1BMWA

A fibronectin type iii fold in plant allergens: the solution structure of phl pii from timothy grass pollen, nmr, 38 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
94
structure length
94
Chain Sequence
VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Immunoglobulin-Like Fold in a Major Plant Allergen: The Solution Structure of Phl P 2 from Timothy Grass Pollen.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords POLLEN ALLERGEN PHL P2
total genus 5
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1998-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1bmwA00
1WHOA 2VXQA 2BH0A 3FT1A 4FERA 4JJOA 4JCWA 4FG4A 4JS7A 1BMWA 1WHPA 4FFTA 4FG2A 3D30A 4L48A 1N10A 3FT9A 2HCZX 2JNZA
chains in the Genus database with same CATH superfamily
3UO1L 4LP4A 2NY2B 4OZFB 4XE0A 4Z0XB 5GGUB 2FZ3B 3Q5YA 1J11A 4NWTL 1VFBB 5CU5A 3VFVA 3CHSA 4TNVF 1FFNB 2IH1A 4KKLD 1JZDC 3QWOB 1EHKB 3QDGA 5L7XL 3TVMB 3SE6A 2EXWC 2BIMA 5CZXD 1DP0A 3PGCB 4N90D 4G59C 5HDWA 3AB0C 4TTDC 2YD6A 3FCSB 3MV7B 3M86A 4Z8FH 4JR9H 2ROXA 4BKSC 5C0DB 5LQBL 4R2GD 3HUJF 4AMWA 4NHUA 5HVWA 5ADPL 5FEBA 1IUZA 4FQQB 3JV4A 3RX9A 3ARGC 3EO0B 3WS6C 5ACMA 4MA1C 4RWHA 1FFOA 3QG6B 1KCLA 1XF1A 1YEHH 3UTQB 4RFEB 1NUFA 3I84A 2E59A 3OKMB 3KBFA 4G9FE 4PBXA 5AOKA 4IBTA 3CQQA 5ALCL 4Y1SA 2NSMA 5HHME 2K4WA 3Q8EA 3WENA 1OB1A 2YUXA 1RPKA 1JVOA 2ZOWA 4AZ8A 1RLWA 5CN2A 1RY7B 3NDYE 5L0QB 4AXWB 5F96L 3LZOA 1HINH 5EO0A 3MV8A 2CCWA 1MPAL 1M7XA 3RNKB 2O4EA 2VL5A 3BZ5A 1NLBL 4NUMA 3DETD 5IJCC 4J3UA 2D4DA 1A64A 5DT1H 4OCSL 2GFBA 3DUUA 4NBYB 4HIQA 1MFVA 2IADB 4PJCB 4ZTPL 3WNKA 1S9VB 2V5YA 3HOGA 4FA6A 1ZS8B 5CCKL 3JQOB 2WYHA 3HR5A 5AWNH 1S9WB 3ZKMC 3DX9B 4ACPA 5I9QB 3WTWA 3BP7A 3F7YB 5JQIB 4LLAA 1M7UA 1TXKA 2WN2A 3FT0A 1GSMA 1E4JA 1RZGB 2BVOB 2EIKB 2H6OA 4QO1A 4WI3A 1WP6A 1MZZA 1J8HA 4DETA 4XPHL 2ARJB 3KPTA 4QHNA 1EAJA 2KMWA 3HE7C 4RCAA 3QJOA 2X9WA 5DS8B 3IAGC 4X7TB 1X5FA 3T5WA 2EE9A 3OR6B 1D9KC 1C16B 4U1KB 1D3CA 5C09E 1KB5B 3EYUH 1JPSL 4H8PA 1JE6A 1X4ZA 2EDMA 5FYJU 5JPMC 3FB7B 3K2UH 2HXAA 3TVMA 4ALAH 4DKFL 1DVQA 2OYMA 5FYLH 3ZGHA 2FK9A 4MA8H 3MRJA 3VFMB 2KZWA 1WDAA 2A0LD 2YAPA 3CH1A 2QPFA 5DA4A 5CP3A 5T1DH 2H6UA 4PWKA 4EZMA 4KTYA 3IE9A 3D8MA 1NAML 1T1YA 2IFGA 2OMYA 4RGOL 1JYVA 2CDFB 1DYZA 2PW2B 5A2AA 4N8CH 2GYSA 4NQDD 2NYZA 4D0BB 1ZD6A 1A9EB 1RXLA 4BQ6A 1EIBA 5CP3H 5F7YC 3B2XA 4U1JA 1F11A 2VABA 1IBDA 3FB5A 3MV9E 4NUPA 1AQMA 4NQCA 3P3RA 5KYXB 1UXWB 3AXIA 2ARJA 4NQSA 4A7TA 5AAMA 2A9DA 5IFAH 5DK0B 1ETZA 1PS3A 1TETL 4JG1L 3MNMA 4LEOA 5T3ZH 3ZHLA 1KC5H 1BXVA 4G6JH 5D4JA 4ZNCD 3NRPA 5C6WH 5E08H 3EUUA 4ZXBD 2WV3A 5C07E 5GS1C 4NZFA 5HI5D 5IVXE 2PYEE 2YPLA 2DYRB 4B60A 1ET5A 4QTIL 3CVDA 5DMJB 3N5AA 5T1KA 4AEEA 2JXMA 4OF8A 3TO4D 4OD3H 4GUCA 3HZMB 5B7EA 1JGVL 1QVOA 4L3EE 1MF2L 1NA8A 2JCCA 3QR1A 5CM1A 1KSRA 3E0GA 5FOBB 1J05B 3K6SA 4M5YL 1IFHL 4JRXA 5JXED 1PW3A 2FB4L 3ARRA 5CSZA 3KLSA 3OTTA 1D2OA 4OZGE 4MMYA 5EOCJ 5TF1L 2P7TA 4NI6A 2VMFA 3KW7A 1R3KB 2X09A 5DSCA 3ZT6A 3C08H 3EF7A 4IEFB 3P0VL 2Y5EA 3GSXA 2F58H 5HHNB 3TO4C 2PPAA 3D34A 1YEWA 4HUWA 4U1SB 2HKAA 2AEPL 2WXIA 4DCQA 1JXDA 4FNLL 1OGPA 3WUWB 5B1BB 4IEFA 2ZOTA 4KNTA 2WWKT 4YBHA 3U4EA 1OSPH 3QUML 2HJKA 1ZT1B 2DQCL 4HOMA 2OX5B 1HQRB 1FAIH 3N50A 3NABL 5CD5D 3QUZB 2X6CA 2ZUQB 5C0DA 3ARBC 1CK0H 3GQFA 1TPXB 4MGXA 5GSVA 3S88H 2GJRA 2J73A 4AGPA 4FZEL 4JQXC 1VACB 1AYOA 1MHPL 2GT9A 3I9GH 1JGUH 3UZEA 1BD2B 1PLGH 1TF4A 2VW7A 4MYWB 4YZFF 5INCA 5IJDC 1DQTA 2IH8A 1YN7B 2VKXA 2IAMA 3HNTL 4OFQA 3H8NA 1JZEA 4OLZH 4JFDE 5K1JA 1VFBA 1BYNA 4S0HA 3LQMA 4NJ9H 5IB3B 1B90A 5ESVB 2YLHA 1CTMA 2K45A 2WWKO 3EG9A 1LQSR 3MRGA 2WN3A 3UP6A 4V1DD 4BE6A 4JDZB 1T1ZA 1ZHLA 3QISA 4DTGL 5D7LD 4UNIA 3UYRH 1Q9WA 2XN0A 1SYSA 4P46B 3VFPB 4TV3A 4PY8I 4POUB 3X2QB 2XY1A 5CD3B 1F3DJ 3HFFA 3EOTL 4YGVB 1ZANL 3M17B 1QSED 3K46A 2DEYX 4OJDH 4RAUA 5J3HD 1FYTD 4LGSB 4O02H 5DK2B 3NJLA 3ARFC 3N41F 2MTAA 3KS0J 1XMWA 2P80A 3DVNA 3TT1L 1ZHKA 3P0YH 2ADFH 4LAQL 5FYKH 1HKLH 5L2KD 3V0WL 4NBZB 1ORSA 1NCBH 4A2FA 4Y2DD 3SKMA 3CFKA 3QNYA 3J7HA 3QHTC 3DX3A 4PU2A 2HRPL 2VDLH 3FHQA 3AU1A 4RAVB 5FYJE 1TJGH 4PRHD 2PPDA 4KY1H 4WEMB 3X1GA 4EUPH 3GSVA 1CZ8L 1AZCA 4Y16B 4JMNA 3RP1A 4TNGA 1FYTB 1OPGH 4FNTA 2E7LA 3MV9B 1XGUB 2WOYA 4RMTA 4YGAB 1EH9A 3QQ9D 3ZO0A 1B0GA 3MTRA 5I1AA 3KVDD 1GZQA 3G5ZB 4D7PA 1VSCA 1P7QD 1LVEA 4F7PB 1AR1D 4YLCA 5FB8A 3ZR6A 4F93B 2AMUA 1HEJC 4N6RA 3U2IA 2NY3B 4RH4A 4U3SB 4M7ZC 2OMWA 4KKCD 1A4BA 3DUSA 4HETA 1MAMH 1QLEB 2V3DA 5DMKA 4P46A 3BUYA 2OR7A 4A2LA 3P9MA 5DGRA 3KD4A 5C0EB 5ACZB 2XG5B 2LHAA 4HS8H 4ZUSB 5FUZL 4LSVH 4WTQA 1ZLVK 2EIZA 5JHDE 1T0MA 2YAHA 5IEHA 1UCBH 4C83B 4MB1A 5LAPA 4HWEH 4ODHL 5CO1A 3VU2A 2R7EA 3VX1A 5KN5A 3EOTH 4FMFA 4PTTB 5KSBA 1KJMA 5EEVA 4PJCA 3N3EA 5EORL 3TN0C 3WKMH 3R4RA 2ZP9A 1E2VA 1U30A 3KPOA 1U3HD 2LLGA 1WBXA 5FGBC 1O6SA 3GUTA 2JKNA 3BOVA 3EADA 2ZE0A 1H8LA 6PCYA 4YWGL 1B2WL 1JPTL 3BKMH 2D03L 1NGQL 4WW2C 2XKNB 3IKCB 1WAAA 3O2DH 2PWDA 1K4CA 5I5MA 2E76C 3IFNH 4ZFOA 4PJ5E 2BO0A 1JGUL 2NY4D 4X5PA 3MYJA 4KU1A 2FX7L 3APNA 3O3BB 4BBWA 5C2BL 4PJ5B 4Z5RB 3ARPA 2BSCA 1GYWA 2EYSA 4JB9H 3RL2B 1U91B 4JNXA 3RA7H 2ODHA 3DSFH 4PJDB 4M4RA 4W9CC 1B4JH 1WZAA 2PO6D 1TZHA 4J8RA 3DGGA 1GJUA 1UJ3C 2XTSA 2ED8A 1ZLUH 1NGYB 1HH9B 4POYA 2BWIA 2FL5B 4Y5XA 3IU4H 3QFDA 3QWRD 4BH7B 4XNXL 4EN3A 4G7YL 3QCVH 2OA9A 1MAKA 2NTFB 1DBMH 1SJHB 3HG4A 4XXCC 5IW6A 1E67A 5FM8A 3IDYC 4KJWC 4P0DA 1L7TH 3L16A 4CSTA 4O2EB 4HSAC 3HI6H 1I85A 3HMWH 2NXZD 3G9VA 5FYJD 1CFNA 4ANUA 4TSAL 1U8CB 3VFVB 4RMBA 2Z31A 3D69B 1QFWH 3RJOA 2WLKA 2CGRH 2E74C 2K1MA 2M2DA 5BZXA 3U36A 1JGVH 4P5MA 2ZXBA 4FEMA 1PYWB 4UU9A 4XI5D 3RWIB 3CZUB 1UATA 4UZUA 4S1RL 2L7EA 5DEGB 2XVLA 4V33A 5HGBB 1HQ4B 5ID0B 4X8CA 1ZVHA 3TZVC 3VGHA 2PCFB 3QCVL 1A7RH 2NY6C 2X4PB 2PTUA 3KE0A 1AVAA 2G5UA 3FTSA 2PR4H 5ID1A 1XB3A 4MVBC 4JG9A 3UJJL 2GIXA 3B9KA 2XBDA 1TZOA 1OLLA 5ACLA 5C1MB 4LIQH 4B3EA 3QCTL 4AVJA 2OMYB 4FG6C 1W2KT 3LNHA 2P28B 4JB9L 4PGZA 4Q6YA 4U3XA 5I5RA 4HX1B 5KS9F 1B2WH 3BKML 2BMKB 2PXYA 5ANME 5DJYA 1RL1A 1UB6B 2CBOA 3DI2B 1FZJB 2IXQB 4J6RL 1K5NA 2GTWB 1WFTA 3QCUL 3AJ7A 3DPBA 2QPSA 3NAAL 1E6JH 5CN1A 4YL4A 4GP4B 1FFOB 5HHXL 4ZS6C 4JO3H 1JBJA 5AB2A 4A6YH 4G5ZH 4PWFA 5IQOA 4Y9FA 3G6JA 3KDPB 1WF5A 1YPZE 3DRQB 2OJ1A 1KPRA 3MJ9A 3BPCB 1W72L 2VITA 2ZUYA 1UYWH 3MJ9L 3V0JA 2IDTA 2WXHA 1BPVA 2A6IB 3OPZL 4Z7NE 5KVDH 4PV9B 1C5CH 3VFOB 4EEEA 2CO1A 2H0EA 3SBWC 3ZL1A 2I9LA 5A2FA 5LUMA 2W60B 5KSVA 4DVRH 1IC5L 3S8FB 3A4DA 2OTWB 2ZTBA 3V0AC 1WA1X 5FYKE 1A0QL 1U95B 2KUTA 2H2PC 5HGGS 2L0DA 1U3JA 2AC0A 5DC4B 1TR7A 4Z3HA 3PAZA 3JWNC 3S2CA 3C6LC 2IADA 2Z3FA 1U92A 1KBPA 4RRPM 1RAMA 2XZCL 3ARDA 3DK0A 1FA4A 1ND0A 4ZFQA 2NZ9D 5AEAA 4N0YH 2UWEF 3ZDYF 2JIXA 5ELIA 4IIQA 1A02N 2ZCHL 2H41A 3G04A 1HTYA 4DQOH 4I0PD 4J4PA 3BC9A 3T04D 2PYED 3LKQB 1HHKB 1DBBL 1GIGH 1QRKA 1JGEB 1VZGA 4AEIH 3FRPG 1TQBC 1RK1B 1W6LA 2CO4A 4AG4L 3NSJA 5J6SA 4LPTA 1UWEH 2BK8A 3L4CA 5I1CL 3TYFB 4PJBF 4N8PA 3MLXL 3QJZA 1IGJB 1XZ0A 4GP5B 3W57A 3BEWA 4LSVL 3LIUA 4K7FA 4NAJA 5E4OA 4AIOA 5BS0A 1YNKH 5HPMA 1ZANH 2O72A 4YVUA 3L48A 3ARDB 3QK0A 4P2OD 1GTFA 1RJLA 2I5YH 4RWYH 4JFTA 1KCRL 3NA9H 4L9LA 2RACA 4P5KA 5IJVB 4P2QE 1VRSA 2LV4A 3NH7L 3W11C 2ZWLT 3WE6B 1M9WA 1IEBB 3T6WA 3HE6A 4LBEB 3CUPB 2DQTH 3EXLA 4AJ0A 2ZXCA 4D0CB 1WZ1H 3HB3C 4W9HC 3G5YA 4O02B 3FH7A 2AK4B 1R5WA 3MRIB 2OTPA 5FLUA 1RJYB 1PLGL 1E42A 1YY9D 3ARDC 3QARA 1AS6A 2QVIA 2ISDA 4QXWA 5FK9B 2ERJC 2ARJQ 4L0PB 1KPRB 2YA2A 3NCYS 1XIWA 3GJFH 1P84J 5ICXB 5IOPB 5JYLA 5B4MC 4PJHA 5BVJB 4IRJC 3CZKA 3VRJA 5HDQH 4XVTL 4NZDA 3VFWA 1YYML 4JE4B 3DPBB 3HBZA 1M2VB 4J3XA 4BGLA 2YRZA 1GS8A 3ULVE 3MRFA 1JMZA 4OGAC 1T7YA 4FZEH 3WNPA 3QEHB 5CZXC 4ZSOB 3BEVA 5DFVD 1L0QA 5BJTB 1E4XI 4NDMA 3AS2A 4TNWK 4OZIA 1ADWA 1FAIL 1JOIA 4HX1A 5IR1A 5I24A 1EJOH 2Q7AA 2O6PA 3I6SA 4WO4C 2DKSA 4NNPL 4NLAA 3G6DL 4QRRB 1YC7A 3RUGE 3D06A 1HI6A 1BVKB 4M5ZH 4RLDA 1O6SB 1UWEL 3GUTB 4M00A 5IR1B 4NOBA 4LPUA 3VI3A 3MRHA 3X3FH 4HJIA 2YPVL 3BJLA 4G70B 5LGKA 1C7SA 3EH2A 5EOTB 4DUWA 1FH2A 1BIIA 3UTPE 1XF4B 1F4XL 2OQJA 3UZVA 3C08L 2R4RH 1KTRL 2KPWA 4QNPE 3QUGA 1ORQA 4ZDHA 1M6OB 3CXHJ 4RMRA 4ZRGA 5JNYA 1TO4A 3CDCA 5IBTH 3G3LA 2J88H 2OLDA 4RISH 3TN0B 4LLUB 3GI8L 1MJUL 5C9KA 3U79A 3KVPA 1DUZB 2ZD0A 3PWLB 4FFZH 2X3CA 2X4RB 3R0NA 3F7RA 5I6XC 4HIXL 3K1DA 5KW9L 4M6AA 3NFPA 5IESL 4WTXA 3V6FA 3EFOA 3V9EA 3ZGIA 5DRWB 4HUKB 5JOPE 2QDWA 3H2QA 3BE1L 3GXMA 5FOJA 3L7FB 1T2QL 3ZMEA 2FX8H 5L88H 1OK8A 5K9JL 5JIMA 1WAAF 1X7QA 1IEBA 1SRDA 1H6TA 1QSFE 4FLRA 1M05A 1WK0A 4M7ZB 4RQQB 1Q0YL 5C7ZA 2DQ6A 3OAWA 4HFWB 1R5IB 1HZLA 2DQDH 3NCJH 4K2UH 4JRWA 1HH6A 3DOHA 3ECUA 3A3YB 2W81C 2D0GA 4LVOC 5I1LB 4P5TC 3SOTA 3ZL4H 4X7CC 2ICEC 3UTTD 4PY7A 5D7LB 4H1LH 1I8MA 1ZLSL 4PP2A 4BUHA 4KWUA 2W0FB 4CADA 3KPLA 3B5HA 5DJAA 2CO3A 1T5WB 5GSRA 3AM8C 2BIOA 4A37A 4KQ4H 3MYJB 4PYHA 1JIBA 2W8CA 2G5BA 2M1KA 2NX5A 4YE4H 3T8XB 4KDTA 1HDMB 4JKNA 1HJBC 5FO7B 5KJRH 3EJYC 5F9DC 2P8MB 3KLKA 4M6NL 3HS9A 1HQ4A 2XY2A 1OSEA 1Z6JT 3I75A 4AC4A 5LDUA 4OKVA 4TRPL 4XPBL 4L18A 1E4XL 3T3MF 2UXFA 5CEZE 5F9JB 1JPGA 2AITA 4Y1AA 3QWQB 5DVKA 2F68X 2BS71 3VRJB 4XBGB 3ZKNC 4HUUA 4BSWA 4P5SA 3K6DA 2FRGP 2MPAL 1P2CB 4AUYA 2ZPKH 5T8IA 3VGAC 1OAZH 4HFUL 4AY0A 5D1ZI 2XQ0A 2R0LH 2WGXA 3OMZA 1S78C 1U42A 4QIRA 5IVOA 2P46B 2WY3B 3F85A 3T0AA 2R4RL 5FKAA 3EHBB 3CN1A 2F7OA 3FQRA 1UQSB 4XC1L 2WVVA 5IVZB 1S7XA 2R1WA 5CHNB 2YPVH 1SEBA 1UZ8A 1BOYA 4BQCA 5IFJA 3FB8B 3HMWL 3HG1E 4XNBA 3L3HB 2QDVA 1D6VH 4AGNA 3AW5A 2ZYIA 4P4KC 1DUYB 4DSYA 3WY1A 3ZRFC 4LB8A 3IDIA 1BQ5A 3VRLF 3MODL 2Z35A 4R97B 4KFZC 4U1NB 4NZJA 2ZOUA 4Y4FA 2F8VA 3IDUA 4JZNB 4JO4H 3VXUB 2GSIB 4QAMB 4U6XB 4XNXH 5CBEA 2GJPA 3TJPA 4BFIA 2VH5H 1ZV2A 3SHSA 4D7BA 4EIGB 4Z7NF 1P4BL 4I48A 4OH2A 3QIWA 4Z1PA 2HJFA 3BW9B 3T0EE 5SWQB 4JY6B 3R19A 2XBTA 1MHEB 3RI5F 1BMWA 4XVTH 2MOGA 1VDGA 2VMDA 2P8PA 4OCRH 3WIAA 1JCKA 3TO4B 4DO5A 3US1A 5I8EB 2WXNA 5D4IA 3F7VB 3SPVB 1LP9B 3U4BL 4QT5B 1MVYA 3SY0B 4L5FE 4LP8A 3SKNA 4EMZA 1QFWM 3PNWA 1JJUA 1QTSA 5E2WH 2GY5A 2XA8L 2OM5A 3QZLA 5FXCH 2VXTH 4PD4K 1E9PB 5DHVB 5C09D 4DN4L 2BNQE 1H6FA 3GDBA 1NC2B 2R7EB 4Q7DA 1BG1A 1V05A 2F53D 4F2EA 3W11D 4YDKH 3D51A 1EGJA 2HRGA 3TBCA 1JRHI 2PW1B 2WTOA 4U0RC 4G42A 1DVTA 1G7JB 4PH8A 3ZRCC 1A9BB 2EO7A 1JZFA 1GPOH 3VH8G 4O2CB 4OQ1A 3W81A 3SQRA 3T4AA 5KVFL 1RUKL 3WN6A 2NQ3A 4GRMA 1R0AL 3T2QA 4CVXB 1DEDA 3NEOA 4R96B 3PHAA 3NSFA 4HAGA 4XXDA 5D2LA 1S78D 3U4AA 2ESVD 5ABZA 1BWWA 4HS8L 1SN0A 2FUQA 3JTSA 4OFIA 4FXGA 4Z7WA 1HEZB 5IWLC 1U21A 1B4LA 1N68A 5I23A 4ENED 4F8PA 2NY1D 4KRPB 4PRIE 4Q0XH 2I5YL 3L3GB 3PHQB 3L9EA 2BHFA 1L9MA 1T7ZA 3V5HB 4OIIH 3DIFA 1RZFH 5FGCE 3B43A 3CK0H 4I4WB 1KGCD 3QZOA 3UYOD 2QQKL 2WVTA 5AAWA 5B3JE 1JF1A 4KGLA 1OAKL 3K1KC 3V4PB 1H3VA 3WS3A 2BCKA 4W93A 4IK7A 5ITFB 4JGMA 5A16A 2HA1A 4ZXBA 1CS6A 2Z93B 1WITA 4LCCC 4FNSA 3RAJL 4LSTH 4PHXA 1SHWA 2D9QB 1PZUB 4LSRL 1TQTA 2Z64C 3OKYA 4NKOB 5HHMB 1A6UH 2GI0A 3DURB 4IDLA 1MW0A 4NQCD 4L2YA 4RAUB 3KJ4B 2IDSA 2Z31D 5DS8A 2XN1A 1QP1A 4K23H 4Z95H 2OP4L 4XP5L 4KZEL 3NPZB 2PABA 4DHLA 1H3UA 2MHAB 1FF5A 3B2DC 3MYZA 4Y4KC 2F8OA 5JW5A 1RK0A 3FH5A 1U6AL 3OPZH 1BJ8A 3PWNA 5ERWB 5B1JA 1RZGA 4G6FD 4YK4C 5ESQB 3WLWD 2ZYSA 4YJZL 1A0QH 3K72A 4I2XB 4A63A 4JRYA 4E2OA 1G9ML 4ZT1A 3MVSA 4HDIB 3K72B 4FLSA 4XBPB 5IG7B 1GC1L 3MNZB 4BWUA 1P7KB 4DTGH 3D48R 1AIFB 3NP4A 1NCAL 3UTTA 1VEMA 2J4WH 4Y9BA 3OSVA 2C4FT 4WWNA 4B95C 4IJTA 5DZOA 5EEYA 2PWGA 1EAQA 2WBXA 5BRQA 1C08A 4Z78A 3GXNA 4N0UB 4AI7A 2I9TB 1JCVA 1UGNA 1HH9A 4HJ1A 1VCBC 5EO0B 1T6WA 4WAFA 1ROWA 2CKBA 4U1JB 2VR9A 4M48L 3WTTA 3QNZA 5GJSH 4EVNB 3L3JB 1SDYA 2UZYA 5D7JA 5LXVA 4HP5A 4BQ9A 2QKSA 3QUYA 3TJEH 1IE5A 3V6OA 3S4SA 3ZHNA 1J1OL 1E7UA 4GIOA 5I0DA 1NPJA 1P9MC 4BINA 1KJ2H 5E6UB 1F4WL 3R06B 4Y7MA 5CUSL 5CEZH 3IDIB 3SDXF 3CSYA 3CXHK 4MAYD 4QHUB 4M7JH 4NIKB 1LO5B 3QPKA 5IHWA 1TCRB 4GIPD 3WHXA 1HH6B 4GINA 3RI5K 3UMTA 1UD5A 3IDNA 3QUKB 1I1AB 5E6IA 3VNZA 5SWZE 3BUPA 5JIDA 3WIIL 2D7NA 1CLVA 3EOAB 5DFTA 4FGMA 2VM9A 5C7XL 1D5MA 3TZVD 1K9TA 5DRZA 5CEXB 4AJYV 3KWVA 2X2HA 4L4VD 4G8IB 3HFML 5L2JB 4K3DL 5DD6B 4KUCD 5C97A 4FFYH 2ZKYA 1KN2H 1DBML 5AOMA 4ZYKA 5LXGL 3IXAA 4ZFOL 3PL6A 1MQKH 1WS7A 3SODB 1NJ9A 2HT3D 3VXQA 3E6FA 1A6ZA 1SBSH 1A7OL 5DJCB 1CU4H 3DI3B 3BUYB 5I19L 4NO3A 5KANG 4XAWL 4PVMA 1QEXA 5I74B 1AIZA 1OAXL 3RY6A 3RG1C 3KHOA 2NY2C 4WJG3 3RZCB 4NRYB 4HC1A 1F2QA 3DO7A 2XETA 4F33B 2MCPL 3KPRE 3EJZD 3L3KB 4ZW3A 4YDLB 3GSNH 4HWUA 3IU4L 3Q01A 1INDH 1IKOP 2DV6A 3N1PC 3ROOA 4ZAKC 3P3SA 5ADOH 2X7LA 4TQEL 1T3FA 2B0SL 3SKUD 4CDGC 2X44D 4IRZH 1CURA 1BFTA 4PW4A 4ODTL 5E99H 4WHTA 4CADB 3B37A 3RZCD 1DSFH 1DJSA 2Y7MA 3CXFA 5DJ2B 3WHXB 4BZ2A 4U1MB 1V3MA 3GSVB 1L9SA 4KO5A 3KYKL 3STLB 3QI9B 5J12C 2HJFB 4ZSOA 2AZUA 1VFAA 1CF8L 1ONQB 4PVBA 4LLVB 3GSRB 1I7UB 4TUOA 3V5HA 1RVFL 4WFFD 4ZMXA 3Q6FB 2BX5A 1MIEH 4GO6B 3WXWH 4ALAC 4PRAA 3RWGB 2X1OA 4URTB 1TJHH 4HPHA 4Y16C 4NJAL 4HIIB 3ARBA 5AQ0A 2VZTA 4OD2A 5GRZA 3UG3A 5ANHA 3DETC 2R0LL 1AACA 1YRKA 4K0OA 4JJHA 4JFQA 3GMRA 1VADA 2JB6A 3L5JA 2AXJA 1MG3C 4XCCL 1XSIA 2IGLA 4OLEA 2MQGA 2Y1YA 1C08B 3QEQA 4N1HB 1H5BB 3CX2A 5EOQL 4Z78B 2I9TA 1RUML 2RB8A 4K7PH 3EGDB 3H2PA 3MV7A 4MMXC 1UVQA 3ZHKA 5GRVK 3NK3A 1WCBA 3IS0X 3BGFB 2XFXB 3QFGA 3UC0H 15C8L 4I77H 1U8KB 3L4XA 4LBEA 2Z4TA 2P52A 3KPQB 1H5BC 3KR3H 4FXKA 4LLMA 4LLVA 2VQUA 1QBML 1Z3GH 3DO4A 4P23B 3SDYH 4Z77A 3V0GA 3VSVA 2AMGA 4AYMC 4I0PA 3LQAH 3M46A 5F1NB 5IB2A 2GUYA 4NQXB 4WSJA 4YE4L 3V4VB 4FQ1L 2NX5E 1U9KA 4K7FB 3T2OA 3ARDD 1YY9C 2WUCH 1YECH 3N40F 5DRNB 2NW3A 5FECB 5K1NA 4HJGA 1FZMB 1IGCH 1QWUA 3M7OA 1DSYA 3HC2A 3LAFA 1CC3A 3WGUB 1ZE3H 3QB7C 2HTKD 3JUZA 2EDLA 4FFWD 2BLFA 3IN0A 3M1BB 4FNRA 4ZS6D 1IGYA 3JYCA 4HEME 3VWJC 3V0WH 2XWEA 3QEHA 1RULL 4EUPA 4ZMOA 5E4AA 5HHQA 2OSLB 1NLBH 1VFOA 5C6TL 3CFEA 4P5RA 5DJAB 4IIQB 4J6IA 4DK5A 2ZCLH 1YO4A 4I5BA 5CIPH 1EZVY 4PLKC 4UM8B 4XVJH 4C56B 4NQXA 1N5AB 2A74A 2R4SL 2X4UA 3BN3B 1YEJL 1N64H 3EZ8A 2IALA 5F1IB 4LEBA 2AHIA 1J0YA 5CEZL 4GAJH 1GY1A 2OJZH 4NC2B 1XD1A 3KVQA 4M3JA 4O00A 5JXAL 4LLDB 4FXKB 4NO3B 4KNSA 1L7IL 4A04A 4P9MH 1LO3H 3JWDC 5FKAB 3G5YB 2AABH 1KXVC 8CGTA 1TFPA 3V0FA 3VXOB 1EJ6A 1BVLB 1MCJA 4O5LH 2JCCE 4P3DB 3HCVA 3JXAA 2ADJB 2WSKA 3KWUA 1J5DA 1P2CA 1U0QA 2FBJL 1ECZA 4HW6A 5ALBH 2XKSA 1JTPA 4O2CA 5EH1A 1A4CA 3GPEA 3KBPA 5A7EA 3ZE1F 4Z7VE 4DP0X 4HLJA 4JREC 3WLBB 4F7EA 4KI1A 3I6KA 2X4TB 1C5DA 1I8UA 2Z4QA 3QUXC 2Z7ZA 1GC1H 2LLNA 1U8LB 3LQZB 1AOZA 1SVBA 4YPGB 3RWGA 3ERXA 2HLEB 2GUOB 2GC7C 2ZICA 2YD0A 4JCLA 2HFGL 2HMID 1QFHA 2G2RA 4NBXB 5EOCH 3LB6D 4FTVE 4R0LB 2CAKA 4GXVH 2J1WA 1I9RL 1MCCA 3L3OC 3VMPA 4PJ9B 5F7LB 3A4AA 4DZBB 3D25B 1JGLH 3OHXA 4JPVL 4HKZB 4JHWH 2H3NA 3JT0A 4FLHA 2F7QA 4OIBA 3SGJC 1K6QL 1CBVH 3MV8B 4PJBE 2OP4H 2W0FA 4LSQH 3EYQD 1NL0H 1MCQA 1TFHA 1LMIA 2G0LA 1KCKA 3WJLA 4MNGA 1B0WA 1LP9E 5KYUB 2N0KA 1EDYA 1UD6A 5C3LD 2ITDB 3AQXA 4IS6B 4IBSA 3O41A 4FMVA 3R4DA 1TLKA 5FA4A 5EZJB 1HILB 3CHOA 1THAA 2XU9A 3TURA 2YD9A 1ZSDB 4GOSA 2B39A 1ZSHA 4K3GA 4GW5B 4K07A 1D7CA 5AVUB 4YS4A 3ARXA 3VYOA 1HCYA 1RZFL 3UCRA 5MENB 3NBNA 4CMHB 1TETH 5T3ZL 1CFNB 3W82A 4AITA 2MRYA 4L2LA 3MZGB 4X9HA 1G0DA 1MOEA 5FLVA 2IF7A 1KJVB 4J12A 5IIEB 4R4NC 3CZLA 1IAOB 4OUUB 5A6MA 3X13A 1S9WA 1G7PB 3E3QE 3IGLA 1KTDA 1S8DA 1SXBA 4N26A 5CJQH 4FADA 1URLA 4FQHB 1H8SA 4BH7A 4LIQE 4QKXB 4WCYH 4YHLL 4YMPA 5E7BA 1PD6A 2B20A 4NN6B 1BIIB 3MUY1 4PWEA 3HUJE 3LH2H 3WLWC 4U6YB 5LCVA 4X0KB 3FFCD 1YPZF 4C56A 1SY6L 1WICA 1WT5A 2JCWA 2QFPA 2VSCA 3MLTB 3NIFB 1FV1B 3ETBF 5F9JA 3VD1A 4YDIL 2HUEA 3K4DA 3T9WA 1AI1L 5T1DL 3KMDA 4G3YH 1M2OA 3HG1A 1MRDH 5KSAC 1QLEL 3N41B 4B9CA 2JJTA 3JV6B 5F9WB 4KC3B 5BV7C 5F2FA 3MX0A 2OSWA 4XOCA 3DJ9A 5BMFL 1A6VH 3MKGA 3KYOB 1JV2A 1LP9F 1XMEB 4KJYA 5AYTA 1MCPH 2C9QA 4DP5X 2QGBA 3BWSA 2XUWA 1FL5A 1MCSA 1M3IA 2BFGA 3QNXB 3NACH 5BNXD 1EUUA 1PY4A 5DFAA 4X4YA 3C5JB 4JFFD 1M1XA 1VZHA 4GG8B 4PJIF 1LM8V 4H44C 1EA9C 4PJ9C 4JFWA 4ZUWA 1QACA 1MIMH 5GRVL 3RWDA 4ALAL 4JFEA 4YUEL 2YGVA 1U3ZA 4JY4B 4DKFH 5A7BA 1CGSL 3L3DA 1EHNA 3P3UA 4MSWA 4YBLC 3VCLA 5I0VA 3MLRL 4F8OA 3K2UL 2FT7A 3BHBB 4XPHH 4PTTA 1S3RA 4PI2A 3TX4A 3VQMA 4MMZC 1RUQL 3F84A 4ZOAA 2DMBA 2R27A 1KTJA 4XNUL 1HWGB 2AERT 2CMRH 2NT0A 2Y23A 1AKJA 2DWEB 2W60A 1UVQB 4KV5F 4PJFE 1X6NA 4MQ7A 4M7KH 2ZKHL 5B38B 1PNDA 1URZA 4Z7VF 1CLZH 1LDPL 3VRIB 4R3SB 5I19H 5IUCA 1RPUA 3O4OC 3ATDA 1PZ3A 3VGBA 4LPYA 2B3IA 5L4JA 2CO6A 3JBG7 3D4CA 4NZTL 2ZJSL 3G5ZA 3SGKC 1PKQE 2VIRB 3MZTA 4JFUA 2P80D 4Y4FB 3C5ZC 5EU6B 5CGTA 4X6EA 2Z93A 4IRZL 1FG2A 2VXUL 4M9OA 5ADOL 3UG4A 1LTXA 2Y07L 4KX9A 4BFKA 1FIGL 4NQTA 4OAWB 2VWEE 4B9KC 3WO4B 1PMYA 4TN9A 3BVTA 3QDMA 3TM6A 1IAII 1GW6A 3DIFB 2OBGA 2R0WH 4YHML 5EU4B 1G4RA 4R6UA 4YQXH 2RR3A 1NUGA 1OAXH 2G4EA 1XAKA 3SKMB 3VXMA 2XXCB 2KPNA 4Q9RL 1R3HB 1WC7B 2AVFA 4JZOA 4NN6C 2NY7H 1OM3H 3D25A 4U1IA 5FS5A 4BQBA 1XGPA 4R26H 1E9OA 3GEWB 3W3BA 1N6QH 2YMXH 2JVUA 3QUMB 5GRXG 3MUJA 3RIAK 4GT0A 2BSRA 5KBNC 2EH8H 1U2CA 1VF5C 1XCQB 3I9AA 2CH8A 3O9WC 4NO5B 3TFBA 2F54E 1PCSA 2PP7A 1HFUA 1TJMA 5J1TC 2VE6B 1F6LL 1YYLH 3G08A 4MLSA 3GTTA 1Z9OA 1L9RA 2CLVB 1JDDA 3O6FA 1KBGL 3C60C 1HCFX 3A47A 5J11C 5IWLA 2XYBA 1QO3B 3EDEA 1QBLH 4PJAF 3N44B 4C4KO 2AGJL 3FQTA 5IJKC 2J1YA 4Y2OB 3MCKA 5CJQL 5IVXF 2WBJC 3T0VA 2C26A 3OAZK 3POCA 5J3HC 4UDUB 3QXTA 5E0QA 5EC2A 1YY8A 2WP3T 3RTQC 2Z9TA 3LRLA 5AW7B 5JHBA 1CR9L 3MROA 3SGKA 4LLDA 4UM9D 5KBMA 2OYKA 3S4SG 1RJZA 3ZE1E 5BZWB 2NR6A 1O5DT 1CDJA 1U2HA 2OJEA 1NC2D 4B0MM 3C60D 4MRBA 4XP4L 4HUXA 4HIXH 5GGVY 4F92B 5KW9H 1MFMA 4ETYA 3S34H 4N9GA 1AJ7H 1LO5A 4MSWB 2JCCF 3WSQH 5IFHL 2FVNA 2HTLC 2WXLA 3EYOA 1KTDB 1S8DB 4Z95L 5LNEA 4ELMA 2D03H 3GSNB 5D6CB 1GL4B 1SEQL 5DD3H 1OP5K 5E8OA 1FQ9C 1T21B 5GGQH 2F15A 3IMUA 3HNSH 5C0CB 3FSAA 3D0AA 3GZQA 4NKIH 1S46A 5HI5C 4GUOA 1MHHA 2E9GA 3DBSA 4Y4FC 3WNIA 4Z23A 3FJTA 4UZSA 1WHPA 4WI7A 3SJVE 4JN1L 5IF0B 2XCMC 1A7NH 4Z7OF 2UYLA 3VI4B 2OL3B 3O4OB 5EPMA 4Y2DB 3VACA 3QIWD 1AGBB 4UQ9A 2WVVB 2I25N 4MAYC 1OOWA 1SLWA 1NOFA 4PGDA 1ZTMA 3QORD 3V5DA 1HX0A 3LKPA 1IARB 2M26A 2NNAA 4HHWA 3EDDA 4I89A 3IDJB 4LLQA 5CF3A 5TQ2L 2LU4A 4X98A 3TNNA 2X6UA 3SE9H 1K3IA 1E9OB 1SJXA 3OV6A 3HI1A 1BFOA 4C83A 1IU1A 1E65A 2BJML 3FOMB 3LKPB 3NSXA 2YD3A 3WELA 3I02A 4E5XG 1Z32X 1GAFH 2Y6SD 3L5IA 4NQQA 3PAVA 1JK8A 1KYAA 1HZHL 3D3VD 1GPOL 1YEKL 5EU4A 1PLCA 4RGMB 4ZNEE 1HE8A 2Q9OA 3BAXA 1PCXA 3TU6A 3SQBB 3GBLA 4ZFZB 1EZUA 1HQRA 4AV4A 1LEIA 2X28A 5D7SL 5DYOA 3GMRB 4ORZC 1FP5A 4FQCL 1KBWA 3T0XA 3TBBA 1GZQB 1II4E 4FRWA 1XT5A 4R97C 4KZ0A 2VR8A 2HJLB 2ICEA 3PPEA 1JZ3A 3HI5H 4FG0A 1DLHB 4LU5H 3U1QA 5BW7C 5BV7B 3ZE2E 4AKQA 1P9MA 1A3RH 1CD0A 2NYKA 4DN3L 4KKQA 1VGEL 3ML9A 5HHNA 4QOKA 4IW4C 3W5MA 3C8HA 1FZJA 2QSCL 2VKWA 4HT1H 4KX7A 3N43F 4MD0A 3UEQA 1QI4A 1SOQA 4OCRL 3D2UB 2V4LA 3US9A 3ILEA 4Y4KD 4DGIL 3EBIA 4MQ7B 3WJJA 1X9QA 4PJGF 4GG6E 3SJVB 3KM2A 2F8IA 1QUPA 2F1BA 1PZ5A 3ILQC 3LB6C 3AMKA 5LWYH 3ZE2F 3GLAA 1QEWB 1XL4A 4WI2A 5B39G 2X4SB 2ZCKH 2CJ3A 2CALA 3FRPA 3D3VB 4DZBA 5LGYA 1JHTB 5CR1A 1G6VK 3U46A 3MV8E 4PJBB 1KUMA 3BDXA 4W9IC 3B56A 5A2IH 1G1OA 2YXMA 1I7TB 1LO0H 3HBQA 3SDCD 2X0VA 5I30H 2Y36L 5DJCA 2QHRH 3WDHA 2E27L 2DMCA 5EU3B 2XVGA 4GSXA 1MHPH 4XAKE 3EG9B 3CFTA 2RBLA 2RALA 3QJRB 3ATAA 4W6WB 3ETBJ 1FORL 5T3XD 4MJ6B 2OMWB 3RVXD 5IK3A 2OMVB 4QXGH 4FFVC 3MV7E 3UZVB 3HCVB 3FMGH 5L2JA 3SDCB 3ZOAA 4AYSA 5DR5L 2HX9A 1IAIH 3M45A 3OZ9L 3HC4H 3G04B 2VDOB 2J57A 1WTGT 3AXLB 3FTXA 5DMGD 1J5OL 2VH5L 3QJXA 4X5RA 5DJDB 4MNGE 1K8DB 5HI4D 4DUXA 4N0RA 2FL5A 4Y5XB 1JXKA 3DMMA 4GW4A 3SKJH 1BZ9A 1W72H 3WD5H 1JF1B 4JY5L 1XV8A 4NZRL 2WLIA 1ACXA 1MCOH 3BFWA 4OVUA 4W4OC 4ZAKB 2FB4H 4EIBA 4MWFB 4DESA 3SYPA 4CVWA 3CPUA 3WFBL 4F37K 3QCUH 2ZIDA 4JO5A 4OB5H 4TKWA 3UOAB 4JFSA 1QLEH 5HPOA 3US0A 2WINA 1YYCA 2KC0A 3ABLB 3OKOB 4E9WA 1YEEL 3LZNA 3CC1A 3Q9PA 2N01B 4JM4H 3Q6GH 4N8VB 4J3TA 1KGCE 4ODTH 4PP1D 3P4OB 5GZNA 3IF1B 1R5WB 3E8UL 3MRIA 2AI0H 3BO8B 2C1PB 1E6OL 4LFHG 5F21B 2G75A 3K71A 1IM3D 1HWWA 5DJ6A 4JPKL 3RY5A 1G7MB 4XPBH 4FQJL 4QHMA 2XG4A 5IB3A 2JJSA 2OMZA 3GRGA 4FFTA 3RPIA 1U8HB 4R5TA 5BO1L 2WBKA 3O3DA 2YN3A 2W9EH 2Y2TA 4Q9CA 2A6DB 1J5HA 5CEYA 1QNZL 1G7MA 4U7SA 3EH4B 2X6MA 1A7OH 3QUXA 1N4XH 2F74A 2FX9H 1V7ML 2NY4B 2VN6A 2B15A 4R4FL 4WSGA 1V55B 3V6ZA 4MAYB 5AVYB 5DVNA 3LHAA 3S0PA 3VW3H 1MJUH 1TTBA 1TZGH 3CLWA 3PQYE 4N8VA 3CDZA 2FR4B 1PIGA 4PJFB 3H3PH 3X1FA 1VADB 2JB6B 2X89D 5ECGA 3RY4A 3S3CB 1GZHC 4Y4HA 5FYKU 4CMMB 3ZUNC 1A9EA 2A9AA 2Q5BA 4LCUA 1CFBA 3LKQA 3MLZL 2R15A 4LVNB 2HT2D 1H3GA 1K4DB 4LQ1A 4XXWA 1OP3H 1BF5A 3SDDD 3GSWB 2LU3A 3HG0A 5K9JH 3HBPA 3LEXB 4HGMA 4M5ZL 3K6FA 3X1NA 1I8MB 4GG6F 3FT4A 1PG7W 3H4FA 5C0BE 3RWHA 3LD8C 4U4BA 2XZAH 2WLHA 1AGFB 3GS7A 1FO0A 4HS6B 1FFPB 2RTTA 4IKLA 2ITFA 4U31A 3RUGB 4AE0A 3NJJA 1KCUH 1JHTA 3INOA 4XRCB 1QA9B 2AJZA 4YLQT 4PRBB 4OV6F 5LG6A 4I1NB 3B3BA 3BT0A 3FQRB 4FJZA 4KAQH 4PJDE 4B5ZA 3QDGE 3BD3A 4HUCA 4R7NA 4UT6L 3ZZ1A 3QWOA 1XR9B 2GJJA 4KH9A 4WK0B 2IPUG 4WUUA 2AEIT 4HJ0D 2KQMA 4CVXA 3UTSE 3SGDH 3WOVA 4ANKA 4H0GA 4YGVA 1PZ2A 4AQEB 1XR8A 1N0XL 4R7XA 2MCMA 4DP8X 3APMA 4PJDA 7PCYA 1OY3B 1JPFB 4APQB 4Z76A 2E8YA 4WJ5B 4OVVA 3B2MA 3L17A 4QXTB 1VZIA 3BMVA 2N3JA 4LRNH 2WBWB 1LEKB 5SV4A 3F7YA 4QXUL 3WKML 2OZ4L 4KNQA 1TQBB 2QJDA 3Q1SL 3QDME 1Z5HA 4HWBL 1WZ1L 3IGUA 1IMHC 2FO4A 1MCRA 2O26U 5E51A 1Y1DA 3HN3A 2FBRA 1JHKH 4K71B 3TBSA 4M62L 5FW8A 3DBXA 1CGUA 2HFTA 1R3HA 3AG2B 4K9EH 2BNQB 4XO9A 3QIUD 3QUXB 1PEZA 4YL9A 3PJSB 2R51A 1Q0XL 3OM3B 4XAKD 3OMIB 1XGYH 2PKDA 4HDIA 4IU2B 4I3GA 4C56E 2R1XB 1TQWA 3DX4A 2ZKWA 1LHZA 1MLBA 1NAMB 5GJTL 2NY0B 4AGOA 4MD0B 5TE4L 1FL6A 4JEGB 3SD2A 1AKJD 3QZWA 4W1TA 1DJGA 2PLTA 4PWJA 1WIOA 1PY0A 5ESQA 1DQDH 1BM3H 2G9HB 4ECNA 4RQQA 3VG9B 5GS0L 2RMNA 3L9RA 3N91A 2ICEB 3OF6D 1GGCL 3C5ZB 2EEXA 2MJWA 5F89B 5K5YA 4PJHB 5BVJA 1AKPA 3B2PA 2KHAA 3BKCL 4GI6A 1IL1A 1UOKA 4N2DA 1IEAB 3BH8A 4N0YL 2B16A 3UTTE 1XTMA 5E5LA 1Y07A 1NCBL 3NA9L 4EPSA 3UJTH 1HZKA 4GSDH 5FGCB 3NESA 4OY9A 2WWOA 1C1EH 3BPNB 3L3IA 5CILH 1DFXA 3V4PL 3KYMB 1T20B 5E95B 5F7DB 5JNYB 3V6BR 2H26B 2YJQA 1R0AH 1PG7X 1OALA 3INUH 1DBKL 3NGBB 4Z18A 4D9RD 5JW3H 3HUJB 2EDDA 3IRZA 1CL7I 3LXUX 2A2QT 3RFRA 3H9SA 5JDSA 2F54D 3VI3B 4NUGL 4JPQA 5L9DL 2C8NA 2WNKA 3FFCA 4HZ1A 5TGBB 3SYOA 1YMHB 2WCSA 3WNOA 1DDHA 1CCZA 4G5ZL 3IMSA 1KV3A 2LW3A 3CSBA 2V9UA 4QNPF 4YE0A 1DVUA 3T2NH 3KPSA 2LAGB 2P8MA 1AZNA 4EDWL 3MACH 1IGYB 1BDYA 2WUBH 5HGHB 1P1VA 5CJBA 4A7UA 4GSDL 1A22B 1A9BA 1CQYA 3ZW3A 4X8GA 4DVRL 3S88L 2A1WL 3EJQA 4JDZA 2C4XA 4R8WL 4MDJB 3QG6A 4MJ5B 5J1AB 1KLGB 1JPFA 4APQA 4Z76B 4CGTA 3EH3B 5J0BA 1KIPB 4L9DA 3AREA 3BWZA 1XIWB 2X2UA 2ZOLB 1ASPA 2EICA 5ICXA 5IOPA 4NQDE 5D70H 1WIPA 4CW1A 5HHOB 5C0IB 3VD4A 3QG7H 4DKTA 1WFJA 4S0SD 4XVSH 1AR2A 1JG9A 4GS7C 1NMBH 1EWHA 2APBA 4RFNB 3CCHB 2VAAA 5D7KD 3ZZQA 5PCYA 1UUNA 3UAJA 4JCMA 3BSZA 4RA3A 2YEQA 4K5OA 1ACCA 4MHHG 4EOWH 1XIWC 3K8MA 4GO8A 3BSZL 2AJ3B 1EHLL 4K94L 4YDJA 4KK6C 2F54A 3ZE0E 5B38G 3QEGH 3UIYA 1X9LA 3QI9C 1WZMA 2AZAA 2WQVA 1G7JA 3E9TA 4OF5A 1VHPA 2J5LB 2R1YB 5TDOB 1E3FA 3EJZC 4MCYB 2K3HA 1PF3A 5I5IA 1B0GB 1FO0H 2AQTA 4LXFA 4G7VL 1WJ3A 5F0JB 3ESVF 3B3IB 5I0YA 3T4YB 1HHHB 4MAZA 3H7LA 4PJFA 3LZRA 1CFVH 1AQDB 3DVIA 2BMKA 2PXYB 3MRNA 3PS6A 2XKUA 2R1WB 5IVNA 1J0JA 1BBDH 5DVOA 2DLHA 2MNJB 1U8MB 1U4EA 4A7GF 5J1SC 2IEPA 1CDCA 3GMPA 2MWCA 1F41A 4EI5D 3KLAA 1XCTA 4JKPL 3P9WB 4Y16D 4KKAD 2NQDA 1CFTA 3L3KA 5L4MA 3FU6A 4OAWA 5I2IA 2YQGA 3BHBA 4TXVB 3M17A 1A47A 4N8CL 2JKXA 1J9QA 2VXSH 4TNEA 5KS9B 1BGXH 3K6OA 2CLRB 1UTDA 2FECI 4PJXB 5EC1B 2QZ5A 4BV1A 4NQSB 3CQFA 1LK3H 3GBML 4G1MB 3P4OA 4H8WH 4Y2DA 3C6LB 3PCYA 1TJIH 2VT0A 4GB9A 3C6SB 3EDKA 1ZEAL 5B8CC 4G7YH 4XMVA 4GKOA 2CWRA 2JLPA 3B6SA 1JGIA 1M3JA 1I3GH 5T5NF 3K8KA 4RNRB 3BPCA 3LV3B 4EAEA 5IVZA 4AYFB 5CZVL 4JFHE 2LU5A 4ODHH 1T2QH 1CJYA 4FQ2H 1SBBA 4Z7UE 3MN8A 4NPJA 4PR5A 1ZPLA 2NR6C 3D5OF 3BIKB 2YWZA 3IDNB 4M1GH 1H3PH 3CX5J 4RMUA 4WWKD 3QQDB 4R4FH 4Q52A 4AJWA 1YMME 2WSPA 2IPKB 2R23B 2W07B 3IFNL 4QYOA 1KELH 1M1SA 3ILDA 4XMUA 1Q9LA 3N44F 2PXYC 3O45B 4PR5B 4PM1A 1CL7H 4MFHA 4W81A 3FCGA 4NQEA 4RMQA 5I17B 3ME0A 4XHQA 2OCCB 2O1AA 4AWJC 2X38A 4OGYH 5ISZB 3B83A 2CM5A 1S7UB 1RZKL 1P6AB 3L7EB 4X7SL 1IVTA 4GMTL 3AFLA 4XVSL 2H1PL 2J5LC 5AYQA 2PCXA 3R7QA 1FZOB 5D1ZA 4X5XA 4XNYL 1PEWA 4OLXH 1X5XA 1FL3B 5TPWL 1YJDC 2GSMB 2QQKH 3M6DA 2R29L 5ITBH 1GW0A 1MPAH 2BHZA 2ALWA 5EZJA 4P5MB 4V11A 1MNUH 2DEXX 3ELAT 1ORQB 2F5BL 1RFDL 1PDKA 5AW0B 1E9QB 5ILTH 1LK2A 2FHFA 1VJSA 1WUZA 3CN3A 3VQLA 1DJIA 1FNHA 2BSED 4PV8A 2ZX6A 1UD2A 4NM4L 3D05A 2HVJB 2CNYA 1I1YB 4LL1A 4N68A 3ATFA 3GMNA 1RZ8A 4KHTL 4A7QA 5JQ6L 4HS3B 4UQDA 5I1EL 5T5FL 4RX4A 1V7NL 2J12B 2QSQA 1P5UC 1HHIA 3LN9A 3P54A 4LRIA 3SKOB 3UX9B 1W0YT 2P45B 1CF1A 3FDWA 3B8SA 3M8OH 4QF1A 1SJEA 1P4LA 1ZVYA 4WUKH 4L4JA 4TF4A 1KIRB 3MU3A 4JCWA 5TE6L 4CL7A 4DOHB 1D5IL 1QKZL 2WLLB 3L1OL 1FFQA 3HVNA 3LKNB 4Q9QH 1UEMA 3UH8A 2AXGA 2P24B 1KIRA 3LMJH 3R1GH 2ZSVA 5DI8B 3H85A 4YSDA 1OGAE 1QWHA 1TTGA 3GFUA 2QADC 3LMJL 1QHPA 3BDYH 4W4OA 4PRPA 4O02L 1U3HB 2R1XA 4FX5A 2N7BA 3BISA 1NINA 4E42A 2EDYA 2F9BT 3RWFA 1O7DE 4YHYB 1E4KA 3UYRL 3DLQR 4NO0A 4PB9L 5KVEE 1G6RH 3HZKB 4HD5A 1E8XA 2WXRA 4XXDB 3QWRA 4FP8H 4NZ8A 1JUFB 4HSQA 4U4IA 4O51A 3FO2A 4ZOCA 2O5YL 4XBGA 2XDHA 4FYSA 1E2WA 4KROB 4P2CG 4PCTA 5ABDE 5HY9B 3QJHB 1RURL 1MFNA 3CVBA 3DHMA 3MRGB 4XBEH 3ZE1B 3MMEB 2APVA 2J25A 3RVVD 2NYYD 4UQCA 2F18A 2YAOA 4HC1L 2OK0L 5IBUB 1JGEA 4WI6A 4E36A 3FTGA 1E40A 4P48A 4TUJB 1SNRA 3L7EA 1TU2A 1D5IH 1ZDSA 4BUGA 1W80A 4ODSH 3TWCH 1IC5H 5JR1L 2MPAH 3EYFA 4YSEA 4Y89A 3VU1A 4JPWH 1Q1JH 3LS5L 3D39E 3K3QA 1OAUH 3TCTA 5F1NA 5IB2B 4W70A 1C9SA 3GMQB 2HJKB 1N0XH 1RIVH 3C9NB 2D9CA 4HS6A 1EGJL 1OF0A 3O2DA 4J5VA 4OI8A 3IM1A 2GG1A 4KKLC 4N3UA 4RZCA 5CCGE 4R9HA 2YXFA 5E8PB 4LVHC 1WFNA 2CBPA 3H2WA 1XB6A 3QFJD 1OW0C 1DLHA 5DWUH 2O5NA 2X1XR 5C0GB 1NAKL 4I3SH 4F2MA 2H32A 3KPSD 1ZOXA 4P46D 2MCAA 3WCYA 4OD3L 1YEDA 1IL1B 3JV4B 1A6WH 1WD8A 2FTAA 2ZP8A 5E00A 3NJNA 4C56D 3D52A 5TDNA 1QFOA 3RBSA 2CJUH 3QCTH 3LPFA 3MBEA 3ECVA 4G6JL 3SQOL 2VC2L 1KJ3H 1U8NB 4OZHE 2CDGA 4PV1C 4ZDHB 4FFVD 4CA4A 4KZDL 1AAJA 1Q0YH 4GMTH 4GFTB 4AL8L 3VFUA 1XCWA 1TO5A 2Z6FA 4AEFA 1ZVSA 1UACH 1DBJL 3HI1B 3F6LA 4N2EA 3LS4H 5KJ4A 4UTBA 2ZWYA 3LVTA 4X4XA 3LIZH 3DJTA 2A99A 3EF4A 3MA7A 4FQLL 3PDOA 3TCXA 1YG9A 3VGGA 1QAWA 1UWXK 2ZUUA 1DVFB 1QR1B 1TEYA 1U4FA 2ZG3A 2FE0A 2W91A 2Z7YA 3OQRA 4S1QH 4XP4H 1NFDA 1OTTC 3QDMB 1F6AA 1KBKA 2X41A 5CLZA 2XX1A 3ISRA 2PCPB 3MQIA 3ZVVA 3N9GL 5LAXB 4GKZA 1KGXA 3VXME 3L6FB 2W9EL 3D4YA 1F4HA 4L4VB 1F97A 3O3AB 2JFCA 4H1LA 2VXQH 4FQIL 1J9RA 3RWJB 1UZ6E 3OBAA 3ZKMD 4FXGC 3KPPB 3B2UC 4PUBH 4N8UA 2VDQL 2XACC 4NT6A 2ENYA 3QZWG 3TTYA 4OCSH 2A38A 4H8HA 1ZRUA 4WW2B 3FAWA 5ITFA 1CG9B 3WMPA 2BSSA 3WO4C 4F8NA 2AJVL 4DFHA 3S3BB 2ICWA 4NNPH 2OPCA 3GBMH 2V5TA 1BZ9B 1YNTA 2OMTA 5GRWA 1HHIB 4MQSB 1RJZB 2YEVB 2R0KH 4PJCF 1MQ8A 1YDPA 2CK0H 3LKRA 5D1ZD 2IQ9H 4JRLA 4QRBA 3RIKA 4ZD3L 2C3WA 1WLHA 2VQ1B 35C8H 2NY7L 3CN0A 2VDOL 5I6MA 2ZOLA 1DVYA 1WSST 2YOAA 1G7QA 4KUCF 1OF2A 1XGRA 1KGWA 5E7FA 3CSYB 4QHUA 3SEPA 4AW4A 2JIXD 4KVNH 3CQPA 1TNMA 4L3EB 3V2AR 5ADPH 5JOFA 3HPJB 3KPRB 3VVWA 1RCYA 3E9UA 1Q1JL 3LS5H 3FBQA 2XRAL 4L8DA 1QUNB 3TJHC 3QG7L 1A25A 1P4IH 3Q8FA 3OJDB 3VXRB 4BKLB 1I8IA 4WENB 2JQZA 4OD1L 2AV7A 12E8H 1IAIL 3IKCA 1HHJA 4Z6AT 3A6CH 4HWEL 3U48A 2DIEA 3GXFA 3DVGB 5CEXA 1YEFH 4XPTL 3HG1B 2NUPB 3HZYB 3GSQB 5C0JA 4JRXD 5JXEA 1RURH 2DYSB 2CUAA 5ANMA 5AVTB 3O45A 5D5MF 2WXPA 5H94B 2YIHA 2Y7OA 5A2LH 2ZKHH 3I9IA 1AQKL 3T77B 3TBYB 1JZ8A 4Z7WE 1FRGH 2VISB 1BZOA 2Z7UA 1HS6A 4TQHA 3ZYIA 4ZQTA 3TH4T 2BW5A 3R06A 4JZJC 3MRFB 3TZVB 5IQMA 5EF1A 2V33A 4LF3A 5LGHL 2XFXA 5LQBH 4WFHE 1NFKA 3A21A 2HG5B 3ARFB 2H0PA 3FHEA 1T2JA 1OPGL 3JTTB 4EN3C 1OP5H 2UZYB 4WF7A 3PV7A 2NQCA 1G5AA 4NC1C 4U1LA 4AC2A 4BUQA 2XKNA 3CHRA 4FQQA 1FPTH 3UBXG 2HKFH 3RIFF 1E8WA 2AANA 5C0FB 4BFBD 3ABZA 4WI8A 4L1HA 4MDIA 3UPRA 2EVHA 1BXUA 5D5ME 3GGWA 5B38A 4E9VA 1J8HB 2ZUTA 4J1UA 2IDUA 2QT6A 2VZVA 2XWDA 4ZX3A 3KPOB 2GY7B 3EHBC 4NQDA 1MW3A 4RFOH 3WIHA 3CIQA 3A24A 4F24A 1T5XA 2YUVA 4X2UA 4TUUA 3V5KB 5JPMA 4R4ND 3MOAH 5HD8D 5CJ5A 1CWVA 2AV1A 4YHKH 1T6VN 3KPMA 2IFFL 4NQEE 4TVUA 4MB5A 4BSWB 2A6JB 2ITCB 4UNVA 2XTJD 1ZDQA 1NGXB 5JW4N 1M42A 3U1SH 3G5XA 4PBDA 1CQKA 2NT1A 1BM3L 3O9WD 3DGCR 3FFDB 1UWGH 4J3SA 4NRZA 1N3NB 1GAFL 3T0EC 4PJ9A 1RIHL 5LNDA 1FRGL 2BZDA 5G4MA 5HI3D 3R8BB 4N6RB 3RY6C 1VPOH 2P5WB 4AGQA 3BD4A 1K8IB 3MLVL 3TF4A 4NP4H 1NCDL 4UBDD 5CZKA 3DJZA 3ZTNH 2P8LA 2BY2A 2OSXA 4HALA 5HSFA 2AV7B 4V2BA 3T8XA 4TNWF 3LRSA 2W0KA 5AFAA 2P43B 1NDMA 2X0WA 4PGJA 2BFVH 2BVPA 3PXLA 4NB7A 1J8HD 1MNUL 4K5PA 4JFED 2VJXA 1BD2E 5HYQA 3UYPB 3H9SE 4X4XB 3VD2A 5D7IA 1JN6A 3VDBA 2PO6A 5DQ9A 2J6EL 5ESAA 1XR8B 1I7TA 1FNSL 4XP6H 4B7LA 2R8SH 3V6OE 3HS0C 2FGWL 2IDCA 2YPKA 4TNFA 3GHPA 5HTSA 2OL3H 3CDGB 2VC2B 2R0ZH 2VQ1A 1J48A 1DQDL 5IB1A 1BD2A 2JTDA 4BQ8A 2HLAB 2HT4D 2WMPB 1NGZA 3BT2H 1SF5A 3G6AB 1W8NA 4Q89A 5DD5L 3WKNA 4YHYC 5GZNC 3OL2A 2X6VA 2ADGA 3H7BA 5E2JA 1EMTH 1T89C 2W80C 4E42B 2NXYB 2W94A 2OX5A 1GOHA 3DXAB 2VOTA 1WWWX 4IM8A 2ZKXA 1Q0XH 3D2UA 4H88L 3IDMA 3MLWH 5EZIH 1T0NB 3T4AB 4U3CA 2JI2A 1PKQB 3VDCA 3CZGA 2DKMA 3IKKA 1CD9B 1IFHH 3QRGH 3VXTB 1BW8A 2QVKA 3UTPD 3Q06A 3LHPL 3L4ZA 5C0AA 4Z5RA 4DCQB 3D2TA 3IB4A 4GW5A 4DP2X 5I8OH 1FGNH 1NBVH 3BPOC 4B9GA 1YCSA 3TZVA 5BZDA 1NBZB 3QUYB 2VIRA 4WU5A 3HR5B 1U3YA 2WLIB 4MX7B 1NCWH 2BSRB 4AUJA 1AGDA 1PZCA 1CI5A 1PSKH 2WKOF 4K3EH 2E3VA 4Y1TA 3E7JA 3MSPA 4F80A 1ZT4A 4N2OA 3GHEL 1HEHC 3IDGA 2GT9B 2XZQH 1FVEA 2WD0A 1KF9B 3I6GB 2ZG1A 5F7UA 2NMSA 3K7UA 1EFQA 2GB2A 2P8PB 4HKZA 3C12A 5TFSL 5MERA 5AOLA 1FH5H 2J71A 3FO1B 4YHPA 5KN5B 3IGKA 2AABL 3WTYA 3QUYD 1JAEA 5IM7A 1LK2B 2VLJE 5JPMB 1FUNA 1JWSA 4B96A 1DHKA 4L37A 4P04A 3HS0A 1CUOA 3KZ8A 5AB0A 3K71B 2HKHH 2Y22A 1H9VA 4PJDF 4KJQC 4RFEA 4GSQA 4MCYA 3D3VE 3QXDA 5IHZA 5J11B 1JPTH 3MBEB 4MDIB 1XVSA 4EJ1C 2OSYA 4NQCB 3S9DB 3MLUH 1JPEA 3SN6N 3GHBH 4APQC 2HWZH 2EUWA 5GISL 2WOBA 1LL1A 4TSCH 1CFVL 2WM0A 1U93B 3D3VA 1MREH 2WNWA 4K8RL 5I1AB 2M83A 3VRIA 4CUCA 3HA0A 3WFZA 4MA7H 3UJIH 4NC0B 4M02A 1X5YA 2BNUB 2KBGA 3C6LD 1KZYA 1P4UA 3BAWA 5TK4A 4MA3B 4H4NA 4M5TA 1V27A 2HAZA 2W59A 1E90A 3D18A 2XN2A 3KL3A 3RGBA 3TNMB 4ZO7A 2VW6A 2YRLA 1NGYA 3FUMA 4X9GA 1IE4A 4NHCH 4EE2A 4IDJL 4GI8A 3WEAA 1N4XL 4JDVB 1OSYA 2H3XC 3EFFB 2WHVA 3EYFB 4KMLB 2B2XH 3VE0B 5AWNL 1ZLUK 4KJWD 3S37L 3VM5A 3BP6A 3SCMA 4DW2L 4PG2A 4XVUC 4TMPA 4KY2A 3IS1X 4AMXA 3CFMA 5K39A 1NFDB 1LWHA 4QHKI 2WWMD 5DT1L 4XCFL 4TLUA 1MEXH 5KS9E 4ESKA 4JMXA 2D7PA 3MRKB 4L4TA 4AYID 4MJHA 1FNEB 3AY4A 2FATL 1TEFA 4JREB 3VXQB 3Q0HA 4LLUA 5AYUL 2XTJB 1JNJA 5I1HH 4BH8A 3P40A 3VSQA 4G7SB 1ZGLB 1FVCB 1JZ6A 4UM9B 3EFDL 4G1EB 4H5SA 3G9AB 2CRIA 5DHYB 1KLUA 2AF2A 3D33A 2WKGA 4GSRA 2MOQA 1QWNA 1A7PH 4JHZA 4N1CA 4EBQL 2Y5QA 1U92B 4Y5YC 1JHLH 1ZVSB 4AKPA 4XO8A 1HKLL 3IPEA 5AVQB 3NCYP 1TJHL 4D94A 4FI6A 1FGVL 5DHEA 1CFTB 2WUBL 3ULVH 4PN6A 2IANB 2J3SA 2X4SA 1I8KA 5KBKA 1NCNA 5I30L 1KYFA 1I1AA 4F5CA 4N5ED 1WRFA 3IMTA 2XPGA 1I7RA 1SDDB 1VCAA 1DSFL 4KZCA 2VZOA 1S4IA 4MJ4A 2GBUA 5GGTA 2GABA 5D9SA 2H32B 1UH4A 3QIWB 2PTVA 5E8EA 2CQVA 3KGTA 5AOZA 4ZZFA 5IMOB 4Z3FA 3LKSB 4YHLH 2JV6A 2ZCZA 3HJEA 3L54A 5T1LB 4EDXB 3MRPB 4PJFF 3IVKB 3QAZC 3GSWA 4PW9A 1S7SA 5DZAA 2HX7A 3AT8A 5F9WC 5MEPA 2Y2YA 3FYEB 3FHAA 3ISYA 4AEHL 1IGFL 5JDJA 1P53A 2B9AA 1FORH 4NCC1 1E4HA 4IRZA 4X9FA 3RVUC 4IJ3B 4XMZA 4IBWA 2PCPA 2ITEA 3A4FA 5EOTA 2BWDA 2BY1A 3STLA 2DQGL 3GJEB 3MJ7B 1JK9A 1M6UA 4K3EL 2EILB 3VXMD 4O02A 5TDPB 1MJ7H 1SQMA 3FN9A 4JFHD 3Q48A 4P99A 4EZKA 2GC4C 4HS3A 3JT2A 5CSGA 4EXPX 5FKPB 1U8IA 1XQ4A 5DO2C 2L7QA 3LPGA 4Y4FD 1KCSH 3TEWA 1X6LA 1K72A 5IJVA 3NTCL 3SGDI 3QO0A 3VFUB 3BVVA 5JQHC 1NUDA 3BGFC 3BWUC 2R59A 3L3DB 3ARGD 2FQFA 4KRNA 3RWIA 2WQSA 3PUUA 4LSQL 2GK0B 2JKWA 4WEEA 4DGIH 1LEKA 4AMKL 3TEYA 2KLSA 5FO8B 1FNEA 4XMKH 4UV4L 4NM4H 2ALAA 4M5YH 2RQ8A 4PB0H 1KPUA 1ITBB 1Y18A 5FK9A 1MF2H 3NFNA 3DURA 3DX0A 1BXAA 4KRLB 1AY1H 3MXVH 2NY3D 5EO1B 4F58L 3STZA 5IUSA 4WFFE 4OZHA 5AZEH 4GUPA 4PJAB 4OV5B 2EYRA 3WHE1 5FCUH 4MB3A 5ISZA 4AVKA 2BDNL 5IW6B 3RWFB 3KPLB 2VMEA 4YIQB 3RRQA 4JFFE 4JO1L 4JDVA 3BP4B 2TAAA 1ND0B 3JVGC 4P2RD 3H42H 1R3LA 1QA9A 1BBJB 2H45A 4Y1AD 3VXPB 2W07A 4QYOB 2K70A 3PL6D 2IALB 5F1IA 1UD8A 4G82A 4QHKJ 5E6IB 3IT8D 1KXQA 1EUTA 4XP1L 2DICA 3AGWA 1M05B 4MD4A 1T4KA 4ORGA 1L6XA 4JFDB 1UJ3A 4AVIA 4OJCA 3CFEB 3MRPA 4OCMC 4XE5B 4P07A 2K6WA 2X87A 2ICCA 4UINH 1PKOA 5I6NA 5EWIL 5F88B 4CC1A 4U6VL 3Q8AA 3RGVC 4M1GL 3RVWC 5C71A 4YDVB 3W38A 3AXHA 4L3FA 3MUHL 5JA8B 43C9B 3KWWB 1CE1H 1WZKA 4HU8A 2H9GB 3EJCA 4MAYA 4JRYE 3CMOL 5JIQA 3VG0L 5HGDA 5A43C 4UIMB 2WMPA 4PJ7B 1A6UL 2FWOB 5EZLA 2ZYHA 2JKTM 4OLVH 3D2UD 2XN9E 1NEPA 1XF4A 5GS2D 2KERA 3MRMA 3X11B 4D0DA 2OR8A 3IBOA 5C08D 3VCLB 1YAIA 5JHDA 1KLUB 3BIBX 2DB8A 2DL2A 4IBVA 1GYVA 1RZJL 5ISZD 4Z0BL 4S1DD 1TZGL 2B2XL 3H53A 3B7YA 3WSQL 1BD2D 3GMMB 3UGEA 1A4AA 3ZDYE 3EGDA 3ZRSA 1CD1B 1CXIA 3RLSA 1JFQL 1IGIL 3CXDL 4N0CD 2FO4B 3NUKA 1MWAL 1ZS2A 2NXZB 4BIKA 5D93B 1OM3L 3H0TB 4L4VE 1J12A 4MCZB 3ELQA 2W92A 1WAAE 2Q6WA 1WBZA 2K8QA 2DTSA 2F5AH 2YKLH 1PIFA 3HKFA 2HPTA 3MR9B 3U0WL 5D8JH 3P0GB 5D4HA 5C0AB 4A38A 5GS0D 2CIKA 4GQPH 3QORA 1AE6H 3C5SB 5DJ0B 3SDCC 3TNMA 2APXA 3MNVB 3L2MA 5FDWA 2WWMC 4GQRA 4WNJA 2V3FA 4KK5C 2YAEA 2N1TE 2LTQB 3LNFA 4GXFA 5E8NB 2WPGA 3NN8A 1E4KC 2YFNA 5D7EA 3AY4C 2GJ6A 3FH8A 4OZHB 1L0PA 2CKNA 3DDFA 1YEHL 3ALXA 3CMGA 4AH2A 3FQNB 1UOWA 1SLXA 4IIZA 3NOIA 2AEOA 1ZLDA 2E7MA 4HU2A 4NCC2 5DLMH 4AX3A 3FT4B 3ARSA 3Q2VA 3EJPA 3EO9L 3RL2A 4N3TA 1U8PA 35C8L 3PWJB 1NMBL 2NLJA 4BFOA 4JR9L 2B59B 2Q3AA 3IK2A 1HN1A 2O6FA 2YBRB 2XZQL 3GJFB 4JHUA 1MLCB 4N2BA 4PW3A 4RX4D 4OF7A 3AS1A 2NR6D 2DM7A 3BZFA 2PP9A 4FHKA 3NYKA 5CFAA 2MCPH 4YXHH 4HOXA 4Z9KB 2DQIL 3NJMA 4D9LL 4QWWC 3WN5A 4URKA 4F7KA 1QI3A 5J12B 5J13C 3NACL 2BNQA 5E2UH 2VSMB 5BRZE 3FO0H 2VL4A 3FB6A 4I9WD 4G6ML 5IBUG 2BXYA 2NW3B 3UO8B 4HZLB 4AL8C 5FECA 4YDNA 4BK5C 2H5UA 4JQVC 4YPJA 5E03A 3BVUA 2Q2EB 3U0WH 1G84A 5BMFH 3ZKND 5AKRA 3ARGB 5SWQA 1AGDB 4KJQD 3O6FD 4Q8BA 2OR9L 2VXQL 4FQIH 1KYOK 3CVIL 3D85A 5A3ID 4X80L 1ICTA 2DW5A 5DJ6B 3FCTB 2VLJB 5AKSA 5D1XD 1S9YB 3FU5A 3WIFB 2KZ1B 4OLVL 3FCUB 4X6DB 4EQ2A 4NQED 4QRAA 1XFPA 1NIBA 3BH8B 2J7LA 3ARUA 4Z0BH 2CKBB 1TVHA 1JNNL 3MBWB 1GH7A 1KXVA 5FYJL 3OKOA 2JJUA 1S7TA 4OM1H 2QSCH 1PZBA 4HT1L 4YR6B 5CU9A 2MSPA 5AZEL 2HLAA 5K1VA 5FM5M 1A14L 4IS6A 2AJSL 5C0IA 1EEZA 5HGAB 1D7DA 3VG0H 4X6BA 4P2OB 4X7FC 3QW9A 1N5AA 2A74B 2LQRA 2X4UB 4JLRB 4K7PY 3UDWC 3ZYZA 1LDSA 3HS8A 5D7LE 2BZ7A 3VX0A 3GMPB 4ZOEA 5DZPA 4QRRA 3LNDA 1GOFA 3L3GA 3QR2A 4G5AA 4MJ2A 1DCEA 1XTLA 1NCAH 4EIUA 1KZQA 3B9AA 4POZD 3ZTEA 2EDWA 3X3GL 4BZ2H 3P30H 3BAKA 4AZUA 5GZOC 1ETJA 4LHUD 1BYOA 3W39A 1T04B 2E4FA 1JWUB 2HT4C 5F8RC 3TFKC 5HVHC 5JR1H 3KCWA 1M2VA 1FG9C 3ULUC 1CD1A 3BE1H 2A83B 4ODSL 4G72B 4QLWA 1ANUA 4I0CC 2PXYD 3MFFB 4HCRH 4NN7C 1KCWA 1A14H 3MV11 2XV2A 5EN2B 3WEOA 4ZFGL 1A6ZB 5FO2A 5KSAB 5IESH 2CDFA 1IC7L 1L6ZA 4ZZKA 4JVUA 4LHUB 4UYPA 2VDKH 1NGPL 4TVPL 4GPVA 1OF2B 1WWAX 4MCNA 4IBLT 3GD1C 2R56H 3O8XC 3BFQG 1LWRA 3W9DB 4B97A 1T20A 3DV6A 4CNIB 2I60H 1GYUA 3UTZB 3VFSB 2BP0A 3NCEB 4P2QA 2J6WA 3J8F7 4XWGL 3MBEC 3UAEA 3VWJD 3DX6B 1UZ6F 4GBXC 2CRYA 5I5JA 4YXLL 2FT8A 3QDHA 4OJAA 4U2ZA 4DPAX 3RJQB 1OAJA 3O8XB 1QHOA 4XCYA 4HF5L 3PP4H 3SBPA 1G6RA 4HZAA 2OR9H 3CSTA 3S34L 4E9SA 1BMGA 3KJ4C 1PJWA 3ULUL 4BFIB 4ZFFA 3RE0A 4HK0A 4NQVB 2WLMA 4RBPH 1C5BL 4C4KT 3AG4B 3QC6X 2ZWKA 2HVKA 1M6OA 2VISA 3ECWA 2O5XH 2X5PA 3BUBA 3S96A 1S5IH 5CWSB 4GKZB 2GAZB 4GQZA 3EFDH 1MELA 1IM9A 4B0MB 1IM3B 2XWBB 2X9XA 5D6DC 1CIDA 5IB5B 2EE6A 3LH9A 3VWKA 1MEXL 3F05A 4TM9A 3L8QA 5AVRB 2EQDA 3T3ME 1R5VB 3LTVA 4APQD 2EYRB 5EU5B 2EEAA 1BAGA 4NGHH 1QSFD 3HJ0A 3NGBC 1R3JA 3VJ6A 4X98B 2QTEA 4PRDB 3ABGA 4U0QB 4UDTA 1T0MB 4XN9A 3NPSB 1R24A 2WQ8A 3GJFA 2B4CH 4R0LC 4PGCB 1B4TA 4N2FA 5CXPA 1V7MH 4NQDB 4LPVA 3KPRA 4C59B 4GKLA 1JZHA 1KIUA 3GSXB 1QNZH 3ES6B 1UM6L 1UXWA 3MNWB 1BA9A 4HJJL 1OTSC 4FL4C 5DD6A 3WEMA 4QRPD 4AVHA 4OR1A 3A6OA 3ZU8A 5AW3B 3ZPDA 1DBAL 3DVFA 4WI5A 1D9KA 1DFBH 1CTNA 4X6DA 3K74B 5TPWH 3ZBMA 3MRBB 2OMUA 4A68A 3AB0B 1R47A 1T5KA 1AKJB 2DWEA 5C2UB 1RUMH 4K7PL 4WU7A 4EI6A 1T21A 2VDNH 1J0IA 2OMTB 1YNTB 2K9UA 3H9ZA 4TPRH 4FABH 2JJTC 1VFAB 3DC0A 2O6CA 2GEQA 2FATH 4L1BA 1CN4A 5F6HI 4EKJA 4KHXH 2WCPA 4OLXL 4ODBD 4WHYG 5L2KB 3RTQA 5DC0A 2APTA 2AXGB 2P24A 4HXBH 3KLLA 1CLZL 4HFWA 1KELL 1TZIA 4Y2NA 4DGVL 1SMAA 2WCGA 1K4DA 4PVNA 2QQQA 3OJ2C 4BCXA 2DEWX 4MCZA 1AZRA 1CF8H 2I7OA 4PRPD 2CMRL 5D7JB 3SPJA 5HYJA 4UQ3B 1FNFA 1P4LB 2P8LB 3BSGA 1HAWA 3CDZB 3SQBA 5JHMA 1JP5A 2BIQA 3FTZA 4ZX5A 3D1MC 3FKUS 4H0IA 5D72L 4X8JB 3STBA 3MMEA 4PHZA 2P4AB 5KVDL 4H20L 1C5DB 3E6FB 2JB5H 4L1DA 4LARH 3I02B 1ZA3A 2YHGA 4WEUD 4X5LA 4YHOH 4ZW8A 3V9FA 3IRPX 4ICXA 5MHSD 1ZEAH 2ATKB 5IHHA 5BVPL 2NDFA 3U82B 1D5ZB 2O5XL 3KPMB 3HZVA 5FHBL 3X11A 4P3DA 5IHUH 4CMHC 1UM4L 1JV5A 3NAAH 1MREL 1OSZB 3QQ4B 4J3OH 1DTUA 1SBSL 4MNHA 4UINL 2C1OA 5J6GA 2GW5A 1P6WA 2QHRL 4P4KD 4L1LA 3W0WA 1NCHA 2ESVA 5CGYC 3LXBA 3IGAA 3GPSA 1AD0A 5I73C 1AI1H 2WO2B 1TTRA 1LK3L 1F4AA 3S3PA 3VTMA 1ZLSH 2R2EB 2X40A 2IBBA 4J8RB 4AZ8B 3QHFL 4RESB 3CLFH 2XIBA 2D31B 4M7LH 4DOHE 4WSKA 2XFGB 7TAAA 3IDYB 4MVBD 1S7UA 4OT1L 3UPCA 4JW3A 3HRZB 1GR7A 2M8XA 3GSNL 5IKCA 4NT6B 3VSUA 5DUJA 2TRHA 3OKLB 4JFDA 3EFFA 1R24B 2F53A 4JFFB 4ZBJA 4KK8C 1Z9PA 2Y06L 5B7MA 5KVGL 5J9PA 5F1SA 4R4BB 4F58H 1ZS8A 1FO0L 1XX9C 2YARA 5I6OA 4E9QA 3FTUA 3RHWK 4X9BA 4WW2F 4AT6A 2ZX9A 1KV7A 1USZA 4WDIB 4B5EA 1FAKT 1EEYB 5DWPA 3M88A 4D3CL 2CLZB 1KB3A 4RRPA 2JSFA 1HL8A 1CICA 3CFNA 4A2GA 4HIEA 3UZEC 2H0FA 3IMVA 3VO0A 2FIKA 1RZJC 4P49A 2EDTA 1EBAA 2YS4A 3RKPA 4R90L 5GGTH 4GXUN 4JO8A 3E38A 2G60H 1VPOL 2JMRA 2F8XC 3WY3A 3O3DB 5F7BA 3EBGA 5A6IA 1CDYA 2VR6A 1WPCA 3SE8H 4PFEA 4YBLB 3IMWA 4M43L 5GXBB 3F83A 1YUHB 2CDGB 4FFWC 5EIIB 4IBUA 1R3IL 1P7BA 4YPGA 4P5TD 4PJ8B 2WXFA 5BRZD 2R69L 3L45A 1IFRA 3QZBA 3T65A 3B9KD 5I71C 1FL3A 5JIHA 2HUHA 1LEGA 2BSTA 2VABB 1GZHA 4HIJB 1KY7A 4PCKA 4WHCA 2DRUA 4IGBB 1I9RH 1H6UA 2AJSH 4X5QA 4WRLA 4RFOL 1S7RA 2R0ZL 1AZBA 5E6RB 4ICWA 4KKNA 1LP9A 3VYNA 5FC9A 3QUZD 3DHUA 4Q9QL 2TSBA 5GJSL 2JE8A 5D1XE 1MUJA 2PN5A 4JAMB 2DKUA 3WE6A 3T3MB 2ARWA 1PZAA 2IDFA 4F20A 4BFJA 4AT6B 1I75A 2V0AA 5BRZB 2CIKB 5FYLD 4GW4B 2OJEB 4Y5XC 1CVRA 3SDDC 1U3HC 1AFVL 1Q9KA 2ICWJ 4K3JL 3PHQA 4OFKA 3ZTCC 4X6FA 3DUHA 4LDEB 4OI9A 4TNVK 3DDGA 3OMAB 3QYMA 2COVD 3HRZA 1KGJA 1D9KB 2C4FU 3O4LE 5IFHH 1UEYA 4L4VA 1SJEB 4GH7B 5JXAH 4M1DL 3VXTA 1V8HA 3HE7B 3BZEA 2A3TA 5F3HA 5L9DH 3TBTA 1NICA 1J7VR 1NSNH 4Q58C 1YEJH 1NEZB 3EBHA 4LLYB 4OZFG 3INUL 4XP5H 4HG4K 4NCDA 4J27A 2PWEA 2BC4B 4ADJA 5ESVA 3BZ4B 5LGJA 2FQDA 4MMXB 2C1OB 4HJSA 4P9HL 4WNSA 2E9JA 4Z7OE 4AYEC 4E41E 2AGJH 3ZMNA 4G9FD 1DQJA 4XCFH 4LEXL 3KXFE 4CJ0A 2EIMB 4OJFH 4UB0H 1ES0A 2NNAB 4R84A 1OB0A 1RUPL 1UT2A 3M1OA 3Q8BA 3MRHB 3SY0A 2AQRA 3RGHA 5KYNA 5HVFB 3FQ4A 4DW2H 3Q44A 2QGDA 2BHYA 1K5WA 2MKLC 1QYGL 1CZ8H 2O93L 2DF3A 2X1QA 5GJTH 3IJEA 3SPGA 2I9LB 3UBXA 2BS9A 1A1NB 1S6NA 2EDHA 1XGYL 4ODUB 1U3HA 5F9AC 2XA8H 1EZLA 3MCYA 5I0XA 4LGPB 4ZD3H 3T6QC 4LE8A 4TYUA 4NKQB 1CXEA 3U4BH 3AY2A 1KT2B 2LU7A 4B9YA 5CBEB 4LOVA 1UKTA 1NKRA 5I8CA 4KH2A 2D4FA 2PCYA 5L8LB 1BLNB 3ARBB 4KTEL 1V3JA 4E0RB 2JH2A 2PYEB 4LCCB 5ICZB 1A4KA 2AJVH 4P9HC 2Q0ZX 5C08B 4HHGA 1AXSA 3WJJC 4HG4J 3TP4A 1I3GL 2X88A 3VXPA 2QPDB 4HKJB 4NO0D 1R5IA 5L8KB 3E2HB 1OTUC 1F86A 5DJ2A 2I7SA 2KT6A 1T5XB 2GPZA 3UBFA 4KDVA 2ADIA 1MJ8H 1UA6H 3P2DA 4P2QB 3VSTA 2CM6A 3GBEA 3QDGB 4IHOA 3CJJA 2LR4A 1WH0A 4Y9CA 4KRPC 1J18A 1J1PH 3Q2LA 5I73B 3DKHA 3FTGB 1A4JB 1U93A 4M61B 2IIJA 2DLEA 3D12B 4NO2B 3U9PH 3AWGA 5DK2A 3JV0A 1RSFA 4S1QL 5B1JC 3WAKA 3A6BH 5GQBA 5T33H 5BCAA 4DK3A 3AREB 2OI9B 1U8PB 3CH8A 4I5BB 4IIQC 1RIUH 4JKWA 5B8CB 2EUVA 2VRQA 2Q10A 1IVLA 4DO6A 4QXVA 4LL4A 2WKLA 1IGML 1SLUA 5EEXA 1EV2E 5T1JA 2E9BA 1EAPA 2BP3A 3PQYB 4JKKA 5IM7B 3EYSL 4AH2B 3ZMRA 5DRXA 2K8MA 5A1AA 4AL8H 3FSVA 1INEL 2J56A 3PAUA 4HH9A 1H15B 5J6HA 4G8GA 4WGKA 1LE9B 1ZHNB 4DERA 4J3VA 2JK5A 3KAAA 3NN8B 1J10A 2AP2A 5E8OB 5BVPH 2ZXDA 4NQEB 5TGBA 3H3PL 2BSEA 1BVOA 5D7LA 4OLWH 3FO9B 4U7MA 1I1FA 2H1LM 5LXGH 2WJ7A 2H2SC 4HV8A 4HIHB 2FX9L 5H2BB 1NLDL 2UV3A 2XIDA 4WU5B 1OCZB 1PD1A 3X13B 4Z7NB 4UZGA 1U8LA 1SGKA 3LQZA 3WUWA 3EAKA 3T71A 1IO4C 4YFLF 3ZQ9A 5ACZA 4QTIH 2ZPKL 2QHLA 5HJGA 3KGSA 4XPFH 1Q0EA 5LBGA 4H8UA 4X42A 3QA3B 5IMOA 5AALA 4M3KB 2IBZX 4X6DE 4NIYE 4HXBL 5D96C 2XQYK 2VC2H 2VITB 3N6YA 1OP3K 4PS4L 1E4XH 2VLME 1YEGH 2Q8AL 1CXFA 1S7QA 3CIAA 2KDGA 4G80A 1TUPA 1AGCB 3IRCA 4KXZI 4KO7A 3TWYA 1TYRA 1UACL 3QXVA 1V3KA 3QEQE 1BQLH 2P5EB 1TQSA 1WO2A 2VDNL 2BP0B 1BEXA 1KEMH 4OGZA 1WTLA 3MRMB 1E3XA 5K9QG 3SQOH 2OK0H 3E6HB 2NNXA 1UWXH 2EDEA 3FOLA 4A6YA 1NC4B 4OTXL 4WUUD 4AW7A 2FAUA 2X6AA 1FSKB 1GGIL 3OC5A 4B50A 3WV0A 4PLJC 3KBHE 1VLXA 4YSTA 1CLYL 2J88L 1O6TA 4RISL 5MERB 3KJ6L 4BK5A 4UTBL 3RKDC 4X0NA 4NUQA 4NPYA 4HJ0C 5ECJE 4U49A 4FTVB 4F2FA 5F1KC 4HUVA 1HKFA 2BP8A 1Y7VA 3FZUD 3LPPA 3Q9QA 4NS0A 5DWUL 1MCFA 2Y1ZA 3S5LG 4WWOA 1GZPB 5E5MA 4LASL 4HMCA 1AS7A 6FABH 1DJYA 1JWUA 3X3FL 3KYNA 2VLRE 1RUAH 3B3IA 1UD4A 2FH6A 2ZWNA 2VLJD 3L08A 4BSJA 1J5OH 4JJ5A 2FX8L 3BH4A 4WK4B 4YZFE 3KPNA 4PAZA 3SDDA 4N5UA 2FJGA 3C87A