5E9DE

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
b'AGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMAWYRQDPGMGLRLIHYSVGVGITDQGDVPDGYKVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGWMAGGVELYFGPGTRLTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 27
structure length 115
sequence length 115
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dE00
3OXSB 1CLYH 5ANME 1MCEA 4YFLF 4WHYH 4G6ML 2OL3L 1J8KA 4S1DD 5J6HA 1IGFH 4AEIL 4P9HL 1UM5L 1YEEL 4NHUB 4I8DA 1AHWB 5TH2A 2FEDC 1EHXA 4Y5XC 3I6KA 4OZIE 1MF2L 4D9LL 2AJXH 4ELMA 1F3JB 5KN5B 4BH8A 1AO7D 5C0AE 7FABL 4YXLL 5T3XL 3FO9B 3ZSSA 1BOGA 1VFAB 4LRIA 3SOBH 5IB2A 2EIZB 4DVRL 3MUHL 1KIRA 4OB5H 2DQGL 4LVNB 5IB4A 4L8CA 4TPRL 5HHPA 3TZVC 1BF2A 4LEOA 4G6JL 2ZOLA 4IOSD 1PZ5B 3AAZB 3T0EC 1DZBA 2AEWA 3RWFA 3BZFA 4JO2H 4OF7A 4M9PA 2IG2L 4KDWA 3IFNH 1ZT4A 3D0VB 4RFEB 5C2UB 1A1NB 5J11B 3MBEC 3QUXA 3UDWC 1J1XH 4XBGB 3JWOH 3RAJL 5H2BA 3AROA 3EIFA 4ODXB 4N9GA 2CUMA 4NGHH 3BWUC 1A6TB 4JHZA 3SE9H 2W60A 3BUYA 3C60C 4RGNB 4OI7A 1LK3H 3BO8A 3U7WH 1HQRB 5DTFA 1YZZA 3CUPA 4XPFL 1BFOB 1P7KA 5TQ2H 3GJEB 4XBEL 4K3EH 1O7SA 3MV7D 3GHBH 1LE9A 3X13A 1R3KB 4G8FB 4M7ZC 2FWOB 4JQVC 4YZFF 3SHSA 1FV1A 1YPZB 2O5ZL 5C07A 5FA3A 3QNYB 2HT3C 5F7KC 2FEDD 4YWGL 4AEEA 5D1QC 1KTLA 4KRNA 4CDGC 3BQUC 4G9FD 4ZUTA 3MZTA 4IS6B 4XMLL 3THML 2WINB 5D1ZB 5I1IH 4Q6IA 1PQZA 1PKQA 4OGYH 4PJCB 4HFWA 1C5DA 1JF6A 3DECA 3ZDXF 3INUH 3BP5A 4RGNE 4DCQB 5DLMH 2X4QA 4OCNC 1R3JA 4ZFZB 3TZVD 4U1GB 3VFRA 3GUTB 1CTNA 4Z78A 1S7SA 4X4ZA 5HSFA 1XZ0B 3LEXB 5JW5A 5L2KA 3T8XA 3DBXA 3B2UC 4C83A 1J1PH 4APQC 2KPNA 4J4PD 1MJUL 1BOGB 2YUZA 2V7NA 1KCUL 4KROB 5IB2B 3TA3A 3KLAB 4DGVL 3UZQA 1YPZE 2GFBA 4FABL 4ZO6A 2UZIL 4L8CB 2O5YH 3IXTB 3C5ZD 3VRIA 1QRKA 4O51A 1AC6A 3C60D 2CKBB 2CLRA 3D2UA 4P3CL 2X7LA 3WHE1 4LEOB 4LSQL 3IDMA 3QULA 5CBEA 2F54B 3WSQH 3BZFB 4G9DB 3RDTB 4Q2ZB 1REIA 3TN0A 1ZT1A 4W70A 2ZG2A 4L8DA 5F44A 2AP2A 2W0LA 3IDJB 3ZE1F 4PJCE 4PRIA 5CKAA 4M7KL 3BJLA 5I19L 5H2BB 3EJZD 1HCFX 3KPRA 3BRGC 4JM2C 2DBLH 5I1EL 3DMMB 3SDAA 3MACL 2HT3D 5HGBB 3RU8H 4HDIB 4FZEH 5HVGB 1MQ8A 3MRIB 1DUYB 5IW6A 3MRHA 4PRPA 5IKCB 3VWKC 3V4PL 2N56A 1B6UA 5B3JE 3L3JA 2CMRH 4JKKA 5BS0A 3FQUA 3OXRA 3PXJA 4HKBB 1AQDA 3X13B 2F19H 1RV6X 4H0HB 1NCNA 5J13B 4DQOH 1G7LA 4XP6L 1FV1B 2CO7B 3QIWB 2ADFH 1RZ8A 1F3RB 4YO0B 1P9MA 4IOFC 3M07A 2F54E 1IKFH 3D69A 5HDQH 1MUJB 5GS3A 1MEXL 1BJ1J 1SJEA 1KC5L 4ESKA 5HGGS 4WO4D 1URLA 4U2YA 4Z7WB 1AR1C 4AT6A 2C7UB 1K9TA 1SJVA 2FLRT 5E56A 3TV3H 1NAML 4Q0XH 1PKQB 2XZQL 4ETQA 1QG3A 1C5DB 1QRNB 5CGTA 3DIFA 3M8OH 3HKFA 3GSQA 4MJ6B 4X9FA 3TBWA 4YHNA 3QEGL 1YNKH 3GB7A 2W38A 2X4QB 1OF2A 1WEJH 4HK3J 1OARL 1RJLB 2IH3B 5BCAA 4OSUH 5FIEA 5KSBF 5L2KB 4TNWF 5HHMD 4Q97A 1K6QH 4U49A 4JM2D 1L7TL 4LAQH 3L5WA 2FECI 4IHOA 4ISVB 3SGJC 3VRIB 4AIZA 1K4CA 2CLRB 4UV4H 1C7SA 2I9TA 5D71L 3QULB 1UH4A 1T7XA 3IXAA 1EO5A 4Z7WE 4XBPA 3HTLX 3LKSB 2CK0H 3RQ3A 1ZT1B 3VWKD 4ODTL 5TPWH 3PHOA 3OPZH 1JHLH 1PKQE 3QDGD 1X5XA 3V0AC 1QRNE 2AEPL 4N0UB 2ZCLL 1V8HA 5E9DD 3VJ6A 2QSQA 3LKNA 3TF7C 3HNSL 5H35B 3CU7A 3IETA 5F1IB 2PYED 1MCLA 3QFJA 5IOPB 4KU1A 4IOFD 2VOTA 5KVFL 5IHBA 5L2KE 3AB0C 4ONHB 4WEUD 4P9MH 3P77B 1KBGL 3QUMA 2V17L 3QCTH 2A6DA 3P9WB 5DEFA 2NXZC 3C2SA 1HH9B 2XPGB 3GMNB 3QHZH 4K8RH 4AY0A 4HJGB 1DUZB 2VL4A 5IMLB 1GAFH 1WZKA 3PHQA 4RWHA 1KT2B 4PJ5D 1CBVH 3BMWA 4JLRB 1IJ9A 4J12A 4PBVC 1CD0A 1XF4A 1QNZH 2WP3T 1NC4B 4LSPL 3T2NH 3OV6A 1FYTA 4QRPA 3HC0A 2H6PA 4HQQL 2E6JA 1H3TA 5T1MB 1R3HA 3GSQB 4KJWC 4YHMH 4E41B 1QKZL 5I1DA 5HI3C 1BFSA 4J3XA 3VCLB 3CFIC 2A73B 1LEGA 4EVNB 5GRJH 1FNEA 2P5WD 5DK3A 5BS0E 3RFZC 5D5MF 1A7PH 5FYJU 4R3SA 4LCWA 4YXHL 3IFLH 2IJ0C 1GHFL 4L3EB 1FRGL 4HIXL 5MENB 3B9KC 5I74B 3UJIH 2IC2A 3W39A 2Q6WB 1TQBB 4XZUB 2ICWI 5DRZA 5BW7A 2OR9L 4X0KA 4JFEA 3BN9D 2I9TB 4GRWB 3GNMH 4EN3A 1MNUL 4WI7A 1AGDB 1XGYL 3RUGF 2DWDA 1NGPL 4MYWB 3V2AR 2VLLA 4RGMC 5JOFB 4RISH 3C6SA 2NXZD 3VJ6B 4KUZL 2ESVA 5TF1L 4WENB 5CEYA 2XWJB 2HLAB 3U4BL 4E41E 5BMFH 5DJ8A 1GGIH 5E5MB 3LAFA 1MCWW 3VFTB 3EFDL 1J8HA 1IM3A 1TQCB 1KEMH 2F8OA 1XH3A 4NJ9H 2FIKA 5DRNA 3ZTNH 4BA8A 2VL5A 5C7XH 1VFBA 4ONGL 4XC3L 4L3EE 1XF3A 3L5HA 4KV5F 3KYNA 5MENE 2V2WA 4HBCH 4R97B 2D4FA 3W82A 1MCNA 2ZNWA 4LOUC 1MI5A 5CJQH 5SWSA 4YHYB 4RGOL 1IC7L 4WWKB 4PJAB 5AUMA 3IF1A 4PG2C 3QEQA 4Z18A 1AD0B 1QEWB 2E7LA 3PHQB 5HI3D 3U82B 3CC5A 1T22A 5C0GA 3ULVF 1G1CA 4H5SB 2PETA 1D6EB 3BMVA 1WWCA 2ZZUT 4HC1H 1N2RA 4OIAA 1DJSA 3QQNA 4JR9L 2NY5H 3HC0B 4JN1H 3MA9L 1UKTA 4EBQH 2EDLA 4JO3L 3ULVH 4XNQA 2VDLL 2W0FA 4M1DL 4HH9A 1I7RB 3MXWL 1Q0YH 3QIUA 2FYYB 5CEZE 4PD4K 2EIDA 1JE6A 1QBBA 3MRRA 4NJAL 2OJZL 2R56H 2PCPB 4U1LA 3JV4A 4BZYA 1MCQA 3KDMB 2VJXA 1IGCH 3KPLB 1K4DB 4PJAE 4YH6A 2C4XA 4Y4HD 4GQPH 5C0BA 1U36A 3FMGH 2PR4H 4GRWH 3SE3C 4J3OC 3VRLE 2RIKA 4F7EA 5I1KH 1ZLWH 3ES6B 1IM9A 4JFEB 4PGBB 2ARWA 4U2ZA 5E8PA 1MPAH 1SQ2N 2IANA 5I17A 3G5XA 5GGTA 3K4AA 4GAFB 3HUJA 4UIMA 1TNNA 3T08A 3ZKXC 2VZTA 3RZCA 3BEWB 5DJ8B 4TN9A 3M17A 2XTJC 1CLZH 1IM3B 1P7QA 4F8QA 5DZOA 2R4RH 3G6DL 4FTVB 4F37K 6CGTA 3VGDA 5IGXL 1KPUB 2X1PA 3O3DA 4LVOB 5IB3B 4MA1C 1A3RH 3QDMA 2APBA 4WI4A 1JF1A 2XA8H 2VQUA 3O6LH 2AQ3A 3H9SA 4B53A 4NKDA 4H20H 5E8EB 1IILE 1MI5B 1OQXA 1NCBL 1WV7T 1T20B 4GO6B 4JKPL 3BW9A 4I0PB 4ZODA 5AUMB 4JFEE 4JY5L 4JPKH 3MLTA 3CC5B 1YDPB 5C0GB 4Z6AT 1M71A 5E1HB 4UB0L 3P0YH 5C09B 4OM0H 1N2RB 5IEHA 4XWOC 5EULV 3UMTA 1RJYA 2VZVA 3AGVA 4MHHG 1WTLA 4U7KA 4YIQB 4HH9B 1ROWA 4FTVE 4L9DA 3OZ9L 3QIUB 4IEFB 1Q9WA 3PL6C 4I9WE 2YA2A 2AXFA 1NBVH 5IVNA 2G75B 4IIQC 5FUCC 5C6TH 3MNWA 3K4ZA 1JPGA 4XMKL 4DOHE 4JDVA 2YPKB 3QAZC 5CLWA 3PWUB 4EOWL 4DZBB 1MI5E 3JV4B 1G7MB 2NY3C 1F4XL 4KTEL 4KKCC 4X9HA 4YHKH 4LPWA 5FO8A 2FJFA 4FQ1L 1FL5A 2HWZL 3QEQE 2BHUA 4XT1C 5E5RB 2D31A 2PTTB 2I9LB 1IM9B 4FQJH 5B39G 4WI6A 3K1DA 5D7SH 4HS8L 5C09E 3ARVA 4NN7B 3LQAH 5I17B 5IR1A 3PWNB 4MAYB 4TVPE 3DI3B 1IGIH 3W5NA 2Y25A 3HMWH 2Y07H 4EIGB 4EXPX 5F6HJ 4NQXB 3RZCB 4CVZA 1NSNL 2HFTA 5LWYL 1EAPA 1FSKB 5IJKA 4CKVX 1DR9A 3BEVA 4XH2A 4GKNB 5JZ7C 4LGRB 3QXWA 4POZD 1JF1B 2YK1L 3MLXL 3T2PA 5IMMB 3MRQA 1MJJA 5IW1A 1IGYB 2NY6C 2O5XL 3WJJA 3T0EA 1AO7B 3P3YA 1F8TL 5D1XC 3UBXI 4RA3A 2A83B 3VD5A 4ONOA 1S7WA 4OD3H 3MLTB 5F6IB 3B8YA 1TZHA 4Z7NF 1NGXA 5IMOA 3MBEA 4P2RA 3UDWA 1FZMA 2IANE 3UPCA 4HMEA 1MSPA 3DO3A 2B2XH 3MLVL 3PGCA 4WEMB 1W8NA 5ITBH 2OMNA 5JXEA 3W2DH 5DQDH 1WC7A 2IGFH 4RMUA 2VXVH 3CX2A 1K5NB 3ZE2E 1JN6A 3PV6B 3MJ6A 4KKCD 3A0OA 4I18B 1CFQA 3EUUA 4M3KB 1CFSA 1UJTA 4OZHA 4UV7H 5B38G 1IC1A 1TJIL 1Z5LA 4XAWH 2AXFB 4HS3B 3QDME 1RIUL 1PY4A 5CWSA 1TETL 5J0BA 3TGXA 1YY9C 1ZHLB 3ZE0E 4JDVB 4DW2H 2C3GA 4Z7VF 4M4PA 3CXDH 1X7QB 3MODL 4XP9H 1AO7E 1CFTA 5FO8B 4UDUA 1FL5B 4P2QD 5D1QA 3WN5B 1PX4A 4GAJL 5J1AA 3BQUA 4R0LB 5GSRA 1I3UA 1TXKA 3N06B 2AK4D 2X89A 5C1MB 2CD0A 4IJ3B 1IAIM 5FYJE 3QQ4B 3KYKL 1PVHA 4KK5C 1FH5L 1JTOA 1S78C 2Z8SA 2OQJA 2R2EA 3RNQA 4KPHH 2X4TA 4D9RD 4YEEA 3HR5A 4Y5XB 4FOMA 4LLVB 2NY6D 4CN4A 3P11L 3F7YA 1X5IA 1BQSA 4NNPH 3EO0B 1MCRA 1JGUH 4U1SB 5D1XD 3BI9X 4G9FB 5F7MC 1JPFB 4G8EA 2LFGA 4APQA 4JFDD 4QRQB 1AKJD 2NXYC 2X4RA 1JZ5A 1K2DB 5CSZB 3ETBF 3RNKA 1ORSA 1FFNB 1R0AH 2ADIA 3NCJH 5F89A 1QFOA 1UXSA 3MLUL 4R4BA 1HEZA 4J3WA 5DJXB 5ADPL 4RAUA 2QKIA 1MJJB 1U6AL 3H9HA 4DUXA 2YZ1A 3TZVB 1VCAA 2A1WH 1SMOA 4KMQA 4PJIA 3OAZK 5ILTH 3BSZL 4XVTH 4WFFE 3RI5K 3SPVB 4D0BB 4MJID 1FP5A 3GBLA 3TBTB 1I1AC 1TZHB 3MUZ1 4OZ4B 5DJDA 5AWNH 3MBEB 1R5IB 1CFVL 5EC2B 4JFZH 1N6VA 3PGCB 5FM5O 5GGQH 1YY9D 1IQWH 3JTTA 4NP4H 2K9UA 1WC7B 1JI1A 2P43B 4JCLA 5CZXC 4MNGA 3C60B 4PJFF 4XRCA 1W2KT 1LEIB 4GG6A 1KEGL 1CFSB 4N90E 4JPVH 5HYEA 2EYRA 1HHIA 1HH6A 4LIQH 4F58H 4F9PA 1C1EH 1JPSH 2F8XC 4JAMB 4NOFA 2G2RA 4OQTA 5L9DL 5LAXB 2DQFA 3IKKA 4QF1B 1N5YL 1JWSA 5D2LA 5CWSB 4XAKD 4M7ZB 1S78D 3U0WL 4LARH 2VDPL 4X6CF 4HEME 3KGRA 3T0EE 5CBAB 3BKMH 3MRFB 4UDUB 5EOCH 4H0GA 5D1QB 5FM8A 4F15B 1YC8A 5J1AB 1I9IH 4WNQA 2I07B 4U6HB 2VKXA 4U6XB 3GSRB 4CDHA 2ZOKB 3FQTB 5L6YH 1UGNA 1AR2A 1CYGA 4M6NL 4MLIA 1T1XB 2JJWA 5CJ5A 3KPMB 4OLUH 2XQYG 4X6DB 4ZDHB 2R2EB 2X4TB 4WV1C 3F8UB 3HZYA 3O3BA 3DRQA 3EYFB 3HR5B 5JR1L 4XNUL 3TO2B 1U8PB 2EKSA 4OZHE 1KB5H 1I9JL 4GXUM 1KJ3H 2KKQA 2PTVA 3X14B 1FIEA 2VZ3A 2NNAA 3KPQA 4WO4B 3MRLA 1I1AD 3VFOA 4MAUH 2PO6D 1NGQH 4QXUL 5F89B 5I2IB 3AFLA 4F8TA 5EO0B 1RU9H 1RQ5A 3SGJA 1XIWC 4OZFB 5CZXD 1BIHA 2EE2A 5E0QA 4DUWA 4L29B 3OGCB 2Z8RA 1BEYH 3REWB 1EVUA 2BERA 1N0XL 3QT2A 4R8WL 3V95A 3MGTA 2X44D 1HHGB 4X6DE 4HLZG 1N7MH 3OB8A 3GBNL 4UILH 3VWJD 4JM2B 2AAVA 3EDEA 1WISA 3NGBC 4L4JA 4IMKA 2AJUH 4GG6B 3B2VH 3NMEA 2WBJA 3IJSB 2EYRB 4I0CC 3NBNA 4L4TB 3MV8D 3GSXA 4MVBD 1GSMA 2DIBA 1RUKH 5D7LA 3VWKB 5ACZA 4C56A 1CL7I 1RVFL 1U3YA 3UYRL 2RFXA 3LKQA 4GQ9L 1DEEA 4F2MA 5JPMA 1JFQH 2DLGA 1QBLH 5D2LB 3DVGA 4NDMB 1OAUH 2QSTA 3CSYA 4ZNEA 5C3TA 4JHAH 1C16A 3DJ9A 2PYEB 4HKJB 1MVUB 3VI3E 3OWEA 5I15L 4BQ9A 2KZWA 4Q9QH 4WNQB 1G7IA 1EZVX 5FOBB 1KENL 5KJRL 1CT8B 3QDHA 3CLFL 5DUMH 2F5AL 4XMPH 2QADD 2VNCA 3O6ML 3UBXG 3QXVA 4K3GA 4JFPB 1OM3L 1S9YB 2BX5A 4P59L 3PWPD 4GG6E 2VH5H 4KVNL 4Y4KD 1HDMB 1F4YL 2DJSA 1N0LA 4LLYA 2DQUL 4LQFL 4L4TE 5DHYB 3X12A 1IFHL 1MFCL 1JWMA 3GGWA 3RKDD 3W0WD 32C2A 1A5FL 5D2LE 1FGVH 2OL3A 4BJLA 4PJXF 3HI5L 5EZJA 3FB8B 1B0RB 3HPJA 3U9PH 3UTSA 1JHKL 4OZFH 2W0PA 4Q9CA 1ERNA 4QHMB 5H94A 2DQDL 5AYQA 3RZWA 4DN4L 3S3JA 2NCMA 2DM4A 1MOEA 5CGYC 4FFWC 1KTDA 1T04B 4Z0BL 2GSIB 2EYSA 2O26U 4DKEL 4XNMB 4ZQKB 3VXTA 4JQXC 3EHBD 4XXDB 1OAQH 2YKLH 2P47B 1AGEB 3D3VD 3MOQA 2UWEF 5EOQH 5LCVL 3GZKA 4ZUVB 5C9KA 4JFYA 3FFCA 2R2HA 5FAAA 3ARTA 4PV9A 4PLKC 1T0PB 1IGMH 2A2QT 4F37F 1NMBL 1UZ8A 3FOLA 3DVNA 4KKAD 1IGTB 2NX5D 1OAZL 4NWTL 5D7LB 4XCCL 1TPXC 4TSBH 2CRZA 3MCG1 3LKQB 4NBXB 3UAJC 3DVGB 2NXZB 4PGDA 1U95B 4ZOBA 2D7QA 4W6WB 1G1YA 5AAMA 3H7BA 1AGBB 4HIJA 4ODVH 2OLDA 1DVFD 4UIKL 2VR9A 3CAFA 4UMGA 3UTTB 5C08D 1LO2L 5CZVL 1U58B 3IRZA 1H3GA 5F7FA 5HJ3A 2X4OA 2BY0A 4HPYH 1NQBA 2XQYK 1NH6A 4LHUD 5D7JA 5F88A 4GKZB 1S8DA 1HK6A 2DQIH 3WUWA 4QHUA 4UINL 2DN7A 4LHUG 2HG5B 5DVOA 5EZIH 1M05B 5ID1A 1AP2B 4NRYA 4PB0H 5CGYD 4FFWD 5D7LE 4G43A 1ZVSB 4QNPE 2A9ML 1JWMB 3KR3L 2EE9A 3NCMA 2QQKL 3OAYK 4L4VD 4BSWA 32C2B 3O45B 3RIFK 2OL3B 3M45A 1J1OH 3MLYL 4G42B 2R2CA 2C5DC 2BXYA 5DWUH 5E1AB 3UTSB 3S9DB 3B9KB 5C92A 5H94B 2BXZA 4N1CA 3SE3A 4WDIA 1GGUA 1CICD 3UTTE 4X6EB 4PLKD 1LMKA 2PYFB 3PJSA 4HXAH 1H8SA 5FO7A 2DICA 4GBXD 3UO1H 3D1MC 3C8HA 4KMTL 1CGUA 1I1FA 5B39A 1GGCL 3H3PH 4FP8L 5LVEA 3FB6A 4LCYB 6FABL 2BNQA 4Q9RL 2B4CL 1JWUA 1KLGB 3FFCB 2JB6A 3FOLB 2YPVL 4L5FH 2HP4A 5D72L 3AY4A 1FE8L 4KZEL 1DANT 1OTSD 3OR7B 3UTSE 3F12B 5CJOH 5TDNB 1ZT7B 4M3JA 4EDXB 2DLFL 5JUEL 2LVEA 4ELKB 2HTLD 3ESUF 2XFXB 3WS3A 5CP7B 1G7HA 5T3XE 1NGYA 1MY5A 4F57H 2LQRA 3WFCH 4Y19D 1HINL 4UAOC 2B1HH 4G6FB 3WIHL 1MLBB 5DC9B 1MREH 3MC0A 1I8KA 3QH3A 7CGTA 3SDCD 1KV3A 3V79C 3BDYH 1LO5B 1MRCH 5FGRA 2Q7YB 3DSNA 1BBDH 4LLQB 1BMGA 4TQEH 2GTZB 3FFCE 2YR3A 3E8UH 5CEXA 3HG1D 3NZHL 3OKKB 2JCCF 4UT6H 5ID1B 3UTQA 3PL6A 1OGTB 1S7TB 4JRXA 3BOVA 4IIQA 3GMLB 4H1LB 4G6MH 3HFMH 5FCUL 1Z9LA 1NAMA 1Q0XH 4AEIH 4P9HH 2BDNL 5E8DH 1BVKB 1YEEH 3RRQA 3FQNA 1MF2H 4RRPG 5B38A 3KXFD 4D9LH 5KSBA 3HB3C 3WFHB 1C5CH 7FABH 2QHLA 5E5UB 2GTWA 4HHAA 1PEWA 2RCSH 1KIPB 2A74B 4JN2A 4DVRH 4NQDD 5K93A 1MRDL 5F9OL 2DIAA 1CR9H 2XN9A 2EDJA 5TGBA 1CD8A 4TPRH 5ERWA 5F8RC 1MHCA 2BJML 2FBOJ 4JY4A 3ZKXB 4XHJC 2OZ4A 3TH3T 4OCRH 3RWCA 3MUGB 2XTJB 4YAQA 5C0RL 2IG2H 3OBAA 2DKMA 1JF5A 1JZ7A 5IHLB 2DD8L 4MA1B 3VG9C 1I7ZB 5HHOA 1W0VA 3R0NA 4HUWB 1XT5A 4K2UL 4LRNL 1RZ7H 5D2NC 2HFEA 3NACL 3ZDZE 4XBEH 1NEZB 1TJGH 5F7EL 2YD6A 4IMLB 1TLKA 3HR6A 4DFHA 1BAFL 4MJ5A 5DJZA 1NLDH 4XB8A 4XP4H 2BNQE 1PSKL 4YHPB 1ZA3B 2XTJE 4PRHD 2BNUA 3R0MA 1ND0B 4HT1L 1X6LA 3TPUB 4PGZA 4XMLH 3FONA 3THMH 3UTQB 1U41A 3H0TA 3PL6B 1VESA 2DQCL 2ICWB 4H1LH 1F97A 4IIQB 1RJZB 2FJHA 3U48A 4FMKA 3TJHD 4V1DD 2R69H 4CVXA 5TJWK 1NAMB 4M8QA 4Y0GA 3FOMA 3QAZB 4NBZB 4XCEA 4KXZI 1WIUA 4M43L 3V7AG 4XHJD 3O41B 3K81A 3L3KA 1I4FA 3CSGA 5I8KH 2BSTB 1MJUH 4JN2B 1KCUH 2R0WL 5AEAA 5T1KA 5IV2A 3BZEA 5JOPE 4DGVH 3HRPA 4Q74A 2H2PC 2VDKL 2C3VA 3NH7H 5I66A 1MHCB 4P3CH 3TM6A 1EHNA 4JY4B 1GZPA 3Q6FA 4LSQH 4P2QB 3T65B 2OI9C 1SEQL 3RUGA 1P4IL 1F6AB 1TCRA 3KPPA 2AK4B 4JPIB 5ETUB 1CD1B 5FUCE 1ITCA 3QWOB 3O6FD 3VXNB 4M7KH 5I19H 4S1QL 5I1EH 5MEOA 1TJHL 1TTFA 4D8PA 5EUOF 4ACPA 1QSFD 2FSEA 4CMMA 2J6EH 5KSBE 2NY6B 3VFUA 3EDKA 3IU4L 4YDJA 3C87A 5D1XB 2WK2A 4HMCA 4PJBF 4NSKA 3V4PH 3U4EA 1U8JA 4UZGA 2V2TA 3CVHH 3VXRD 2YMXL 4JFDB 5DVMA 2LAAA 1SM3H 1VFMA 2VLJD 2DQTL 3TYFA 4BSVB 1KN4H 1MAJA 2XN9E 1UM4L 4MJ5B 2GEEA 4HC1A 1V3MA 3IVKA 3R8QA 1TTUA 5IP4A 3F7RA 1QYGH 1MCWM 3HZVB 4P2QE 1FYHB 4HWBL 1KN2L 1E4XL 3LKRA 2DRUA 3TT1L 3MJ7A 1X6NA 2HVKA 1UYWL 2H3NA 4MJIB 1AQKL 1QZ1A 4R4FL 1NANH 3KNBA 4DZ8B 3GSUB 5J3HD 4PJ9C 3EJYC 2XZQH 5DMKA 4RDQF 1G7PB 1A7NL 3WDIA 4M8QB 4NKMA 5MEQA 4MDJA 3KPSD 3DARA 5IG7B 4B0MM 3SDYL 2LABA 3PUCA 3SKNB 43C9B 5GHWL 4D0DB 1BGXL 4JFDE 1K8DA 1FVDA 1FNHA 4OCYH 1OAYL 3G6JF 5GGVY 1IT9L 2I60L 2YA1A 5GSVA 4P23D 1TZGL 2AJSL 1L7TH 4N1EA 1JGLL 1DFBL 1ETZA 5C0IB 3CNKA 3RP1A 3U46B 3H7LA 1GZPB 1S7RA 2NY7L 2DIJA 2NTFA 3RWJA 5D71H 1AJ7H 1Q8MA 3AM8C 4GXVL 4JZNB 5HPMB 1I7TB 4OCXL 5BXFA 4XC1L 2N7BA 3ULSB 4X5XA 2Y7QB 2NXYB 2AEPH 3VXSA 3NAAL 3PQYA 1HSBA 3ZDYF 4HMDA 5KSVA 1S5IH 5FUOL 4D8PB 4XVUC 1A6UL 3FQRB 3G08B 4KKLC 4MA8H 4D3CL 4CMMB 5ESQB 5EU6B 4YDJB 5KVFH 1E28A 2BVQA 5AZ2L 5IB5A 4M7JH 3A67L 3OJVC 1KBGH 1I1AB 3MNVB 4NQSA 5F1NA 1I3GL 4XAKE 4ZSOA 5I1LA 3K46A 1IEHA 1X5KA 3TYFB 1MFDH 1B4JL 3MYZA 4X99A 2EDEA 3D18A 3REVA 3FB7A 4U0QB 3JWDH 1OB1A 4XCYA 4DVBA 3S3PA 2BY1A 2OMBA 5CAYB 3OF6D 1MIEL 2ADJA 1JTTA 1YYLL 1BZ7A 1CXKA 4K9EL 3P4OA 4UOW1 4U7MA 2H3NB 3S8WA 3BPOC 1YEIL 1WWBX 1Q9LA 1ZGLP 1NLBL 9CGTA 2GUOA 3SE4A 1KB9J 4HQQH 5EU5A 5EO1B 3DXAD 2P4AB 4P46A 3RPIA 4FFYL 1ZLSH 4PJDB 5EU6E 2HJFB 3VGFA 1FVCA 4L8SA 3WFBH 1JNLL 4X4XA 3FTGB 3MV8B 1BLNB 3TJEL 1CK0L 2X4NB 2Z4QA 1CE1L 4JFXA 3VXPA 1FL6A 2GJZA 2ILLA 3GMQA 1I8LC 4YXHH 4QXWA 1GHFH 3O6KL 2NR6C 1F02I 4WI3A 5BRZD 1E4XI 2Z31A 2YRZA 4QY8A 1EEZB 4WV1B 4CW1B 5A1AA 4XVUD 1ETZB 4WFHE 5CGMA 4RX4A 5J56B 2SEBA 3NFSL 1FG2B 5HYJD 1Q94B 4BUHA 3RWJB 5E6YA 1J12A 1ZE3C 1MNUH 2J88L 5IQ9A 1XGYH 3LS5H 1U8KA 1NGPH 3UBXB 3VW3L 1IKNC 3OKEA 1M6OA 4FQXD 4Z0XA 4KUZH 2Z92A 1RUML 3OGOE 3V0VB 4WW2C 3RHWK 5TF1H 4DK3A 3KPTA 4PJDE 1IAIL 2GITB 4X8JB 3RX8A 3PWPB 1T21B 1XIWB 2CDGA 3B83A 4M5ZL 3OAYH 4LEXL 5DJ6A 2QSCL 1HXMA 3MV8E 4NHCL 4X7SH 3RGVC 4X7TA 3LRSA 4IDLA 1U3HC 3U1SL 4R96B 3W0WB 4ONGH 1EO7A 4AEHH 2DB8A 5GRWA 2EDDA 2YC1B 4K3DL 4RGOH 4PRDB 1IC7H 5M94B 1Q9KA 1N26A 4XCYB 3O0RH 3T3PE 1NFIA 4NOBA 4RFOL 3PABA 3MRNB 5DMJB 4O2CA 3NGBB 2GW5A 4QRTB 2GT9B 4L3CA 3ROLB 3RTQA 3JZ7A 3BH8A 4R7NB 2JJTC 4YGAB 2FR4B 1U8MB 3VXSE 4IRJC 5IMKA 4JR9H 2NR6D 3MA9H 4OLXL 5KSUA 5EN2A 1A3LH 4M1GL 3WIIL 3LV3A 1D5ZB 2CGRL 1J0YA 3BP4B 4JB9H 4F33B 1JV5B 3MXWH 3O3AA 3E6FB 4IM8A 4PJEB 1BQUA 1HILA 2M8XA 1PDKA 1S7UA 2IMNA 2VERN 4YJZL 2Z4QB 5E8NA 2NX5B 2JIXD 3V9FA 4Z7VA 1LDPL 3PGFH 4ZSOE 1DBBL 1EFXA 5JO5B 1A6VH 1QVOB 5GS1C 5GRUL 2IMMA 4MQTB 3HC4L 3GSNA 1FJ1B 3NIDF 3ULUD 4WJ5B 4PTTA 1RIHL 2E9IA 2HLFC 4R90H 3WHXA 4A6YH 1KGCD 4ZAKC 3W81A 3MREA 5FK9B 1I7UA 3HE7C 2C3HA 5C08B 2BC4B 5A43C 1HXYA 3CFKB 1U3HD 1HYSD 2OR8A 4PJGB 3BKCL 2F58L 5IESL 4LHUB 3E6HB 2VUOA 1M6OB 2ED8A 2DF3A 5JW4R 1XGUB 4KMLB 3NN8A 4PJEE 4U1NB 1CD9B 4ODBD 1WICA 3SKMB 1U8OA 1G7QB 5LQBH 2NX5E 3ROOA 5D96C 1CFBA 1UWEL 2P8LA 3I75B 3NZ8B 1NCAL 3VGEA 1OP5K 2ADGB 3NA9L 4URTB 5D8JH 5FF6B 1NCBH 4JKPH 3MCLH 4PJ7B 1L9MA 3R1GH 3FB5A 4JY5H 1YYMH 2GAZA 5DMYA 1I9EA 1CICB 3WHE0 3I6LD 4P3WA 4YNYB 5C08E 4L3CB 2X70A 4GAGL 5FUZH 4UB0H 2WWKT 3S5LG 1YQVL 2GKIA 1IAII 1VERA 1TPXB 2EC9T 5TDOA 1U8IB 4PJFA 2CUHA 3O4LD 4J3SA 5HDOA 1ZV5A 3MGOB 5JMOC 2VTFA 1S9VB 5EN2B 1X4ZA 1T0NA 5T5NF 3LV3B 3GJFK 1OAXL 3C6LC 2X42A 2RB8A 2FX8H 1I8IA 4Y2DC 1F90H 3OKOB 4HKZA 4F7CB 3OZ9H 3SJVA 4ZAKD 3MV9B 1XR8A 5EA0H 5MEPA 1HILB 5DF0A 2DQHL 1XAUA 3MV7A 3Q48A 1R6VA 1JK8B 5I75B 1JZ8A 4CU6A 1A2YB 4XMKH 1INQA 1CLOL 1MHEA 1A9BB 4X6CA 5GGSB 4HUKB 2F5BL 5F7NC 4PB9L 4BQ8A 1F4XH 5DJYA 4AENA 4FQ1H 1M7DA 4L9LA 5FV1L 4WHCA 1BZ9A 2HWZH 5IBTL 5DVNA 5I1JH 4OUOA 3STZA 3SE8L 1ZVYA 1MCFA 2PW1B 3D85A 1ZGLA 4O58L 3MREB 1ZWIA 2OTUB 4WFGE 5DK2A 4HS8H 1JP5A 1H15A 5DSCB 1HKLL 1HXYB 1H0DB 2EDTA 1EVTC 3EYVA 4UTBL 4IOIA 1WFOA 5EORL 2XOTA 4JGMA 1CGWA 3ZHLA 3P9MA 5DQJB 2BY3A 3P9LB 1T5WB 1M7IA 2P8MA 2Q1EA 1HHKB 1WZMA 3MV9E 3IT8D 1CZ8L 3DV6B 3IRPX 1LE5B 1NKOA 2E7HA 1YMHB 4OD1L 3TT3L 4Z7VE 4J4PA 1XR9A 5I8EA 2H45A 1DBJH 3MLXH 2YK1H 3EYOB 3LPGA 3VRJA 4LSTL 1EDQA 4B5EA 2DI9A 3LPWA 5EOTB 2HH0H 3GSOB 3W9EB 3KXFB 2O5XH 1S9KC 3HC3H 3RA7L 1A7RH 3U7AA 1QSZA 5FGSA 1NDGB 15C8L 1F8TH 1W72A 3Q3GB 3BAEL 1FNAA 4ZTOH 4Y2DD 1TVHB 1GIGH 5SX5K 4JCMA 1K3IA 4NQDB 5F8QC 3MLVH 4ODSL 5L8LB 2YD3A 4RDQG 4CJ1A 1FN4B 1SVZA 3OKYA 3ZYIA 1RI8A 2I26N 1IQDA 2HT2D 4P0DA 5EBWB 3H6JA 2ITDA 4O2EA 1JYVA 1E27B 3BWAA 4Y16D 1ZEAL 2YUXA 4X9IA 4K9EC 3UZEA 1XR8B 5MEPB 1HHHA 3WFEL 1RIUH 3GIZL 5GRZA 4UAOB 4KJPD 1XGQA 1INQB 4HPOH 1MHEB 1F4AA 3P4NA 4P5MA 2HRPH 5BZWB 3ZT7A 3KXFE 3MODH 3QDAA 5DJYB 3O2VL 2VZOA 4AENB 8FABA 4UQ2A 5HHVL 4KRPC 4G8IA 1IGJB 2BOCB 4AYFA 1EV2E 1QLFB 3TIEA 3P4MA 1SBBA 4Y1AA 5EFIA 1QACA 2C1OA 2LAGB 4NQDE 2YD8A 4BUGA 4HLJA 1QHOA 2J12B 3QNZA 1MFEL 4LCIL 5JORA 3EYVB 4KK8C 4ODUA 3PE9A 4J1UB 5IVXF 4PD4J 3GIVB 2JF1A 4GMSL 4U6TA 3P11H 1FZOA 1DLHA 3SJVE 5I1HL 4IDJL 2VDOH 4LCCA 5KVGH 2VZ1A 4PJXA 1P4LA 4Y5VA 3AMLA 4P57B 3RVWC 4KGLA 5I18L 3ZLQC 4HK3N 5C71A 1BWWA 2Z91A 5GQBA 2Y5TA 4YC2C 3CVIL 4X6CE 5E99L 4JO1L 3MLUH 5F97E 4Y8AA 1FO0A 5ADPH 5EC1A 3GKZA 2DQJL 1T89A 2E3VA 4OBSA 3P30L 3MMEA 4XVSH 4KTDL 3CFCL 4XXCC 5FA4A 2ZG1A 1UZ6E 3B3IB 5BJTB 2R29L 3ARRA 2XWTA 1A14L 2UWEA 4PR5A 5F7UA 4FZ8L 3QDGA 4ZXBC 2FX9H 2IQ9L 2AJYL 3O3UN 3VG9B 5E9DA 5IB1A 5I1AB 4RWYH 1EIBA 1EUUA 3VXUA 3BPCA 2BHYA 2BVPA 2ZUUA 3MR9A 4AG4L 5D2NB 4JKMA 3B9VA 1H3XA 4HUUA 4P4RA 4NUGL 1RIVL 1OPGL 1D5XA 4EQ2A 5L9DH 5JQHC 3VXOA 1N5YH 1J87A 3V7AE 4O4YH 4I5BA 3P4NB 3HCVB 4H88H 3C8KB 2GY5A 3FT4B 1QSFB 4G7YL 2ATPA 2FO4A 1JVKA 3IFPA 8FABB 1I85C 1KG0B 3HZMA 1B4RA 2W9EH 3P4MB 5DMIL 5EFIB 4G8GD 2VLJB 5I1CL 4UT9L 3TFKC 4B50A 1KFAL 1SBSL 1JGEB 4GKSA 4NQED 4QGYA 1H8OA 3UYPA 2X4UB 1EXUB 4RFNC 1NFDF 2AERT 2EH7L 3ARDC 3H3BC 4XNUH 1BFVL 2XNAA 4QCIA 1I9JH 1CXIA 4LCUA 4EI5C 2VE6A 1V3KA 2DTSA 4I4WB 2PXYD 1PBYA 3MO1B 5DD5L 3L6FA 4E0RB 3D0LB 4JANB 3ZKQD 4QXUH 4X5WA 4JFQB 2Y5TB 4Z7QE 4HGWA 4D94A 1VADA 3K74B 1QSFE 4LMQE 4Y5YA 3FO2B 3FAWA 4YDVA 5GGUA 5IEKA 3KPSB 3MLZH 1IL1B 4CAGA 4LKXB 2OI9B 5KSAD 1OLZA 4Y1AE 4G7VL 1NC2A 3PWJA 1LK2B 2VLJE 1FG9C 4KI5C 1VPOH 1CIUA 5IFJA 3DNKA 5GS0H 3GBNH 2W92A 4TUKH 1PEZA 3PP4H 3VXUB 2WIIA 5DJ0A 3HZKB 4NFDA 1F00I 4POUB 1V3JA 4DAGL 1A4JA 2J8UF 5K9QI 1QFWL 1RVFH 4M61A 3UYRH 4KDTC 5CJXA 1Y0LA 4LAJH 3S36X 3P0VL 4XVJH 5FGBC 3KJ4C 4M5YH 3BH9A 4GRLC 5KS9B 3WDJA 1TFHA 3KPSE 1SJHA 1F6FB 3QG7L 5E2VL 2FO4B 2F53B 3ARDD 4AMKL 5SX4I 5I15H 3LQZA 3GRWA 3G9VA 4U1JA 5HGAB 3HAEG 4AM0A 4BK5A 2UWEE 1OP3H 1WVZA 1YUHA 4PJ9B 4P5TA 4WI2A 5CINL 4GKSB 3O6MH 1Q9OA 1G9MH 5D7IF 3VXUE 4TTDC 1T6WA 1R5VB 3B5GA 3C08L 4KVNH 5DXWA 2BVOB 1OTTC 2AI0L 4QCIB 4LQFH 4Y2OA 1NBZB 1R3LA 3T04D 4HH8A 1L6ZA 1SEBA 2IBGA 1GPOL 1N5AA 1A5FH 3BGMB 4LLDB 2ZSVA 3HI5H 1MJ7H 5DS8A 4ZFGL 1ZK9A 2ZCKH 4N5EC 3MXVL 5GISH 2DYPA 3GJFB 4UUJB 5KS9E 2DM7A 2DL2A 3KPOA 3H2WA 3I3BA 3LZFL 4PGCB 1VADB 1JHKH 1IEAB 5AG8A 2MWCA 5AZEL 3KPNA 2F53E 1AFVL 2DQDH 1HWGB 2F15A 2QJDA 4TOYL 4JRYB 4OF5A 3UTPD 1HNGA 1LP9F 1GZQA 2ZPKL 3CH8A 5F21B 5E2WH 2WAHA 1YEHL 5EIQA 1XF2A 1U8QA 4BM7A 4BH7A 3S34H 3BHBB 5IROC 1NGZB 4NT6A 3O2DA 3QDJA 1KJ2A 1ZMYA 5DRWB 3CMGA 2GJ6D 2E27L 3UJJL 1I9RL 5JLZB 5LCVH 3U30C 1VFOA 4HS6B 4GW1A 1NGWA 5LGJA 1QR1A 5HYJB 2KBGA 1MHHB 5E6ZA 3U0TB 4EQ3A 1A4JB 5E03A 4RIRB 3DSFL 4OZGB 1BQLL 4X7CC 2ORBL 3GHEL 1OAZH 4NWTH 4YX2L 3MJ9H 4XCCH 1I8MB 5I30L 2APWA 4Z7UB 1JYNA 4ZOEA 4ORGA 2X40A 2BSSA 4M6ML 4YGVA 3BH9B 1RUPL 1D5MA 5DT1L 4TTDD 1UB5A 3NIGF 4JZJA 1G7JB 4JRYE 3QUYD 2P5EB 3QI9D 2ZUYA 1AIFA 1A6ZA 1BJ1H 3M1BA 2C1PA 1OSZA 4EKXA 3S3SA 5IK3A 1PYWB 1LWRA 2JJTA 1X4YA 5CZVH 4AM0B 1HZHH 3BPOB 5FECA 4IRJA 3ESVF 1VKXB 1OGAA 1D6VL 3QCUL 3MYJB 3L7FA 2R4SL 3T1FB 4DTGL 2Q8BL 4UINH 3DX6B 4K3HA 5JQ6L 5IFHL 5I6XC 1R3LB 3FRUB 2WUBL 4OZGE 3TWCL 3VE0A 1KELL 2COQA 4XPHL 4Z7UE 35C8L 3VFPA 3GJFH 4O9HL 2ZSVB 4HAGA 1NDMB 5KW9L 3MLYH 1FCCA 4N8CL 4K3JH 1OSPL 3MJ8A 5T1LD 2CJUL 4ALAL 4OKVB 2P5EE 3CFDA 4WY7L 3G5VA 5JA8B 5FXCH 1QA9A 4RZCB 5GGVL 1FNSH 5CEZL 4HXBL 5C0AD 5FKPB 3VD3A 5DEGA 1LNUA 1EUTA 4C55A 1G9NL 4H26A 2JIXB 1LD9B 1VDGA 4IRSC 3QUML 1XF2B 3WDHA 3I6GA 3MBXL 3N0PB 4KUCF 4U1IA 3QNXA 3I3EA 3EYSH 3PNWA 3D39A 1GGCH 1S7QA 2P8PA 3NFPB 5K9JL 3LDBC 4WW2B 4FP8H 2DI8A 2GK0A 1FNLA 4M6OL 4Q9RH 2J6EA 2CRIA 1ZSDB 1NGWB 5TE6L 2B4CH 4M62L 1E4JA 1QR1B 3EZJB 1Z3GH 2W65A 2QR0B 3DROA 3LB6D 1MWAA 1W0YT 3RGVB 1KLUB 3CVHA 1YEDA 1U3HB 1H3UA 4W4OA 5EUOA 1FE8H 4U6YA 4KZEH 5HPOA 2ERJC 3P40A 4ORGB 2IPKA 3HE6C 4QRSB 5EZLA 1AD9B 1N8ZA 4P2OA 3B9DA 4PJBA 5JUEH 2XKNA 1Q1JL 1M7XA 5CIPA 5C0CA 2CLZB 4LPCA 1MLCB 4MB5A 4HV8B 3QEUA 2VDRL 4RA0C 3KVQA 3TBSA 2ICWJ 1UACL 3CCHB 4R26L 3WIHH 1ORQA 1NCWL 5FECB 3QDJE 5JA9A 4K7FB 3EFFB 3OJDA 3G5YB 4PYHA 5SX5H 3NCYS 1G0DA 1JNNH 3C6LA 4HUXB 1Z9OA 3RVTC 3S5LB 3NZHH 5CD5C 3FRPG 5DQ9B 3AU1A 5C0JB 2V7HB 1BQHA 5B22A 5JW4Q 5FCUH 1D5BA 4IRSD 4QWWC 3NFNB 1ONQB 4X98A 2H32B 5BVJA 5GS1B 4N0FB 5I76A 5AD0B 1SYSB 3DUUB 3STBA 4CNIA 2V5YA 4DGYL 5K9QG 4MZ2A 3G5VB 3QG6A 5SWZD 4HIIA 3ULUF 4ZAKB 1T1ZA 3G6JA 4OBRA 1OVZA 3QUXC 1JHTA 1LNUB 3HE7B 4OTXL 2VITB 1MRDH 4FQLH 1UQSA 1RZIA 3NABH 3Q1SH 4YDKH 1FNFA 5IF0A 3I6GB 3UX9B 3UC0L 4JFFA 1C08B 4NIKB 3ULUH 5INCB 3HE6D 5F1SA 2P8PB 1CXFA 2OJEA 1YJDL 5DA4A 2OTWA 3I6LE 5C0RH 5E94B 1DE4A 2QQNL 1CI5A 4P4KA 5D6CB 4QHNA 3DX7B 5D1ZD 5I1GL 5D96B 5DJ2B 2DD8H 1AKJA 3U0PA 3ECBA 1VGKA 5HHQA 1Y6MR 3MRCA 5K9KA 1NJ9A 3LKOB 4K2UH 4ZO8A 5EZLB 1ZA6A 3NACH 3GO1L 5SWQA 3MRKA 1KCKA 1M1SA 1XGRA 2XG4A 5E8OA 5C0CB 2PNDA 1RAMA 1TVDA 5F7EH 5CD5D 4PJHF 4X6FB 4Q6IC 3QQ3B 2WUCL 3ZMRA 1EHAA 3Q0HA 2O61A 8CGTA 3D39E 3MROB 1DBML 3VXQB 4XP1H 2D9CA 5C0DA 5ITFB 1GC1H 3S36L 3LN4A 3BE1H 1SHMA 2DTMH 2Y06H 1KYOJ 4D9QE 3C6LB 4HT1H 3CH1A 3S37X 4Y2DB 2VISB 3WLBA 2AJZA 4CADA 1RK0B 3AU1B 3IYLW 5F3HA 4M48L 3TA3C 4NZDA 4FQQB 5E00A 5GGTL 3IDIB 2H32H 4OF8A 3ARFA 3DYPA 3WEXA 1KNOB 2MPAH 2XZCH 1WBZA 1LO4L 2VR5A 4GLRH 1U92B 4M43H 4R7DA 1A02N 3WE6A 4CNIB 2J5LC 5C0CE 4S1RL 3SDXF 1ACYH 3TN0C 1AE6H 2R0WH 4YBQC 5C8JB 3TP4A 1S7VA 1AXTH 1JHTB 3OR6B 1SYVA 1EGJA 2BSRB 1FBIH 5IF0B 5KTEL 1YY8A 2VDKH 4TRPH 5C07D 4JPWL 4OFKA 4NZRL 2OTWB 4MQXD 4BFIB 1AC0A 3ZZ1A 3RWHB 3U79A 4RSVA 4CVUA 4HK0B 4QHNB 4S2SB 4GUPA 2VYRE 2DS4A 2IAMC 1T03H 1TJHH 5HHQB 1WF5A 1NJ9B 1F58L 4S0SD 1P9MC 1OWWA 3IU4H 4U1MB 4Z77B 2R0ZL 4BYHA 4PYGA 3L95B 3S97C 3ABZA 4BZ1L 5L2KD 2YMXH 3ZL4L 3MNZB 4FFZL 2MMXA 3TA3D 4ZXBA 4TNVK 2EDHA 2X10A 3MLRL 4XTRD 1G84A 4H8WH 1RUQL 1CFNB 5D4QA 1X44A 3QCVL 3HN3A 2IPTL 4HWBH 1ZHKB 4D0CB 4HX1A 5D70L 1N64H 2CSPA 1FORL 1PW3A 1KN2H 2UYLB 3L3HA 4QRRA 1RURL 3TT1H 4I48B 2Z9TA 3EYQC 1AQKH 3X3FL 4PGEA 3TN0D 1RZJL 3ZDYE 3T3MF 4YBQD 4PG9B 1E4WL 1IZKA 4PRID 2ICCA 2N1KA 1DN0B 3EO9H 3WD5H 2WP3O 2CXGA 3KPRD 1N59A 5C0EA 3SDAD 3LN5A 3ARGA 3NCYP 3SKUD 4Y4FA 1WBZB 4U3XA 1WAAE 3G6AB 5ALBL 1KCVL 3SDYH 4KRPB 2NTSP 1DQLL 1TVBA 1Y18A 1BGXH 5DJCA 4A6YA 3U7YH 4OV5A 4PRPD 3G5ZA 1FFOA 1OAYH 5A16B 3QUZC 5HD8C 4JREC 5BS0D 1KSRA 1IT9H 2I60H 1SYVB 5FHBH 1EJ6A 3HS0A 1HWHB 4OV6F 4GKOA 3OG6B 3HAEA 2HKFL 3DGCR 3GSWB 5F3BB 1NUFA 3TNNA 5E6IC 3QUKA 4GSDH 4LF3B 2NY7H 4PV8A 3QXDB 4GXVH 1MCOL 4NO2A 5IVOA 1WFTA 3T0DA 4NZUL 4OCXH 1G9NC 4HIEA 4XC1H 1CIDA 3BKYL 1NC4D 1YNLL 3T4AB 2ENYA 4OLWL 4ZUUA 4YC2B 3CMOL 1C7TA 4MSWA 5T5FL 5ISZA 3NTCL 5JHLL 1T1WA 1BECA 3C2AL 4E41D 2V2XA 4ZOAA 2X05A 2NW3A 2AS5M 2NY1C 2E7CA 1F42A 1JUFA 5I16A 1T2JA 5HYSG 2EIEA 2YD4A 3UPRA 3IU3A 4YE4H 4CUCA 1QQDB 1UB6B 1UWGH 4ZXBB 4YHOH 4WHTA 2G5BB 5MEND 3Q5OA 2NW2A 3EOTL 3OTTA 3PWLA 4HX1B 2H26B 5MI0C 1K85A 1MIEH 4QRRB 1YYLH 3L3IA 5KSAB 4K9EH 4J2XA 1JGVL 4KQ4L 1T0MB 4GRMA 4KDTA 1NLBH 5IHZA 5FGBA 4QTHA 1OP9A 4XCFL 4RCAA 1N3NB 4OM1L 4GRLA 4J6RL 4NO5A 1JZ3A 2VKWA 5MERA 3QRGL 3CFEA 4FFYH 4NNYA 2B1AL 2B8OT 1YN6A 5BW7C 3QFJD 5EO9A 2VB5A 3DRTB 2PW2A 1VACA 4P99A 4HWZB 4EN3C 5CEZD 3TJEH 5TQ0H 3SY0A 1CE1H 1DVFA 1DTUA 1RFDL 1FZKB 2AV1A 3CPLA 3WNOA 4Y88A 1KCSL 3DWTA 4UU9B 4R9HA 3VFSA 5IBLC 4U6VL 3O6KH 5EDXA 4MQ7B 1EHLL 4MCYA 5EU4A 4JZOA 4O5LL 2FJGB 4JRWA 2ZSWB 2BRQA 2R0LL 1IC4H 4RFNB 4KHTL 2Q86A 3ARDB 4QRRE 5DDHB 3TNNB 3SGEI 1AH1A 3AVEA 4X7EC 5KOVC 5CILL 3S4SG 4EI5B 4WUUA 1MRFL 2NY1D 3RY6A 3C5SB 2J88H 2VXUH 3CFBA 3DX9B 1LHZA 1JZ2A 1FZJA 3TNMA 3DTXB 3QEHB 3VW3H 3SO3B 4MD4B 1QP1A 2IEPA 4L4VA 3WNPA 2G5RA 1FYTD 2A77L 4MSWB 3WIFA 3B9AA 3BT2L 5DJAA 3IDYC 1YJDC 1X4XA 1DCLA 2OSLB 5DO2C 4EXKA 4LEXH 2OP4H 5F7YC 2E7LC 2QSCH 3I2CL 5EBMA 1RULL 4NQVB 1VEOA 3U1SH 1T1YB 5BVPL 4JKLA 4FXGB 4OQTL 4LU5L 2QQQA 5DHVB 2Q3ZA 5KAQG 2XWBA 3CDGB 4PRBA 2P46B 3IU3B 4PRAA 3HRZB 1EH9A 1H9VA 4GBXA 4WHTB 1KPRA 5HGDB 5I8CA 4LPYA 3FFDA 2MNUA 1EBAA 1NEUA 5GGSY 3PWLB 4U1HA 4JFED 1EBPA 3P73A 4PRNA 4YR6A 4AK1A 4EN3D 1IAOA 2EC9U 3S98A 1YC7A 1LO0L 3RL2A 4O2FB 3BZ4B 5GIRA 2H2SC 4PREB 1VSCA 4HUVB 1A1OB 5ISZE 4JO4L 4H0IA 1ZLVK 2ESVD 2GJ6B 2CGRH 12E8H 1FLRL 2J3SA 1IBGL 4NNYB 4O02L 1J8HD 4OFDA 1QPPA 5ICYA 3MFFB 2NLJB 1DQQA 4K23H 3SGDH 1VACB 5ESAA 1S5HA 4NRZB 2P24A 1JGDA 4KI5E 4I9WD 1O7VA 5EU3A 4OJFL 1DBBH 4TSAL 3S37L 3V5KA 5GRUH 1V7MH 4RMWA 2Q87A 1RUAL 5HHNA 1FNGA 5SWSD 1MI5D 4OFPA 1RIHH 1A4KA 3EDJA 43CAA 4I0PD 3UTPE 3DURA 5DO2D 4BFEA 3QEQD 3F6IA 2CXKA 2ZUTA 3OKDA 3LH2H 3I50L 4CL7A 4RBPH 1R5WB 3ET9F 5DZNA 3TNMB 2F58H 4HF5H 1X5AA 1VB9A 4TVPD 3A6OA 2JK5A 2GJ6E 4TSCL 3WNLA 1AXSB 2QQLH 5ID0A 3OG4B 1BWMA 3QIUD 2NY4C 5HI4D 5E2TL 4H25A 1UWEH 3QJFA 5ANMB 4LNRB 2Y4SA 3Q5YA 1NCAH 2X4SB 5F93C 3NA9H 1QSVA 1MFAL 1U8LB 1ZGLM 3BUTA 3QPXL 1HQ4A 2AJVH 2EDBA 5T1LB 1YEJH 1KPRB 5I8CB 5C0BD 1CGYA 1P2CA 3U30B 3SGKA 1QO3A 5D9SA 3V4UL 4NQCA 4WUUE 3BP7B 3PWVA 5C0AB 2Y36H 1IM9D 3WKML 4J8RA 2FDBP 4GAGH 1IAOB 3OL2A 1U91B 1YQVH 2IAND 1CLYL 4HIHB 5I0DA 2MCPH 3ZKND 3QO0A 3RPKA 2WLZA 2VLKA 4E5XB 4F7PB 5EG6C 3RZCD 2VO5A 4YHIB 1OAXH 2VAAA 3GBMH 1CGXA 1FAKT 2AK1L 2GSGA 5F7WC 1RZJC 2NY2C 1UH3A 2UZYB 5JXAH 4X9BA 3K1KC 1CLOH 3SOBL 3QDMD 3T0BA 3LSOA 2F5BH 4OB5L 5HDLA 1TNMA 4PB9H 2C9AA 2H8PB 3GDBA 4YBLC 5DVLA 5IBTH 3VFMB 1NFKA 2A6KB 4PRHA 3SE8H 4JJ5A 5IJKC 3FT3A 4FXKB 4JO2L 1AGFA 4I2XB 5DEZA 3V5HB 5I6XB 3OKDB 1WZ1L 3TIDB 1HKLH 5AYUL 5FYJD 5JDJA 1DQDL 1NFDA 1OCWH 3CDFA 1AY1L 4LLWA 4WU5A 3PGDA 4EUPH 4U31A 4NGHL 5C70A 1LILA 2HJKB 3WJJC 2ZCHH 4Z76A 5HDBE 1LK3L 3U7WL 1CZ8H 1YNTB 1KTRL 3JVGA 5MP6H 4OZIF 4OD1H 3FO1A 5TQ2L 3I02A 1FFPB 4CRPA 4MNHA 4IRSB 2V5SA 3QJFB 5JXEC 4QYOA 1TZIB 2M1KA 2HJLB 4LHQB 4X9GA 4HW6A 3LDBB 15C8H 1KB9K 3CDYA 3BVNB 1N6UA 3FCTB 1QO3B 5SWZB 4I2XE 5D9SB 3ARPA 3GI9H 2DJUA 2DDQL 4WFFD 4S1SH 4EEEA 3O6FA 3FQWB 5CD3A 4XWGL 5I1IL 3WS6A 1D9KA 4OGYL 2ERJB 1E6JL 3L3OB 3QO0B 4QT5B 4NUJA 3HE6B 2M2DA 2VLKB 4GW4B 1KJVA 3D87B 3LD8C 4S11A 2FECL 1PGRB 1ZEAH 3W11C 4E42A 2ITCB 4N90D 1MHPH 5F9JA 3VXRA 5IIEB 2EXWC 2BVYA 3GKWH 3BD5A 2H9GA 4GJTB 5J6HB 5C2BL 5TH2B 3O2VH 3I6KB 1RK1A 4ELMB 1AGCA 5SWZE 4BH8B 1TMCB 4XPTL 3T0ED 2NY0C 1QFUL 3UROR 2CRYA 2MHAA 3MBED 2IALA 1S9WA 5D7IA 4MX7A 1KIRB 4UOW0 3SEPA 5IB4B 3GM0A 1MAMH 4DN3H 3IGAA 5JXED 2VLKE 4WU5B 2HT4C 5HHPB 2DBLL 3BYTA 4WHDA 4YFLI 1GOFA 4GMSH 2ZOLB 3RU8L 4WFEE 4I13B 2X1XR 5I1HH 3RWFB 1U2HA 4Z5RA 3RL1A 3MOBL 1ZT4B 3VFNA 2YWZA 3QUXB 3TVMC 1YQ2A 5BOZG 1G6RA 4M00A 3CVIH 2CMRL 5CSBA 4NM4H 5E99H 4JO1H 4N9GB 2D0FA 1V7NH 1BBJA 2UVFA 4QYOB 2DQJH 1INDL 1U8NA 2W60B 3B5HA 3BUYB 3S35X 4ELME 1LP9A 3RWIA 3BO8B 1YPZF 5DTFB 5D1QD 3CUPB 1P7KB 1IKFL 5HDQL 3CFCH 3BQUD 3MUY1 3V0WL 4IRZH 4F9PC 2OM5A 4JHBA 5IHUH 2X89D 5K9OA 2GI7A 1A14H 1RSFA 2EXWD 1LE9B 1U9KA 2IQ9H 3MJ9A 2AJYH 2IAMA 4DUVA 4ZPVA 5DR5L 4Q0XL 5C07B 5GGRA 1XGTA 5FA3B 4PJCF 3V5DA 4AG4H 4F7TA 1KTLB 1CDYA 1NL0L 2NY0D 3G9AB 4ZUTB 4NUGH 4OSUL 1RIVH 1S7XA 2AVGA 1OPGH 3B2UD 4JG1H 4APQD 3ZYZA 1N4XH 2YPLA 4Q6IB 3DYMA 1PQZB 5DD3H 4HFWB 2H9GB 5B3JF 1K6QL 3BP5B 4TYUA 4OLZL 3L9RA 4EI6A 1R3JB 5HYSA 3VFRB 1Z9MA 1MCCA 4Z78B 1S7SB 4NCDA 5IFAH 4UV4L 2FHCA 2ED9A 1O0VA 3ZO0A 5DMIH 5JW5B 5ESVA 3T8XB 3DBXB 4C83B 2HN7A 4Z95H 5ABDE 1LEKA 4F3FA 2V7NB 4UT9H 2CK0L 3O8XC 3TA3B 1NCDL 4YXKH 4HUMB 1KFAH 1JHLL 1SBSH 4NCC2 5C07E 2GFBB 3D25A 5H37G 1X5JA 2R1XA 2CKBH 4O51B 5K59E 1BFVH 2OZ4L 3D2UB 2CO6B 2X7LB 4AEFA 3IDMB 1QOKA 2J5LB 5CBEB 1MCPH 4Z5RB 3H3KA 3L3DA 1RMFL 4L4TD 2J8OA 3HPLA 3O9WC 2KQMA 5DD5H 3TN0B 1KJMA 3RY5A 2W91A 4L8DB 4ZS6C 4XGZA 3QUZA 4MD5A 1DP0A 4S0TD 1L0XA 4PRIB 4ENEC 1R24A 4GW5A 2KDGA 3KPRB 5BRZA 2JJUA 3SDAB 4KVCH 1HYRC 2WQRA 1XF5A 4IMKC 3MCKA 4K8RL 5E6IA 5B4MC 4S10A 2R2BA 3EAKA 3PDOA 2VXSH 2WBJC 1GAFL 1P1ZA 4G7VH 3WL9A 4WRLA 1QSEA 5IW6B 3MRHB 4XPAL 4PRPB 4YDIL 4YHLL 3L3JB 1AR1D 3BPLC 5D7IE 5BS0B 1QNZL 3FQUB 4KQ3L 4OUUA 2FRGP 3OXRB 1AQDB 2IAMB 4Z7WF 3S4SA 4FQXA 1G7LB 4ZPVB 2F74A 1L0YA 4HWEL 1RZ8B 2D7NA 5INDA 2D0HA 1A6WL 4F7TB 3QO1A 4YHML 4DAGH 3D69B 1MCDA 4QHKI 1QFWH 1WT5A 1SJEB 4QOKA 5DVKA 2IH1A 4PRIE 4AT6B 1A21A 5C6WH 2YPLB 4M1CC 1V3LA 2V9QA 3KPRE 4MGXA 1NUGA 1T7WA 4ETQB 4KDVA 4LLMA 3DIFB 2B0SL 3IFLL 1P5VA 3TBWB 4UNVA 4YHNB 1UJ3C 3GB7B 4GH7B 1OF2B 3HI1A 2H1PH 4AMKH 2XRAH 2ATKA 1OOAA 4PRPE 3GNML 4DKAA 1JRHH 4GG8A 1UVQA 3QZWA 5E70A 3RIAF 3QFDA 4TULH 4ENED 5CINH 2HFFA 2G9HA 4HFUL 4JDTH 3JV0A 3L5WB 1KXQE 4LDEB 3BIKA 4IHOB 4AIZB 3C08H 1K4CB 5BMFL 1GGIL 2AI0H 3BKJH 3S96A 5B4MD 2VDQL 4JFOA 2J2ZA 3ARQA 4R6UA 1KEML 2WBJD 3IXAB 4NJ9L 4XBPB 3HPLB 3SDDC 3X11A 4DGIL 3MA7A 2X09A 2YPLE 5D7LD 3ZTNL 3PHOB 3QUZB 4LSDA 4JREB 5C7XL 3MXVH 3ZSTA 3LZFH 1JNHA 3LKNB 1B0GA 5MHSE 3GI8H 1AFVH 2WLYA 5CJQL 2DM3A 3IETB 3VMOA 3QFJB 5E6IB 3NPSC 2ZPKH 4G3YL 3Q2CA 1A7OH 4I77H 3UTTD 4WI9A 4RQQA 2JB5H 1RHHA 3DHMA 4YLQT 3QUMB 1TITA 2A6DB 5DEFB 2XQBL 4M1CD 3NA4A 4HC1L 3S4SB 2NY5L 3UJJH 1I9RH 5DD6A 5A40E 4JN1L 2BCKA 2B20A 4KJWD 3T09A 4Q7DA 5A2JH 4Z9KB 4EBQL 2GJJA 3ULVL 1UKSA 5HVFB 4WHYG 3VU2A 1GCFA 3QO1B 1Z0MA 2NY1B 5JIPA 5TE4L 1BQLH 2YEZA 3UEZA 4PLOB 2A6IA 1XF4B 4QOKB 3V8OA 5C9JA 5I30H 3ILPA 5D7JC 2UUDK 1FYTB 4QRPB 1M4KA 4WTZG 3DV4A 3ILQC 1RUPH 2H6PB 1R3HB 2KZ1B 4LLMB 5DT1H 4M9OA 3T2OA 3UTSD 5KZCD 5JNYA 3B9KD 3QFJE 5ADOL 4PJHA 5DK0A 3HI1B 2VZUA 5I1DB 5MI0B 4LLAA 3VD4A 1EZVY 1QSEE 2PR4L 2ZUQC 2IFGA 5T3XD 1LEGB 2HFGL 1FNEB 4RAHA 4GRWF 2C3WA 4QRUA 1A22B 4R3SB 2AABH 2ICES 4LCWB 5E08L 1D6VH 3O4LA 4M6AA 4DTGH 1J05A 2Q8BH 2XA3A 3RWDA 1H8NA 3W39B 5L7XH 3IS0X 2PN5A 5DRZB 3ORJA 5IFHH 5JPNA 4X0KB 3FFCD 4OT1L 3TWCH 1JRHI 1KELH 3KYMA 4KJYA 4QOKE 3B6SA 5TE7L 4NO0A 4EN3B 4UI2A 35C8H 2DWDB 3X11B 2APVA 3MA7B 1FYTE 4O9HH 4QRPE 3ARXA 5FO9A 5A3IC 4FFVC 3LMJH 2VQ1A 5HGHA 3DPBA 2VLLB 5IUSA 5KW9H 4ZO9A 1X5HA 3C6SB 4G6KL 4Z7OE 1OSPH 2XA8L 1JNHB 3U9UA 3O6LL 3WUZA 4LOUD 2ESVB 2CJUH 4ALAH 5CEYB 3SDXA 4WY7H 1HSAA 1QUNA 4H20L 1GGYA 2D03L 1II4E 1J8HB 5GGVH 5ICZA 2D9QB 5CEZH 2EYTA 1XH3B 2R1YA 3V6OA 2DKSA 4PJAF 4JPKL 2FIKB 5DRNB 4KKNA 3MSPA 1MQKL 1NAKH 4PTUA 1JTPA 3T4YA 3V6FA 3OJMB 2VL5B 3QUMH 3MFGB 4LCWE 3AY4C 1VFBB 1EK3A 3OSKA 3TPKA 3VRLF 4G6FD 1XF3B 4DOHB 3P0YL 3KYNB 5D7JD 5GJSH 3L1OH 2V2WB 4F7MA 5SWSB 3AREC 2E8YA 4M6OH 1B2WH 4MA3A 3IDYB 3IF1B 4M62H 4PJ8A 3QEQB 1HE7A 4HGMA 2FB4L 5HBBA 3S35L 3WUWG 3OKNA 1T22B 2YEZB 4F9LA 1NBVL 1U0QA 5C9JB 4L1DA 2EO9A 4D2NA 5C6TL 4J23A 1UCTA 2ESVE 3KYOA 3DGGA 1ED3A 2WNGA 1J8HE 4XNQB 1DLFL 4YHKL 2W0FB 5JIKA 5I8OL 5DK0B 2WZPD 1T2QL 2BMKA 3FQXA 4UDTA 2R9HC 4G6AC 3ARBA 2FATL 2AKRA 4FQJL 3MRRB 1J0JA 5LKNA 1AI1H 1BHGA 4R26H 1CG9A 2CR3A 3V52L 4EZMA 2YWYA 4BKLA 1FCGA 1XCQA 4N0CC 4U1LB 5SV4A 3LQAL 4FFVD 5SWSE 5F1KC 3D9AH 5T1DL 2BVTA 5C0BB 1WWWX 2BNQD 2UVEA 3WMSA 2XTJD 4U0RC 3R06A 4FQ2L 2FL5A 3IFOA 4F7EB 4Y16A 3T2QA 3SKOA 4KJYB 3W9DA 4MNQA 5E8PB 3QP3A 1NBYA 2P7TA 2IANB 3VXMA 3G5XB 3HUJB 4UIMB 1FL3A 1F11A 2X6MA 1KLFA 5GJTH 4QHLA 2EDRA 4PJHE 4DGYH 2XKUA 3M17B 5DI8A 5CZKA 1P7QB 3HLAA 3J8F7 4N0YL 3TO4A 5FFLA 2CDFA 4OTXH 4PTUB 3O3DB 3QDMB 5DZLA 1T7VA 5JOPD 4ZTPL 1ADQA 4XWOD 3K8MA 3BD4A 3H9SB 4FNLH 4NKDB 4F7MB 5DQDL 5C0BE 2IGFL 2VXVL 1IRAY 3EJJX 3QXAA 4K8RC 3BW9B 4MA3B 2QQNH 2RJMA 2NZ9C 4UV7L 4MXWH 3PL6D 1C5BL 4JRXD 3MRMA 1M71B 2D2OA 2CUIA 3HUJE 3CFJA 4TVPH 3I84A 2K7QA 4N0CD 5IEHB 1Z9SA 4DW2L 1RJYB 2NY3D 3SCMA 3CXDL 2OX5A 4RAVA 5L8KB 4BFBD 1T3FA 3GO1H 5LBSH 1BVZA 1QFPA 4NN6C 2E8ZA 4LKCA 1Q9WB 2HVJA 5LJYH 1W0WA 2WUCH 2G60L 3MNWB 1JPGB 2A6JA 1DBMH 2XN9D 3H9SE 4PY7A 4UBDC 4RNRA 2AQ2A 3GSNL 3S36H 2FJFB 4OI9A 4UNUA 2Q76A 4HCRA 3KWWA 2D31B 1NUDA 1JGUL 3ZE2F 4QEGA 4M48H 4KC3B 5JZ7D 2MTPA 1HI6A 4ODWA 1R3IL 5IR1B 2HKHH 1ZKAA 2GY7B 1LO4H 4WW1A 2CIKA 4YBLB 3ZE0F 4CVZB 4S1RH 1ZAGA 5ILTL 1FC2D 3TCXA 1EAPB 1UWXK 1ZS8A 2NZ9D 3BEVB 4XH2B 4QKXB 1H5BA 4N5UA 4P2YA 4CN1A 2YN5A 4G8GA 3ZT6A 1BM3H 3L5XH 4NNXA 3MRQB 4NPYA 4JFZL 1CL7L 3CK0H 4JPWH 5IW1B 3GMOA 1U93A 4NZRH 5CP3A 5DUBA 1IE5A 4NFCA 1PG7H 3QXAB 3T0EB 2NZIA 1HOCA 3T3ME 2CR6A 2DLIA 4GFTB 3EOBA 1S3KL 4MDIA 2PXYA 1XCTA 1S7WB 4ZPTA 2J4WL 2VWEC 4LPXA 1NGXB 3C5JA 5FYJH 5IMOB 3TVMA 4P2RB 1FZMB 1C1EL 3LOWA 2P48B 4XPBH 3T0XA 3VMPA 3T0VA 1F58H 1SY6H 3VI4E 2NY5C 4UBDD 1LVEA 4LARL 5T3ZL 1JN6B 5EUKA 3ULVC 1CFQB 1QLRA 2R0ZH 3MJGX 3RWEA 4OZHB 4YFDB 4BZ1H 4NRXA 3ZL4H 1Z5LB 1I9IL 4FFZH 1HIML 4YUEL 4BELD 4MCZA 3CJJA 4NC2B 2AXJA 4N1HB 4KK5D 1L7IL 4R4NC 1CDJA 1RUQH 4X8XA 3HA0A 4PY7B 3QCVH 2IPTH 1OD7A 3VFVA 2R23A 4JG0H 1FORH 1CFTB 1IAKA 1RURH 2IBZX 3LD8B 4QXGL 5FV2A 1B6DA 4JDZA 4PS4L 3RVXC 1KB5L 3QIBA 4JGJA 4HZLA 3BQUB 4NFBA 3X3FH 3U36A 2Q76B 5GSRB 5BQ7A 2OK0L 1RZJH 4P2RE 5BZDA 3PHSA 2VMFA 1E4WH 5C0NC 5EIIA 3TBYA 2NXYD 1I3RA 4P5KA 4JM4H 2OQJB 3MRPA 3RNQB 4WI8A 3IJYA 3V4VH 4AL8L 1RU9L 3MRBA 5ALBH 2CIKB 1KPVA 4ORZC 3JUYA 4OGXH 5EU6D 3F7YB 3SO5A 1DQLH 2NY0B 5JIHA 2JELL 1QFHA 2YSSA 1ZS8B 4G8EB 4JVPA 4APQB 2DMCA 4YDLC 3UZVB 1UXWA 2X4RB 3HNVL 3O8XA 1BVLA 5F7DA 3RNKB 1ORSB 2EXYC 1C12A 1HHJA 2ADIB 1UXSB 3MRJA 4R4BB 1HEZB 4RAUB 2QKIB 3H9HB 4UILL 2FO1A 3GMOB 4PJIB 5JW3L 3JV5A 1MCIA 1W72L 4WFHD 3BXNA 3K80A 4NZUH 2AJUL 1JL8A 3O9WA 5DJDB 1YNLH 3C5JB 3V8CA 3TVMB 4OLWH 2Z35A 1A9EA 2VABA 3CMOH 2VIRA 5JOEA 4NYLA 3QA3A 5T5FH 1JFQL 5J7CC 3JTTB 2CLVA 5JIIA 3NTCH 2ARJA 5JHLH 4MNGB 2AV7A 4XRCB 2Y6SC 2VLRA 3K8LA 2AXHA 2HTKC 1FIGH 1ZLUK 4JQIL 2XICA 1HHIB 3IDNA 1HH6B 2NPLX 2G2RB 4TNWK 5DGQA 1ITBB 2DQFB 1CXEA 5C0ND 3DX8A 1JWSB 1OTUC 4JFHD 1KCRH 3SE4C 2IFFL 4P46C 5I71C 4LBEA 4CJ0A 1VA9A 4ZUSA 4PJIE 1JMXA 2YOCA 4X6DF 4L8SC 2IADA 2XXMB 5EPMA 4OLVH 5C6PB 5T33L 4JDZB 2VH5L 4OQ1A 1JGVH 3CZFA 3HI6H 1MAKA 3ARSA 4KQ4H 3VD7A 3V6ZA 1WCBA 3PIQA 3PV7A 4XCFH 2QEJA 4HKXA 4YHZL 2J1KA 3VXSD 1I3RB 1CCZA 3LQAC 4XB7A 1FGVL 4AH2A 3PQYD 4J6RH 2EXYD 2Z31C 3MRPB 3QRGH 4MNGE 5DUPH 3HZYB 3O3BB 1UJ3A 1J86A 3OKLA 1YMMA 3DRQB 1XIWD 3EOAA 3QUYA 2EKSB 5HYQA 3L7EA 2UUDH 4P3DA 2EKJA 4OD2A 2R0KH 1O5DT 4WTZA 2BVEA 4FG6C 2A9NL 2NNAB 1MCBA 3KPQB 5LXGH 3MRLB 3VFOB 2BNRA 4L8BA 3VI3F 4CVWA 2FHFA 1EHLH 1FO0L 4O5LH 5F7LB 1C12B 2YKLL 3LS4H 2R0LH 1ZTXH 3RVUC 3EDFA 4JM2F 2Y6SD 4KHXL 2HTKD 5CILH 1BIIA 1MRFH 1E4KA 2ICEA 4NO3A 2BVUA 1UKQA 2CK2A 2OYPA 1MCHA 3SDDA 3O9WB 4GG6F 3B4NA 3VGHA 3MGTB 3V6BR 4X80L 5HYFA 1A9EB 1BD2A 2VABB 3EDDA 4FS0A 1OTUD 1F45A 1L6XA 1UG9A 2YZ8A 3SBWA 1VGEH 2I5YH 3ZYOA 5D2LF 2JE8A 5J8OA 5ACMA 5C0FA 3LRHA 1MH5A 3I2CH 1U2CA 1B90A 3RTQC 2M26A 3EYUH 2CKNA 2WBJB 1KYOK 1X3DA 3AB0B 3OHXA 1KIUA 4ODVL 4PBXA 1UEMA 3GSXB 5BVPH 4OQTH 5ACZB 4LU5H 4C56B 1TCMA 3BPLB 2RFXB 3VFWA 4F2MB 1DEEB 2DM2A 4A2LA 1GGBL 5JPMB 3IDGA 4HPYL 3FL7A 2AEIT 3CSYB 4LBEB 2DQIL 1C16B 3F5WA 1X9QA 5A2KH 1BREA 2I25N 5DC0A 4BQ6A 1G7IB 1DQJA 4PP1C 1LO0H 3OXSA 1KIQA 3HMXH 4WCYL 4BZ2H 3UTOA 4NHUA 1AHWA 4JO4H 2WWKO 1J1OL 2EE6A 4JVUA 1NMAL 4QO1A 4O02H 5KN5A 1F3JA 3EOAB 3RVUD 4LNVA 4LLYB 3FAXA 3QRFM 1FSKC 5EZOH 3FO9A 4C56E 1VFAA 1G0XA 3X12B 4OJFH 4TSAH 2EIZA 3GGWB 1FQ9C 3S37H 2DLHA 4HXAL 4L8BB 4S1DC 1RUAH 1FGNL 3FN0L 4WWID 5EZJB 1MFBL 1OW0C 3F65A 3HPJB 4ZNEE 3UO1L 5KZCB 1NCCL 4XPGL 4WU7A 1WTGT 1PZ5A 3AAZA 1CDUA 1ODAA 3ZKMC 3KHQA 1CDBA 3E0GA 1MCJA 2WWMC 4EDWL 3RTQD 1KTDB 3D0VA 3I50H 1QBAA 4NO3B 4RFEA 2GK2A 1A1NA 2UZXB 2EYSB 4KJQC 3SDDB 4WFGD 1BPVA 4XBGA 3VXTB 4ODXA 3N85L 4KZDL 2OTPA 4RGMB 3J7HA 5F96L 1A6TA 3UAJD 4U05A 1YMME 2H41A 3B43A 2JJSA 2UV3A 2ID5A 3U2SA 5E7FA 3GMMA 4JFYB 1BFOA 2R2HB 3MV9D 4LSRH 4PV9B 3NPSB 3IDXH 3GJEA 1PLGL 1UZ8B 4NBYB 3DVNB 2BNRE 4AQ1B 4LSVL 2X4PA 4ZMAT 1BZQK 1R3KA 3I9GH 4G8FA 4N8VG 2FWOA 5FOJA 1ZLWK 2B1HL 4PGDB 3IDGB 1RPQA 3AREA 4NKOA 4M7LT 1MRCL 3OAUL 3WKNA 4Z8FL 3V4UH 3K8KA 3H7BB 1BBDL 4OLEA 2ZUSA 3WFDH 3CIQA 3GRWL 4HIJB 4J3VA 4XP5L 3WKMH 1EMTH 4IS6A 2WINA 5D1ZA 4YPJA 1KIQB 2E6PA 5HJ3B 1BD2E 1RZFH 1KXVC 2X4OB 4PJCA 5F88B 5D7JB 3HFML 1Q0XL 1QLEL 5E8DL 1S8DB 1TDQA 4DCQA 5JHDA 3WUWB 2EZ0C 4ZFZA 4L9LC 4QHUB 3GUTA 3NCEB 2Q7NA 2AK1H 4NRYB 1XZ0A 1C5CL 5L88H 3ZKMD 3LEXA 2O93L 2ZUQB 2WWMD 1J0HA 2RCSL 4G43B 4BSWB 2OL3H 4KJQD 3KLAA 1UM5H 4TTGA 1OL0A 1CR9L 1NBQA 3IXTA 4A2MA 2CKBA 1OLLA 4WU7B 2GYSA 4YXLH 2F54A 4OCRL 4WDIB 5T3XH 4G9DA 5KVMC 3RDTA 4Q2ZA 3PJSB 4YZFE 1WZ1H 5CJBA 3ZHDA 4J4PC 1CQKA 3RGHA 3IDJA 5AYUH 1VEPA 1DQDH 2DQGH 1CVRA 5FM4A 4YPGA 1AY1H 5FO7B 3O2DL 1KJ2L 4U3CA 5DYOA 2LTQC 3RX7A 2NYYC 3DMMA 3C5ZC 1I1FB 5B39B 4G6JH 5HGBA 3FB6B 1OY3B 5T3ZD 4HDIA 2P44B 2BNQB 1RZ7L 2Q3AA 4NKQB 1CN4A 3U2SB 3MRIA 3P4LA 1DUYA 1JWUB 3GMMB 3SJVD 5IKCA 3ZDXE 2JB6B 1TJGL 3RAJH 4HKBA 2X4PB 3EJZC 4LSSL 1UWXH 3QIWA 1NLDL 3AREB 4YO0A 2EZ0D 4XP4L 4NKOB 4XPFH 3RI5F 1MUJA 3WS3B 1G7HB 4F15C 3ALXA 2DDQH 1NGYB 1CF8L 3N50A 3D85D 3LPFA 1J18A 2YD7A 4Z7WA 3PXHA 2DBJA 4XWGH 2C7UA 3OAZH 1QR4A 2O5ZH 1E6JH 4WEBL 1QRNA 2R69L 5GRXG 3WNKA 1I8KB 3QH3B 4MJ6A 4AIXA 5CUSL 5E4IA 4YWGH 5JHDB 3ZE1E 1RJLA 3HB3D 4GMTL 2IH3A 5CEXB 2P49B 1OAKL 4JRXB 4WO4C 3SN6N 5I8KL 3L3GA 3ZDZF 5C2BH 3FQNB 1EX0A 2NY3B 2NYYD 5B38B 4ISVA 2Q20A 3NH7L 5KSBB 1I75A 4XPTH 1QFUH 5J4MA 4U0RB 5D5MA 4LCCC 2GTWB 4Y5VC 4HHAB 3LKSA 4DK6A 2VDNL 1OWRM 5GS2D 4FABH 2UZIH 4N0UA 2XN9B 2W9LA 1P84K 4YPGB 1DQTA 5TGBB 5ERWB 3IAPA 5DYOB 5JHDE 5TDPA 5H35A 1CXLA 1T89C 1T2XA 5F1IA 2BZDA 2FGWL 1EERB 2J6EL 5IOPA 3RWCB 3CGTA 3MOBH 4YAQB 3X17A 5GGRY 4JRXE 4ONHA 3IDUA 1MWAL 1FFRA 3P77A 3CVHL 3E3QC 1MIML 1SM3L 2WBKA 1KN4L 1HH9A 2XPGA 3MACH 5HHOB 3GMNA 3PDDA 4OCSL 1INDH 1W0VB 4ERSL 4LASL 4V2CB 1QYGL 4HJGA 1DUZA 2HFEB 3KJ6L 5IMLA 1KT2A 4JLRA 3V0WH 4Y1AD 4ZS7L 2VXQL 4B7IA 4KI1A 1NC4A 2QHRL 1WJ3A 5E2JA 3CX5J 4U1KA 4XP6H 5DR5H 5DJZB 5T1MA 4YBHA 4K07A 2PUQT 4E41A 2FGZA 1P7HL 2BNUB 1NL0H 3VCLA 1MEXH 1KC5H 4NN6B 2A73A 3CSPA 3FONB 4EVNA 1RJCA 3H0TB 4OZFG 3L3GB 1NAMH 2FJHB 4OCYL 5DMGC 4CVXB 1ZLUH 5HHOE 4L3EA 4MQSB 3FOMB 4I3SL 3QEGH 4OLZH 2H2PD 5MENA 4MXVF 4XCEB 2Q6WA 1OARH 3DI2B 4XZUA 5BV7L 4K94L 2VSDA 4XNZC 3B9EA 4OKDA 3L3KB 1I4FB 4HUNB 4MHHI 5D5MB 1AJ7L 4M4RA 4KK6C 1A3QA 3DLQR 1AGDA 5IV2B 5T1KB 2F9BT 3BZEB 1NCDH 4MB3A 4M7LL 5J12C 5JOFA 4Y5YC 2C3VB 5I66B 2XWJA 1S5IL 2HLAA 5TDPB 3VXUD 2OZ4H 5E5MA 3Q6FB 4MA8L 3VFTA 1FHGA 2VDML 3RUGB 3BN9C 2V5TA 1RMFH 3Q5TA 3QSKB 1TCRB 3KPPB 3VDBA 4ODTH 4M7JL 3KS0J 4X7DC 2ZCLH 1U3JA 1A64A 3I85A 1MFDL 3HNSH 5MEOB 2FSEB 4WWKA 3JWDL 4PJAA 1DBAL 2F53D 3VFUB 2Q8AL 5LG1A 1AD0A 5D5ME 2APFA 1QEWA 2VAJA 5DURB 4XPAH 4YDIH 4NSKB 3OJ2C 3U4EB 1U8JB 2V2TB 4YHLH 4H5SA 4DKFL 5CJXC 1D6EA 2PKDA 2YD5A 4KQ3H 2V17H 3O81A 2VN7A 4N0UE 4PJ9D 3EJYD 5DMGD 4U1KB 4JEGB 3IVKB 2VR4A 4HWEH 3WNMA 1A6WH 1BX2A 1A0QL 3FO0L 4NZJA 3RUGE 1I7RA 1ZLSL 4CBPA 3LKRB 2V6HA 2FYYA 3MJ7B 2E9BA 3WFBL 2HVKB 5A2FA 4KK6D 3KNBB 3MOAL 4LSPH 5GXBB 4P5TC 3BIAX 2PCPA 4Q58C 5DMKB 2EDQA 2WMPA 5F9WC 4P9HC 4NKMB 2B0SH 5H8DA 3KDMA 1B9ZA 1A6AA 1J9CT 3KPLA 1K4DA 1LO3L 4JKWA 2KQNA 5MEQB 4MDJB 1QKZH 4FQPA 2FHBA 4JRYD 1F3DJ 1NANI 3ES6A 4KV5E 1NC2D 2VWEE 4PGBA 1K8DB 1FVDB 5KVDL 1U42A 3KAAA 3LS5L 4KKBC 4OCMC 1UEYA 1EGJL 1OQOA 2QBWA 1FRGH 4HFUH 4HIXH 5GSVB 2MQ0A 1H3PL 2ARJQ 4Y4HC 4KKLD 3ULVE 3BEWA 4JY6A 2OR9H 2VDQH 1S7RB 3VMNA 2NTFB 2ENSA 1WITA 4FTVA 5BXFB 4X7SL 4DGIH 1KPUA 5IB3A 3EZ8A 3RIFF 4X5XB 4YDLB 3VXSB 3PQYB 1HSBB 2WV3A 2EC8A 4AEHL 3U4BH 5KSVB 5E8EA 4M03A 2VLME 3EFDH 1T20A 2DI7A 2P5ED 3O0RL 4I0PA 4DWHA 1E28B 4G3YH 4M02A 4GRWE 2BVQB 5IB5B 4ZYKA 1YDPA 4HJJL 4PY8I 4OFYA 4XC3H 4JFHE 4NQSB 5F1NB 5I1LB 4ZSOB 2YBRA 5C09A 2XQBH 4K7PY 3MLWL 4P5TD 4X99B 2IQAA 2JLLA 3D18B 3REVB 3FB7B 1OB1B 4JZJC 4DVBB 3N1FC 2XACC 1A3LL 5AG9A 5C3LD 1BX2B 4YIQA 5JW4N 4JB9L 4HLZH 2ADJB 1BZ7B 3QQ9C 4PJDF 5TE4H 3P4OB 2G75A 1Q9LB 3O2WL 3PGFL 3PQYE 4KKBD 4N9OB 2GUOB 2YPKA 4Y8DC 1A6VL 2DYPD 2E7MA 3PWUA 4DZBA 5EU5B 2YN3A 3QWRD 1BFTA 1G7MA 4JO3H 3FN3A 4P46B 1A6AB 3QYCA 4WGVB 5I71B 1DBKL 2VDLH 1WUNT 4M1DH 4XNXL 4JVWA 3RPIB 5ADOH 1D5IL 1FVCB 4L8SB 4N8VA 4R90L 4K55A 4NZTL 4A6YL 2NMSA 2PTTA 2I9LA 4X4XB 2HFGH