVA 3CBKB 5FYJL 2YQGA 3JT2A 5IFJB 1G0XA 3BFQG 1X7SA 1KIRA 1A7OH 1HOCB 4OTXL 3I6KB 2IADA 3GT6A 1NAMB 1DQJA 3L2MA 5IVXE 2ZP9A 2R2HB 2RTTA 2BFVH 2WSKA 5L8KB 1GGTA 5TK2A 5IREA 3QEHB 1XD0A 2AW2A 2YPLA 1F5WA 4HIHA 4MJJA 3WKPA 2VO8A 1GMEA 2H5UA 2HX8A 1KACB 3IFNL 2AFNA 4LOVA 1FVDA 1I9RL 4HLZH 3O6KL 4JM2D 4LVOB 3VFUB 4K5NA 5MHSD 3UDWA 1ONQB 2AI0L 4K23H 1K72A 4FKEA 1BZEA 1FBIL 4O5LL 4YAQB 4JHBA 1PDKA 4K3JL 4ODUA 1WGVA 3VRLE 2WC7A 4IHOA 5C0AE 5LB1A 4HT1H 1E9PA 3JV6B 4DP6X 2CJ3A 4A04A 5DF0A 3IXTA 4Z7VF 4FHBD 4ERSH 2XZQL 3QHZL 4NKOA 3LPPA 2LW3A 4HT1L 3WE6A 3E1F1 1BZ9B 3DVGA 4PBWD 1FWXA 2WLMA 5EUOF 2P80D 1XGYL 2YPLB 2ZKYA 3VGBA 5GS1B 2RH0A 4RDQG 1P1ZB 5H2BB 3S88L 5IBTH 2G4GA 3DYOA 4WFGD 2QZ5A 4JEGB 1U91A 3CNKA 1RD6A 2EXWD 4WV1B 5HJ3B 2N3JA 3TASA 1UWYA 2WYTA 1N12A 2BHFA 4N2CA 3T0EE 5IMMB 1I8UA 2IANA 1QA9B 1WA0X 3LZNA 4JKPH 1E40A 4LP5A 2IV8A 1INEH 1KBWA 1N19A 4XAWL 3GSWB 4HJIA 3JWNG 5IJCC 4QRQB 1RZGB 3TCLB 3TEZA 5JW3L 2F7OA 4HJGA 1QBLH 1XX9C 5DYOB 5BRPA 1YEKL 3DGDA 3NRQA 4PBVC 1LE9B 4TQPA 3D9AH 1G7PB 3A4FA 5DD0H 4ZODA 4I2XE 3MBEB 3G08A 4FEMA 4LPVA 3TONA 4AQOA 3RP1A 5KVDH 1DVXA 2B5IC 4M7LH 4N0UA 4JGMA 3K2IA 3W39B 3IXAA 2ZF8A 2WZPA 5AALA 5C0IA 4NKDA 1A9VA 1IBFA 1QI5A 4HSCX 4WGVB 1LO4H 1AHWA 4JFFA 3WD5L 1M2OA 1J0KA 1RZFL 2G2RA 3CFEA 3VTTA 5IUSA 3ZSTA 2VQTA 4WZ9A 4OVVA 5HJBA 1JXGA 4O2EB 5HYSG 5IHHA 3CDGB 2VE6B 5EN2A 4JFHE 5CGBA 2FIRT 3WFBH 1NCJA 1AC6A 4JFDA 4ZUSB 5FYKL 1T2XA 2XT1B 1EGJL 1IGJA 1N10A 2MQCA 3CZGA 3HCVA 4DPBX 2KL6A 4L3EA 4Z7VA 1WWAX 4O9HH 4UTCA 2AXHA 3VDAA 5AW7B 1O7DC 3G5VA 5KG9A 1RUKH 3HG2A 5LAPA 2V8MA 1TZGL 4UQEA 3BW9B 1EVTC 4BE6A 1PIFA 3P3UA 1B6DA 3P9WB 1QLRA 2DEWX 3T0ED 1Q0XH 1UEYA 2G2RB 1KZQA 2XKSA 4K94L 5B1BB 4AQZA 4U7MA 4Z7AA 2IALB 4RFNB 2IDTA 1OP5K 4HUMB 4OCSH 2VDOB 1LJMA 3C08H 4QY8B 4A7GF 4X50A 3DX0A 4I5BB 4YDIH 2JCCF 4EE2A 5CD5C 1FRGH 3CHPA 1IFHL 4YDNA 3KLLA 2QPSA 4HH9B 5D9SA 4OJYA 3VMNA 4YPGA 1M1SA 1C5BH 3ZT6A 1CICD 2IFFL 4OAWA 3ULVF 4XO4A 2ZP8A 2H8PA 1MAML 3IBEA 1TCRB 5CP3A 5GGVY 4UDUB 4ODVH 3L9BA 4H26A 1AMYA 1MHPL 4GIAA 1KMGA 3S2CA 3V0HA 2R4RL 1UG9A 3AITA 2WYZA 2JK5A 5DTFA 1AOZA 4AE1A 1BVLA 1K2DA 5JIPA 4P23B 4EDWH 1ULVA 1PS3A 2XG4B 4YR6A 2EDJA 4NRZA 2AJUL 2BCKB 4MWFB 3RDJA 2WCPA 2F8OA 2MCPH 2YXMA 3H3PL 1UATA 3RKPA 2FJHB 3KEHA 5ANMB 1ZWIA 1TPXB 1X6LA 3QNYB 4N9GB 5DHXB 5JHBA 2AAAA 1Z9SB 2A74C 2P9RA 3KXFB 1QOKA 5CGMA 3WOVA 2BZDA 1KXTB 1IARB 1DLHA 4B9CA 5KBLA 5L8JB 2VMJA 1IAIH 2CBTA 1IGTB 1HJBC 1CF1A 5HBBA 1O9ZA 2VH5L 1CIDA 3IE4A 2JTDA 3WNLA 1WZLA 1ORQB 2O5XL 3EH1A 2ZUQB 1ASOA 3INUL 3F8UB 1N2RB 1BJMA 3KPOB 3D85D 1JUFB 3W57A 4U1HA 3BISA 1ZHBA 3SYOA 4Y4FC 4I0PD 1ZANH 3HE6C 4JMXA 2HFGH 1DVSA 1FYTA 2HLFD 5AZEH 2KPWA 3BGMA 4MMYB 3GJEB 4CSTA 5DZOA 5LAXA 3NJHA 3V0IA 2BW4A 4JUSA 2F1EA 3MOQA 4XVJL 2Z9TA 4OSUL 4IHBA 1JGDB 3QNZA 4KNSA 4DW2H 1IGCH 2DQCL 3FHEA 2EKJA 3MNVA 5ESAA 4C4KT 1G0DA 3BO8A 3NIDF 1T3FA 3GLEA 1PFCA 2HN7A 1Q4NX 3ISRA 3ZO0A 3MRMA 4FQJH 1SVZA 2P45B 1U8PB 1XCTB 1QTSA 1KNOA 4Z0XA 3ZTDC 1K85A 2NY0C 4PRDB 5JORA 4OI8A 4FQJL 2IQAB 4LGSB 1YY9C 3LRSB 1MJ8H 5AAPA 3IE9A 3TEYA 4BRVA 4AYID 2X9XA 3TPKA 3IKCB 4ZMAT 4NNPH 1AGFA 3DX9A 3OKMB 4F15C 1CR9L 2NZ9D 4ABUA 4GRMB 1AZBA 1GL4B 4KPHH 3F01A 3VSUA 1MJ8L 2WHVA 4L0PB 1A7BA 2C9UA 2Q86A 2GHWB 3QARA 3MNVB 5ESAB 4BFIB 5JPMC 3PWVA 3NZSA 3DIVA 4HKBB 2YZ1A 1K4CA 2C7FA 3QWOB 2MJWA 1I4FB 4GG6B 1YJDL 4CNIA 1S3KL 2YC1A 2DB8A 2WTRA 2HT4D 4X6DB 3HC2A 4KKCC 1R75A 3OAUL 1ZAGA 4UQ9A 5C09E 3LRSA 4NQUA 5EU5A 3A21A 3KPNB 2ATKB 3ESOA 3LS5L 5AOZA 4L3EB 3CN1A 4U0QB 2ZONA 1UT1A 5DJAA 5I1EH 2X70A 1RIUH 4HHAA 2VXSH 3C60D 3CZLA 4UILH 5ACZB 3BUIA 7PAZA 4P2RB 2IANE 1GR7A 3CSTA 4LQFL 3X1GA 4JHWL 4ZFZA 3GBLA 5F7UA 1M6OB 2WAHA 1CXHA 2FGZA 2WP3O 2CHNA 3ERXA 1XF5B 1V7MH 1Z6JT 1G7MA 2HYMA 3GXMA 3QH3B 5AB2A 4W70A 2J4WL 4N0UB 2ENSA 4OI9A 4MJ2A 3VQ1C 4HDIB 4P3CL 5IVZB 2V2TB 3KPNA 2FH6A 2Z91B 3Q9QA 4TRPH 5JMRA 1QUNB 1UXSB 3EGXB 2EIBA 4WSGA 4PRAB 3SDXA 4K3HA 2A6IB 4HZ1A 4GW1A 4QKXB 3TBVB 1BDYA 2WLJA 3EOBB 4NM8L 1GY2A 1OW0A 1TLMA 2WXKA 2ZKHL 2QVMA 1S4IA 2UXTA 2W5PA 3D4YA 3ETBJ 4YL4A 4AG4L 4E9WA 2ICEB 4MA7H 5IBLD 1ANUA 2H3XC 3WUWA 4PJ9C 5AKVA 1B0GB 4PVNA 2WBXA 4G1EB 4JE4B 1KTRL 2QGBA 3DBXB 5L2JB 1FG2A 3RI5K 3N55A 2VLKD 4AG4H 3BPCA 3L9YA 4XI5D 1PSKL 2A6JA 3PFUA 4M6MH 1JBJA 2NXZB 4LPXA 2QVIA 2R2CA 4A6YH 1CDJA 3RWFB 1JGLL 4ZMYA 4L8CB 5GZND 2UUDH 2XG4A 2NTFA 1XR8A 1CFTB 1CVRA 2CWRA 2B8OT 3CFIC 3G5ZA 4YSRA 4BQ9A 3AU1B 2FJFB 4JPVL 5ENWA 3SE9L 4Y16A 3MOBH 4K55A 3ZE0F 1O0VA 1XTMA 1A7QL 1JZEA 3OKOA 1HAUA 2VDRB 1ASQA 4JQXA 3SO3C 3RWGA 2GTWB 4PM1A 3WTXA 3DSNA 3LY6A 4LSTH 2A7BA 1YHPA 4OAWB 5EOCJ 5DK2B 3K6SB 5FLVA 3NG5A 4D3CH 4K94C 2F53D 5GZOC 2A9ML 1QHPA 3EUUA 3PGDA 1P1VA 4JZNB 3NIGE 4N1CA 3BCFA 5E9DB 3V55A 4F8OA 5ABDE 5J57B 3DXAE 4JKMA 1UACH 4DN3L 5D2LE 3NFSH 4M4PA 5B1AB 1QPXA 1D6EB 1HQRB 2ZKXA 4QCIB 2DQIH 2FWUA 1GCYA 1X5MA 1P5UA 2VLKB 2GW5A 1XXDC 1EAOA 2OMTB 4OGXH 1RK7A 1Y0LB 2PWFA 4LSUH 5H35B 1M71B 1DO6A 1YYMH 1SLXA 4M7LL 1A6VL 1KG0A 2Z65C 2ZG1A 2FGWL 4KROC 5CFHA 5J1SC 1XSJA 3RRQA 5HHXL 1DANT 1Z9SA 3KXFA 3QWRD 1S7WB 2VC2B 2FUTA 5E51A 3VFNB 4KJQD 5EORH 2W0KA 4WKZA 3MLTB 3T3PF 2UVFA 2AV7B 4HUXB 2F5BL 3UP6A 2XWJA 4YK4B 2XWZA 1WC7A 3DX3A 1XGZA 4AV5A 3IMSA 4IM8A 4PRPE 2WXFA 3BH8B 1KPVA 3QQDA 1DJZA 4LNVA 4IBLT 5HI5C 1OOWA 3UPRB 1NEZA 1QNZL 1S8DB 3DI2B 5BO0D 4PV8B 1XTLA 1NC4A 2DEXX 5TDOB 3GTTA 4R90L 4TOYL 4P4KD 3U36A 1I7RB 4E41A 3WLWC 4ANKA 3VNYA 4JHAH 3PCYA 1IBBA 2XFXB 4HJSA 2DYPB 4OBRA 4ETQB 4HCGA 1WUNT 2DWDB 3DK0A 3WU1A 1OTSD 4F7TA 5CZKA 2LABA 1QRNE 4NQSA 3CFUA 3S4SB 4TQ8A 3SDDA 4NENB 1DVQA 3ET9F 5CAYB 1OO2A 4ATTA 4JFSA 1NCIA 4JQIA 3BYTA 3LRMA 1UQSB 3HZ3A 4L8BA 4QRQA 3MR9A 5D7KE 3TCLA 1ETA1 1XCXA 5BW7C 2HN7B 1NGWB 1AO7E 1UXWB 3WLBA 3D85B 3A5VA 2CD0A 1U3HD 2OTWA 3DKHA 3LS5H 2OK0H 5HGBB 3V4LA 2RD0A 4JZJB 5ITBL 1KCRL 3IAQA 3EYFA 2CMRH 5CN1A 3UTPE 2RQEA 3I2CH 4WNQA 5I1HL 1KGUA 1BBJA 2BVTA 5AZ2L 1O9VA 4C4UA 2O30A 5GRVK 1W72B 2M8XA 1NCOA 5CP7B 1SY6A 1XH0A 1X5IA 3FUFA 4NQCE 4TKWA 2BSSB 4OTXH 2IBGA 1YN6B 2MQGA 3ZDXB 4EN2A 3GIZH 1MW0A 1JHTA 5IQNA 4R7DB 2F54A 4PGDA 4TL4A 4N3UA 4JFXA 5C08D 4B6ZA 1CTNA 4KTEH 2DQMA 1INDH 2HFEB 5F88A 2F8XC 3IFNH 3BKCL 4DP8X 4OBSA 4O02L 4EVNB 3STLA 1RI8A 5FKAA 4XPBL 2PYEE 3VH8G 2DQJH 2XIDA 2BIIA 3QUML 4E9LA 1OAJA 3PWPD 5DLMH 2YK1L 4PWKA 1NTDA 1D5MB 1R3KB 3WY2A 4X4XA 5GGVL 2XCMC 3B9EA 2MOQA 1VESA 3HLKA 1NGXA 2AQPA 2EH8L 3HOGA 5IM7A 4R4FL 4LASL 1AQHA 1RPUA 1BLIA 3FB6B 4HH8A 5TDNB 4OJAA 5CGYD 4Z7IA 3BD3A 3PQYE 1A7QH 4N4YB 3CH1A 3ZTEA 3MGTB 1C8PA 4YE4L 5C0CA 3MACL 3QORA 4YLQT 1QTPA 1IAKB 4JFEE 2VQ1A 4BH8B 3WHXB 3DV6A 4OCNC 4WUUE 2XPYA 4BZ1A 1UT9A 4Y5VA 4F2FA 3VWJD 2P5WD 1MCOL 1I8LC 5MEND 4AYMC 4XVUC 3NCWA 1NMAH 3L2LA 3P11H 4PJEF 1TYRA 1ZVHA 3NPSC 1S7XB 3UBFA 5HJ3A 1K3IA 2R56L 3MI6A 3SE6A 1F90L 3FT2A 1QO3B 1NAMH 3JV5A 4QTIH 3GO1L 2EH7L 4XNMA 3R06A 3WS3A 5FX3A 5GSRB 4KDTA 5EB9A 4R7XA 1FYTE 4F9LA 4M7LT 1V3MA 5DZVA 1AKJA 5K9OB 4OQTH 4F8QA 2AQ1A 3MBWA 1N8ZA 4QDGA 5DEZA 5EIIG 4KTDH 1KC5L 3LHPH 2MOGA 2YBRA 4YHOH 3ETSA 4AGQA 1I3RA 1VFBA 3JVGC 5D6DC 5KZCB 4EAEA 4JFDE 3ULUE 1SVCP 3CPUA 3U4EA 3KPRD 3ZTCC 5HYJD 2OMTA 12E8H 4NKDB 4NZTL 5T3XD 1AQDB 1LXMA 2YXWA 1M71A 4ZD3L 2F18A 4MS6A 3QAQA 2HJFB 1VZHA 1BYPA 2VIRA 3N1PC 2D7OA 4XNQA 1GPOL 4F57L 5KVMC 1HXYB 4F9PA 3BUYB 4CMMA 32C2A 5J7CC 4U31A 3FONB 4H1LA 3WSQL 4EN3A 1X4XA 3GMPB 1NCDH 5GS1C 1I9EA 2E6JA 4A67A 3CDZB 4MNQA 1FZOB 4RMRA 5IB5B 3U0TA 3NYKA 1RHFA 3EFFB 1TZGH 3DOSA 4QAWA 4U6XA 3IMTA 3DSNB 3RVUD 1RAMA 5BO1H 4W1TA 4MXVF 3BRFA 1QKZL 3B34A 1BVKA 4BQ8A 1F8TH 1N59A 1G1CA 4LU5L 3SJVE 4AQ1C 2W9EH 1Y1UA 4X5XA 3G04B 3GMLA 4J3XA 1PW3A 1YNTA 4RLDA 4JHWH 2ZXQA 4EIGB 5GGQL 2R83A 2NW3A 4EIUA 4R96A 4KQ3H 1ZHNB 4CN6A 1BZ7A 2GJ6D 4QYOA 2JKLA 1A25A 1T21A 1RUKL 1XAKA 3UBGA 3IWVA 3S96A 4FQPA 3QO1B 2FK9A 4YHKH 4XP9L 4NQQA 4AE0A 2X9WA 2OMUA 5GISH 2YARA 5EOTA 1ZLWH 1UB6B 1JYWA 3FQUA 2R0KH 4BZ2L 2X9YA 1G43A 2C3XA 2NCMA 1BVKB 3HMXA 4F8PA 1EVUA 1OAYH 5FWRA 1UXWA 3QPXH 1EXHA 1PKQB 5CJQH 4KZDL 1IGIL 1WS7A 4H26B 2QSTA 1Z2KA 2XQYG 3QISA 1CB4A 3LSOA 4M7JH 2E7MA 4P49A 1TU2A 2XDHA 3DURB 1RH8A 3VXPA 5D7HA 2EDEA 1H3VA 3CFDB 4ZFOA 4YHMH 3WIFB 4JRYA 1KJ2A 3CQPA 5LNEA 2ESVB 4Z7NB 4R9HA 4NJAL 5I8OL 1DQLL 1SLVA 2YC1B 3CHOA 4Q6IC 5TDOA 3EZJB 3C5ZB 1YN7A 1I9RH 1N5YH 3KYMB 3KPRB 4M43H 3UTZB 1T3FB 1VLXA 3GINA 1AQKH 2YMOA 4NJAH 2DN7A 4PB9H 1X6NA 4W9ZA 5FKAB 4WEMB 3EH5B 1CT8A 3FUIA 4JFED 3W1ZA 1M05B 3QQ9C 4Z7NF 5AW3B 2CG9X 2H0FA 1NOAA 3VFGL 3N43B 4AIZB 1SN0A 2R51A 2VC2H 3MRKB 2XQYA 1H5BC 4TNWF 3TJHD 1C1EH 2X6MA 2EVJA 1WVZA 5A2AA 1NCNA 3RWHA 5GS1A 5JNYB 3GXIA 3MV8D 5F6HJ 3S48A 4PCSA 1UD2A 1JUFA 3B8SA 4PD4K 4ZMXA 4TUUA 1KIRB 2VZUA 3GDBA 4KQ0A 3HBPA 4NZRL 1II4E 1T1WA 5F7NC 3PWPE 3RNKB 4LF3B 4JPWH 3OMZA 4Q4EA 3AG2B 3RY6A 4LHUG 2AJZB 1UB5B 3MACH 4IMLB 1IEAA 3LKQB 4OQTL 5DS8B 3VGAC 3BRDA 2WXIA 2IDQA 3FBKA 3EO0A 4GEIA 3L6FB 1AVAA 4AZUA 4OLYH 4MD4A 4PVMA 4Y2DB 4Y7MA 5BUGA 4O2CB 3TN0D 1UFUA 1I3VA 1EAJA 1OGSA 1SF3A 2C4XA 1EEQA 1DBMH 1UA7A 4XP1H 3SDDC 2V17L 3CFTA 1AE6L 3CPLA 3K7UA 1U8LA 2IBBA 4NFCA 2PTUA 2VDPB 2JJSA 4JREC 2P24A 2Q6WA 1U42A 4JZOB 3DXAA 3EF4A 1ETZA 1NLBL 2B77A 3IJEA 5DUPH 1NSNH 3WNOA 5F0MB 4F93B 1YMMA 1G6RA 1SN5A 4FA7B 2H2SD 3NCCB 1W6LA 3D3VD 4W4OC 3SDXF 3TLRA 1HEZB 2FBJL 1KJ2H 3TO4C 1E65A 5IVXF 3VXNA 4U1KA 1NGXB 3BKJH 1F18A 1XDTT 2DF3A 2JKIS 3V52H 5JA9A 2J2ZA 2N59A 2QJDA 1AO7D 1AAJA 2FEDD 1NCWH 1VIWA 1E8XA 2YRBA 3FRUB 4G9DB 2MIZA 4E0RB 1CF8L 3VW3L 4FXGB 5FB8A 5CF3A 5ENWB 3OAYH 1QFUL 2OBGA 4KGJA 5BMFL 2J57A 3QYNA 3K80A 1NM4A 1UENA 2ZYHA 2QEJA 5J13C 1A6ZA 3QNXA 5LGYA 3WAJA 3AREA 4XP6H 4IBWA 3EYSL 3PIQB 5EG6C 4OVUA 3RTLA 5T3XE 4OFYD 3X12A 1TCMA 2OX5B 2P49B 3EFDL 5CZXD 2K6YA 4QXVA 2HKAA 3AXLA 1D5BA 3B2MA 4X9FA 1P2CB 2WD0A 5KSAA 3FT2B 4G43B 1RIUL 2LOEA 2ICEA 3SY0A 2A6DA 4A38A 1RJLB 5CHNA 4NUGL 2QADB 3ULUL 1VERA 4LHQB 2QV4A 4U3CA 4PRPD 3KPLB 5IOPA 4QD2E 3M46A 5CIPH 4YHLH 2YAQA 4ZUTA 1YEHL 3TZVA 5CEXA 5SWSD 3U9PL 1PNCA 4U49A 1P5UB 2W9LA 3NJFA 3D69B 1S9KC 2OYLA 2ICWA 2OK0L 1YJDH 1CGWA 1QKZH 4DEUA 1P0SE 1SDDB 4TSAH 5DJXA 3FN0L 5FUCE 3TOPA 3IDNA 2VDKB 2C9AA 4G9FA 2AQTA 3HS0A 5J1AB 2XRAH 1NFIB 3FSZA 4DGVL 5I1LA 1YEEL 4ZUSA 2JKNA 3ARDC 3LXBA 4IU3A 1OHZA 2HJFA 3VE0A 4G6FD 1OLLA 4X83A 1JHKH 2W94A 1P6FA 1A8ZA 1NBVL 3RWGB 3X1FA 1JI1A 1T5XB 3ARFC 5CCHE 1YCSA 7TAAA 1JZ8A 4XP5H 1IC1A 2Y5TB 2ZUQC 4YXKL 2OKMA 4H8UA 4HOMA 5G4MA 2OSWA 4L48A 2B15A 2L7UA 3MMEA 1FZKA 3FO9A 1AOHA 4MVBC 4PGZA 1DJXA 4JN1H 2MQ3A 3L4YA 3D39B 2IQ9H 4XOAA 5G55A 3RIFF 2OS7A 4DEPC 1NM9A 1WLHA 1MCPH 3CUPB 5SX4I 4K7PL 4DVBB 4K23L 3QEGL 5F1NA 2EDQA 4O5LH 2B1HH 4XCEA 3MV7A 4ALAC 3P2DA 4HGMA 3MKKA 3QCUL 2XPGA 3LQAH 5J0BA 1KG0B 4HIXH 4DKEL 4PY8J 2OZ4A 3GGWB 5IB1A 1RMFH 2FHCA 4YDVA 3CSBA 3OB8A 5C08E 4IMKC 1JN6B 5FUOH 2R2BA 4HFWA 3BAYA 2PCXA 4GAJH 4Y16B 3T6XA 1U8HA 5HHOE 4YSOA 5IK3A 4Y9FA 3WI9A 1PZ5B 2QZQA 5HYSA 4I0KA 1Z0MA 1NGWA 5E7BA 5KSBF 5HYIA 1L9OA 4K7FB 3C9NA 4U4BA 2I60H 1RY7B 3INUH 3FN3A 1FNEA 1XL4A 2VDOL 2ZSWB 4OLYL 1AZVA 1ZHBB 3D39A 2PCFA 3NRPA 2F5AH 4GIOA 4Y1AE 3HG3A 4KI5D 5FDYA 1GHFL 3MAWA 3IJSA 3NSCA 3F84A 4UT7H 4WKXA 1J86A 5DD3L 3ZDXE 5D1XE 3QWOA 2G3NA 1UACL 3ULVH 3MYJB 5AVTB 1OPGL 2LAGB 3T9WA 4LSPL 4I18C 4UT7L 4XPHL 1M3JA 3G6JA 4FFWC 4PY7B 3RB5A 4RX4A 1F4WH 4CN4A 3T4AC 4PVLA 4F33B 5E4IA 3P9MA 3NP3A 5TH2A 3QJFA 3GXPA 2A9DA 5B3JF 3DO7A 1OIOA 4N87A 5CKAA 2QSQA 5JHMA 5JXEC 4NAJA 1U2HA 3LKSB 1DQVA 3QJTB 4X8JB 2HG5A 2IAAC 3H9HB 2UVEA 3X3GH 4AKOA 4G2AA 5IM7B 2V9UA 1EXUA 2WWOA 2UZYB 1H19A 1W0VB 3NACL 5TDNA 1N67A 2PO6A 4HBQA 1LO4L 4KY1L 4BWWA 1HWHB 4PQXA 3HN5A 5DS1A 3BWUC 1NLBH 4X4YB 4Z0BL 3W9EB 3IPEA 1VZGA 4KJYB 5ILTH 1NCDL 5BQ7A 4YSCA 4U6VH 2A6KB 3O2VL 1OARH 5AVQB 4HXAL 3QIBA 5DWUH 1JOIA 2BNUA 4N90E 5LAXB 1CGSH 1YEKH 4NLAA 2GPZA 1E4HA 5C09D 1RJYA 1FL3B 2ZOTA 2EUZA 3QIWB 4XC3L 4PRBB 1D7DA 5KYYA 4JFXB 2DDQL 4IEFA 1CL7H 2VITB 2P8LB 2CJTA 5JO5B 4DEPB 5AVXB 3I02A 3K81A 1OAKL 1HS6A 1XSIA 5IT2H 3NN8A 1JV5A 4AYFA 5T3XH 3E0GA 4RMBA 1L7IL 5DJCA 5I1EL 3MLSL 4HAKA 3QFGA 4W6YB 3V4VA 4OV6F 4WWPA 3ZDZE 5IUCA 1O6SB 3F6LA 5GGQH 3N1FC 1HJCA 2KZ1B 2A6KA 4MRCA 2F6AA 4TNFA 4UTBL 4G43A 1C16B 4LLWB 1TTAA 1AHWB 4PJ9B 4YBLC 2OTWB 4MB5A 4UV7H 4N26A 3W9DB 5DQJA 2OA9A 5IB3B 1OB1A 5IMLA 4R90H 4TOYH 2ICEC 5I0ZA 2Y5EA 2XXGA 5IVOA 2B20A 1E42A 4R0LA 1J5HA 5K39A 4BZ2H 3ZMNA 3ZKNC 1JXDA 1R5WA 3FQWB 4AJVA 4UMSA 2BHUA 4QRRB 1NBYA 2BS9A 5DXWA 3T0EA 2EKSA 3BP7A 3LEYL 1HHHB 3R1GH 3BD4A 2ED8A 2NXZC 2VIRB 3H53A 5CJXA 5J11C 2GKIA 5D2NE 3L9RB 3V0WL 4HJTA 1FNGA 4UT6H 2Q1EA 2HH0H 1HE8A 3R1GL 2Y7QB 4XBPA 5T1KA 2L3BA 2CRZA 2E9WA 1EFQA 4FFWD 4GRLB 3ARSA 3QR2A 2OSLB 3EFFA 4HSAC 4HHAB 4LCIH 5CIPB 4GG8A 4P2AA 1KPRA 4PSRA 1W2KT 3EJSA 4G8FA 3DHPA 2DKUA 4H8VA 3W3BA 2Z35B 4NB7A 5K9OA 1T5WB 4X80L 4XNYH 5DJYA 1OAXL 1SOKA 4P46D 3ARED 4XO3A 1NBYB 4QOKE 4YNYA 1ZCRA 1VEPA 1OM9A 4GQRA 1KBBA 2O4EA 4IBSA 2X12A 2IOIA 2Y7QA 3NCBB 4RDBA 1XWVA 2YRLA 2F15A 3UCQA