2G75B

Crystal structure of anti-sars m396 antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDYVFGTGTKVTVLGQPKANPTVTLFPPSSEEFQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IGG Heavy Chain
total genus 43
structure length 211
sequence length 211
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75B01
4ZOBA 5J9PA 1FE8L 2RCSL 4LAQL 1TCMA 5LBSH 4X0KA 1U3YA 3O41B 2AV7A 2B4CC 5IMOB 4ORGB 5H2BA 3L3KA 4JANA 4NHUB 1FVEA 2P46B 4R0LB 3W39B 4WJ5B 4S10A 3RNKB 3FZUD 1NL0H 4KK6C 1CLZH 5GSVA 4A6YB 1X4ZA 1GGUA 3QIUA 1PFCA 1IAIM 1P6FA 5F7DA 1BZ9A 5IQ9A 3QWOA 5ENWA 5E95B 2MKLC 3R8QA 3SOBL 4Y1AE 5IV2B 4P46B 3HZKA 4RFNC 2FSEB 3AS0A 1ACYL 4NNYA 5ISZB 2H6PA 2VDQL 2ESVA 4ZQKB 5HHPA 1X7QA 1JRHH 4HUUA 1A0QH 3HLAB 4JQVC 2BDNH 2JB6A 5HYQA 1FL3B 4G8EA 5CSZB 1AP2A 2R9HD 4PJGA 7FABL 1XZ0A 5E2TH 3VGGA 2F5AL 5FF6B 4P2RD 4ZFZB 4Z7VB 3UTPD 4BZ2H 1W0WB 1LO2L 1K3IA 4HMEA 4WY7H 5FA3A 5HYQB 4H8WH 4XC3L 5DD3H 2GTZB 2X40A 4XB8A 2LU3A 3L7EB 3O6LL 5I75B 3TP4A 3F7QA 4MSWB 3S88H 4HS8L 2CLRA 1VFAB 4O02H 2AJ3A 4RDQG 5E9DA 4NRXA 3WNMA 1QBML 4XMKH 1A6VL 1YEIH 4YX2L 2BMKB 4XWOD 5LWYL 2CLZA 5B38A 3BDXA 1A64A 1KCLA 4OF8A 5TPWH 5CJOH 1QR4A 4AJ0A 3X3GL 4WHDA 1J88A 4KRNA 1MEXH 3T0EE 5F7EH 3RNQB 5IW3A 5EORL 2EDNA 3DV4A 2YBRB 1ZVSA 2XN9B 1QSFD 1HXYA 4FQJH 5IMOA 4U2ZA 1RK0A 2LAGB 1C7SA 4XWGL 1MJJA 4BH8A 2EDKA 4G9FA 4HIEA 2CQVA 1FN4A 1I4FA 2Q8BH 1T83C 4DGVH 5JW3H 5I1AA 4YWGL 4YGVB 5CHNA 3OG6B 2XT1B 3U7WH 1NL0L 1G9NH 5GRJL 3BZ4A 3KWWA 3K74B 1A4JB 3VFUB 1BVLB 4J4PC 1N4XL 4P3CL 3HA0A 3CXDL 3BH8A 5HSFA 5MENB 1CGUA 1N5YL 4NO0B 4GT7A 5DEGA 1EV2E 4M8VA 2QKIB 5CP3H 3LPGA 2FHFA 5DQDH 3VI3F 1XGRB 2PCPA 1NCTA 1IGYA 2V5RA 5DJYB 1Q9KA 5FYKD 1ZANH 4RZCB 4BQBA 5E2TL 1JFQL 1DEEA 3TZVB 2GUOA 4JDVA 5ABDE 4NN5C 3U6RA 2PYED 4ZAKC 4LLYB 5KJRH 4OJFH 3ARZA 2Y25A 5IEHA 2R0LL 2HTKC 4CVWA 1PZ5A 1IMHC 2CIIB 1YQVL 3MLUH 4JFDA 3RI5F 5DUBA 5HGHB 4S1SL 5D96B 1YDPA 4P23D 5J3HD 5I76A 1FFQA 1J7VR 3N06B 4YXHL 5C0BB 4PJ7A 1U8LA 4XBEL 4GRMA 1S7UA 2AXFA 4UV4H 4PJ8B 5EIIA 2P49B 5ANMA 1A6VH 4YJZL 4YX2H 2X09A 3ULVC 3VMNA 3QDMA 3E0GA 1D5IH 4MQ7B 4YE4L 1AFVL 4IMKA 4MXVF 1XF5A 2F54A 4CRPA 5C6TL 2GQHA 3HZYB 3IDXH 2F5BH 4M5ZH 3PP3K 5BVPL 5F7UA 2H2SD 1OSPL 4YDLC 1DANU 2ERJC 2DLHA 5ERWA 2YK1L 2OS7A 2DWEA 3ZTNH 3EJYC 1LO5B 3GEWB 2APXA 3F6IA 2ATKA 3V6OE 1H8SA 5IB3A 4B5EA 3NCBB 5IROA 5F9WB 3BRDA 3B43A 1U2CA 4F80A 1LILA 1QYGL 1X5JA 1KTRL 4DGVL 5DVKA 1N5AB 4D94A 5FO8B 4NQUA 1JPTH 1AGCA 3GO1H 4XP4L 3U7WL 3ZDYE 3ARTA 3BXNB 1N59A 2X4PA 1MRFL 1S9VB 2FX8L 1P53A 4G6JL 3DIFB 3CZFA 2PXYA 3HE7D 2IANB 4ELMB 3RVTC 5ESVB 3ARDD 3KPMA 3SKUD 4XZUA 2HWZH 2AQ2A 4JFPB 4DWHA 3BGFB 3TA3A 4QLRA 5IT2L 3TFKD 3D5OF 5IEKB 1FAKT 3PJSA 5KOVC 1FIGH 3FN9A 4GUPB 5C0CE 3GSWA 3I75A 1MHCB 3DO7B 3OJMB 2YA2A 1MAKA 1JWMA 2LVEA 1A1OB 2X05A 4AYFA 1IGFL 1S7WB 1RMFL 5C08A 3TYGH 3UTPE 4GRWB 1T4KA 1FNLA 2JK5A 1I3VA 4AL8H 3IJSA 3UZQA 4R3SA 4LSPH 2ZUVA 4MAUH 2AEIT 43CAA 2NLJB 1FFOA 4M7LH 1JZ6A 1AE6L 4WENB 2DN7A 1TIUA 3V6FB 2P5ED 5FM5M 1XF2B 2D3VA 3T1FB 3TV3L 4ORGA 1FFOB 2W0FA 3HMWH 1MH5A 4RX4A 2PYFB 3D0LA 3LKNB 1T89C 4MD5A 4MNQB 5DR5H 2VLRA 4RMRA 5J13B 2EDDA 2VAAA 1KT2A 2QSCH 1MREH 2VH5L 1X5GA 4WVRA 4WI3A 4HUVB 2GFBA 1PKQB 5IHLB 4RGMB 5CKGA 4JFZL 3D39D 3PDDA 1QFWI 4FP8L 1ZGLA 5EN2B 4GKZB 4U6XB 5E9DD 4JFFA 5IW1A 3EHBC 3MJ7A 4PGBB 5FFLA 2DQJL 2ITCA 5D7LB 1OWWA 4NIKB 3IDJA 1TVHB 1OTUD 4HKXB 2X4NB 1CZ8H 4NC2B 1YEFH 3UBXB 3QNXA 3TZVD 2R23A 2W9EH 1FGVH 4U1MA 1AI1L 1N64L 4CN1A 4ZOCA 3HC0B 5MEQA 5C92A 4QRPA 3ES6A 2HFEB 3P73B 4HUXB 4MA3B 2ZSWA 5HHOD 1CXKA 2DYPD 2J8HA 3OXSA 1DEEB 1YEEH 4MA1B 3ZL4L 1CFNA 4H20L 5IT2H 5C0GA 5E8EA 3ARFA 5C0BD 4XXDA 3P73A 1R3JB 3F7PC 4OGXH 1KELL 1YY8B 2B4CH 3LQAC 5I19H 1B0GA 3V6ZA 4ZFFB 5I1CH 3F12B 4TNWK 4R26L 4UDUB 4QOKA 2EYRB 2VZVA 2BY0A 3DX6B 3IFLH 3WBDA 4HKXA 1BQHA 1OLLA 5JUEL 1DTUA 1IGCH 1JWUA 1C5CL 5GISL 1FZKA 1KYOJ 4JFOA 4MX7A 4XNQA 2WM0A 3MACH 4PGEA 4Y4HD 1U8OB 2AXHA 4A6YH 2HJLB 5AD0A 2O5XH 1B9ZA 5IHZB 1NCBH 3MV01 5KSAD 2YPLA 4XX1E 1NC4B 4DGIH 3KYAA 3MRGB 4U3XA 1AGFA 4JM2B 5BQ7A 3HMWL 1IE5A 4ODTH 1IEAB 3BQUD 5FYKU 1ZTXL 5I1GL 1TQBB 2AJSL 1B4RA 3LEYH 5EN2A 1EJOL 1RFDH 4OTXH 1C1EH 3HE7B 5IVZA 1S5IL 2DM4A 2AV1A 3ILQC 5DRZA 3CFCH 2CLZB 4GBXD 1YPZA 2BVEA 4XXDB 4CU6A 4QRUB 1Y6KR 4NQTA 2J8UB 2ZUWA 1J1OH 5E0QA 1JGLL 3MBED 5CUSL 3MOAH 3TIDA 3ABZA 1WTLA 3SE9H 5B8CA 4OD3H 5D1QD 4MSWA 3N1MC 2MQ0A 3WSQH 4UBDD 4ZXBC 5TDPA 1EERB 3EO9L 4BQ6A 3OKMB 5D7JC 2WZPD 4GG8B 5FYJU 2I24N 3V4UL 3O9WA 4U1GC 3MLVH 3PJSB 2J5LC 1OW0C 5T1LB 1CICC 3IU3A 3WJLC 1KEMH 3FRPA 3MV7E 3G6DL 3GJFH 3PIQA 4S1DC 4WW2F 3WFCH 4YBQD 3SO3C 4HUUB 5JIHA 4DEPC 3JUYA 1YEGH 4ONFL 3RVVD 1W0VB 5C0NC 4U0RB 5HYFA 4V1DB 2DLIA 2OLDA 3MC0A 3MODL 4NN5B 2IAMC 1YNKH 5JUEH 2NY3B 1AY1H 4XTRD 2FIKA 3NFSH 3D18A 1MCIA 2R1YB 5GISH 2QQQA 4QHMB 1AGCB 4MD0B 2EDHA 4HWBA 4XP9L 4PP1D 3PL6A 4ZD3H 4R97B 2PO6C 4X4XB 3W5MA 4PRHE 2XY1A 2QQNH 5IB3B 4I18B 4B0MM 1INQB 3G5VA 1TZHB 5IVXF 3LKRA 5DC4B 3LKSA 1S8DA 3IF1A 3MCLH 4KXZH 3T0DA 1KEGL 3CU7A 3X14B 5C0AE 1EVTC 3QUXC 1W0VA 2E3VA 5INDB 3SKNA 3BO8A 4MXQD 2WINA 2XYCA 3WIIH 3UBXI 4O9HL 3PABA 4U1HB 4NUGH 4KHTH 3ARYA 2E7HA 2YPVL 4C4KT 1G7MA 3W0WD 2V7HB 3K1KC 2QADD 4ZYKA 1Q0YL 4WTZA 2YWYA 3RZCD 1RU9H 3ULUC 3NZHH 4Q9RH 5IKCA 1UACH 1VERA 1HSAB 4GQ9H 4GG8A 1V05A 4H1LG 3SDCA 5EZOL 1I7UB 2H2SC 3OAUL 4U7KA 1UQSB 3NTCH 4DOHE 4Y5YB 2PTUA 2CIKB 4NQDA 1J0YA 4YBLB 3PV6A 4CVZB 2PTVA 3CZFB 5KAQG 3FB8A 2GUOB 4JDVB 4WV1A 4AG4H 1HIMH 3O6FB 1DBKH 5DUPL 2IH1B 4P2OB 4R9HA 4HK3N 4X99B 4KJPD 4M1GL 3RY6A 2ZCLH 4PJIB 1F45A 3B5HA 1FZMA 3L6FB 4XP6L 3U7YH 1YEGL 1CFQB 3ZE0E 4XI5D 1CXFA 2EDXA 4YZFE 1L9NA 4OKVA 5JHLH 3W5NA 2UZIL 3B9KC 3LS5L 1EEQA 4HF5H 2VLRD 3D3VA 4Y4HA 5J0BA 3CJJA 3UP1A 4ERSH 1A6AB 4N9GA 1DZBA 2AJZA 3FB8B 1KN2L 3EFDL 3IRPX 4JKLA 4RAHA 5B4MC 2M26A 2W65B 4RGNE 4AIZB 3NFPA 4O4YL 4HLZG 3ZKSD 3E3QE 4JZJA 4MB5A 4NO2A 3RIAF 2P5WA 3LHPH 1F3DH 1KLGB 4GW5A 5DWUH 1UJTA 4RWYL 4S2SA 5EBGA 1TJIL 3BD4A 3DVFA 3O3BB 2QQKL 1P4IH 1ZT4A 3QPQC 3UTOA 3L5XL 1F00I 2E8YA 2VSCA 3JV6A 3TO4B 1P4BH 4PV8A 1A22B 2NTFB 4O2EA 1VPOH 5DK2B 3T0VA 3WIIL 5I74C 3VD5A 3QT2A 1UWGL 1GC1L 2P5WD 1QSFB 1RV6X 2JCCF 3U48A 3GMNB 3PG2A 5T5NG 3PWUB 5IBTL 4PGDA 5I16A 4NQSB 4HWBH 5BS0A 4HSQA 1A3LL 3C6LA 1A6WL 4OIBA 3RDTA 1NQBA 3U0WH 5EU6E 1EXUB 3MFFA 2X1WL 1F4XL 1M05A 5HBBA 1EK3A 1M6OA 1XFPA 2YBRA 5HHVL 4DAGH 3PQYA 5IF0B 1RUAL 1RZIB 4LSQH 2ADFL 1F4YH 2CKBH 3ARGD 4ZOAA 1DLHB 4OBSA 2R1YA 4XPAH 2FO1A 2QHRH 4ZO9A 3BN9D 1FE8H 4UTAH 4R7NB 4PRHA 5F1SA 1BP3B 1UXWA 4D9LH 2VISA 2BY1A 2EYTB 2WBKA 5IK3A 1EFXD 3C8HA 4YIQA 5DQJB 5I1LB 4XP6H 1FL6A 5CD3B 5D1XD 1K8IB 5BZWB 5I8OL 5L0QB 2VAAB 5CBEA 3BJLA 4KK5D 4HXAH 4PJ9C 3JZ7A 3WFEL 1BZ9B 5IQ9B 1NAKH 1BECA 3SDDC 1WZLA 3INUH 1BJ1J 3TBWB 3TZVC 4XP5L 5F71A 5DSCB 3PL6D 3H9HB 2G60H 2P8LA 3VWJD 4TTDC 2A73A 2FD6H 4NHCL 3RWJB 2IQ9H 5A2LH 1ACYH 3QJHA 4KXZI 4R4ND 2OL3B 3AROA 4KVCH 3SKNB 2AXGB 3GM0A 5CCKH 1LK3L 3QIBD 3H9SE 3LZFH 5DT1L 1A5FL 4LQFL 1Q9OA 4LMQE 4Q6YA 5CMAA 1BEYH 2XTLA 2YUZA 1T1XB 3HI6H 2P5EE 3HUJF 3RKDC 2G75B 2F5AH 4PRHD 3HC4L 1DQQB 3OGCA 4F7TB 2X4UB 2YA1A 4NRZA 5GHWL 4YHMH 3ESVF 3UTSD 1KCVL 3SE4C 1B90A 5IFJA 3FT3A 4LNVA 5TE6L 2BRQA 4LHUD 4PJAB 3O6LH 1ZHBB 4N0UE 1NDGA 2H26A 5IMLA 4HAFA 4OI8A 5ID1B 3PHQB 3RAJH 1SJEA 1IJ9A 5HDBE 1TMCB 4L8CB 5MEOA 4U1GB 4FQLH 3CLEH 2V17L 2P48B 3X3GH 2VDRH 3BW9A 4LSSH 4CGTA 3S3JA 1AHWC 5IJKC 2VLJD 2JB5L 4GS7B 1WBXB 3REWA 4NZTL 1I8LC 2APVA 2CLVB 12E8L 4HKBA 4F33B 1A02N 5E2VH 4PJBE 3U0PA 1NLDL 3D87B 4XPAL 2RJMA 2AVGA 5I30H 4O2FB 4UTAL 4HCRL 4EXKA 1EGJH 3MRFA 3MROB 4QRRD 2ZNXA 5GSVB 4A6YA 5JMRA 2F58H 3UCRA 1Z3GH 4BZ1L 3BZFA 4OLWH 5I6XB 5IWLC 2VLKD 3O6KH 2HFGL 3WMSA 1WZMA 3KPQB 1A6ZB 4JKKA 3MPCA 2NY5C 4PJFB 5J1SC 5DLMH 3ZKXC 5DMGC 1MCJA 3MYJA 2LU4A 3HR5B 3KHOA 4ZS6C 4Z7VF 5CSGA 1BQSA 1OVZA 2BXZA 3T77B 2DJUA 4Y4KC 3GK8H 4MQTB 4LHJB 4TYUA 3RGVC 1HHHB 4XHJC 2E27L 5EZLB 4HPYL 3CFIC 4C56E 1UZ8B 3MRKA 4LQ1A 5K9KB 3MJ9A 5CCKL 4OGYL 4RGND 4PB9L 5JQ6H 4LQFH 4JDZA 4HUWB 3F58H 2GTWB 4KKLC 4OF3A 4K8RH 2M2DA 4C59B 1JFQH 2F53D 1I7TB 2YPLB 4K23H 1KNOB 4ZUVB 4U6VL 2P7TA 1UH3A 3W0WB 5HYJE 4JRYB 4ONGL 4PGEB 1MCBA 2JTDA 1MFEL 1ZWIA 4ODWB 4QRTB 4FQXC 3VRJB 2P5WE 4ISVB 5C86A 1A7RL 1FO0A 1XMWA 1UVQA 1IC4L 3BIKA 3HNTH 4QGTA 2L7JA 3VRLE 1YYLH 2FR4A 2OSLB 3IDXL 3QUXA 3MXVH 5D1XB 4YK4B 4G6FD 1OSZB 1BAFH 3VD7A 2WUCH 5E2VL 3IKCB 5E2UL 5HHMB 2NY2D 1UCBL 2VDNH 4W6YB 4U05A 5F6HJ 3RU8H 3VD4A 5SWZA 4ZAKA 3RUGF 3MV8B 4O2CA 1CGYA 4HWNA 4JDTH 4OZGF 5D5MF 1CXIA 1Z3GL 4QXTB 4U33A 4U1NB 4NN7C 3CDFA 2XPGA 4PJCA 4OF5A 2WBWB 1ZE3C 4UTBH 3PGDB 1B0WA 1Q72L 3PIQB 2NY4C 5J13C 2MQCA 4NNXA 3D6GA 4TUJB 2GAZB 4Z7VA 2EC9U 2QBWA 4XXCA 3SJVD 1NANI 1MRFH 3ROOA 1BD2E 1U58A 5SX4H 1DQJB 4X6DE 1DFBL 1ORQA 5IIEB 5CJBA 2FX9H 5HHPB 4EN3C 1RZFH 3B9KB 5ICYA 2FGWH 1NGZB 3U1SH 2YS4A 3GUTB 2FHBA 4HPYH 1I1AD 1QFOA 4JREC 3EDFA 4U1LA 1DQTA 4DZBA 3F58L 4XI5C 1BM3H 5B39A 3K4AA 5JO5B 4JFFE 4DTGL 4R2GC 4D2NA 5C0AD 3LEVH 4BJLA 1U58B 2DOCA 4MJ5B 5D7SL 5L0QC 5FF6A 3N50A 3UTSE 3QNZA 2Q86A 5M7QA 3QIWD 2NMSA 3EKCA 2ZWLT 2KBGA 3CFKA 1V3KA 4FMFA 3TO4C 1CGVA 5AZEL 5CP7B 2P7TB 2JK5B 3HZYA 4FN0A 4J3UA 4JN1L 5LWYH 1A7RH 2WQRA 2EDBA 4FXKA 3S35X 5C7XH 1QQDA 4POUB 4PJ5E 2DLFL 2Z8RA 1CDYA 3QPQD 4NQCD 5EORH 5GS0L 1TJHL 3MXVL 1WWAX 2DBLH 1MELA 2ZOLA 2O26U 3FO0H 4P5TB 4DVRH 2P47B 5FKAB 4JFYB 1QP1A 4N8CH 4L3EA 4APQA 1JUFA 1PGRB 3PGDA 5DUBB 1MCKA 2G9HB 4ZUUB 5HGHA 5FYLD 3SDCC 4XPHL 2C7UA 3HZMB 4X7SL 1C12A 3WE6A 2HRPL 2VABB 4PJGE 3RDTB 4RDQF 4PJEB 2BX5A 4X4YA 4L3CB 4N68A 3QIWA 5DMJB 4DFIA 4LP5A 1HHGA 4LCWB 5DD5H 4ZTPL 3C8KA 2NYYC 4JFQB 2GKIA 3RGHA 4DKEH 2NY3C 5FO8A 2A6KB 2HRLA 1DLFL 4O5LL 3OBAA 5I8KL 5I8CB 3D0VA 2J1KA 4XBGA 1A7PH 4PRIB 1RZFL 4KKBD 1NKOA 4HT1H 3HFMH 1Z6JT 5FKAA 4N0FA 4WTXA 1G1YA 3IDJB 1NCNA 2FB4H 1SYSB 3ARFC 2XTJC 5EU7E 4YHLH 3DUSB 3GIZH 2NW3B 3RL2B 5DMIH 4KKCC 3RWCB 1GPOH 3HI1A 4NP4L 4H20H 4K3EL 1X5KA 1I9JH 4NO3B 4JZJB 4OZGB 1J1PL 2CUHA 2DICA 4EUPA 1LO4L 4LCCB 4R26H 3L3DA 3WL9B 5DA0B 3BRFA 2R0LH 4AY0A 4K3DL 1A6AA 5MHSD 3F5WA 2VQUA 1F6LL 2Z8SA 1AD0A 1IGCL 1DDHA 2CR3A 4KK8D 3RTQB 1BJ1H 1BZ7B 4W6XB 1XF2A 2WK2A 1WFOA 1YECL 4YEEA 5TDOA 5HYJD 1I85A 3GSVB 4GXUN 5TF0A 2ADGB 1IEBB 5EPMA 2C1PB 2X4SB 2Z35B 4JFXB 4YE4H 1NCBL 4K8RC 3QFJE 3AAZB 4OLYH 1F6AA 3RGVA 1EO5A 3WJLA 5E99L 4GKSA 4U1JA 3BE1H 3QZWB 1S9WA 3R8BB 2V7NB 5AAMA 4RMUA 3O8XB 1QBLH 5CGYD 4GSDL 4YXLL 3HC0A 4JM2D 2ATPB 1JNLL 2ADIA 4PD4J 4N8VA 2QKIA 4KPHL 1LP9E 4X7SH 2HRPH 5SX4I 5C3TA 1MF2L 1BVKA 2FECL 3VGFA 5CEZL 2OJZH 4HHAA 4PBWD 3VXUE 3HE6C 4XCCL 4L9LB 3T2QA 5HHQB 2BVOA 1XZ0B 1OQOA 3GSOA 1FL5B 3WKNA 4HDIA 4QXGH 3RWEA 4GBXB 5D7KE 4JG0H 4K7PH 4WO4C 1MCFA 2Y06H 4J3OC 4NYLB 5HVWA 1D5XB 2HG5A 1JI2A 4LLDA 4LSVL 3SJVE 5BS0E 5I8KH 2CDFB 3FMGL 4WWKC 3T77A 3MRCB 4KV5E 1E6JL 2XQBL 3AY4A 5KSVB 1BBDH 3QUMH 2DDQL 3OGOE 5E70A 2VLRB 1FGNL 5HGBB 3IYLW 1RZJC 3GIZL 2OL3A 3MLZH 5E8NA 4MZ2A 3ALXA 2EO9A 1HKLL 5T1LD 2GCYA 4LBEA 4YHYB 1J1PH 3VWKB 3PWLB 4OZHF 5DMKB 1JBJA 3IDGB 1PVHA 1KFAL 1T21A 4ZS6D 2UY6A 4XCFH 1DQQA 3OGCB 4JY5L 5KG9A 1FFRA 4XPBL 3OR7A 3MCKA 3PGFL 5E2WH 4LRNL 3MRCA 1A1MB 2ID5A 3JVGA 1WBXA 4YDVB 5FHBL 5CD3A 4QTIL 3QXDB 4Y8AA 1OOAA 1E4WH 3VFRB 2F54B 4LVHB 4M3KB 3MLPA 3ROLB 4N90E 2BJMH 1NJ9A 4M1CD 4DK6A 1OAZH 5MEOB 3MNVB 3S3SA 1QZ1A 2VERN 4LPYA 5DJCA 4JJ5B 3QEGL 5A2JH 2VLJE 5C9JA 3MJ9H 1KG0A 5E1AB 1YNLH 2VUYA 3LSOB 2UUDK 3GDBA 1ZHBA 3EYSL 1X7QB 1ZT1A 4M00A 4LCYA 1A6PA 3F7YA 1IVLA 5CLTA 3GHEH 5DGRA 5FGRA 4HFWB 4XGZB 4MNGB 4P23B 1S9VA 1UJ3A 1J10A 1T04B 2P8PB 2VIRB 3GRWA 2VLKE 5ANME 1JVKA 2Z91B 4Q9RL 4HAGA 3ULVF 4PJXA 5I1DB 3HE7A 5IVZB 3CIQA 4JG0L 4K7PL 1DN0A 1Y6MR 3EJJX 3PQYB 1FO0L 4WI9A 2Y06L 5IR1A 2JE8A 2WQ8A 3GJFB 4IJ3B 3KGRA 3QFDB 5E6ZA 5J56B 1EHLH 2XWJA 8FABA 1G9ML 1MWAB 4NJ9H 5A1AA 1W8OA 2UZYB 5DGQA 3CFJB 4OZFB 5FV2A 4YHIB 5INCB 3VFGH 5IQ7L 4P5TC 1CT8B 3L3JA 4MDJB 3DURB 3KJ6H 5ACZA 5IOPA 2B4CL 2EDQA 1QFUH 3V4PH 4ONHA 2F53E 1MJUL 3QXAB 2GEEA 2FHCA 3DYPA 4L4TD 3UYOD 5BJTA 4TNWF 1QUNA 3GNML 3RZCA 1CFQA 5D1ZD 2PW2B 1MCWM 1G6VK 4U1HA 1B0RA 3FQXA 1KPVA 4NZJA 5F21B 5KVGL 1K2DA 3WEXA 4Y2DC 4HIHA 1GGBL 2B1AL 3WHE0 5F1KC 2O5XL 1C5DB 1IAIL 1WGOA 2AJZB 4TNVK 5FYLL 1P7KA 3SDAC 3RIFF 2D03L 4UT6L 3WLBA 4YDKH 4E41B 4DEPB 5DHXB 3QFJD 2YD1A 1U93B 2X1PA 4L8BA 3NAAL 1P4BL 1H3PL 3D39A 3UO1H 5D70H 2VXQL 4JFEA 5IESH 1T1WA 2XZZA 4LSUL 4Y16A 3PF2A 4UOJA 1Q0XH 2B1HH 1EIBA 5H35A 1PQZA 4OCXL 4J2XA 3ZHDA 4OLVL 1NGPH 1RZ8B 3BH9A 3V0AC 3EYFA 1QBBA 4LASH 4YHOL 3WIHH 3AS1A 1A1NA 1FP5A 5F3HB 5LVEA 3VXQB 5HYJA 4OSUL 3BISA 3QFJA 3V52H 4P59L 2ESVB 4X7CC 1KJ2L 3SE9L 1MQ8A 4Q6IC 2VWEE 3UPRB 4O58H 1BHGA 5TQ2H 3L3OA 3TH2T 1LK2A 1I9RL 4N9GB 1DCLA 3IF1B 1M7IB 1A21A 3HE6B 1MLCA 3UJIH 2A83B 3QWRA 3WUWG 2OP4H 4OCMC 5T33H 3QDME 3Q6FB 5L88H 4ZFOA 4LLVB 5TDPB 3CLFL 1C08A 3VXUA 2NXYD 3WFCL 3VFMA 4P9MH 3KJ6L 4Z7UB 5I8OH 3BPOC 3LRSB 4Y19A 3WXVH 3QBTB 5IVNA 3FTGB 4G42B 1G7IA 3HRPA 3PDGA 3INUL 2YD3A 1I1RA 4UQ3A 2PXYD 5DFVC 5AG8A 2AQ1A 3QUYB 4PJHE 5EOTA 2EIDA 4Y5YC 1NMAH 2CIKA 2DI7A 1H3GA 1VGEH 4KKCD 1N2RA 1EHAA 1JJUA 3V7AG 2KQNA 1K8DA 3OKKB 1UM5H 3IDIA 2D03H 3TNNA 4M7LT 4NRYA 4NQCE 4ONOA 3QEUA 1YN7B 3ARUA 1ZLVH 1XGQB 1XR9B 1ULVA 4Q9QL 1K9TA 4NQDE 1A47A 4IEFB 4UQ3B 4YK4C 1AGBB 1VKXA 4J4PA 3TC9A 2BSSB 3TO2A 1HHIA 4F8TA 4OV5A 4XCEA 3BX7C 2B5IC 4MDIA 3IDGA 2YEZA 4FQHA 4FQLL 1MFDL 5KZCD 4YFLF 4UDUA 2VDRL 3QSKB 5DC9B 5C08E 5F9OL 1Z5LA 1CDBA 2R56H 1F02I 4I0PA 3MV9B 5ALBH 3C6LB 2IH1A 2QSVA 3N1FC 1CL7L 1Z9LA 2DWEB 3HPJB 4JM2A 1R5WA 2O5YL 2Y6SD 3CVHA 1BIIA 1KULA 3P0VL 3WLWD 4LOUD 5CZKA 1PX4A 4NCDA 4OI9A 2E8ZA 3R1GH 5E08L 3CK0L 1WZ1L 1EH9A 3ISWA 3DV6B 4O2EB 3SDDB 1IKNC 4RMSA 5J89A 1TPXB 3MXWH 1F58H 3CLFH 4PLKC 3QA3B 4IOIB 3BUTA 2HLFC 2XTJE 5EU7C 5IMMA 1JGDB 3G5XA 3A67L 3DXAD 3NIDE 4WO4D 4NKDA 1MCPL 4KUCD 4HF5L 1UH2A 4MYWB 5MHSE 3KS0J 3MLWL 2WINB 1MCSA 4OF0A 3EOTH 4HWEL 1R0AH 1V3LA 2X1QA 1FQ9C 1QKZH 4JO1H 3U7AA 3BKML 1UKSA 1BIIB 1GGCH 4XMLL 4OGYH 2PCPB 4PB9H 3SGDH 3U0TB 2B2XL 4M7KL 4M6NL 4KUZH 2YXMA 3GJFA 3UBXG 3UXFA 1D7FA 1N0LA 3V5HA 5EPMB 2DI8A 1NEZG 1LMKA 3DI2B 2IC2A 4WU5B 1J8HB 3OZ9H 1GGIH 5H8DA 5DFTA 1AR2A 1LE5A 2VLKA 2VLME 4O2FA 3RTQA 5J8OA 3RVWD 4JRXD 5MI0C 2NY6C 2VXTL 2V5SA 3QIBA 4HFWA 4JFDD 4XGZA 3P2TA 3M17A 4MJ4A 2EICA 2MQ3A 1MAML 2APTA 1YPZF 3VXUD 5IHZA 1KIRA 2GFBB 1BOGA 1A1OA 1U8MB 4U6TA 1UEMA 3M1BA 3MRQA 3U46A 3DMMA 4WDIA 1SEBB 1A3RL 1P2CB 1F3DJ 1F4XH 2XRAL 3WN5A 1BVZA 4JKPH 3ZYJA 4Y1AB 2X44D 3FQWA 1WZKA 4ZUTB 3OHXB 2DTML 1CXLA 1JPSL 1CL7H 2AS5M 2WUCL 4UDTB 2YMXL 1UWEL 4XMPH 1BGXH 1CBVL 4NGHH 5JA8B 4LKXB 1A9BA 4N5ED 5HVHC 4JHBA 5T1MA 5TQ0L 2OCFD 1KUMA 4X7DC 4FQ2L 4TQEH 3IDMB 4FQPA 4HH9B 4R4FH 2VDOL 3RVXC 3QDMD 2A74A 2IFFH 4U3HA 5C0DB 4NWTL 3I6KB 5GS2H 5JPNA 5EZIH 3IDMA 4HXAL 2MHAB 5ITBL 1MI5D 1YMHB 3EYUH 3KYNB 3P11L 5LAXB 1SVCP 2CXKA 5J11C 5BW7A 4PJ5A 1P7QB 3MUY1 1S5HA 2CUMA 3VRLF 1OAYH 2FJGB 3KPRE 4P9HC 1NKRA 4IOSD 3QUKA 4B53A 5B3NA 5B39G 2QL1A 4YBLC 4OCWH 1YEKH 3QO1B 2HT3C 4TN9A 2WANA 4JQXA 2DD8L 3K7UA 5IUSA 1NCAL 5CEYA 3KYMB 1T6WA 4DCQB 1BZQK 3L3OB 2X9XA 4XC1L 1I1AB 5E8DL 1RUMH 3NIGE 2IANA 4X9HA 5GZNC 4LARL 1CD1A 1NCCH 3ZSSA 4YHML 3KPLA 4RA3A 3THMH 32C2A 3SKMB 3CDGA 5HI4D 2WLYA 5L2KB 3S96A 2V5TA 2PYFA 1TQCC 3HNVL 3C6LD 4PYHA 1J9CT 5EFIB 3BPCB 3EGSB 2YKLL 2EDTA 3DPBA 1ND0B 2YUVA 3V6OC 2AJYH 2YD6A 1J86A 1WWWX 1KXQE 1MAMH 1ONQA 2Y7QB 4KQ4H 4WJ5A 4JN1H 2IGFH 1XT5A 1Z9SA 3CLEL 4ELMA 4JY6B 3STBA 4DVBA 3BP5B 3PWJB 3LKPB 4H25A 4LSSL 1NFDA 3DX8B 5HGAB 2VDPH 2R2HB 2DTMH 3UEZA 5SV4A 2ZOKB 4HV8B 4KK6D 5BO1H 3BAEH 4ZUVA 1IEBA 4NM8H 3SQBA 2R23B 4U1MB 4MB4A 3BOVA 4WHTB 2CDGB 2OI9C 3KPSB 5IB2A 3BH9B 3LRHA 5C3LD 3T4YB 3ROOB 2OTWA 3BH8B 3VXRB 1ZLSH 2CD0A 4UUJA 4Z9KB 1FBIL 3ULUF 1VEMA 2D31B 1HILA 1RZ7H 4NN7B 1HOCA 1R24A 3C87A 5ACZB 5IOPB 4FTVA 4WCYL 25C8H 2QQLH 1I8IB 4L4TE 3SGDI 5BV7L 5F6IB 4DN4L 2X4QB 1CGTA 3DSFH 4P48A 1J8HD 3N85L 2K7QA 3MA9H 1W8NA 1Q9KB 2FB4L 4M1DL 4W4NA 5EU4B 3CVHL 4YPJA 3DUSA 3FQTB 1FNSH 5CZXC 1I9IL 4GG6A 3C5ZB 3MRMB 4XVSH 5C09B 3GFUA 3BGAA 2BDNL 5CBAB 5KW9H 4I4WA 4JFDB 1Q9WB 1RUML 4XNMB 2VN7A 4QOKB 5FO9B 5I66A 4LLMB 4RIRB 3V8CA 2XI9A 3NIFE 1CCZA 4K3DH 3C5JB 1I1YA 1NPUA 2YUWA 3DX9B 3SY0A 4HZLB 4EOWH 3LN5A 3O9WD 4KY1H 1JF1A 1NH6A 2DIBA 2FX7L 5C2BH 1KNOA 4Y88A 4XMKL 3C60C 1NDMB 3MUJA 2J88L 5D1QA 5GGQL 4N0YL 3WXWH 3BKCL 4OLYL 1KN4L 5AZ2L 1RK0B 4X9GA 3BE1L 4ETQB 2Z8WC 3WJJC 3BPNB 3MRDB 4FQCH 5JZ7C 5D4QA 5T5FH 4HJJH 1REIA 1ZSDB 4FQ1L 2V5MA 1H3TA 4J4PD 5CHNB 5TE4H 2EZ0D 1AO7D 1S78C 3VI4F 2RCSH 4KRPC 1MF2H 2G75A 4P4KB 5GGUB 4XCCH 1VFAA 1Q72H 4ZSOB 3OKEB 4Z0XB 2IH3B 2W07A 3UZEA 1XF1A 4LCYB 1KTLB 5HHNA 5HVHB 3STZA 3DJ9A 3AMLA 3PWVA 1QLRA 1JPGB 3D2UB 4M62L 3WYRA 5JXAL 4U1LB 1G7QA 1FAIH 1OTSC 3UTSA 3S37X 3GBNH 4BH7A 1JF6A 2GSIA 2X89A 1NFDE 2J3SA 4GAGL 2A6IA 2R4SH 1JRHL 5F44A 4Q58C 1JV5A 3S35L 1KJ2A 3HZKB 1ZANL 3IVKA 1KIQA 1LP9F 2FCBA 4HJGA 5I0ZA 4PRAA 5KJRL 1ZK9A 3DROB 3CFKB 1WJ3A 5I9QC 1T2QL 3BP7B 2DB8A 2MCPH 1LEKA 1IBGH 1F4HA 3NFNB 3WO4C 4NQDD 5JHDB 3PWVB 1PKQE 3VXTA 1U95A 3ILQD 5IB5A 3RWFA 2VXVH 2W0PA 4QRRA 4KY1L 4BSWA 1FC1A 4XVUC 1W0YT 1ERNA 4IRJA 5A3IC 2ICEB 4GW4A 3MR9A 1IGIL 3U4BL 1OAZL 3B83A 1V7NH 4PRDA 1JYXA 5IW6A 5L9DL 4QRUA 2DQEL 2VL4A 2CLRB 2E6PA 2X4TB 4Q9BA 4RCAA 4Q6IB 3BWAA 1FNHA 2X4SA 2Z35A 3VFMB 4Y2DB 1UCTA 4O00A 3SQOH 1QG3A 1E4XI 5E6IA 2NNAB 5ACMA 4DW2L 3NACH 3Q2CA 4YR6B 3RZWA 3IDYB 4I8DA 1CS6A 3O6FC 5JR1L 3V7AE 5CSZA 4X98A 5HHOB 1SEBA 3MOBH 3GO1L 3ARDC 3O45B 2DLTA 2Q3AA 4V2BA 3GB7B 1CL7I 1AD9B 1JNJA 3L3DB 2NY1D 4IRSC 1MHPH 4HKJB 6FABL 4D0DA 1AQDB 4H26B 1IM3A 2R8SL 5DJDB 4OZFA 2R0ZH 1TCRB 4QOKD 5GJTH 1I75A 1K4DB 2VC2L 3HB3C 1OSZA 1T22A 4G7YH 4QHUA 5F96H 5GGTA 4KKNA 1CE6B 1FRGH 1II4E 4RWHA 2HWZL 1MFAL 5KSBF 15C8H 1T1ZB 4K2UL 1JPST 2E9IA 4BSVB 1P4LB 1I9JL 3PUCA 1WFNA 2PTTA 1FIGL 2Q20A 2QSQA 3QUXD 4RMVA 3SGJA 3S3PA 1AXTL 4G9FD 2Q7NA 4XPTH 5JOEA 3TYGL 3QDGB 2AJUL 4HIHB 3VWKC 4QRQA 3KPNA 4Z7WE 4JRXE 3EO0A 5D6DA 3WDHA 4PTUB 4GG6E 3JV0A 3QDAA 4XBEH 3R4DA 4JDZB 1KYOK 4PY8J 4LGSB 4UV4L 4OD2A 3BPLC 5FYLH 4P3WA 5LGHL 3CX5J 4UAOC 3QAZB 3TV3H 1I8MA 3RY5A 3FB7B 3KJ4C 4RFOH 1R5IA 1MQKH 4LDEB 5L7XH 4HUVA 4AIZA 3BO8B 5JW4Q 3SQOL 2ZOKA 4AK1A 1CYGA 2AKRA 1HZHL 5KAQF 3ARDB 1ACZA 3MYJB 43C9A 3MCKB 4M02A 5C8JA 4NZUH 2OMBA 3HUJE 4PB0L 2P44B 4MD4A 5HI3C 3QPXL 3T3MF 5JW5A 2EE6A 1OAQH 3UPAA 1JHKH 1QYGH 4LKCB 3WIHL 4X80L 1UB6A 1VACB 3BZFB 3C9NB 5D1ZA 2OK0H 3FT3B 2EDLA 2ORBL 4P59H 4NHUA 3L6FA 2DQJH 4D0BA 1HH9A 3NPSC 5EO0A 1CE6A 1CLYH 1IKFH 1KCUH 5E8OA 1H0DB 4GW1A 5E56A 1WWCA 2FBJH 3T0EC 4BZYA 4FXKB 1ZT7A 1G6RH 4DGYH 3BW9B 2EDRA 3C08L 4R97C 2Q6WB 4JRYD 3LD8C 2WMPA 1UGNA 4PJBF 3B6SB 3X12B 4L9LA 5HHQA 1FYTB 3SE3A 3O4OC 3QHTC 4I18C 5D7JB 1ORSB 4I0PD 2Y5TA 1QLFA 5FYJH 1F3RB 2ADJA 4YHZH 5GXBB 5ISZE 1J1XH 1UEYA 4U1NA 1NSNL 4NZRL 3REVA 3U36A 1ZMYA 4NNYB 3BWAB 3ZKNC 2PXYB 3OKEA 4Z0XA 3MREA 4XRCA 4Z5RB 3LEXA 4A6YL 1CD9B 2Y4SA 4MAUL 3OKYA 2WNGA 1CK0H 5HYEA 3H3KA 1Q9OB 4Z7VE 4BYHA 5DXWA 2ZUQB 2Z31D 1ED3B 4WUUE 5CIPA 5EO0B 5T1MB 1QLEH 3MOQA 5D7LD 3QWRD 3FO1A 2ZJSL 1NGQL 1M4KA 5ADPH 2FEEL 4F9LC 4JANB 5F97E 4Q9QH 1KBGH 2JJTA 2YRPA 3VE0A 5KVFH 5T3ZH 2LTQB 4U1IA 1U92B 1H5BB 3JV4B 2GW5A 2J7LA 3MLSH 4FQQB 3KYKH 5B8CC 3JBG7 5D2NC 1KCKA 4PJHF 3WL9A 3RTQD 3I6GB 1KLUA 3B8SA 4X80H 3ARXA 4OQTH 4KGLA 3SDXA 5CUSH 2AK4B 1G7PA 5TF1H 1RZ8A 1FO0H 4UUJB 3OJDA 1CLYL 4OZIB 1ETZA 4LIQE 1DLHA 2AK1H 1DQDL 1T5XA 1MI5B 2R39A 5GS1C 2OM5A 5D2NB 4UILL 4PTUA 5HDLA 2W9DL 3R1GL 3IXAA 5E08H 2ADIB 5FUZH 3MXWL 3VFGL 3MLYL 1DE4B 3V8OA 2J12B 5EH1A 4HZLA 1R5VB 1N7MH 1N6UA 1K5NA 3DMMD 1BFSA 4PG2A 3QZWA 4M3JA 3GSUB 3RA7L 3I84A 4N1CA 3H0TA 4QEGA 4W68A 2D0GA 1Q9LA 2OXHA 4NNPH 2DQCH 5GS1B 4TTGA 5D5ME 2YN3A 3IETA 5AWNH 1YQ2A 4XHQA 3GMLA 3MUGA 5FM4A 4FFYL 1X5YA 3GI8H 3MRHA 4L4VD 3FAXA 3C5ZA 3GRWL 2BSTA 4DZ8A 1CD0A 5C07B 4C55A 4L8SA 1R3HA 4NSKB 4GKZA 1DVFB 1H8OA 2BOCA 4JZOA 3IXTA 3MBEB 4KUZL 1QSEE 2MWCA 5HGDB 1H3VA 4MDJA 2NX5D 4OZFH 3D3VD 1UQSA 2ZJSH 1U3ZA 4OLUH 1KEGH 3OZ9L 3IXTB 5HHOA 3ULUD 1UZ6F 2HH0H 3SY0B 3U2SB 4JKWA 5BRZA 3RWCA 5KVFL 3P9LB 5FHAL 4GAFB 4TOYL 4JHZA 3PHQA 4U31A 3VXOA 1EEZA 1AO7E 3VGEA 1G0XA 1EJOH 3L7FB 1NFIB 4GKOA 2Y7QA 1CIUA 2YPVH 5J12C 4YDIH 3ESUF 5DJ6A 3TVMC 3S9DB 4XVJH 5C0CA 4GRWF 3T04D 4LASL 4YHOH 1KJVA 3TN0C 1HDMB 3V6BR 1RJYB 3V52L 2X4TA 3WNNA 4DQOH 4OV5B 4MXWL 4I77H 1V7MH 2FLRT 4RMWA 2WBJC 4O58L 4Y8DC 4YFDB 1SJVA 3DRTB 4WW2A 3OXRA 1N6VA 2N7AA 4KJYA 4EDWL 4IRJB 1DE4A 4RGOL 3U36B 1IM9D 4QF1A 5F70A 1IKNA 1I8IA 2GJ6E 3PL6B 4K3HA 1IGMH 4UT7L 3CDCA 3DRQA 1T5XB 2RHEA 3VA6A 1N0XL 3CPLB 3QB7C 3VXRA 3BFOA 4YAQB 3ARBA 1KEML 1VFBA 2DRUA 1OM3L 3TJEH 4NWUL 4JREB 3VCLA 4BK4A 2P8MA 4NFDA 1U8PB 4X7EC 3NGBB 1GJIA 2JB6B 2ZUUA 5SV3A 3OTTA 4ELME 1MSPA 4JHWH 3W9EB 4FRWA 2GI7A 4WW1B 3BPLB 3BZEA 2ZPKL 3B9DA 4F7TA 3DGGB 3KPOA 4WW2B 3PQYD 4HLZH 1F13A 4DCQA 3CVIH 3TPUB 1KPUB 1MPAL 3NFSL 1NBYB 3T0AA 2VLJA 1OGAA 3PHOB 2IADA 3MNWB 4X4MA 5T1LA 5T3ZD 3LHPL 4G6AC 1J8HA 3STZB 4ZG1A 1FLRH 4PRPD 5L8JB 2MFNA 2L4OA 1IAII 3WFDL 4QCIA 2V5YA 5EFIA 1FCGA 1A6TB 3O4LD 4W70A 1MVFA 2CKNA 3VXMB 3QRGH 4JRYA 1H15B 1U91B 1ODAA 1HEZA 4C4KO 1AGDB 3EOAA 4P2OD 5H37G 2A6JB 1GZQA 1QR1B 1XGQA 5GGRY 3AMKA 1FZOB 1DUYB 1PX3A 1OP5H 3Q6GL 1A3LH 1QLFB 3U0WL 1GC1C 1U8PA 4PGZA 1MFDH 5HPMA 3IFNH 3TM6A 4QNPE 4ETQA 3MRIA 4MNQE 1JRHI 2B0SH 4PD4K 4PJHA 1CLCA 4WU7B 1V7ML 4GW5B 4JHAH 1JGEB 2QEJA 4GXVH 1IFHH 3NA4A 3NTCL 3OAYK 4WDIB 3SN6N 4Z78A 5SWSA 4H5SA 4MA7H 5BO1L 1M05B 3QUZC 4XBPB 3NIGF 3MFFB 4DFHA 3P0VH 5CGTA 5KSBA 3PDOA 5C1MB 5DJ0A 2VDLL 3DRTA 1DBKL 1YEHL 2I07A 1M7DB 3GBMH 1G7IB 3VWJC 2YN5A 1WK0A 1ZLSL 5DRZB 5EZJB 4FFWD 4UMGA 4JHWL 2ZUXA 3SCMC 4WEUD 3K2UL 1J0KA 25C8L 2QQLL 3EDDA 3QEQD 5DJZA 5EZJA 4ZMAT 5DD6A 4LEOB 4QHUB 1L7IL 1UM6L 4HIIB 1NEZB 3P30L 2D4FA 2BSSA 1M7IA 4KDTA 1CFSA 5GGSA 4P2QB 2PW1B 4CN6A 3BZ4B 1IAMA 3WFHB 1U0QA 3DURA 1U8MA 4XNZB 3HR6A 2FEDD 3P4NA 2V9TA 3HI6L 2YD9A 4KV5F 3ARSA 1QA9B 3RPIA 5C6WH 1ZLWK 1JGEA 3CFBA 4U0QB 3H42H 5M95B 3FFCA 4HH8A 1GGIL 3M8OL 3D3VE 5DJZB 2X1OA 3QWQB 5EU3A 2CDGA 4UT9L 3QIUD 1KSRA 5C0IB 5TE7L 1XGYH 1FJ1B 1RY7B 4PJ8D 1G7HA 1WFUA 1RUQL 1LD9B 2ENSA 1HEZB 2J88H 3TH3T 1OLZA 3RWGB 1A3RH 3TNMB 3LKSB 5AZ2H 1ZGLP 3QRFM 3FT4B 4IMLA 1MH5B 5JTWA 3SKOA 5M94B 4HC1L 3KLHD 4KJQC 3F62A 3PWPB 4UQ2A 1HHJB 2J8OA 3NCMA 3EUUA 5DK3A 1RUAH 4LSQL 5HD8D 1HSAA 5T3XE 2QHRL 4WWKB 4V2CB 3G6JA 3WUZA 5TQ0H 3O3DA 1AR1C 3GBML 1T2XA 3O2WH 1MWAH 4R90H 1WC7A 2X9WA 1FL3A 2X2YA 1V5JA 4M6OL 4GFTB 2AK4A 3D69B 2R1WA 3KLSA 3P4OB 3DGGA 4Z76A 1FORH 1Y18B 3QXDA 1ZA6A 3F7VA 3QDJD 4M93B 2XWBB 2H2PC 1UA6H 5IBLC 1MHCA 1H0DA 4Y2OA 1G7QB 4PJXE 4NDMA 3LDBC 1OD7A 2ARJQ 1FAIL 4FXGA 4NQED 4L5FL 5JNYA 3VXMD 1FZJA 4XNYL 3QP3A 4LLVA 1A7NH 3BQUC 1UENA 4BQCA 4PJ5B 1MAJA 1XGPA 3MRNA 1RUPL 1MJ7H 2X4UA 3QJFB 1DP0A 4KJYB 1DR9A 1U9KA 2EKSB 3DIFA 5D7LE 3LRGA 4QHNA 4OCLC 2NY5H 5DI8B 3DX7A 4ESKA 1NCCL 3V95A 1J87A 2D7TH 1WUNT 1PKOA 1T2QH 4P3DB 3FONA 5HJ3B 4LCIL 4U6VH 3AB0C 1RJYA 5GHWH 1CE1H 1G7HB 1CG9B 3T3PE 3REVB 2DQFB 5I18H 1D6VL 1QFHA 1YUHA 1F3JB 3VGHA 1A9BB 3OKLA 3EYOB 2F8XC 1MFEH 4YDJB 2YKLH 4RRPA 4CW1A 2J4WH 2A73B 3UC0L 4JPVL 5FA3B 2AJYL 4F3FB 3RAJL 5JHDA 2A38A 5FDWA 4PG9A 2BNRD 3BEVB 3KAAA 3LCYA 1F11A 3OHXA 2GAZA 3MNVA 4PBVC 4KTDL 3MRGA 3CH1A 1MFBL 3ZE1E 3RX7A 3QEHB 1OF2B 4PRPA 1YNTA 4HX1A 2JB5H 1MUJB 2QLVB 2V2TA 5KANI 4HFUL 4RA0C 3OXRB 1MCCA 1UCBH 4YBQC 3Q5YA 1GOHA 5E03A 3GHBL 2XV6B 5FB8A 2J5LB 1EHNA 4J6RL 4TSBL 3JTTB 1EGJL 3AY4C 4LEOA 3ULVL 1OP3H 1JIBA 3EDEA 3TN0D 1RZKH 1GOGA 1Q9WA 5EA0H 3C2AH 4DOHB 2HKFL 4IIQB 4JEGB 3I6LE 5ADOL 1M6OB 2HVJA 5K93A 1FZMB 4LRIC 1S7SA 5B3JE 4P5KB 3RUGA 3GSUA 5GJTL 2PO6D 3HE6A 1I3GH 4Z7OE 2C9AA 1YMME 2NY0B 5TDNB 2OXGA 3U1SL 2ZSWB 2DYPB 1IL1B 5BOPA 4L4VE 1FNSL 4YDLB 1A7NL 4F7EB 2NTSP 3GMOB 1B0RB 2VDQH 3DECA 1FG2B 2CKBB 4QRSA 1PG7X 1N8ZB 1WFTA 4F9LA 2A0LD 3HZVB 1TVHA 2XA3A 5C71A 5K9JL 3ELAT 7FABH 3QG7L 3RHWF 4NN6B 3NN8B 1L6ZA 5B38G 5D8JH 5CP3A 4Y5XA 3ZO0A 2NY2B 2DQGH 2WWMC 4HS3A 4N8VB 4H8WL 5D72H 2A6KA 3QXUA 4EOWL 2MTPA 3TT3H 1AGDA 3EOAB 3ARFB 3LY6A 4NKIH 5I1JL 3DX9A 2XKSA 4M4RA 3QHZL 3SDCD 3PDOB 2E7MA 5DURB 2K3TA 1RULL 2XZCH 1S7SB 4QCIB 4U49A 3HNTL 1GIGH 4J3TA 5KSBE 5TH2A 1T7ZA 2Z92B 2FJHA 1PG7L 1IZJA 4XNZC 1RAMA 4J8RB 5I2IA 4PJIA 4HJJL 1MIMH 3ULVD 1LEKB 4DVRL 3DUUB 1E0OB 5GS0C 5E2UH 1SY6H 2GJ6D 1J0JA 3FHAA 3GJEB 4MCZA 4PB0H 4GAYA 5IG7A 3QUYC 2O61A 2N1KA 1X5HA 4Y19D 1T4KB 1HNGA 4YWGH 3EJYD 4HMCA 3OSKA 3KR3L 4AH2A 1H15A 1K4CB 4GG6F 2EE9A 5D1ZC 1PJ9A 1N4XH 3ZSTA 4JGUA 4Y4KB 3QNYB 3QDJE 4Y5XC 4OM1L 2LE9A 1P5VA 2RAMA 1KTLA 5E6IB 5EOQL 3I2CL 3ROLA 1PLGL 3T2PA 1MLBB 1CG9A 1OGAB 1TTFA 4PJCE 4GXUM 3QCUH 2Q8AL 4PRPE 5E8PA 3OR7B 5C0EA 3FTGA 5HGAA 1I8KB 1NAML 3MA7A 4PJEA 1EFXB 2B5IB 4JB9H 4PREA 1LD9A 3T3ME 5D93C 5IFHL 1KIUA 4IM8A 4I5BB 3QIUB 4G5ZL 1ZT1B 4JO2L 3FO9A 3FB6B 2G9HA 1DQJA 4GUPA 4CMHB 1W0WA 5E5MB 1MHHA 3PHOA 5DEZA 4LRIA 4J23A 2IBZY 1G84A 3S6CA 3NIDF 1Z0MA 3ECBA 3IU4H 4X9BA 3VFNB 1OWRM 4JM2C 1V8HA 4MCYA 3QHZH 4JFPA 3KHQA 4HGWA 3PP4H 1V7NL 3TEUA 2HT2D 3RUGE 2W0LA 3C5ZD 3BN9C 1M7XA 1AFVH 4MNQD 1EEUA 3Q5OA 1NGQH 4ELKA 3TJHD 4UINL 2VITA 4G8FA 3SDYH 1XIWB 4GAYB 5IG7B 1E4KA 1JZ8A 1D6EB 1F5WA 1LEGA 3W2DH 1F6AB 3RGVB 3EZ8A 4NCC1 5DZLA 4HJ0C 2VXSL 2FR4B 5IJVA 4EI5D 3AM8A 4QRPE 3CU1A 4J8RA 1YDPB 5FO9A 3DX6A 1S7QB 4M03A 4P9HH 4X6DF 5LBSL 3KS0H 3DYOA 1FO0B 2ZCKL 2ATPA 3MOBL 3ULSB 4TTDD 4KJQD 4ZTPH 4L3AA 5D2LA 3HS0B 1QSFA 2YPKA 3QEQE 5GSRB 4LSVH 4DKEL 2JIXA 1YPZE 3MRRB 2X89D 4KRLB 1U6AH 4LHUA 5EC1B 3EHBD 3OF6A 1KPVB 5C0AA 3BDYH 2O93L 2X4NA 4TSAL 2J8UF 4ZOEA 1JL8A 3WFBL 1T22B 3ZMRA 4UB0L 1N7ML 4MVBD 1JGDA 4HHAB 2ARJA 1FVDB 4PLOB 1JI1A 1NAMH 5C9KA 1EX0A 4NPYB 5IBLD 2EDJA 3OQ3B 4LSTL 4HKJA 4KI1A 4ZXBB 1KIRB 5CWSB 3ZTJG 4FQXA 5GSRA 4W81A 4MS8C 4NJAL 3O4LB 3VXMA 5T3XL 4AL8L 3S88L 4R8WH 4L3ED 3UMTA 3RPKA 1DQLH 4O02L 1OAUH 3B2UD 4XNMA 3DVNB 2C3HA 5JXED 2I9LA 5LGHH 1BFTA 1EBAA 3AREC 5E2JA 3QEGH 4G80B 4FZEH 1MEXL 3S4SB 1F8TH 4HUMB 1MQKL 1TVDA 4Z7QF 2BMKA 4OI7A 1TQBC 3KDMB 3Q3GA 3BIAX 5KS9B 4PGCA 4ZNCD 4P23A 2YPLD 4H0HB 5T3XD 1INEL 3ULSA 5AYUL 2HLFD 2QR0B 3WHXB 4KPHH 3RWHA 1ZHLA 5EBLB 1MCEA 5JW3L 1FVDA 4FQQA 4CDGC 5FO7A 5D2LF 3VD9A 1NUFA 1MFNA 3QO1A 2C1OA 4AEEA 4NNXB 4TULH 3VXSA 5K9KA 1QD0A 2VZOA 4JLRB 1CDCA 1VB9A 4XZUB 1CZ8L 1VCAA 4I3GA 4NM4H 1PZUB 3HRZB 2Z31A 2AERT 4Y2DA 4KKLD 2W9EL 1OPGL 2FBJL 3MBEC 2ED8A 4OCRL 1N5YH 4NQEE 2ILLA 2F54D 4IRJD 1I8KA 2YZ8A 5IW6B 3FB5A 4G42A 3CMGA 5HDQL 4X4YB 3ZL4H 5HYSB 1OM3H 3TJEL 4NWUH 2W92A 3VXSD 3OB8A 4HCRA 2SEBB 3V5KB 3SGKC 5CGMA 1ONQB 4GRWE 4JN2A 2HJKA 1MIEH 5JIKA 2PETA 2NY1B 1D9KA 3TBTB 1BWMA 3MRFB 4P0DA 4PLJD 4XPBH 1C7TA 2E7CA 4JFEE 3S96B 5FYKL 4AH2B 1E4WL 3KPOB 5EUOB 4B7IA 1RQ5A 2BJML 1R5IB 3CD4A 3K46A 3M17B 4XTRC 4PP2A 1CWVA 2E7LA 1QLEL 4G8GD 1G6RB 1RZKC 1HYSD 4KAQL 3UJJL 3TT1L 4L8SB 1WC7B 5HPOA 3UTSB 4FMKA 5KZCB 5FIEA 3DVGA 3PNWA 4KJWC 1PQZB 2BCKA 3O8XC 1OSPH 3QUXB 1I1FB 5I1GH 1H3PH 5T3ZL 3UO1L 2HJKB 3EYSH 5EDXA 4ELMF 1AQKH 4D0CB 2Z4QB 5AYUH 2XTJB 4ODBD 3RVXD 3UTTE 5KVEH 5LGJA 1JNNL 3EW3B 4JJHA 1RFDL 1U93A 3VRJA 3HMXH 5IVXB 1LDPL 1NGPL 1CDJA 3LKOB 3K80A 5B8CB 2GK2A 3NIFF 4KZDH 1QRNE 2CMRL 3Q6GH 4DUXA 1UB5B 1VGKB 5FOBB 2P4AB 5TF1L 3GSRB 5D1XA 5DZOA 1ZV5A 1KJVB 5I73C 1HWHB 1TZGL 3MLRL 4I4WB 4MA7L 4M6AA 5FECB 2IPKA 1W72H 3KXFE 4M43L 4J3WA 4G3YL 2Y07H 1G9MH 4OLZL 1ZXQA 5TFSL 3BWUC 4N0UA 4PY7A 3D39E 2GY7B 4FABH 3G6DH 4P9ML 3BUYA 5ETUB 4QKXB 1OCWH 2MJWA 5DD0L 1D5MB 4OZHA 1JF1B 3RDTD 3FB7A 4M61B 4EQ2A 3VI4E 2Y1VA 3NN8A 1MJJB 4BH8B 2J6EA 3F6LA 3UROR 4HG4J 4U1SB 1IC7H 1YNKL 3CFEA 5D7IE 4LF3A 3P4LA 3S4SA 3GSNA 1LE5B 2PN5A 5J4MA 3GRWH 5JXEA 5I2IB 1NDGB 2H26B 1KOAA 1A7OH 2BVTA 3MUGB 4XP9H 3QQ9C 2ZSVB 5HI5C 5EO1A 1GAFH 3FRPG 2I27N 5I1DA 4LIQL 1EXUA 2W9LA 4X99A 4M7LL 5BVJB 1EFXA 3JTTA 5E8EB 4MQXD 1G1CA 1BBJA 5GRWA 3L3HA 1CGXA 1YY9D 5E1HB 2WLZA 4FTVD 3VGDA 5CILH 5BZDB 3V0WL 3MCLL 4P2CG 2BNUB 1CF8H 3ARBD 5CINL 1B4JH 1NGWB 2HVKA 4AEHH 1MLBA 1ZAGA 5IVXA 5FHAH 1KIPB 2G5RA 4G8IA 2CRIA 4BSWB 4G7VL 5EUKB 3AREB 1CD8A 2AJXH 4Y19E 1GCFA 4LU5H 3EJZC 1X9QA 4Y4HC 4YH6A 1ETZB 2CMRH 4LOUC 5T5NF 3CGTA 2G2RB 1F6FB 1KLGA 4WI7A 3LMJL 1NGYA 1SEQH 1FG2A 3QI9D 2AABL 1KJ2H 3GMPA 5EZOH 1KCRL 1H3WM 2DWDA 2O5ZH 1CXHA 2O5YH 5HTSA 2NW2A 1LE9A 2R2BA 3GJEA 4G9FB 4AG4L 4IJ3C 4G3YH 4OFYD 1MFCL 2VR5A 1IGML 3MV7B 4GRLC 1AC0A 4OKVB 1MCLA 5IR1B 5LGKA 2H8PA 3HPLB 5FUOL 4LPTA 4FABL 2OR9L 4HWUA 2W60A 1Z0NA 3Q0HA 3SDXE 2EH7L 4KK8C 5DD0H 3SJVB 5D9SA 1X5FA 4E0RB 4BSJA 5F7MC 4FFVD 3VXSE 4PREB 5JIPA 4X8XA 2V2WA 4RAUA 3ZKMC 4JPKH 1NBYA 2EE2A 4KZEH 3LS5H 3MLWH 1RZGB 3VFTA 4QHKI 1AGBA 1HXMB 3CVIL 2XWBA 4ELKB 1NMAL 1C5CH 5A40E 3QJFA 1MOEA 1DBAH 4ODSL 1A7OL 4XMLH 4HGKC 3U9UA 4D9RE 1QRKA 2NY6D 2G2RA 4M6NH 1ZT4B 5F7LB 5ID0A 2Y23A 3FQNB 3QNYA 3TVMB 3IS1X 4XPFL 2F19H 1VFBB 1YN6A 3D2UA 3WFDH 4CMMA 1DUZA 4RSVA 2XA8L 4X6CF 3E2HB 1N2RB 2A9MH 1MY5A 5CBEB 4CW1B 2Q6WA 3RBGA 1F3JA 4K55A 1BOGB 5HY9B 2FO4B 4WFFD 5EOTB 4ZS7L 3ZYZA 1HQ4B 4NT6B 3VI3E 1L7TL 3MA7B 1R3KB 3LIZL 3WNLA 4PJIF 5AEAA 1LO0H 3JV5A 4U1KA 4WFHE 4JO3L 4PJXF 5D6CB 5EO9A 3AAZA 4A2MA 2KZ1B 2BFVH 3TBSB 1G9EA 1QSEA 4G80A 5HHXL 1XF3B 2KDGA 2I26N 3JUZA 5GS3A 3C9NA 3HMXA 3O2VH 4V1DD 5D1ZB 4E42B 4J7RA 2NX5B 3G6AA 2O5ZL 4BFIB 1UWEH 4ZUSA 3FFCB 4YC2B 1BGXL 5A2KH 5DRNB 2G5BA 5DJ8B 4Y1AA 4PJDE 4ZPVB 4Z8FH 4H0GA 4J6RH 2VDLH 1MFCH 3W0WA 2P5EB 1RUKH 4FQXB 1WZ1H 3UJTH 5D5MA 1LVEA 4FA8A 2AEPL 2OR9H 3QFJB 5EA0L 2QJDA 5DJ2A 1XAUA 5C70A 3RL1A 3DO3A 5ADOH 5I8EA 1BQLH 4RFNB 3S36L 4ZPTA 4XNXH 3A67H 5EC2B 4HS6B 2APWA 5EUOF 4BK5A 3MODH 3E6FA 2NZ9D 5IF0A 5GZND 4YDJA 2HMIC 1A6UL 4HWEH 1R0AL 1T03H 1RSFA 2FGZA 3KPNB 4I0CC 4NHCH 2IQ9L 4QWWC 3O0RL 1WBZB 4L3EE 1E27A 4K3GA 2AI0H 1NCAH 1QPXA 4HQQH 5D2LB 3MZGB 3TNMA 2R0KH 4XC1H 2B2XH 1CFSB 2YSSA 5IHBA 1T66D 4XPFH 1CGWA 3S5LB 5CD5D 4F7MB 3OAZK 4I2XE 5DK2A 5MENE 4FG6D 3DETC 5D8JL 1P84J 5SWSB 1E6OL 1QSZA 1U8JA 3D1MC 4ZAKD 5BV7C 5TE6H 3BHBB 2EYSA 3MROA 4UT9H 4PR5A 2MKWA 4JM4L 4GAJL 3RRQA 5SWZE 4Y0GA 4P23C 32C2B 3SKMA 4JO3H 1R3LA 4S1QH 3MUHL 1CXEA 4NO2B 3STLA 2V2TB 3RQ3A 1UKQA 1I1AA 3GB7A 3HB3D 5D96C 3IFOA 3O8XD 4NRYB 2DM2A 4F15B 2V9QA 5DDHB 1NUGA 2KKQA 3B5TA 1J0ZA 3ECBB 3VFNA 4C56B 5IKCB 3LN9A 4XAKE 3DX8A 2D0FA 5K9OB 4IHOB 3T2NH 3LKPA 4H25B 3T65B 4YQXL 4ZNEE 2ZUTA 4MJ5A 5JOPD 1FVCB 2F54E 5IMLB 2HVJB 5DUPH 1ZVSB 5ECJE 3E8UH 4JZNA 5DVLA 3Q48A 4KTYA 3DBXB 1ZEAL 4BZ1H 5MEPA 4OLWL 1GZQB 2R69H 1JZ3A 2NXZB 1FBIH 2X5PA 5HYSA 2XZAH 2FJFA 2FIRT 2IFFL 3P40A 3S36H 2FEEI 4X7TB 2J6EH 4XNXL 2XQYG 4NWTH 1PAMA 4BFEA 4P4KC 4RAVB 4HH9A 4X6FA 2H3NA 3W11C 5FGSA 1D9KC 1MUJA 1CLOL 4DN4H 5MEQB 1HINL 3MRNB 4QT5B 4JFED 3OR6A 3PE9A 5E5RB 5ESQA 2YUXA 3L9RA 5EOQH 3I2CH 5GRUH 4APQB 1KG0B 4N1HB 2CPCA 3QQ4A 3HG1B 5CJQH 2DQDH 3RVTD 3CSPA 2K7PA 5BMFH 2DD8H 1C8PA 1JCKA 1W72A 2VKXA 3QUKB 2MCG1 1J05A 3FRUB 1G7JA 2NY5L 4ZQKA 2WP3T 4K23L 4P2RE 3P9MB 3L5XH 4WY7L 2VE6B 3SDDD 2DQHH 2FECI 2V7NA 4RAVA 4BA8A 4LNRA 3WNOA 4XNQB 2WW8A 5GGVL 3HNVH 3WUWA 4X8JB 1FCCA 1NEZA 1LO3H 4HS8H 1INDL 2OBGA 1UXSB 5E8OB 4H1LB 5H37H 2OSLA 4R4NC 4NQVB 4JN2B 2I9LB 2EZ0C 5DJ6B 5GGQH 2IQAB 4KTDH 3F65A 5I1KL 4R96A 4LKCA 1IC4H 1S7RA 5GRVK 3KYNA 4Q97A 5I15L 1RHHB 3D18B 4ZO6A 4PJCF 1IEAA 3T0ED 3ARBC 5C0GB 4NQSA 2R2CA 3U4EB 3VWJB 1BAFL 4S11A 4XCNA 3ARDA 4MNHA 1LK2B 4MA1C 1P2CA 4FQJL 5TE4L 4CU7A 4FFZL 2VE6A 2AV1B 3BP6A 3E8UL 2F9BT 3SDAB 3B5GA 2W59A 2VL5B 3LH2H 1A1NB 2ZCKH 1OTSD 4GMSH 3SPVB 3C2AL 4JY4B 2GTWA 4X5WB 2CDEA 5LCVL 1KXTB 3FQWB 2CXGA 1MCRA 3TCLB 3RWDA 3QUZA 4P3CH 3WFEH 3AREA 4YUEH 4S0SD 1P1ZB 4F7EA 1CLOH 1ADQH 4RGMC 2FX9L 4NOFA 4CVUA 3WLBB 4QRRE 4M1DH 2HFTA 3L95A 3TWCL 3WFBH 4GKNA 5C07A 3W82A 4KROD 4NOBA 4YXKH 2LQRA 4KKBC 5DQDL 1A5FH 4AENB 4P46D 2B39A 2FL5B 5FYKE 3WO3B 4D9QE 4LSTH 4FTVE 4WI5A 3MX0A 2DJ4A 2PYEE 4TUKL 3B9AA 1TTGA 3DSNA 1TQCB 1JYWA 1EMTL 4YHNA 5I8EB 3K8MA 1HQ4A 4NT6A 4X83A 3A6BL 4CNIB 1CFTA 2QSTA 5DEFB 5J6HB 5JDJA 4GMTH 1HILB 2DM3A 1EVUA 2VTFA 4JPIA 3JWOL 4LLQA 1JZ7A 2LVCA 3C2SA 2X7LB 3JTSB 4PJHB 5IGXH 4KC3B 3VE0B 5C0FA 3OJDB 4OZIA 2DI9A 4I3RH 4N0FB 1I9EA 1BLNA 4AMKH 4HULB 3H2WA 3FB6A 4NFCA 3GIVB 3RNQA 2EECA 4UAOB 5ITFA 1FFNB 5GS1A 2OJEA 4PV9B 1KLUB 3LS4H 4MJIB 5CS7A 3SE8L 2F58L 5JOPE 1FYTE 5EO9B 5LKNA 3IFPB 3HS0A 3S36X 3HR5A 3RJQB 3LB6C 4QHNB 3D0LB 5EU5B 3F8UB 6FABH 4RQQB 2BNRB 4IOFC 2R0WH 2LAAA 1NGZA 4KMQA 1PSKL 2K9UA 1N5AA 4X4XA 4YUEL 3S7GA 2FX8H 2GTZA 4O5LH 3OJVC 4NM4L 2LABA 5IB5B 5D1QC 2A77H 5E1AA 3LKQA 2UWEF 1A7PL 4AT6B 4IBLT 5F96L 4M62H 3H9HA 4P5TA 4QNPF 5D7LA 3P77A 2V9RA 2IPUG 3MRIB 2H32A 4YHLL 1LNUA 3V79C 3RHWK 3OX8A 5I73B 4D9RD 4HBCL 4UV7H 3QCUL 1L9MA 3NH7L 2Q8AH 4GRLB 1CVRA 2WP3O 4M7JL 4WFED 3F7VB 2IPTH 4WW2C 5C08B 3FN0H 1BJMA 4X5XA 2W0KA 1F4AA 2DBJA 3HE7C 5DUMH 1SYVA 1A7QL 2FLBT 1OD9A 5C0ND 3BKYH 2ZUYA 1NUDA 1UJ3C 2GY5A 5DMKA 2EYSB 5BCAA 1MRCL 1T1WB 3LKQB 3SJVA 4L9DA 3UDWC 4JO4H 2AK4E 2CGRH 3VFWB 5HYSG 2CIIA 2QHLA 3A6BH 2D7MA 4KVNL 4QF1B 4X6CA 3S5LA 4P49A 1TETH 5BS0B 5CJOL 3MJ8A 1CR9H 1WIPA 5E99H 4V1DE 1KPUA 1R3IL 5GRZA 4NRXB 1IGYB 1FFPB 4PFEA 4G8GB 1TZIB 1QSFE 2GK0A 4AEFA 1JZ4A 1S7WA 2D4DA 1XF5B 5EO1B 4I48B 2QSCL 2DQIH 3GMRB 4HDIB 1RZJH 3QPXH 1RD6A 3SE8H 4PJEE 5HXMA 4UTBL 2V2XB 43C9B 3QA3A 5GRJH 4PJ5D 4Q2ZB 1JMXA 3D85B 4F9PA 2NXZC 5DJ2B 4MWFB 5F1OB 5I1AB 1TZGH 3CXDH 1YEFL 3BQUA 2OX5A 3FCTA 2JCCE 3QHFL 1AI1H 1N64H 2VC2H 2H45A 4K3JH 3VFTB 5K9QG 3QUML 5C2UB 2HT4D 3SGEI 4J1UA 5TFSH 1M1SA 3G5ZA 1TNMA 3MRHB 1YEEL 4K2UH 2IPKB 3QXWA 3QYCA 2AAVA 4ZDHB 4RMTA 3P0YH 1M71B 5CBAA 4JQIH 1DVFD 4QRQB 5IB4A 5I1CL 1PD6A 2X1XR 1ZVHA 3C8KB 4RISL 2NYYD 4OJFL 3W11D 1KCSH 4X0KB 1HH6B 2NY3D 4JY5H 3NA9H 3MLUL 3EFFA 5D7SH 2YOCA 4NJAH 1J12A 4M61A 1S9YA 4S1SH 3ZE2F 4Q0XH 1HCVA 3MYZA 5SWZD 3U82B 3QQ3A 2CGRL 1I4FB 3GSXB 1CK0L 1HOCB 1R24B 3UTQA 4JE4B 3QULA 3V4VH 1IM9A 5GRXG 1DUZB 2ITCB 2KZWA 1RJZA 2ZOLB 4EN3B 1F11B 2DIAA 4OLXH 3WCYA 1CR9L 4PJ7B 4FZEL 5AUMA 3QUZD 2DLFH 4B41A 1WV7T 4XAWL 1F8TL 4AIXA 3V0WH 5GS0H 2JJSC 4HIXL 2VQ1A 1H3UA 3F7RA 4RFOL 4PP2B 3BPOB 3SDAD 4B7LA 3BGFC 4RNRB 5F9DC 5INCA 1OARH 2VDKH 4L9LC 1UB5A 1GSMA 1T1XA 4ZPVA 5DI8A 4LU5L 3LRSA 2XACC 1F42A 4W6WB 2Z9TA 1X5IA 5IB4B 3PWLA 1CQKA 4P2RA 3L7EA 4D3CH 3V6FA 4HIJA 5EULV 5GIRB 4IRSB 3DXAA 1IKFL 1KCUL 1NBQA 4G6ML 1DLFH 3CSGA 3WSQL 1NANH 5D6CA 4HT1L 1EHLL 3IJSB 3LQMA 3MLVL 4ODVH 3H7BA 1YC7A 4NO0D 4YHYC 3VGBA 2FH6A 5IQ7H 2EC9T 4JR9L 2PYEA 4HX1B 2Z31B 5FYJE 3BVNA 4LDOB 3BT2H 1FL5A 4OQTA 5DHVA 4PUBH 4UBDC 4YHKL 4URTB 3QIUC 5IEKA 2NR6C 1JPGA 3BEVA 2Y5EA 4U6YA 5T1KA 1AXSA 1FSKB 2KQMA 4PJ9D 4FFYH 3RKPA 3L9RB 3A6CL 4OM0L 5CKAA 1DBAL 3NCEB 4OCYL 4CAGA 5B3JF 1QSVA 3DVIA 1ED3A 3RI5K 5DJAA 4DZBB 2X41A 4JGMA 3H7BB 2YZ1A 2BRRL 3CFDA 2AK4D 4P46C 5J9PB 2FWOA 3HN3A 3MLXL 2F19L 1XH3A 4KAQH 3UJJH 2XA8H 4MJIA 3FQUA 3QUMB 4OLUL 2B7DT 5LGJB 3RKDD 4U6HA 3RWFB 2ADJB 5DR5L 3O3EB 4GSDH 3NAAH 1NC4D 2JJTC 1MREL 4N5UA 1X44A 2BVOB 5J06A 2B1HL 2FIKB 5IBUB 3TBWA 2CK0L 3LIZH 5BRZB 2X70A 4KTEH 3DROA 1K85A 2IF7A 4JFZH 4K07A 2VOTA 1JGUL 4WTZG 4OIIL 4BFBD 1SJHA 4DQOL 2AGJH 4I0KA 4W4OA 3LN5B 4BELD 1IAKA 3VGAC 4NQXB 4L4JA 4YHNB 3T08A 5GZOD 2IANE 4N0UB 4PY7B 2HJFB 4HUWA 1E4XH 5MP6H 2VYRE 2BP3A 1CGSL 1S7TA 1TDQA 3G6JB 3K1DA 1E6JH 2XQBH 1QLRB 5DD6B 4WGWB 3UJIL 5IMKA 2CH8A 5D1QB 4Y16B 1M71A 3BMWA 3UTQB 1OAKL 2OP4L 3RZCC 5FUZL 4K7PY 3F12A 3V0VA 5SWQA 1CFBA 5C0BE 1DBML 4M4PA 2PR4H 3WLWC 3U9PH 4GKNB 3UZVB 4U1SA 4OGXL 3U83A 2HN7A 4H8WC 5BZDA 4IOFD 3RA7H 2ICWA 4PUBL 1NMBL 4XVUD 3ALPA 4YHKH 1AKJB 5KSAC 4PRNB 3IFLL 2RQ8A 3T0EA 1E27B 4RNRA 3C60B 1EUUA 5E2WL 1XIWD 2Q7YA 5E6YA 1EFQA 4KKAD 1KN2H 1U95B 3EFDH 1QFWL 4QTIH 3NCYS 3KG5A 4DUWA 3RGVD 1JF5A 2PKDA 4O4YH 4KMTL 4ODHL 4S2SB 3DVGB 3L5WA 5A2FA 5FO7B 2R0KL 4HK0A 5BQ7B 4D8PB 3GGWA 4ZTOH 4DN3L 4J12A 1Q1JH 1UM5L 4PRIA 2X4QA 4K94C 1HHHA 1PYWB 1YNLL 3IGAB 3HCVB 2R15A 2AJSH 3D85A 5FM8A 1NMCC 4IRSD 3VWJA 5EOCL 3LEYL 5IVOA 1A8JH 3QCTL 4P57A 4UNUA 4M48L 2CK0H 1Z5LB 1FYTD 1NC2A 4LLMA 2VABA 4YDIL 4S1QL 4ZFFA 4ORZC 4PJXB 3MRMA 3BEWB 4GXVL 3W81A 4MJ6B 3ARPA 1RIVH 5E8PB 2LV4A 3RVVC 3EYVB 5DHYB 2AJ3B 3KPLB 3GSNL 3NZ8A 1EUTA 2CDFA 1S3KL 4YHPB 3CK0H 4M6MH 1ZEAH 1GZPA 5FUOH 1T2JA 1ND0A 2L0DA 3MRDA 4WI2A 4L8CA 4RX4D 1K8DB 4WFEE 3CUPA 1TNNA 1MHHB 4R0LC 4WEMB 1AP2B 3PGCB 4R7DA 3GMRA 1Y0LA 4TUOB 2RR3A 5J12B 2YD7A 2ZPKH 3SDAA 4BQ8A 3V6OA 2Q3ZA 3BD3A 4PJGF 1U2HA 3FQUB 2FD6L 4PJ7F 3NZ8B 4W4OC 1MCOL 5DO2D 3IB4A 4MD5B 4MNQA 4ODHH 4KVCL 1GGBH 2VZSA 3CCHA 3CX5K 4PS4H 1O0VA 3MGOA 1Q94B 2UV3A 4X6CB 5FGCE 2WAHA 1FLRL 2VN4A 3HRZA 5T1DL 5L2KD 3QJHB 2V6HA 2A9ML 4UT6H 4YDKL 4F2MB 2X4OA 3CX2A 3M8OH 1I1CA 4NO5A 1Q94A 1KCVH 1Z9MA 4QGYA 2Q1EA 3JTSA 4RQQA 5I71B 1VEPA 3OL2A 2VKWA 2BVQA 4O9HH 1LGVA 3DMMB 4MGXA 3IVKB 3IGAA 3CSYA 3WHXA 3TO4D 2NTFA 3B9KA 5HGDA 4K7PX 1J0IA 3M45A 1OP3K 3PXHA 5HHXH 5I1KH 2BOCB 4JZOB 2V17H 5IM7B 3KXFA 4YNYA 1OTUC 2B0SL 2NW3A 5I15H 5I1EL 2UUDH 2XKNA 1EZVY 1RIVL 5E00A 3VFSA 12E8H 4AM0A 1A4KA 4PTTA 3X11B 3IDUA 1YYMH 4ZFGL 1NLDH 1ZLUK 1U8JB 4AQ1B 4Y4FD 1DBBL 2EYRA 4HCRH 1KIPA 4G8IB 2DJSA 5IEHB 1HHJA 2Q76A 2MHAA 3QDGA 2RFXB 2W91A 2J2ZA 1C5BH 1ZWIB 5JPNB 2DMBA 3T0WA 4MB3A 1OY3B 4PGCB 4YEFA 1R5VA 2CO6B 3TYFB 4Z18A 3L5HA 4JRXA 5DLML 4QY8A 1UA6L 3G9AB 2XOTA 1JYNA 5JHLL 2VLRE 4HS3B 3P11H 2M1KA 2VR4A 3E2HC 1ADQL 3FKUS 4QTHA 3QI9B 3X11A 1KTDA 1IGTB 2X10A 1FPTL 3GZKA 3FT2B 4G9DA 1NEUA 4XVTH 4TVPD 4HS6A 3BRGC 3C5ZC 5IW1B 3T4AB 2VLLB 5F89B 4C54A 1A4JA 1LQSR 2IG2H 3ARFD 1MJ7L 2XTJD 3GSXA 1JTPA 4ZO7A 4LCCA 4GQPH 3QEHA 4EIZC 1MHEA 3VG0H 3SDCB 2NY0C 3P3YA 4N0CC 5F7WC 4O51A 4OFYA 1JK8B 2VMFA 2QQKH 4HJ0D 1LO2H 1JMZA 4XCNB 2Y36H 2V2XA 3MRPA 2G5BB 5J57B 4BQ9A 5A16A 3GBLA 4ZUWA 2JJSA 1UWGH 2VZ1A 3JWNC 1GC1H 4F8QA 4RGNC 1C16B 4NUJB 5F9AC 1YUHB 5ALCH 4OZHE 2DQFA 5EU6D 3AS3A 1SBBA 2Z93A 1XH3B 1PEZA 4QXUH 4EUPG 5HHVH 5F9OH 4DAGL 5MERB 2EXYC 2DS4A 3BDBA 3MREB 1X3DA 4K9EC 4XRCB 4R6UA 3P9MA 4KK5C 4DVBB 2ZG3A 1E28B 1S7RB 2CKBL 2Z4QA 2C26A 1T83A 4MVBC 3TA3D 1U8HA 5D2NA 4JFDE 5T1KB 3LS4L 4D9LL 3NFNA 3CNKA 5DJCB 4EIGB 1AGEA 1UXSA 2R69L 3PNWB 4AEIH 3WDJA 4PJGB 3MRBB 3OWEA 1G9NL 4K94H 1JWSB 3O11A 4NQXA 2VL5A 2N4IA 2R0WL 1ITBB 4NRZB 2IAMD 4JRWA 4R4BB 4UOW0 1BD2D 2CK2A 1A9EB 2G60L 3ZDXF 4MNHB 3N1GC 1CQYA 2XN9D 2YR3A 3TIEB 1S8DB 2AJVH 3BKJH 3B2UC 3MA9L 4JO1L 3CVHH 4P5KA 3RUGB 5JXEC 1ZKAA 2LFGA 1I9IH 2MMXA 2IG2L 5GIRA 4HBCH 4UV7L 2CRYA 2IQAA 3FO9B 2Z92A 3V5KA 1FVEB 2WSKA 1WCBA 3MBXL 3PWPA 1DJSA 3IDNB 3QUYA 3I6KA 5L2KE 5E4IA 4EN3D 2JELL 1BQUA 4PRBB 1EZVX 3TPUA 4HK3J 1YQVH 5E9DB 4ENED 1HI6A 3KPRD 1A9EA 1RK1A 4KDVA 3KNBB 2WWKO 2ZKHH 4S1RH 2OJEB 3U79A 4JO4L 5AZEH 3CXHJ 4JPVH 4R7DB 2C3XA 1IQWL 3WNPA 1F4WL 1IGJB 5C0FB 2FDBP 3QUYD 3BIBX 3BKCH 5C0BA 4IHOA 4FNLL 1YEDA 1X5XA 3BP4B 4R2GD 1PG7H 2NZIA 4M5ZL 1TJHH 5IBUG 3NCJH 4FQCL 2R1XA 3DOSA 5DMGD 3M1BB 1K8IA 4QT5A 2VWEC 2UY7A 1QO3B 4HFUH 3T1WA 3AB0B 2QTEA 4MA8H 5D71L 1IAOA 3PXJA 2BSRB 1BF8A 3ARGB 4OGAD 1EO7A 4LPWA 3LH2L 3IKCA 4XHJD 4LHUG 1BFOA 1LP9B 1JWUB 4AEIL 5FV1L 3CMOH 4RIRA 4FZ8L 1FFNA 3KR3H 2EO1A 4K94L 2H9GA 3EOYG 3TO4A 5D6DC 4PLJC 1OHQA 1CDUA 3B9KD 1OB1A 3N9GL 3L7FA 4C58B 1N3NA 3QH3A 4MHHG 5ICXB 3G5ZB 3TF7C 2A83A 1I3GL 5KSAA 3K8KA 1OAYL 4X5LA 1AGFB 3BKJL 4OZ4B 4J3XA 4C56D 4H26A 1AXIB 1YEKL 2BSRA 3BQUB 3HCVA 1AH1A 4PIRF 1CFVH 1CT8A 1K2DB 2XY2A 2VXUL 2R4SL 2R4RL 3ARQA 3CH1B 2EXWD 1I8MB 5CIPH 3BD5A 3QDGD 4K8RL 3VFVB 3QIBB 3LQZA 4P2OC 4DKAA 2X70B 4D8PA 5DJ8A 1OGTA 5EU6B 3J7HA 1JZ2A 1VHPA 1S7XA 4OGZA 1U3HC 4ZYKB 4OD1L 1KCSL 5ID1A 4HW6A 4QO1A 2MCPL 3GKZA 4XC3H 3MMEB 1T1YB 4HKZB 5D72L 4XBGB 4L8BB 2EDOA 3MRJB 3ZE1F 2ZKHL 3H6JA 2VXVL 1SJXA 4LHUB 5DJXB 3NFPB 2EEAA 3WHE1 2NY2C 1WIOA 4Z6AT 1TPXC 1YY8A 2C4FU 4QYOB 4P5MA 2DYPA 5F8QC 4DKFL 3DTXB 2E6QA 3VXRD 4E9LA 1AKJA 3B9EA 1IGIH 3L95B 3RY4A 4LSDA 3QIWB 3U4BH 3O6FA 3D3VB 4JPWH 1TZHA 4PJFA 2ICWI 4OAWB 5DJ0B 4Z77A 4FNLH 3JWOH 3PWJA 2PTTB 1SBSL 2HA1A 35C8L 1N3NB 2ED7A 4HIXH 3BSZH 3FQXB 1RVFL 3SBWC 1WVZA 3MNZA 2P24A 4I3RL 4OBRA 3ZE0F 4LLWA 3BP4A 2IAMB 2BHZA 2VDNL 1MLCB 2JJUA 4XWGH 9CGTA 2CDEB 5DRXA 1OGAD 1TENA 1G7MB 3G08B 1D6EA 1LEGB 2OJZL 1ZGLB 1YZZA 5JR1H 3MV9E 1IAOB 1R6VA 4L29B 4TVSa 5FEBA 4YIQB 5INDA 1OF2A 1FYHB 1MHPL 4IRZL 1FN4B 2BVQB 4OZ4A 5CEYB 4PRBA 1TITA 4PJIE 2UWEB 4RMQA 4RAUB 1U6AL 4CMMB 1INQA 3G5VB 1Y6NR 1I3RA 3DSFL 3DGCR 2X4OB 1B6DA 3O2DH 1AJ7L 2BC4B 1PLGH 2XN9E 3VGAB 5IFJB 1F2XK 5B39B 1FZJB 2C3WA 1RURL 4PRID 4I5BA 1IC5H 1NAMB 5CIPB 3NH7H 2VXUH 2ITDB 4YBHA 2IPTL 1HSBA 5J1TC 3TO2B 2ZNWA 1FFPA 4NN6C 1IARB 4OF6A 3GMNA 4Y16C 1YJDH 4V1DA 4MLIA 3OKNA 3ZDZE 2QADB 1KJ3H 3KPPA 3RIAK 5JQHC 2VO5A 2BZDA 4NYLA 5MEPB 4CADB 4M5YH 3VWKA 3WDIA 2W60B 5K9QI 4OCYH 3BGMB 1UH4A 4R8WL 4I0PC 2P8MB 1G0YR 2CUIA 1DL7L 1FG9C 3HKFA 4JJ5A 3T65A 2X7LA 2BRRH 4N90D