5E9DE

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMAWYRQDPGMGLRLIHYSVGVGITDQGDVPDGYKVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGWMAGGVELYFGPGTRLTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 115
sequence length 115
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dE00
1FZMB 5GS0D 4MJIB 3QEQE 2DRUA 4Z7UA 5LCVL 4XP4H 2BZDA 5AZ2L 3ZTNL 4RA0C 2PYEA 2B0SH 4ZS6C 1B4RA 2XV6B 4M7ZC 5E00A 1H8OA 5IFJA 2NY0C 8CGTA 5GRUH 4DN3H 4WFEE 4XPGL 4IMKC 3RJQB 4LSTH 5CKGA 3ZKND 2UZIL 4Z7VE 3L7FB 4ELKB 4OCNC 2E9WA 5IR1B 2XQYG 4FQHA 5DQ9B 1BZ7B 2MHAB 4OM0H 3QO0B 1I8LC 2EICA 4RAUA 3OBAA 4XPFL 1WCBA 4KKAC 3EFFA 2QSCH 3TZVA 5GRZA 2KZ1B 3HNSH 5CBAA 5HTSA 4FFZL 4W4OA 3JTSB 4P5TA 3PHQA 1M71A 5CMAA 4XCEB 3LN5B 4PLKD 4XBPB 1ZKAA 4U1LB 4KAQH 3HTLX 3MCLL 4ODHH 4ONGL 4R8WL 1CDHA 3U7WH 4J23A 4UU9B 2AJUL 1HN1A 1NH6A 4KTEH 4PGBB 4H8WL 5FO7B 3V8CA 3O4LA 3WBDA 3FFDB 1C08B 1FGNL 4GXUN 5H2BB 3VXRE 4V1DB 4HFWA 3WL9A 1A7NL 4XVJH 1LWRA 3REVB 5F3HB 5C0AD 2C4XA 4POYA 4M1DL 3HZYB 3N50A 4JFFE 4MJID 2G75B 2D9QB 4QXGH 1NBYB 3WFZA 4QYOA 4LDOB 3MNZB 2Y25A 4JO2L 4ORGB 3SGDI 5DC0A 1NCBL 1E27B 4RZCB 4KHXH 3X3FH 2UVFA 3QPXL 4S11A 1T89C 2JE8A 5I18L 5EZLB 4XBEH 4NT6B 4U1MA 5IEKA 2J8UA 5FECB 2OP4H 1A7OL 3P4OA 4GW5A 2BNQA 4YFLI 4UNUA 4EOWH 1AJ7H 5D2LF 3W5NA 4MXQC 3MA9L 4M61B 1OAKL 3D6GA 2OTWA 5CHNA 4KY1L 1WBZB 4U0RC 3LKNB 1XH3A 5I16B 3EYFB 4GRWE 4UIMA 4BK5A 1CFNB 3REWB 5EC2A 1QLEL 1QEWA 2F19L 3BESR 3RZWA 1VB9A 2ZWLT 4YBQC 5B38B 5D4QA 7FABH 2P5WA 1AP2A 2EIZA 2CLRA 1UJ3C 4MAYB 5FO8A 3MUY1 5IJVB 4CMMA 2VKXA 4PP2A 4V1DD 1XIWB 3QHZL 3JUZA 1QOKA 3UJTH 5FGCE 2QHRL 3KGRA 3FHAA 4C56A 3T65B 1JNHB 1U95B 1DQDL 5CS7A 2X05A 3D5OF 1TFHA 4FG6C 1N5AB 5D7IF 1AQKL 5K9QG 2Z8VC 2DQFA 3LAFA 5SX5H 1JYVA 3SN6N 1A0QH 1FNGB 3KLDA 4HLZG 1IMHC 2V17L 3DRQA 3TO4B 1NDMB 1AGCB 1YN6B 4WI6A 3D1MC 2QSTA 3BW9A 3OG6B 4L4TA 4WWKA 4JKLA 3V6ZB 3CUPB 3WJLA 3MV11 5HI3D 3V0WL 1DVFA 1KIUA 3CXHK 2X4NA 3I2CH 2H26A 5H94A 3K7UA 1GZPA 2DMKA 4OUOA 5DC9B 3S7GA 3UAJD 1IILE 1GL4B 1A7BA 3PQYE 4N0RA 5GQBA 1S7RB 1U8QA 5B39G 5F6HJ 1IAIM 1I1AC 3G6JE 5DMKA 1T2XA 1R24B 4PJFB 5FV2A 4MJ6B 1QBLL 2Y07H 1G6RA 4HXBH 1CTOA 3OKDB 3RVWD 2HTKC 5I66B 3KG5A 2PYFA 3T3ME 1XIWD 4P48A 3DMMC 3ET9F 1G7HA 5BXFA 4XWGL 1Q9OB 2XKUA 2EDKA 5GS2D 2CUMA 5IB2B 1N5YL 4POZC 4HKXB 5HHOE 2O5YL 2C5DC 3VW3L 2H1PH 3GSXA 4UDTA 1KJMB 2YMXL 2FBJH 2CDGA 2WIIB 2V6HA 4AH2B 3HRZB 1PQZA 2EXWD 1HSAA 2WM0A 3TO4D 4GMTH 5I1HH 3ULVC 1N64H 4K3EH 2P42B 2BVQA 1II4E 3V79C 2OSLB 5JXEC 3GZKA 5IMOA 5I75B 3MOAH 3MODL 3IFPB 4LSDA 5M94B 1EPFA 4RAHA 1FIGL 5EZIL 2A38A 4LPTA 4PREB 2Q7NA 4P46D 3BH9B 1JMXA 4PJHA 4LCWB 1Y6MR 2Q6WB 4L3EA 1Q1JH 2Z31C 3LEXA 4X0KA 5DZLA 3MRHB 5C0ND 1TENA 4Y5VB 3H7BA 4XAKD 4ZSOE 4AZ8A 2R1WB 4HFUH 1RUKH 1MRFL 1JPFB 1CK0H 1OCWL 1ZLWH 3HFML 4MJ2A 1I9RH 2CKBB 2HWZH 4MXWL 2P4AB 4MA7H 4ODSH 1A9EA 2ZJSL 4MQXD 4DVBA 2ZUQB 5GGUA 1ZSDA 1MUJB 4Y88A 1ZLVH 4FP8H 4LRNL 4GSDL 3P0YL 5D1ZC 12E8H 1HOCA 3SY0B 3UYOD 1U8MA 4GBXC 4Z7WE 3U9PH 4ZTPL 2XRAL 4PRPA 3ULUE 3GSVB 1J1PL 2XKSA 1D5MA 3FRPG 3P0VL 4LASL 3S37X 4RGNB 4DQOH 4MQ7B 5KVFH 1JGUH 5MENE 3FAWA 3BKCH 4JRYB 1WITA 3VFTA 3L5XH 1WZKA 4L9LA 5T3XL 3RIFF 2FGZA 5FCSH 3WHXA 2YZ1A 2GTWB 3LEYL 5B8CC 1A8JH 1I4FA 3IVKA 4NUGH 32C2A 1PYWA 1YN7B 1A7PL 3L95A 1E4XI 4MXVF 1MLBB 2ORBL 3UJJH 2EYTB 4BQ9A 4D9RE 5C0FB 1DBKL 4PRHE 2XI9A 1ZTXL 2WUBH 3RI5F 4Z0XA 5F7YC 4LCWD 2D03L 1D6VH 3IU3B 4JGUA 3THMH 5C0CE 3STLA 5HGAB 3KPMA 1UWXK 3AREC 3D0LA 4JJ5A 4M4RA 1A1MA 4WVRA 1D5XA 1U2CA 2UY7A 3QXDA 5FEBA 3ZTJH 5D72H 2DLTA 4AQ1B 5HD8C 5IWLA 3L7EB 2VL4A 3OR7B 4HIJA 5EO1B 1G7MB 3MMEB 5E7FA 3UXFA 2VISA 3ORJA 2EE2A 1CLZL 1CGXA 5E08L 2FEEI 5TDOA 1FFNA 3PUCA 4HKJB 4M5ZH 4X9IA 4Z7VB 2XXCB 5K9OB 1E4XL 1D9KA 1GGYA 3BT2H 1Z3GH 5TPWL 1HHGB 1AGEB 4YBLC 4TUJA 4P4KA 4L5FL 1QSEB 3OKEA 1G9ML 1A6UL 4LVOB 3VFMB 4PRDA 1R5WA 1T5WA 4RGND 2R69H 1P7HL 3DJ9A 5JR1H 1QRNE 5F6IB 5H35B 3DX6B 4JRYD 1PSKL 3QWQB 4RFOL 2DWEB 2MJWA 5FUZH 3H9YA 1NCCL 3TVMB 4R4ND 1QFOA 2R0LL 2FEEL 5TF0A 1JZ4A 4HS3B 4LSSL 3PWPE 5T1LA 4L3CB 4AMKL 3DHMA 4P9HC 3QCVL 5JZ7D 1FRGL 3DTXB 3EO0A 3KXFE 3QEHA 3ZYOA 4FQ1H 3VXRB 1K3IA 1SYSB 3G5YB 2X4QA 1EBPA 2CMRL 2PTTA 4PJIB 5SV3A 1FFOB 2EKJA 3FMGL 4YXHH 3MRNB 3NA9H 3WFCL 4HPOL 1J05B 4OV5B 2V2XA 3MREB 1BFOA 4TN9A 4WW2B 3RVVC 3IETA 1D5BB 5FK9B 3MBXH 2P8PA 5CSZB 3FQXB 3BISA 4P2YA 4Q6IB 2W9LA 3Q6FB 3GMPB 4DEPC 3RWGA 3KPQB 2AXGA 3P0GB 3BDYH 4LQ1A 5T1MA 3V4PL 2ZG2A 3LPFA 1RD6A 3PF2A 4LHUB 1I8IB 3GHBH 4K55A 3MXWL 1QSED 5EC1B 1HWGB 5E9DB 4NKMB 5DD6B 3KPOB 1DQJA 5C0DA 5HYEA 1BVLB 2ZCHH 4NM8H 5CJ5A 4EN3B 1CGTA 1HH9B 4OBSA 5KSVA 4MCZB 2IPUG 2DB8A 5IP4A 1MFEH 5EBMB 1U93A 3BYTA 2BCKA 1Z5LB 3TVMD 4MZ3A 2JELH 4R97B 3U36A 2E8YA 4TULL 4K7PH 4Z95L 2GK0A 5I15L 4R2GB 5HGDB 5F3BA 5GSVB 5F44A 4HJJL 4JFEA 1A6PA 1QFWH 3VCLB 1HQRA 1VACA 2DTML 4LVEA 4OJFH 3F58H 5T33H 3F7YB 2AXHA 3T0EE 2EYSB 2YC1B 2ZG3A 1UXSB 3RKDC 4R0LB 2GTZB 4LKCB 5E2VL 4UV4L 4UDUA 3IB4A 4KKBD 5F88B 1FSKB 1KJ3L 2HT2D 5FOBB 1JK8A 4XPHL 3KPRA 1SY6L 4NZRL 1CF8H 4BFIB 1A6ZA 4GS7B 1CD9B 1DE4A 4PJBF 5DUML 4WCYH 1AFVH 4GAJH 1FORL 5HHNA 5CIPH 4Z78B 4LHUD 2ZUVA 3FO9A 5E9DD 1H9VA 3MBEB 4ELMF 4RA3A 4U6XA 4PS4L 4P99A 4Y8DC 4EN3D 5F71A 2EDNA 3BKJH 5DLML 4HW6A 3EGSB 4F80A 3WIIH 1LDPL 1ES0B 1QTYT 5J6HA 4LSPL 4JHWL 2O61B 3H42H 5I1EH 2HYMA 5CBEA 3OKKA 5E1AA 4XNMB 1U8OA 4G6ML 4ZXBB 4OB5L 1OF2B 3MRLA 3RTQB 4R2GD 3KAAA 1YYMH 4AYFA 4EKXA 1BQSA 4QLRA 1LP9A 1YMHA 1C1EL 2PR4H 4S0SD 1B0WA 2AXJA 3VWKC 1L7IH 3QI9B 2BNUB 3VFGH 4MNQA 3QDMB 5T3ZL 1NAMH 1WBYB 4PJXE 5I1KL 2WWKO 5K9KA 4NQDB 4Q9CA 3QFDB 1TJHL 2OK0H 2VE6A 1TCRB 4NJAL 4U1IB 3R4DA 1HZHH 2I5YH 2QR0B 2X4SA 2Y6SC 3ESUF 3FB8B 3Q3GB 1PW3A 5JO5B 1HYSD 4IMKA 3S35L 2VDKL 3UTPD 3C5JA 1PEWA 4OQTL 1FP5A 3MCKB 5DMGC 2FO4A 4L29B 1NCDL 3LPGA 3BP4B 4K94L 1M05B 1DBJH 2LE9A 3O3DA 3BO8B 2XA8L 2VDLL 3EHBD 1I8LA 1GJIA 1A7RL 1S7VB 3BJLA 5JLZA 1DL7H 4CUCA 5E6IC 3MBED 3MYJA 3FN0H 1PG7L 4NN7B 4YH6A 5EO0B 4ELMA 1T0MB 1J18A 4U6YA 4U1KA 3ZDYE 3IKCA 2HA1A 4PGEA 3NIDF 1YEKH 4CVWA 3ZYZA 2ZUWA 5E7BA 1MFNA 4NRXA 4XHJD 2I9LB 4OCRL 2W0KA 1R3JA 4ZXBD 3PWUB 4QHNB 4XNXL 1KELH 4KDTC 1Z6JT 2R2CA 3T2NH 5ICYA 3NTCL 4TRPL 3ZTJG 2AJVL 4W6XB 4X6FA 1LO3H 3KWWA 1OPGL 2A1WH 2XZAL 1IKNC 2HJFA 3T77A 4CADA 4DKEH 3QI9D 2IWGA 3QDMD 1NUGA 4YHNB 4GG6F 4NQDD 1BZ9A 1MQKL 4MWFA 4XP9L 1JN6B 4Z7WB 4NGHL 1MREL 4IDLA 3WUWA 1W2KT 2EIBA 2MQ3A 4FTVA 5E03A 4XRCB 1T89A 3PGDB 2LU7A 2Z91A 2CGRL 3BEVA 3G5VA 5MENB 1F4AA 3NZ8B 3C9NB 1JJUA 5DGQA 1ZA6A 1JWUA 4YC2C 5I30L 1G7LB 2OXGA 3FO1B 3KYOB 4XCYA 4TSAL 5ITFA 1KXVC 4K3DL 1KIRB 4K07A 1UZ6F 5D7SH 1A4JA 5KAQG 4Z8FL 4Y1AA 3ARWA 3HC3L 4LLDA 4PLJC 3EFDL 3GJFK 4PG9A 2L4OA 2CO6B 5HYIA 5BO1H 3CVIH 3U0WH 5KJRL 5J9PA 2BOBB 2A9NL 3UTTE 3H9SA 3O9WC 4ZOEA 3QCTH 3DSFL 4WGWB 1K5NB 5DK3A 1YY8A 5AUMA 3RNKA 5E8PB 2H6PB 4NO3A 4NCC1 3MV9B 3HUJB 2OTUA 1IT9L 2Z8WC 3BPLB 4M43H 5DT1L 1QR4A 4V2BA 4JG0H 4PTTB 4NO5A 1JPSH 4YDVB 1X5AA 3P4NB 1N59B 2BVPA 2EE3A 3U46A 5L0QB 1JUFA 4TSCL 4HDIA 4ALAH 1A7QL 4RMTA 4G6JH 1CE6A 3BP5B 1ZGLM 3WFHA 3MQIA 1F45A 3SJVE 1MHEA 5JXAH 1GZQA 4HK3N 3VH8G 3VFRA 2VDPH 2V2WA 3C6SA 3QDJA 2E7BA 5JW4R 2BHZA 5D1QB 3ZKNC 4ERSL 3IJHA 5DD0H 5SWSE 3ARPA 3SO3C 4FN0A 3D39B 1EEYB 4HMCA 1JRHL 43CAA 3ALXA 4R4FL 2A6IB 5MEPB 5DD5H 4G3YH 5DQJA 2NTSP 4N9GB 3S4SA 4QRSB 3ARBB 4JZNA 1QA9A 5HYFA 3UBXA 1KB9K 1H5BC 5I1LB 5C3LD 4WNQA 3MRBB 2A77H 5BJTA 3TIEB 2VQ1A 5BVPL 4DCQB 3GSQB 1IBGL 1TMCB 1IAII 3SOBL 3CXDH 5EBWB 1BEYL 5AZEH 1U3YA 3CFKA 1HSBA 4FHBD 4PLKC 4UMGA 4YWGH 3DUUA 2R2EA 4MLSA 2CQVA 2NZIA 2BSRB 3FT2A 4XNYH 2QQLH 1DLFH 4RFNB 1KPRA 1I1AA 3KPSE 4H26A 2VKWA 1MJ8H 2HVKB 1EHLH 3S9DB 3MV9D 3NCCB 4ETQB 3TC9A 4WEMB 4NO0A 2CDFB 5DTFB 5I8OL 2E8ZA 1KJ2A 4Y8AA 4LSUL 3CH1B 5TF1H 1OM3L 5F8RC 1MFDH 4MJ5B 3DMMA 3I9GL 1N7ML 5JPNA 2XKNA 1IAIL 4KUZL 1FNSH 3IDMA 4YXKL 3DX9A 5F9DC 3X14B 2A9ML 1O7SA 1IEHA 1JTOA 2OTPA 3DV6A 1CLYH 2O5ZH 2W91A 2FYYA 5D1QD 5E6YA 1CG9A 5FYLH 4M6NH 3D39D 3UYRL 2RFXA 2WWKT 4E9LA 5DMYA 3OV6A 5ACMA 4L4VB 1KN2H 3GM0A 4QRUA 3AFLA 3I85A 5DUPL 3ARBD 4FMFA 2YA1A 5HHVL 3UO1H 4GKSB 2DJ4A 2QKIB 4LNRB 4X4XA 5JXEA 4X6EB 3RIFK 5C09E 4GW4A 1FIEA 1IC7L 3BVNA 4WFFD 5CEZH 4JAMA 3VRIB 2F8VA 1MH5A 3VFOB 1MCDA 4MD0A 2RCSL 3QWOB 1JF5A 1TVBA 2G9HB 5HJ3A 1L0XA 1YMMB 3RI5K 1PKOA 3JTTA 2Z31A 3LKOA 1MJUH 3ARGB 3B6SA 1XGRB 3JV4A 4URTB 5E0QA 1G84A 4G6FB 3MLXL 4ZUSA 3KDMB 1EMTL 1VPOL 3MXVH 1BAFH 4IM8A 4Y5YB 3MFFA 5CD3B 3O6MH 4QOKE 2EEAA 1YNTA 4H5SB 3HMXA 1YEHL 3VXUE 4P9MH 5I73B 4HX1B 4X6CA 4M00A 1RUQL 1KJ2H 3ARZA 3ISWA 2EZ0D 5D1ZA 5JORA 1KEGH 2EDOA 1A14L 4GBXA 1YQVL 1MCIA 2GSIA 5DJXB 1MHCA 5IW6B 4OZIB 2YA0A 3PP3H 5C6TH 4L4VD 5LGKA 4M7LH 4AT6A 1KNOB 3PABB 5HHXL 2Q87A 3UAJC 4X4ZA 3H3BC 1RZJL 2FLBT 4HG4K 2I9TB 1UXWA 1CDJA 4LFHD 3SPVA 5B8CA 1XR9B 2OZ4A 3SKOA 3T0VA 3GMOB 3KNBA 3ULVH 4XX1G 3T4AB 3GGWB 1VCAA 4YHOH 1YEIH 5DK2B 1KTDA 5J1AB 2VLMD 3PIQB 4R6UA 3JV6A 3A6CH 1MCSA 3SGEH 3P3YA 1A64A 3AXLB 5GS1B 5JTWA 2AP2A 1YMMD 5SWZE 2DI8A 2X41A 1WIUA 5KS9B 1RUAH 3ARGD 4CVXA 5IVXE 3AREA 3RVWC 5C2BH 5D71H 1AD0A 1XIWC 3GJEB 4G6FD 3MRCB 2DIBA 1FE8L 1XF5B 5GGRY 3G04A 2OX5A 4KK5D 1PDKA 5CWSA 1GGIL 4F3FA 4LLYB 3SDAD 2XFXA 3B83A 1SYVB 5EOCL 3VFSB 2YD7A 5HYQA 2ICEB 4NWUH 4KPHL 4P2RB 5IVZA 2EXWC 2FL5A 1CR9H 4KTDH 3TO4C 3OKMB 3LS4H 1KPVA 1CL7H 4NFCA 2FHBA 4MX7A 5L7XH 1NGQL 4CVUA 3VFWB 1QQDA 4XCCL 2CJUH 2NTFA 2BDNH 2UWEF 3S37L 1G9EA 4OCWH 4TVPH 1WTGT 5JUEL 4TUKL 2GJ6A 3EIFA 4U1NA 4QXTB 2X4TA 1JL8A 3UZVB 4CN6A 1BX2B 1DDHA 4P46C 4R7DB 1DQQA 5EULV 2YSSB 5C0NC 5CZVL 4DK6A 1KCSH 1UADC 4XGZB 3BPCA 3ULSB 1ZVSB 4E0RB 5CP3A 1MAJA 4EUPB 2EDHA 2YUXA 1DLHB 4HIXH 1QO3B 4NQXB 3MJ7B 3PGFH 1G0DA 4NZJA 1R3IL 4KV5E 4MQXC 5GRJH 1U36A 4IIQB 5C0JB 3LN4A 3MUGB 3I75B 1C12A 5EORL 4P3CH 3K8MA 5BMFH 3GBML 2FEDD 3GSNA 2KH2B 3GMMA 5EU6E 3TYGL 1GYAA 2AI0L 1M7IB 5DFTA 4UNVA 4DKFL 1G7IB 1Y6KR 4JN2B 4P2RD 4O2EB 2W60A 1XF4B 5T3ZD 2BRRL 1KB5L 3NN8A 4U1GB 3WUWG 3LEVH 2FX7H 4G7YH 2VDML 1HIMH 5F7HA 2V9RA 1JFQL 2UYLA 4MHHG 4XP6L 3TO2A 4OF0A 5FDWA 4GQ9L 5FKPA 2NY7H 4O4YL 4OM1H 3LKPB 4Z7UE 2V7NA 5LGHL 3CSYB 1LEGB 2V5MA 5F9OL 3MV8A 4F7EA 5IEHB 1AH1A 2GSGA 3OF6D 4V2CB 2ZOLB 1K8IA 2PYEE 2CLZB 1WJ3A 2ICWA 2NY5L 2R23A 2NNAB 3KYMA 3FL7A 4HWBA 1SJEB 2XWTA 3AM8C 5DEGA 1G7JA 1SBBA 1I9IH 2K1MA 1WZ1L 3I6KB 4UT9H 3F62A 4YUEL 5F7MC 1W8NA 1DBMH 3GHEH 4ONHB 5TE4L 3LHPL 4P9HH 2IANA 4BKLA 2DM7A 4LP4A 2YK1H 1M7XA 2ZUQC 4DVRL 4S1RH 5CP3H 3UPRB 1P9MC 5HPOA 1OSPL 4YHPB 4RGMB 1W72A 3NIFF 3OKNA 4ZAKB 1K8DA 4MCYA 3W39B 1Z9SA 1A6TA 2YXMA 2DQHL 4OIAA 3CX2A 3VGAB 4L3AA 4HS6A 1XEDA 4GG8B 4HH9B 1JZ5A 1VADB 2EDDA 4HUUA 5ACLA 4Z0BH 5EU5B 2RIKA 3O4LE 3PE9A 4O2CB 4RGNC 5GJTH 4PRBB 2AV1A 4YHZH 3HPLB 3EYVB 4W6YB 4LPUA 4PB0L 3QXVA 4B5EA 3S4SG 5E8OA 3IGAB 3KLAB 4LARH 3TBWA 3UBXG 2HTLC 4CVZB 1YYLH 4R4NC 3QDGA 3T4YA 1C5CH 5FCUH 1DFBH 1IGYA 1YEDA 3IS0X 4LAQH 5JZ7C 4LLQB 5HHPA 4LOUD 5C8JA 1TJGL 3QNZA 1S78D 4QKXB 1RIUH 3FAXA 4MAUH 1IKFH 2R0KH 4M1GL 4OLYH 1J9CT 3I6GB 1BM3L 2J8UE 1JNNL 4L8SB 3BRDA 4CAGA 5KG9B 2BNQE 4HHAB 3KPPB 1T7VA 4HWBH 3VWKA 3H3PL 5KSUA 3V7MA 3BWUC 2MCPL 3LPWA 4ZAKD 5EPMA 2HJLB 5A2JH 1FAIH 3MPCA 3KYNA 4TNVF 4OGYL 1A02N 4XC1L 4NBXB 4UV7L 3UPAA 4RX4D 4JO1H 1CFBA 4ZUTB 2P5WE 3A6BH 2UZYB 2ZOKB 4OT1H 2XQYK 1HI6A 1IGIH 1W72H 1CU4H 3HE7B 4LVOC 1EEZA 4WY7H 4ZUUA 5I71B 2FSEA 1OSZB 2IPTH 5C09B 1CBVH 3MRFA 2R56H 4LGPB 4OCSH 1B2WH 1BLNB 4GRMB 1U9KA 1EVUA 5E6IA 2VXTL 4Q9QH 1QFHA 1W0VB 1RFDH 3TVMC 5D9SB 4C56E 4CN1A 3LS5H 4KHTH 4LF3B 4Y0GA 4EI5B 5IF0A 1MWAA 5FGSA 3DXAA 5GGVL 3WO4B 1YC7A 1S8DB 2XWBB 3RGVB 1IM3B 3DO3A 1V3MA 4ZDHA 3HAEB 1NC2A 4UNTA 4XT1C 1UB6A 3U1SL 4OZFB 1FN4A 4KDTA 5JPMA 5DJ6A 1FGVH 3AVEA 5CILH 3IFNL 1J7VR 1U8IB 3BPOB 3CFDA 2WINA 3INUH 4L4TE 3BZEB 4GO6B 1IKNA 4WW2C 4HWZA 4KMQA 3VXUB 5LGJA 5J12B 4H8WC 4KKBC 4RFEB 5INDB 1GGTA 2I07A 2HT2C 3ARFB 1J8HA 3BH8A 4E42B 1RULH 4LIQH 3ZT7A 3WHE0 4Q6IC 3HZVA 4FQQB 2HN7A 2XQBH 3NCJL 1ZA3A 2YBRA 4PJDB 5AD0A 1U8LB 4P59L 1S9YB 4QRTB 5FYKE 1OQOA 3GNMH 1KGCD 2BERA 5E4EB 4JJHA 1CS6A 2ZNWA 3CGTA 4YXLL 3JWDH 5KVDL 3HE7D 1N4XH 3FQWB 3RZCB 5J6GA 3QUMA 4XNUH 4AY0A 3EOBA 3OGCB 4EN3C 2H9GA 1UM6H 3WNOA 3MJ8B 3CDGB 1FZOA 5IBUG 1OGAA 2VC2L 5C0BB 4K71B 2HFFB 2CH8A 4R97C 4OFYA 3O9WA 2EDEA 3FOLA 4WI5A 5K9JL 4XBGA 4XC3L 4MLIA 5JOFA 4I3SL 4XMPH 5SWZB 3RGVD 4R2GC 3O0RL 2J6EL 3HLAB 3MYZA 1IQDB 3IDNB 1S9KC 5F7DB 1CVSC 1CZ8L 5D7IE 1X5GA 5GGRA 1MWAH 1HCVA 2E6JA 2DQIH 2EC8A 1FL3B 5I17B 2PETA 2JJTA 5D8JL 1NDGB 5HVHB 4I77H 3FCTA 2Z35B 1BPVA 2X4PA 1TZHB 3X3GL 1WISA 4R0LC 3T2OA 3W9EA 1DUYB 2PN5A 2V5RA 4KI5E 1FFQA 1FSKC 3ARFD 1ERNA 2JJUA 4A6YA 3QQ9D 2XN9B 1HYSC 2IG2H 4FQ2H 5EG6C 4JDTH 4KQ4L 1XGUA 4HBQA 4GS7C 5EIVA 1NFIA 4ODWB 5IHBA 2ZPKL 2MTPA 1LO5B 1PBYA 3D18A 4PJHE 1S7QB 1WFUA 3SKMA 1NMAL 1G0YR 4ODUB 5KAQF 3DGGA 4L3EE 4NHCL 2BSSB 3EHBC 3LQZB 2BP3A 4G7VL 5FA4B 3VXTB 2DQTH 1MFCL 4KKCD 3UTZB 1GXEA 4UB0L 3MBEC 1YJDL 2ZSVB 3IDXH 1MVFA 1H5BA 5C1MB 1CDUA 3LIZL 1X5KA 3WIHA 4MA3A 3VXPA 3ZKSD 4HAFA 3PHOB 5DRXA 3S5LA 5C0BD 1B88A 1N6UA 4XHJC 2B1HH 2HJKA 4I5BB 4UQ2A 4J6RL 3FB6A 3VXNA 2DQDL 3SKNA 2PTVA 4ZXBC 3QRGH 3L3HB 4PJ7F 5D7KE 2I60H 3C60B 2D31B 2OBGA 4PRPE 5IHZB 2JB6A 1F8TL 4U2ZA 2Y7QB 3S3SA 1RHFA 1FZMA 5C0AA 4MJIA 1VGEL 5GGTA 4DW2L 3QI9C 4TTDD 1NEZG 3QB7C 5IK3B 2QLVB 4HEME 4LKXB 2BK8A 2E27H 2G2RB 3BDXA 2BHUA 4M9PA 4X9GA 3GDBA 1OB1B 4ZO8A 1NLBH 3V5DB 1TITA 2XN9D 1AY1H 5L6YL 1BHGA 5HGBB 4KU1A 1AXTL 3L7FA 4ELKA 3IU4H 4NZTH 1FDLH 5IR1A 2VH5L 2CIKB 5LVEA 1IFHH 2LABA 5DQ9A 4LPXA 1BZ7A 1J0HA 2MHAA 3RA7L 3QO0A 3BGAA 1WF5A 2XT1B 3TBSB 4NN7C 4Q9BA 5CJQL 1EUTA 1CGSH 3JTSA 1KB5B 2X1WL 3FB5B 4JFZH 4D9QE 4XCEA 1N3NB 2WIMA 5JIKA 5DJ8A 1A3RH 3LN5A 4U1LA 1S3KL 1TVHB 3WIHH 4UU9A 4PGBA 5FO7A 5FFLA 3C60D 3FFDA 1IEBB 2GT9B 3C2AH 1C08A 4PJ7A 3S97C 5H2BA 3NAAL 1TQCB 4H25B 4V1DA 3SQOH 2DF3A 2IBZY 5FM5M 3REVA 1JVKA 5F3HA 4FXKB 2N7AA 4Q2ZB 2G75A 3G5ZB 2P5EB 2GQHA 1NBYA 2IF7A 3MNZA 1N2RB 4F2MB 3VFVB 1V3JA 4ORGA 1G1YA 5TFSH 3S88L 5GGTH 5CEXA 4RNRB 1E27A 4RZCA 1IE5A 4M02A 2HKHL 3O4LB 4KWUA 5EZLA 4GT7A 4PR5B 3P9MB 3TN0B 1MCNA 4F15B 5FECA 3ZDXF 3QNXB 1YEEL 3QCUH 3OJMB 1JGDB 3OXRB 1RZKL 3T0WA 4S2SA 3WKNA 3O6KH 4M61A 5I1CH 2VDOH 5GGQL 1D6EB 1WBZA 1LO0L 3LKNA 5EB9A 1A5FL 5I16A 3DVFA 3EYFA 1MEXL 1CFNA 3REWA 4LCYB 4O5LH 3D2UB 1IC1A 5D7JB 5B38A 1F4HA 3L3KB 3WLBB 3AS2A 3MCG1 1DBBH 4H0GA 3E2HB 3BPLC 3P4OB 2XG4A 3VMOA 5IT2L 1M1SA 5D96B 3BDBA 1ZWIB 4MDJB 4Z7NE 5L0QC 4YFEA 5HHME 1XIWA 2VXUH 3IAQA 4OQ1A 2P5ED 1IZJA 3KLSA 3T65A 4M7KL 1U95A 3DX8B 3JV5A 3VA6A 5EOQH 1PKQB 3T2QA 5D1QC 3WS3B 1N5AA 5BZWB 2EDYA 3L5JA 3FN9A 5FO8B 3QNYB 3UYPA 4KROB 4HBCH 1FNGA 3VGDA 1MFAH 3O3BB 4UBDD 2XTLA 3TO4A 3TN0D 1NDMA 1AGCA 1KYOJ 2YEZB 3ARBC 4WFGD 2HP4A 2DI9A 4JFEE 1P4BH 4S0TD 3V6ZA 4DGVH 4JHAL 5K33A 1NANI 1K4CB 3QR2A 3T0XA 2KPNA 3O3AB 2HFEB 1QBAA 4I18B 2DQJH 2GITB 1JHKL 1G9MC 1S7RA 4S1QH 1V7MH 2AJSL 4P46A 2EDWA 3D2UD 3KPRE 1D5IL 1AQDA 5D7JD 1KLFA 1D3CA 4ZS7H 4RFNC 2A73B 2YD5A 5BVJB 1R24A 5C08E 3MNWB 3MJ9A 4PJFA 3HZMB 4MJ6A 3PXJA 1DVFB 4LVHB 3OKDA 5I66A 1SQ2N 5D2LB 1RSFA 4NJ9L 3UJIL 1DEDA 1Q9OA 1IL1A 4XX1E 3DARA 4YO0B 5IB2A 2EZ0C 2JK5B 3U4BL 4HKXA 2YPVH 3TH3T 3L3IB 1KJMA 2B7DT 4IRZL 2P8MB 1MJJB 4Z7QE 3HRZA 2VDNH 5C92A 5GS2H 4KROD 3JSSA 1J88A 3QYCA 2NW3B 1PZUB 3FRUB 3SDYL 2SEBB 2ADIB 1EJOL 4X5LA 5KTEH 2FATH 1LP9E 1U3HB 2OSLA 3K74B 3CPLB 4MNQE 5IHUH 4APQD 1FLRL 3SE9L 1Q9WB 3IFPA 4DZBB 3RWIA 5ITBH 3QZWB 4EBQH 1BVZA 5D7IB 4PREA 3WFDH 3BH9A 2CUIA 4LCWA 2Q6WA 3AM8A 3HI5H 4NWTH 3MRHA 1QACA 3ARGC 1FC1A 1N6QH 4WFHD 2BVQB 3NCBB 3JWOL 3SKJH 2HKFL 2R1WA 4Y5YC 4KK5C 1JPFA 4KKNA 5FUOH 2NQCA 3B2VL 3B8YA 1LO4L 2CKBA 1KCLA 1RK1B 3SDAC 5I1GH 3N9GL 3GJFB 4IEFB 4ZOBA 2YXFA 5I73C 1P9MA 4LPWA 5ISZD 1MUJA 4PLOB 4ELME 1INQA 1NGPL 2DKSA 4ODXB 1FNAA 4TNVK 3DV4B 4EZMA 1T7YA 2MQ0A 3H8NA 5EZOL 4AEHL 1NMCB 1JWMB 5MERB 2YZ8A 3GSVA 1ITCA 2R29L 5DF0A 5CINH 1X5FA 3V6FB 3PNWB 3L3JA 5I8KL 4MQ7A 2CDEA 4F7CB 4R26H 4HGWA 4JRYA 5ID0B 1U3HD 4TUOB 4PBVC 4U4BA 5F7EH 4WI7A 2ATKB 1BQUA 4CN4A 2VLRB 4JVWA 4U6VH 1ZGLB 1RMFH 1GIGH 1YN7A 1F4XL 2VUOA 3H2WA 5ICZB 1MLBA 3WXWH 2EYTA 4NKOB 5C0FA 1A6WL 3CMOL 3S5LG 1V3LA 4Y2OA 5HSFA 5DD1L 5GS1C 2X6MA 1U2HA 2VSCA 4FTVE 3QPQD 4ZO9A 3IU3A 3LB6D 4NP4H 5TE6H 3RWDB 1Q72L 5DJ0B 3UTSB 5HGAA 2I26N 4F33B 2QADB 4Y1AE 2XXMB 3L7EA 3OR7A 2FEDC 5EO1A 1G7MA 1PYWB 4HCRA 4F9PC 3RHWF 3H9SE 4BZ2L 4HKJA 3QUYD 5K9OA 3DI2B 4NRZB 3EDEA 1BJ1J 1IAMA 3ILQD 1HHGA 1LDSA 2AABL 2EE9A 5I1JL 1VEPA 1AGEA 3NIDE 2FIRT 5LG1A 1QSEA 3LMJH 2ITDB 4YHLH 1QSZA 3VFMA 1CDYA 3QXDB 4LRIC 2DBJA 3ARXA 3MLUL 4ODVH 5H35A 1RUML 3DX6A 4UAOB 2DWEA 2D7QA 1FQ9C 4NNXB 4WTZA 4G8EB 5FYLE 4K94C 1FFNB 1CLOH 2FJGA 3TVMA 3QEUB 4JCLA 2VLRD 1PGRB 1UCTA 4HS3A 3HPJB 4L3CA 1TZGH 3QDJE 4FQLH 2HRPL 4LEXL 4ZUVB 3RWFA 2JJSC 4HUXB 3DTXA 43C9B 4ZPTB 1ZT1B 3IFLL 2BXZA 2YD9A 4IRSD 2ARJB 3G5YA 1O7VA 1R5WB 4PJIA 5EO9B 1T0NA 1FFOA 3UTSD 3MRNA 1P4LB 3HRPA 2GJJA 1CE1H 3CFCH 1J05A 4OV5A 1TVDA 3FT3B 5AYQA 3MREA 4IIQC 4WW2A 3ZMRA 2FX8H 2J4WL 2QADD 1UZ8A 1D5BA 3DURB 4OIIH 4J8RB 1GC1L 5FK9A 5TQ2H 4NN6B 5CSZA 3FQXA 4HXAH 4OTXL 4GH7B 4Q6IA 3Q6FA 1FG2B 3GMPA 1FG9C 4GQPH 1CQYA 5I2IA 3KPQA 1QFUH 3RBSA 4I3RL 5F6HI 4OLVL 4I9WD 1QKZH 4U1GC 1FO0B 1UCBL 5BRZD 4M48H 3TYFB 4LHUA 1I8IA 4EVNB 1A6VH 4XXDB 4KTYA 3SDCB 3UZQA 5EC1A 5E9DA 4NKMA 5DD6A 3MTRA 2R1XB 3KPOA 1BFOB 1BVLA 3ZO0A 1CXLA 4EN3A 3GI9L 3RIAF 1HH9A 3DHJA 5EBMA 1DN0A 3C09B 5HDBF 1Z5LA 1QVOB 4LOUC 5T5NG 1UM4L 1S78C 4X7CC 4OZGF 2GI7A 5HPMB 4RWYH 2UZIH 4KKLD 1XZ0B 5HGDA 1ZK9A 3L5HA 5GSVA 2W9DL 4P4RB 3BIKB 3MRJB 4HUKB 4QXUH 4JM4L 1AO7B 3MLTB 3VCLA 1IC5L 4XPFH 3ULVE 5KSVB 5J11B 3F7YA 2EYSA 2IPKB 2YC1A 1A4KB 1UXSA 4R0LA 4FFZH 2WUCH 4FZ8H 3GI8L 3X12B 4LKCA 4RGMC 2PNDA 2X70B 4ZAKC 2KBGA 4EDWH 1KC5L 4G8FB 2X1QA 5F88A 2P44B 1RURL 5FKAB 5FOBA 3BX7C 1DTUA 3VFPB 4G42B 3VGAC 4KUCD 4R8WH 4ONGH 1NL0H 1XR8A 3IDYB 3VD5A 5DWUL 3G9VA 2AJUH 2L0DA 5K93A 4H8WH 2VUYA 3RJDA 1CI5A 3IDJB 4QHMB 1FGNH 4LSVH 3MGAA 3SDCD 3DSNA 3MBEA 3MV7B 4M1DH 4JR9L 4LLUB 3VI3F 4YHML 5HVFB 4UILL 3B43A 3WO3B 4WI8A 4G9DA 3C8DA 3PV7A 1MF2H 4OD3L 4FABH 3EGSA 1R3KB 4WHTB 1ES0A 1QFWM 2D0FA 2O61A 1NCBH 1FL5B 5C08B 4XNMA 2COQA 1FZKB 3F7VB 4YHKH 3M17B 4ZXBA 1OF2A 1IGFL 1RHHB 3O45B 1NPUA 4TVPE 2QJDA 4PJGF 1NCAL 4L8SC 4Q6YA 1AO7D 3OR6B 4OI7A 3TCLB 1DSFL 2D0GA 3QI9A 2BNUA 3ZE2E 3QDMA 3WKMH 1LK3L 1WBYA 1I7ZA 2EH7L 4NQDA 3QFDA 2MNUA 1V8HA 3C6LD 1QLEH 5E1AB 4B7IA 1JNLL 3PL6B 4U1IA 1CDCA 2QR0A 3SGDH 2FGWL 3FB8A 5JO5A 1JYNA 3MCKA 2FD6H 3MR9B 1I9JL 3HE7C 4L29A 4TOYL 5ALBL 3BP4A 1HDMB 1M05A 4N8CH 5I71C 4MB5A 3BO8A 4X7DC 4WO4D 2DJSA 2YUZA 1S7VA 2CLVA 3MV7D 5TDNB 1VESA 1L6ZA 1P69B 4C4KO 5LXGH 3J8F7 2CRZA 1DQDH 5EO0A 3MROA 4UTAL 1T0MA 1OP5H 1CXIA 4JFQA 4JPWL 4M7ZB 4Z76B 3WO4C 2O93L 4NKIL 3RGVC 5JOPD 2V7HB 2I9LA 3O6FB 3NACH 4FFYL 5C08D 3NZHL 3BAEH 3DO7B 2J3SA 2V17H 4D0DB 4J3WA 3PWUA 4PJBB 4QHNA 4ZO6A 3AB0B 1OHQA 4N0YL 4K9EL 1FBIL 4FQJL 3BPOC 4TQEH 1WFTA 5L8JB 2B1AH 5J12C 5SX4I 3QG7L 4P57A 3R0MA 3ARFC 4JZOB 4AIZB 1UA6H 4XP4L 1NSNL 4WEUD 5DA4A 3VI4E 4PGEB 3DI3B 3QQ9C 2GJ6E 1JHLL 5A2KH 1JN6A 4NC1C 3GMRB 5HDQL 2XOTA 3WV0A 3PL6D 4HK0B 4XRCA 2M8XA 4MA8H 2VAJA 4DN3L 1MFBL 3PGDA 5E4EC 2AXFB 5F7LB 1AGDB 4LSTL 2EYRB 2AEPH 2J1KA 3NZ8A 3C9NA 4KKCC 3U4EB 4ZMAT 1QBLH 1G7LA 2PW2A 3FO1A 3KYOA 2X44D 4PJCF 5BV7H 3RZCC 1KIRA 3IJYB 4JFYB 1QBMH 3OXSA 2GAZB 5I1DB 2QSCL 3Q1SH 3HNSL 4K71C 1E4KC 1H3WM 2GJZB 1N5YH 5DUBB 3PJSB 1K5NA 3VW3H 4AG4L 4PJ8B 5E8PA 3O3EA 2H6PA 2YMXH 3G5VB 3O6FD 1RZJC 3MV9A 3HUJA 4FQCH 1JWUB 4QHUB 3U7WL 4PTTA 4OFKA 4HJGA 4KTEL 3P4NA 1N59A 4TTDC 4HF5H 5HVHC 1KXTB 1FYTB 5DJDA 1DP0A 3M1BB 1ZHLB 1EAPB 3OB0K 3AS3A 1JZ3A 3BP5A 1OP3H 4NDMB 1MAML 1OAQH 3MODH 2CR6A 4QXGL 5DR5H 1IGCL 4KK8D 4Q0XL 3MV8E 5EZIH 5D1QA 4ZFGH 3TA3B 1HXYB 4JEGB 4PJ5B 1J12A 2APFA 3D39A 3LZFL 3W9DB 4KHXL 3RVUD 3X3FL 2F15A 2A6IA 1HXMB 2JCCF 1ZLSH 4P23B 2BVPB 4XBEL 4RMSA 4QRSA 3ARBA 3ULUH 2OP4L 4HDIB 3AC0A 3HFMH 3MRBA 4RBPH 3TIEA 4EOWL 4MXWH 1GSMA 1MHEB 2IANE 4Y4KB 4DCQA 3GSQA 2ZJSH 3VFRB 5EBWA 4ZFOL 2XA3A 1RJZB 1BBDH 2Y36H 3OAUL 4PV9B 5I19L 5EZOH 4GG6B 1WICA 4HH8A 4QGTA 4DAGH 4GSDH 4Y2DB 3BOVA 43CAB 5F70A 3C60C 4D8PB 1HEZA 4X4MA 3QG6B 4O02H 4PJ8D 3TBYB 2HVKA 4N90E 1UACL 3T04D 2DLIA 3GMLB 3F7RA 1A21A 3P0VH 2I24N 1QA9B 4ETQA 1ZV5A 4M7JH 2CDFA 5DTFA 3GMNB 4X7TB 4ENED 4ZD3L 1X5HA 1GPOH 3QDHA 3MLZH 2C1PB 5EOTB 1YUHB 4OFIA 3CH1A 5ALCL 1FYTD 1ZVHA 4MJ5A 4JFDB 3GUTB 1S7XB 2OR9H 5EFIB 3UJTL 4WI4A 4P3DB 1B6UA 3G6AB 3MLVL 3EO9L 3X14A 1ZXQA 3QDGE 5HY9B 2LU3A 2ESVB 4P2QB 5LWYH 2P43B 4UIKH 2ORBH 5FB8B 4YE4L 3O2WH 1MPAL 4ZTOH 2VRAA 3QIWB 1DBKH 4QHLB 3TA3D 5IQ9B 3QXWA 4RRPA 3ELAT 1J1XH 2D7PA 4PJ5D 1EAJA 2ZUSA 4NO0B 2D03H 1INDH 2BVUA 3BD3A 3UTQB 4L4VA 2VJXA 1A0QL 5E56A 4P23D 3EYQD 1QLRB 2JCCA 4LIQE 5EU3B 3HS0B 2FH8A 2IH3B 2GYSA 1AGBB 2EH8H 4KGJA 1JGVL 4G9FB 4IOIA 4GKSA 3DROB 3RX8A 2QKIA 4LNRA 4X6EA 4Y4KD 4YAQA 4BQ6A 1DANT 1X7QB 1FVEB 2AK4B 2R4SH 4L1DA 4O9HH 3VRIA 3BZ4B 3VFOA 1UT9A 3QWOA 1E4XH 5IQ7H 4YPGA 4I0KA 4Y2DD 3RGHA 2NY1B 4JQVC 2OJZH 1YMMA 3B2UD 3E3QC 4JPKH 4L5FH 4C4KT 3ARGA 1XGRA 1TQCC 2VN7A 1A6UH 4G6AD 3KDMA 4KVNH 4Y5YA 4W4OC 3WE6B 4BUGA 1PSKH 4GW4B 2CKNA 5CD3A 4HXBL 4C54A 3SDAA 5LQBH 4JFDD 4H5SA 1NQBA 3CVHL 4HX1A 4Y19D 4PGCB 2QSQA 2R0LH 1LQSR 5LBSH 3SE3C 4HLJA 3MRKB 1TVBB 4MGXA 3RHWK 3DXAE 4AMKH 1NKOA 4J3SA 2ESVD 4P2QD 4QHKJ 4XNZB 2F53E 4UBDC 1FRGH 3JTTB 3TN0C 4S1SL 3QIWD 3LKOB 4F15C 2H1PL 4EXKA 1AKJB 5DJXA 3D48R 2WLZA 1BOGB 2FBJL 4ZUSB 5IW6A 4OZIA 3N1QC 3MGTB 2VDRH 2XIDA 3FMGH 4PPTA 3I6LE 4CNIB 1SY6A 1EV2E 3ZYJA 4HPOH 3RVTD 4GMTL 3DPBA 5I1HL 3PABA 4LHJB 4K3EL 3OJDB 2O5XH 2WLYA 4G9FD 2I9TA 3WHE1 1T21B 1XR9A 1J8HE 5D7JC 3GMOA 2AK4D 3GGWA 5DK2A 5FYJU 5J1AA 5GSRB 3PIQA 5CZXD 3E2HC 2GSIB 2NY1D 5F1SA 1LD9B 3AXLA 5FAAA 5D96C 2E7MA 3S96B 5KS9A 3MXWH 4AT6B 3ZSTA 1Q1JL 3ME0A 3TFKD 4HPYH 3BHBB 3GJEA 2ARWA 1XF5A 4LGRB 3T3PF 5HVGB 4BFGA 4L8DB 3UC0H 1RUKL 1FNEB 1CK0L 1CXEA 1IZKA 1TDQA 1KCVH 4UOW0 4LLYA 4N9OB 1I9RL 1A22B 2X7LB 1OGAE 5B39B 5E94B 1AXSB 2X1OA 1TLKA 3VFSA 1F2QA 4F9PA 4KZDL 1BOYA 2ICEA 4FP8L 1KOAA 5D5MF 4P2RA 1SBSH 4KROC 3VU2A 1WWBX 12E8L 3ZE0E 1RJYB 3OKMA 2W1NA 3DYMA 1X4XA 4HJJH 3WDIA 1AKJD 5I1AB 2YA2A 1KLUB 3VFWA 4OSUH 1RI8A 4DGIH 4LRIA 3TJEH 4DQOL 1JZ8A 5FIEA 1JGUL 4C59B 3RIAK 1KBGH 3BKCL 3SE4C 4OQTA 4I18C 1RIHL 3O6LH 4M03A 3OF6A 3L5XL 4QXTA 1WZLA 1KJ3H 1NGXB 1BX2A 1J0ZA 1I9EA 1SY6H 1KEMH 4NUGL 4X9FA 4AENB 1IGML 3IDIB 2C4FU 2JJSA 4YBLB 4OZHF 2OI9B 4XVSH 4XGZA 3UJJL 2JF1A 3ULSA 1ZVSA 4E0RA 4EUPA 1FORH 1DLHA 35C8H 4P5MB 1QO3A 3THML 4LVHC 4NQXA 3MJ7A 3VRLE 1WAAA 3A6OA 5FDYA 3JBG7 2M26A 4IIQA 5C0JA 5D70L 4MB4A 2X4TB 3MUGA 3I75A 2YD4A 3P73B 2XG5A 4LSPH 3WNPA 3TESA 1M7IA 5DFWH 4G6MH 3BPCB 4LSRH 4M5ZL 3U6RB 1G7IA 4NQEB 4O2EA 4LL9A 1LE5B 4I0PB 1QBBA 1I1FB 3BT2L 1Z3GL 1WUNT 2B5IB 2D7NA 4E5XB 2Q20A 1C1EH 1BQHA 1U3HC 1LHZA 5JQ6H 5C0AE 4MJIE 5T3ZH 2R69L 3LKPA 5JR1L 3CSYA 1LEGA 2EDFA 3GSNB 5FUZL 3WNLA 4NJAH 1L0QA 2CLZA 3VGBA 4IS6B 1VFMA 2EEBA 3QPQC 5I8EB 4NBYB 2NNAA 3HB3D 1SJEA 3LB6C 4HS8L 5GRVL 3I6KA 1NCDH 4K94H 3CH8A 1KFAH 4ONHA 2F5BL 4D2NA 3FQTB 4ZO7A 5HI4D 4WW1B 1A7RH 1BECA 4MDIA 5E2TL 3NA9L 3PP4H 3S8WA 2UWEB 3OKOA 2F74B 3UPRA 2FHFA 4EUPH 4F7EB 4YHPA 4ZAKA 3HHRB 1TIUA 4XMLH 5DSCB 2YD2A 4UT6H 5TDPB 2E3VA 3MBXL 4Z7OE 5IIEB 5B3NA 1EVTC 3DNKA 3KYMB 4U49A 5ERWA 4KMTH 4RX4A 3ILQC 5DEGB 1GGCH 4PIRF 4OCRH 4GG8A 4HH9A 1VADA 1FV1B 1GHFH 5K59E 2PCPB 3ECBB 4NQED 4MQSB 5EU5A 1UC6A 1EHAA 4I0PD 1JGEA 2EDRA 2P24B 3BDYL 5ICXB 3HPLA 1EFQA 1RUPH 3EYVA 1MRDL 4TRPH 2IANB 4PJ7E 2XZAH 1T1YB 1UWGH 3GHBL 4V1DE 3MNVB 4PP1D 3D69B 2Q1EA 1J0JA 4G6KH 4BFEA 1RU9H 4NM8L 2ZCHL 4CVZA 4JQXC 2H41A 3EJYD 3L3GB 3MZGB 2F9BT 4XP9H 4NGHH 1T3FB 4XCFL 4X8XA 3MRDB 4LLQA 3TNNB 4NM4H 1YJDC 4XNQB 2X4RB 4KDVA 2JELL 3ZKQD 1P4IH 4K7PL 1XGTB 3NFPB 5DURB 2CGRH 5I8CB 4CW1B 2IADB 3I6GA 4PJAF 1BVKB 4ONFH 5F1IB 4TSAH 1TQBB 4L8SA 5IB1B 4Z8FH 1IGTB 4HHAA 3A67L 2QADC 3KPPA 4LU5H 1QFWL 1VHPA 3EFDH 4OKVB 5ILTL 4OJFL 3F58L 1EDQA 5T33L 3S36X 2RQ8A 4BUHA 2VR4A 4YGVB 2HJLA 4X7FC 4XPAH 3Q5YA 4QY8B 1IC4H 2FDBP 1GAFL 2DTSA 5IOPB 4ZUTA 1CF8L 4H0HB 4U1HB 2ZOKA 1IT9H 5DT1H 3C08H 3TWCH 1MIMH 1TTFA 3HE7A 2Y9RT 1AFVL 3HNVH 4WCYL 2OQJB 3F12B 4GAJL 1YNLH 3VWKB 1OSZA 2ICES 4JM2D 2P45B 4GRMA 2VN4A 4UAOC 3QSKB 1U3JA 5EA0H 5MEQB 5AG8A 3NH7H 1AGFB 1W0VA 5D9SA 1C5BL 3ARDB 4N8VA 4LF3A 4G8GB 2YKLL 1PX4A 3V52L 3BKJL 1S8DA 2XWBA 5IG7B 3RGVA 1IM3A 1KXQE 4KKLC 3WIIL 3BN9D 5IKCB 3HAEA 4TVSa 5I1EL 5IFHH 4R4FH 3ZL4L 4OZFA 2OJEB 4PY7A 4L4JA 2FSEB 2FH6A 3IXAB 1OY3B 1S7UB 3PDGA 3I84A 1YYML 1U8IA 3P4LA 4HWEH 3BZEA 4DZ8B 4U7MA 3SGKC 2V9TA 5BVPH 5AWNH 1BD2B 1U8KB 5INDA 4DUXA 1L7IL 1BEYH 4NN6C 3ARFA 5IF0B 4E42A 1MCFA 5D2NB 1NAML 5GGVY 1K3ZA 2R0ZL 5E6ZA 2F53B 4YK4B 4FQQA 3WCYA 3CJJA 1N0XH 4PJDA 4U1SB 1KYOK 2OK0L 1U8LA 4JFHD 1S9YA 1EGJL 4H88H 3HI6L 2I5YL 4QRTA 5ADPL 1FN4B 3U79A 2Q3ZA 4MVBD 4N0CD 4RDQF 2D3VA 2VOTA 5TGBB 3SDCC 3CVHB 2IEPA 4PJFE 2WINB 3GMQB 2FBOJ 5I8OH 4XAKE 2IALB 5LGJB 1A3LL 1L9NA 3GBLA 4XP1H 3ZHKA 1DBJL 3OGCA 2CD0A 3MJ8A 3CDGA 5JQHC 3AGVA 5IGXL 4W6WB 1IAIH 1DL7L 3C09C 5C0BA 3HZVB 4WV1B 4RWHA 2HFFA 2BNRB 1E4KA 1RZKC 3ARDD 4OF8A 4G8GD 2A9MH 4YFDB 2G60L 1UWEH 2DOCA 5JHLL 3HLAA 4TYUA 1IQDA 3FTGB 1SMOA 3IDNA 4UUJB 4R9HA 4YC2B 5EZJB 1S5IH 2XYCA 5J6GB 3QUMB 5I17A 4HQQH 1KELL 2H45A 3U7AA 5J11C 1NDGA 3HAEH 2FECI 1TZHA 5E99L 2A1WL 1DUYA 1BD2D 1C5DB 4DKEL 1MCCA 1KACB 2XN9A 2L7JA 2F53D 2VITA 5FOJA 1RK0B 1BFVH 3IDYC 3HKFA 4WUUB 4ODWA 1LO5A 4QTHB 4LCWE 1FZJA 5EBLB 4ODUA 5JMRA 4N68A 4WO4C 2BSSA 3LQZA 5FA4A 1ZHBB 3VXTA 3MLXH 1PX3A 2UUDK 4HMEA 1EMTH 2X4PB 1RZ8B 1FJ1B 2ZSVA 1VGKB 5J1TC 1CFTA 5D7SL 4FNLH 4X9BA 4NO2B 2VYRE 4JDVB 5DJYA 4A6YB 3PHOA 4J3VA 4FS0A 5BO1L 3U0WL 3O2DH 2BNRD 5C07B 2QEJA 3BUTA 4I5BA 2D7TL 2RB8A 3K2UH 5DHYB 3L3HA 1LO2H 3WSQH 3C60A 1YQVH 4OV6F 2D31A 1F6FB 2HG5B 4PD4J 1MNUH 5IHZA 1SEQH 2Z0BA 3BE1H 4MD5B 3RWJB 1SM3L 2Y7QA 1SJHB 1JPTL 4DJMA 4M43L 3LRSB 4FRWA 1H5BB 2C9AA 4JG0L 4RGNE 1JPSL 4EUPG 2DLHA 5IK3A 3T0AA 3BP6B 4LKXA 4YDLB 5HHXH 3M8OH 4JRYE 2G2RA 4JE4B 1S9VB 3QEGH 5DRXB 1H0DB 4ALAL 3QDAA 4G6JL 4NZUH 1OB1A 5F9WB 4JN1H 4BSWB 3V5DA 2MOVA 3FONB 3PL6C 5JXAL 4KH2A 5L2KE 2VDPL 3ZE1E 5HGBA 5J57B 5J8OA 4WUUD 2VNCA 5IHLB 1F6AB 2CXKA 3FJTA 1ZEAH 1MCPH 3BYYA 2CIKA 4NYLB 5C0AB 2F8XC 2BVTA 4G3YL 2LFGA 3MLSL 4JY4B 1FE8H 5DVLA 4LCCB 4UI2A 3TBSA 1R5IB 5F72S 3QA3B 1NCNA 2KUTA 3VA2C 1KB5A 3FB5A 5E8NB 1N3NA 1G0XA 1NBVH 1UWXH 3CXDL 5EOCH 5AZEL 3AAZA 3M07A 1F13A 5C07D 4MNHB 2N7BA 3O6FC 1P7QB 1TVHA 4LEOB 4M8QB 4YWGL 3TBVB 2FJFB 1IQWH 4JQVA 4XNYL 2QQLL 3AB0C 4PY8J 1DLFL 2X9WA 1IEBA 2GT9A 2D9CA 1MJ8L 3P9LB 5DD3H 1QSEE 4YDIH 4H25A 1NLDL 1EHLL 1R0AH 4XCCH 2VDQH 1MI5B 2RR3A 4FXKA 1G7PB 2IC2A 4Q2ZA 3G5ZA 1CN4A 2P5EA 4X6DF 5AYUH 1C7TA 3KYKH 5JUEH 1RVFL 5F7UA 5TF1L 3TNMB 2BMKB 1N2RA 4KK8C 4F2MA 1MFDL 2QQKH 3AU1B 3VFVA 2KQNA 5DJ8B 5HYSG 3JWOC 3R06B 2CXGA 3SE3A 1FNSL 3B9KB 4RNRA 1I7TB 3NFNB 5CCKL 5GHWL 3RVUC 5CZVH 2CRMA 1CLYL 4PR5A 3P9MA 3TN0A 4PJ7B 3W11D 1F58H 3QNXA 1JGDA 3OXRA 4M6NL 4LPVA 3E0GA 4PJIE 2IFFL 5C0GB 1JBJA 1KN2L 1R3IH 5ADOL 3K4AA 5C2UB 1ULVA 4IRJB 1T5XB 1D6EA 4GRWF 1GRWA 3GRWH 3UO1L 5D7LB 2PW1B 2AJZB 5CEXB 3H6JA 4LCYA 3RRQA 1SVCP 1ZMYA 1GH7A 3WDHA 3D2UA 5D7JA 3L9RB 4PJ8C 3L3KA 1U3ZA 5CEZL 3WLBA 3OZ9L 3ARYA 1F4YH 2OL3L 4DKFH 1P7QD 3BWAB 1DN2A 5B21A 2VR5A 3RAJH 2BRRH 1KB5H 4ENEC 1XMWA 1ZWIA 4MDJA 4S2SB 1I8MB 3AUVA 3DETD 3STBA 5E9DE 3LRGA 5FYJD 4GQ9H 1JZ2A 4O4YH 1ZE3C 1MI5D 1QSFB 5BS0D 4OCLC 3N1FC 5LGHH 2PO6B 1MCOL 3DIFB 3CZFB 3DX8A 3O6ML 5CUSH 4X6DA 1PKQA 3QULB 3WS3A 3TA3C 5BZWA 5L2JB 3B9KD 4PV8B 3QNYA 1KJ2L 1T20B 3O3BA 4P23C 1WZ1H 3EYQC 4I4WB 2YEZA 4JO4L 4U7KA 3LH2H 3DVNB 3ALWA 3MLYL 5B3JE 1T6VN 1TNMA 3NABH 3UZEA 4Y4KC 1K4CA 1NFDF 1MCBA 4APQA 1JPST 4IRJD 2OXHA 3O3AA 2HFEA 3SE4A 4I18A 3H3KA 5IFAL 1HKLH 2GITA 1CTNA 5D7LD 4Y2DC 3SQBA 2DQHH 4KDWA 1KCUL 3G6JF 1NAKH 5CIPB 3WLWC 1QFPA 2A73A 1YEIL 3B2UC 4YHOL 3UTPE 2YUWA 1LEKB 2W9EL 5BVJA 2EXYD 3QUXB 4G6AC 3MNWA 3A6CL 3HZMA 3HAEG 2HT3D 4OFPA 1E4WH 1RUAL 4PB9L 2J88H 5D2LA 4I2XB 5D71L 3CAFA 1QSFD 5ISZA 2DQGL 2PO6D 2YS4A 4P46B 4YO0A 2JK5A 5IMLA 1AQDB 4N8PA 4C83A 1NGYA 3QFJB 1X5XA 3JVGC 3QIWC 3WEXB 1D7FA 3L3IA 3RL2B 2FX9H 4ZNEA 4H0IA 5TH2B 2P8MA 1MJJA 4M1GH 1GC1C 4WHCA 1NBZB 1CR9L 4KTDL 1BM3H 1NAMB 2NW3A 1HINH 3FRUA 1JNNH 3RVTC 2SEBA 3LS4L 1ETZB 1CL7L 2ADIA 5BQ7A 1YDPB 4HUVA 5CSGA 5KW9H 1U3HA 5L7XL 4Q97A 1Q8MA 3C5SB 1IL1B 3UEZA 1QUNA 3CPLA 3QDME 2BDNL 2MCPH 2Z92B 2BC4A 1Q9WA 4OCWL 2NYYD 4NQDE 4TVPL 5DHVB 4DZBA 3GIVB 5F96L 3QZWA 4OGYH 4XC1H 2NY1C 3MOQA 5D7IA 4F7MB 4HMDA 3RP1A 5GIRB 1YZZA 1MCEA 4NRYA 2IQAB 2Y5TB 2E7HA 4X80L 3UDWC 3QUXD 1KCSL 3I3BA 1E6OL 3OKLB 5GRYA 1AIFB 2P46B 2EDLA 4BSVB 3PGFL 2VXTH 1RK1A 2J6EA 4MS8C 3GJFA 3VGEA 3IF1B 5GRJL 4JFPB 3RWIB 4YNYB 2BX5A 4BK4A 3QUYA 3VI3E 3QWRD 4P3CL 4QTIH 5M7QA 3V4VH 1HILB 4OI9A 5BMFL 4BM7A 1TCMA 4ODXA 4JKPL 2K7PA 3DV4A 4XNZC 2XNAB 3QFJD 1KJVB 3EOTH 2W92A 5I76A 1OLZA 1JWMA 5MERA 1P5UA 1I85C 2G5RA 1QLFB 3AY4C 2DKUA 5DMJB 2NY4B 3V6FA 3PNWA 1T04B 3TH2T 5FYKH 3IFNH 4F7CA 1XGPB 3LEVL 2Y1VA 2FX7L 2VAAB 4G7YL 5ID0A 1HIML 4TPRL 3BSZL 4OCXL 3IS1X 4TUOA 4ONOA 3W82A 2NY7L 2ATKA 2DS4A 4OM1L 1INQB 1G6RH 4JQXA 2VLRA 1YNKL 1ZGLA 3IT8D 2VIRA 5ICZA 1Y18B 1F4WH 4NKOA 4P59H 1PY9A 3QUZB 2Q8BH 3SCMB 4IRSA 1QYGL 3KJ6H 3RWDA 4U0QB 3L3JB 1DCLA 2CDEB 5DJ0A 3UTSA 5KVDH 5L9DH 4HGWB 2AJXH 4X7EC 5F89B 1I9IL 2ZCKH 4UT9L 4WIQA 3PDDA 4FFVD 1DBML 3GHEL 3KPLB 4F33A 2VLJB 4P9HL 3TGXA 2CO7B 3IRPX 4KUCF 5L2KB 5IV2B 4M7LT 2YK1L 4YHYC 4S1RL 1H15B 4XC3H 3FQUA 1MHHB 4NRZA 1CDIA 3O0RH 4J7RA 4OCYL 2K9UA 3GJFH 2W07A 4NCC2 1CGWA 1CZ8H 5BRZA 1Z0MA 5KSBB 3MV9E 3HUJE 5T3XE 2ITDA 4B53A 4HD9A 4Z0BL 2NY4D 5C70A 5GJTL 4CDHA 4YHZL 5GZOD 4R7NB 3X3GH 1MCQA 1CIDA 4F8TA 4NNXA 4AEEA 4G8EA 5CEYB 1NJ9B 1ND0B 3NVQA 4LARL 3QEUA 1YYLL 2DD8H 2F8OA 3HPJA 3HB3C 1C5CL 2PF6A 4RMWA 4ZUVA 1DFBL 3QHFH 4HUXA 4LAQL 2OI9C 43C9A 4ZPTA 3BMVA 4QRRB 1ZT1A 3QUZD 5DEFB 3SCMD 3D39E 3U4AA 3FQNB 2ARJA 1PLGH 3WD5H 4CU7A 5EO9A 2A83B 4NHCH 3EJJX 5HI4C 1MFCH 4OLYL 5HYJB 5C0EB 1P4LA 4UB0H 4W70A 1CCZA 3FT3A 3U0TB 3HG1B 3SGKA 1I7UA 2Y72A 4RGOL 2FJGB 2VLJD 3DURA 4J8RA 4LCUB 4AK1A 4DOHB 1KF9B 1ED3B 4K9EC 4WFFE 5JOEA 5L2KD 1N6VA 4JB9H 3RWFB 2VZOA 1EO8L 1FG2A 1N8ZA 2DQDH 4PJEF 3ROOB 3D85B 1UGNA 1KIPB 1FAIL 2WAHA 3K81A 3DWTA 4I0PC 3WN5B 4X4ME 1T0NB 1FO0A 3LVEA 2B5IC 4JO1L 3L5WA 3TYFA 4EVNA 4OT1L 3SDCA 4XXDA 5GGSY 2RHEA 2QQQA 1IGIL 4PP1C 1W72L 1CU4L 2R1XA 4WTXA 3TH4T 3QRFM 1UZ8B 1H3PH 4ZODA 4J2XA 2IPTL 3EJYC 3ZDZE 4OCSL 1F3JB 1WC7B 1B2WL 2J2ZA 1G9NH 4HUWB 4J3TA 1NEUA 5DVKA 3WNMA 5DRZB 4Q9QL 1QVOA 4FFWD 1MCRA 5I2IB 2HT4D 3LS5L 5FA3B 1P2CB 5L6YH 1T2QL 5HPMA 4OLXH 1XZ0A 4OUUB 4P4RA 3BIKA 3MRJA 2E5EA 4QRRD 1AO7A 4L4VE 2IBZX 3MLTA 4J4PD 3LY6A 5HYJD 2APWA 2JCCE 1VEOA 4KK6D 1FGVL 2IPKA 3MRRB 3BN3B 1A4KA 3N85L 1DN0B 2OL3B 3HG1D 1Q0YL 1ONQB 3X12A 3C6LA 2X70A 4G8FA 2F54D 4PYHA 5E1HB 5FKAA 4XP5H 1RULL 1UYWL 3VFPA 5F1OB 4G42A 2VLME 4YZFE 5DS8B 1IGJB 2XQBL 3TV3H 3D85D 4LGSB 3GEWB 4PJEA 3I3EA 1YMME 3IDJA 4UINH 4QHMA 2YOCA 3GNML 4M93B 4BZYA 3MOBH 4WO4A 4WWID 1FNHA 3JWDL 4FQXB 3MV7A 4LLUA 2APBA 5FV1L 5B4MD 4XNUL 1FO0H 2V5SA 3BGMA 4HT1L 1FC2D 3KS0H 1UM6L 1SVZA 4KVCH 3RU8L 4L8CB 1PY4A 1R3KA 4WHTA 3BN9C 1QNZH 3O3UN 1XR8B 4N0UA 1FL5A 5C86A 5C08A 1JZ7A 1FZKA 3F7VA 3K8KA 3M17A 3SDDB 1RHHA 3O45A 4XMPL 1GGBH 4Y4HB 4LDLB 1O0VA 1JCKA 3MRQA 5A40E 1TQBC 3MSPA 2VB5A 4OZIE 3OR6A 3MRMB 5DFVC 5FGBC 3TCLA 1G1CA 4PJXF 1OTSD 2DQIL 5C0RH 4G9DB 4GW1B 4XPBL 5CEZD 5EU4B 1WT5C 4I77L 3A0OA 2B4CH 4G8IB 1A5FH 2PUQT 3IXTB 3GBNH 1OTTD 2DMCA 3PL6A 1QG3A 5L88H 4OZGB 4MVBC 2IG2L 4JDTL 4N0CC 2JIXB 2X10A 1JHTB 2BSTB 4LDEB 3MR9A 3D3VB 2AQ1A 1HDMA 4HUMB 3WFEH 5KS9E 1I7ZB 3FO0H 4FQXD 5TDNA 3BUYB 4UOW1 3K46A 4M7KH 3ZDYF 1Z9MA 1KV3A 3ARDC 3B8SA 1NGWB 2VWEE 2VQUA 4E41B 2RAMA 2FWOB 4Z76A 2QTEA 3DOSA 3BZFB 5KZCD 2DQCL 5A16B 1FPTH 2V7HA 4K8RL 3DYOA 4OLUH 2DMBA 3O6FA 4Y5XB 1J1OH 1CICB 4NQCB 3QZWG 4CGTA 3DO7A 4P2RE 4D0DA 3TT3H 4PJBA 3SDDD 5T3ZE 2I60L 3CSGA 1J0IA 4Y4HD 2EDBA 2VSDA 2CLVB 1RJLB 1I3RB 1HHJB 1DQLL 3MROB 5GPRA 1DJSA 2M1KA 4JFQB 4JZOA 4AIZA 3EDJA 5D2NC 1Z9LA 3OAYK 4JGMA 2E27L 3FFCB 4N0FB 4YK4C 1JHKH 3I50L 3D0VB 3GMRA 2R8SH 2D7MA 4NNPH 1NLBL 4HK0A 3TM6A 1RJCA 3T2PA 2AXFA 3W2DH 1AGDA 2EYRA 2JIXD 3RWCB 3ESVF 1UH3A 5H8DA 2FCBA 3U4EA 3ZT6A 3D3VD 4FQIL 3IU4L 4PJGB 3IJYA 4NZTL 1OP5K 1FDLL 4JFYA 2GEEA 4BA8A 1IFHL 3D25A 5TE7H 4P57B 5FHAH 5IW3A 3L1OL 2GAZA 4WDIB 1WAAE 3V4UH 1NANH 3T8XB 5A1AA 3TIDB 5I1DA 4WV1C 1F11A 4GFTB 1A2YB 2IAMB 8FABB 3T3PE 5BW7C 2GJZA 4E41D 5DUBA 3E6FB 3PJSA 1CGSL 1WEJH 4QF1B 2WP3T 2HFGH 4JFZL 4PJ8A 1KTKE 1A3RL 3RL1B 1CICD 1XGQB 2PW2B 2VLKB 4FQPA 4NQCD 4QHUA 2F58H 3JZ7A 3WIHL 3LKQB 3SDYH 3OXSB 1EJOH 1FYTA 1NBQA 3M1BA 1ZHLA 1EAPA 3SQOL 3ZZ1A 1CT8B 4NDMA 4J3UA 4YDJB 1FLRH 3SE9H 1YECH 3FFCD 3O3EB 1JRHI 3TA3A 1HXYA 2BRQA 4PJ5A 1F3DH 4X83A 3W9DA 5GS0C 4HJGB 1HXMA 4P23A 1HHHB 1IAKB 2VMFA 2JJTC 1J86A 3J7HA 4W81A 5KBNC 5DJDB 3JWOH 4OLWL 1NEZB 3DLQR 1WSST 1OGTB 3B2VH 4X8JB 5E2UL 4Y4KA 3N9GH 4K3JH 5I1CL 5F21B 1RJZA 5KVMC 2VDOL 4PV9A 3U0PB 1FFPB 4GG6A 2IAMD 4Y2DA 5GRXG 5GISH 4PYGA 3OGOE 2BVYA 3P30H 4D8PA 3MLRL 3QG6A 2AK1L 3GFUA 3TBYA 5HVWA 2R29H 3GMLA 5MI0B 4B41A 1LE9B 1DBBL 5F9JB 2UVEA 3WFBH 2VLKD 4XI5D 4QEGA 3GMNA 4NZDA 4X7TA 4PJCB 5IB4B 2C1PA 5EOTA 1YUHA 4YDLC 1CFQB 3TPUB 1U8PB 3OWEA 4JFDA 3GUTA 1S7XA 3RUGF 2DN7A 4ESKA 5EFIA 4Y19A 4P3DA 5F9WC 1QSVA 3G6AA 3O4OB 1CWVA 1MIEH 5HY9A 1OWRM 3WNKA 3HR5B 3N1GC 3GK8H 2ESVA 3FHQA 4P2QA 2VL5B 3ZKXB 5FM4A 1HEZB 5GGSA 5FB8A 5ETUB 1MRCH 3JVGA 1A6WH 1ROWA 3QIWA 4QHLA 5IQ9A 3W11C 4TSBL 5T3XD 4NQTA 1HHKA 2YWZA 3QQ3B 3UTQA 1QLRA 2HLAB 5EU3A 4XH2A 3HS0A 2EDQA 1WWCA 4LCCC 2IH3A 3VE0B 2JLLA 1AGBA 2VABB 1B9ZA 3V6OC 1P4BL 4G9FA 4DGVL 5FUCC 3DROA 2ID5A 3CZJA 1KG0B 3HNTH 4QCIB 1E6JH 1X7QA 1LEIB 15C8H 1FVEA 2AK4A 4CL7A 2YUVA 3BZ4A 4BZ2H 2DQJL 3U7YL 4KJWD 2N1KA 4S1QL 2JB5H 4XWOD 4LSQL 5ID1B 1AE6H 4ZS7L 1CDBA 1KGCE 4GLRI 2JCCB 3UDWA 1T1XB 2C7UB 2DQEL 3DETC 4KRMB 5HXMA 2Q3AA 1MCKA 3MRIB 2XTJB 4IOIB 4L9DA 1RUMH 3WE6A 5IW1A 5EWIL 4YAQB 1OT1A 3KJ4B 5F1NB 1J5OH 3JXAA 1BQLH 2ZG1A 2XZQH 3MRPB 3VGGA 3BKMH 4PGCA 2X89D 4Z18A 3VG0H 4YPGB 2WZPD 4RQQB 3B9KC 3MRKA 5JHDB 2ENYA 4YIQB 1YEGH 4BH7B 3VD9A 3VXSD 4YEFA 4LEXH 2YPVL 1ORSB 1DBAL 4ACPA 3IFLH 4HZAA 3C5ZB 1AKJA 5LAXB 1I85A 1BOGA 1UG9A 3GO1H 3O8XD 3AY4A 4QRQB 2VDNL 3MGTA 4CNIA 1T1WB 4IOFD 2FJHB 3GB7B 5JDJA 4IRJC 3SDAB 2XZCH 1T83C 3OJDA 2J4WH 4DGYH 4YX2H 2BOCB 2A6DB 4G43B 1T21A 1OAXH 4BJLA 2V5TA 4OTXH 5IHUL 2FRGP 3E8UH 4ZFZA 3DX7A 1ZT7B 1NC4B 1J8KA 1UM5L 1ZHNB 5GSRA 4NC1E 4PJDE 2EXYC 3PG2A 4EBQL 1LD9A 4JKKA 2HT3C 4OLVH 3WFDL 1HHIB 1T0PB 5HDLA 4YDKL 5IVXF 5HI3C 5DQDH 3S96A 1YPZF 3HI5L 4NWTL 1ZT4B 2J12B 1OAZL 3BHBA 4QO1A 1N6QL 5D1XB 2QQNH 2XTJD 3L3OB 4BFBD 4L8DA 1FNEA 2PO6C 3CFBB 1GOHA 4NUJB 5I1GL 2X7LA 5B39A 4JY5L 5C0BE 5E94A 1AXSA 2AQ3A 4FXGB 4HKZB 2R0WH 5JHDD 4LCIH 1P1ZB 2PXYB 3BQUB 1YA5A 1P7KB 4RMQA 3OB8A 2APXA 1CLCA 5GS3A 2W9DH 1RJYA 4NPYB 5FHBH 3FT4B 4EIGB 3C5ZD 5I1AA 3QAZB 1KLUA 3RWHB 5CINL 3G5XB 4LLWB 4R96B 3WS6C 3EUUA 1QHPA 1P6FA 4XAWL 1RPQA 5I6XB 2NYYC 3GI8H 3LKSB 1KC5H 5DJZB 3SBWC 3HE6B 1NGXA 1RURH 1D5ZA 5F7EL 1YEFL 5DMIH 5E5UB 4AENA 2XN9E 1NCWH 1RMFL 1GIGL 3IDIA 4U3XA 1NC4D 3HMXH 1K4DB 2HH0L 3PWLB 3QUXC 3WXWL 5B22A 1RZ7H 5IM7B 2H2SD 2K3TA 4P5MA 2W0PA 4NP4L 5TE6L 3WXVH 4BZ1L 2C3GA 1JYWA 4UQ3B 5D1XD 2P47B 2J8HA 1YY9D 3ZLQC 4NIKB 4OD3H 5EDXA 3BRGC 3P73A 4WJ5B 4GOSA 4Q74A 3DRTB 1ZAGA 1S7TA 4M5YH 3OL2A 2PXYD 3BQUD 1R3LB 5ESAB 3U6RA 1FH5L 3EBAA 2OZ4H 4NQEA 4JFOB 1IGFH 1LE5A 1U91B 3P11H 4I0PA 1I1FA 4JM2F 3U48A 2IGFH 4X6BB 5FGRA 5C9JB 3EDKA 3VD7A 4E5XA 1OWWA 4JRXB 4YHLL 4PRNB 3GKWH 4Z7UF 5FF6B 1U6AH 1LK3H 3NBNA 4JREB 3HC4H 4JG1H 4PD4K 1EERB 3HE6D 1JNLH 1CLOL 2R4RH 5IJKC 2FR4B 1P84J 4IS6A 5I8EA 1TZGL 4FQLL 5D5MB 3VFNB 1MQ8A 1ORQB 1JF1B 4GAGH 1I9JH 1B0GB 3RY5A 1BQHB 4FFVC 1JGLH 2ADFH 4OLZH 1BREA 2ILLA 3FQTA 2NXZB 1URLA 4DTGH 4WW1A 1VEMA 2P48B 2GCYB 4K8RD 1CE1L 2UWEA 2JKXA 2F74A 5E8EB 2Z9TA 4OKDA 3K1KC 3CLEL 3W0WB 4JPWH 2FX8L 4KFZC 3QXAB 5DSCA 1VFOA 1ZLUK 5KANI 5TDPA 4OIIL 4NKIH 5TQ2L 5I74B 5IIEA 1IVLA 4HXAL 5IBTH 3RKPA 1UQSB 3MX0A 1SEBB 3DBXB 3V7AG 1FAKT 4FFYH 4U6HB 5JA9A 2C3VB 1FV1A 3FOMA 4OZHB 1W0WB 2PCPA 3ECBA 1QFUL 2NY4C 4HIHA 2P24A 5ICXA 2DKMA 1FBIH 1QKZL 3E3QE 4FQJH 5GZOC 1AC6A 4JM2A 5T5FH 3BP7A 3OAZK 3MRGB 4M48L 4MDIB 3RNQB 1T1YA 3EZJB 3VWJD 1AC0A 1A6VL 3MNVA 4JRXD 3OKOB 3D69A 3QG7H 2WWMD 3D9AH 3X17A 2GY7B 2P5EE 1NSNH 2QV2A 1L7TH 3NPZB 3L3GA 3MGOB 1JHLH 3R0NA 5ERWB 2B2XL 1T3FA 5HDQH 3TNNA 3MRDA 3C8HA 4XNQA 2X4RA 4XXCC 3QUZC 4ZQKB 3VGHA 3SCMC 3KHQA 1MFBH 1XGTA 3NFPA 4D9LH 4N5UA 4QHKI 2J8UF 1JGEB 3GSNH 4M8VA 2P7TB 4RWYL 4YEEA 5I8CA 4X98B 2IADA 4CW1A 4ZFOA 4KJPD 3PDOB 1BVKA 2ZCLH 5F1IA 4WFGE 3CK0L 5IB1A 3V0VA 4QXUL 1IGTA 2DLGA 5T1DL 5FGBA 3CLFH 4NOFA 2NXZD 3L3DB 3BXNB 4OKVA 5SX4H 2X1PA 4WI3A 1NKRA 1WT5A 1H3UA 3VRJB 2NX5B 5DJCB 4A2LA 1K2DB 4JGJA 4YGVA 5DRWB 3RPKA 4LHQB 1I1YA 2WUCL 4FZ8L 3W0WD 5DC4B 4X7SH 1U8HB 2M2DA 4EDWL 5MEOB 4AG4H 4QY8A 2O26U 2QHLA 4K7PY 5IOPA 5TQ0L 3OSKA 2IH1B 4U1HA 1J0YA 1NL0L 1RIVH 4P5KB 5JW3H 1TJIL 4YQXH 3BJ91 2OQJA 3F12A 3F6LA 2AGJL 2GK2A 3ES6B 5MP6L 5KSAB 4LSVL 5MEQA 1MAMH 4EQ2A 1AGFA 1OOAA 3S36H 3RFZC 3Q6GH 4FFWC 3OTTA 3ARDA 1UENA 2HT4C 3T08A 3SDXF 1QR1A 4G8GA 1IGCH 1K6QH 1MF2L 4Q0XH 4X6DE 1PKQE 1KULA 4FABL 4OI8A 1FYHB 5IG7A 2F5AL 5IKCA 1LMKA 4RISL 4LLMB 3LZFH 4N1CA 1ZVYA 4YHKL 1U8NB 3C8KB 2OJEA 4J4PC 3DGCR 1V5JA 2HFTA 1T22B 3IXAA 3QXUA 1S7UA 4KK6C 4O58H 5MHSD 1T03H 3V5HB 2Y06H 5ACZB 4DZ8A 4XPTL 1PAMA 1BD2A 2FHCA 4N8VB 1U8KA 4ZYKB 4KZEH 3P77B 5D2NA 3WKML 4N1HB 3OAUH 2NX5D 5I19H 1WIOA 2F53A 2XPGB 5DDHA 1C16A 4U1SA 4DN4L 2YPLB 1JWSB 5J56B 3CU7A 1V7NL 5E95B 3WN5C 4PY7B 1UACH 4I48A 3VXME 2DBLL 5TGBA 4HAGA 4WFHE 3CVHA 5A43C 3GMQA 2FD6L 4PJAB 2IALA 4ZD3H 4XB7A 4HEPG 5EIIB 2AKRB 5B4MC 5ENWB 1IRAY 4N8CL 5ALCH 4QRPB 3TT1H 5KSAD 5BZDB 2ZKHH 3ARQA 4X5WB 5D2LE 1Y6NR 1REIA 3NIGF 4WV1A 2CK0H 2BNRA 5ISZE 3MLVH 3EO9H 5LXGL 1AI1L 2LAGB 3DYPA 5BW7A 1Q0XH 1S7WB 4YE4H 1MPAH 3SDXA 1WWAX 3FTGA 4UUJA 1OARL 2MWCA 5F7WC 4ZNEE 3EKCA 3NACL 1MSPA 5EZJA 5L8KB 4MSWB 3BAEL 1OTSC 4HC1L 2QSVA 2VXQH 5C9KA 1VFUA 1JGVH 2DYPB 2MPAH 4KI5F 4TQEL 2EIEA 4OCMC 4JKMA 2B1AL 1KN4H 1CFVL 1OTTC 1C5DA 3N1MC 1UA6L 1NFDE 4NHUB 2X4UB 4FZEL 1OAYH 1RK0A 2LAAA 3QO1B 1C8PA 4PJHF 1SJXA 4ZPVA 4AEIH 4WUUA 2YPLD 3HC0B 2Z93B 3RQ3A 2I25N 4QTHA 4F7PB 2RJMA 1KPUB 3SEPA 5EBLA 3VXOB 4MA8L 2DM3A 1TZIB 5A2IH 4M93C 4HZLA 1ZHBA 2AEPL 4MAYD 1R5VB 2EIDA 4FQXC 1RZ8A 1FJ1A 1BWWA 2CRYA 1VGKA 5BV7L 3OJ2C 5DJ2B 4EJ1C 4NO2A 4JDVA 4QRPD 1QBML 4F8QA 5D6CB 1Z0NA 3CVHH 2VITB 3ZKMD 3Q1SL 5C07A 5J06A 1IAOB 2YD3A 5E8DL 4P2OB 2I27N 4Q9RH 5KVEH 5DO2D 4KRPB 5DHYA 4B7LA 3SDDC 1FZJB 2JTDA 4KI1A 4S1SH 4Y4HC 2HG5A 4MD5A 3RWJA 2AJYH 2MMXA 1SJHA 4FQCL 3GSUB 2FZ3A 3LRSA 5AAMA 2DLEA 2E7LC 1CFTB 2GUOB 5CFHA 2BHYA 1B4JH 1A9BB 3BP6A 2W0FB 1NFKA 4OAWB 4HF5L 2AEWA 5DJYB 2DYPD 2XY1A 1S9VA 4HV8B 1H0DA 3KR3H 3QUMH 1OAQL 4XHQA 3MLWH 4BSWA 4JPVL 2VLRE 3FONA 3VDAA 5HDOA 1N26A 5DR5L 5ESQB 4O51B 1I1CA 2Q86B 4ZFGL 1F6AA 4M6OL 2X40A 2NW2A 4NYLA 4PG2C 4U33A 1ZLSL 2DDQL 3UTSE 4I13B 4JY4A 2R2BB 4LCCA 2JJVA 5H37H 3ULUL 4POUB 3V6OA 1R5IA 2DQUL 3F5WB 5GS0H 3HA0A 3QA3A 4AM0B 4LK4A 5ANMB 5E8NA 3CMGA 4KZDH 1UB5B 1BBDL 3QJHB 2Y36L 4NQVB 4Y4FB 1INEH 4XVTH 4MNHA 1DZBA 2NY2B 3E1F1 4Y5XC 1BFSA 1P7QA 1CICC 4ODTH 4LEOA 4M8QA 4P2OD 5CGYD 4DAGL 3TBVA 2FJFA 1FVDB 4KRPD 1KCRH 2FIKB 2BVOB 4I9WE 4A6YH 4O02L 3NFSL 5BRZE 3P9LA 4M6MH 1HQ4B 4PUBL 1MI5A 4M7JL 5BS0A 1G7PA 4LQFH 5J4MA 1GPOL 3B9AA 3NOIA 3MLZL 1SMAA 3TNMA 2BMKA 1RIHH 3R1GH 4PGZA 4U05A 3AAZB 3AU1A 2R39A 4LLAA 2OR9L 4D3CH 3M45A 5IMKB 1XF2A 4JO3H 3R06A 3B9KA 5EU7C 1I7TA 3NFNA 1IGMH 4KK9D 2MKLC 5LWYL 5IBLD 4UIKL 5IMMB 3O2WL 4KJQD 4ZTOL 5LKNA 1W0YT 2C3HA 1J1XL 4OGZA 1INDL 2P1YA 4WU7B 3QEQB 1WFOA 5C0GA 4OZ4B 1F90H 4YR6B 2BY3A 4IRJA 4UT7H 1T5XA 1W8OA 1T83A 5D70H 4TNWF 2EH8L 3VH8A 5D7LA 2IAMC 4ISVB 2VLLA 2PW1A 5J13B 2AJZA 4YLQT 1MLCB 1BFTA 3MJGX 3L9RA 4OGXL 5IB3B 2R4SL 4Y4FD 4O9HL 4M3JA 2NY2D 5IQ7L 4MXVE 3BWAA 5T1KB 1JV5B 4XI5C 4Z7NF 3O41B 5CAYB 2OJZL 1I8MA 3ARUA 3IYLW 4JPKL 3QIBB 5KVGL 1GOGA 3Q5OA 1UVQB 1BJMA 1ZANH 4PBWD 1QSFA 3DUSB 1MJ7L 4KVNL 4NFDA 1I3UA 2PO6A 3ZYIA 3E6HB 2PKDA 3DIFA 3CZFA 5CLWA 1ADQL 1CYGA 3QULA 5LQBL 5DGRA 4H20H 5FYJH 4BSJA 5L2JA 1OVZA 2HTLD 4NSKB 3PWJB 2R2HB 4NNYB 5LBSL 4PV8A 4D0CB 4HS8H 4KQ3H 1T20A 2CRIA 2MCG1 4I4WA 1M6OB 2ICWJ 1KSRA 2F5BH 3DVNA 3IAPA 1AO7E 4JPIB 4P0DA 5CJXC 3EYUH 4JFFB 3WS6A 1ACZA 4R90H 3QEQD 4LVNB 2VDRL 5E2TH 5DK0A 3QH3B 4ETYA 4X6DB 5CJ8A 3P2TA 3HMWH 2O5XL 1F3RB 3SBWA 4KJWC 1YEJL 4K7F