3EO1B

Structure of the fab fragment of gc-1008 in complex with transforming growth factor-beta 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
216
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSSASTKGPSVFPLAPCSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/cytokine
molecule keywords GC-1008 Fab Light Chain
publication title A cytokine-neutralizing antibody as a structural mimetic of 2 receptor interactions
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 216
sequence length 220
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo1B01
5C6WH 4ETYA 4NHUB 1CT8A 1JRHH 2FCBA 4DFIA 2XQBH 4M8VA 5E94A 3WNPA 3KPSA 1GC1C 4Y5VB 1G6RB 3HI5L 3UTOA 4K3HA 1A9EB 3I6GB 5DZNA 4LAJH 5IB2A 3G6JA 5EU3B 4LRIA 4NKOB 4KUZH 1RULL 3CUPB 5D2LB 4UOJA 5EWIL 5FAAA 1YZZA 5IWLC 2ATKB 2IFFL 4MQXD 5GGTA 25C8L 1FVEB 4PG2C 4U0RB 4LRNH 3KR3H 4R2GC 1P1ZA 2EZ0C 3AS3A 1VACA 3REVA 3SDAD 4LF3B 3CLFL 3U83A 3WFDH 1OP3K 3OG6B 1XCQB 5EU6A 1CDGA 5HVHC 2JCCE 4XB8A 1UGNA 1R5WB 3KPOA 4NQDB 5DR5L 2CK2A 4N8VA 4I2XA 3I84A 4OM0H 1MCRA 3QEGH 2BDNL 3D48R 2ARWA 4N8PA 5DURD 4P59H 4E5XA 4K23H 3F8UB 4JLRA 1JZ8A 2DMBA 1Q9KA 5D1XA 5CZVL 4NN5C 5DA4A 2BVPB 4TQEL 3K80A 3O3EA 4EI5C 5I66A 4GXVH 1NBZA 4WUUE 1KIPB 4OLEA 5C92A 3MGAA 3W39B 3QQ3A 1GC1H 3KPLB 5E8DL 5FYJH 4IMKC 3VI4F 5CEZD 2HJFA 1WF5A 2D7TH 4YGVA 3FQUA 2HT3C 1EMTL 1UA6L 3IAPA 5T5NG 4RA3A 1V5JA 2EC9T 5DSCB 1IKNA 3NIDF 5J1SC 4Z95L 3VXUB 4R3SB 3U2SB 3WO4B 2FBJL 1QLEL 4K7PH 4FQXD 3AC0A 3EDDA 4EI6B 3EDJA 1LO5A 1KPVB 1A0QH 1IGTA 2UWEE 3ARVA 1FNEA 3KYKL 4P2QD 1KCKA 4TNWK 1J8HE 1RPQA 3QXTA 5DEFA 2QQKH 4QY8B 4ESKA 4WWID 4NWUH 5DJ8B 1FH5L 2HJKB 4EZMA 1WFOA 2OJZL 3IU4L 3MO1B 1U8LB 1NFKA 4K8RC 4QTIL 3Q6FA 4OZGF 1DN0B 5TDPA 3WN5B 4B53A 5KW9H 3MRNA 1JHTB 1H5BA 1VGKB 3RBGA 5K9JH 2DD8H 1A7QL 1YEGL 3NAAH 4LCCB 4ZD3L 3CDYA 3WDHA 5ALBH 3QRFM 4W6WB 1AJ7L 1JF6A 4JREC 5D2LE 1EO8H 2E9IA 1CXLA 3BO8A 4P2OA 4AEHH 1LE5B 1YEHL 1T0MA 1MH5B 1J1OH 1YY8B 3MRLA 1ZVSA 3KLAB 1BLNB 1OD7A 2QADC 2FWOB 1LP9F 1A7RL 2X41A 5TH2B 5CINL 5E56A 3KG5A 3CAFA 4P23D 3RL2B 1NDMA 2MQ0A 4OFDA 3K2MC 1HHKB 1ZANH 4JN1H 5C0CA 3JUZA 3PWJB 2NY6C 1RV6X 1XR8A 3OB0K 3JZ7A 1OM3H 1U3HD 5BXFB 3DUSA 2EE6A 3QDJA 4XTRD 4XMLH 3PV6B 2LQRA 2X7LB 3QIUC 4JQIL 5HHVL 2I27N 2V9TA 4APQC 5IUSA 3SO3B 3DETD 2CIKA 5L0QC 4EQ2A 3SN6N 1YC7A 4H88H 3RUGA 5F1IB 1MJ8L 3FONB 3MLSL 1JNHA 5DRWB 3NABH 3S36L 2J8UE 1G7MB 3S34L 4HLJA 3UZQA 4EVNA 2B0SH 3U9PL 4U1IB 4QF1B 4DEPB 2OMBA 3VMOA 3BN3B 2Z92B 4C54A 5DD0H 3MBEB 5GGTL 5JA9A 2ADGA 3TT3L 3K1KC 4G5ZH 2R2HA 3HUJF 5EIVA 2BC4A 1OTSC 1CTNA 4HWUA 5EZOH 3TFKC 3EJYC 3PF2A 2P43B 1FV1A 2IALA 2CQVA 1HHGB 2ENYA 5CFHA 4KGLA 5D9SB 1YUHA 1UQSA 5CJBA 4KVCH 3DX7A 4AJ0A 5F96L 4Z77A 1ZT7A 4RFNC 3GSUB 4JE4B 2F54B 4IRJD 5IJVB 4OLXH 3WJLC 3O0RH 4Z7QF 1FBIL 3TH4T 4V1DD 1FL3A 1QFPA 3C6LA 5CGYC 4Y8DC 4UT7L 4K94L 3MRGB 3B5GA 3H3KA 1A7PL 4RISH 5LGJB 1H15B 4PS4L 4A2MA 1NMAL 4JY5L 4LKXB 5EU7C 3VRJB 3UTQB 4WY7L 3QUZB 4UIMB 3RKDD 4YC2B 3E6HB 3RFZC 4OAWB 3F6LA 1DZBA 5IVXF 1MCWW 4R26H 3L95A 1MCOL 3MLVL 4BK5A 3UYOD 3NCJH 3ARED 3MOBL 5FA3A 1IC7L 2O5ZL 4CL7A 4MNQD 1DEEB 1KACB 4L8CB 4NDMA 2ICWI 3EFFB 3MACH 2CDGB 4DVBA 4OLYL 3BH9A 3VMPA 3ARBA 4MHHG 1KCSH 4QT5B 3G04A 4PLKD 3UBXA 1MCCA 4MD5A 1JP5A 5A3IC 3SGKC 5IW1A 4LIQH 3K2UH 4Y16A 3WYRA 5DZOA 4BUGA 5HYSB 3ZO0A 3BZEA 2ZUXA 5D1QB 2UYLA 4Y89A 2G75A 4OF0A 3ULVC 3RWHB 4NGHH 4Z7UA 4D3CL 2ZP0T 3NA4A 4ZPVB 3CX2A 1C5BH 5I8OH 4IRZL 1YNKH 2BSTA 5HY9B 3QUYD 2YA1A 5IG7B 1G9NL 1NSNL 3MRRB 4LPTA 4GG6B 1CICD 4MWFA 5T1MB 1B6UA 2CRIA 4QRRB 4RMVA 3B6SA 1JUFB 5DFVD 4N0CC 1ZTXH 3QFJB 3UPRA 1XGQB 5CGTA 4NKMB 1MRDH 2OQJA 5D8JL 3B3IA 4YNYB 3EO1A 3O11B 3RWEA 4IOSD 1WGOA 4S1QL 5EUKB 5HYJE 4OCMC 2ZOLA 1Z9LA 3X11B 3BKML 2F8OA 2B1HH 2E8YA 3FB5B 1WT5A 4F33B 5F7YC 3MJ8B 1PX3A 2D0HA 2E5EA 1HWGB 4G7VH 4FQJH 3F5WA 1H3VA 3DX9A 3OV6A 2F54E 3LKPA 1FORL 1H3TA 4OQTH 1JK8A 4MNGA 5FDWB 1VB9A 2APTA 5L7XH 1P7QA 4AG4H 3GMRB 4PTTA 1QPXA 4LLQA 2QV2A 3MLYL 5ADPH 5I6XB 2PR4H 1BMGA 4O5LL 1MWAL 2DQJH 4IS6B 3ULVH 3ZKXC 3RY6A 2Y06H 4G6JH 3O81A 1S7XA 4HIHA 1KB5L 3N1PC 4XNQA 5MENE 4PP1C 3UTTA 2OR7A 5DK0A 2J6EA 3DVNA 4ZO9A 4AIZB 5J13C 1UXSA 2C26A 2AJSL 4LCUB 4QRUA 1ETZA 3LQAH 1JCKA 1INDH 2PO6A 1M6OA 4P3CH 5F7EH 2HFGL 3MRHA 3T8XB 3PIQA 4LASL 5D70L 5F8RC 4GAJH 3KPRD 4R2GD 1EHLH 2EZ0D 1A64A 1S7VA 1OP5H 1P9MA 2GITB 3S4SB 5SWZE 3LEYH 4JCMA 2X09A 2HVJB 1A5FH 4RX4D 4P4RB 2W60A 4BZYA 4MCYB 1YEJH 4AEIL 4Y5YA 1AFVH 2AXJA 3IJHA 2D0FA 1FZOA 4CKVX 5D7SH 4EN3A 4G9FB 1NLBH 4CMMA 2R0KL 5E9DE 3MJ6A 5IMMA 2PUQT 4P57B 2VSCA 2Q86B 3KXFB 5E8OB 1DBKL 1TQCC 3CLFH 5CBEB 3DXAB 1BD2D 2FX7L 4ODTH 2VUOA 4P5MB 4UOW1 3TVMD 3FQNA 4OKDA 2XWJB 3C09B 4JVPA 4KHTH 5I9QB 4BA8A 3MRFB 1MJUL 4IM8A 4QRRE 2BDNH 4MAUL 1F58H 4YO0B 4OLZH 3QFJE 1FFNB 5JPNA 3NCFB 4L9LC 5GGRY 2ZUQC 1T7ZA 4RCAA 4FG6C 4P3DB 1FVCB 4KI1A 4WHTA 2B39A 4S11A 1A7OH 1MJJB 4TQEH 2APFA 2ED8A 2CSPA 2OSLB 1QBLL 2AEPH 4ZODA 4G8FB 3ZDZE 4WO4A 5HGBB 2OYPA 3AMKA 4E42A 1ND0A 1HCVA 3OR6A 5DJZB 1OGTA 4PV8B 5IF0A 5EH1A 2BRQA 4X4YA 3VXMD 3VD5A 4NJ9H 1E27A 1VFAA 5CD3A 2EYSB 5EA0L 3RGHA 4UOW0 4FFVC 1UWGL 1MCQA 2ZCHH 4OFKA 3GSQA 1AGDB 4ZNEA 3QDGA 5DC9B 4CU6A 5GISH 3O8XA 3KJ4B 4WJ5A 1T7WA 4Q9RL 5MEPA 2DQUL 3QCTL 1E4WL 1V7MH 4PJEB 4ZSOB 1SEBA 2EC8A 1UM4L 3E0GA 4QWWC 4XP6H 3V6OE 3CFDB 1B9ZA 4F57L 1NANH 4OCXH 3TNMB 2QKIA 4R7DA 2EH7H 4S2SA 4O2EB 1SYVA 4PP2B 5DC4B 1P4BH 1EBAA 2IMMA 2MWCA 2WQRA 2YBRA 5DF0A 1NCBL 2VDLH 2OJZH 4XAWH 3QHTC 3OGCB 1I7TB 1UB6B 3GSWB 1FSKB 4QTHA 4R4BA 3HPLA 3PWNB 4U1JA 4AK1A 1RJCA 2BRRL 5DS8B 3HI1B 4HUWA 4PJDB 4C56B 5ID1B 5FGBA 4KRMB 2O5XL 4XPFL 1U8NB 2E9BA 2X6MA 5JW5B 2VXUH 2BVTA 3RBSA 3QISA 3TIEA 1F3DH 1KUMA 3WKML 1GOGA 1NCAL 4XP1L 1CE6B 5EORH 4YDJA 3LKSA 1QEWA 5GIRB 1DANT 2A74B 2X4OB 4IRSB 1BQHG 5JNYB 2NY6D 3JWOC 3KPNB 4OZGE 5ESQB 4XP9L 5A2KH 3P40A 5D71H 3VXPB 4G9FE 5EC1A 1I1AA 3GMLA 2K3TA 4NNPL 5B39G 4PGJA 5AZ2L 2Q76B 4RRPG 5F6IC 1C5CL 1UYWL 2ITCB 1MPAL 2J6EL 2X4PA 1XGPA 3DI2B 3QXDB 4X6BB 5EO9A 4Z5RA 5A2LH 2EDDA 1J1XL 2BNQD 4EIZC 5KS9B 4D2NA 5DWUL 1T1XB 2OTWB 1A6TB 2VLRD 1U8IA 5JOFA 3KPQA 5E8PB 1Q8MA 4EDWH 4LPWA 4P2QE 3L1OL 5D96B 3ZE1F 4GQ9L 3MLUH 1OTSD 3TFKD 1MJ8H 3MV7A 4ZOEA 3MLSH 2ZNWA 5HHPB 1B0GB 4M61A 2AJVH 3MXWL 5FFLA 3RDTB 5D1ZA 3OL2A 4ZXBB 5D7JA 3UJTH 4XPGH 1F4WL 4QGYA 3QXWA 3JWOH 3OKLB 4G3YH 4I4WB 2NLJA 5JW4R 2IC2A 4H26A 2VTFA 1KLUA 3HZVA 3HA0A 5DI8A 1S3KH 4I0CC 4JO4H 4OLWL 1IBGL 5CGYD 2KDGA 4PJEE 4ZSOE 1JZ2A 2YMXL 4WV1B 1NUNB 1OAUL 4Z7NF 2E7MA 3DIFA 4HIXL 1CXHA 4YR6B 4OSUL 5F96H 5DHVA 3TBTB 4LLVA 1F4XL 4NQSB 3VXQA 4JHAL 3BSZL 3QT2A 3N1FC 1XF1A 1BFVH 3HUJE 5FO7B 1N6UA 2ADJA 1FBIH 2YD3A 1AQDA 4WDIA 4ZYKA 1KCRL 2BOBB 4U2YA 1RUQL 2ORBH 1Y0LA 3BRDA 1LDPH 4K94H 4WW1A 4X9BA 3U1SL 5IBTL 2AI0L 1QBMH 3TBSB 4PJDE 1R3JB 4PB9H 3MA7B 3GMQB 3K1DA 2BNRD 3S88H 1YQVH 1RZ8A 4XRCB 1NGWA 3GM8A 3QDMB 1YEFL 1HOCA 3MTRA 2Y07H 1RZIA 4IBLT 3E3QC 3CVHA 3DBXB 3WFHB 4GRLA 3LVEA 4BELD 5A3ID 1OPGH 4MGXA 4HDIB 1HN1A 5GZNC 1IFHH 2IPTL 1CGWA 1DN2A 1TTUA 3WE6A 2LV4A 3CMGA 2XN9A 5E6IB 3O3BA 1FAIH 2CUIA 4WI6A 2BY2A 3ULVD 1X4XA 2ICWB 3J7HA 4WU7B 5DD5L 1IGIH 1X3DA 4WFFE 3T2OA 5IVXE 3JTSA 2BSSB 2QL1A 3CK0L 3FRPG 5KS9E 3PV7A 2H26A 3ZTNL 4UTBL 1MFNA 5L9DL 5GJSH 5ISZD 4X7SH 4Y19D 3IU3A 1NPUA 2FH8A 2Z93B 3Q5OA 4OTXL 4N0CD 1F6AA 1UADC 1J12A 3DLQR 5CSZB 2H8PB 4I18B 4QRPB 3D0VB 1P7HL 4DGIH 3OX8A 3TBVA 4HKXA 4XI5C 3NFPB 4C83A 2PTUA 1AR2A 4URTB 1MQKL 1G9NH 4NM8L 4F15B 5JDSB 3PQYA 3UO1L 3MJ9H 4V1DE 4PY8I 2DTSA 1VKXA 5IFAL 1IM3A 4OCYH 4N8CL 2I60H 4ELMF 4X4ZA 2F8XC 3TH3T 3HG1B 3DECA 3MRPA 1RK0B 4YPGB 2F53A 1J0IA 4LLUA 3ULVF 1GZQB 4S1RL 4S1QH 3AROA 4LEOB 3AY4C 3BWAA 3H9SA 1ODAA 3BKMH 2VL5A 1U8OB 3A67L 3BQUC 3LH2L 4PP1D 3T08A 2HFEA 1INQA 3IFOA 2ZG3A 4JZOB 1ZHLB 5GGSA 1JYVA 1EVUA 4HIEB 3GBMH 1KJ3H 3SGDI 3VXSA 5T3XL 3G08B 3FCTA 3C87A 3ZMRA 3OZ9L 3MLYH 1UB5B 1YPZF 4R97C 4YAQA 4QHMA 4UV4H 2PKDA 1CE1L 1LK3L 5M94B 1L7IL 1Z9SA 2YPLB 5CSGA 4MA1C 1CIUA 1I8LA 1UACH 2B8OT 4O4YL 1KFAH 3UCRA 5IHZB 1HH9B 5CJ8A 1OQOA 2GTWB 3G5XB 4IDJH 4TOYL 2R2EA 3QDME 4UILH 5EULV 5CZXD 4MDIB 1RURL 3THMH 1KENH 5JPMB 3IJYB 2N7BA 4EI5B 3AXLB 4OM1H 3PGCB 1E6JH 3JTTA 5D70H 2Q3ZA 2IAMA 4NP4L 5F7LB 5HGDB 3RAJH 2HT4C 2H2PC 2JB6A 4TUOB 1G9MC 2H1PL 3V4PL 3ARDB 5FYKE 2XIDA 2ZWLT 1EZVX 2YD7A 3OPZL 2EIBA 1F11A 1WFTA 1NCUA 3CVIH 1N5AA 3BWUC 1AE6H 1Y18A 4Y16C 3QEQD 5F3HB 4AEIH 5FECA 4PRPA 2KH2B 4Y4KC 4NQXA 3WHXA 2VDNL 4FG6D 2H32B 5A43C 2B4CL 2XTJD 1DQDL 2HTKD 1XAUA 4OD2B 3P77A 3H3PH 1TVBB 4U6VH 2Y36L 3V4VH 3C60C 1K6QH 2HVKB 1OT2A 4X0KA 1AGFB 2WIMA 3X13A 5F89A 2RGSA 3VFRB 1MVFA 4HK3J 3HG1E 4WEBL 2LE9A 3F6IA 2IWGA 4GQPH 4NT6A 5FYJE 3OXRB 3P9MA 4R90H 3MV8A 4FQHB 4L3EA 5CKAA 5DRZB 4JREB 5EO0A 5ICXA 4B7LA 3O3AB 3UDWC 1G9MH 4AMKL 4QWWD 4X5WA 3NACH 1ZGLM 3MYZA 4OV6F 1SBSL 5KOMC 5EA0H 3B5HA 1YECH 3LSOB 3KPRE 1K2DA 4J3TA 1KEGH 2PXYC 3E8UL 2QADB 4DK3A 1G6VK 4DZ8B 3TN0C 5KTEH 4F3FB 1Z9MA 4R8WH 1WCQA 1M7DA 1MIEH 2AGJH 1E4WH 2OCFD 5J6GA 2CD0A 5I76B 1JPFA 3SDXF 4PJFA 3KPSD 1WAAA 3GSNA 3MRCA 2VXSH 1FPTL 4UV7H 3T4AB 3QIUB 3MJGX 4APQB 1YEIL 2VLLA 5D6DC 2VQUA 3K4DA 4W4NA 1U42A 2PO6C 5I2IB 2E6PA 5KN5A 2VOTA 1A6VL 4LHJB 1IEBA 1BD2E 4NSKB 3U82B 4XCCL 5IM7B 4U1NA 5HJ3B 2PYEA 4KKLC 2VB5A 4X8JA 1UZ8B 3OKMB 4ZTPL 3SE9H 2YN3A 3VXNA 1CDCA 1EXUA 2O5XH 2XG5A 1HXMA 2JJVA 5EU6D 4DGYL 2YPKB 4TULL 1EK3A 3RWDB 4M6AA 5LXGH 3HR5B 1NCAH 1MI5D 2ICCA 5T5FH 4JM2B 3MLZH 4Y5YC 5AG8A 5CLWA 3VWKA 4X5XB 2OJEA 5FO8B 3QPXL 1YJDC 1MHCA 1CTOA 1JWUB 1Q94A 3NH7L 4JGUA 5CJ5A 1CGXA 1HINL 1NEUA 4XP9H 4L9DA 5HBBA 5C9JB 1ZHKA 2R0ZH 3T0EA 5D1XD 3MREB 1NGYA 3HFML 3VXME 2OR9H 1M7XA 1V3LA 3MRDA 3JWDL 4XPHH 5ILTH 3PDOA 1WWBX 4RFNB 3L7FB 4L1DA 3G6JF 1MPAH 3GNML 3MNVB 2CRZA 4MDJB 4LKCB 3OHXA 4XVJL 5DWUH 5I0ZA 2E7HA 5GGUB 5FV2A 3VH8B 3WD5H 2NY2C 4HSQA 1AO7B 5DJ2A 4NO0D 5TE4L 1JHLH 3RWGA 5BV7C 5I19H 5DJDB 1KIRB 5F8QC 1RAMA 3IDMA 5DD1L 3VFVB 3EYVB 4KHXL 1QA9A 1OTUD 1T89C 2L0DA 2XXCB 4B0MM 3V6FB 4X9GA 4NO2B 4ZQKA 2FB4L 2VE6B 2AEQH 3DX8A 2C7UA 5BO1H 2FYYB 5DMGC 2HMID 1J8KA 1MELA 1KCVL 1BFOB 1AIFA 3TO4A 3FT3A 2J4WL 4YK4C 2VLJB 1A6PA 5ITBH 4LSPL 3ECBA 3MUZ1 3WFZA 5FA4B 1YJDH 5GSRA 4NC1C 1PAMA 1HYRC 2I5YH 3KNBA 3ZE1E 1FO0H 1BBDL 5DC0A 1OAYH 2LAAA 3HS0B 1QR1B 2Y4SA 1ZT1A 3D9AH 2A6DB 2VN7A 2YMXH 4D0CA 2ILLA 5IMOB 1FNHA 1OAUH 2XKNB 1ZHNA 2FJHB 3KYNA 5HYSG 2D0GA 2AV7B 2YPVH 4NRXA 1RZGB 3T1FB 1BFSA 4OSUH 3D3VB 5JHDD 4YFEA 1YMHA 2GUOA 4JHAH 2BFVH 2LABA 4XNXH 4DJMA 4XCYB 4OIAA 4PJHA 4JZJC 3PABA 4LPCA 3UX9B 3BN9C 4R0LC 3RPIB 1OB1A 5BV7H 2CPCA 2OP4L 4HKBA 4H20L 1CGSL 4Z7NE 1AQKH 5SV4A 3LKNB 2ZJSL 4CVXB 1T1ZA 4P2RB 3VDCA 4CNIA 2X4NB 3CCHA 4I77H 3HE7A 5HHOA 2VLRE 4NRYB 5FKAB 4LHUA 1D5MA 1UCBH 4PBXA 3C5ZB 1S7SA 3LDBC 4BYHA 5C0CD 2MJWA 3WLWD 1J0ZA 4OFYD 1JPTL 2AJZA 3HNVL 6CGTA 4G8GA 1I4FA 5CJXC 1XMWA 5IW6A 1F4HA 3RWCB 4KDVA 4PREA 4R9HA 5L8KB 4OD1H 3HMWH 4LCWB 2D4FA 3TM6A 5J12C 4M93C 3V5HB 1DVFA 3TCLA 1MAJA 3IFNL 2IQ9L 3QH3B 4LIQE 5DD5H 5E2WH 5DVLA 2HA1A 5DUPL 5JHLL 2IMNA 3CK0H 5IIEB 3BKYL 3GSRA 1L7TL 4NZTH 1RJZA 3LZFH 4YZFF 1AO7E 3K4ZA 3LD8C 4LBEA 2YZ1A 1G0XA 3TC9A 4OTXH 4XBPA 5DHYA 2GEEA 3VE0B 1F97A 2APBA 3MCLH 3ZKXB 4MAYA 3CFBA 3UTSA 2W0LA 4HIJB 3I2CH 2XQYK 5EU7E 1MJ7H 3IF1B 1EVTC 1AR1D 1IT9L 5J13B 3O2VL 1WIPA 5D1ZC 2ERJC 3EYUL 3D69B 2GFBB 1QVOA 5EZJA 1Q9WB 5IFAH 1ZGLP 1D7FA 5HVFB 1Q38A 2Q7NA 1KPUB 1IL1A 3RWIA 1ZLUH 1BOGB 3UROR 2M1KA 4N8CH 1S78C 1EA9C 4LVOC 5FKPB 3HR6A 5AWNL 2X1OA 4JFHD 1ACYL 3QWOB 5F88B 3RUGF 4EUPB 3RWFA 3LV3B 4OBRA 3T77A 4HUUB 3PGDA 4DKFL 4I3RL 4JGJA 1MFBH 4GRWH 4L29B 1JZ6A 1YYMH 5I1GH 2JF1A 4PRIA 4YDVA 2A83B 3F12B 2LU3A 4KTEL 1XF4B 3WUWG 1G7PA 4ODVL 3M1BB 4PRHD 1BREA 2Z8VC 4LQFL 5DD6A 4OT1H 3FO1A 4PJBF 3N9GH 1J05A 3UC0L 3RTQC 3ULVE 4I48A 4OZFG 5LAXB 3JWNC 1IAIH 1Q9OB 1CI5A 1QLFA 3BIBX 5IMKA 3X12B 1IE5A 5FV1L 1CE1H 4NZRH 4P2RE 4FXLA 1N8ZB 1U8QB 2C3VA 2VR9A 4XBGA 5F7UA 1U8PA 2VDPL 2NNAA 5JW4Q 2IGFH 3KLDA 4M7KL 2HT4D 4KK8D 2H2PD 1E28A 4L9LB 2ZUQB 3BH8B 1RURH 2HYMA 2Y72A 4HMEA 4JHZA 3HMXA 2XZQL 1GCFA 5IMLA 2WLYA 4ODSL 1XR9A 4Y16D 3UYRH 2XWBA 1S7TB 4L4VB 4NFDA 3BT2H 3OXSB 2GY5A 3LN4A 4K71B 4LCWE 5E8EA 4HPYL 4NKIH 4PJ5B 4PV9A 1GPOH 1TJHL 1SY6A 3KPMA 2K1MA 5EOCL 2WP3O 1PQZA 3V4PH 4JFED 3BDXA 4XC3H 4CUCA 1A6AB 4N0UE 4K9EL 4Q58C 1JGUH 4OF3A 3HCVA 3C60D 4L3CA 2EYTB 4PLJC 5BVJB 1HH6A 4YHKL 2EDRA 1A3RL 4HUKB 2DQCL 4NNYB 3H8NA 4K7PX 1UWXH 3NBNA 1DE4A 3U7YH 2AJXL 3LQZB 2OTPA 4Z8FL 3L5WB 1Q72H 4YGAB 3P9LB 2Y36H 1AI1L 2Y6SC 3VW3L 3E2HC 2P5EA 7FABL 2AK1H 3OGOE 3L5XH 5CCKH 1HHIA 3CVHH 4X98B 1B90A 4Q2ZA 3VWJA 4MVBD 4X6FA 2NTFA 3KJ6L 2PXYD 3P0GB 1WWAX 4LP5A 4ZMAT 3WXVH 1NCWL 3TN0D 4G7YL 3ILPA 5GRXG 4NQCA 4X6DA 5T1DH 1CQYA 3T04D 5EUOF 2DBJA 4AQOA 4BSWB 3SJVB 5KAQG 4OBSA 1JPGB 4AMKH 3TBWB 5HDLA 3ZKQD 2ADIB 3PWPD 1ZWIA 5FDYA 2VXQL 5ETUB 3GMOB 4CADA 4OGYH 2HTLD 5L2JB 3AMLA 1Q0YL 1A1OA 2PO6D 1L9NA 1PLGL 1J87A 2APVA 5F6IB 1DBML 2NY3B 3ARFA 2Z4QB 2XWTB 3X3GL 5CP7A 4FA8A 3RL1A 4PJIF 5DJCA 3ZTJH 4Z7VE 3A6BL 4XVTL 5TDOB 5J89A 3RKPA 4Y4FB 1S7RA 5DJ0B 4OV5A 1A21A 3MRIA 3O9WA 2MCPH 1RHHA 1UVQB 4FMFA 5E2JA 5I1CL 3V7AE 1QQDA 5FO9B 1DBAL 5TFSH 1A6VH 1MQ8A 4CU8A 1CD9B 1CXEA 4L4VE 5K9OA 4EN3D 2ZSVB 1VHPA 3B2UC 3SDXE 1MRCL 4LSSL 2X4RA 4LLDA 4BZ1L 2ESVA 4JY6A 4PJ5E 1ACZA 4NC0B 4HWEL 5DJYB 2QEJA 4JPKL 5JXEC 2VITA 3WDIA 1Z9OA 2UV3A 3BXNB 2MPAH 4TULH 1SMAA 3T4YA 2F74A 5F72S 2P8PA 4MCZB 1R3IL 3GM0A 1U8HA 3QO0B 2YKLL 4HJ0D 3NH7H 1QFWH 1X5KA 1XIWC 3STZA 4DCQA 1MHHA 2NY2D 3K0WA 1AD0B 4KQ3H 4LCYA 3KYMA 1MCNA 3BHBA 1BIIB 3HFMH 3D2UD 3WL9B 1TVDA 2D7OA 4YHMH 5FOBB 4JFZH 4RIRB 1HXYB 1DQJB 3FFCD 4FXKA 3RVTC 1H3XA 3GZKA 5GGVL 4YXLH 5C2UB 2OZ4A 1K3ZA 5BOZG 4M7LH 1WZLA 3HMXL 4XVJH 5C9KA 5BQ7A 5F7HA 1B4RA 2Z31C 4F9PA 4RNRB 1E4XL 3F7YA 3MNZA 3QXAA 3UP1A 5KSAA 2RCSL 3QDGD 3O8XD 1SJEB 1D5IH 2GIYA 5ERWA 5I1LB 2JCCA 4G6FB 3T09A 4JN2B 1SY6L 4TVPL 1HQ4B 3V8CA 5JDJA 1RZKC 3EO0A 3SJVE 1QD0A 4KMQA 1U8KB 4K3GA 3P0YL 4KPHL 1N3NA 3RGVB 5C0EB 1WEJL 5GRWA 2W9EL 4IIQA 4OGZA 4WW2A 3BN9D 2BVUA 4ODWB 3BD5A 4WUUA 1BBDH 1A4KA 1T20B 3UJIH 1MI5E 4P9ML 1BWMA 3TLRA 5INCA 1WISA 4J12A 3O4OC 3GMMA 3JV4A 4MA8L 4HBCH 2XA3A 4MZ3A 4PJXB 5K9QG 2APWA 4OCWH 4HJJL 1J1PH 1OP5K 2DKUA 1KCLA 3BZFA 1MEXH 3FHAA 3BP6A 1AGEA 2NYYC 2OP4H 1XGUB 3U0WH 4MYWB 1I7RA 4JG1H 4UBDC 1I1AD 1INEL 4H20H 5I15L 1CGSH 1U95B 5SX5K 1B0RB 5IHBA 2UWEA 1JGVL 1MHEA 2WNGA 1HZHL 1OAKH 3EOAB 5LCVL 1J8HA 5HI4D 3HTLX 4LLMB 3CZJA 5JO5B 3ROLA 2FNBA 4HF5H 5KSBB 3VWKC 5JUEH 4WWKA 5F7WC 1T1YB 5DFWH 1UH4A 2Q7YA 2QR0B 4M3KB 4OIIH 2BVQA 3HC3H 4PJ9C 3U6RA 3T0EC 3U4EA 2XKUA 3ZL4L 1URLA 3QNYB 1EPFA 4Y8AA 3BQUB 1M7IB 3TWCL 4L8SC 1A9EA 3GSNH 3O6MH 4XNUL 4AENA 4NKOA 1WIOA 1F45A 2V17L 5DUPH 4MJ5A 3G5YB 4LVNB 1CGYA 5D2LA 5JHLH 3ILQD 5D1ZD 4F58L 1QKZL 3L3HB 2ATKA 4JHWL 3VI3F 1TDQA 5D7JD 1X5GA 1IM9B 3EOBB 4UINL 1FVEA 1ZGLB 4HT1H 4DK6A 4LF3A 35C8H 2EXYC 1EFXB 5JHDE 1AXTL 2V5TA 4GRWF 2IADB 1R5WA 4UU9B 2YD2A 5DD3H 3E3QE 5D7LB 4YZFE 4OLUH 3RZCB 4Q97A 1HHJB 4YWGL 2EEAA 3LB6C 3MJ7B 4N9GB 3RWJB 3EFDH 4PRDA 5T1KA 5FM5M 1VCAA 2BVPA 3MOAL 1PZ5B 1JV5B 3N85L 5AWNH 1ACYH 3LHPH 4OJFL 2YOCA 4PFEA 5CBAB 3W39A 1EJOL 1W0VA 3KPLA 2J8UA 5CKGA 3RJQB 1HDMA 3EO9H 1KBGL 2OZ4L 4ODVH 4LPYA 4D9QD 2CLRB 4R3SA 3U2SA 1LEIB 5IVNA 4Y4KB 4YFDB 1FIEA 1SM3L 3P4OA 5MP6L 3RRQA 4Y0GA 5BVPL 3DV6B 4LFHD 4X6EB 2O26U 4PGZA 1E6OH 1KPVA 2EIZA 3L7EB 1PY4A 5DA0B 1I3UA 4FQCH 2XN9D 2YC1A 4HBQA 1I8MB 3LIZL 3KLSA 4GT7A 4HXBL 4GG8B 1QO3B 3VFPB 4M7KH 4S1DC 5KSBE 4PJBE 5FUZH 1IGJB 2ICWJ 5DJ8A 1AKJB 2HJKA 4YBQC 2W0FA 3MO1A 1RU9L 5HDQL 5B8CC 3V7MA 1U8LA 3SY0A 2VDKL 1FCCA 3OAZH 4PTUB 3WN5A 4RWYL 4PLJD 1S9KC 1RD6A 4OZIF 3A6CH 1JHTA 1TENA 1VGKA 3DVGB 2R56L 1EH9A 1PFCA 2NY0B 5C70A 3F7RA 4QXGH 1R3KB 4J4PC 3IXAB 1I1CA 1F2QA 4RZCB 2VAJA 1EGJA 5FF6B 3WS6A 1QFWI 3PQYD 4DUVA 2YS4A 3M17B 4JFHE 3GJFB 4FFWC 5HSFA 2R2BB 4M1DL 1FYTB 1SJHA 2Y6SD 1LE5A 5C0BB 1CS6A 5IB3B 1MH5A 2AXHA 4EXKA 5AAWA 2A0LC 3KLAA 1YQ2A 1BLNA 3K7UA 1C1EH 4V2CB 1R6VA 4E41B 2FWOA 2F53D 4PRHE 1F90L 4F2MA 4GS7C 5TH2A 4M4PA 1TCRA 1LQSR 4GAFB 1MOEA 3RL2A 2IH3A 2C3HA 1JN6B 1HHKA 4JO1H 3SQOH 4QLRA 3RX5A 1M4KA 3PWJA 1CU4L 5D7LE 1L0XA 2F9BT 1AI1H 4O9HH 1JI1A 3VW3H 4ORGB 1AP2B 2QQQA 4TSAH 1KIQB 3PWVB 4YDLC 3PV6A 2X7LA 4KC3B 1J88A 5FYKU 3VXSD 1W8NA 2L4OA 4MJ6B 5I1EL 4L5FL 4BZ2L 3DPBA 3BDYL 1JBJA 5DO2D 3H42H 3FONA 2W65B 5DRWA 4OUUB 3QFDB 3VFOA 1AGBA 4KAQL 5L6YH 1FN4B 1G7MA 4QXUL 2Z9TA 5C6TL 5I18L 3WBDA 1UJ3A 1I9EA 4KK9C 5JW4N 1YY9D 2DICA 4U1IA 4QF1A 4JKMA 1TZIA 4CAGA 1FFOB 4WENB 3MBEA 4YHLH 4NJAH 2VLME 2ZUUA 5E8NB 4JDVA 4MLIA 4YHIA 5F9AC 5D2NC 4JFEE 1N6QL 3SPVA 4G6ML 4GUPB 5EUOE 1C8PA 5HYJA 4OCRL 1HHGA 1QFOA 3GMNB 2IAMD 3AU1B 3B2UD 5JIPA 5D9SA 2CO6B 4PLOB 3ZZ1A 4FFYL 3A6BH 5FYJU 2DQDL 3GSUA 1BGXH 5JXED 3ZKSD 2F54A 5L2KB 4NRZB 5C6PB 4NOFA 4B50A 4ZFZA 5J11C 3EKCA 1QACA 4FTVB 1A9BB 4YHYB 5ICZB 5E03A 4JFOB 4N0YL 4ZTOH 4P5TB 2X9YA 2N56A 5JW4M 4P9HL 2IEPA 4PJIE 3TZVB 1GGCH 5KG9B 5JW3L 3DSNA 3FL7A 5LGJA 1NC4A 4YX2L 6FABL 4U1SB 3H9YA 4LKXA 3VRJA 4FQIL 1WZKA 1NEZB 3I9GL 4UIMA 2DQIL 1G7LB 2WWKO 3D25B 4OAWA 1W72H 2MFNA 3RVTD 3S36X 1RIUL 2OS7A 1R3IH 4H1LB 1MFDH 4D94A 5C0BE 4JFPB 3RIAF 4L8DA 3VGAC 2IF7A 2G60H 1BM3L 2IQAB 2Z31D 5GRJH 5AZEL 1U2CA 1ES0A 4E41E 1DEEA 3MV8D 3EFFA 2R4SL 3PWPE 2CDGA 1OAXH 1Q0XL 5SWZA 4L3ED 1G1YA 2GK0B 4QT5A 4YE4L 4JZJB 4LGPB 5GGVH 3ARPA 4M8QA 3MOQA 2HKHL 3R1GL 4Y5XA 5CWSB 5KVGH 5EBLB 1Q1JL 3BISA 1WJ3A 5IKCB 5I74C 5E2UL 1WBYB 4IOIB 3BP5B 5E9DA 5T5NF 1TZHB 1T4KA 2NY1B 4HFWA 2BZDA 3LDBB 4KJYB 3L3KB 4RGMB 4ZOCA 5IG7A 3MRRA 4X7TB 5BZDB 1SY6H 4POZC 1EGJL 2Y7QB 1GGIH 4YJZL 3L3OA 4U4BA 5T1MA 3A0OA 2D03L 4QRRA 1MY7A 4KPHH 1LEKB 3QFJA 3UEZA 2W9EH 1LK2B 1O0VA 4ZUTB 4KK5C 3CC5B 4F7CB 4NKMA 5DEGB 3FN0L 5E70A 5I71C 4YNYA 5J12B 1WFNA 3O11A 2OMNA 2NYYD 3ISWA 5EUKA 1KT2B 4NYLB 4MMZC 4Q9QH 1EHXA 2FHBA 3LN5B 3O6FB 4UBDD 3SGEI 3QXUA 3X11A 4TRPL 4M62H 4MA8H 3MJ8A 2WAHA 3EOTL 4LU5L 2A1WL 4MQ7B 5EFIA 5C3TA 3QQ9D 2EYRA 1WTLA 1UWEL 5FDWA 3VWKD 3IXTB 3B8YA 4X9IA 4ZUSB 1OARL 2VDRH 5HYFA 3FFCE 1XF5B 5KVEH 4IS6A 3T0ED 3Q0HA 1GYAA 1INEH 1F3RB 2BOCB 4PJFF 3V6OA 1EEQA 1WAAF 1A1NB 1JGVH 2AABH 3GRWA 1NCCH 1WSST 4AIZA 4EUPG 4QCIB 1VESA 5CS7A 3QEHA 2JJTA 4NC1E 4LCUA 3ZT6A 3DGCR 5HPMB 3ZKMD 1P7KB 3NN8B 2VXTH 1A6ZB 5JA8B 1G0YR 1L4IA 5GJTH 2NW3B 4QOKB 5SWSB 1QSED 2QHRL 5CEXB 2FGZA 2H6PB 3R8QA 1UC6A 2ITDA 4LLYA 2W38A 1SEQH 3HNSL 1D5ZA 4WFGD 4KZDH 2EXYD 2GITA 3S4SA 1RSFA 1Z5LB 3NA9H 4LSRL 1MIML 5GS0L 4TPRL 3QI9B 4P4RA 5JORA 3VFNB 1KN4L 4MCYA 3O2DH 4MHHI 3RTQB 1QKZH 4JQVC 2NXZC 4OCSH 2DI7A 4OZGA 1JYXA 2R29L 3P30L 5JZ7D 2NQCA 3MNWB 4P4KC 3ME0A 4UINH 1KNOB 4G9FA 3MR9B 2NX5B 5DVKA 4NQTA 5KVMC 4P57A 5E8OA 1T7YA 1S7QB 3BEWB 1WZ1L 5CBEA 5FGRA 3D39D 3BP7B 4PJ7B 2XWJA 1CFBA 2MNUA 1F4YL 3MRFA 2CLZB 3MXVL 1N2RB 2GKIA 1BJ8A 1MHPH 1HKLH 4K7FB 1FVCA 4P3DA 2ARJA 5C3LD 3MOAH 4P2QA 1K5NA 1JFQH 4GMTL 4ZFGH 1R5IB 5HGBA 1EJOH 2FATL 4FP8L 1MNUH 3OR7B 5DJZA 3DMMC 4PV8A 3CLEH 4XVSL 3FQWB 4KTDL 5DUML 5HHOD 4LHUD 2V2XB 2PTTB 2FECI 4KROB 3SCMC 2XZAH 4ZUVA 3V0WL 3CXDH 2W0KA 1D9KB 1AGDA 4Z7OF 3F58H 4YBQD 2BY3A 3CIQA 4G8GD 2L7UA 1BBJB 2GQHA 5F1KC 5BW7C 5F7MC 4K55A 3M8OL 4PJEA 4ZSOA 1T66C 4KFZC 3T1WA 2FZ3B 3ARGB 2AJUH 3BE1L 3CFDA 4CU7A 1YDPA 1DVFD 3TNMA 1HIML 4O2EA 4HJGA 4J4PD 4R4NC 3CU7A 5HPOA 1EIBA 4WWKC 1LMKA 3CFCL 4K3JH 3HUJA 4Q6IC 1TTGA 4FFWD 4HWZB 4P23A 3HAEB 2F58H 3OGCA 3GSWA 5DT1L 3ULSB 1JWSB 1N0LA 3BUTA 2VDKH 3PWNA 4QOKE 5TDNA 3SE8H 5LVEA 1IGFH 5SWSE 4JJ5A 5CMAB 4JGMA 3GSVB 4Y5VC 4PJDA 1ORSB 2W9DL 4M7ZB 1XH3B 3MGTB 5JW5A 1Q9LA 3V5KB 3WLBA 3S35H 3CPLA 3QIWC 2VZVA 4EXPX 4M1GL 5C09B 3OKNB 2DMCA 4M1DH 3KPNA 4U1MA 3RVXC 5DRNB 5ESQA 1ULVA 4U0RC 4OZIE 4PY8J 3DV4B 1B4JL 4XCFL 1HSAB 1SVZA 4D9QE 1TIUA 1WBZB 4M43H 3QO1B 3ZT5A 5A40E 2PW2A 5TQ2L 3GRWL 5CD5D 1P5UA 2ITCA 3QXDA 4RBPK 4X6BA 5F44A 5IVXA 2CMRH 4PRID 4CGTA 1XGTB 5KS9A 3VGDA 1R0AL 3QHZL 1K3IA 1KJ2B 4KK9D 1RUAL 2A6KB 2I9TB 4FXGB 4NZUH 5DMKB 4M5ZL 1B0WA 5H35B 2XN9E 3C5JB 1T1WB 4JDTL 4I0PA 2SEBB 5I1EH 3U7WL 3W81A 4OKVB 3BDYH 5DZLA 1CLYL 3NIFE 1ROWA 1G6RH 1RFDH 4IRJA 5HHPA 1GGBH 5J1TC 4YFLF 4KAQH 1DTUA 4QXUH 3RDTA 2DLFH 3PP4H 4V1DA 4JPIB 3WO4C 3PHSA 4KDTA 2B5IB 5EU5B 1XIWB 3INUL 4WI3A 1T21B 3VXOB 5D4QA 1I7UA 4PD4K 2VDML 4I4WA 4ODUB 1GIGL 1VADB 1CZ8H 1BVKB 1P4IH 4GAYB 1H8SA 5IROC 3EGSB 3MV9B 1ZEAL 5C07B 4EBQH 1N6QH 1W0YT 43CAB 1A02N 4GW1B 4WV1A 1BZ7A 3FOLB 4Z9KB 5C0AB 1YN6A 2DWEA 3AREA 1IGCH 5BRZD 4YR6A 1T0NB 2DQDH 4YHZH 1MREH 2Q8BL 3TBTA 1G9EA 4NQSA 2MOVA 4C4KT 5SWQB 2AK4D 5DUBB 5A16A 2FL5B 2CIIB 5FO7A 2IBZX 4KY1H 4U1HB 3CH1A 2BOBA 4N0YH 4BH7A 1GL4B 1X5JA 3WEXB 2YD1A 1IMHC 4D9LL 3TBSA 4MXVE 4JPVL 1R3JA 3MA7A 4LCCC 4X8XA 2X4QB 6FABH 1YN7B 3IS1X 4FQIH 5C0RL 4JRXD 4JJHA 3QDMA 5C09E 4LP4A 5EIIB 4YH6A 3DBXA 4JRYB 1SHMA 2WANA 4E0RB 1QRNB 4HDIA 1SBBA 2B1AL 3QUYA 1MRFH 5ENWB 4EOWH 1H8OA 2ICEB 2QQNH 4XWOC 1GHFH 3FMGH 3WFCL 3O4OB 3O41B 3FOMB 2YSSB 5E6IA 2FIKA 1I7ZA 4A6YB 4QXTA 2Q20A 4W6XB 4C57C 1NGPH 2ICWA 5F71A 1WQVT 4WU7A 4NIKB 4FQLL 4NQCD 4G43B 5GRUH 4WCYH 4YE4H 2P47B 1FGNL 4POZD 5MERB 4PIRF 4GW5B 2HKHH 3R1GH 3OF6A 1U36A 3QUKB 1X5ZA 1YYLL 4F7TB 1PD6A 3SO3C 3DROB 2NY4B 3V0VB 2DTML 5CSZA 2H8PA 1PJ9A 5E2UH 4G8IA 4QYOA 5HHNA 5E2VL 1TZGL 5C0DB 4KK5D 3D0VA 1N5YL 4H8WL 1BAFH 2HWZL 2BVOB 3NFPA 3ARFD 1ZHBB 3N06B 2YD8A 3FB6B 4OF6A 5JDSA 1FLRH 1BQLL 1B2WH 5KBNC 1NGZB 4MNHA 5EC2B 2EXWD 1FG2B 4MJ2A 1SYSB 2I07B 43C9B 4DEPC 2HLFC 4MA7L 4UZGA 1LNUA 4PJ9B 3RNKB 3CFJB 2NXYC 4FQ2L 1DUYB 3O9WD 3TA3C 4RGND 3HG1A 15C8L 3IDXL 3FN0H 4YPGA 5F9DC 1RIHH 1RUPL 1Y6NR 3T3MF 3MRMA 1CF8H 3MV9E 3IAQA 2K9UA 2R0WL 3CSYA 2VN4A 4X6DF 5JOPD 5TJWK 2V9RA 4X4XA 3BZ4A 1U8OA 5C0AE 5E4IA 3DNKA 4Z18A 5IWLA 3BGFB 3VG0L 5H2BB 2A1WH 3OAUH 4KKCC 4JZOA 1ZHLA 1AH1A 3KPRA 5E99L 2VC2H 3Q1SH 1UWEH 3SE3C 5I17A 3WIFB 5I1IL 5CILL 5DRXB 1NGXA 1UB5A 1AHWB 1S8DB 3PGFL 5LGHL 3VD3A 1X9QA 1EZVY 2R23B 1HILB 4HIIB 3T2NL 1KC5L 5AYUH 1CN4A 3QUZC 1HH9A 4YC2C 1FNAA 4DQOL 2GTWA 3G5XA 4MDIA 5JQ6L 2I9LA 4NQEB 3VRLF 3IJYA 4JAMA 4JRYE 4CVWA 2R9HD 4XBEH 4EI5A 1QRNE 3AXLA 1KN2H 1BD2A 3BPCB 1LO3L 2VZSA 2GK2A 3QEUB 4P4KD 1A4JB 3PWLA 4LSUL 4IMKA 5KSAD 3EYSL 1D6VL 1QR4A 4HS3B 5K9KB 2VISB 4HGWA 3HLAB 2EEBA 3ZE0F 2V2WB 5BJTB 1JNLL 1DLHA 3ARDA 5SV3A 3T2QA 2E7BA 5J1AB 3NTCL 5GS0H 1FZJB 3MUJA 1ONQB 3IDNB 4JR9L 4PR5A 5F3HA 2AEWA 2BMKB 3CMOH 5ESAA 2Y5TA 1IGMH 5KZCB 5IGXH 3V6ZA 1MAMH 3P30H 3H6JA 3L3GB 1F6LL 1FP5A 2EKJA 5D1QC 1RZJC 5FB8B 3DO7B 1DR9A 3VXMA 4ONGH 1YNTB 2H32A 4LDLB 5C0ND 1QYGH 2HRLA 4WUUD 1ZLVH 4QRSB 4LVHB 5IQ7L 2AJYL 5K93A 4BQ6A 1W2KT 1TVBA 1QFUL 5IEHB 3GSOA 1JMZA 1F4YH 5EOQL 2HVKA 3TNNB 4ZO7A 3VG9B 3MXVH 1VEMA 1EEZA 2JB5L 2R8SH 1JRHL 3LS5L 4JQXC 3VFRA 4NZJA 2FX8H 3QIBB 5IB2B 3BIAX 4KUZL 2JCCF 4HC1H 5GGRB 3VD7A 3ZSSA 4Y4HC 4DOHE 4FQHA 4PUBL 1DQML 4GBXC 4HZAA 3M45A 5DRZA 4X6CB 1T66D 3QJFA 4XVSH 1QSFD 5DVNA 4HAFA 4K3EH 4LRNL 1QSEE 3LEVH 4R4ND 4EIGB 3RVUD 3V0WH 3WFDL 4XVUC 4WWKD 1FNFA 4PG9B 4CMHB 5I6XC 4DZ8A 3IT8D 3KPOB 1T3FB 3VXTA 2HJLB 2D31B 1CDJA 4I2XB 3M8OH 3VGEA 3BZDA 1PSKL 4OM0L 3QEGL 2YK1L 4P59L 2EDOA 2OLDA 1LD9B 4YDLB 4ZS7L 3VJ6A 3T4AA 3QIUA 4UNVA 4RMUA 4APQA 3O3EB 4NQEE 1CFTA 4GXVL 5I2IA 3CFCH 1ITBB 3D39E 2WWMC 3QQ3B 4NSKA 1CG9A 3RVXD 3SDDB 5IM7A 1GC1L 5HJ3A 5FYJL 2D7QA 1UZ8A 2XA8H 2IANB 2D7TL 5DEZA 1VFUA 2UWEF 2IJ0C 2VAAA 1B88A 2VLRA 4K7PL 1JF1B 3RWDA 4NQDD 3MLTB 4YQXH 1A6UL 1KLGB 4JM2A 4WTXA 3H0TA 1ZT4A 4GAGH 1J11A 1JWUA 2X40A 3FQTB 4NFBA 1A0QL 1IGTB 3P4MB 1FNEB 2VQ1A 2Y23A 3MREA 3LRGA 3B9KB 4XCFH 5AD0A 4R7NB 3N50A 5DEFB 4RA0C 2QQKL 5CJOH 4NWUL 1DL7H 3C09C 1K8IA 5I9QC 3SHSA 1MLCA 3IJSB 4FFZH 5D2LF 4QHNB 3WJLA 4MDJA 4LKCA 3Q6FB 5GSVB 4HPOH 2NCMA 3B5TA 5GGUA 3VH8A 5KW9L 3VXUD 1AO7A 1FNSH 1H5BB 2AQ3A 3HB3C 4M5ZH 5K9JL 2DD8L 5C0FA 2P5WB 5C0GB 5I1DB 5IBLD 3NAAL 4HFUL 3VFVA 3EYVA 3U7WH 1TVHB 5ALBL 4NO2A 2VE6A 1CLYH 3JSSA 3K3QA 2YD4A 1EO8L 2FYYA 2VQTA 4X6CE 4P2OB 4AEHL 1JWMA 1T0MB 3O6KL 3MRLB 4PB0H 3QDHA 4JKKA 1ZVSB 5CLTA 2ZKHL 3VGAB 3INUH 4YXHH 1CDBA 5DK3A 3SDCC 2ZNXA 3KJ4C 2VDMH 2J2ZA 1NDMB 2Y1VA 5EZLA 1ZANL 3C6SA 3RHWF 3MGOA 4UAOC 1CFVL 2DQEH 1XR8B 2R15A 1RY7B 3GB7A 2A6DA 4AL8H 2CDFB 2JTDA 4IDLA 2XKNA 5EOTB 3DUSB 1OM3L 5IFJB 3QDJB 1U8MB 4M3JA 3SGKA 2AV7A 4XMLL 4OQTA 3T1FA 1RMFH 3FFDB 1LEGA 4LEXH 2CIKB 4K8RL 4XCYA 5I74B 2NW2B 3DX6A 1MWAB 2XTLA 4G80B 1FSKC 3ZT7A 2R4RL 4KXZH 1KB5B 4BKLB 2IANE 5T3ZH 1TQBC 2VUYA 4EVNB 5F9WB 2DQGL 3OKOB 4CVXA 3ALXA 2B0SL 4P2RA 2X4NA 5BOPA 4OGXH 5JXAH 4NRYA 5DJ6A 3EYQD 5FKAA 4GRMB 5DD0L 5B3JE 4M03A 4O02H 1FDLH 4GMSL 5IFHH 1NCDH 2ADGB 1H3UA 4ZG1A 5I1JH 5J3HC 4IRSC 3B9VA 4P5KB 2R2HB 4CDHA 3PWUA 2BC4B 4F7EB 5EZOL 5M95B 5D2NE 4QKXB 1FV1B 2IALB 3CXHJ 3EJZC 3QUMB 1W0WA 4ZFFA 1UQSB 3QNXB 4LCWA 3DX7B 4Z77B 1ZT7B 5J9PB 2R1XA 2V2TA 5HHMB 1I3VA 1WIUA 4OLXL 3QH3A 4FQLH 3UTZB 4HG4K 4M1CD 1GRWA 1KTKE 1FGNH 1FL3B 4N0UA 4DZBA 3C6LB 3ZE2E 2DOCA 1NCTA 1CIDA 2HLFD 3MZGB 1YYLH 2FO4B 1AXSA 3EDFA 3MBED 2DM3A 2P5WE 3VE0A 1FNGA 2DTMH 4BSVA 3KLHC 3VFTB 3L3JB 5BRZE 1P53A 4H8WH 2IPKA 2XRAH 4HIJA 5FHAH 3MV11 4HEPG 2AK4E 2D9QB 3BUYB 2X89A 1P4LA 2DLTA 1R24B 4R26L 4J3WA 2WINA 3QULA 3D69A 3NCJL 2KBGA 1UT9A 4ZXBC 1Q9WA 3IGAB 1DUZA 5GS0D 2FX9L 4XP4L 2F54D 5D5MB 4FQ2H 2CLVA 4KKCD 2UUDK 1DANU 3X14B 5FKPA 3MACL 15C8H 1LGVA 3QWOA 4DVBB 1QNZL 4WHYH 3LV3A 4X7FC 5HYEA 1RUPH 3ARBB 4JRXE 4PJCB 2RAMA 3G04B 4HUUA 3OG4B 3KAAA 4MD5B 4JY4B 4L29A 5HVGB 3WFBL 4LIQL 3U7AA 4ISVB 3OAZK 4I13B 3F12A 1VERA 1XF4A 3K2UL 4TTDC 2NXZB 3M1BA 3SGJC 4PGBB 3VG0H 3QUZD 1H9VA 3MRJA 1I8KB 2Y25A 2G75B 3U0TB 4Z7UB 4NGHL 4C55A 5I8OL 5LAXA 4ZS6C 3X12A 5MEQB 5LGHH 4MWFB 1N8ZA 1HSBA 3B8SA 4J8RB 1DDHB 1YEKH 2FRGP 2Q6WB 5IVZA 4OZHB 4BUHA 3BVNB 3T2NH 2VKWA 1ZTXL 4W6YB 4Z7VA 3B9DA 2AJ3B 3UPRB 1TPXB 2FBOJ 4DQOH 4I0KA 4L9LA 1MRDL 3LKOB 3BPLC 5JQ6H 3RWEB 3BGAA 3CX5K 5HYQA 3B43A 1CL7H 2ZOLB 4L4VA 1E4KC 2B1HL 3OXSA 2G2RA 3SDXA 5D1QD 5E6IC 3DMMB 4FQJL 3NFSL 3DX9B 4PJ5A 1JHKH 5HHME 5CGMA 1RI8A 1JK8B 4OQTL 5IEKA 2QTEA 3SCMB 5E1HB 2YUWA 1P7QB 5L7XL 4RFOL 4PTTB 4AG4L 4LLQB 1A6AA 2DAVA 5ADPL 4QRRD 4HWNA 5IJKC 2DQJL 2EYTA 3L5HA 4KRPC 3ULVL 3QFJD 5BVJA 2BY0A 4I18C 4G6JL 4HIHB 4XNQB 3UTTB 2AQ1A 3DVNB 3ZE0E 2BXYA 2QBWA 3ZHLA 3LQZA 3OJ2C 4F15C 3L5WA 3HAEG 5DJXB 2LVCA 1ETZB 1YNLH 4U6YA 3P9LA 1INDL 4K2UH 2H3NB 1RJLA 1W8OA 3TJHD 4KJQC 3HE6C 4P3CL 5F7EL 4JEGB 5EOQH 3PIQB 4CVZA 2WZPD 1VFMA 3NZHH 2JB5H 3BI9X 4GAJL 3LS5H 2YD5A 5D5ME 2GI7A 3HZYB 1EHLL 1D6EA 4ZDHA 3VRIB 4P99A 3DHMA 4XVUD 4PJCE 3LEYL 5E6ZA 3C2SA 4ETQB 1A5FL 2I25N 2V7HB 4HX1B 5GS1C 5GXBB 3QIWB 1HWHB 2WBJC 4GG6F 4PUBH 1YEJL 1DQMH 4YBLB 1AFVL 3SJVA 3IJHB 1A8JH 1EHNA 5FYKH 1JPGA 3PP3H 3TBWA 5D7SL 1FE8L 2DB8A 3OAYK 4CMMB 5DQDH 1NLBL 4KI5C 4KGJA 4D9RE 4ZAKC 3I75B 5E5RB 1GZPA 5L2JA 5D6CB 4XGZB 4ODTL 2R1WA 1GAFH 2WWMD 3A6OA 2Z4QA 4KHTL 3ZDZF 1MI5A 4QRTB 3U9UB 1PSKH 4OZHE 1F58L 4OLZL 1U91A 2YK1H 4TUKH 4GW4A 5JPNB 5TDOA 4WHTB 4N0FA 4Y4FA 4ZS7H 4L8BA 4XCEA 3I3DA 1A7OL 3OSKA 4KXZI 3MLRH 5EBWB 1NDGA 1UVQA 4B41A 2AEPL 5FO9A 1CD0A 4WO4B 4S10A 4QHLB 4KWUA 5TE6L 1ND0B 5HGAB 3QG7H 2GJZA 4J6RH 4G9FD 1OGTB 1A6WH 3OKYA 4C59B 4YXKH 5C08B 1E27B 4NJ9L 3KXFD 1VFAB 1LWRA 3GI8H 5DJYA 3D0LB 4MJ4A 1T03H 3ARDC 3CSPA 3DXAD 4NO0A 3BGMB 2ZCHL 1OP3H 5LG1A 1C5DA 2Q8AH 3BXNA 1A6UH 4WJ5B 5GISL 4P46C 2P48B 3SKNB 5MEPB 3QO0A 1NBYA 1V7ML 4ODHH 4PBVC 4N90E 1SEBB 2X70A 1NGQH 1IQDA 1AD9B 1H3GA 4XP6L 2OK0H 1AD0A 3HB3D 1H0DB 1QSFE 4OCXL 1XT5A 3WL9A 1KJVB 1DBBL 3W5MA 2EH7L 1SJXA 1SYVB 1NFIA 5T3ZD 2JJSC 3CH8A 2YBRB 1P4BL 5FOBA 4RIRA 1HXYA 1DQJA 3LKQB 1EO5A 4IHOB 2VDLL 2FGWH 2R0LH 2UVEA 4XAWL 4QTHB 5IHUH 1T0PB 4TSBH 2EO9A 1MFCH 1T5XB 3RNQA 1ZLSH 5GQBA 4RNRA 2VDOH 3QAZB 2VXUL 4A2LA 4HFUH 3TIEB 3W11D 2DM2A 2BJML 1SJEA 5JHDA 3IS0X 3MJ9A 4NNXB 5I1LA 5EORL 4YDJB 4QNPF 1JTTA 1QEWB 4KV5E 1HQ4A 5ACLA 3R06B 4CRPA 1U8KA 4CW1B 3O6KH 1FRGH 5D71L 5EC1B 1QG3A 5C0EA 3RGVA 3MRBB 2DN7A 3BKCL 3GMLB 1JZ5A 2ZKHH 1KGCE 4IMLB 4BM7A 1R3LB 1S9WB 5K33A 1JZ4A 5FIEA 2X4PB 2H32H 1EJ6A 1XEDA 2FHCA 5EO9B 4NQDE 4ZO6A 5CUSH 1CFVH 4OFYA 1F3JA 3R0MA 1IVLA 4C56D 1KELH 3MV01 2CUMA 4L1HA 1U8IB 2HG5A 3P3YA 4MA3A 3ZHDA 5JOFB 4PJXA 4LHQB 4EDWL 4K8RH 3V0AC 5F6HI 5J3HD 2CKBB 3UAJC 4IRSD 1I8IB 3MLUL 1N7MH 4YHPA 1XGUA 3MV7B 2R4RH 4JANA 4U7SA 5ICYB 5FK9B 2AJVL 4KKBC 4KKAC 1XZ0A 3I6LE 4PJEF 3EJZD 1ZK9A 5I73B 2DQGH 5C08E 2B2XL 3ABZA 3VXUE 2NPLX 3UJTL 4XPGL 3LEXB 1X5LA 2NY5C 1OSPH 3JWOL 1WUNT 4JM2C 4WFFD 2J12B 5JO5A 2NXYB 2F19H 1CL7I 1NKRA 4G3YL 4GMSH 5HDOA 4CDGC 5KSBA 4PJBA 4H26B 1MCPH 1MCSA 2M26A 3TA3B 4X7CC 1CBVL 5JR1H 5DI8B 1S3KL 1T1YA 3DYOA 4JO4L 4WTZG 5KVDH 2EE2A 3QQNA 3AY4A 4WRLA 4FABH 4X4ME 2DWDB 2JK5B 4PJDF 4I0PD 3QNYA 3KLHD 2DQFB 5DHVB 3RI5F 3VXQB 1T6WA 3BQUA 3RVVD 1VDGA 2F5AL 1BFVL 2FJFA 3SQBA 3ARWA 4TVSa 1RUKH 5KANI 3RDTD 2ADJB 4M48H 2CK0H 3EUUA 4WDIB 2JIXB 4G6AC 3W5NA 2ORBL 3L3HA 4XAKD 1LDPL 4ZXBD 4WW1B 3AS0A 3BEVA 1IM9A 1QBML 1FG9C 1ZGLA 4PB9L 3AGVA 1AY1H 3OJVC 3KHOA 3T0VA 3S88L 1RZ8B 1YQVL 2AQ2A 4PRHA 5BZWB 5KJRH 1I9RH 1A14H 3UPCA 2IADA 4UT9L 1HOCB 3FB7A 2Y07L 3VFMB 4WI7A 4GRLB 2NY5H 1EAPA 3EHBC 5KS9F 1OPGL 5D7LA 1IKFH 2DBLL 1IFHL 1HHJA 1FAKT 2XFXB 4TTDD 3MJ7A 4N9GA 4H5SB 2FX9H 4HK0A 4XP4H 3O3BB 3Q48A 1FAIL 3DUUB 1JV5A 4TUJA 3F7VB 1EERB 1IGIL 1QNZH 1QPPA 4GFTB 1HQRA 5CSBA 3DI3B 4WFED 4I1NB 3WFBH 4CVUA 5GJSL 1FZMB 2P8LA 1VEOA 3IU3B 1Z0MA 4X7SL 4Q74A 1BPVA 1F8TH 2P8MA 1MFAH 3WHE1 2WSKA 5T3XE 3QUXC 3BRFA 1BVLA 5GGQH 3QDMD 1LEIA 1A1MB 4Y4KA 3W0WB 4DTGH 3OX8B 3DRTB 2DMKA 4DGIL 5K9QI 4HKXB 1ZSDB 1MCFA 3DV6A 5FOJA 3GKWH 4X6EA 3NIGE 4JFEA 1MCKA 3MJ9L 3G5ZB 4H0HB 5EUOA 5EU4A 2HH0H 3G6DH 3L7EA 2V5MA 4JZNA 2MQ3A 3S37L 5E6ID 4OCYL 3C60A 3C5ZC 1QO3A 3HHRB 3VFPA 3SE4A 2I60L 4GO6B 2FEEI 3R4DA 1FC2D 1P69B 4LPUA 1G7HB 5FYKD 4LLAA 1AKJA 1UM5H 4MQSB 4UIKL 3OF6D 3H9SB 3BWAB 3WHE0 3JUYA 5E5MA 4PTUA 5T33H 4Y4HB 2VL5B 2ADFH 4PJIA 4GBXB 1UZ6F 5FUOH 4QRPD 2FIRT 3DVGA 1EEUA 3QCVH 3UDWA 1INQB 3EOYG 3IFOB 3NFSH 1R3KA 3BPNB 3NZ8A 3IXAA 4HK3N 4HMCA 3GBML 1KJ3L 1WLHA 3NMEA 5FF6A 4N8VG 4RFOH 3GJFA 2ZUTA 2ARJQ 2PXYA 2R2BA 3BIKB 2ICES 4UV4L 3TN0A 2DJUA 3VDBA 4XXDB 4U1KA 4O58H 5C0BA 3CNKA 4WHCA 1NAMB 3NCMA 2CGRL 4L4TB 1RK1A 3HG1D 1IAMA 1UACL 1KFAL 4E41A 5I8CB 5H94B 5T1LB 5FYJD 4CJ1A 4NO3B 4IDJL 3PWPA 4UILL 1S7UB 3THML 4C58B 1KENL 1EX0A 2K7QA 4FHBD 5D6DA 7CGTA 4MQTB 3PJSA 4OM1L 1E4XI 4ZFOB 4ORGA 1AP2A 1K4DB 2AXFA 1E6JL 2WIIB 1PW3A 3PWVA 1T22B 1J9CT 3RA7L 1HKFA 2M8XA 3RAJL 2JB6B 4BFEA 4BK4A 4OCNC 4H25B 1I3RA 2EDWA 4HV8A 2IBBA 3ORJA 1NBQA 2W65A 1F11B 4OUUA 5DQ9A 4L4JA 3CVIL 1AE6L 4PRAB 5H37G 4I5BA 2YPLD 4PRPB 1C12B 2A73A 4XB7A 1NL0H 1KYOJ 1DJSA 1FE8H 4WU5A 3WHXB 5C2BH 1FFOA 1FO0A 3S35X 3W0WE 3WUWB 4JFYA 3ALPA 1V05A 4HH9A 2VZOA 3V5DB 5E8NA 4EI5D 3D87B 4QHKI 4L3AA 3H3PL 1F2XK 1R5VA 4U1GB 4F9LC 4GUPA 2AKRB 4U6VL 5I75B 4GG6E 4OZFB 3MODH 3V4VL 1K6QL 4X0KB 5IESL 3OKEA 2HT3D 5F1NA 2W59A 4Y2DB 1BP3B 4XNYL 3GUTA 2W0PA 1BEYH 4OF8A 3ARDD 3U4AA 4NRZA 4OB5H 3D2UA 1PG7W 4FZ8H 4R90L 2IPUK 1A9BA 1T89A 3BW9A 3FFCA 2EKSB 4K71C 5TE6H 4EUPH 2Q3AA 3PHQB 2EICA 1G9ML 5KG9A 2XI9A 4X5WB 4HMDA 3NACL 5EBMB 2A6JB 1O5DT 1XCTB 3ES6B 1YECL 1K2DB 2VXVH 3VFSA 1NEZA 3PL6C 1KEGL 1G7LA 5IQ9B 4Q9CA 4U7KA 3D25A 5LWYH 3SDCB 5KTEL 2VL4A 3BJLA 1WICA 4H1LA 4R8WL 1M7DB 3SGDH 4K8RD 1MIEL 2AGJL 2W92A 4UAOB 3S97C 4L4TE 1JPFB 3WO3B 2E9JA 4ZUUA 2IQAA 2QQLH 3MRCB 1YEDB 2DDQH 2V9QA 3TYGH 2VXSL 1DBBH 4UV7L 2VLLB 3WS3A 3MPCA 4NUJB 1XGYH 4JZJA 1IEBB 3D1MC 2O61A 4R0LA 2ZCLH 4TNWF 1MCJA 2PYEB 4X8JB 4CBPA 5C0JA 2UZIL 1OSZA 3SE9L 3IRPX 5EBLA 4N9OB 1TQBB 1WBYA 1HXMB 2ZSWA 1XFPA 3BP5A 4OGAC 1TZHA 2QADD 2MSPA 4LNRA 5E4EB 2BJMH 2YA0A 2HFFB 2XNAB 5LXGL 5T5FL 3MLZL 4KJYA 3L3KA 1NCNA 1S5IH 4X7TA 3MCKA 4RAUB 2Y7QA 1Q94B 4POYA 1ZHKB 2R0ZL 1ZVHA 3QIUD 5CJXA 1LEKA 1N6VA 4APQD 3BKCH 1LK2A 1KIUA 2OR9L 3MRDB 4I3GA 3KXFE 4NPYB 4F7PB 3CC5A 4JB9H 2JKXA 4XPHL 3PDOB 5ILTL 3O45B 3ULUC 2NY3C 3DXAE 5A2FA 4QNPE 3EYOB 1KT2A 4NYLA 1FJ1B 4F80A 4KKBD 4KKAD 3O6FA 5HHQA 3OHXB 5JQHC 1DLFH 3QPQC 1AC0A 2UZXB 3WD5L 1DQLH 3E6FB 3B9EA 1L6ZA 4Y4FC 3RWGB 1JHLL 1MCHA 3CZFA 4HUVA 4MQ7A 5I19L 2MHAB 3GHEH 3WIHA 1REIA 1IC1A 3IDMB 4JM2D 5CP3H 1QA9B 5T3ZE 4I9WD 4ZUSA 3DX8B 2AEQL 3FQXB 5BO1L 3EJYD 3K46A 5DMIL 3TO4B 3MRQB 1J10A 5ITBL 4M6NH 3ECBB 3AM8C 3B2VH 2B2XH 2R39A 3AVEA 1AGCA 4Y2OA 4GKZB 1YJDL 4IEFB 2I5YL 4GH7B 1FO0L 2FR4B 1OAYL 5HPMA 1VFBA 1CBVH 1P7KA 2E7CA 1A6ZA 2VLKB 4G6AD 2YWZA 1I85C 1AO7D 1ZT1B 2XICA 3D9AL 2NW3A 4QOKA 3NPSB 2FSEB 3ULUH 3FN9A 5SWSA 1ZHNB 3KYNB 1J0KA 2ZCKL 1KG0A 2Z8RA 2YPVL 3VMNA 2KUTA 3EDKA 5J06A 4O00A 1YMHB 2GUOB 1CK0H 4OFPA 2BFVL 4XNXL 4PJHB 1Z5LA 3PABB 2F5AH 4JM2F 3QI9A 1OB1B 5BV7L 3VFNA 2PN5A 4UT6H 2VLJD 3RTQA 3MLXH 3UJJH 1AQKL 4LNVA 1T1ZB 2GSGA 3TPUA 4CNIB 4OZIA 4C56E 1KNOA 3MR9A 3CCHB 3HE7B 4I77L 3IRZA 1CD8A 1G1CA 2XOTA 3DSFH 1UCBL 4KQ4H 1S7QA 3ESUF 5B4MC 2IFGA 4UT9H 2GJ6B 1JPST 3ESVF 4HLZG 2AJZB 3ARRA 1HCFX 3BPLB 2DLHA 3MUGB 2GCYB 2VDQH 2CLZA 1N2RA 3RGVC 5IW6B 2DBLH 4RQQA 2HLAA 3D3VD 3TYFB 4NKDB 4PREB 2FD6H 1C16B 4OD1L 2CDEA 3HMWL 1N4XH 3FO2A 3AFLA 3REWB 4K7FA 3LOWA 3QCUH 4LSDA 1NUFA 1KB9J 4X99B 2ID5A 2L7JA 1ZOXA 3FO0H 3HZMB 4XMKH 1I9JL 5E2WL 3DTXB 1NC2B 3HRZA 4P2RD 3W9EA 3OR7A 4LLWB 5IOPB 4NZTL 4YIQB 1RJZB 5HD8C 1BJMA 3LZFL 1WBXB 3N1GC 1OCWH 3C5ZD 4XBPB 4KRPB 1X5AA 4MJIB 1AXIB 3G5VA 3MCLL 4MAYB 4ODXA 3CFBB 3UTSB 3I2CL 2GSIB 1MJ7L 2VWEC 1BBJA 5ECJE 2RJMA 4XP5H 4LOUC 2YUXA 4XMPL 2H9GB 2DI9A 3IFPA 3NCYS 5I1KH 2X1PA 5IR1B 3D85B 1QVOB 5E0QA 4EQ3A 1ZA3B 4LCWD 1P5VA 3S37H 1IL1B 2FZ3A 3HE6B 4XAKE 4RFEA 3CFKA 1ED3B 3WSQH 1XGRB 4X9HA 3KWWB 3I6KB 3T77B 4UDUA 2VLKE 4HWZA 3PGDB 4M9OA 4UIKH 3ULSA 1HYSC 1MFBL 1UH3A 1YYML 5I1GL 4XNZB 5GS1B 2WBJB 5HI5C 3FB8B 3GSVA 1FL6B 1WK0A 1ORSA 4M9PA 5DQJB 3BESR 4OT1L 4G42B 4X7DC 2VMFA 4P0DA 2XG4A 2X89D 4LVNC 4XWGH 3N9GL 4ZAKB 5C09A 3OKNA 4FMKA 4PYHA 1IAIL 1QLFB 5EN2A 5DRNA 1OGAB 1G7QA 2W1NA 4NZRL 4WFEE 5FGCB 2C3VB 4XBGB 3T0XA 1CLOH 1D5BB 1UZ6E 3DV4A 3C8KA 4PGCB 3O2WH 2CGRH 2Z91B 2NNAB 2IGFL 1HSAA 5IB1B 1WBZA 4FQXC 2NY7H 5IK3B 2A2QT 3CDCA 2GJ6E 4HZLB 5C1MB 4PRBA 1RIVL 4E9LA 5IMLB 1XGTA 3RZCC 5I16B 1XR9B 3UYRL 2XWBB 5FYLE 4YHOH 4ZUWB 1KJ2A 4OUOA 1T83C 2BK8A 2EIEA 3BT2L 2A6KA 3LN4B 2I9TA 4FXGA 3RA7H 5H35A 3C5JA 4NKIL 1KPRB 3NCEB 3VXRB 4ZPTA 4DVRH 1GPOL 4HUXA 3KPMB 1PVHA 5EB9A 3MROA 5JXEA 4G9DB 4XC3L 1MVUB 2D7MA 1JGUL 1N64H 3HCVB 1IARB 1NMBH 4P46B 1EHAA 3MRKB 1HH6B 5GHWH 4NCDA 4MJIE 1XIWA 4QRPE 2BVEA 3VXOA 4PJ8B 4AH2A 4WUKL 5CEZH 4ODUA 1CVSC 3U7YL 5GRYA 1BVKA 1Q72L 4GAYA 3EGSA 3MV9A 1FGVH 4L4VD 2KZ1B 1G7JB 3SDYH 1B3JA 1OF2A 1OW0C 2P5EB 2AK1L 4GW1A 4BJLA 3L5XL 5IESH 3FOLA 1HHIB 3S7GA 3SE4C 5CCKL 3CVHL 5C0AA 4PJ5D 3VWJB 1YEEH 3Q5YA 4XNYH 2Z31A 5SWQA 2X05A 2PCPA 4FFVD 2BX5A 2XZZA 3VA6A 4R96A 5DUBA 4XPBH 2FL5A 2CIIA 3WXVL 1GXEA 5E7BA 1OY3B 3P11L 3BMWA 5T1DL 1IGYB 3S3SA 3UYPA 4X9FA 1U3HC 4FOMA 2NY0C 3VCLB 4H0GA 4MSWA 1NUGA 3S98A 2X4QA 4Z7VF 4HCRH 1FC1A 3MYJB 1LO4L 4KI5E 4ONHB 4OGYL 3L9RA 4QRQA 2ZPKH 2WLZA 1A1OB 5F9OH 4JRYA 3I3EA 1H3PH 3S5LB 1OGAE 2NTSP 4OF7A 1QRNA 5EZIH 4RAHA 5CP7B 5FGCE 5ENWA 4QHUB 2YPLE 3PHOA 3OJDB 4CN4A 3IFLH 8FABB 3O41A 3FOMA 2YSSA 2Z0BA 5IT2H 2LFGA 4A6YA 4OGAD 4NM4H 2FJGB 4OV5B 2GTZB 4KMTH 2MCPL 4AT6B 4G43A 1QBAA 1PEWA 1QQDB 5LKNA 1JNNL 2E27H 3SJVD 5TFSL 1I1FA 5HGGS 1IRAY 1V7NH 4GW5A 2X5PA 4JDZB 5K9OB 2CRMA 3Q2CA 2VIRB 4F7TA 2UZIH 4POUB 4N1HB 2X4RB 3O3DB 2EDYA 2ESVB 5EBGA 3V0VA 2DIBA 4JY6B 3VXRE 5C0DA 2VITB 4TVPE 3ULUD 3P0VH 2MPAL 3T4YB 2F74B 4JO2H 1ZHBA 4U33A 4M7LT 4Q0XH 1ZS8A 1NGZA 3HC0B 1FG2A 1SYSA 1QFWL 3SKMB 3STZB 3GJFH 3V4UL 2E3VA 3LAFA 4PJ9A 3RNKA 4Y4FD 5DLML 4LCYB 3KYMB 3G9AB 4KQ3L 1IC4H 2C1OB 4YDKH 1DUYA 1X7QB 3GK8H 2BSED 4YHML 3RKDC 4JFZL 3I02B 4L8SA 4FXKB 4YXLL 4AZ8A 5L88H 1KF9B 3V8OA 1EDQA 4M7LL 3IVKA 1O7SA 3FKUS 3T0DA 3TH2T 5H2BA 2WK2A 1NAKH 3F7YB 5KSAB 1QSEA 3QXAB 2E7LC 4MMXC 5E2TH 2RFXB 4YHYC 3IDIA 4XZUB 1D5IL 2DF3A 3WIFA 4P5TC 5DRXA 3ULUF 5BS0B 1WC7A 3TZVC 1S8DA 2YR3A 3EO0B 2J88H 5DMIH 4G6KH 4NN6C 2R23A 4XPAH 5A2IH 4ORZC 1S9VB 4IIQB 4WW2B 3MA9L 4NQEA 1J7VR 1A4KB 1C7SA 3WV0A 3UJIL 1B6DA 5L8JB 3D39A 1CICC 4KK6C 1IAOA 2G9HB 2WUBH 3S9DB 2OTUA 3QEUA 4HBCL 4MLSA 2ZCKH 5ADOH 3KYOB 4HS3A 3ET9F 5K9KA 3HLAA 4OCWL 1J1PL 3DURB 5BJTA 3QA3A 2BSRA 3QUXB 4G6FD 5B4MD 3BKJH 3BZFB 1MEXL 2Z35B 3H9ZA 3K8MA 1AGEB 4J1UA 1ONQA 2KKQA 3U0WL 1I7RB 4LAQL 4JG1L 1T04B 5LQBH 3RGVD 5GZND 4LSVH 3ARSA 3L3GA 1FCGA 3L3DA 3PP3K 5FB8A 4LCIH 3DJ9A 3DO7A 1OP9A 4Z78A 4FZEH 1OAKL 2NY1C 1YNTA 5CEYB 4KDWA 1RZKL 1J8HB 3ROLB 4QRSA 4RGMC 4HF5L 1JGLL 2OL3B 1I1YB 5JUEL 4I9WE 3OWEA 5C0IB 3W9DB 4Z6AT 4OIIL 3HC3L 5B38B 2BHUA 2PETA 4UDTB 5HD8D 3GIVB 2A9MH 3U4EB 5I8EB 4DAGH 5B8CA 5TF1L 1JZ3A 4PY7B 5JMOC 3GMPB 3DWTA 3DYMA 4H1LH 3K74B 4JFFB 3MCG1 4QXWA 1UM6L 1RQ5A 3GSNL 3QIBA 3O6ML 1LO0H 1FFRA 1I9JH 1JTOA 4XI5D 1ZXQA 4J4PA 4A6YL 4AENB 3BOVA 2X2YA 3O6FC 4MJ5B 5GGRA 4LOUD 5TE7H 1BIHA 4Y1AB 4X7EC 3TV3H 2B20A 4ZNCD 1JPSH 2EO1A 1Z3GL 4X6CA 3L5IA 5E1AB 4JKPH 1KV3A 3QDAA 4HT1L 2LTQB 3WNOA 1R3HA 3I3BA 2DJSA 1RVFH 3T3PE 35C8L 2YEZA 3EYFB 3HNTH 4PG9A 1CYGA 1ZE3C 3AB0C 4KH2A 5BS0E 5ACMA 1T3FA 5D7IB 2HJLA 1NBVH 2D31A 4XMPH 1ZA6A 2RB8A 4UQ3B 1WWWX 2WMPA 4YBHA 1HYSD 5DD3L 4HWBH 2VLJE 4OLUL 5HI5D 5KVFL 4OF5A 3DRQA 3BQUD 1LD9A 3EFDL 4PJXF 4PRDB 5T1KB 4LVEA 9CGTA 5I1AA 4LARH 4TSCH 4S1SL 1J0JA 1OWWA 1VPOH 3P73A 2C5DC 3LHPL 3UZVB 1CR9H 4JFQB 4KJPC 3TVMC 3RVWC 1W0VB 1IM9D 3SDDA 2J8UB 5IV2A 1NFDB 2IANA 2NZ9C 3FTGB 5LBSL 2E6JA 1HDMB 3QHFL 3EO9L 3VFWA 1IJ9A 1EFXD 2YZ8A 3D3VE 3C9NB 4O2FB 1W72A 3SBWC 1JF1A 3QI9C 3P4OB 5KSBF 3ZYZA 3MLTA 3VFGH 1KLGA 2RQ8A 3WIHH 3VD4A 3C8HA 5D7LD 3RQ3A 3RZCD 4DW2L 1PYWB 5D2NA 1PZUB 2EIZB 1E6OL 3FQTA 3QWQB 3JV6B 1IEAB 1HI6A 3P4MA 2YC1B 4FQCL 4I8DA 1K4CA 3B9KA 3ELAT 1JE6A 4R7NA 1YMMB 4BFGA 2EEDA 2VABB 5FUZL 1CD1A 4XHQA 1RIVH 1G7IA 2W0FB 3IJSA 4K3DH 4QHNA 3TT1L 3SY0B 2ATPA 3ZYIA 5GGSY 4W4OC 5GSVA 5DTFB 3EAKA 1X5FA 4MB4A 4NQVB 4U2ZA 1BZ9B 2J5LC 4MB5A 3A6CL 5IB4B 4Y4KD 4JFFE 4D8PA 2P5WA 5C0GA 5I1DA 2VLMD 4QXGL 1PKQB 5BRZA 2OXGA 1TVHA 3CFEB 3LS4H 3NFNB 5BCAA 4AEFA 2AK4A 3H9HB 4Y1AE 2DQTL 3PL6B 1SJHB 4WGWB 5GRZA 4I3SL 3SKJH 4KROC 1UKTA 4PJAB 5I8KH 2HKFL 5KOVC 3L6FB 1MCBA 1D9KC 1C1EL 3WUZA 4OI7A 4U3CA 4F2MB 1AKJD 4PGDB 4WUKH 1TCRB 2IH3B 3HC4H 4JPWL 5D7IE 4JO1L 3IKCA 4JRXA 4OZ4B 3SQOL 2P7TB 4NKQB 1A2YB 3ARGC 4JG0H 4O9HL 2CDFA 5EOTA 5IFJA 1QRKA 4TSAL 1U8MA 2NY0D 3C2AH 3EBAA 3ZYJA 4UTAH 1J5OL 4XXCC 3Q3GA 3FFDA 1BQSA 4NBXB 2NW2A 1FYTD 1MWAA 4WI2A 4G80A 2VR4A 5E6YA 1JZ7A 1MUJB 3H42L 3P11H 3VFOB 5C0BD 1AGBB 5L6YL 1KB5A 1M71B 4BKLA 1NFDE 1UJ3B 3OKOA 4J3OC 3WIIH 4M7ZC 4E41D 4YHNA 1LVEA 1TZIB 1S9YA 2CUHA 3H3BC 4GRMA 3BFOA 1OAQH 3KDMB 4YHLL 1LO4H 5F7NC 5FCUL 4NJAL 1YC8A 2CJUH 2FECL 4JDVB 4P5KA 4U1LB 4YHIB 2VZ1A 2IH1A 5D93B 5DVOA 4F7EA 3SPVB 4UUJB 5GRVK 1FZKB 5HYJB 1NLDL 2N4IA 4HS8H 4KKLD 4BH8B 1BQHA 3H7BB 1GGUA 1IC5H 2GW5A 3QUMA 3DGGB 2BCKA 3QNXA 4JO3H 4NO5B 1YMME 3KGRA 5J9PA 1BGXL 5F7DB 3U36B 1M05B 5B39A 3O2DA 2R69H 3UTZA 2DLGA 1GGTA 4RRPA 12E8H 4ZFZB 1HHHB 2EE3A 1JNNH 1JIBA 4HXAH 5DYOA 4ZTOL 4JKWA 4WNQB 2G5BB 2DYPB 2FO4A 1GGCL 3HAEH 1T2XA 1NC4B 5MENB 1NJ9A 2V7NA 3VFTA 1IILE 1PKQE 3L3JA 4FQPA 4BFIA 1FVDB 2D7NA 3GGWA 3IETB 1QLRB 3BD3A 3BAEH 5A2JH 4NQUA 2A9NH 3BUYA 4M4RA 1I3GH 1W72L 1R24A 1JRHI 1FIGH 2OBGA 5DHXB 4D0DA 2XV6B 4U6HB 1MFDL 4U7MA 3WJJC 4PJGB 5F93C 1P84J 4L8DB 4FNLH 4PJAE 2B5IC 4JVUA 3IGAA 3V4UH 2G60L 5GRJL 1ES0B 5DLMH 5L2KD 1KXQE 1U0QA 3K81A 5D5MA 1UG9A 3X14A 1OWRM 5D72L 3TJEH 5J57B 5KANG 3O4LB 4FTVD 1DQQB 4U31A 1OAXL 4M6OH 4AIOA 4KVNH 1CFQB 4P5TD 5SWZB 4PJCA 1DFBH 3G6AB 3OKKB 3TZVD 5DMGD 4M8QB 4JY4A 2WM0A 4Y5XB 2ZOKB 4KJWC 4ISVA 4XC1H 2WBKA 1S5HA 5KVGL 4JQVA 4LHUG 2E9WA 4PGBA 4UQ2B 1FL5B 3ZDYE 4PLNC 4P4KA 1I8KA 1KJ2H 4HHAA 5E9DB 4EDXB 1T4KB 3U0TA 4NZDA 4HFWB 1KOAA 1BZQK 2QSCH 4Z0BH 3ARXA 5DVMA 1DSFH 3MFGB 1Z0NA 1CLZL 5MEQA 2EE9A 4KK6D 1GGIL 3L3OB 4D0BB 4J8RA 1DDHA 4HUMB 4YDIH 2Q6WA 2PYFB 4OZHA 4J3VA 3BVNA 4B7IA 3PDDA 4JM4H 3LQAC 3TIDB 2YUVA 4O2CB 2AJ3A 5ESVB 1PG7H 5AUMA 4FQQB 3MA9H 4TN9A 5FHBL 3LKOA 1J0YA 2APXA 4O51A 3ULUE 1TJGL 4JFDB 4RMSA 5HXMA 4Q9QL 4U6XB 1X4ZA 5CIPB 1UJTA 1XF3B 2F8VA 5F7KC 4AY0A 3GDBA 4M62L 4ZO8A 2PW1B 3DMMA 5EO1B 2H41A 4OD3H 2NY1D 5EFIB 5JLZB 1T2QH 3QJHA 2EYRB 4RDQG 3SCMA 1BX2A 3GSXB 1MLBB 1U3YA 2VDRL 2X9XA 2V5YA 32C2A 3GI9H 2YN5A 4LAQH 5KVEL 3FRPA 2NY4C 5BW7A 1CFSA 3GBNH 2Y5EA 1N59A 2AABL 4M6MH 1MY5A 1NCCL 3TO2B 1QSFA 4HG4J 3HZKB 1RZKH 4NBYB 1I9IH 3QEHB 2GT9A 3AAZB 1JGLH 3SDAB 5DJXA 3O6FD 1U93B 2D7PA 2H3NA 2VXTL 4PJGE 1KJMB 4Q6IA 3FO9A 5GJTL 1MSPA 5TF1H 4NHUA 1RJYB 3MQIA 3HZYA 2MKLC 2ZG2A 2ITDB 4LLYB 3QUML 5DURB 1SEQL 1D5ZB 3VRIA 4Y5VA 3HI5H 3MBXL 1G6RA 3O4LE 4KZDL 1X4YA 3G9VA 3GBLA 5CZXC 3I6GA 3NA9L 1UM6H 2YRPA 5F6HJ 3JVGC 4ETQA 4A6YH 5EU3A 1DEDA 1RULH 2V7HA 5JORB 4HX1A 3CUPA 3QIWA 5EWIH 2BY1A 3O2DL 3V79C 4WFHE 4OCSL 1JYWA 1Z3GH 3BGFC 4OZGB 2IFFH 5SX5H 25C8H 4MXWL 5MHSE 3KHQA 2AS5M 3QP3A 1S78D 4UMGA 3I75A 2JJWA 2IG2L 3UZEA 3QWRD 5D6CA