2G75B

Crystal structure of anti-sars m396 antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDYVFGTGTKVTVLGQPKANPTVTLFPPSSEEFQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG Heavy Chain
publication title Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 211
sequence length 211
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75B01
5FUCE 4O2CA 5FECB 4J12A 3AB0C 3WFCL 5E08L 3T3ME 4HH8A 1ONQB 5EBWA 2X4NA 5F7HA 3NFPB 1JPSL 4LLYB 2F58H 4A6YA 3W0WD 2J4WH 1DUYB 1H3PL 3AU1A 1LD9B 4XVSH 4IOFC 2OJEB 1B9ZA 3WUWA 1QSFA 2PETA 5DYOA 1OAZL 4GMSH 5SX5H 1LEKB 1JF6A 4MA3B 1UH4A 2P5EA 5T5FH 1GZQB 3CX5J 4ONGH 1ZHLB 3RA7H 4X83A 4S0TD 5D7LB 3ARGA 1KB5A 4Z8FL 3VW3H 1NPUA 3ARFA 1F97A 2D0FA 3B9AA 1JK8B 2HFGH 4FZ8H 2XWBB 5JO5B 3T0VA 2WZPD 4XT1C 1MHEA 1M71B 4JDTL 4X99B 5EBLA 5IM7B 3UC0L 2P4AB 1KC5L 1GC1C 4PYGA 3W39B 4PRID 5J9PA 2RQ8A 4APQA 2D4DA 2HFTA 1T03H 5TH2B 3O3EA 3VD7A 1KTRL 1JTPA 2CIIB 2V7NB 4LNRA 2GQHA 3S34H 1OT1A 3IVKA 3C5SB 4RAUA 2A0LD 4YHNA 2EZ0D 5IQ7H 1BIIB 1HH6A 5ITFA 1RK0B 3KPLA 4WI3A 3S96A 1J0YA 3EGSA 2Z91B 4NJAH 2BXYA 3QFJE 3I2CH 1MNUL 3VXRA 3T8XB 3GKWH 3FN0H 2ZUQC 3FB5B 5CGYC 1EHLH 1INDH 4UNUA 3IDYC 5D70L 5H35A 4DVRL 2W9LA 3BGMA 2PTTA 2Z0BA 3OX8A 4OF7A 4KK6D 1A6AB 3TYFB 1B6DA 1NAKH 3I6GB 3I85A 5C0BA 2XICA 2VH5H 4P5TD 2FX8H 1VA9A 3CPLB 4HGKC 3UBXB 3MMEA 3IU4H 5JXAH 5DZOA 1U3YA 2L4OA 4JPIA 4R4BA 3C60B 2J8UB 1JUFA 1UWXH 4ENEC 4TPRL 1B0RB 3JV6A 2RCSL 4FQ1H 3ECBB 4MWFA 3QQNA 4KVNH 2ZSVA 3WXVL 1I3GL 1I85C 4LHUB 3LOWA 4JZOA 4WFGD 1CFTB 4U1IB 2ICWA 5TDNB 4PP2A 2MHAB 2C26A 4UTBL 1L0QA 3GDBA 4YXHH 4ZS7L 4Q2ZB 3VGAC 4ZUSB 1A7BA 1K2DB 1CLCA 3P4MB 4XBGA 2VLJB 2DAVA 1L6ZA 4AIOA 3BVNB 3C9NA 1F4YH 1GPOH 4U7SA 3MR9A 3O2DA 2VNCA 3VGFA 2R4SL 1UJ3C 3SGEI 4K71C 4APQC 2Y06L 4RIRA 3S35L 2AVGA 4MCYA 4O9HL 3V7MA 5DD0H 4YHKL 3HNTH 3ARQA 4JO4L 5HGDB 3WD5L 3HNSH 1NBZA 3SGDH 4J3XA 5H8DA 1J87A 1HEZB 2R0ZL 1J0JA 4JQIH 1LO0H 2G5RA 3O11B 1JGLH 3TZVD 1K4CB 2V17L 3I50L 1OP3H 4GBXB 3PABA 5D1XA 1YUHB 4OFVA 4YGVA 3HE6B 2P8MA 2X4OA 2X1PA 2NY5L 1ETZA 3QCTH 1OAYL 2K3TA 4PJAA 5IGXH 1E6JH 5E03A 3CXDH 4IIQA 2C3WA 43CAA 3H9HA 1SYSB 3NTCL 5D2NC 3THMH 5FKPA 3IKCA 1VFAB 3CFDB 2ARJQ 3QUYA 3QHZH 4PS4L 5CJ5A 3WHXB 1UH2A 1PYWB 5HI4C 2EDOA 5GSRA 1I9IH 3BPLB 3V5DA 4JHBA 3L1OL 4GLRH 3VXMA 5F1IB 4JB9H 4KV5F 1K4DA 1EHXA 3TN0C 4Y1AE 2NTFA 3DVGB 3B6SA 4LCWD 4QOKE 3RTQD 4IRJC 4DW2H 3JTSB 4K23H 4KRNA 2FD6L 2UWEF 1JHTB 3FB8B 2GJ6A 4OCLC 3OL2A 1UZ6F 2D7OA 2DI8A 5EZIL 3H3KA 1VB9A 3MCKA 3RWDB 4ZFGH 1EXUA 1XGUB 3EJYD 1ZHKA 3ARYA 4PP1C 5FHBL 2NY7H 1AQDA 4YC2B 3RGVC 4FA8A 2VDLH 1G7JA 5F3HB 1LO4H 5IMMA 4JG0L 3K4ZA 1WAAA 4MJIE 5CINH 1KTKE 5CBAB 4XPFH 4YBQC 1P84K 2NY3B 5IIEB 5K9OA 2Q8AL 3OKMA 5CJQL 3MGTA 3UTQA 1C1EL 2YPLE 4QRUA 5KS9A 3N1GC 1MHCA 2BVPA 3U36B 4ZUWA 5J6HB 3QIBD 3FQUB 4L8SC 4G5ZL 1QYGL 3EJJX 3V6OA 2ATPA 3VFOA 2GY5A 3EOAB 4LHJB 2VC2H 3TJEH 2VIRB 3OGCA 2A2QT 4JFQA 1VADA 3ARBB 4DQOH 4J3WA 4YHML 2M26A 1F6AA 1DN0B 3DJ9A 3BIAX 3T0AA 1CTOA 1ZE3C 4LU5H 3GFUA 4YHIA 1WBZB 2XZCL 3B9KD 5D1XC 4ZFOA 4YHLH 2H1PL 2AJ3B 3MRNA 4O02H 2MSPA 5D1ZD 5D96B 4AL8H 5C9JA 4FG6C 2YHGA 3UCRA 3W2DH 4HDIB 3FT2A 2L7JA 3MRMB 5L8LB 2YD6A 3L3GA 4K3EH 4IIQC 3CFCL 2X89A 3KYOB 2XWTA 5HYFA 2H6PB 3FQTB 1KIPA 4MA1B 3VRLE 3CCHA 1QSEA 5EOCJ 1QA9B 1FLRH 4Y19E 2Z31B 4BUHA 1NGPH 5JQ6L 3DVNB 4KDVA 3E2HC 4XPTL 2WIIA 3MXWL 3QUXB 3V5HB 2NY6C 4WIQA 4AG4H 2B1AL 4H0IA 4WDIA 4ZS6D 3GBLA 2DQCH 3EYFB 5EZLA 3DO7A 1FE8L 5E8OB 3NIFE 4L8CA 1V3JA 3SDDD 1D5BB 3MFFA 4I3GA 5B39A 3ET9F 2X1XR 1RUKH 1QBAA 3UEZA 2DYPD 4HWZB 5E94B 3O9WB 2Y5EA 1M7IA 2NLJA 2X4SA 4EVNB 1NFDA 3VFNB 3VI3F 2DL2A 5HHOE 3TT3L 4RMUA 4GXUN 1I9JH 4PRPD 4Q58C 4PJHF 3U7YL 4NNPL 1F4HA 3WLWC 2DKSA 2R15A 4K94L 1VEMA 3QO0B 2SEBA 3V6OC 1GGYA 5HYJB 4DKAA 3L3KB 2F53A 4CVWA 4XMLL 5K33A 4FXGA 5I71B 4ZUTA 4U1LA 43C9A 5CWSA 2DQJL 3RNQA 2VLLB 4Q6IC 4RFOH 4DOHE 1OAUH 3HG1E 1YEDA 1UM4L 3TNNA 4QHUB 1U8KA 1Z9MA 3U9UA 4AM0A 3TFKD 1ZLVK 3MRLA 1CQYA 3QDJB 3I6LE 4RBPK 4ZQKB 1I75A 1AO7D 1GSMA 2R4RH 2PKDA 2W59A 4RGOH 2DQDL 3CXHK 3SDXB 3O4OB 3U82B 2OR9L 2DDQL 1UXSB 3G6JB 5B39G 1MSPA 5IQ9B 5DVOA 5KSVA 1YDPA 3CLFH 3QJFA 3FFDB 4GW5A 5D7IE 5D9SA 2VE6A 2ITCA 2WAHA 4PGBB 5DMIL 2CJUL 1Q0XH 1FNAA 2D0GA 3X12A 1H5BA 1X5XA 1MREH 5DJ6B 5DF0A 1ED3A 2GTWB 1I4FA 4HKBA 4MDJB 2GJZA 3PWUA 2R23A 2YUXA 5HGHB 3DX8B 3PWNB 3BP5B 4FQ2H 5D8JL 3C2SA 4HT1H 3MZTA 5HYQB 3MNVA 3ARED 1IC4H 1OTUC 4GS7C 3D6GA 3BDYL 3TBYA 1Z0MA 3W0WB 4H5SB 1AGDB 3ZHLA 1VFUA 4NQTA 2CDFA 1DBAH 1WGOA 2Q86A 1XCQB 1HE7A 3BP4A 3MRPA 5EZJB 1XF5B 5I1GH 3WIHL 4L4VD 1NAML 3B9EA 3AXLB 1HCFX 1ZOXA 4WHYH 4ZAKB 4U49A 2DJ4A 2C4FT 5K9KB 4Z0BH 4AEIH 4M7KH 4EZMA 1IKNA 3F7YA 3LQAL 1PW3A 4O2CB 3QEGH 5DJAB 5EN2A 5FO7B 1OAKH 4FMFA 3TYGH 3TESA 4FQCL 5EUOB 4I2XA 3UYPA 5EFIA 1EFXD 4ONHA 2QADC 1O7SA 1FGNL 5C0AE 2IADB 4JGJA 3DXAD 3N50A 3AU1B 4YDVB 1AGFA 1KIQA 1KCVL 2H26B 3ARDD 5BOZG 2FLRT 3RU8L 3BEWA 4RISH 1OHQA 3STBA 5E9DE 1J8HA 4M48L 4OLXH 4LVOB 1AXSA 1NH6A 2P5EB 4FMKA 2E3VA 2O93L 5F9JB 1ERNA 4GKNA 4GAJL 4TRPH 4JE4B 4H88H 2B2XL 4OM0H 3ARGB 4RWYH 1OF2B 3ARFB 2IQ9L 3KYNA 5FO8A 5T3XD 1Q72H 4DWHA 1NCDL 3MUJA 4N5ED 2PUQT 1BBJA 2GY7B 2IQAA 4NOFA 3NABH 2FSEA 4BFGA 4FHBD 4P5TB 5I8CA 3RVVD 3O3EB 5KG9B 3HI5H 3MA7A 2R0WL 1GXEA 3ZKMC 3KJ4B 3EDKA 4E41D 4G6ML 3RP1A 1AR2A 4PRHA 3S96B 3KPOA 1YEFL 3HZMB 5I66B 2VDPH 2YWYA 4OGYH 4KTYA 3VXRB 1MJ8H 3HZYA 3UYRL 5KVEH 2KZ1B 3IXAB 4JQVC 1CXHA 1W72B 4MZ2A 5H35B 1E4KC 3OB0K 5CZXC 2Y5TB 1CICC 1U36A 1X44A 4M93C 3OX8B 5KVGH 2F54A 4JM4H 3QDMD 3WS3A 4U1HA 3PQYA 1GRWA 1PY9A 1X4XA 5FF6A 1BQUA 4GUPA 5BO1L 5BZWA 5CD3A 4XCFL 1AH1A 3F7RA 3LV3A 5SX4H 2CH8A 3Q5OA 1TVHA 3BPOB 1IFHH 3BEVB 4WWID 1F6FB 3I84A 5DK0B 5ID0A 7FABL 4JRYA 1T22A 3LB6D 1CLZH 4QYOB 3GI8L 3V95A 1NBVH 2FCBA 3CZJA 3TA3C 3B2VL 1YPZE 4PJAF 4UIKL 5CUSH 1IVLA 2ZCHL 2CPCA 35C8H 4MHHG 4PJGA 3TZVB 5J13C 5CILL 1A7NH 3SO3B 1YN7B 2CLRB 3EHBC 4KMLB 1OVZA 4WNQB 1RAMA 4JHAH 5L0QB 5BVPH 4LEXH 1FPTH 4YJZL 5ERWB 3T0WA 3HC4H 5IFAH 3MR9B 3V52L 3KVQA 2QKIB 2OTUA 2V2XA 1HKLH 3RAJL 4PJEE 2R29L 3KNBA 1DVFD 1NMCC 4BFIA 3BRDA 2APTA 3IFNL 4HMEA 4JG1L 3KPSA 4MCYB 1CL7L 4XI5C 2HTLC 1CT8A 1RFDL 3ZSTA 5C0NC 1NMBH 2HAZA 3I02A 1V05A 3RNKA 4X6CB 1NBZB 4MNGE 4XZUA 2DS4A 2XKNA 1U8PA 2QHRH 1WAAF 3GIVA 3I3EA 4RMWA 3V8OA 1F58L 4RWHA 2CXKA 3MREB 5TDOA 5CJXA 4P99A 4HG4J 4LCWB 3RTQB 3ULUC 1KELH 2G5BB 5KS9F 4B41A 4KKLD 4UQ3A 5GISL 2P8MB 3DRQA 5DGRA 2X4OB 1S78D 3VJ6A 2GKIA 1MRCH 4UBDD 4D9RD 1S9XB 2YN5A 4FQXD 2ITDB 5GZOD 2FL5B 5MENE 4F9PC 2AERT 4WEMB 2ZWLT 4JY4A 5ALCH 3QUYB 1A9BA 3MRQB 4YEEA 2YMXH 2BXZA 2HKHH 5EC1B 1AD9B 1KIRB 1G7QA 2GHWB 2K1MA 3EOBB 5TGBA 3V5DB 1XR9B 4M9OA 4O5LH 4Y5XA 3VXMB 3MJ9A 3IDIA 1LO3H 3GSQB 2VLRA 4I3SH 3TV3L 4JDVA 3B6SB 1BLNB 4UIMB 2ADGA 5ESQA 3VU2A 2C9AA 1MPAH 2IG2L 2WIMA 1CS6A 1DDHA 4HPOL 4Q9QL 3FO9B 1R0AL 1BJ8A 2CKBB 2P5WA 1AP2A 1R3KB 1QR1B 1EXUB 5IJKC 2QQNL 4HCRH 4U6YB 4ALAH 4CU8A 4GG6A 3A6BL 2X10A 1S9KC 2XXCB 4XMKH 3LS4L 3PWJA 5D1ZB 5IMMB 4PGZA 1BGXH 3NZHL 4W68A 2IAMB 4JCLA 1FRGH 1FL3A 2DQFA 1D5XA 3IFLL 3FT3B 2FB4L 3V0AC 1CD8A 4P2RE 3GUTB 1F2XK 1SM3H 2D0HA 3PP4L 4QTHB 2WUBH 2EYSB 4RGNC 5MI0B 4ZUWB 3K1DA 3RHWK 1GC1H 1J88A 1N5YH 4GKZA 2JCCE 1OP5H 2HN7B 2RFXA 3NACH 3SOBH 3VFOB 4ZODA 1HYSD 1SEBB 1C5CL 1NFDF 4ZXBA 5JMRA 4G9FA 5F1KC 4YXLH 4XNQB 4QGYA 5CJXC 1KG0B 1IBGL 1BAFL 3JBG7 1G7HA 3QCVL 4CVXA 3SGDI 5D2NE 3MRNB 3Q2CA 3BT2H 4HIJA 4P2QE 3SDDB 3AMLA 5C9JB 3FT2B 2LAGB 2FECI 5B8CC 2DYPB 3L3GB 3QXAB 4EUPH 1IEAB 4X5LA 4TUJA 5FYJH 1CWVA 2DJSA 3HZVB 1MCDA 3N9GL 5C0FB 2I9LA 3GJFA 1A6WL 4OBSA 2C7UB 3ZTJG 1KPVA 3OPZL 1RSFA 4J3TA 4PUBL 3FO1A 1M1SA 2YZ1A 3EYVA 4PRPB 1I8LA 2OZ4A 5HGBA 2ZOLA 2DWDB 4A6YH 4G8GE 4QRRA 4WO4D 2Y07L 3MLSL 3IDUA 5HI5C 2CLVA 5C09E 4HHAB 2XQYK 2XZQL 4QRPD 3E8UL 3G5VB 4K2UL 4GLRI 1AGCA 2B20A 4ODHH 5HHXL 3S3SA 5I6XB 1T83C 4K8RL 5KSAD 3MSPA 3UTPD 3QXWA 1UB6A 3AS0A 2JELL 1WJ3A 1TNNA 3NZ8A 1M7IB 4NDMA 2NLJB 4YQXL 2D7NA 4F15C 4NBZB 1EHAA 2ICEA 1LE5A 4Q74A 4L1DA 4YFEA 3P0GB 1KB5H 1X5LA 1OSPL 4XBPA 3V0WH 3UO1L 2AKRA 3QQ4A 4H1LH 4X5XA 3ESUF 1N0XL 5ANMA 4JGUA 4XCCH 4KC3B 4NKIH 3U79A 2ED8A 4KTEH 1N6QH 2EDQA 2ZSWA 2EDTA 5DC4B 5B4MD 5KSBE 4K3JL 2AXFB 5HYIA 4OLUH 2EKJA 2DQIL 3FFCD 4M8QB 1ZLWH 4ZXBC 1AGEA 4BKLB 1S7WB 2LVCA 3MV9A 6CGTA 4XMPH 3DHMA 4DCQA 5I19H 4PJXA 1PKQB 4MVBD 4OZHA 1FO0L 2OBGA 1GH7A 2X7LA 3AREB 4AM0B 2W9EL 1QG3A 1T1YA 2EYRB 3JWDL 2AV1B 3WNMA 1MJUL 4DZ8B 4CMHB 5DD3L 3FHQA 5BZDB 1G7PA 5GS0C 3CIQA 2MOVA 3QUZC 4Y89A 2PO6A 2ZOKA 1CK0H 3D5OF 1A6VL 1T5WA 5IB5B 5KSVB 5ACZA 3G6DL 1YYMH 4EQ2A 2VE6B 4HIXH 4L4VB 2GSGA 4J2XA 1Y6NR 4R26L 4W4NA 3TT1L 3U83A 4ZNEE 4QXWA 3GK8H 2ZPKL 1HQRA 4ZSOE 3IU3B 2FJGB 1ED3B 1E27B 2FHBA 4HFWB 4FS0A 4R96B 3DGGA 1JMZA 5D2LE 5GRUH 1NUDA 2P24A 3MNVB 2YD4A 1EFXB 2JB6A 3D2UD 1BZ7B 3VXPA 4NWTH 4CADB 3WKNA 2H45A 4LSPH 5LGJB 2CDFB 3DX7B 2GCYB 3ARDB 2WWMD 1IE5A 1QBLH 3A6CH 4KK9C 5SWQA 5AG8A 4ISVB 4M3KB 5GPRA 1RD6A 3T2NH 5E2TH 1H8OA 3DI3B 1CR9L 4Y5YB 3U0TA 3D39D 3O2DH 3PWVB 4KZEL 3NFSL 3WO4B 3LSOA 1G6RB 1MCSA 4YAQA 5EUKB 2DIBA 3F7YB 4NGHH 1ADQA 4R97B 5GJTH 3EJZC 4X7SL 4XB8A 1CZ8L 2AEQL 4ODTL 3QQ9C 3OXSA 2BRRH 1RZFL 3HI1A 4PB0L 1P84J 2BCKB 4TOYH 2F8OA 3E1F1 3P11H 3HE6C 4MMZC 2BNQE 5FGCE 1KGCD 1KN2L 2E8YA 2OQJA 3RX7A 3IB4A 4HJJH 4PJ7B 5IHBA 4FFVC 4L5FH 4X8XA 4YHOH 3LEVL 4JM2C 5HHPA 5ALBH 1AQKL 3M1BA 1B2WL 1CDIA 3PGDA 1FIGL 4JRXE 3WFEH 2FX7H 4Z7QF 1CLYH 4GKNB 2QTEA 1VERA 5IK3A 3EO9L 1S7UB 3WL9A 3LKQA 3BPLC 5TDPB 1U2HA 2YXFA 3D25A 3J8F7 1J10A 1NSNL 5GGQL 4CW1A 2W0KA 5F7KC 1T1WA 1WISA 2R39A 3KPMB 3BAEL 2IQAB 3VFTB 3GRWH 4LSDA 3GSNA 1JTTA 2NX5E 3VD9A 4MS8D 5HVWA 1RZIA 4G6KH 2ORBL 4NKOB 2P49B 4PJGF 3MA7B 4OCRH 3S88L 1KCUH 2W0FA 4I1NB 4N0YL 2NYYC 3T1FB 1S9VA 4UB0L 2VDOH 3RWEB 2G9HB 3JSSA 1CTNA 1JPST 1I1AA 1IAKA 2ZG3A 1Q9OB 1EZVX 2WWKO 2YUWA 4L8BB 5EOCL 3DV6B 1CD1A 2F54B 3HPJB 2HJLB 2ZP0T 4CNIB 4PJ5A 3PWPE 2PW1B 4LLUB 5BZWB 5CD3B 1VFMA 1G9NC 2OK0H 2B4CC 3GGWA 4K7FA 3Q48A 2X41A 4E9LA 4QWWD 4U1KA 3HB3C 3QH3A 1YMHB 3SKJL 1DBKH 3S97C 5T3ZH 4BYHA 1MCQA 2BSSB 2BSTA 1T22B 4LVNC 4MXWL 5ELIA 3IDJA 5D96C 1DTUA 4XH2B 3UJJH 1KYOK 2EXYD 3TNMB 1MCNA 3VFRB 2NZ9C 4I77H 4I3RH 3BSZL 3GMLA 3H9SD 3VGHA 3F5WA 2AJSL 3SCMD 3VGEA 5IROC 3TM6A 3JWNC 3HAEH 1I8KA 25C8H 4NSKA 3QUMA 2YZ8A 2CLZA 3QDHA 5INDA 5HHME 3I3BA 4AEFA 2DMBA 4Y16C 5CCKH 2PCPA 3QUXC 5DJZB 3P0YH 4OM1L 1K8DA 4W6WB 2Z8WC 5C7XL 3WHE0 2XKSA 1U41A 3VXTA 5JHDE 3VXQA 2V2XB 1SYVA 1Z9LA 1QKZL 4MJ2A 3HUJE 1ITCA 2CRZA 1EGJA 1GVIA 2DQHL 1UVQB 3RY6C 4FQXB 1QSZA 2C4FU 2P43B 3PNWB 1KJ2L 1NBYB 3CXHJ 5ICZB 1OGAA 1OQOA 1G7LB 3QG7L 5D7JD 5DMKB 4PJCE 2I9TA 3VD3A 4GG6F 1VESA 3O9WC 3I02B 2YUVA 3BP6B 4WFFE 3MACL 4QT5A 2AXHA 2XKNB 4QHKI 3AY4A 3BD4A 4NUGH 3QCUH 4ELME 5IHZA 1MCEA 1I1AC 4S2SB 4YK4B 5GRVL 5C08E 3LMJH 3FCTB 1IEBA 4N1HB 4UQ3B 1R3JA 4Y88A 4NC0B 4JKPL 4AY0A 4JQXA 4OLZL 3FMGL 1EO8L 2ZUTA 2FDBP 1NC2A 4JFFA 1V5JA 4Y2DD 1QFPA 1JWUA 2Z8RA 3RY5A 5C9KA 4FFZL 2EICA 4WWKA 5BRZA 4ERSL 3DX9A 2H32A 5C0GA 5T5NG 5LWYL 1HDMA 5I71C 5DDHB 4PRIA 1ZT4A 4FFWC 2Y7QB 4R4FL 4R7NA 2K7QA 5GZND 2A6KA 5I1AA 1ZMYA 2N56A 4RRPG 3S9DB 5DD5H 5SX4I 2LAAA 1LDPH 4TSAH 2J6EL 4Z7OF 4JFDD 1P4BH 1NUGA 1S3KL 5DO2D 4PGDA 4X9HA 4EQ3A 1FNGA 3MROA 2ADGB 3OKEB 3V6BR 4YDJB 3MRKA 4KJPC 3W9EB 1BD2A 3EYQC 3K81A 4BZ1H 1FN4A 4IRSA 4POYA 1YQVL 5K59E 3ALXA 2X1WL 2HTKC 1VPOH 4G6AC 4DGYL 1RVFL 3DETD 5EIIB 1FL3B 5DJYA 2DQFB 1D5XB 5FA4A 1JPTH 1RZ7H 2Q8BL 1A47A 1J1OL 1LILA 1PJ9A 1DEEB 3HTLX 3D3VA 2OTWA 3EFDH 2APFA 2QQLL 3L95B 4HWBH 4UV7H 1CFNA 2VSCA 3N06B 1K3IA 5IG7B 3QWRA 5C1MB 3QFJD 4TSCH 2O61A 3OKKA 2MQ0A 1FVCB 3BHBB 1MEXH 1H0DA 4WO4B 1A3LH 4PGJA 5IBTH 4LCIH 3WXWL 3QEQD 1PY4A 1G7HB 2HLAB 4CVXB 4Y4FB 4QRPB 4L3CB 5EO1B 5FOBB 4R0LB 4EN3D 2EC9T 4LEOA 3HKFA 4JPVL 4XPGL 2LE9A 3L5WA 1IM9B 1U8LA 4TUJB 3D9AH 2AQ2A 3UTTA 4QHMB 1HSBB 3VFGH 1C08A 5FKAA 3KWWB 4PJXF 5HVHB 4OZHF 3B5GA 3HCVB 2A0LC 3BIKB 1I7RB 4X6EB 4EDWL 3BQUA 4QRRB 4XP6H 1ZANH 1MIML 2HKFL 3HC0A 4LVOC 4Z7UE 1IT9L 4NQCD 3U9PH 2VXVH 3JWOL 3IFPB 3FFCB 1NC4B 3BRGC 5T1LA 4BSVB 1AGCB 1UKQA 1IL1A 4KJYB 4KK6C 3WYRA 1YEKH 2WBKA 5GJSL 5JOFA 1XIWD 3SE3A 3H2WA 1FO0B 5KVDL 3H0TB 1DJSA 4DJMA 3DV4B 3NZ8B 4PPTA 4GXVL 4P5TC 4LRNL 2BJML 1EAPA 4KROC 4OUOA 3PV7A 4HXAL 1YNKL 5DUPL 1IM3B 4X5XB 4ZOCA 4LSTL 3S8WA 1ZEAH 1HHJB 2EO1A 4X9FA 4S1QL 4XCNB 1KJMA 2KQNA 3NAAL 3S36L 2ZCLH 3BKMH 1VGKA 4NQXB 3VXSE 3GNML 5HXMA 1AXTL 4PJDB 4H25B 2F5BL 1G7IA 3CDFA 4P3DA 3KS0J 1JNLH 1S7TA 3V4VL 1FIEA 5JORB 1IGCL 4M1DH 3GSXB 1SHMA 3WS6A 5A16A 3LHPL 1IAIL 4J3UA 1Z0NA 5DGQA 4YWGL 4OZHB 2X4RB 4OQTL 3G6AB 2FHCA 1NCWH 1YYLH 2YRZA 4JKKA 2YKLH 4ODWA 4PV8A 1CE6B 3D2UB 2DLHA 3MUGA 4WEUD 3HR6A 1ZVHA 1REIA 2VYRE 1H8NA 3JZ7A 4JVPA 4UT6L 4KRLB 2HLFD 3BPCB 1RHHA 4HFUH 3ULUH 3EYOA 3DRTA 2PO6B 3AVEA 1ZT1B 3GHBL 4S1SL 3IXTB 2BERA 3IF1B 4JN1H 1C5BH 4B7LA 3PHQA 1IKFL 1A7OL 4Q0XH 1ZWIB 2GAZB 4IS6B 1MY5A 3FQNB 1FVDA 3C5ZA 4WW2A 1CXFA 5D7LE 1LK2B 3QDGA 1RU9L 1MF2L 5B38B 3FZUC 3Q3GA 5CJOH 5E2VH 4HJGB 5ISZD 3KXFD 2A6IA 1Z6JT 3VFUB 4WI6A 4XB7A 3L5XL 4JO1L 4IDLA 5EU6D 1U8IB 3IDMB 3WIFB 1EJOH 1DR9A 4X5WB 4HWUA 3E3QC 3SO3C 1VKXA 4NUJB 2VDML 5TPWL 4NCC2 2GEEA 3B9KA 1KJVA 4CMMA 1CXKA 1ZTXH 3WV0A 2NY5C 4LCYA 1RUPL 5DSCA 4LL9A 3OF6A 3SDCA 2ZKHH 4F9LA 3TO2A 5CP3A 1NLBL 4FABH 1D6VH 5FUZL 5BS0A 1CU4L 5SWQB 5ECJE 2HG5B 1JRHL 4NHUA 1NCAL 4FQPA 2GT9B 2YPLD 4WU5B 4JN2A 3TH2T 1J05B 2FO4B 3CFJA 4M4RA 4UUJA 5E5MB 5LG1A 3G04A 4KRPC 4YAQB 4Z0XB 3S6CA 4RAVB 3LPFA 1KEMH 2KDGA 1EV2E 2IBZY 3OXSB 3WS6C 3RTQC 3KJ6H 2M1KA 4WFED 3RWIB 1W8NA 5MEOA 4U1GB 2LTQB 3EOTL 1WSST 1Q9LA 1OQXA 3SKNB 5BVJA 3UJIL 3C2AH 3QI9D 4R90H 4M61B 1U91A 2C3XA 2J8UE 3EJYC 2EH8L 1CVRA 1NUNB 2LQRA 2FJFA 3LEYH 3MUZ1 3O3AB 2DTML 5DD6B 3M1BB 4Z78A 2YD9A 4PJFA 4ZG1A 4D0BA 3BIBX 4L4TA 3GMPA 1NGYA 4OJFL 2R2HA 2HFEB 3WL9B 4Y19D 4GG8B 1TITA 4XNXL 1U9KA 3O45A 5FA3A 3IKKA 1WWBX 1FC2D 3HMWH 1FV1A 1MCRA 3T4AA 1Z5LA 3QIBC 5GHWL 1ROWA 3BKCH 3GHEL 1INQB 1VACA 1PDKA 1S5HA 4RCAA 4OCMC 2Z8SA 4YHZL 2WUCL 3MJ9H 3QG6B 3P4NB 3DECA 3B9KC 4P4KD 1MCWM 2DJUA 3P9MA 5D1ZC 1YMMA 3SDCC 4I9WE 1F3JA 1V7MH 3ZTNH 2FBOJ 2YC1B 2H3NB 2VAJA 3H9SB 4LSQH 3HRZA 3MRIB 2BP3A 4W81A 3SCMB 4ZUVB 2FEDD 2VWEC 5HHOD 1CD1B 3NOIA 5MI0C 5IEKB 5IVZA 5J0BA 3DIFB 3F7VA 2APXA 3L5JA 1DLFH 4F33A 1FZOB 4GOSA 4G8EB 4ZS6C 3CMGA 1YN6A 3SJVA 3IDGB 2A74A 4QNPF 5CFHA 1T21B 4UT9H 2FATH 4P9HL 2ATKB 5FCSH 2EDRA 3IDJB 3SDDC 1G7MB 1KIUA 4R7DA 3WCYA 3KLHD 1KCSL 1CF8H 2DLGA 3GMLB 3QIUA 1NFIB 4WHDA 2RIKA 4O2EB 4OZGA 4M6MH 4HKXA 4AEHH 5FUOH 1IQDA 4OQ1A 4KTDL 4LGRB 4M62L 3LQZB 4NSKB 4NP4H 1H15A 4ODVH 1U6AL 5INDB 2Z93B 1NAMA 1U3HD 3LEXB 1G1CA 1NLDL 1ITBB 3RWCB 5GS0H 3CMOH 4EEEA 3O2WL 4XC3H 3IDXL 1DQQA 1T0PB 3O0RL 1YECH 2VDQH 1OM3H 5AWNH 3MV11 4OSUH 4K94C 5EA0L 5E7BA 3MXVH 3WFHB 4M6NH 4WV1B 3T0BA 5JPNA 3H9ZA 3HE7A 3NPSB 4KAQH 4NPYB 4U1SB 3L5IA 5F9WB 1M6OA 2OZ4H 1MCCA 5HHVL 4LAQL 2I9TB 3DXAA 4P5MA 2IWGA 5E00A 5C0JA 4OKVA 5ENWB 3PE9A 1LP9B 2DBLH 4X8JA 3TFKC 3BE1H 4OCNC 4MAUH 3QEHB 4ZDHA 1KF9B 4JFDB 3ZE2E 2A83B 2UVFA 2J88H 4NRZA 5I1LA 1W0VA 2VLKD 3C6SA 2F19H 1R3JB 4WI7A 4KY1L 4X6DB 1N6UA 5DZNA 2FBJH 4TYUA 3R0MA 1LO5B 3FRUA 2DF3A 1TDQA 4LBEA 5FO9B 3RWFA 4WWKB 2PR4H 1S7QA 2JK5A 5C0GB 5I17A 1AY1L 1BZQK 4YUEL 4KKCC 4NO5B 5C0AD 1LMKA 3BJLA 3ARUA 5DS8B 3VWJA 1D5MA 3ABZA 5DT1H 3ZKSD 4H26A 4PRAA 4RDQG 5J3HD 2J5LB 1SBSH 1PZUB 4CMHC 1NCUA 4MDIA 3WIIH 5DXWA 3RPKA 3QIUC 5C6PB 5E9DD 1JYXA 3MROB 4LKXA 5GIRA 4IMKA 3R06A 5IVXB 3MRKB 3O4LB 4D8PA 5ITBH 5FDWA 1ES0A 3QEQB 3LZFL 3U46B 1FZJB 3D0VB 1IGTA 4IOIA 4YDIL 5ADOL 3TBWA 3A67L 2VL5A 5E8DL 3EO0B 4MNQD 1FYHB 4AK1A 1WZ1H 2W9DL 1ZA3A 3HE7C 1TJIL 5AZEH 3SE4C 1MFDL 4NKDB 5HYSG 1LEGB 4NZTL 4G8IA 3WSQH 3GO1H 3M8OL 4DKEL 1QRNB 1CI5A 2PF6A 3P9LA 3QEUB 3MYJA 4YX2L 2WW8A 1DQJA 1QO3B 2GI7A 2O61B 1ZHNB 3NCJL 4M1CD 3UYOD 3KLAA 5HHQB 1IGFH 3OKYA 3C6LA 5HYJE 2AXJA 1AI1L 4JREB 4NQCB 3T2QA 1HNGA 3LN5A 1Y18A 3MRGA 1HZHL 4HS3B 1WC7B 3X3FL 4FZEH 5EULV 3WO4C 3Q1SH 4E0RB 5F93C 3EYUL 3C5JA 1WIPA 1BQLL 4IRZL 2XNAA 3E6HA 2EDJA 1J7VR 1U8LB 2ZUYA 3OKDB 5DEFA 3QDJE 3SQOL 1DVFA 5E2WH 3FOMB 4LCCA 4CN6A 5EU3B 3RVVC 1C08B 4OIIH 5ACMA 3KHQA 1G9NH 1ADQH 3SDXE 2B4CH 3G6JE 1OGTB 5FIEA 5H94B 4PG9A 4XP5L 3H3BC 4NNYA 1MFBL 1QQDA 3LKSA 4WW1A 1R24B 1KN4H 2A73A 3QZWA 2ADJA 5L2JB 5T1LB 3OR6A 3QB7C 2P1YA 5F89A 4DK3A 1YJDL 2X6MA 3PGFL 4WW2F 3W0WE 5IKCA 1EAPB 1T20B 1KYOJ 4JAMB 5JW3L 3RPIB 3P0VH 4NN5B 2AEIT 1RULH 4NC2B 1JIBA 1RUAL 5F97E 3U0WH 4TUOA 4ZFFA 2AJYL 2HT2C 4F7MB 1KJMB 5C0IB 3GSNH 1FH5L 4Z77B 1QLRB 1KULA 3RQ3A 1MFEL 4OCXL 3DX6B 1A1NA 3IJSA 1SVCP 4P2OA 4HH9B 4OCSL 3B4NA 3C08H 5IF0A 5ISZB 3KXFB 3D48R 3W5NA 1FZMA 5EUOE 5GGTL 3MRFB 5EU6B 5KVMC 3RWJA 5GRJL 1RUQH 3P2TA 1TVBB 4N0FB 3IS0X 4ORZC 3KYMB 2VISB 1K6QL 2Z92A 4CVZA 3OHXB 3MUGB 5C3TA 4Z7WB 1ZLSH 3SO5A 4Z7VA 1N7MH 4RFEB 2MTPA 3FRPA 4OCWL 2Y25A 3QZWG 4F7CB 5KTEH 1DVFC 4LCCC 3C8HA 4EDXB 1WCQA 2D7QA 1S8DA 2C5DC 1EEZA 3SE8L 5DURD 4BJLA 3CFIC 3KPRD 2X70A 5D5MB 4AMKH 1OB1A 3ARPA 5EC2B 3UTSA 4ZTOL 3BD5A 1JN6B 1JYWA 5DJDB 1KT2A 2B1HH 2VXTL 4PJFF 4EBQL 5C0CD 4HIHB 3U1SL 5I18L 1VKXB 2FGWH 1MI5A 2ENSA 4PR5B 1PG7L 5KZCD 5AUMA 4WI9A 4DFHA 1T0MB 5JW4M 5D6CA 2AK4A 4KKLC 4G7VL 2XA8H 5I2IA 3CSPA 3H7LA 1HSAB 5I1CL 3QI9B 3QUMH 3MCG1 1A1MA 4FQXC 2C1PA 1MH5B 3GSWA 5C07A 5J1AB 1ZLUH 1LK3H 5H37H 1AHWA 2ID5A 3OTTA 2EC9U 4GFTB 4AIZB 3VXOB 4HGMA 5F96H 5C2BH 3CFJB 4L3ED 1CGSL 3G04B 3WFCH 5E08H 3IETB 3GBML 3FRPG 4JO3L 3T04D 1BF8A 1JPSH 5I30L 1A4JA 3ROLB 5DRNA 3MRHB 3PL6D 4OGXL 3B2UD 4YK4C 1H3PH 3D0LB 2XYCA 2EC8A 5A2JH 2GIYA 2E7MA 2QJDA 3D87B 5INCA 4D9QD 1KXTB 4J8RA 4OZIF 1U91B 1OAZH 3ORJA 5KSAA 5AAMA 3BW9A 4F2MB 1YZZA 1VFBA 3AUVA 4BK4A 2RBLA 4PJIA 3P3YA 1PEWA 3QULB 4D0BB 4RMRA 3D85D 3CC5A 1FFNA 4X80L 2RHEA 1CGVA 4Z8FH 4OUUB 4P46D 3GMQA 2VLMD 4ZO8A 3VD5A 3V6ZA 4JDTH 3ZT5A 3UC0H 2X1OA 3E3QE 4XHJD 3PWLB 1KC5H 2JB5L 3TF7C 4LFHG 4OZGF 2FWOB 3T65A 2DKUA 1HYSC 2XG4A 4FFYL 1CFQA 15C8L 5E99L 1DFBL 1C16B 2VXQL 2YSSA 2APBA 2NY1C 2VAAB 4BM7A 4PBXA 4JY6B 2HFFB 2MNUA 1T1XB 3MLTB 2VSDA 4RDQF 4L8DA 1YMMB 2A1WL 3IJYB 3X11B 4YR6B 1WFTA 1F3JB 1LWRA 2NW2A 1U95A 2P8LB 4XGZA 4X6CE 5D70H 5D72L 4HAFA 4PJ8A 4DVRH 3OB8A 4BA8A 3M17B 2JJVA 1E28A 2D31A 5GGRA 3GSVB 3PP3K 5E6YA 1RURL 1G0DA 3MRDB 4LCWE 1U3HB 1V3LA 3UTOA 3F7VB 1BZ9A 4MJ5B 1Q94A 1YN6B 2EIZA 3UTZA 4XCYB 4GSDL 4KGJA 4YHPA 4TPRH 4GKOA 5DVMA 5KVFL 1CDJA 2RCSH 1BPVA 4XWGL 5J6GB 2AV7B 3WXVH 1I3GH 4A2LA 1MUJB 5KSAC 4K8RC 3ZDZE 4UTBH 3DUSA 3VXME 4MQ7B 2DRUA 3G9AB 4ZS7H 4YDLC 1A6PA 1NDGA 3MRBB 2FHFA 1VHPA 4N0CD 2VLKB 1T7ZA 3X14B 2ESVD 3D39A 3T3PF 2XFXA 1UXWA 4F3FB 2R4SH 2NY4C 1K5NA 5B4MC 2Y06H 4U0RC 4FOMA 4M7LT 3S35H 3G5XB 3MBED 4O9HH 4V1DD 4PFEA 5BXFA 1TVDA 3T77A 5J11B 2IALA 3LKOA 1WAAE 2CDGA 2OI9C 4YHKH 4ZPTB 5F6HJ 4JO4H 4MVBC 3WD5H 1X5FA 1A02N 1QBML 2R0ZH 1WTLA 4X8JB 2VWEE 3BO8B 1EVUA 2R9HC 3N1MC 5JIPA 3RI5K 5ADPL 3JWDC 4ZDHB 2E7HA 2V17H 3I50H 2IAND 3HZKB 5DUBB 4XX1G 4UNVA 4NRZB 4PTTB 4GRWF 5TQ2L 1FAIH 2QSQA 2NY5H 2PW2B 5DVLA 4C57C 5HYSB 1N26A 1OAYH 4W6XB 4PV9A 2L0DA 3FRUB 3GMOA 1FNHA 1R3LB 4LVHB 5IB1A 2XN9D 4LBEB 1F8TL 3MV7A 1MCOL 3NTCH 4GAGL 1I7ZB 4QXTB 5E6IB 2JK5B 5EBMA 3RRQA 4LPTA 4PS4H 1QEWA 4FTVA 1SMOA 4Y5VA 1CG9A 5HDBF 4MNQB 3MZGB 1KCRL 3BN3B 5C8JB 3L1OH 2LABA 1JCKA 4I8DA 3PDDA 2RGSA 1LNUB 4X0KB 2DIJA 2FD6H 4PRPE 4R2GD 4JRXD 5F1SA 4ZPVB 3FONB 4QY8B 4KHXL 5EZIH 1IGYA 1CDUA 2JIXA 4KUCD 4GT7A 5FDWB 2OSLA 4WHTA 1ZVSA 1ES0B 5FHBH 3ILPA 3ZE0E 4JG0H 5I0ZA 3CSYB 3VRIB 2Q8AH 2NX5D 4MAYD 1Q38A 5CJQH 3SKMB 5EORL 1ZA3B 3NN8B 1C1EH 1T6VN 1UA6L 5EO9B 2E9WA 4KKNA 4H20L 3I6KA 3OKNB 3T0ED 2GK2A 4WUUD 4HF5L 4G5ZH 4RA3A 1NCBL 1QYGH 3MYJB 5TF0A 1DQJB 4X7EC 3WEXA 5ICYA 4I18B 3ROOA 4YHMH 1A14L 2MPAL 5GXBB 1JPFA 1JNNL 1MLCA 2XZCH 1MCLA 5DA4A 4JFZL 1BJ1J 1IQWL 4OLVL 2H1PH 1OWRM 4N90D 4XP4L 3MO1A 5J89A 4MJ6B 4JVUA 2L7UA 5JIIA 2WWKT 1PKQE 5CP3H 3V5KB 4NKMB 1HCVA 5I8KL 1UM6L 5F7EL 3CFCH 1FHGA 1ZK9A 3U0PB 5HPMA 1PQZA 5EPMB 1U8HB 3WKML 2DM4A 4MS8C 4P49A 3SDAA 1P6FA 3RL1B 2LTQC 5JQ6H 4NBYB 2Y6SD 4XPTH 3QXVA 3MXWH 1B4RA 4HUWB 4HS8L 1FG9C 3P4LA 1FYTA 3MA9L 4NNYB 2B1AH 4L4VE 1TZIB 4RZCA 1UT9A 3EBAA 3TIEB 1UG9A 4Z7VF 4IJ3C 4N8VA 4Y4KD 1FE8H 2HVJB 4DKFL 3PDOB 5HHMD 5HI3D 3QWOA 3VFWA 1II4E 1D6EA 4MXVE 1I1FB 1ND0B 1HNFA 1JYVA 4TTGA 1LE9A 3QAZB 4U7KA 3VMOA 3RL2A 1XH3B 4ACPA 4G8FB 3WJJA 4LLAA 3SE9L 1ZS8A 1F13A 3TT3H 2IH3B 4QWWC 1CYGA 3CAFA 3U7YH 3ARSA 4S1RL 3O3DB 4NNPH 5DHVH 4K94H 5TFSL 5JW5A 4P3CL 5DURB 3KPRB 1VFOA 4U6HA 2EXYC 1INEL 4I5BB 1P4LA 2HA1A 4PLNC 3QXUA 4Z7NE 4XMLH 2FNBA 4P2OB 1OTTD 3VH8B 4NQVA 5IF0B 2IGFL 3SCMC 5T3XE 4OLYL 2DQJH 4HIIB 2UUDH 1UM4H 3RWJB 3QNYB 5C0CB 2AAVA 3TCLA 3ULVF 2FYYB 4FQQA 5LAXB 2I26N 4N8VG 5EU4A 2DOCA 5ESAA 5EWIL 2DQDH 1OLLA 2OR9H 4PJ7E 2DDQH 3BUTA 4XNUL 5FB8B 2DQUL 5DMIH 1DBBL 3SDAC 3GJFK 2CJUH 4HAGA 1JFQL 1EVTC 3KLSA 4O51B 2HT3D 4XPBL 2EDLA 5D7JC 1TETL 1HI6B 4MCZA 1UEMA 4NYLB 1XF4A 1ZA6A 4L3EB 4LLQA 5D8JH 5E5RB 3UTSB 5F9DC 2PYFA 4IMLB 3V8CA 1NCCL 4PJIF 5IB4B 3D1MC 1WIUA 2FEEI 5GSVA 5I15L 3WFDL 3O6FA 2RJMA 4XTRD 3ULSA 3BDYH 3PL6B 1NGWA 4Y4HD 5DHYB 1MI5B 3GMMB 3O41A 4QCIA 3G5ZA 2UV3A 5I2IB 3L3HB 1VGEL 2AJXL 2LFGA 3GM0A 5CP7B 4X4XA 1H3UA 4Y2DC 5FUCC 2LU4A 4DN4L 1EMTL 3WIHH 3WJJC 3IYLW 1NAMH 3U6RB 3W11D 4NN7C 3NPSC 5IMKA 2ICWJ 1AD0A 1SJVA 1QVOA 3JUZA 3D85B 4K3DL 2P8PA 1HHHA 5GZNC 2YD1A 1R5VB 5IBUG 3LQAH 4NBXB 2F54E 3F12B 3NCCB 1OSZA 1IARB 3H42L 2DQGL 5KANG 3REVA 4FQCH 4YLQT 4X7TA 3PGCB 4HIEB 1NUFA 3KYAA 4UT7L 2W1NA 4OV6F 3O2VL 4BH7A 1FGNH 5DO2C 1A5FL 2DM2A 4FQIL 2P42B 1KCVH 3WN5A 2QL1A 1RV6X 3SBWA 5A3ID 3RU8H 2I27N 1T89A 3RUGB 2AP2A 1JZ5A 4NNXA 1XIWA 4M48H 3TBTB 4NZUL 3NIDE 2V7HA 3CZFB 5K9QG 1QFOA 2YBRB 4GAJH 2J8HA 3MGOB 1PD6A 3DETC 2B2XH 4OZFB 2IQ9H 2BNRD 1JZ4A 3S4SG 1NCDH 1MWAL 2J5LC 3E6FA 3Q6FA 3GMQB 4P2YA 4G6JL 1U8NA 3V6ZB 4RGMB 1J1XL 2W65A 4OCYH 2X9XA 1VEOA 2EE3A 2X4UA 3L3OA 4M03A 4Q9BA 5J4MA 1WCBB 4Z5RB 1P9MA 1ORQB 2BVQA 2EEDA 2UZIL 3ZDXE 4RQQB 2R0WH 2R1XA 3FB6A 1AGBB 3O6FC 4D9RE 5KAQF 4G6MH 3RX8A 4BELD 2GUOB 1U58A 1U8QA 1DCLA 3DYPA 3RDTD 3ZYIA 1YEFH 5IESL 5M94B 3MLUL 2WP3O 3V6FB 4EN3C 1WLHA 4I0PA 3TH3T 4JDZB 3DHJA 3UYRH 1ZHBA 4XGZB 5AZ2L 1P1ZB 4LSRL 5FV2A 4PJ8B 4JFED 3ZSSA 2D31B 4KDTA 2DLFL 3UJTL 2HJKA 5E8PB 1MHHA 1XCTB 5BO1H 3RVUD 3VXSD 4XCFH 4NQSA 2BNUA 1PKOA 2ESVB 4IM8A 2Q3ZA 5E8NA 4GRWH 2N7BA 5IB3B 5SWSA 3EYSL 4Y1AA 4OFDA 3U7WL 5F88A 4E5XB 1LQSR 7FABH 1S7XA 4QOKA 4JREC 2HH0L 5IW6A 3AGVA 2XWJA 1CFSB 3JWOC 3MBEB 3GI8H 3OAYK 4V1DB 4LPXA 1S7SA 3B2VH 4CN1A 1T89C 4UIKH 5A2IH 4OI9A 1E4XL 1I7TA 4HKJB 4DTGL 1DE4A 2ZCHH 1C5DB 1XIWC 2X4TB 1EHNA 2D9QB 3LCYA 5E4EB 2GK0A 2CR6A 2DLIA 4MJIA 4JFPB 4L3AA 5CILH 4LLVA 4ZFZA 2IANB 2PYED 4G42B 1S7RA 2FJHA 3SGJA 4NQED 2YPLA 4BQ8A 1S9WB 3BH8B 4LKCA 3V52H 5D7LD 6FABL 4P57A 3T1WA 1S9YB 3RAJH 5C0RL 4KU1A 1TENA 2R29H 1FZKB 5KBNC 3BUYA 1XZ0A 2G2RB 3PUCA 2IEPA 3IFNH 4JG1H 1P9MC 2XN9B 2NTSP 1CL7H 4KI5F 3S3PA 4DUWA 4ZOEA 5DFVD 1RFDH 1EEYB 4U31A 3GJEB 3S36X 3DI2B 4RNRA 2Q7YB 3ZL4L 3MRRA 5DJCA 4MD5B 1JJUA 1JWSB 5CEXA 3JV4A 4JFYA 1BVZA 4NRYB 5E6ZA 1CE1L 3MX0A 4LLMB 1AIFA 1F58H 4NN5C 2HLFC 1NJ9A 1ORSB 5DI8A 5JQHC 5GISH 1MJJA 1WT5A 4KDTC 3V4PL 1BECA 3LRSB 2MCPL 4Y19A 1HH9B 1T2XA 4Y8DC 4N9GA 1JPGA 1GGBL 2VDRL 3EAKA 5IB1B 4QRPE 2CRYA 4HUVA 3Q5YA 4WUKL 2D7TL 1JGEB 2XPGB 2E5EA 5BJTB 4Y5VB 3UTPE 3QQ3B 4QHNA 4MAYB 3OJDB 1I8MA 1FG2B 3X13B 3FO0L 4MB5A 1RZKL 2N7AA 3ARTA 2CIKB 2YRPA 3L3IB 3C09C 4PRDB 3C60D 3IJHB 3T0EB 1T7VA 4P4KA 3TV3H 4EI5D 4WUUB 2VUOA 1TPXC 1GZPA 1FNEB 1SVZA 1YEEL 2IG2H 1HHIB 4Z9KB 4LHUD 4HUUA 2QLVB 4U1NA 3DROB 4HPOH 4GAYB 4Q9QH 1R0AH 3VI4F 1BM3L 2JIXB 1D5ZB 1TXKA 2QQNH 5JPMB 5MHSD 5HHOA 4L29B 1F90L 3FFCE 3A6BH 3D18A 1A7PL 3VWKA 3LS4H 5L2KD 4O58L 1V3KA 1MCKA 5IHLB 4Q7DA 2VLJD 2R0KL 3BN9D 1BFOA 4BH8A 2FB4H 4Z76B 1MRFL 2YWZA 3OKOA 3PP4H 4YPGB 1A6ZB 3QIWA 3BGFB 3S37L 3LIZL 5K9JL 3O8XA 3HG1A 4LGSB 5IP4A 3QNZA 5TF1L 4UTAL 2EDYA 3QI9C 4LMQI 2FIKB 1C5CH 5ICYB 4I9WD 3SPVA 2X44D 3QDAA 3BZDA 1GYAA 3QJHA 1JPFB 3DMMD 4PJDE 3T3MF 1IBGH 4WHYG 1BAFH 1T04B 3G5YB 3QCVH 4Y4KB 1KTLB 3O6LL 2WLYA 3V0VA 2YD2A 3MO1B 3KDMA 5D7IA 2V2TA 5CZVL 1KSRA 4XRCA 4OZHE 4D9LL 5IEHB 1JGDA 1NGQL 2WINB 3LRGA 4R3SB 5J12C 4ZD3L 4LPCA 5HPMB 5MP6L 3N9GH 5JLZA 3DO3A 1PQZB 4YGAB 1T1ZA 1A6WH 3QUKA 4ZUUA 3C8KB 5GRXG 4TNVF 4PUBH 4HX1A 3TIDA 1DBML 3IT8D 3OXRB 4G9DB 4TQEL 4P4KC 3F58L 5F3BB 5JMOC 2Y07H 2Z35B 3MLSH 1QD0A 4XNMA 4XNYL 2ZCKL 5I1DB 3OKLA 4N8VB 1W0WA 5JXEA 2XZQH 3CFKB 3E8UH 4U1JB 2P48B 3MJ8B 4K2UH 5HHXH 1P7QA 1RZ8B 3RVWD 4K8RH 2FEDC 3VFWB 4MQXD 1D6EB 2JELH 2WBJA 3EFFA 4YQXH 4ONFL 1NDMB 2RAMA 5DEGB 4FP8L 1OSPH 1KOAA 3UO1H 2OM5A 4EXPX 1QHOA 1N0XH 1WICA 1U2CA 4KKBD 1QLFB 3QRGL 5C0AA 2F9BT 2CDEB 1BOYA 2XRAL 3AM8C 4K3JH 3SY0B 1IFHL 3VE0A 2DQIH 4J6RL 1N3NB 3KLHC 5IMLA 3WNOA 2IBGA 1X4YA 3BZ4A 5E9DA 3STLA 4JZJB 4WTWA 1FCGA 3MNWA 2PN5A 1R5IB 1BREA 3TJHD 3V2AR 1FO0H 3FQWA 5EO0B 5I8OL 3BXNB 3ARBD 2W9EH 2F5AL 1U3HC 4ODXB 3JWDH 4Y4HB 1MJUH 4MB3A 4FQQB 4PLKD 5DD3H 3BFOA 3VMPA 5C6WH 4NHCL 2NW3A 4LSUL 1HOCB 1MVUA 3BH9A 4KVCL 4UOJA 5DJ8B 1A6VH 4JLRB 4JPWL 1FL6A 3G6DH 1G9EA 4MA8L 5B22A 4R26H 4P23D 2HVKA 2YPVL 4LF3A 1JVKA 5CBEA 1F4WL 3TT1H 2OLDA 2OXHA 2ZPKH 3KPQB 1D9KA 5JDJA 4MCZB 3OWEA 1QSVA 1CDCA 2PXYD 4PBWD 5J7CC 4X7FC 3S5LA 2A38A 5DVNA 5JXEC 1NGXB 5FAAA 5GSVB 3IFOA 4PJ9D 4QLRA 4TTDD 4QCIB 3TPUA 1ZT7A 2BHZA 2WBJC 3S4SB 5LJYH 4K7PY 4UINL 1I1YA 2Q6WB 2FR4B 4JHZA 5DVKA 1Q0YL 2YD5A 2A6DB 1N2RB 1BIHA 1YNTA 2APVA 4LLWA 3I75B 4GMTL 5J11C 1CR9H 3NFNA 1KLUA 1AD0B 3VXUD 3H9SE 4KZEH 3NFSH 4GRMA 3LS5L 4U6TA 2BOBB 2BNRB 2E9IA 5J3HC 4QHLA 1OSZB 4F8TA 5FHAL 4X7SH 5I9QB 1CZ8H 2AEQH 4X7TB 1YPZA 4ODTH 1Q9WA 4WU7B 5T1KA 5GGSY 1RZFH 4J1UA 4BH7B 4PB0H 3AS1A 4OFYA 5HBBA 2E7LC 4UDUA 4UV4L 2MCG1 3VDCA 1J86A 2GITB 1KN2H 1CXLA 4NQDD 1Q9KA 5BV7L 4LVHC 3S5LG 1NGZA 3LEVH 4NNXB 1T7WA 2NNAA 2VOTA 1AQKH 4KI1A 1B2WH 1FIGH 5SV3A 4GW4A 5JTWA 4XC1L 4XPAL 3LKRA 4YXKL 2VZOA 3EO9H 5SWZD 3MTRA 2VQ1B 1NSNH 5GGQH 4JFEB 5FYLL 5FYLD 3Q6FB 1CLOL 4XCEB 3O6ML 3HMXL 1RIUL 1T5XA 4H0HB 4CUCA 4HK0A 2OL3L 4ELKA 4MNGA 3FQRB 3OAYH 3LRHA 1YY9C 2ORBH 2BX5A 4M1CC 1N64L 3ARVA 5I8EA 3ZKND 4ZYKB 4P4RB 4MXQD 1XF2A 3S88H 5GGTA 1U58B 5CKGA 3BZFB 4N0YH 3K1KC 1YY8A 4UB0H 4KMTL 3FTGA 5EOTB 4G6FB 4YNYB 5FM5O 2V5SA 1LP9E 5JW4N 1T4KA 4AENA 4XXDB 1JE6A 1WFNA 5MENA 5EOCH 1GAFL 1WBYA 1AKJD 3VMNA 2VJXA 5D93B 1I85A 3TVMB 5JOEA 3CDGA 4JFDE 4OLEA 5DMYA 5F6IC 5JDSA 3ZMRA 2HJKB 2AJZA 2BVEA 2PYEB 1PZ5B 3LPGA 4NQEB 4ZAKD 5FYJD 4OI7A 4JKLA 4X6DE 5ICXA 5SWSB 4QRTA 1QNZL 3OAZK 3ZKXB 3BP7A 4FXKA 3SKJH 2FZ3B 2OJZL 1S7XB 4H1LA 1UENA 1X5AA 4LPVA 4MXWH 4PY8I 3ZLQC 4FQJL 3VRLF 2BOCA 2AQ3A 1Y0LA 1UJ3A 3FB7A 4EUPG 1A6UL 3BSZH 4ENED 5I75B 2Z4QB 3QISA 5HDQL 1YJDC 2AJSH 3TO4B 2QQKL 4PJBB 2GK0B 3C8DA 4PY7A 1QSFD 2R0LL 5L8JB 1XGQB 4KHTL 1S7VB 4P2RA 2P5ED 3BRFA 2ERJB 5C7XH 4CGTA 4LKCB 3MCLL 5IVXE 3O4LE 3ARGD 5E70A 1QKZH 2JCCA 3ARFD 1GGIL 5TE4L 1OARL 2DQHH 1BWMA 3QEQE 4U6XA 2NXZD 1JZ8A 3WUWG 1KJ2H 2R2EA 1XGTA 3ZHDA 3QG7H 4APQD 2B5IB 1RZGA 4OLUL 2WSKA 5J57B 4UILL 1A6TA 3PJSA 5CIPA 3MACH 5D2NA 4OV5A 5DJCB 1YNLL 4P2QA 3QAZC 4PRNB 5HGAA 4ESKA 1RIHL 2R1WA 3DUUA 3PIQA 5E2UL 1QRNE 1XFPA 1AIFB 4EI5B 4H1LG 1E6OL 1NJ9B 1VDGA 3K46A 2VN7A 2R1YB 3OZ9L 1UYWL 1OW0C 4JFXA 3VXRD 4JKPH 1YEJL 1MJJB 4OLZH 3TN0A 3FMGH 4YH6A 4MSWA 4YHYB 1EO8H 3SEPA 1W72L 1UWGL 2G75A 5LVEA 1K8IA 4UNTA 4IRJA 4NQCE 1F3DJ 2EYTB 4FFZH 4LPYA 5L2KB 3MLVL 4ERSH 5LWYH 4HUVB 5C0BD 2O5ZL 4G8GA 3WNPA 1RJLB 1A4KA 4R4FH 1U8OB 5C09A 3BZEA 1XT5A 4I48A 4C56B 1IILE 3RGVA 5GGUB 5HJ3A 4LSSL 1JNHA 2HJFB 1R3IL 5D7IF 2J6EH 1T2QL 1VCAA 3D69B 3RWHA 4BSWA 2Y36L 1S3KH 3TBSA 1CDYA 1NBQA 5HTSA 5KSUB 1Z3GL 3HR5B 5DJ2B 3BPNC 1HILA 2EXWD 3GSRB 3P73B 4XP9L 2LU3A 3IAGC 1P7KB 3SHSA 1D5IL 4L8SA 4M00A 3DMMB 3O6KL 1U93B 3V7AE 1I9EA 1YQVH 3LAFA 4UU9B 2BFVL 2O5YL 3OJ2C 5KJRL 3J7HA 2C3VA 3CH8A 4DGYH 1RVFH 3ES6B 4BH8B 1BFOB 2R2BA 4NZRL 1WWAX 2Q8BH 3UPRB 1YEIL 1J1OH 1T0NB 2YPKB 1RUML 3U7AA 1Y6MR 1FFQA 2V2WA 1X5KA 4IEFB 3B2UC 4YBQD 2UZXB 2QQLH 4AT6A 3HG1B 1DBJL 5IT2L 5MEPB 3GRWA 1UFUA 4U7MA 1CL7I 1IAIM 4ORGB 3IGAA 2ARJB 4ODUA 5FK9B 3HHRB 1RHFA 3WXWH 1TQCC 4GW1A 1DUZB 4Y0GA 2F74A 4KQ3L 2H8PB 5ISZE 3KXFE 2AGJL 4JPVH 4XPGH 1G9ML 4XRCB 5EU6E 4ZNEA 1G84A 4P46C 2X5PA 4XVTL 4ZSOA 4P48A 3RVTD 3NIGE 4PREB 1MAJA 3VFMB 3GMNA 4Z7WE 5JLZB 1R5WB 3L9RA 1X7QB 5IFJB 2CXGA 1O7VA 3U4AA 3LKNA 3QUYD 2BDNL 4EDWH 5IJVB 5DMJB 4ZNCD 1MIMH 2HKFH 4EI6B 4XNMB 4PB9L 1IT9H 3EO1A 2BMKA 4F7TA 3KPNA 1QFHA 3JWOH 3CD4A 4XNZC 3VXMD 5D5ME 2H9GA 2DWEB 2NY6D 4GRLA 4OF3A 1EO7A 1J0KA 1KTDA 2QQQA 2YRLA 4FNLL 3MV8A 4XAKE 5JNYA 1F45A 3B9VA 5GJSH 2N1KA 1U8MA 5KVDH 2GJ6D 2R56L 1KPUA 1X5JA 3MRJA 4GXVH 5I16A 2CKBL 1BOGB 3EZ8A 2BJMH 4LRNH 5FM8A 3L7FB 1SJHB 4HK3J 1HHKA 4WFEE 4Q6IA 1N5AA 5IB2B 2YUZA 3GSOB 3HAEA 1YNKH 3QPQD 4HXAH 2R69L 5DUPH 1X5ZA 3KG5A 5EZOL 4LSTH 1MAML 4NT6A 3CFEA 3T4YA 3CVHA 2VZTA 2IAMD 1BVLA 4LCUB 4B0MM 4S1QH 3NAAH 1I8IB 3S36H 2GSIA 3GNMH 4P23B 2BNQA 1AXTH 4OD1L 2F5BH 2UWEB 3S3JA 4QF1B 3V4VH 5CEYA 1IC5L 1IGCH 1M05B 3NPZB 2PXYB 4OZ4B 3WDHA 3LHPH 3WNLA 3BMVA 1IAIH 4YWGH 4OQTH 1LEIB 3B3IA 4FQHA 2WMPA 1K85A 1IC7L 4PJ9B 4N0CC 4UT6H 1JHKL 3BI9X 1HQ4A 3BKJL 1A2YB 1N8ZA 1YPZF 3GHBH 4S1SH 1KJ3L 5CMAB 4PGEA 1P2CA 1UB5A 2A6JA 3L3DB 2I07A 3H7BB 1IKFH 1A7OH 3MBEC 3VCLA 2HVKB 4JR9L 1NEZA 2X89D 1ZGLP 2W60A 2HYMA 3MLRL 3UAJD 3P4OA 4ZO6A 3VXUB 1QSED 3K2UL 1RU9H 1MF2H 2C1OB 3GSUB 2XTJB 5DRWA 4UDTB 3HAEG 3L5XH 4JO1H 1J0HA 1OT2A 4PTUA 4OGAC 3DVFA 2ZUWA 4GRLC 4M7JL 4PJEF 2VDMH 4JANB 5TPWH 2XTLA 3MUHL 3QNXB 5DUML 1I7UA 2D9CA 2Q76B 4PGCB 5ID1B 3PWPA 1RUPH 4NQDB 4AEEA 5TQ0L 1NLBH 1OOAA 4JY5L 5FUZH 5BV7B 1CU4H 3MRCA 4NZJA 1YNTB 5DK3A 1JRHH 2ZG1A 1YMME 1NCAH 1SY6L 2BC4B 1BX2A 4NWUL 1A1OA 3VRJB 5SWZB 5HY9B 1A7RL 3PHOA 2XA3A 32C2A 1TIUA 5JIHA 2CSPA 3QSKB 2BHUA 1J1PL 4GKSA 2Y9RT 3NA9L 4EOWL 1FFOA 2OL3B 1IAOA 5IMOB 4R2GC 1FL5A 4UDUB 3EOTH 5F1NB 5BW7C 2F53D 3UJIH 1KEGL 4HWBA 2EH8H 3VFPA 1RJYA 4JZNB 4RX4D 2ICCA 1NGZB 1Z9OA 3K8KA 4LLDA 3GB7A 2DTMH 1KLGA 3ZYJA 1C12A 1B0GA 4FRWA 4D0DB 1WBXB 3B43A 5JHDA 4PJHB 4IHOA 3KAAA 4X4ME 3OG6B 3VFSB 3HUJA 1SEQL 1U8JB 3HLAA 3DTXA 3LKRB 4OJFH 4MAYC 4X7CC 4HKZB 4XNXH 1DQML 1T3FA 3VG9B 1AKJB 2VQUA 5IR1A 2ZUQB 5H2BA 2IPTL 3OAZH 4PJCA 3EZJB 4JQVA 1YC8A 3GHEH 3FKUS 4EUPB 1E4KA 2VLKE 3O3BA 1CICA 4OF5A 2CUMA 2I24N 3EUUA 3CUPA 2IC2A 3DGCR 2E9JA 4DVBB 4OAWA 3F62A 5M7QA 5FYKL 2X1QA 4ELMA 4YHZH 5FYKD 3CFBA 2WUCH 5I76B 3CX5K 3FJTA 5C08A 5EBWB 4L9LC 2X4NB 1MFNA 4JRWA 1LHZA 2VKXA 4EIZC 2VZ3A 4A6YB 2V9RA 4I13B 3A6OA 1MCBA 2NXYC 2GFBA 2JCCF 3MLZH 5TE7L 1MCPL 4KQ4L 3WLBA 1QPPA 2ZUUA 2JJSA 3NCBB 3TA3A 1J5OL 3P40A 3WUWB 1QSFB 4X7DC 5DYOB 4TULL 1QLEL 2AJZB 5CGTA 4DZBA 4HW6A 2Y6SC 3MJ7A 1QZ1A 5I1EL 2EDHA 4LSVL 1UCTA 4KK8D 3TPKA 4HQQL 4NRXA 1D7FA 1G6RL 1KB5B 2BVOA 3RZCA 5T3XL 4H1LB 4PBVC 4Y4KC 4P9HH 2VZ1A 1MHEB 1LGVA 4KDWA 2NXZB 4QGTA 4KKAD 5EBLB 5KW9L 1AR1D 2VXSL 1GIGL 1TZHA 1KCSH 5J9PB 4K71B 5HI3C 4APQB 4MNQE 5E56A 4NCDA 3A0OA 5F7DA 3EDJA 4LNRB 1AE6L 2DI7A 5GGVL 5C0EA 1YEHL 3IVKB 1T6WA 1GHFL 4RAUB 2EKSA 4KTDH 4M62H 4G80A 4YHNB 1HH6B 2J8OA 5ITFB 5LBSL 1U6AH 3L6FA 3KPLB 4J3OC 3EGSB 1J8HD 2OP4L 3AC0A 1NLDH 1MRDL 3IRPX 4JGMA 1QFUL 3O2WH 2AABL 3IDXH 1JNJA 5BQ7A 3DSNA 3O0RH 5AD0A 4EXKA 5MEQA 1RPQA 2BSRA 2DIAA 5EA0H 3BGMB 2PTTB 4U6XB 4UAOB 4YE4L 5C0BB 1OTTC 3NCYS 4ODSL 2R2EB 5ESVA 5HHVH 4LAQH 4EKXA 1BBDL 3MMEB 1CDHA 4YIQA 5DQJA 5LCVL 2GYSA 4F9PA 1HIML 2QSTA 2LU7A 5CEZL 4P2QB 5HGAB 5CEZD 1MLBA 4JPIB 5DRXA 5DQDL 2R1WB 3DUUB 4R4BB 1HXMA 1JUFB 4PRHD 1N0LA 4ETQA 3JV6B 2JJSC 4MWFB 1DSFL 2ZSVB 3VFVA 3INUL 2NPLX 4JZOB 4KY1H 2G75B 2ICWB 1K8IB 4BQ9A 2EEBA 4PP2B 1MWAA 2F54D 5E8EA 2HT3C 4O4YL 3MNZA 1AY1H 2EH7L 4YUEH 4G43A 5IJKA 4XBGB 4Z7UA 3RZCC 2EDKA 3WFBL 1UQSA 3WJLC 3DVIA 4U3CA 3C9NB 4HBQA 3RGVB 4JJ5A 4XTRC 5DK2A 4Y4HC 5E2VL 4JRYD 4RIRB 4OGZA 4XXCC 3RDTA 3TBSB 1ZGLM 4WRLA 4DFIA 4QXGL 3EKCA 4HV8A 2BRQA 4RSVA 5IV2A 3REWA 1FFRA 3W11C 3QT2A 4L8SB 3QP3A 1EUTA 3LZFH 3CH1A 3ZE1F 4YDIH 5ADOH 2YD7A 2W91A 4MNHA 3A67H 3W9DA 5DWUL 3PABB 4X6FA 5E8DH 5MERA 5D1XB 2W9DH 5D1QA 4YGVB 5TE6L 1TJIH 5DJXA 3VXNA 5D7KE 1ETZB 1MFDH 1OD7A 4PJAB 5FECA 1EDQA 4NZTH 2AEWA 3M8OH 4DKEH 5B8CA 1ONQA 2CR3A 4IIQB 4ZTPL 43CAB 4LLYA 3H9HB 4YX2H 3LPWA 1MFAL 2XKUA 5A3IC 5FKPB 5B21A 3IKCB 3ZO0A 4RGND 3NCJH 2ZJSL 2XZAL 5I0DA 5CSGA 4QRSA 5GSRB 1PLGL 1AI1H 5GS1C 2OJEA 3KPRE 2WP3T 1CD9B 1P5VA 1HZHH 2NY6B 3X3FH 1K4DB 2IBZX 2NTFB 4MA3A 3EYUH 1BQLH 4IRZH 4QTIL 1GZQA 2JKXA 2ZUVA 1ZHLA 1NMAL 5C0CE 1WITA 2GJ6B 2BY0A 4M4PA 2F8XC 1CIUA 3SQOH 3MCKB 4AYFA 1JK8A 3FHAA 2XWBA 1T83A 5BMFL 5JO5A 1ZHKB 4HUNB 1PSKL 3K4DA 5HD8C 4X99A 1AQDB 2BY2A 1G7JB 3W39A 4M5ZL 4KUCF 4XP5H 5TH2A 1MFBH 5K9OB 2V7NA 3JTTA 3OKMB 12E8L 3RDTC 3C5SA 4MYWB 5LGKA 3EO1B 4HBCL 3MGTB 3UTQB 4QRUB 5KS9B 3KPNB 1MHCB 1BIIA 2BVPB 4WCYL 2H9GB 1RK0A 5C71A 8FABA 2VLRD 4L3EE 2Z91A 3UTSE 3MV8B 5HI5D 2ATPB 1YJDH 3FB5A 2XACC 4XVJL 5CSZA 3RVXD 3OGCB 2CGRL 2VDKL 5A2KH 4JFQB 1VADB 1MI5E 2P5WD 1F6AB 3DSFL 5SX5K 4OF6A 3RVUC 5JW3H 5T1DL 1A6AA 1CDGA 4YHIB 4ZFOB 5D1QC 3HAEB 4NN6C 3I6GA 4D9QE 1DANU 3RHWF 1RUAH 4NT6B 3CPLA 1BVLB 5KANI 2AJYH 2VXUL 1EEQA 1FH5H 4R8WL 3QUZA 2XWTB 1MFEH 4OCXH 3DWTA 1KIPB 2J8UA 3CCHB 1QSEB 4OCSH 1UCBL 1B0RA 3ECBA 5GGTH 2VLME 2WIIB 4LHUA 5D93C 5GRJH 1CFTA 4WEBL 4U1IA 2W0PA 2DTSA 4G9FD 1K6QH 4FQHB 4WDIB 5TDNA 5K9QI 1T7XA 2IF7A 5EZLB 3DO7B 4Y4FD 1ZLVH 4OCWH 4L8CB 3KPTA 4ZUSA 3P4MA 1K2DA 1N8ZB 3MFFB 3RUGE 3ZKXC 5B39B 4RBPH 3BOVA 3SKOA 4S1DD 2QV2A 3BVNA 5GS0D 4HWEL 5T33L 4XC3L 1RK1A 1KBGL 3SE8H 1IM9D 4X98A 5DFVC 4DKDC 4CU6A 2X4SB 1NFDB 1BEYL 3RKDD 3VGBA 1M7DA 2YA2A 4ZTOH 4P59L 2MQ3A 2VXTH 4EBQH 3U1SH 5HGDA 4AZ8A 5I18H 3HUJF 4QRRD 1PX3A 1HEZA 3B5TA 1UWXK 1PG7H 4TVPL 1TJHL 2SEBB 4TVPD 2AJUL 4G7VH 1TTGA 2ERJC 3MQIA 1NC4D 5C86A 2F53B 2GW5A 5I1CH 3PWPB 4GO6B 4PJCF 4GBXA 4FXGB 4ZUTB 3NH7L 4U1LB 1UEYA 4Y7MA 2A77L 2H2PD 5CWSB 5D6DA 43C9B 5BCAA 2VZUA 3RNQB 3MRCB 3HE6A 4K7PL 1YEDB 3TNNB 1OP9A 1U8KB 3U9UB 4ELMF 4MLIA 3MRLB 4HEME 2ENYA 4JM2A 1CGSH 3FAXA 1RZKC 1VFAA 3CFDA 3GBMH 4JO3H 4U3XA 5I30H 3WHXA 1I3VA 4OTXL 3C60C 5DFTA 5E7FA 1YDPB 3QJFB 4GW5B 5D9SB 2ITCB 5C6TL 4OGXH 3ZDYE 2VZSA 3X12B 2ESVE 1H5BB 5CIPH 4YHYC 1I4FB 3DVGA 4HKBB 2GJZB 3PWUB 3QQ9D 5F7WC 2R23B 3L3JA 3WUZA 1EAJA 2VL4A 4XX1E 5TJWK 3VFPB 1RJYB 5KOMC 5JIKA 4V1DE 3FB8A 4LLDB 1IAII 3RWDA 3NCFB 4EJ1C 1XGUA 1RZJL 5C0DA 3TBYB 4NO0A 3HUJB 1OP3K 4X80H 3BN9C 4NM4L 2D03L 2YK1L 5F3HA 2Q86B 2PO6D 1PGRB 5CBAA 3BP4B 2VB5A 3MRPB 3UDWC 3B9DA 2IANE 2JB5H 4X4YA 3R0NA 1R6VA 1XGRA 5K59F 4M93B 4FFYH 1JMXA 3U36A 15C8H 1RJCA 5J6HA 5E99H 4D94A 1UJTA 1DFBH 3FQUA 2VXQH 3CFBB 3DMMC 3EOAA 3MLXL 2I60L 2XN9E 5EN2B 4CVUA 4G7YL 4I2XB 1G0YR 5EFIB 2A1WH 4ONHB 5A1AA 1DN0A 4GBXC 3GBNL 5D6DC 2DN7A 1WBZA 3ULUF 3AMKA 4OZFH 5D72H 2AJ3A 1AGFB 2EIDA 1KIQB 1KENL 1KPRA 3WLBB 4X9GA 3TA3B 4HDIA 1RURH 3BEWB 3MRMA 2MKWA 3OB0H 1J8HB 3KYOA 5IROA 1AXSB 2H6PA 4HZLA 2D7PA 4J4PD 1JRHI 4UQ2A 1QA9A 5J13B 2Z31A 4NRXB 2XXMB 4Y16A 4GSDH 3KYNB 5FO8B 5J06A 3QUXA 3V5HA 3NA4A 5KVFH 4XWGH 1BBJB 1D3CA 2FSEB 3HB3D 3EYFA 5EG6C 5I8CB 3RVWC 3K2MC 1FGVL 4JVWA 4MQXC 3RY6A 5E8OA 5F7DB 4HPYL 3HNVL 5C0EB 1D5BA 1U0QA 5EIVA 2OYPA 4OB5L 2EKSB 3T0EE 4HWZA 4Z7UF 4WUUE 3CJJA 5E94A 4Q9RL 3O9WA 4PRHB 4YC2C 4WGVB 4C58B 3KPOB 3PG2A 1GOHA 4M7LL 4KKBC 5BQ7B 2NY3C 3VFNA 2Y4SA 2E9BA 3HZYB 5DMGD 3KS0H 5DZLA 4N90E 3WS3B 4U1HB 2VN4A 3PQYB 4AQOA 3QO0A 2QR0A 5FF6B 2YN3A 3QR2A 4GUPB 5HYJA 1T2JA 3TJHC 1L7TL 4PLJD 1QBMH 4N1EA 3LV3B 3L3KA 1TVHB 2ZZUT 3LN9A 3GKZA 3ARBC 4BK5A 5ID0B 5ADPH 1KXQE 4PLKC 1DL7L 3CSBA 2Q7NA 2VLLA 4JRYB 4TNWF 4XPHL 4O2FA 4QHUA 2K9UA 5TQ2H 2AI0L 3KR3L 3QDJA 4ZQKA 4P23C 4WJ5A 2YD3A 3SDXA 2AW2A 1UXSA 3G6JA 5E8EB 5IQ9A 5L9DL 1F8TH 4MA1C 1MCOH 4GAGH 3FFDA 4PJGB 4PJ5D 3OAUL 2PXYC 4QXUL 2ADFL 4PGBA 2Z31C 2OCFD 3CVHH 2AEPL 2BHYA 4PIRF 2W0LA 3LN4A 2CQVA 1F11A 3E0GA 5DJ6A 4MDJA 1KCRH 3MJ6A 5F1OB 1AXIB 5HGHA 2OTUB 3DX8A 3PWNA 4KXZH 4PJ9C 3KNBB 4TTDC 1B90A 4BFIB 5HYQA 5FGSA 1M4KA 3VG0L 4U1MA 3KPSB 1J9CT 1QFWL 3W0WA 3LH2L 1CT8B 1AGDA 4LASL 4RGNB 3I9GL 4KHXH 3T0XA 3MLPA 1N4XL 5IV2B 3CVIL 1NEUA 3REWB 3RNKB 1XCQA 2QSCL 4XZUB 4XP1L 5EZJA 1XF5A 2OTPA 4JHWL 1U8PB 5JOPE 1UKSA 3GIVB 2KQMA 5F21B 4G3YL 4KJPD 3AXLA 1G1YA 4MA7L 4DGIL 4MNHB 5TDOB 4MGXA 3GI9L 3K74B 5K9KA 5EORH 3WHE1 3DRQB 4UOW1 1UA6H 2MFNA 3VJ6B 4H20H 1EGJL 5DJAA 4K3HA 5FO7A 5B8CB 4HF5H 5EUOA 1NCBH 2R8SL 4N1CA 4JY4B 1OGAD 2IADA 4BZYA 1A9BB 5BV7C 1A14H 5IHUL 2MPAH 4YDVA 2OXGA 2H26A 4QRSB 1G7QB 1JNNH 5TGBB 1MFCL 4S11A 4JFZH 1IQWH 5H37G 4OLVH 4Y5XB 4XP4H 2E8ZA 3IDIB 1BVKA 4PG2C 5DD1L 2VLRB 1PVHA 4JDVB 4KUZL 3O4OC 5ESQB 5I8KH 5F9JA 1T66D 1UM6H 1BWWA 1RMFL 5F7EH 1JWMA 3JUYA 1PG7W 2MJWA 1DDHB 2J8UF 1OF2A 2P5WB 1AP2B 3WKMH 1NC2D 4JFFD 3W81A 1IZKA 4GG6B 4W4OA 4WWKD 3W5MA 5BRZD 4YZFE 4CJ1A 1EJ6A 4HZAA 3PWJB 1JF5A 1TFHA 1HWGB 3ZKNC 4F15B 4P5TA 2PTVA 4HS8H 3MA9H 4MXQC 2HP4A 3HN3A 5KG9A 3JTTB 3P30L 2DKMA 2XI9A 4DKFH 5L88L 2WQ8A 8FABB 5I1HL 2JF1A 1QPXA 4GKZB 3HZMA 1FORL 5I66A 2RFXB 3VG9C 5CSZB 4ZXBB 1QTYT 3BESR 3IXAA 1W72A 3O4LD 4G9FB 4UMGA 1BD2D 2Y5TA 1ZSDA 3WMSA 4F57L 4ZAKC 3SE9H 4IRSD 1NL0L 1X4ZA 2JJTA 4HIJB 1NCNA 4KROD 4S1RH 1K9TA 2O5XL 1JHLL 5TFSH 2BVYA 2JE8A 3BEVA 4P3CH 5DK0A 3QUZB 5DHXB 5I1JL 5DC0A 3CLEL 1INEH 3D3VD 2DM7A 2I9LB 4M6AA 3GJFB 4QYOA 1QRND 4WY7L 2BNRE 4I4WA 2IGFH 4OLYH 1BFSA 3QWRD 1F3RB 1KPVB 3FO1B 2EZ0C 3EYVB 5HGBB 3VA2C 4HS6A 1EBAA 2ZOLB 5DLML 2BK8A 4JM2F 3VDAA 2CLVB 1MHPL 5EWIH 3TZVA 2M8XA 3LKPA 1YN7A 2CLRA 3ARGC 2FLBT 4M5YL 3ARFC 4WNQA 4XNUH 2DQUH 1HWHB 3SKOB 1UADC 1DBBH 4H8WL 5FGRA 5ERWA 4W4OC 1UB6B 2NXZC 1RK1B 5A40E 3Q5TA 1JFQH 2QKIA 4NDMB 4X98B 4XPBH 1TETH 2BSED 2ICEB 3UTTD 1LE5B 5CZKA 1W0YT 1EFQA 1M7DB 4LQFL 4XBPB 4FXLA 1A7QL 4JFEE 2AKRB 3QQ4B 3RIFF 4HMCA 1NCCH 4BFEA 3KJ4C 4N0UA 5ANMB 5I15H 3WFDH 3ARZA 3BQUD 3FZUD 4X6CA 2ZSWB 4N9OB 3ARRA 3TGXA 1FBIL 2X05A 1GL4B 1AGEB 1VGEH 2AJXH 5T1LD 3MREA 1HYRC 1IEHA 3MV9B 4LCWA 3RTQA 2G5BA 3P9WB 4DCQB 1EMTH 4PJXB 2IH1A 4DN4H 5A43C 1FAIL 2JJTC 4UAOC 3QHFL 4RMVA 2X7LB 4LDOB 2ICES 5F7LB 1T1YB 1S9XA 2GTZA 3ZE2F 4K3DH 2ITDA 1G7PB 2E7CA 2FL5A 1MQKL 2K7PA 3BPOC 4JM2B 1HK6A 3QPXL 3H42H 2DQGH 2ZOKB 4NIKB 3MRQA 4GQPH 1T5WB 5GQBA 4C59B 4UT7H 1WZLA 5JUEL 5EC1A 3O2VH 5ACZB 1AD9A 1KIRA 2PYEE 3EOBA 3TWCL 4LDEB 1UACL 2GSGB 1XR9A 4KRPD 1A5FH 1XF3A 4NQEE 4TSBL 4Z95L 4FQIH 1HQRB 2EXWC 4M1GL 3GSQA 5SWSE 3QIBA 1VENA 1BLNA 3AAZA 4UIMA 3L3JB 3S35X 3DGGB 3TC9A 4CAGA 4NZUH 3TZVC 2P24B 3FO9A 9CGTA 2CKBA 1R3KA 2JB6B 1QR1A 3VDBA 5HSFA 4GQ9L 3VXPB 4U6YA 3MODL 5C0DB 3OQ3B 4NO0B 5L0QC 1GGTA 4OI8A 4P9ML 5D1ZA 1MWAH 4PJBE 3MOAL 4MD4A 1WV7T 4CU7A 2IAMA 3JV5A 4G6JH 2V5MA 1J1XH 4BQBA 3FT3A 4X4YB 3ZZ1A 3GUTA 1XGRB 4KPHL 4QTHA 1CVSC 1EO5A 3C5ZD 2EYSA 3U0TB 2UZIH 3QDGD 1A3RL 5F8QC 4M9PA 4NOBA 2HN7A 1P5UA 3LSOB 4XAKD 1SEBA 1P69B 5IESH 1LDSA 3TEUA 4AIXA 3MLUH 5FCUL 4XNQA 1KNOA 1KG0A 3HI1B 1G9MC 3MOBL 5AZ2H 4LSRH 4LVNB 3RVTC 3SDDA 5JZ7D 2OQJB 1KPRB 3SDCD 4JO2L 3OF6D 2DLFH 3CK0L 3N85L 4DK6A 3UJTH 2DYPA 3QXAA 4Z6AT 3T2OA 1IEAA 5BS0D 5HHPB 1FNFA 4F58L 3HZVA 3PGDB 4HZLB 5C0FA 3QUYC 3RBSA 4UQ2B 3EYSH 5IK3B 2C7UA 3LKQB 3U7WH 5MHSE 3D25B 4Y16B 2HH0H 3EW3B 1JTOA 4N8CL 4CW1B 1AFVL 1BFVL 1ZKAA 4PRPA 5DRZA 5L2KE 2DWDA 2HRPL 1T1WB 1CBVL 2VLJE 5DHVA 4XBEL 3GSNB 1E4XH 1OP5K 4DTGH 4U6VL 4HHAA 4C56E 3SDXF 3LDBB 4Y8AA 3G6JF 1RZIB 3G5VA 4CDHA 1MOEA 4OD2A 1L4IA 5L8KB 4WTXA 2DD8L 2W0FB 2HMID 3QPQC 4M8VA 1JL8A 1V7NL 1S9VB 1SY6A 2QHLA 4MLSA 2IAMC 2CMRL 6FABH 5D71L 4L4TD 5C0RH 1CGYA 1KLFA 1RI8A 1J11A 1I1AB 4DGVL 1AO7A 1IAKB 1QR4A 1ODAA 1NQBA 5BOPA 4PJ5B 3UROR 3KYKL 4OZIA 2AXFA 2QR0B 5EDXA 4KJQD 4BQCA 3CX2A 3ZL4H 4M8QA 2QEJA 3NVQA 3GGWB 5C3LD 4K7FB 4BKLA 1S7WA 2B39A 1J8KA 1TLKA 1CE1H 4U1KB 5JHLL 4RX4A 1PKQA 3QH3B 1FFPA 5KN5A 2AJVL 2BSTB 4O2FB 3AREA 2X4QA 1YMMD 2EYRA 4DZ8A 2AV1A 5DR5L 3V4PH 5ILTL 5BZDA 4JCMA 2MCPH 1UC6A 3F5WB 5EUOF 4WJ5B 2VR4A 2VDRH 1GGBH 3UAJC 1JGVL 5IB5A 1I9RL 1I8KB 4ONOA 2D7TH 4WUKH 3QUMB 2CLZB 4L4VA 3WIHA 3IAPA 1WEJL 1NKOA 1ACYL 4KZDL 3LN4B 2PCPB 3IU3A 1F11B 2FJGA 3FO0H 1K8DB 1E27A 1RZKH 5AYQA 4HFWA 4OD3L 1YA5A 3SJVD 3VXTB 3VXQB 4M6OL 4R96A 1SYVB 1C7TA 1R3HA 4KKCD 3Q6GL 4C4KO 1EFXA 4U1MB 2HWZL 1ZLWK 3SE4A 1YEEH 1BZ7A 5I6XC 4CADA 1OGAB 1BM3H 3QIUD 4FQLL 5LGJA 1V8HA 2MWCA 3DX7A 4NKQB 4E42A 2GCYA 3ARDA 1F90H 4QT5B 2ZUXA 1A7PH 4YPJA 4O58H 3NCYP 3HFML 5IHZB 4ISVA 3ME0A 5L6YL 5JR1L 3GIZL 4Y5YA 2R0KH 3WDJA 1MRFH 4O00A 1IEBB 3PWVA 1G6RA 5D7SL 1VEPA 5EUKA 5J1TC 1NC2B 4JFFB 3S37H 3LIZH 1JWUB 5K9JH 5BRZB 3HE7D 1H3WM 5TF1H 2J7LA 4UTAH 3DX9B 2H32B 2OR8A 3MBXL 4KV5E 1HDMB 4MZ3A 4PRIB 1ZT4B 1MJ7L 2BCKA 4DAGL 4R7NB 2AK1L 4YDKL 2A6KB 5I1AB 3UMTA 5I1IL 3AREC 2UWEE 1UZ6E 4PJ7A 3O6LH 4E41A 3BWAA 1BVKB 5LQBL 5CZVH