5E9DE

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMAWYRQDPGMGLRLIHYSVGVGITDQGDVPDGYKVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGWMAGGVELYFGPGTRLTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 27
structure length 115
sequence length 115
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dE00
5HDLA 4TUJB 4YBLC 5I1DB 4IMKA 3E6FB 4EVNA 3QNZA 1FYTA 5ID1B 4UTAL 4PRIB 5ITBH 2FB4H 4U0QB 3EO9H 2EIDA 1P5UA 1IC4L 4WWKB 1CDGA 3OJ2C 5DD3H 5LBSL 4XBPB 2HH0L 1RD6A 4WI8A 3PGCB 2WP3O 1MLBB 4JKPH 4EBQL 4NQSB 1DE4B 4NO2A 3MROB 4MAUH 3QUXC 5I75C 4JCMA 4MXWL 3NACH 4J8RA 5FYKE 4JN1L 4FTVB 2FJFB 3LEXA 4NQXA 1KT2A 1HQRA 1G6RL 4Z7VB 5GGRY 3DO7A 1JE6A 1M6OB 5AZEH 3VH8B 2NY0C 3CVHL 1EGJL 4ZUVB 1GAFH 4LCCA 1RU9L 2IAMB 5HGHB 4HH8A 4Y5XB 1YMHA 2UVEA 1E4XI 3AY4C 3C6LB 3LHPH 4IIQB 3HA0A 5C0AE 5BS0B 2EDRA 3E6FA 4K8RH 1OB1A 2ED8A 5F3BB 2L7UA 2WUCH 4L8SC 1C08A 1IQWH 3SQBA 25C8L 2VDRH 1U91A 3ARVA 3GRWA 2NYYC 1J8KA 2M2DA 4PGZA 3RY5A 4D3CL 2NPLX 2MOVA 2R8SH 2VXTL 5C08A 4PJEE 4QRPA 3HMXA 1KN2L 1DBAH 4QXTA 4F7EA 1QTYT 5IMOB 1BFTA 1A4JA 3FFCE 1CL7H 1QBLH 3MLSH 3W0WE 1VERA 2B4CC 3CFIC 3LD8B 5CZVH 1XCQB 1BFOB 3VA6A 1GZPB 1CCZA 2NY0D 1QLEL 1NUDA 1MREH 3BQUC 3H9SB 5B8CA 3BP4B 5B3NA 4DVRH 1ZOXA 5I73C 2VTFA 4UDTA 3EO9L 3H0TB 2PW2A 3DECA 3MRMB 4GW4B 1P9MC 2LU7A 4O9HL 3VFMA 4S0SD 3RDTD 2H32B 4U1SB 1JF5A 5DJAA 1S7WA 3FJTA 3RWGB 4LEXL 2FH6A 2O61A 1IVLA 3MQIA 4L1HA 5L2JA 4MNGB 2FL5A 2CMRL 1P1ZB 3S36X 3DURA 4MB4A 5HHVL 5DC0A 5HD8D 4S1QL 2GK2A 2PW2B 4BSWB 4D8PA 2DAVA 2AGJL 1UWGL 4PJ8A 5C09A 4Y2DC 3EO0B 5IM7B 4MJ6A 3WHXA 1J0JA 1FDLL 2FLRT 3MXWH 4XPFL 1I7RA 3V4VH 3UTPE 1ZSDB 1IM3A 5CEYA 2OYPA 3I75B 4WFFD 7FABL 4LCWD 1IRAY 1FNEB 1P9MA 2AEWA 1F3DH 5E56A 2QSCL 3V0VA 1TITA 1EV2E 4NM8H 1Q72H 4GKNA 1GYAA 5BVPH 1KCSL 1DSFL 4YE4H 2XTJB 1RJYA 3MLPA 1T2QL 4I5BA 1HK6A 1N3NB 1Q94A 1T66C 2APFA 4BFIB 4D9QD 1ZVSA 1V3LA 1FYHB 4HBCL 1T1XB 4QHKJ 1DLHB 4KJPD 4P9HC 3RX8A 3X14A 3QG6B 3K81A 3RWEA 1MCIA 3QIBD 5A43C 4XAWL 4TULH 4XNYL 1P4LB 3RI5F 1NQBA 4LKCA 1ZSDA 4KUZH 3RIFK 1VGEL 3Q5OA 2DLIA 1T04A 4YGVB 3OKNB 4O5LH 2CDFA 2DQCH 4G80B 1WVZA 1KPUA 1QSVA 2AJ3A 3N1FC 4G6AC 4K94H 1KTLA 5TGBA 1CL7L 1QBLL 1YJDL 1MRDH 2CLRA 2QADC 4ODUA 3U46B 1J0YA 3I6LE 4HUWB 1NC4A 4J7RA 2YK1H 4HFUL 2JB5H 2OJZL 3WD5H 3ZL4H 4M1GL 4HWBA 4XRCA 3ZDZE 2O61B 1XZ0A 2K3TA 3U1SH 3WUWB 2NY4B 4M7JH 2OMNA 3QO1B 4P2OA 1RZ8A 4ZXBD 5IBTL 2FDBP 1TQBC 4WJ5B 4HPOL 4EN3C 2IWGA 2HFGL 5C0BA 3NFNB 2Z8WC 1RK0A 1IGFL 1QSFD 1I3GH 2ATKB 3DX7B 1S9YB 1MNUH 1FL3A 1DTUA 2HT3C 4JKMA 5FFLA 5CJOL 1T5WB 4X5WB 2RB8A 1S9KC 4GRMB 1TZGH 3VD5A 1NAMB 3GHBH 4HGMA 2BOCB 4F7PA 5IFAH 4UQ3A 4LK4A 4P5TB 3SDAC 2QQQA 4CW1B 4NN7B 1XAUA 4NN5B 3RVTC 1UGNA 3T0BA 5IG7B 3MRDA 5D2LA 2DMBA 2PXYB 2OR8A 2DIJA 4IRSB 4B7LA 3IFNH 1D9KA 4G42B 1TVBB 5J11C 2EKJA 1D7FA 5JW4Q 3HPJA 2D7NA 3JTTB 2OZ4A 4R7NB 4GBXB 5T1LD 4Y1AD 2UWEF 1H3XA 3RL2A 2YSSB 5IUSA 4LCYA 4P0DA 1NGPL 5I6XB 1FJ1A 4XMLL 4P5TA 1XGRB 2QHLA 3RFZC 5J1TC 4AEEA 5FECB 3E3QC 1OP3K 5DSCB 3LEXB 2YD6A 4CU7A 4WO4B 4ODVH 3PP4L 1YEFL 4O58L 3VD7A 1XH3A 4LCUA 4ELMF 5EO1A 1KENL 1L7IL 1UWXH 5MEOA 2DDQL 3OHXA 2BY2A 3MJ9L 4MA8L 1YDPB 5AYQA 5JW5A 3ISWA 2DLFL 3KVQA 3KPNA 4XXCC 1KCSH 3T0EE 3WFHA 1AHWB 2YUWA 2H2PD 3FOMA 1H8OA 4Y4KA 1OPGH 5JOPE 4WFGD 1ZGLM 1NL0L 1IZKA 2ITDB 3BXNA 2AGJH 5J0BA 5TPWL 4HUVB 4AJ0A 1QSED 4DQOL 3MRPB 3KPOB 1X5AA 3WIFA 1HNFA 2BRRL 3LMJL 1G7JB 4RAVA 4IJ3B 4MJ2A 1BZ7B 1HIMH 4N5ED 1VFAA 4GQ9L 1ZLUH 2J4WH 3N0PB 2I27N 4YBHA 1JI1A 3ARGA 4GQPH 2HT4C 1F3DJ 5JW5B 1AQDA 1NCDH 4JO1H 4WV1C 4PJDE 3L3DA 3VXSE 1BWWA 4Z0BL 4MA1B 3BP6B 5K9KB 1L7TH 2YD3A 3AY4A 3AS2A 4ONHA 3WD5L 3O3UN 4YDIH 5HDQH 5FYJL 3UBXI 1FN4A 2YPLD 1D6EA 4CJ1A 5CLTA 1ZLVH 1NFKA 1A2YA 4I77L 4U7KA 3QRGH 3V6BR 5F3HA 3CFCH 3O4LB 5GRYA 1WEJH 5E8NA 3RRQA 3LDBC 3ZYZA 5INDA 3WDHA 2VZUA 5IF0B 4ESKA 5CSZB 4E42A 1N64L 3HC3L 4IHOB 4MCZB 2VH5H 4QY8A 4F7MB 4LU5L 1OARL 3RDTA 5LCVH 3OQ3B 3IJHB 2WLZA 1OCWH 3VCLA 2HKHH 3FQNB 4NKQB 5FK9A 4X9GA 3IETA 3SCMD 4JRXD 4TUKL 5JIIA 1T3FB 2F53D 2VN4A 3MV8E 4LQFH 3BN9D 4R4NC 3VXTA 3FO2B 4YDKH 3GI9L 1Z9SA 2WBKA 5D6DA 3ULSB 3R1GL 4J12A 1GZPA 4PJCA 1HCVA 4QHLB 4XCCH 3A6BH 4RGOH 4JFOB 4P2QE 1NFIB 1W0YT 3OR7B 4JJ5B 3GMOA 3TBTB 4GMTL 1RVFH 3VCLB 2HLFD 3T2NL 5FV1L 1LD9A 4LLYB 3ARRA 3UPRB 5D7JC 3FQRA 3BN9C 4R4ND 3QHFL 4PJHE 4QXGH 4L5FH 3FO1A 4L4VB 4XCNA 4APQC 2G2RB 3Q6GL 3HNSH 4ZFFB 5LWYH 2VISA 1IKFL 4OCWH 4RMRA 3HB3D 4OLXH 1C12B 5KANG 3BEWA 3VXRB 1GIGH 2PXYD 5C7XL 4FFWD 5IHUH 4G9FD 5D2NB 2IPTH 3BT2H 5IW1A 3D2UB 4EDXA 4PGJA 3BP6A 2V2XA 2X4RA 2YPLB 5DJ2A 5IB2B 3UMTA 1MCHA 3SEPA 1S3KH 3NCYP 3CPLA 1E6JL 5SWQB 4BFEA 3DHJA 2JIXD 4XWGH 4OSUH 3GMLA 2PTTB 4W6WB 5C8JA 5LG1A 1XF5B 2CRIA 3KAAA 4Y4FB 3QDJB 1KPRA 3WIIL 5DI8A 4H1LH 5ID0B 1NAMH 4RIRA 4ZFGL 4PJDF 3RWEB 4GQ9H 4D0BB 5HXMA 5GS0D 5I66B 4OJFL 4X4YB 5L7XH 2F53B 4LVHB 4OTXL 4PRIA 2DIBA 4ODTH 2DM7A 1XR8A 3RI5K 3TBYA 3DARA 4QNPF 5J8OA 2X2YA 2C3WA 3DXAB 3DPBA 5GS1A 4RAHA 3MV8A 1INDH 5C8JB 4E41A 4WTXA 2OR7A 5LKNA 4M48H 4NQXB 1CK0L 2FJFA 3MOAL 4WU5B 4YDKL 1MJUL 2APXA 1FRGL 4FP8H 3UBXB 2F58H 1LE5A 5EBMB 4M6NH 4X5XB 3IFOA 1FO0L 2RJMA 4LPWA 4PUBH 2EE9A 1HQ4B 4XCCL 4FFVD 5EU3B 2EKSA 1TQCC 1RUMH 5F7HA 3HR5A 1QVOA 1RZGB 1P4BL 3CMGA 1U8PB 3TH2T 2W9DH 4HWBH 1RK0B 3F62A 3QO0B 4JY4B 2VLJA 4NO5A 1JHTA 4YHOL 3U82B 2K7PA 4X7TA 1FNGB 3GJFH 3JXAA 5H37H 5HDBF 5EU3A 4NQEB 1WT5C 2ATPA 3FONB 4YR6B 1EK3A 3E6HB 4MNQB 3DMMB 4XWOC 4UTAH 4LVNC 4ORGB 2XRAH 4KJYB 2VL4A 5C0GB 2I5YL 4Z8FL 4XP5H 4K71C 3BJLA 4HC1L 3I9GL 1BFOA 5BZWB 2W65A 1QKZH 3GBLA 5CJ8A 4OBRA 5CIPA 3D85B 4NYLA 3LEYH 1IGFH 1T7ZA 3LKRA 4KKLC 1T1YA 4LPXA 3NPSC 2VMFA 2Y6SC 3DGGA 5MENB 3OKEA 5I8EB 1LEIA 5D6CA 4QTIH 3CZFA 3NA9H 3MLUL 1G6RH 4M5ZH 1LO3L 1TETL 5E9DD 4ODXB 2NY1B 2VLJB 4M93C 3R8BB 3VXMD 5ABDE 3DX6B 1DLFH 2PCPA 1RJYB 5CFHA 4G8IA 3HR5B 4F3FA 4GG6A 1XF3B 3GKWL 3PGDB 3SGJA 1T1WA 4RA3A 5EU5A 3UAJD 4HV8B 1EERB 1P2CA 4PJ7E 1FVEA 1N59A 4HFUH 1U8NA 1UEMA 2D0FA 3ILQC 3MTRA 2OTWB 2NW3B 1WISA 2CK0L 3EYOB 3QULB 4TTGA 3U0TB 1MWAH 3WNOA 1IGMH 4LLWB 1M6OA 2FEDD 1GJIA 1HCFX 1NJ9B 3G5ZA 4OZFA 4OZ4B 3V6OE 4HIJB 3I3DA 5F89B 4FTVA 1HHJA 2DD8H 4HWNA 2AP2A 2VITA 4JHWL 4TRPH 3D9AH 1YEKH 2ORBL 4CDGC 4LVOC 3VXRA 2QLVB 5IVXF 2DM2A 3K2UL 1ZT4A 1RIHH 4XCFH 3FAWA 1WJ3A 3T4YA 1QR1A 3KXFA 3RQ3A 2JIXB 5EOCH 1AXTH 2D9CA 2VDMH 3CXDL 4LPTA 3DVNB 5FA3A 4FA8A 2O5ZL 3BT2L 2Z31C 2G9HB 3OZ9H 4N9OB 4ZS7H 4EQ2A 4TVPD 5FCUH 4EVNB 2GUOA 3IDXH 1O7SA 4P2CG 4X0KA 5A1AA 3WUWG 4C4KT 1G7PA 5K59F 1M05B 2DL9A 3IT8D 2A6IA 1PSKL 1QA9A 4UBDD 5IEKA 3P11H 1KFAH 3D0LA 5GZNC 2KUTA 3IFLH 1PG7X 5JQ6H 2FHCA 3NA4A 4X8JA 4PG9B 4RFOH 3GSQA 4JPKH 4M7ZC 4N8VB 1PLGH 3QPXL 1CLYH 1T80A 1T7VA 1BD2D 1JZ2A 3VGFA 1A4JB 2OSLA 1SEBA 3SE4C 1B0WA 4NUGH 4KKLD 1DBKL 4GW1B 4PJAA 1RUPH 4X6BA 1JWMA 4IRZH 4YHKL 1S7XB 3MRRB 4AZ8A 5IBUB 4N0YL 1CD1A 1XGQA 3P77B 2PYEB 5ACMA 3WE6B 1ZTXH 5FO8A 2WUBH 1N0XH 1SVZA 2F5BH 1DUYB 1QG3A 4YK4C 4AIZA 2D03H 4BH7A 1D6VH 3SCMB 4QCIA 3I9GH 3O6KH 2X7LB 4D9RE 4GMTH 3RGVD 4LU5H 5I15L 4K7PL 4P2YA 4F7CB 1NAMA 3UAJC 4KDWA 4GRMA 5GGVL 4ACPA 4BQCA 2R2CA 4QXUH 4FQHA 3KPRA 2P4AB 3MBEA 4JFHD 3C5ZB 2BERA 4NT6B 3ARDB 4WW2A 1A0QH 1EDQA 5E6IB 1YEDA 5F7FA 3OZ9L 4ZS7L 2A74B 3P0VH 1JRHL 1R0AL 1CXLA 4NKOA 1DQDL 1E0OB 5TE7H 2BNQD 4XXDA 4OLYH 2V2WB 5FM5M 4NQSA 1U8HB 4MS8C 1OD7A 4KJPC 1OAZH 2W0FB 1T7XA 4Y4KD 1JCKA 1CLZH 2HFEB 2ILLA 5FO7B 3MRRA 1EEUA 3OPZH 2Y6SD 1QYGH 1ZA6A 4PJCE 4H1LA 3HMWL 3TBYB 5FYLL 3MRGA 4AM0B 4IEFB 4AQOA 3IFLL 5ANMA 3EO1A 2GEEA 3FO0H 5EO0A 4RQQA 3WJLA 2VN7A 4XNUH 4CADB 3KNBB 4ODWA 3MSPA 4ZAKC 5FDYA 4HIHA 1FZOB 5FYKD 5F88B 1IGML 2QHRH 1CVRA 3QZWA 3V8OA 5E2TH 3VFPA 4YQXH 3WFZA 4Q9BA 1TJIL 4RRPG 1WBZB 4P23C 2BDNL 2CSPA 3MLYH 1YQVH 4GRLC 4PJXF 5DS8A 1FNSL 4KK8C 5GGUB 5KSUB 4KKNA 5L0QB 5DFWH 4N90E 1X5GA 1T83C 3BPCB 1NCNA 1DVFC 3RZCC 4RQQB 4OCMC 4OF0A 2C7UB 5HD8C 3O11B 3TT1H 4J3TA 1G7LB 3GBML 4FMFA 4K9EH 4PV8A 3MV9B 1TJHL 3V6ZB 1UQSA 3F12A 3SDCD 1ITCA 2V2WA 4YC2B 3RA7H 4K3DH 5LGKA 1WBXB 2F58L 3K8LA 2Y5TA 1VESA 1ZGLA 2D31B 2EYSB 3ECBA 1HHKA 1E4WH 4OGAD 4TSBL 3U4AA 5EWIH 2X40A 1CLYL 4OZIA 1WIPA 2IH1A 4JKWA 1H3TA 3ZHKA 3BMWA 4NBYB 4R2GD 1HHHB 1W0WA 4F7PB 2GJZB 4GAGL 3D85A 4H0GA 4NYLB 3P30L 4PJ8C 1UACH 1JYWA 3VG9B 2JJTA 5FUCE 3WDIA 2NY1D 4POZD 3EOBB 2XIDA 3BWAA 5E8OA 4KRPC 1S7TB 1CE1L 3HNVL 5C7XH 5FCUL 5DRXB 4XNUL 3QRFM 1NCAL 1A7PL 1NLBH 1KJ2H 2D7TL 3BP5B 4EIGB 2E6PA 4MSWB 4PB0L 2WLYA 3HE6D 4R7NA 4X7TB 5E24E 4UNTA 5C07B 1I9JL 4C56E 3DV6B 4O51B 4Y19B 3QFDB 4XC3L 1D9KB 3W81A 1A6VH 3H7BA 4Q0XH 3KLHC 4OCNC 1KCRH 1VGKB 1DQML 1CS6A 1R24B 4LASH 1ZLSH 5EOTB 5JPNA 3MV7E 4DFIA 1JHLL 5E00A 5EZJA 5BZWA 2FHFA 3IDJB 4RA0C 5EIQA 3ALWA 4XBEH 2CDFB 4OLZH 2WIIB 1A7OH 4JFFD 1JMZA 4XX1E 4P46D 1FNHA 3KYKH 2IGFH 1RULH 1IKFH 4OCWL 5KS9E 5F9DC 5I1KL 1ED3A 4ZO8A 1A1MB 3MRBA 3KLHD 3KJ6L 3C8KA 5A3IC 3OKYA 1Q9WB 5J06A 3AS0A 2WBJA 5FV2A 3DVNA 1KCUH 3HC0A 1R5WB 3QFJA 1U3HD 4PJXB 3HE7D 2IPKB 2D9QB 2DWDB 2EYTB 1AD9B 4I2XA 2NY2C 4JANA 4ELMB 5C0CD 3OKOB 5T1DL 4YHYB 1MIEH 3GK8H 4FP8L 3BD3A 4LSSL 3RTQB 5KVFH 4PRIE 1QFWL 4XNXL 4Y4HA 5F9WC 4ZUVA 1IQDA 1CT8B 3LSOA 1J1OL 1CGYA 3QRGL 4MNHA 5D7KE 1BLNB 4U05A 3FQTB 3VRJA 4ZPVB 1CFBA 2AEQH 2F15A 4AYFA 3MRCB 4X99A 4ZAKD 4D9QE 4JFFA 4H0HB 1FO0B 4C55A 5C3LD 1JFQH 2X4UB 2YD5A 3GSWA 1R5VA 2I60H 3MLWL 3O3AA 3W39A 3RGVB 5E5MB 3RPIB 5D5ME 2AEPL 4XBPA 3MOBH 3PQYD 3BZ4B 4O2EA 3FQTA 3VRJB 3CU7A 4NQDD 4Z76B 1WZ1H 2ZCHH 4N8CH 3O6FA 3QEHA 1G0DA 4RMWA 4HJGB 4X4XB 2QL1A 1GOFA 4X4YA 2RFXA 3ZDYF 3F58H 4G8GA 3DUSB 4P3DB 4UDUA 1FLRH 1ES0B 3C6SB 5T1LA 2YPVH 3V95A 3VFVB 1UACL 5CILL 1FZMA 4GAJH 3QUZC 5IFJB 3MREA 3K2UH 4NN6C 4JPIB 5FB8A 2AJVH 2VXQH 4HW6A 4FABH 3MRDB 3BIAX 4JDZB 3FB7B 3GMOB 3D39D 3LN4B 5I74B 1EEZB 1ORQA 3WXVH 4J23A 1IM9B 3LVEA 4JFOA 1CQKA 2VO5A 4FFZH 3K46A 5GIRA 4QXTB 5HVGB 4M61A 4F37K 4YJZL 4K94C 2FJGB 1CD9B 3C08H 5DD1H 5HYEA 3QDGD 4DCQB 1KLUB 3GKWH 4IRJB 2HFTA 2Y36L 1KTDB 4Y1AE 5KW9H 2BJML 1CFQB 4KMLB 1CICD 3H3BC 3D0VB 3OKMB 4G6FD 4PJHF 5GSVB 3REWB 1LD9B 1QKZL 4K23L 3NN8A 5FKPA 3SOBL 1S7QA 3QWOA 3IJHA 5DD5H 2XYCA 3VD9A 1CQYA 3LEVH 1U3HC 3MACL 5AWNL 2QQLL 3B9EA 4XVSL 4PRHD 1WCQA 3H0TA 5BS0D 3GHBL 1MIEL 2DQUH 4BQ8A 5EA0H 3CDCA 3VRLF 3MLTB 1I7TB 1ZLUK 4NWTL 2XACC 2XA8L 4YHOH 4LCWB 5C0FB 4LFHG 2LV4A 2HA1A 5FEBA 4Y7MA 3L1OH 4HKXA 1KTKE 4P5MB 1VHPA 5FYKL 5F44A 2V6HA 3G5XB 5I1AB 1I7UB 1J5OL 3VA2C 3QXDA 3NH7L 4RMSA 3BPLC 4R96A 4F7MA 2QR0A 2Z8VC 3SDCA 3I50H 4UTBL 2E9JA 3O8XD 4L3EA 4BFBD 2FIRT 2GTWA 4S11A 2VQ1A 1N3NA 1O5DT 3FFDA 2PCPB 4UB0H 4D0BA 2BK8A 1IMHC 5C0BD 3QIBC 2HWZL 1P7QB 3CK0H 3MOQA 3GSNH 3LKSB 4M3JA 1WC7A 3KYKL 4NCDA 5T33L 3OKDB 1I1YA 1T66D 4PRAA 4WEBL 3R8QA 4LKXA 3Q3GB 4PJIB 3ZLQC 3VWKB 4AH2A 4Q9QL 2Q86B 3LZFH 1JPTH 5LGHL 2Y36H 4PJBB 5ISZA 2I9TA 4YAQB 3VI4E 3NCJL 3JV6A 1F4WL 2F54D 5SX4H 4QO1A 3AS1A 1XR9A 2K7QA 4MNGE 4P3CL 1S7SB 1HINL 4D0CA 4MJ5B 4KTYA 3V7AG 4AT6A 2V7HA 5JXED 3QIWD 2N7AA 3BJ91 4PLKD 4OCRH 5IGXL 1G0XA 4NQEA 3IU3B 4L3EB 1UXSB 2QADD 2UYLA 3CVIH 1QP1A 3TN0C 2DD8L 1CFSB 5DXWA 5CEZL 2QTEA 2VZOA 1X6LA 4GSDL 5FAAA 4XCYA 4QHMB 4JJ5A 1YEFH 5GHWL 2JJSC 2MHAA 4ZXBC 1HE7A 2R0KH 4L8BB 1UZ8A 2AV7B 5DQJB 3HE7B 5HGBA 1L7TL 5DYOA 2W0KA 4P2QD 1NUGA 3TO4A 2NX5A 2DS4A 4Z7UB 5E6YA 2IBBA 4PREB 3LKOB 4OGYH 5J6GA 4J3WA 1WAAE 3G5YA 5SWSA 3RBSA 2VZVA 4N1EA 3VXTB 2A1WH 1OTTC 2EO9A 3G6AA 4JY6B 1A7QL 4LL9A 3IRPX 3DRTB 1BGXH 3QJFA 1RK1A 2YSSA 2MQCA 3KPSE 3U0PA 4FQPA 1PZUB 3KWWB 1ROWA 1TVBA 3NAAH 5C0CE 3TIEA 1Q1JH 1VB9A 5IB5A 5J3HD 4FXGA 1M71A 1F5WA 5IHBA 4P5TD 4PRID 2GAZB 2LU4A 4L29A 4LSQH 2CIIB 3LH2H 4K7FA 2OL3B 4LAQL 3TA3C 4MX7B 5HSFA 4G6KH 1GOHA 5FUOL 2A6DA 5D1QC 4Z76A 3T0EA 1SM3L 4DN3L 4YPJA 4PS4H 4P57A 1MH5A 2CH8A 4FRWA 2BNRE 4M5ZL 4KY1H 2ZG2A 3OL2A 1FV1B 1JK8A 2FIKA 4PGCB 4N0CC 1JPFB 1R5VB 1ADQA 1N0XL 5HGAA 1S78C 3O3EB 4I18C 2ADJB 5KVDH 4JRYB 4NNPL 4XP1H 3UJTL 1GGBL 2EIZB 5DJ2B 2NY6B 1LMKA 1I8IB 4Y4HB 5E2WL 4JKKA 5KBNC 2P8PB 3WXWH 5EFIB 3ESUF 3T0EB 4KK8D 2XOTA 3OAYH 4LHUB 1PZ5A 4RGND 1GVIA 4OFPA 2X1PA 3FRUB 5GRZA 2N7BA 4HJ0C 4QGTA 3ULUH 5HVHC 3GEWB 4XNZC 2VSDA 1RIVL 3JTSB 5IB5B 3CX5J 5HI5C 1ZHNA 3IDUA 2EEBA 3OXSA 3H42H 1WIOA 3DHMA 2IPUG 2G75A 3MNWB 1G7HB 4XXCA 3G6AB 4JY6A 3V7MA 4RMVA 1JGLH 5B39G 5E03A 1A9EA 3ARFD 1GZQB 4HT1H 5L7XL 2EC9U 1MRCL 1JNLH 2QSVA 3EO0A 3O3BA 4PTUA 3V8CA 2DB8A 4NPYA 1BOYA 2ICEB 5DRWB 5C0CA 3FMGH 3NGBC 4JO2L 3HE6A 5M7QA 1D5BA 5DMIL 1FDLH 1OP5H 1JWMB 4J4PC 3U7YH 1OL0A 5FF6A 1A3RH 1J7VR 3N1GC 1IAOB 3QEUB 5FKAB 3DUUB 4HMCA 4FQXA 1II4E 4Z6AT 1MY7A 2VIRB 2Z92A 3MMEA 4U1SA 2ITCB 1DBMH 3P9MA 5SWSB 5E6ID 1KLUA 4UDTB 4F7TB 3CC5B 5MI0C 3EGSA 3ZKNC 4YXHL 2FH8A 3GZKA 3GI8L 1J1PL 1KELH 1PG7H 4PBVC 3HUJF 4Y5YA 3STBA 5JLZA 3V4UH 1G7MB 4DKEL 1K6QL 4D8PB 1HSBA 4WHCA 4HHAB 3GSNA 5CBAB 5C6TL 3FB6A 4OLWH 1I1FA 5EULV 4Z78A 3WYRA 1SMOA 5T5FL 4QHMA 5JHDD 4YX2H 2IBGA 3PL6B 4ZS6C 3LEYL 1IAOA 3TV3L 2A9NH 3E1F1 1NGWA 5B38G 2CD0A 4HUUA 5AZ2L 4MJIA 5CP7B 3WMSA 2BY0A 5TDNA 3HMXH 5ERWA 4N0FB 5KG9A 2J1KA 2XFXB 4KUCD 2R2BA 3TCLB 4HK3J 4HMDA 1RUAL 4PJ5A 3BP4A 2RFXB 4HUWA 1WZKA 1NDGB 4K9EC 3GSOA 2VDKL 5ESAB 4P2OC 1BVLB 1OM3H 1E6JH 1JGDB 1KJ2L 2AJXL 2ARJB 3RWIB 3SGEI 2IBZX 1UM5H 3PWNA 5T3ZH 4QKXB 2MWCA 4NNPH 2IFGA 4XP1L 3EOAA 1I8LA 4PJ9B 1T0MB 3FHQA 4K07A 2X1OA 5CEXA 5CHNA 1YJDC 5E2WH 4C58B 5DUPL 2WUCL 1EVTC 5HI3C 3IDMA 4AG4L 4KKAC 3HKFA 4M43L 4ISVA 3UTPD 1EFQA 2XN9D 2NW2B 3D2UD 4ZG1A 2J8UE 3EOYG 5D96C 5E8DH 4QHUB 3MFFB 1WTLA 5HYJB 3H8NA 3NIGF 3IU4L 3B9AA 1EFXA 1ZV5A 3B5HA 1XIWC 2EECA 1B6DA 1JZ3A 4ZQKB 4H1LB 5KSAB 1OW0A 4Z7WB 3V5HB 4P9HL 4MD0B 1HHIA 1PVHA 3GIZH 5GSVA 1JNHA 4O58H 5FGBA 4M03A 5DLML 3VU2A 1A3LH 1CK0H 4P2OD 1Z9LA 1DDHA 2BHZA 5C6TH 1LO5A 4ZTPH 4POZC 1PW3A 2LE9A 5JIPA 5DJCA 1TVHB 1JPGA 1YNLL 2R2HA 3CIQA 1JTPA 2Q7YB 3LS4H 4OI8A 1CDIA 1KIQA 2MJWA 3VWKD 4BH8A 2Z4QA 4PJHB 1JPST 3IGAA 2WBJC 4YDJA 1JGEA 1J0HA 2CGRL 5KVEH 2ARJA 5KAQG 4GW5B 4G9FA 5CINH 3DURB 1CBVH 5I1CH 3N50A 4U6HA 5ID1A 2EDEA 5D2NE 3P0YL 1ZA6B 4OQTA 2WWMC 3X3FL 2J4WL 3NFNA 1E4KA 4X8XA 1BF2A 2NY5H 3OAUH 3UDWA 4JM2A 2JJSA 4ZXBA 5LVEA 3D69A 4GBXD 1MUJB 3CCHB 3DX8B 5T1LB 1QVOB 3JWDH 1ES0A 3C6SA 2ENSA 2FYYB 4W81A 2Z9TA 5IV2A 3HCVA 2BNRD 3HAEG 3HI1A 3NVQA 3QUYC 2ADIA 5EIIA 2AI0L 1F90L 5H37G 5GS0C 1A6AB 5ISZD 5F8QC 1JGLL 2R4SL 1A7PH 4QOKE 5IK3A 4LSPL 3KLAB 3P2TA 1PKOA 5TQ0L 3RGHA 5B22A 4P2RB 5DTFB 5IFHL 1REIA 5DJ8A 5CJBA 4AMKH 2AK4B 4Y16B 4YDJB 4M62H 2P8MA 4JM2F 5TE6L 3QH3A 1UADC 3DOSA 1CGTA 5MEND 1J1OH 4QCIB 1L6XA 1DL7H 1S9YA 1TVHA 5AEAA 4U6XA 4LSSH 1ORSB 2QJDA 1UWGH 3SJVB 3VWJD 8FABB 4DKFH 2Q87A 1NGXB 4F9PA 5BOZG 1FHGA 2XTLA 2IQAA 4X0KB 1BJ1H 1WWAX 4OFVA 5CMAB 1BOGA 2AVGA 1OAXL 1A1OA 1RFDL 1I85A 2M1KA 3R1GH 1QRNB 2BNQE 1UYWH 3RY6A 4IMLB 3QDGB 2ICWA 2VXUL 4Y5XA 5BV7L 3HC0B 1A6ZA 4P4KA 1FL5B 2BSRA 3NCBB 4NPYB 5IF0A 2DQIL 3W39B 1VFOA 1NPUA 1CFVH 2WQ8A 2X05A 3STLA 4N90D 2V9TA 1T0NA 2IPUK 3IF1B 4Y19D 4QXGL 4WDIA 2DQGH 2OXGA 3L5XH 3B3IB 3O6FD 1N64H 3L3KB 4LKCB 5F71A 2GKIA 3U79A 1P7HL 2WMPA 1ZT1A 5J13C 3S9DB 2H1PL 2PTVA 3J7HA 4HKBB 3IU4H 1AQDB 4G7VL 2YZ8A 4WWKA 4NRXA 4MA7L 1DZBA 1FBIH 3JTSA 1QHPA 4Y5YC 1UWXK 4M00A 5F9OH 2EYRB 2VQ1B 2BVEA 5CJOH 5IB3B 1U9KA 2I07A 2ID5A 1XGPB 4F8QA 1SYVB 1YMMB 1F45A 1ZT7B 4XT1C 5EUKA 1MF2H 3JWNC 4OUOA 5T3ZL 3QUYB 4I3GA 4M7KH 4MAUL 4Q2ZB 1A7QH 4NM4L 4WFHD 5FCSH 3X17A 2BX5A 1BZ9B 2VSCA 3MRMA 1DQJB 3C5JB 2ADJA 1FPTH 2ZG3A 4LLMB 3BD4A 5E6IA 1LDPL 1CYGA 4HAGA 3MV11 4LBEB 3GHEH 4IOFD 2NX5B 5I19H 2YRLA 2OI9C 3TJEL 4L8DA 2W9EH 3RIAK 3VI4F 1RIVH 2UUDH 4PGDB 1OAXH 2KKQA 1OAKH 4BSWA 4MGXA 4R4FL 3IETB 5L2KE 4LLDB 2YBRB 1U3JA 4M48L 1EUTA 1FNGA 1MWAB 3K4AA 4PJ7B 5L6YL 4U1JA 4YHLH 3CFJA 1OF2A 1IBGH 3SKJL 1UWEH 1YEEH 4TSBH 5F3BA 1S7TA 4HGWA 3RY4A 1YUHA 3MV9A 3E8UL 5GS2H 4RAUA 1UZ6F 5TQ0H 3KYAA 1AO7D 1G9MH 4L8DB 5C0DA 1X5YA 3VXPB 4QRRD 3FOLB 2KDGA 1JTOA 4NHCL 5TH2A 1WTGT 1HKFA 2FO1A 2IANB 5IMOA 2FO4B 3MGTA 1MPAH 3O9WB 3LAFA 1UXWA 1CXFA 3P9WB 3RHWF 4X6EB 1ZWIB 4PJEB 1E28A 4MQXC 3ULUL 2R15A 1Z5LA 3RJQB 3ARXA 3QQ3A 3QDAA 5HY9B 2XA3A 4NJ9H 1FGNL 1RZIB 4PJ9C 1BMGA 3F12B 3T4AB 3ALXA 3FFCB 1BIIA 4PGEA 1YMMA 1ZT7A 5BMFL 4P59L 4J3XA 3FN0H 1BZQK 2ENYA 3ZDXF 2H2SD 3WNMA 1DVFA 4HH9B 1N4XL 3S34L 1MREL 5T1KA 4S1QH 5D7KD 3F8UB 2R1WB 3TBWA 3BKCL 4MWFB 5KVDL 2B1HH 2NTFA 3MLRL 4XRCB 1VCAA 4S1DC 3FFCA 2V5TA 1BQLH 2HFEA 1AE6H 2H26B 4TUOA 1RIHL 1KXVC 4HD9A 5EDXA 4G3YL 1HH6A 3CSPA 5DHVH 4MB5A 3B5TA 3VFPB 5M95B 4YC2C 2GHWB 3QUMA 2DQJH 4HKJA 1FORH 1PYWA 2EH8H 5GZOD 3FOLA 4B0MM 4HZAA 4MJID 2O5XH 2CRYA 2FLBT 4A6YA 3EW3B 4WEBH 5JOEA 2FR4B 4MWFA 4ZQKA 2X89A 4JQVC 2IGFL 3MV9D 4RX4A 2XN9B 3JTTA 4OD1L 4X9BA 3FT3A 5DJZB 5C0NC 1V7ML 3RZCB 2DJUA 4GXUM 4HH9A 4Y2DD 3W9DB 1U8MB 3JUZA 5F9AC 1DANU 3UJTH 5L0QC 3GBNL 4GRLB 1OAUH 1TTUA 4P3CH 4R96B 3CDYA 1YYML 3KYOA 4DCQA 5HYQA 4P23B 2VC2L 2HJFB 1YEJL 3IFPB 3HC3H 1LEKB 1DBJL 1OSZA 4JG0H 2RAMA 3OF6D 3NGBB 3MOBL 5DJXB 4ZAKB 2G5BA 3ES6A 2P5WE 3OR6B 3MC0A 3SKOB 1OT1A 2DBLL 3FN0L 4V1DA 3BSZL 2R69L 4Z7UA 4XPAL 1FIGH 1BFVH 4QHNB 5FDWB 1OGAD 3O4OC 4WY7H 5GGSY 1MFEH 1T1ZA 1W72B 2A9ML 2VJXA 3RWCB 1UH3A 3FONA 4YR6A 1CDBA 4MXQD 1TTGA 1KENH 2Y06H 3L3JB 2J8OA 1P1ZA 4HQQH 4WI5A 2ZG1A 2BC4B 2JB6A 5KTEH 4LRNL 4TQEH 3VXMA 4FZEL 4X5LA 5SV3A 5DEFA 3M8OL 5L9DL 1FNAA 2HT3D 4GW4A 4ORZC 1H5BC 4DJMA 1YZZA 4E0RA 2PN5A 3KG5A 4Y19E 1BAFL 3T4YB 1EH9A 5DUBB 4DGIH 4KK9D 3RUGB 2BSED 4QHNA 1HQ4A 4DQOH 4XMKH 3QCUL 5SV4A 4WI7A 4Z7QE 4YK4B 1HILA 3B2UC 4I2XE 4OFYA 5DK0A 4D0DB 4Y4HC 5CCKL 2MCG1 5IWLC 3LN4A 4L9DA 4UQ2A 3TYFA 2H3NB 3FCTA 3EZJB 4Z5RB 5IESL 4Y5VC 2BXZA 5KVGH 2EDWA 2J8UA 3QEQD 3DIFB 2VLMD 4FNLL 4OZGB 1GHFH 1YEIH 4RAVB 5D1ZC 3FHAA 1UQSB 2MFNA 3WS6C 1CLCA 3TYGH 2X4PA 4QT5A 4FG6C 4PJXA 3T65A 2ICWB 1XGTB 1S5IL 3ESVF 2Y23A 2YEZA 4G8GB 1MCBA 3O11A 1WFTA 1X5JA 3ULUF 4KHTL 3BPOB 2X42A 3PHOA 5D1QB 4JDTL 4M7ZB 2J3SA 4YLQT 1W8OA 1PAMA 3MRBB 4NC1E 4NQVB 2J8HA 2IC2A 4U1HB 1I1AB 2LU3A 2IAMA 3MNWA 3QDJA 1NCCL 2MNUA 4D3CH 5MENA 4DW2H 5MEOB 5I18H 3W5MA 4RGMB 3N1MC 4X7SL 4OFYD 4OIIH 1I4FB 4JO4H 3MRCA 4X99B 4HQQL 1YA5A 2BMKA 1T5XA 2OQJB 5F1KC 3U9PL 2I9LA 1QFWI 4G8FA 3P4OB 3RU8L 3WNNA 4QRSA 2XFXA 1UFUA 3E6HA 1T6VN 5ELIA 1WZLA 3W2DH 3DV6A 4O51A 4I48A 2EXWC 4HUKB 4PY8I 4GBXA 1D9KD 1A6TB 5FYJH 2CIIA 2NY2D 3HE7C 5EZIH 2HRLA 4FQIH 3H3PL 4ZXBB 2R56H 2VXSH 1JF1B 3HUJB 4JY4A 3CSYA 3D85D 4NUJA 4HKZB 4MD5B 1KIRB 4OLWL 1ZA3A 2K1MA 3WKML 5I1HH 1NCDL 4PBXA 3WUZA 2R0ZL 3I85A 2GK0B 4OLYL 1O0VA 5DK2A 3QFJE 1WT5A 1YEIL 3K7UA 4HS8H 1SYSB 4NP4H 4Y88A 3IGAB 1CE6B 3CH8A 3QXUA 2X7LA 4P5KA 1F8TL 4PJAF 4PJXE 4YHML 4Q6YA 4OCXH 4M93B 1FFPB 4U1MA 4GH7B 1IC5H 1NMAL 3Q48A 3L3GB 4YHPA 1JHLH 1A7BA 3P77A 4HUNB 3EYUL 1VDGA 1BQHA 4DGIL 3VWKC 1J18A 4DEPB 5BS0A 5GRXG 3GNMH 1HXMB 4XPFH 4IS6B 1L0YA 1KIPA 3KPSD 3MR9A 2X4NA 3RDTB 1EXUA 2EDQA 3WFEH 3OAYK 4FQCH 1NGYB 4L9LB 4K71B 3QIBB 3PDGA 4HXBL 4EUPA 3BI9X 4KJQC 4LVNB 3JWOH 1G9NL 1TNMA 3BWAB 4IRZL 5DD0H 5E8OB 4HBCH 2MKLC 1JNNL 3EZ8A 1WWCA 4I0PA 3L5JA 4ISVB 3DBXB 1W0VA 1BJ8A 3MCG1 4LP5A 4P59H 3BPLB 5TE4H 5GS1B 4JFFB 3U7AA 4PRPA 4PPTA 3KNBA 4ODWB 4XC3H 5H35B 1S7RB 4H20L 2DTML 5CBEA 1HHIB 2ZNWA 3UC0L 2R0WL 4JFHE 5HI4D 2E9BA 4BQBA 4LIQH 3WNPA 1TQCB 4BUGA 1HYSD 4NFBA 4O2FA 4OIAA 3QA3A 4NQCA 1H15A 1JFQL 4FHBD 1HKLH 4ZNEE 4N0FA 1XGPA 4L4VA 3QSKB 1IL1A 4NKMA 2F9BT 1JRHH 1Y18A 5FGCE 2DLTA 3CXHJ 3U4BL 3OF6A 4KI5E 4IDLA 4Q9QH 5C0AA 2VWEE 4OZ4A 3P40A 4WW2B 1AGEB 4PJBA 2OJZH 4O02L 4L4VE 4YGVA 1LP9B 4CVXB 4KJWC 5JDSB 1WLHA 1WCBA 2DL2A 5IB2A 1GSMA 1YJDH 2CDGA 1GHFL 4PJIE 1B2WH 4ODSL 4R8WH 1HSBB 5FHAH 5DMYA 1IM3B 5CEYB 3VXPA 4UU9B 3D39A 4XTRD 4OLUH 1YPZA 3LKSA 2DQEH 5IM7A 4OQTL 3DBXA 4PRPD 1I1AD 2FBJL 1MFDL 4G6MH 4MDIB 3BAEH 2NY3D 3T0AA 1GGYA 3Q5YA 3WLWD 1WQVT 2OZ4L 1AR2A 2YD8A 5E94A 3T77A 5HHOE 1KN2H 3NZHH 2XZAL 3VFGH 4F8TA 5DQDL 4F37F 1QSEA 2JELL 5DJDA 4HS6A 3AU1B 4I0PD 3OB8A 4NN6B 3C09C 3L3OA 5T3ZD 2E27H 3VD4A 1MI5E 3MUY1 4E42B 1PQZA 3G5VA 1IGJA 2VAAA 2BVUA 2NXYC 1HI6A 4KVCH 4U6XB 3FQUB 1HILB 4KI1A 4YFLF 2HYMA 3S3PA 3GSQB 4POUB 4UQ3B 3QH3B 4R0LB 4UOW1 1SQ2N 3D39B 4APQB 1LHZA 3SOBH 1U8LB 2ZPKH 4ONFL 4HWEH 1RUML 4P2RA 4WFEE 2MPAL 4OI7A 2FSEA 4HC1H 5HHMB 5JDSA 3RGVC 1MCKA 4BM7A 3T0XA 3FB5A 4M7LT 5D7JB 1S7QB 2H9GA 3WO4B 2ZUTA 2DQUL 4NHUA 5JOFA 3JWOL 3SE8L 3VXMB 2Y5TB 3OKKA 3OAZK 2L7JA 1M1SA 5CP3A 1XGQB 4PRNB 3CDFA 5INDB 5C0CB 2FZ3B 2P47B 3X11B 1ACYH 1ZEAL 3ULUC 3K4ZA 4E9LA 3RTQC 2X4OA 2SEBB 3SHSA 1XZ0B 2AJZA 1XF4B 4I8DA 4QRSB 1ZE3C 3GI8H 2XXMB 3MLUH 4HJGA 2RIKA 1HHJB 3CFBB 4QXWA 1S8DA 4V1DD 1C5CL 3GUTA 1KF9B 3O6LL 3O3EA 1HXYA 5JQHC 4L3EE 2UV3A 3MV7D 4OGXL 1R6VA 1HH6B 1W72H 3RWDA 5F6IB 4U3HA 1IGYB 3FMGL 3OJMB 1VA9A 3HRZB 3RAJL 4GKOA 3SN6N 5ITFB 3RA7L 2IQ9H 1JPSL 5IEKB 1TZIA 1LO2H 4RDQG 5JXAL 1UCBL 1EPFA 2QSTA 4JRYE 4MNHB 3TEUA 3AUVA 1TFHA 1T1XA 3O45B 2CIKB 2YA0A 4K3EL 1MJ7L 1VPOL 1MRCH 3SPVB 3AB0C 1G9NH 5T1KB 2X70A 2BNUB 1OAYL 5B3JE 2I60L 3UX9B 4GRWB 2E7LA 3RP1A 1YDPA 2ZJSL 4MA1C 2IMMA 3CXDH 4PY7B 3K74B 3GSVB 3IB4A 4JM2C 3DLQR 3QIUB 1BIHA 1F4XH 1B3JA 4ZUSB 2KZ1B 3DV4A 4DUVA 3MRHA 1A1MA 4X6EA 5DJ8B 5E7BA 3A0OA 4Y89A 5FECA 3BRDA 4AG4H 3MROA 4LLWA 1U6AL 1D6VL 1IQWL 1XGUB 1FJ1B 3TO4D 4KMQA 1H3WM 2BCKA 5JDJA 3BMVA 4WTWA 4PJIF 3E2HC 4G43B 1S5HB 3MXVL 2E27L 3EYQC 4PJ8B 4P46C 1BVKB 4I4WA 5F1NB 3U9UB 3K0WA 1DBAL 1MLCA 2O5ZH 2QKIB 4YO0B 5CINL 1ZHKB 2GAZA 5J6HA 1A0QL 3NCEB 3PQYE 1KIRA 4TUKH 4PJCF 4HXAL 1R3HB 3V5KA 4NQDE 4Z95H 1A6UL 5C07A 4U1JB 2BSSA 5I8KH 3D3VA 3PWPA 5DZNA 1U92A 3U36B 1S5HA 3GJFK 4E5XB 3NTCH 2FJGA 5JIHA 2KQMA 1HHGA 1MHHA 3GSXA 4LLVA 5D7IE 2PW1A 1IEHA 4M6ML 2DQFB 5I6XC 4KDVA 2NY4D 4UOJA 2V7NB 5SWSE 2JKXA 5K93A 4QRUB 4EI5A 5EZIL 3O6KL 4TVPL 3SJVD 4JVPA 4ZO7A 4NZUH 1A6VL 4LBEA 1EMTH 2B5IC 3MLVH 4OCYL 1WZMA 2BVPB 3LH2L 4NCC2 2VDQL 5HI5D 1E4KC 5TE6H 4QRPB 1UB5A 4GRWF 4IRSC 3VG0L 3OGCA 2C1OB 1N5AB 1YY8A 1PKQE 2VNCA 3KPRD 5DD0L 4UIKH 4NN5C 4NQTA 4HUMB 4Y0GA 3CAFA 4LMQE 4OBSA 4JLRB 3TVMB 5E9DB 3PNWB 4KI5D 1RURL 2A1WL 1T21B 3QG7H 3H9HA 2EZ0D 5E8NB 4NRYA 3WCYA 2NY7L 1A14L 4UT6L 5HHXH 3AM8A 3DUHA 4K3HA 4DVBB 1DFBH 2PO6D 5C09D 2R39A 4ZUTA 3D1MC 3RKDC 2ED7A 2VLKB 3FAXA 4X6CB 3VGAB 4H26A 3HZYB 5I1JH 3PWUB 2RBLA 5EG6C 4F9PC 4DFHA 1Q1JL 3MUGB 3HS0B 3QCVH 5KVFL 3MACH 2UY6A 5AWNH 2G60H 1IGTA 5C08E 3S98A 3ARDC 1XF4A 3C5ZC 2VL5B 3JSSA 4GS7B 2P1YA 3OKOA 3UZVB 5I8CB 1WUNT 3QZWB 1OAYH 1INDL 5ADPL 4P23D 3T65B 3F7QA 1SVCP 2QADB 2LABA 2ZUSA 4BSVB 4WFHE 4OF6A 5JHDB 2W0LA 1NLDH 1ND0A 2X09A 3FT2B 4Q9CA 2E6JA 3S7GA 1SY6A 2HN7B 5D7JA 4UINH 4Z7WE 2H32A 1NCWL 1EA9C 3QBTB 1WEJL 4U6TA 4J1UA 4GRLD 1RUKH 1SJVA 5JLZB 3VXUB 3EYFA 4OD2B 4ZDHA 1EBPA 3VH8G 1CGSH 3BVNA 3ARDA 4KTEL 5TF1H 3PJSB 1LO3H 2KBGA 3KPPA 2XXCB 2XKNA 5IT2L 1RJCA 3BESR 1X7QB 3ABZA 3F7YB 3WIHA 5DEFB 3U2SB 3EJYC 3MRIA 5DGQA 1C1EH 1NCCH 2PR4H 4X83A 4U6YA 2FGZA 3T04D 1PKQA 4HJJL 1MF2L 5EU4B 1OTTD 4PR5B 5EUOA 4FXLA 4AENA 3X12B 4JAMA 5EU7E 3VG0H 3CUPB 5IROA 4QTIL 1BQHB 4EIZC 1NANH 1CG9A 5D1XA 1S7UB 4ZUUB 1AY1H 1TPXB 5IQ9A 4N0RA 4UV4L 5IMMA 3MLVL 4MHHI 1CTOA 3TH4T 1RZFL 4JFXB 3TH3T 4Y2DB 2DWEB 1F42A 2PUQT 2X5PA 4F80A 1U3HA 2B0SL 4AY0A 1U8LA 4HS3B 4OZHF 4BELD 5JPMA 3K4DA 4KKBC 2KH2B 3KHOA 2HVJA 4FFWC 2NNAA 4KKCD 3QHZL 5DZLA 2JJVA 2AK4E 4NWUL 4BZ1L 5E7FA 5FOJA 4HXAH 3QUXD 5HGBB 4XH2A 4Z7QF 1OB1B 1J05A 5D7JD 4YEFA 2HKFL 4YHZH 3V5HA 4X6DB 4Z7OE 3F6IA 4KUZL 2WZPD 3VGDA 2JLLA 4UBDC 2VLRB 5ADPH 3ILPB 3KLDA 1M7XA 1MJ8H 3U2SA 1WBYB 1E6OH 1LGVA 5SX4I 4JPKL 2WNGA 1NBZA 3MRFA 1VFBB 4MA8H 4H88L 2NLJB 2JTDA 1DANT 2FB4L 2R1XB 1P4IL 2DKSA 2XZCL 4MAYC 3UTZA 3JVGA 3HI5H 3CZJA 1KTRL 5AZ2H 5TFSH 1EIBA 4RFNC 4TPRH 4Z77B 3KPLB 4I9WD 1UM6H 4LSVL 2CLVA 4KAQL 4YDLB 4HIJA 2V17H 5E0QA 4EI5D 4YAQA 5KJRL 2R2EB 4OM1L 4N68A 4RFOL 2IANA 5EO9A 4H25A 5K9QI 3S6CA 4K7FB 1RURH 4XAWH 4JFQA 3RL2B 4QNPE 2AEPH 3IKCB 4LOUC 4NGHH 2AJZB 3H42L 4Y5XC 1YEGL 2IALA 5CWSB 1OTUC 4XZUA 4RAUB 1VKXB 4OSUL 1BIIB 3VI3F 4J2XA 1OGAA 4RCAA 4PB9H 2OM5A 4TNVK 1A6PA 1OP5K 3UTTD 4JCLA 4PRBA 4CNIA 1FAIH 2NY6D 2AQ3A 1AHWA 3DRTA 2XWBB 1QACA 1RZJC 2Q6WB 3SJVE 3G6JA 1K8IA 1MFCL 4XNMB 3L5HA 3AVEA 3EYOA 3JWOC 4WWKC 1AGFB 3X3FH 3C60A 1LO4H 2EIEA 3ZDYE 4MZ3A 4R4FH 1NAKL 5GRUH 1QSZA 5DTFA 4PD4K 2JK5B 5LWYL 4E0RB 3QJHB 5KN5B 2UZXB 3GB7A 3H7LA 4G3YH 4DGVL 3UDWC 3ZYIA 4BA8A 5DO2C 4DGYL 5IHLB 3CFJB 4PP1D 5L2KB 3HI1B 5D8JH 3MLWH 3ZTNL 1F4YH 3D3VB 3PWPB 1YYMH 5D5MB 4X6BB 3U30B 1QSFA 1P6FA 2Q76B 5T3XH 5L8KB 3KXFE 4NO5B 5D70L 2DYPA 3UTOA 2B4CL 3MRJA 3O2VL 1N4XH 5B8CB 3UZQA 1CXKA 2P5EE 4NFDA 3IS1X 3V4PL 4LLQA 4D9LL 1DJSA 3S96B 1H3PH 1GZQA 1QBMH 2VDLL 3JV6B 4LVHC 2QQLH 1KBGL 3I6KA 3UO1H 3PV7A 1I4FA 5GGTL 3C60B 4NNXB 2E6QA 3FB8B 5E2TL 4D2NA 3C08L 4KGLA 1SYSA 4OFDA 5KOMC 5GGUA 1FC2D 1GGCL 1QA9B 5IBUG 1K2DB 5J89A 1QBBA 2EC9T 1L0QA 2BNQA 2ZZUT 5SX5K 3DSFL 4NRZA 5MEQA 1CN4A 4GMSL 3HMWH 1AXSA 3PGFL 4DK6A 1JN6B 1FZOA 1UJ3B 1IAIH 2BSRB 4M6OL 1I9IL 5HPMB 5AD0A 5KZCB 5F1NA 1E4JA 1C5BL 1MQKH 3O8XA 2UZIH 1AR1C 1U8KA 1FRGH 1FH5H 3SQOL 4UUJB 5D7LA 5FGSA 2G5RA 1JPSH 2VZSA 3ZTJH 4QRQA 4X6FA 2W0FA 1ETZB 3Q1SL 4X9IA 2NW2A 3G6JE 2F54B 5D1XD 3FN3A 2R23B 3OV6A 4KI5C 3ROOB 3G9VA 3U0WL 1H8SA 5C0EB 3GBMH 1TZHB 3INUH 1P2CB 4HLJA 3RKPA 1NEZB 5BXFA 1JWSA 3TM6A 5LJYH 1BBJA 5EZLB 5ACLA 3OG4B 5F88A 4F7CA 2RQ8A 3HNTL 4PYHA 3KLAA 2V2XB 1T21A 1NGQH 3VGGA 1KJMA 1G6RB 1PZ5B 3RWGA 4IBLT 4KU1A 2YUZA 2ADFH 2EDYA 4WI4A 3O8XB 2XN9E 5ACZA 4H0IA 5IFHH 1FFQA 3D9AL 1KB5L 4PJFB 4LHUG 1KPRB 2J5LC 1U93B 3W0WD 1ZKAA 3NFSH 1IGCL 5C0JB 2M8XA 4YHPB 3UBXG 1MHCB 3HAEH 5FM4A 3PL6A 3PF2A 1FNEA 5C70A 2HTKD 3NFPB 4XVTL 3DVFA 3PWVA 3WJLC 2D7QA 4RRPA 1K2DA 2P42B 5C0GA 3BGMA 3MJ7A 5EC2A 4OV6F 3LDBB 4FQJL 4BQ9A 1A6AA 3DMMA 5J9PA 1JUFB 3GMQB 2A0LD 3SKMB 4X5WA 1U58A 4JFYB 4LIQE 3SO5A 4PJFA 1FL3B 1MCOH 4FN0A 3D69B 12E8H 1J8HE 5GJSH 4LASL 2WSKA 3PGFH 3ARZA 4NHUB 3G6JF 5JOFB 1RZGA 2UYLB 1SHMA 4AQ1B 3EUUA 2DKUA 3ARFC 4GW5A 5D1ZA 5EC1A 4XGZA 2VE6A 2H2PC 3U4EB 1F6FB 1L6ZA 1A7NH 1SEBB 1JGEB 1ULVA 1HEZA 3CH1A 3BUTA 4I9WE 4Y1AA 3P0YH 3SDAA 1G7IB 1SY6L 2IAMD 4DKAA 2IBZY 3F65A 5CS7A 3QXTA 4LLUB 3RUGE 3BOVA 1KACB 4JGUA 4QRRB 1QYGL 4IOSD 5F9JB 2GJZA 5KSAD 4QOKD 1JGUH 2B39A 4PJ9A 3U1SL 3LY6A 4R97B 1BZ9A 3BKYL 3LPFA 3HI6L 1QPPA 3BDBA 3DXAA 1ZHNB 1W2KT 4Z7UE 2XV6B 5F6HI 2HT2C 5FOBA 4DAGH 3D18B 3K8KA 3SPVA 1FYTB 2Z91B 3L7FA 1M7IA 5D7IA 1Y0LA 4MMZC 3V5DB 5DDHB 4LIQL 3PNWA 2YUXA 1YNKH 3KPSB 4L4TA 5D72H 3O6FC 2FD6H 4X6CF 5TF1L 2OL3L 3QWRD 3RWFB 3PUCA 4XBEL 5ID0A 4G8GE 2MSPA 1P7KA 1ZHBA 1AXIB 3IJYA 4LSDA 1Z0MA 1KEMH 4ONHB 3CZFB 4IRSD 4GBXC 4YNYB 1BD2E 4WGVB 1PYWB 1KJ3L 3VD3A 8CGTA 2F74B 5L88L 5I17B 2OXHA 3PWUA 4RX4D 1X4YA 2PXYC 2DJSA 5EU6B 3BEVA 1DN0A 1IAKA 3U7WL 5DS8B 6CGTA 3G08B 5GJSL 1PX3A 1AY1L 5E00B 5EZJB 3UTQB 2E9IA 4CRPA 4LRIC 4FMKA 2EO1A 3S34H 3SDAB 1T1WB 2R0LL 3MCLH 4ORGA 4MQTB 1MCSA 4W6XB 1XCTB 4F7TA 1KELL 1PG7L 3K1DA 4IMLA 4EBQH 3UYOD 2EE6A 5ILTL 5A16A 5F7YC 3RX5A 2C5DC 5DEGB 1QSFE 4XBGA 2DKMA 3MV01 5SWZD 4ZO9A 3IJSA 1PLGL 5FM5O 2X4TB 3REWA 4D9RD 4L4TD 4TRPL 4IS6A 2DTMH 4YEEA 3NCFB 1K3ZA 5TDPA 1N5YL 2V2TA 3O2WL 5KSVA 4EN3B 4CMMB 1UH4A 5FYJD 1C5DA 1EGJA 2NQCA 4TNVF 4QRRA 3BP7B 1FC1A 2P8LB 1PFCA 2V9RA 1XCQA 4PP2A 1KLFA 4JM4L 4P5KB 3KPRB 1JNNH 1N7MH 5FYLH 4CMHC 3PABB 3VFNB 3QR2A 1KNOB 2ICCA 3DUUA 3MRHB 3ARFB 4L8CA 1C5DB 2A6JA 4CJ0A 4OF8A 5IV2B 1FVCA 3HPJB 4XP6H 4YXHH 2I25N 4XPTL 2X4QA 5KSBA 5KOVC 1RJZA 3TT3H 5JO5A 4JFZH 1JWUB 2XZZA 5D7SH 3VFSB 3IDGA 4M8QA 5L2KD 5BOPA 3TJEH 4JFDB 1AGBA 3CFDA 4XPAH 3VFWB 3MRLA 2VQUA 3U9UA 1FFPA 3OXRA 1UXSA 5FA4A 5DRZB 4X4XA 2ZUQB 4LEOB 4XBGB 5DO2D 3HMXL 3PP3K 4FZ8L 4NSKB 4HUXB 4HCRA 3RY6C 2XTJC 3F7VB 3RL1B 3BDXA 3OPZL 2NZ9C 1E4XH 3K80A 4Z7OF 3SE4A 1ZS8A 2A9MH 1KB9K 3HHRB 3T0ED 1YEGH 2BY1A 3QDME 5FYJU 4RDQF 2F8XC 1TZHA 5F7EH 2WW8A 3I50L 5DHYA 4OCSL 2FWOB 4NNYB 4LQFL 2E7MA 5EBLB 1J87A 4G80A 3VFGL 4J4PD 3MZTA 3VXNA 2Z93A 5LAXA 3HUJE 3MNZB 1Y18B 4MD0A 3O8XC 1CGSL 1CZ8H 1J86A 1H3GA 3P11L 3TZVA 4KVNH 2MPAH 2WP3T 4JY5L 1ZVSB 3BAEL 3QEHB 1R5WA 1AGBB 1RVFL 2I07B 1N26A 3CFDB 3QFJB 3QNZB 3S4SB 5LXGH 5JOPD 4F57H 5LAXB 4LVEA 4AEIH 3ULVF 4P9MH 1RV6X 4PYGA 1IC7H 1ZT4B 3T4AA 5EBLA 2A73B 5AAWA 4R26L 5BJTB 4R8WL 2XTJD 4DUWA 2NMSA 5BRZD 1KG0A 1K8DB 4HIIB 2F5BL 1AGCA 4KK9C 4S1SL 3PWNB 2VDOL 3EFFB 4DAGL 3T2OA 4R0LA 3CFCL 2LTQC 4WGWB 3WFBH 5H94A 1BX2A 4ZUTB 3DGCR 4GJTB 3LD8C 4HDIA 1T22B 4I1NB 3X11A 1BAFH 3VDBA 5F7NC 4DKDC 2MHAB 3H6JA 2GY7B 3MXVH 3TIEB 2CO7B 4WW2F 5D7LD 3IXAA 3VFUB 1LO4L 4MJIE 4R9HA 5HHPA 4MNGA 3H9ZA 2J8UB 1X5IA 1EHNA 3ZKQD 5E8EB 3IDYC 1FYTD 1NGXA 4ZSOB 5IESH 4G9FB 1F2XK 4O2CB 2DQHH 5A16B 1TCMA 1MI5B 2D7MA 3SBWA 3C5ZD 1F11A 4NQCD 2FEEL 5IHUL 4OD2A 1CGVA 2XZQL 2A83A 3BKJL 3C6LC 3FRPG 3HG1A 4JZNA 3MBXL 2OCFD 3GNML 1NMBL 3FQUA 2FNBA 3JV4A 4YXLL 1HHHA 2EDBA 3P9MB 3RNQB 3FO0L 4L3AA 4JKLA 5CLWA 4Q6IA 1PQZB 2NY0B 4XAKD 2GSIA 5EU6D 5FGCB 2HTLC 1LEKA 2ZCKL 1P4IH 2ZSWA 5J3HC 2NY3C 4AEIL 4MMXC 2VDLH 3BZEB 3TWCL 4Q9RH 3K2MC 4PV9A 4TTDC 3HCVB 5KJRH 3QUYA 2C4XA 3R0NA 3VFMB 3QUXB 5I75B 1IL1B 1FL6A 3MJ8A 3T0WA 2LAAA 3UPAA 1GRWA 1T22A 1JVKA 4HS8L 5FDWA 2I9LB 2GTWB 2OR9L 5IFAL 4F15B 4HWBL 2W9DL 3ARSA 3LPGA 4V1DB 2BJMH 4UILL 2VB5A 3QCTL 3HRPA 1LVEA 3AREC 1T04B 1I7UA 2HTLD 1S78D 5C6PB 4LKXB 5ALCH 3EYSH 4R90H 1R3JB 3S3SA 2EH7H 3GSWB 4ERSL 4RMTA 4KGJA 4ZTOL 4OUUA 2QQKL 1K4DB 4QOKB 4GRLA 1UEYA 2BVTA 2P24A 3QCVL 4P2RE 3HB3C 1CFNA 1NFDE 3DX6A 4QTHA 4I0CC 1NANI 3U0WH 5ANME 3Q6FA 1AD0B 4P4KC 4ZNEA 2QR0B 3SDCB 2XN9A 5I16A 1FBIL 3QEQE 4AM0A 2GSGA 1GGCH 1T0PB 3IKCA 5AZEL 4J6RH 4JR9L 3JV0A 1QOKA 3AREA 4YDIL 4OKVB 3D39E 4K94L 3DIFA 2XZQH 1J05B 4ELKA 3VXNB 3QT2A 1UH2A 2ZCHL 4UQ2B 5IBLC 3TYFB 4NKOB 4KTDH 3X3GH 1K4DA 2V5MA 4KJQD 1I9IH 1LK2B 4RFNB 4ZNCD 1CIUA 2BNQB 2ZP0T 3KPMA 3C87A 3QDGE 4RBPH 4WO4A 4MAYB 1INQA 3TBSB 2XQYK 3UYPA 5H2BA 1MH5B 3HN3A 3CPLB 3MYJA 1H3VA 4XP9H 4JHAL 2DMCA 5D93C 1KGCE 4XCEB 3AS3A 1U92B 3U36A 2AEQL 1FVDA 1EMTL 4OCYH 1MCEA 3B2VH 2D3VA 5IT2H 4YPGB 5FUCC 1R3IH 4LSUH 1G84A 4YX2L 3RVWC 4M8VA 2VLJD 5GISH 3PIQB 1JNJA 4PJGE 2ORBH 1F3JA 2OLDA 5GRUL 2QKIA 2A6KB 3KLSA 2UZYB 4OLUL 4IRJA 4YO0A 5DRWA 4POYA 3I6GA 3EJZD 1RUKL 1B2WL 2WWKO 4G43A 1SJEB 4ODSH 4KWUA 5JXEC 3O3BB 3M17A 2YOCA 1I85C 43CAB 4M7LH 1CXIA 3RVXD 3ZKMD 3QUZD 4PJ5E 3BKJH 1NC4B 4K3JH 4P2QA 2G5BB 3ES6B 2Y7QB 3HZKA 3TWCH 3UEZA 1K9TA 5EZLA 4FFYH 5MEPA 2RCSL 1MCJA 1S5IH 5HHVH 1X5HA 2AV7A 5HHNB 4GAYA 1QFOA 1UZ6E 5I30H 3QEQA 2A73A 1YUHB 1LK2A 4U7SA 2VAJA 3K8MA 4GRWE 3W9EA 1TPXC 2FX8H 1YPZF 1A3RL 4NUJB 4B7IA 4NQVA 1KEGH 1J0ZA 3SKJH 4KDTA 1KBGH 3EIFA 3UO1L 1G9NC 1F4AA 4X6FB 3FT2A 4QRPE 3V4VL 5IR1B 2JCCB 3WN5B 4PJ7A 1S9WA 2GITB 4QF1B 1CIDA 4NZTL 5JMRA 3QUKA 1PKQB 4PJBF 5F1OB 2W0PA 2EDTA 1F8TH 4K7PY 5CD5D 6FABL 5TE4L 1KC5L 5HPMA 1NCBH 2ICEA 3BH8B 5JUEL 5E9DE 5BRZE 1J5OH 4HCRL 3DO3A 2Z93B 1SEQH 4S1RH 1N6VA 3ZHLA 1DBBH 2H6PB 2W07A 4L1DA 1IAIL 5F8RC 1ADQL 4OQ1A 3MUZ1 3MRNA 2ZUVA 1OSPL 1FP5A 1ZGLP 4NO2B 4CGTA 2XKSA 3TPUB 1OAZL 4XHJC 1RHFA 2CXKA 3STZB 3VFRA 1B4RA 1WBZA 2HKFH 2IG2H 4WFFE 4MLIA 1JI2A 1T0NB 3NPZB 5EIVA 2H6PA 5C0AB 1SYVA 2PTUA 5I18L 4F3FB 2Z31D 5DDHA 1MFBL 5D9SB 1M7IB 5D7IB 1JP5A 1UJ3A 1VGKA 5DLMH 4R4BB 5ERWB 1CTNA 4WU7B 4K9EL 1YECL 5CMAA 3U0PB 4Z18A 5IR1A 3BFOA 1LE9B 3TPUA 5JHLH 3AMLA 3EHBD 1CI5A 2EIZA 1EAPA 2VDPH 1OPGL 1ZTXL 2W38A 3REVB 4XI5C 2OJEB 4RNRB 4K8RL 1P4BH 3VGAC 3A67H 2PETA 5HHNA 2BY3A 4YZFE 2P8LA 1MVUB 4LSPH 4DZBB 1FCCA 5LCVL 1IGJB 2V7NA 5IVXA 2HJKA 5GHWH 3SGDI 2APWA 3P30H 3BZDA 3QFDA 3RVTD 2EE3A 3S8WA 3GRWL 5DQ9B 1U8JA 5IEHB 4LSVH 1OP3H 3JWDL 3KXFD 3OB0K 5DJDB 1NDMA 4U4BA 1BF8A 3M17B 2FX8L 2IQAB 5FHBL 1FORL 1S9VB 1KCKA 4IHOA 5KVGL 1AFVH 4M5YL 43C9A 2VLKE 2XNAA 4X6CE 1JWUA 2VYRE 1VENA 3S35L 5E6ZA 5IW6A 2OP4L 3M1BA 4BK5A 1C8PA 1FSKC 3DYMA 3CLFL 2UY7A 5GSRA 1OP9A 1D6EB 5I30L 2B5IB 1YPZB 3ZKSD 3WEXA 4LPVA 4KKBD 2BSTB 3BD5A 5GZND 3F5WA 3DI3B 4JJHA 3B9VA 3ZT7A 5D4QA 5JIKA 5HI3D 1A8JH 3PWJA 2IFFL 2MCPH 4P2RD 3HNSL 1P84J 1P69B 5F1SA 4MHHG 4DN4L 1RQ5A 3MPCA 3O6ML 1ZXQA 3I02A 2V17L 4TOYL 4EKXA 1LQSR 5GGSB 3CXHK 2P5WB 4XTRC 4ODVL 3QIUD 2AEIT 1G7LA 3LRHA 4WFED 4MD5A 1E6OL 3HUJA 5IB3A 4O02H 4K55A 1E4WL 1CICB 2NXZB 3O6LH 3PDOA 1JGUL 4U6HB 3ZKXB 1MY5A 3V6FA 2NXZC 3DVGA 4BSVA 4EXKA 5IVZA 4YQXL 2ZUWA 4TUJA 4FFYL 3EJJX 3HAEA 3W0WA 3H2WA 5JR1H 2P5WA 3O2DL 4PY8J 3MODH 4HIXH 3SDXB 3QHFH 4N8VG 3ZE1E 4HWZB 1AJ7L 2DF3A 4OZFB 4ZOEA 4PBWD 3QIUC 5ALBH 4LNRA 5SWQA 2W60B 4JHZA 1T0MA 5I17A 2F74A 1RI8A 2YA2A 2NLJA 1MCPL 1OCWL 1YEHL 3W5NA 1A22B 4NZJA 2AERT 4DZ8B 4Z7WA 4MCYA 4N9GA 3DVGB 1XR8B 2BNUA 2EYTA 4I2XB 1HXMA 3BW9A 3OXRB 5FA4B 3VXQA 3U6RA 2JJWA 5I66A 1FSKB 4NO0D 4XCNB 5IMMB 3FFDB 1AIFB 3RU8H 2GIYA 2CKBH 3V5DA 2QQKH 4TSAL 1OD9A 3GHEL 3BIKB 4LOUD 4MQ7B 4TVPH 1NMBH 3N9GL 2DQGL 1TZIB 3CUPA 4XP6L 3QUXA 1F58H 1QSEE 1N5AA 1YY8B 5F6IC 4OUUB 1IGYA 1WITA 2DN7A 3TV3H 3ARFA 4M7JL 1NFDA 1KB5A 4N5UA 5F9JA 5C3TA 5HDOA 3V4PH 3T08A 4BKLB 4XX1G 2DQDL 5FYLD 4JPVL 4X6DE 3KPQA 32C2A 4KFZC 4Z0XB 4HJ0D 2C3HA 1K5NB 2A83B 1KCLA 3GSOB 3SE3A 2PF6A 3BEWB 2P5EA 2YXMA 2OX5A 5HYSG 1MPAL 2Q1EA 3WE6A 4RWYL 3TBVB 1AGDA 1F4YL 4OM0H 3LV3A 4NP4L 5D5MA 4U1LA 3OBAA 3R0MA 1OF2B 3GMRA 3LQAC 4OZHB 3ARGC 2H45A 1ZHLA 3CJJA 5DT1H 5GRVK 1MWAA 2X4TA 4XC1L 3ET9F 4AK1A 4QY8B 4JPWL 1CFQA 5EBWB 1XF2B 2VLLB 3GB7B 4LLDA 2EYRA 2X41A 3KXFB 1K4CA 1PEZA 4R0LC 1M4KA 5EN2B 2P5EB 1UENA 5GISL 1UCBH 2VZTA 4GAFB 4JFEB 3BDYH 1BX2B 4MXVF 2NXYB 4OJFH 3KPQB 4GG6E 4GXVL 3TIDA 1KB9J 2R4RH 2AI0H 3NZ8B 1T6WA 4Q74A 3NBNA 3KDMA 4CN6A 1EZVY 1PY4A 3C09B 1ZK9A 1DEEB 2CKBB 3O9WD 3LKQA 4Z0BH 4E41B 1BZ7A 5HHPB 1WSST 3FL7A 5IFJA 1FG9C 1FL5A 4YWGH 3S5LB 1KJVB 4XPHL 1QO3A 1NGPH 1SMAA 1DN2A 2GTZA 2VL5A 4KXZI 1FZKB 5JORB 3P9LB 1JV5A 3V0WL 5KVEL 5TE7L 3T8XA 3BSZH 2AXGB 4WW1B 3ZTJG 5M94B 3WL9B 1YMHB 3MA9H 3MCKA 3LHPL 1MJ7H 4IOFC 3RGVA 3RPIA 5KZCD 3WO3B 4B50A 4JE4B 4S1DD 2PTTA 1IM9D 5BJTA 5D71H 3RWIA 1HN1A 2DLFH 3O41A 5L88H 1PEWA 4NNYA 5C09E 1ITBB 4U3XA 3O4LE 3LQMA 3TC9A 3NCJH 1EBAA 5IBLD 5HI4C 4CADA 3LPWA 1YECH 1BEYL 4D94A 5B38A 3ZZ1A 1UKSA 1KN4H 2P45B 2Q76A 2C3GA 1LO0H 1Y6MR 4IDJH 3I3EA 3MR9B 2OL3A 2DWDA 2IPKA 5B21A 2A77L 4JVWA 1PD6A 2O5YL 2C3VA 1OTSD 2EC8A 3CCHA 5L2KA 3MLSL 12E8L 1R3HA 4M43H 5I19L 4JB9L 4NQED 3LKPB 4OFKA 5IIEA 1JN6A 1BFSA 3FQRB 4OI9A 3SJVA 1N2RB 3OHXB 3GKZA 4PJFE 3M8OH 2BHYA 1FCGA 4BZ1H 1EVUA 3MRQB 2YD1A 5DJ0B 4FQXC 2YPKB 4L4TE 3ULUE 5DK3A 3NA9L 1MHEA 3D25B 4NM8L 2AKRB 4P2QB 4TTDD 5EBMA 3BQUD 2DWEA 2CO6B 1SY6H 4AEHL 1JGVL 2H41A 2B4CH 4L9LC 3O3DA 3C5SB 2YRPA 1DQMH 3QQ9D 4JHBA 1ZGLB 1LP9E 3RDTC 3NIDE 1H3UA 4K3DL 5C07D 4O4YH 5F1IB 1VFMA 2HRPL 2XRAL 2PYEA 1BWMA 4NCC1 4ZUUA 3OWEA 3MRJB 2ARJQ 5IW6B 3ME0A 4FQXD 1J12A 1K6QH 5F7DA 1J8HB 4Y4KC 1OLLA 2BVOB 1CDCA 4HDIB 2FR4A 5CSGA 3G6DL 4W4OA 4DZ8A 3QAZC 2CXGA 5D71L 2ZUXA 3SDCC 1DQLH 4CW1A 1T2QH 1A9BA 4YDVB 5HHOB 5LQBH 5DD6A 3PJSA 3O4LA 3DO7B 4D0CB 1HINH 4XWOD 1NCUA 2Q8BL 2FX9H 4OV5A 3QDJE 4YUEH 3DX9A 3UTZB 3GSVA 3ROOA 2ATKA 3DX7A 4JFPA 2J7LA 5J4MA 4ZPTB 4QRTA 1JBJA 4C83B 4U3CA 2YZ1A 3MFGB 3QDMD 1VADB 5CEZH 3AREB 1KJ2B 5EZOL 4EN3D 3RHWK 4UB0L 1CLOH 3HZVA 3EO1B 4WCYH 4M1DL 2J6EA 4F15C 5GS0L 2GSGB 4NKMB 1KLGA 4I48B 4OIBA 2SEBA 4UV7L 3SE3C 5I71C 2G60L 2XTJE 2Z8RA 3QCUH 1U8IB 5T1MB 4RFEA 1Y0LB 3SE8H 3M07A 3VXME 3VDAA 1KJ2A 3THML 4H25B 5CKAA 3WFHB 4YH6A 3SDDC 2NY3B 5C0RL 3TPKA 3CMOH 1WFNA 4ZPTA 4RGMC 3VRLE 4NKIH 1NMAH 1S8DB 1LO0L 3H9YA 3U9PH 2DQTL 3JV4B 3RL1A 1IAMA 4JQVA 1ZHBB 3IJYB 3FN9A 3QG6A 1XF3A 3RUGA 3IDJA 1JV5B 4AIZB 2VISB 2EDLA 3S88H 5I0DA 4XP5L 5ENWA 3S96A 4H5SA 4BFIA 1U2CA 4HIHB 4YIQB 5IB1B 5E9DA 3FO1B 1VFBA 1IC5L 1N6UA 1T3FA 1RJZB 3RVVC 5D1ZB 4FXKA 3VWJC 4AENB 4MDJA 2MKWA 1WWBX 3EAKA 2ESVB 5DJAB 2I26N 5CZXC 3UTSE 3PG2A 4Y5VB 1EHAA 3IRZA 4R7DA 2GSIB 4MCZA 5E2UH 1T1YB 4HJJH 3DSFH 1I1FB 2AQ1A 2VR5A 3S4SG 1RFDH 5BVJA 4KPHH 3JBG7 2DM4A 1T89C 3DI2B 1FYTE 2LTQB 2WUBL 3OR6A 3SE9L 3SKOA 4NQUA 1KB5H 1NKRA 3DROA 2FBOJ 5BO1H 2Y7QA 3HZKB 5KSVB 3LIZL 3SY0A 4DKEH 5EBWA 1XF2A 2Q6WA 3MOAH 2GY5A 1E27B 4URTB 1ZHLB 5EOCJ 5GGRB 2AJVL 1U91B 3SDXF 3PWLB 1QRKA 1BD2B 3OAZH 1G0YR 3L3JA 4H8WC 2HVKA 3QB7C 3FRUA 1DQTA 2VXVL 5EU6E 1GGTA 3EDKA 3T09A 4KROB 1INEL 3WHE1 1WWWX 2EDFA 4A6YB 1FGNH 1PG7W 1K5NA 4HIEA 3PQYB 1IM9A 1A9EB 2Y06L 2BRRH 3MNVA 1CR9L 2X4SB 3JZ7A 1L9NA 3P0GB 4ENED 5IOPA 4YWGL 5A2JH 2EDOA 2P7TA 2NY7H 1NCWH 3QXVA 4MNQD 3EDDA 2NCMA 2CUMA 4LDEB 5C0JA 5J12C 5GXBB 1JL8A 3T0VA 3KYOB 5EU5B 5F97E 3KPOA 3LS5L 5CILH 4CAGA 3GFUA 3F7VA 4NJAL 1FAIL 3GSRA 4XMKL 3WS3B 4U0RC 5DJ6B 1YMMD 4YHIB 4O2FB 2A6DB 5EWIL 3S35X 5C2UB 5I1EL 2ZUQC 3RZCA 3VW3H 2Z0BA 4MQSB 2JCCA 3PHSA 5T5FH 3A6CL 1XT5A 1HIML 4L29B 4UMGA 3L7EB 3MJ6A 4JGMA 4ENEC 3TVMD 4M02A 4KZDL 4PP1C 4R26H 2PO6C 1RZIA 4DVRL 4P9HH 4LCUB 2IADB 4NC1C 5E4EB 3V0VB 2X4UA 2VABB 4OD1H 2JB5L 5IG7A 1RSFA 3EFDH 3L3HA 2P8MB 3U48A 4NRZB 5MEPB 1GC1C 4WI2A 5CAYB 1W0VB 4FQLL 4J8RB 3L9RA 3ARYA 4CMHB 4BQ6A 3S36L 4TQEL 1IE5A 5AAMA 4JZJB 3T0DA 4Z7WF 2NW3A 2WIIA 3IAGC 1B90A 2DM3A 2C26A 1RAMA 2R9HD 4R2GC 4BH7B 3IKKA 4JG0L 2YKLL 2HKHL 3GI9H 4YBQC 1RY7B 4K3GA 3FT4A 5ESQB 2PYEE 1Z0NA 4Q58C 2DICA 2FECL 1CFSA 1DQDH 5E2UL 1Q9WA 5SWZB 5DMKB 2WQRA 3QDMB 4K7PX 4FQ1H 4OZHA 1ED3B 3GJEB 1ZLVK 3U7WH 1UVQA 4PJAB 1NLBL 4RBPK 3ULVD 1V7MH 3DROB 1U36A 3OSKA 5JHDE 3T2NH 1HYRC 3NAAL 3IDIA 3TF7C 5C6WH 32C2B 4Z0XA 3BKML 2HAZA 3GMMB 4LSQL 5I1IH 3NCMA 1QRND 1C5BH 2P49B 2VABA 5CJQH 5D72L 4MVBD 4AH2B 4WV1A 3ARBD 4O2CA 2V2TB 1CD0A 2D2OA 2IH1B 3V0AC 2F8OA 1M05A 3S37L 2X1WL 1AE6L 3P4LA 2GFBB 4CN1A 1KYOK 4JN1H 2F8VA 3O6FB 15C8L 5IMKB 1V3JA 5DQ9A 2BNRA 3VW3L 1G9MC 2V7HB 4AIXA 5ENWB 3VFOB 1J8HD 4ALAL 5DJZA 4QT5B 6FABH 2OI9B 5LGJB 3MJ9H 3C6LA 3MBEC 5GRJH 4HX1B 3VXRE 5L8JB 4LARL 4XWGL 1TJGL 5CEXB 4WEMB 2E7LC 3ARBC 3DYPA 3TYGL 1SEQL 2Q20A 3U83A 2YPLE 1XIWD 2CRMA 2DLGA 1F4XL 5GJTL 1CDUA 3DYOA 3EOTL 5E1AB 4HWZA 3V0WH 3QULA 1I3RB 4XMLH 2Q7NA 2YPVL 3WFCL 1N5YH 1U8KB 1JZ5A 3Q6GH 4HV8A 4PY7A 2V5SA 4XNYH 4DW2L 2ESVD 1INEH 3U4EA 3RPKA 4C56A 3B6SA 1NBZB 4GO6B 3V79C 4U49A 4NWUH 2C7UA 3QWOB 1FLTX 4OT1H 2FL5B 3GO1L 3FQXB 2F53E 3QIWC 3QZWG 3QQNA 4PLKC 1Q0YH 3ILPA 3WN5A 2VLRA 2CIKA 2ZSWB 2XY2A 2OK0H 4U2YA 3D0VA 1CXHA 3OKMA 3QFJD 2GFBA 4H20H 4ETQA 3IVKA 4W4NA 3DXAE 5INCB 3VJ6A 4A2MA 1OOAA 1MFEL 1C16A 2CRZA 1I75A 5TF0A 2APVA 5IKCB 5C0FA 2VUYA 2D7PA 1FLRL 1I7ZB 5JXAH 5I0ZA 4G7YH 3CSBA 4X6DF 1G9EA 1M7DB 1D5MA 4KMTH 2H8PA 2X89D 4BKLA 3CFBA 4OF5A 4EDWL 3HLAB 5ICYB 1JK8B 1ZVYA 3KJ4B 1F97A 3L5XL 5HGDB 4HXBH 4PIRF 3ZYOA 3QEUA 1NEZG 2V5YA 4KJWD 3T1WA 1TENA 4UT6H 5HHXL 1IKNA 4LAJH 3OX8B 2HLAA 1BOGB 4XVJL 4HZLA 5ISZE 1OWRM 4NM4H 5C9JA 4N0UE 4UIKL 5EPMA 1EJ6A 5D1ZD 4OCXL 4FXGB 1I8MA 4PJGB 4LF3A 3KYMB 2EDXA 1G1YA 4IMKC 4PR5A 4WWID 2VR9A 5HJ3A 5BVPL 4YHNB 1J10A 2NNAB 4IDJL 3HFMH 4GW1A 2VLKD 4XPGL 4MNQE 5DMIH 2EXWD 5DWUL 4E41D 4PGDA 3BGMB 1NFDB 3MJ7B 4JN2A 1NEZA 4LCCB 4PJ7F 1K8IB 5EC2B 4PRDB 4Z9KB 3CGTA 1DL7L 4JFXA 4JY5H 1QLRA 3NABL 3VI3E 2R2HB 1ZLSL 4HK3N 4LF3B 4XB7A 1A7NL 2CK2A 3AXLA 1OM3L 5MENE 1U8MA 2GQHA 5MP6H 4I0KA 3MA9L 3VXQB 4LPCA 4A6YH 4Y8DC 4YXKH 3VGHA 4LGPB 4GMSH 3OKLA 2WK2A 1RZJL 3L7EA 3O0RH 2HJLB 5HGDA 2JCCE 3BIBX 4G8FB 3Q6FB 5TQ2L 1X5LA 3QQ4A 4OD3H 2CLRB 1R3KB 2ZKHL 1MCWM 2GI7A 4UAOB 1AO7A 4FFVC 4I3SL 1I9RH 3BZ4A 2WBJB 4AT6B 4LPYA 4PJ9D 5C92A 1XCTA 3D3VE 1NMCB 1I8LC 3PWPE 3IDMB 5HGAB 1DUZB 5ITFA 5A2FA 1TCRB 2OZ4H 4OV5B 4DN4H 4HAFA 1A3QA 1JPGB 4EQ3A 4HIXL 4IRJD 4HGKC 2FD6L 3MCKB 2NYYD 1HXYB 2Y07L 4MA7H 4BUHA 5JMOC 5E8PA 1AGEA 1AO7B 1LNUA 4WEUD 3B9KB 1GGIL 3F7PC 1ND0B 4MX7A 3FQXA 4HPYL 5JPNB 3QXWA 4BYHA 1XIWB 3L6FA 5T3ZE 4PJ5B 1RZKL 2PO6A 3JWDC 4OZIB 5EORH 3UJIH 1NBYB 3KYNB 4LQ1A 4K2UH 1DR9A 3AC0A 1JZ6A 1QRNA 4LLAA 1MJJB 2ITDA 5D96B 5TDNB 2DMKA 3JV5A 4JLRA 5IVXE 3U30C 5AG9A 4KTEH 5BO1L 1Y6NR 1NSNH 2D7OA 5HYJD 4JREB 3FFCD 5C0AD 3QXDB 1UWEL 1NJ9A 1YEEL 4U1MB 1T03L 2EDJA 1JNLL 3LRSB 5I8EA 1LEIB 1U8JB 4GFTB 4D0DA 2FRGP 4ZODA 3O6MH 2XPGA 3GMPB 2W9EL 4HS3A 1G7MA 4UT9L 3RWHB 4MLSA 3ULVC 4P46A 1QFPA 1JGDA 4YXKL 5ETUB 3P4MA 3LQAL 5DVLA 2YWYA 4G8IB 4JPVH 5KSBF 3G6JB 5JW4M 4UIMB 4Y1AB 2F54E 5C9KA 3LQZB 4ZSOA 4Z7UF 2R0ZH 3H7BB 4MJ4A 1G7QA 4N1HB 1R0AH 2C9AA 4GUPA 2B0SH 3GJEA 2Q8AL 4L3CB 5JXEA 2ESVA 4LMQI 3PL6C 4A6YL 4KUCF 2UVFA 5B38B 3QHZH 5CZKA 2PXYA 3HLAA 3L3GA 2YD2A 5ALBL 5D7LE 1KOAA 5IP4A 4O4YL 3OJDA 1OAQL 3CVHH 3HG1B 4JZNB 5CGYC 2AJ3B 1UKTA 4LCWE 1A64A 2X1QA 5E8DL 3NABH 1NUNB 5B4MD 4KKCC 2AAVA 5MI0B 1CZ8L 2DQFA 2XZCH 3EGSB 3EYFB 4F7EB 5DRNA 5BQ7B 2AKRA 4I0PC 2Z4QB 2GJ6E 4YDLC 4ETQB 3IVKB 4N1CA 3FB7A 4NQCE 5DJCB 5HBBA 1AC6A 1BECA 5BZDA 4S1RL 4J3OC 3LN5B 3QCTH 1OAUL 4MA3A 2G9HA 4LHUD 4WUKH 3P4NB 1TTFA 3K1KC 4U6VL 4Z7VF 1OGTA 4P49A 1QR1B 1IC4H 3QDGA 1LILA 3S88L 2F19L 3BXNB 3DXAD 4ZYKA 2Y25A 3TO2B 1MFAH 2F53A 4GAGH 2C1PA 3PHQA 4PUBL 1D5XB 2FBJH 2VH5L 3HS0A 4KV5F 4OZGF 1QBAA 4WU5A 1A02N 3FZUC 1I8KB