2G75B

Crystal structure of anti-sars m396 antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDYVFGTGTKVTVLGQPKANPTVTLFPPSSEEFQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGG Heavy Chain
publication title Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 211
sequence length 211
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75B01
2R9HD 4I1NB 2FHBA 1BFOB 5D4QA 3SGJA 1LDPL 3EJYC 4NZTL 3QO0B 2V5RA 3CK0H 3ZL4L 1GIGL 4H88H 1NGQH 3KDMA 4N9GA 3R06B 1P4IH 3VXME 5D9SA 4GW5A 4NQDD 2ZPKL 4ZDHA 2OSLA 4TULH 3GB7B 4OFIA 5B21A 2DBLL 1BD2D 1L4IA 5F96H 1KCRL 4RRPG 3ZT7A 3PGFL 2Y7QA 2DI7A 1NAML 5TE6L 4PJIB 3UC0H 2A0LD 2NY0B 5DEGB 3OG4B 4QHMB 5GRUL 1XR9A 4F7MA 3QNZB 2LV4A 3WO4C 2HFFB 4QRSA 3FT2A 4GRLD 5J4MA 4D8PB 2RJMA 4OLYL 1RIVH 4KK8D 2J8UE 5FUZL 3S8WA 3B5HA 4PJXF 4K3EL 1ZE3C 1DLFH 5HBBA 4RWYL 2B0SH 4TNVF 4TSBL 4JM2A 3P4OA 4XVTH 4P3CL 2ESVB 1J0IA 2AK4D 5C0GA 2LAGB 1PJ9A 1YEEL 3KYMA 3SE3A 1A7PL 2YPLD 1KJ3L 4NQEA 1P7KA 4P2RD 1VPOL 2DWEA 4JG0H 3S36H 1FQ9C 4WW2C 3RFZC 5EUOA 5E8NB 4X6DE 3OGCA 1EFXD 3R1GL 4JN1H 4NQDB 3LKPB 1P84J 3KPLA 4KK9D 1J8HE 4LDOB 1IKFL 1LP9B 1NLBH 3G04A 4OF8A 3BYTA 3BDYH 1ZLWK 1FVEA 5KG9A 3HMWH 1FAIH 1A7NL 1DEDA 3O3AB 2ZSVA 3FFDA 2V7NB 5DEZA 3H9HB 4KVNL 3MLXL 3MRCB 5GGRA 1WFUA 1U2HA 3MBEC 5TPWH 3TO2A 2X6MA 3V2AR 1P5VA 2UUDK 3DYMA 1OM3L 1A7QH 1E28A 1KN4L 2Y5EA 4XMLL 1JZ7A 3MUZ1 2Q6WA 3JWDC 1KCSH 3CVHH 4XP9L 4P57A 1L9NA 2QQNL 4BSJA 3G9VA 3QUZA 5C8JA 4NQCD 3QISA 3QIWA 4JQXA 1PQZB 2AV1B 5DJXB 5SWZD 4M6NL 1JHKH 1RZ7H 1JCKA 3CDCA 4YHNB 3RDTB 3UJIH 4QRUA 1OB1A 4GUPA 4HLZH 1A1OB 3FO2B 1PG7W 4JFEE 2WINA 3MROA 1F45A 1WZ1H 4P2RB 4LNRB 1UZ8B 3IDYB 2OJEA 4M7LH 3ZE1F 1J12A 3OXRA 5KS9E 5MHSE 4PJAA 5SWSD 3GMQB 1V7ML 3JWDL 5HGDB 4LSSL 2PW2B 3MACH 4OCSH 4FQQA 3BZEA 2ZZUT 1CGSL 3HG1E 5EZIL 2BMKB 3UDWA 3EOTL 5F89B 1RK1A 3WE6A 3WXVL 3RVVC 1RVFL 4RMVA 4P49A 2YUVA 4S1QL 2CLZA 5F3BA 4PJ9B 2UVEA 3EFFA 3T4AA 4QTHB 5E2VH 3VI4F 3C5ZA 4MNQE 4JVWA 3O6LH 4G8FB 4L8SB 2EC9U 4WCYH 2BXYA 4KZEL 3GO1H 4Z7QF 5ESAA 1ITCA 1U36A 1YUHB 4J6RH 2WIMA 4LCCC 2H3NB 4ELME 4GG8B 3F7RA 2C4FU 2O5XH 4PJFA 4TTGA 1BBDH 1KJ2A 3EOAA 4S1RL 4LPWA 1I7RB 1SY6H 3U2SA 5GGVL 2UZIL 2WBJC 3BIKA 1WK0A 3JWOH 3QFJA 1MSPA 4OZGF 3OB8A 5ESVA 2D0GA 2LU3A 2DD8L 3SGDI 2AABL 3AS1A 3RU8H 5JLZB 5FK9B 1YNKL 2B20A 1J05A 4LGPB 2X9YA 3VXUA 5J0BA 4YLQT 4WHTB 1I1AD 4G9FD 3UTPD 2E9WA 3GSNA 4RQQB 4JFPA 1F6AB 5I8EA 4ODHL 4ZUTA 2VZUA 1LK3L 1N6VA 4EI6A 2E9JA 4CJ1A 4K9EH 5SWSB 3VFSB 1T03H 4JFYB 2P8LB 3TZVA 4OZFA 1UXSB 4RMQA 5AD0B 2V2TB 3U9PL 3FN0H 2NY4B 4L8CB 3M8OL 5I9QB 3R0NA 1MRDL 4NJ9L 4P9ML 4YC2C 2Y07L 5FHAH 3Q6FB 5ADPL 3DSFL 1FC1A 3FQXB 2LAAA 4LU5H 4YX2L 4PRAB 2P5EE 1TXKA 2R69H 5J12B 2ADGA 2Z31C 5C9JA 1ZGLM 3T8XA 2M26A 1GZQB 2EDNA 1J9CT 3QUYC 5IB3B 4P46A 1XH3A 2FO4A 5KSVB 3MXVL 5I15L 4KK6C 1N4XL 3FOMA 3IVKA 1AXSB 4F33B 4OSUL 4K3GA 4PRID 4HWBL 4I9WE 5BXFB 3V5HB 1GGYA 3EZJB 4QGTA 2YD4A 1N64L 2CR6A 4JZJC 4XHJC 1QYGH 4KI5C 4LLVB 5EIVA 1ZANL 3BPLC 3MOQA 3HZVA 3D0LA 3IDGB 3LPWA 1NC4A 3LZFH 2I07B 5FDYA 5FOBB 1MWAB 3UPRB 3B83A 4NZUL 3O4LE 2PTVA 3VD9A 4DW2H 4UIMA 5IW3A 3F7QA 3DETC 4F7CB 3ARPA 1YC8A 1Q9OB 2ZG2A 2LVCA 1BVLB 1B0GB 3TA3D 2VLJE 5C08E 4JGUA 4EDWL 1G7QA 5H37H 3ESVF 4LF3B 3WJLC 3T3ME 5IEHA 1ADQA 1M6OA 1UH3A 2X4RB 5T1MA 3FB7B 2FEDC 1NAKL 1YPZF 3FTGA 5ISZE 2I9TB 1EHLL 5DJ2B 1NSNH 3QUXA 4R8WL 3V6OE 5F6IB 3D25B 4MQ7B 4ONFL 5CIPA 2IJ0C 3JTSA 1F42A 3U0PA 3STLB 1AC6A 2XRAH 3RX8A 4UDTB 4KWUA 5DEFA 1U8IB 4R7DA 4YZFE 5BS0A 3ROOB 5GJSH 4IIQA 4WDIB 2B7DT 4XNYL 4TOYL 4PJCA 1R5IB 4HK3J 4BKLA 2A6IA 1ITBB 3PV6B 5DA4A 3VWJC 3ZSSA 1IBGL 3FQUB 2W9EH 4RX4D 3PL6B 4ETYA 3QA3B 5CJOL 5FA3A 4HFUH 2E27L 2HWZH 1BZ7A 3GNMH 3K8LA 3ZE0F 1FYTB 3S35L 5JXEA 4LP5A 4YK4B 3MODL 4PJDB 1U8LB 1U8HA 4JY4A 3EO1B 3EYOA 5CJ8A 1H0DB 1I3UA 4U3HA 1D5BB 3QXAB 2NW3B 5GGTH 4Z7VF 1NUFA 3DROB 2YD2A 2XQBH 3TA3B 4QRPA 2NY5H 4OTXL 3ARYA 5FOJA 1FNEA 1UQSA 3MFFB 4RA3A 3U36A 1I1FB 4OFYD 2OL3B 5H2BA 2VXVL 4K3DL 5FA4A 1IGCH 5E8EB 1P5UA 4QXGH 5J1AA 5IESL 5B8CB 4JPWH 3FCTB 1EGJL 2IAMB 2GTWB 3O6MH 1Q9WA 3L5IA 4CVUA 4N8CH 2KL6A 4XC3H 4CN6A 3MRBA 3CXHK 4YGVA 2EDBA 4L1HA 4LMQE 1A8JH 4PLOB 4F9LA 1DQQA 3L5WA 5MI0B 3SQOL 2CGRH 1QNZL 2VABA 3VGHA 3RZCD 1T80A 2R8SL 4XBEL 4YIQB 2XG4A 5D7LA 1JMZA 4PRNB 4X5WB 2BVPA 5E2TH 4JDTL 5TQ0L 4KJQC 1QSFA 4UTBH 1K2DA 4HBCH 1A9BB 2HN7A 1MQKH 3I02A 3FL7A 5F7DA 5AUMA 4QHKJ 1J5OL 2NQCA 4YHKL 2IQ9L 1PX3A 2V7HB 5HJ3A 4Q58C 1BFSA 1CXEA 3BPCA 2DLFH 3SHSA 1OSPH 1A3QA 3G5XA 5H35A 3KPMB 2VXSL 5CSZB 1S9XB 3V0VB 4PBVC 4HUWB 3TCXA 1W72A 4QXUH 3MRIA 1A6AA 1SM3L 5CZVH 4ZFGL 4LCUB 3CSGA 1FE8H 2YMXL 5FCSH 3PGDB 1ZOXA 1OQOA 1AD9A 4O9HL 3ME0A 3RAJH 1A1NB 3AXLA 1X5IA 5LWYL 2E9IA 2NXYC 1RFDL 5DJ8A 1UWXH 2APFA 5E6IB 3BGFC 2O61A 2JKXA 1P9MC 1AJ7H 2P5WA 3LRSA 2A9ML 4KRPC 3BZFA 4L3EB 4PV8B 3RZCB 2FHFA 1ZEAL 1RSFA 4LASL 1S3KH 3DVFA 4Y4KC 3HAEA 4R4FH 1OWWA 5CJBA 4L4TD 1MH5A 3OBAA 4JO1H 5CEZL 1ETZB 3EGSB 4MD5A 4O02L 4QHNA 4AY0A 5HYEA 3Q5TA 5ANME 5FCUL 5AG8A 1NCDL 5HYSA 5EO1B 43C9B 4MHHI 4ODXA 5IMMB 3MGOA 2H26B 2O5ZL 2AXGA 3TN0C 1IC4L 2VKXA 5DD6B 4PG9A 4X6CF 5FYLD 3VFRA 4GQ9L 4NNXB 5I0DA 1ZTXL 4X99B 4M62H 3QDJB 4IMKA 1JK8A 1I9JH 4V1DD 1FO0H 4GLRI 2XWTB 3V6FA 4GAGL 3GSUA 2C3GA 1AQKH 4NHUA 3DXAB 4Z7WE 4HDIB 4RBPH 1UWGL 4PS4L 1SYSA 4GRMA 1MEXL 4ELKB 4J3UA 5CJXC 2J8OA 1I8IB 3DURA 3UBXA 4NOBA 1NFDB 2RIKA 3C6LA 4OCNC 3F65A 5F9WB 3RWJA 3ORJA 5J57B 4HUKB 3MR9B 2AXJA 5DUML 5EC1B 3S3PA 1H5BA 5DD0L 5IHBA 3BVNA 4HKJB 1NCAH 3TBWB 1CVSC 1RZFL 5EZLA 1QQDA 1GGIH 3ZE1E 3IF1A 1FRGL 4O58H 4L29B 1FLTX 4P2QA 2VUOA 3EOBB 5FO7B 4LLUB 1WZMA 3L3KA 4JCLA 2GTZB 4HIEA 3BW9B 2YUWA 1LO4H 3PWPE 3U0TB 4GOSA 4M03A 5GRWA 2CXGA 3O6FB 1UM6L 4JHZA 1T83C 5IIEB 3DIFA 3O9WC 1AXIB 3C08H 1N0XH 3VI4E 1QO3B 4GSDH 3V79C 1G6RL 4FFZL 4Y2DC 4V1DB 1KPVB 2UV3A 2NZ9D 1UH2A 4Z7QE 3MYJB 3CFCL 5C0BB 5ESQA 1NBVL 5BZWA 1KIPB 1IAIH 4C56D 1E4KA 4IOIA 4AT6B 1SJXA 4OZIF 4EOWH 3I6KB 3LN5B 4F9PA 3RX5A 3GFUA 3QZWA 4P23A 4HH9B 3QUMH 5CP7A 4U0QB 4YH6A 2VLRB 2EE2A 1S78D 1YECH 1V8HA 4OZGE 5EO0A 4PJ8C 5E5RB 2ENYA 5ITFA 4Y5XB 4F7PB 4MMXC 3DPBA 2D03L 2HFEA 2PF6A 2DAVA 4PY8J 2P48B 1KJVA 4NUJB 4NT6A 3UJTH 4JFDE 3MRHB 2IANB 3FFCE 5EBMB 2EECA 4MJIB 4QO1A 1X5KA 1OVZA 3MOBH 3OPZH 1E4WL 5C0FB 5EC2A 2CR3A 5F7NC 2PYEE 1XF3B 1AXTL 4XAWL 3DVIA 4XPTL 1YQVH 1FYHB 1J1PH 3KHQA 4LARH 1AR1C 3GM0A 4POUB 1ZGLP 5EU6A 3QDGA 4CNIB 1TQCB 1VEPA 1FNHA 4OZHF 1P4BL 5I1JL 1UM5L 2VR4A 4PRBA 3CDYA 3ES6A 5DVKA 2ICWJ 4Z8FL 2FX7H 3VGDA 3NCCB 4YGAB 3PWUB 4XWOC 3Q1SH 3PWLB 1IGYA 3NCJL 5IQ9A 1OL0A 3HC0A 3EYUH 3C09B 2PTUA 2FB4H 5DMKB 4J4PC 3MNWB 3VXQB 1S7VB 2MWCA 2D0FA 3BN9C 3LKNA 3IXTA 3FRPA 2YKLL 4ZSOE 1K9TA 1AKJA 1G7MB 4HMDA 4FFYH 4Q9BA 1KEGH 2FIKB 3A6BH 1IGFH 3LMJL 3KYKL 1LGVA 2ZWLT 4TUJA 3W0WA 1G7IB 2CMRH 2BNRE 4P3DB 2SEBB 3I84A 3MV8D 3GBNH 1OSZA 3MLWH 3MJ7B 1CGWA 4P4KA 5FYKE 1L9MA 1IT9L 4ZUWA 5CD3B 1RUAH 1AY1H 3HC3L 3CMGA 5JOFA 4FQ1H 3O4OB 1U91A 5EPMA 2Q7YB 4M43H 2CKBH 1JTOA 1RJYA 4HUXA 2HMID 4XVJL 3Q2CA 5DJYB 4D3CL 2YZ1A 4UINH 4XVUC 5D71L 1VFOA 5GS0D 1YPZE 5IEKA 1T4KA 2M2DA 1MFCL 4JZOA 1OAYL 1NANI 4UUJB 1C08B 1QRNA 2E6QA 4HF5H 4NZRL 5C0EA 1VKXB 1XIWC 4OIIH 4UTAH 4AEIH 4NC2B 4DN3H 4YWGH 5E9DE 5IM7B 4WJ5B 1ZSDA 4HKXB 4LHQB 4PV9A 4JFHE 3O3EA 1XGTA 1KB5H 2X4PB 4DFIA 4XBPA 4DOHE 3GIZL 3GMLA 3AM8A 4XGZA 4HUNB 1CR9H 1BGXL 5DMGD 3G6AA 2XNAB 1QKZH 2D7TL 2IEPA 1FNAA 4MD4A 2Q8BH 2GT9B 1HXMA 5I66B 5J6HA 4PUBH 1CE6A 2VZVA 1CDCA 5L88L 2W1NA 1KPRB 3BISA 3ZE0E 4OB5L 4KC3B 2EEBA 2WWKO 4OV5B 3INUL 1A6ZA 3MV8B 5IB1A 1RZ8B 3O2VH 3VDBA 4P48A 3GMRB 1S9KC 2PNDA 3CX5K 5K9JL 1KTLB 4M1DL 1TCRA 3KLDA 1R24A 3WXWH 1DE4B 1AO7E 2OR9L 4WO4C 4Z7VE 5D2LB 4UU9B 3D3VA 1HHHA 2R1YB 4X0KB 2AJ3B 5B39B 4W81A 4APQD 4LLQA 4LRIA 1HH9B 4K7PL 5C7XH 2BNQA 4K23H 1A3RH 1FC2D 2FEEI 2FSEB 2J88L 3WS3B 3U7WL 2D2OA 1N6QL 4KHTH 4ODVL 4CU6A 3AREC 4HKZA 1L0XA 3TVMA 1CFSA 3RUGB 1MVUA 1BOGA 4I5BB 4LSTH 2G5BA 4EI5D 3DX9B 5HHMD 5F7UA 3CFJB 1I75A 5DR5H 5LCVL 3HZMB 1MRCH 5DUBA 5EO9B 3S35X 3U82B 2F8XC 4M4RA 3ULUH 3BPNC 3BYYA 5F9JA 1AGBB 4R6UA 2VDKH 4KJPD 4Y16A 2HKHH 4LLYB 4Z95H 3WIFA 3MREB 3E3QE 3BSZH 3V6ZB 1FL6B 5BV7H 3K4AA 2E7MA 3G9AB 3SDCA 1MFBH 3ULVD 4YBQC 5KVEH 4A6YB 2XG5A 4O4YH 4EEEA 3PQYA 1L0QA 1IGJA 2Y36L 1T20A 3LKRA 2H32A 3JXAA 4HXAL 3MPCA 2IGFL 1ZVSB 2XFXB 3IETA 3VG0L 3VD5A 3C8HA 4Y4HA 2F74A 3QHZH 4I3GA 2P8PB 3CLFL 4WI7A 5CD5D 1PYWA 32C2B 4RGMC 3ECBB 3LRGA 4ZFOA 2VZ3A 2CXKA 2IMMA 3BHBA 1PZUB 2L7UA 2FNBA 1RURL 3RIFK 2YA0A 1LEIA 3TPUB 1BD2E 3L6FA 3T0BA 3MCLL 1FNSL 2A6DB 3SDXA 1XGRA 3B6SA 3P9LA 2XZAH 2I5YH 4NPYB 4JG1H 4ZFOL 5FDWB 4H25B 3TJEH 3NA4A 4I3SH 4EI5B 5D1QA 4HD9A 5HHMB 1T2XA 2O26U 5CBEA 1LO0L 1Q94A 3KLSA 4ZO9A 1U3HD 3O6KH 5FV1L 4FQXD 3VXRE 5FO8B 2OX5A 2W0KA 4DZ8B 4PPTA 3CZJA 3PDGA 1INQA 1J8HA 2NNAA 4Q9RL 4NWTH 1X5JA 1NCWH 3VMOA 4NWUH 1P2CA 1WV7T 3QDMB 2HTLD 4H26A 4NQVA 2C3VA 3K2UL 2A6JA 4HJ0D 5CUSL 5I1DB 3CFKA 1S9VA 2A83B 4HHAB 5I18L 4URTB 4DKFH 4XP5H 3EYSL 3DVNA 5EWIL 4YDLC 1MIEL 5J89A 2ITDA 4KROD 4ODUA 1HCFX 2AK4E 4MQXC 5C09D 3IDMB 4U1IB 5TH2A 3TYFB 2YPLE 4MQTB 1KB5B 4X6CE 3W9EA 1T7XA 4GLRH 5HGBA 1IAKA 1BZ9A 3E0GA 5DUPL 1WEJL 4GO6B 3ULUD 3QO1B 3W82A 4L4VE 2BSTA 4LHUD 3EJZD 4G8GD 4WEMB 2HLFD 2QKIB 3CZFA 5ICZB 1TLKA 5GGVY 1QLRB 2DF3A 3EYVB 3KPSD 1MHEA 1TZIB 1WCBA 1I8MA 1WITA 4PJHA 4XX1E 4X7CC 2R0ZL 2E7LC 3ZKND 1NAMH 5TE6H 3DTXA 3CMOL 2V9TA 1U3HB 4PRHD 1PEWA 4JFQB 1NGYA 4L9LB 3T0ED 4ZXBC 3C87A 1SVCP 3LV3A 1BHGA 2IBZY 4JPIA 3QULA 4D0DB 3GSWB 3BEVB 4CADB 3VGGA 3WFDL 2DQTL 5SWZE 2F5BH 3X3FL 5TGBB 5DRNB 3ZZ1A 1OAZL 4OCLC 2VLME 3OKNA 1N0LA 5F6HI 4KROB 4PREA 3GRWH 1GH7A 2ITCA 5C09B 3TBVB 4GMSH 3IS0X 5F88A 4BH7B 1SMOA 3MLUL 3MRPB 3G6JB 4WHDA 5DJ6B 4TSCL 1I4FA 3VA2C 1MJ8L 2DIAA 1FCCA 3H7LA 5IMLB 4LHUB 3VDAA 3DUHA 4XRCB 1NQBA 1IM9A 1GZPB 3H3BC 4HKBA 1Z0MA 4RGOH 1IKFH 4OZIE 1CZ8L 2N1KA 3WFZA 3UTTA 3H42L 4B7LA 4XNUH 2NLJA 5IR1B 1DBAH 2ZUYA 3LEXA 3AU1A 4TRPH 4Y1AD 2J6EL 1W0WA 1JYWA 4OLVL 3DMMA 4NZJA 1KNOB 1MFDL 25C8H 3T0EB 1JUFA 3PP3H 3TO4A 3I2CL 4FTVA 3U48A 1YY8B 2FJFA 5DJDA 4WY7L 3WUWG 2X1OA 1B0RA 3GJFH 5J56B 4KKNA 1U93B 1FFOB 1E0OB 2W9DH 3DUUB 3T77B 3RI5K 1FZMA 2AXFA 4IOSD 3FB8B 3HE7A 1Y18B 5BZDB 4IHOB 3RWHB 1YEDA 2BVEA 1CYGA 43CAB 2IQAA 4XBGB 3SJVA 3TCLA 4DVRL 3VH8B 4OUUA 1DEEA 3RWDB 5EZOH 1T5XB 3QJFA 2UY6A 1WISA 2ZCKH 3MLTB 1A22B 5GS2D 1A4JA 4O2FB 1H15A 2AI0L 5D7JC 1SJEB 5DVLA 3OAYK 1ZWIB 2VDQH 4YPGB 3ZDYF 6CGTA 4OT1H 4MMZC 2AEPL 1BVZA 4OLEA 5D70L 4F58H 3VFNA 5KTEH 3LKOA 3EJYD 4XI5C 1R5WA 2CD0A 5F9OH 4W6YB 3WUWA 1F6LL 3WEXA 5F7MC 4GW4A 1EBPA 4M7ZB 2D7PA 4YDIL 2ZUXA 5AWNL 4W4OC 3RY6C 2F58H 2JCCB 3V6OC 2AJUH 2H8PB 2V9QA 4KZEH 1LD9A 2I24N 2UZXB 5CEYB 2K7QA 4JKPH 4Y1AB 5AZ2L 3PE9A 4G6FD 2Z91B 1GC1C 5IB5B 2YSSA 4Z0BH 5I17A 4Y19D 1I1YA 1T7VA 4DUWA 4S1RH 1IL1A 3JV6A 4X4ZA 5L2JB 2JTDA 1U95B 2ARJQ 4YHOL 3NABL 4DVBB 1M71A 1EO8L 3MV7A 5DQ9B 1NANH 1CBVL 4YBLB 1W2KT 1QVOA 1R3HB 4GAYA 1DJSA 4JFXA 3CDGA 1NEUA 5GSVB 1GC1L 4Q6YA 2OTPA 5BO1L 5JQ6L 4WENB 3VXSD 1CG9B 3LQAC 1U8OA 4XPFH 4WUKH 4GBXA 3O2WH 5D6DA 4LPXA 1P53A 2H1PL 5TF1L 5IJVA 2Y7QB 3SDAC 5K9OB 5IJKA 2PYFA 3U9PH 1I7ZA 3ESUF 2GAZA 3M8OH 3T1FA 5DFWH 1NLDL 4P59H 3V4UL 5C0CD 1A7BA 1WIOA 2AJSL 3LEYH 3O41B 4GMTL 5ADPH 5H8DA 3T04D 3GKZA 2F8OA 3IKCB 4M02A 4O00A 2FYYA 1LNUB 3ARRA 5MERB 4F7MB 5T1LB 4G6FB 4BZ1H 4XPBH 3WKMH 2EKSA 3QUKB 1KPUA 1KN2H 3BP6A 4JRXB 1LE5A 5D8JL 2WK2A 2XZCH 4Y19B 1MJJA 3T2PA 3MXVH 1AFVL 4GW1A 3BWAA 4HWNA 3IJYA 3EO9L 2DBJA 4JM2B 4HWBH 5EBLA 1IGMH 1L7TL 4Y4FA 4HIHA 1X4YA 4O2EB 5MEQA 5DD5H 3MCKA 2YEZB 5CJQH 4YO0B 5D1ZA 1A9EA 4MAYA 2EXWC 3WD5H 1D9KA 4NO5A 5E00A 3WN5C 4OFVA 5L0QC 3OKLA 5LBSL 1KCVL 1BEYH 2ZG3A 1P84K 3BZ4A 3NFPB 3KLHC 4P5KB 1H8OA 5HPMA 2KDGA 4NZUH 1VDGA 3A67H 5F1IB 1VACB 3V52L 5HTSA 2RBLA 3DV4A 3N1PC 1GGCL 3G04B 4L5FL 3HPJB 1VEOA 2EDWA 1TPXC 4GXVH 5HVFB 1ORQB 4N68A 3WFBL 5GRYA 3KJ6L 1A6VH 3RBSA 3QQ9D 1Q0YL 1YYMH 3V4VL 3F5WA 1NKOA 2A77H 5DHVA 5DJZA 5TF0A 5E4IA 1KOAA 1JWSB 2HA1A 2VZTA 5C0CB 2R2BA 1A5FL 1BF8A 5DRXA 3QEQD 3R4DA 4DAGL 1RUML 3RVVD 3X12A 5E7FA 3D6GA 4ONFH 1SQ2N 4LBEB 5DC9B 3CPLA 5D1XC 4D9RE 3UMTA 1JE6A 3HB3C 1KLGA 2PKDA 3QUZB 1N7ML 1KLUB 1VGKA 1F4XL 4DEPC 3MBEB 3QIWB 5JO5A 1NBYB 4I0PC 3S96B 4K7PX 5J3HC 4UZGA 3WIHA 4NUGL 4QRUB 1RHFA 2DMBA 5E7BA 5BMFL 1JI1A 5LKNA 1MCPH 3AUVA 3MROB 3RWIA 1I7UA 1CL7L 1RU9L 2FH8A 2E27H 2CIIB 4OCRL 4AIZA 3H9SE 3BGMA 3TZVC 2B1AL 4CU7A 4PJAB 3RVTC 1MCNA 3MV9D 4P2YA 3UTQA 4PJXA 2GY7B 5CBAA 1QSED 4POZC 2DKUA 4N0UE 4XCNA 1IRAY 1LO3H 4FQQB 4BK4A 4KFZC 4HUMB 2IG2H 1N5YL 1KT2A 1G9NH 5HY9A 4PY7B 5F71A 3MRDA 2MJWA 1RK1B 3VFOB 2XZQH 1KG0B 2XPGB 2Z8SA 3RVXC 1AGCA 5F3BB 5FKPB 3SKNB 4OTXH 5ANMA 1CLOH 4LSQL 1ZLSL 3WL9B 3TBYA 5I1EL 5ECJE 1XF2A 3VXNB 1KJ2B 3O0RL 4DUXA 4UQ2B 2X9XA 3BKYL 4O2CB 1MELA 4PTTB 1YEFL 5A1AA 5GS1A 5C1MB 2Z31D 3QFJB 4JRYA 1XCTA 4K71C 5DRWA 4LSDA 3U30C 1BQUA 1PZ5B 3QUYD 4OD2B 4P2OA 2R8SH 4XXCC 4DKEL 3RGVA 4CVWA 2WQRA 1BQLL 4KK6D 5C07D 4L4TE 4JDTH 4PP1C 2WBJB 2JELL 1ONQA 1KBGL 3L95A 1DBML 2YK1L 1CGTA 4XHJD 4KI5D 4MA7L 5HSFA 1OGAD 1G9MH 1T7WA 4OZFB 4KUZL 5FB8B 3DI2B 3WUZA 5KN5A 1EHAA 4HX1B 2JB5H 4I2XA 1KENL 2BVTA 1JZ3A 1VFBB 15C8L 1FZOB 3DETD 4X9GA 3ULUF 4PJBB 1QP1A 1FZJA 1VGEL 5DFVC 1S7UA 3T8XB 8FABA 2FEDD 5GGSY 1U58A 1X7QA 2DM2A 4X98A 1UADC 3IDXL 4P46B 3DX8A 4UAOC 3RTQC 3QXDB 4WIQA 2R2EA 3IVKB 3GSQA 3G5VA 2JJSC 4KZDL 5J9PB 4ONOA 1YDPA 4QRRA 3GSVB 5DK0B 2Z31B 2Z35A 3QIBA 1X5AA 4E41D 3D39D 5IVOA 3HHRB 2NY7L 5J8OA 3FJTA 3QUYB 3U7AA 2OZ4A 1ZGLB 1ZKAA 1IGTB 3D0LB 4LASH 4WEBL 1KYOJ 1IKNC 3X3GL 1TVBB 2QJDA 4JZNA 4FQ2L 1TMCB 4MX7B 3VWJD 4HPYL 4UV7H 3BH8B 4UIMB 4LVEA 5F3HB 4HC1L 2DLEA 4U1KA 4OZGA 1RMFL 4JZJB 1MAML 2Q76B 3BPLB 4NSKB 1OGAB 5IROC 1NCDH 3S3SA 2ILLA 4J3TA 5IEHB 3QWOB 4LL9A 1M6OB 3UEZA 5HHQB 2F53A 3NCYP 5JW4N 5LQBH 2X4UA 4KQ3H 1KTRL 4WRLA 1Z6JT 1EAJA 1CXKA 2X44D 3G5ZA 2YPKB 2VZOA 3SY0B 5TDNB 5CIPB 2PETA 4WFEE 1UVQB 3JTSB 3K0WA 3HUJF 1BBJA 3P4LA 1MAKA 4C56E 4N0FA 3L9RB 3GSXA 7CGTA 2DQCL 2HVKB 1HQ4A 4Q7DA 5SX4H 4IIQB 5EOCL 2APVA 1FAKT 1MEXH 2GFBB 4Q2ZB 3HR5A 3IU3A 4BKLB 2GITA 3D85D 1M7IA 4H20L 1MPAH 3EFDL 2DQFA 1JFQH 3S5LA 5A40E 4ONGL 4E41B 3D39B 3NMEA 1HEZA 3HI5H 5EFIA 3WLBB 5ID1A 5TDOB 1XF4A 2Q7NA 5T1KB 2CRYA 2YWYA 1T1XB 5DUMH 2RQ8A 5DD0H 5KW9L 1E4XL 4IRSC 2ED9A 4JY4B 4KRLB 2WMPA 1UCBH 2V5SA 2ZCLH 3DSNA 5IBTH 3RRQA 1UACL 5EU7E 1Z5LA 3UCRA 3VWJB 3ZSTA 3ZHLA 5HDQH 2V2XA 1WAAE 3V5DA 4ZO6A 4QRTB 4M93C 2HJKB 4KJQD 1X3DA 4M8QB 4NC1E 5C0IA 3ZDYE 3HRZA 4JGMA 3MMEA 2PTTB 2PXYC 1WC7B 3KWWB 4L3AA 4HK3N 1F4WH 3ZDXF 2Y06H 1NEZG 35C8H 2BNRA 4PD4K 4LPYA 7FABH 2UY7A 3NFNB 3BE1H 3O8XC 5ILTH 1Q38A 4ETQB 3VWKC 4E42A 4WGWB 3ZKQD 4OI9A 5H2BB 1FORH 3ZTJG 2F5AL 3L3DA 5FA4B 4U1SA 2BVOB 1RHHB 3VFTA 4S2SA 2CO6B 4M61B 1W0VA 3KYAA 1NBZA 4ZS6C 4ODSH 3WHXA 4IJ3C 1JGDA 3D18A 4JJ5B 4PLNC 5FYKL 4X6FA 1EEUA 4Y5YC 4RZCA 5F7KC 4P5TA 3P73A 3GHEL 1OAUH 1YPZA 4MCYA 3K81A 4PJGA 4MLSA 1I1RA 4ONHA 1MAJA 1I3GL 4FP8H 4KQ4L 5D7LB 1NEZA 3LH2L 2NXYD 3QIUC 3C5JB 4TUOB 2R1WA 4PP2B 4UBDD 5IFJA 4R26L 2K3TA 5C9KA 2ZKHH 2EH7H 4KK5C 5LGJA 1DBBL 2D03H 3GK8H 4KRPD 5F7DB 1Q9LB 5M94B 4YUEL 5AUMB 4Z7OF 3UAJC 1GGUA 3OB0H 2XKSA 4Y4KD 5HJ3B 3SE4A 5FO9B 1VCAA 3L3OB 4X4XB 1AHWC 5EBGA 1FV1B 2MKLC 2J3SA 1MCLA 2KPNA 1KJMB 3QCTH 2W38A 4YDVA 4M7JL 4BZ2H 2YPVH 1EEQA 1V7NH 3MRIB 1ZHLB 1A6AB 4Z8FH 3MJ8B 4MDJA 1IFHH 2W0FA 2AJVH 2BCKA 1BAFL 4L8BB 5JDSA 5KOVC 1FLRL 3EDFA 3TN0D 1AO7A 4KY1L 1EJOL 1AD9B 4RSVA 1BFOA 1AQDB 2AJZA 3AXLB 3C9NA 3VD4A 4RGNE 1D5MB 3B2VL 4WW2F 2AJXL 3QO0A 4KGLA 2PN5A 1U3JA 2O61B 3R06A 2P5WB 2XN9D 5CGTA 3VXOA 5D2NE 3MLZH 1A2YB 1DZBA 3ZLQC 4LEXH 2XQYG 3B9EA 2UYLB 3VFGH 5I6XC 3HAEB 5T1DH 2NXYB 1FL3B 4X4YB 1TNMA 4LSVH 3OKMA 4PJIA 2FX9L 3E3QC 1MH5B 3BGFB 2P49B 3LMJH 4MD5B 1WUNT 4PR5A 3HS0B 1TJGL 1GGBL 1KC5H 2FGWL 2P47B 3O11B 4QHNB 5DEGA 3OAZK 4TYUA 4G6MH 5TE4H 2QTEA 2X4TB 4X6BB 4MB3A 4XPAL 1V05A 2ID5A 1UJTA 1SEQH 2R2CA 3HC3H 5HYJB 1D6VL 3MLVH 1MCEA 5CLTA 1QHPA 4JFFA 4D8PA 1GSMA 2VE6B 3EDDA 3VFRB 1G0YR 5AYUH 4WUUE 4FQCL 3BDXA 1JK8B 4Y5VA 5DZNA 4AENB 3MRQB 2ENSA 1SBBA 1MFCH 4NHUB 1MIML 4ZAKC 4NCDA 3TN0B 3MUHL 3O9WD 2XQYK 4PBWD 1LMKA 4WI3A 3FOLB 1UXWB 4GRMB 4ORZC 4Y2DD 5BVPH 4H1LH 5E8NA 3VXPA 5HHPB 1HSAA 2XN9B 3RWJB 4LEOB 4NQDA 3LKPA 4DFHA 5LJYH 2BDNL 3L3HB 5CP3A 5C0DA 1BD2A 1LP9A 1YEGH 2B4CC 1H5BB 3IS1X 3CH1A 3V5KB 4PJ7B 3BVNB 1WJ3A 1X6LA 4G7YL 5EZLB 2VITA 3TT1L 3O3AA 3OR6B 2V7NA 3H9HA 2VLKB 4GRWB 1U8MB 1JF6A 5BRZE 3MJ9A 4I18B 1ZLVH 3RJQB 4PJ8D 4QHUB 1R3LB 1JNHA 5ITBH 1GAFL 1G6RB 4X80L 1DFBH 3FZUC 4CKVX 4GFTB 4XP4H 3LIZL 3ULSB 3DIFB 2RCSH 4XC1L 4GRLA 4KTEL 5T3XH 5DVNA 4HZLB 4WI4A 4FG6C 3U4BH 2Y4SA 5E2WL 2B4CL 2WIIB 1PQZA 2AV1A 5DJXA 1HINL 1AR1D 4YHMH 2YXMA 4K7PH 4YHNA 1N5AA 3RHWF 5FAAA 1OAKL 3QEGH 1K3ZA 1A1OA 3U7WH 3O9WB 1N6QH 1VA9A 4CW1B 5F72S 5ALCH 4P2RA 4LNRA 1UZ8A 5C0AE 5JMOC 1P7HL 3DYPA 1JYXA 3F58L 4Y2DB 3WFHB 4LMQI 3GMQA 2A1WL 2YBRB 3QZWB 2X1XR 5HGDA 3EUUA 2X9WA 5EO0B 4NO3B 2VERN 3NA9H 3MRMB 1T04B 3RX7A 4J4PD 1CU4H 2BMKA 5JHDB 5F89A 5GGSB 4HV8B 1CI5A 4G80B 3X13A 3PHQB 3BN9D 2X05A 1RUKL 2D31B 2R29H 4QTHA 4WI9A 1S7WB 4G8FA 3CFDB 4L8SA 2R0WH 5EC2B 1F6FB 3TNNB 5DMIL 5HVWA 3CGTA 2VMFA 3LN4B 3ZTNH 2APTA 1YUHA 1C5BH 2DQJL 2ICWA 3T2NH 3F7YA 2H3NA 4GG8A 3H2WA 1SBSL 2OM5A 4UT7L 4Q97A 4HXAH 2XXCB 2IGFH 4PRBB 3ES6B 4LCWD 2BJML 1I7RA 2NY3C 4NQCA 5GGQH 3B4NA 3TJHC 4JAMB 3VI3F 4N5ED 1YMME 4OF5A 2Z8WC 5EULV 5JIHA 1CL7I 5CSGA 4G8GE 5IQ9B 2W91A 4XVUD 5JLZA 5FK9A 1RURH 4Q9QH 3L5HA 2Q3ZA 4H88L 5HDBF 5C2BH 3KPSE 1NGQL 4WHTA 3MCLH 4LIQE 2QSQA 1P4IL 4RQQA 1F6AA 2DWDB 4NHCH 4TULL 1XIWD 2P8MB 1BP3B 3LKNB 3OJMB 3B8SA 5F96L 5SWSA 2DS4A 1I3VA 4PYHA 3VFSA 4PJEF 4JFYA 2DIJA 1ZHKB 2P8LA 3ZT5A 4Y89A 4GXUN 2V2TA 3UC0L 2NCMA 3RL1B 4MVBC 4YE4L 3H3KA 3W0WB 5T3XD 2A2QT 5IHUH 2IPTH 3Q6FA 5B3JF 2A74B 1MCJA 2F8VA 4BH8B 3OZ9H 3FQXA 4PGCB 3OKEB 3NGBC 4PRAA 4MWFA 1UGNA 3JV4B 1EXUB 4JQVA 4S1SH 5DK2B 2JJVA 1U91B 1KIRB 1RIVL 4PRPD 1GZQA 1RJYB 4Z7UF 5IB3A 3F12B 1H3UA 1JGVH 1AXSA 1DLFL 4F33A 1T4KB 4WU7A 4JZOB 4XNQB 3SGEI 5BXFA 1YEHH 4H1LB 4XVTL 1ZVYA 3V5HA 4M1GH 4YHYC 1PDKA 1TZGH 4WO4D 5KVMC 4QOKE 1HZHH 1ERNA 5ENWB 4JG0L 3S36L 1LILA 3HUJE 1QEWA 1CF8H 1DQDH 3DI3B 3O3EB 3IDGA 4OZHA 2AEWA 2I07A 5FOBA 1MWAA 4G9FA 5GRVL 2FWOB 3PDDA 3UPRA 1EVUA 1V3MA 4JN1L 4J3OC 3G6AB 5DJAB 4W68A 3VXMD 3WHE1 4R9HA 3S4SA 1NLBL 2R0ZH 3ARED 3BDYL 4F7CA 1Q9OA 1S7XA 1BVLA 1B0GA 4FXKB 3HMWL 1CE6B 1FAIL 1F97A 4LF3A 3CVHA 2QADC 2XV6B 2X4RA 3VD3A 1EK3A 5TPWL 4IEFB 4PG2A 2I9TA 4LLWB 4KTYA 5DJ2A 1A7QL 2B8OT 5BJTA 4C55A 2HLAB 5HYQB 4MQ7A 4TVPH 3OXSB 3QHTC 1KCSL 1WLHA 1R24B 3RGHA 3STLA 4N8VB 3KXFD 3MTRA 1A6WH 4UDTA 3D3VB 3N1QC 4G42A 1U8IA 2J12B 4YBQD 3ROOA 3ZDXE 3O3DB 3DO7B 4WDIA 5FGBC 4CMHB 1JHKL 1R5IA 4PRIA 3ZKMC 3UJIL 3FT3A 3VFWB 4LVNB 5D7IF 1B4JH 3FQUA 3B2UD 3HMXH 2WSKA 3PL6A 5FECA 4TSCH 4X4ME 1WZ1L 3QA3A 4HKZB 4M7LL 5HYFA 2P7TB 2QQLH 5SX5H 3ALPA 4XNZC 4EQ3A 3M17B 2BVQB 1U8LA 4PJDA 2YR3A 4ZS7H 3MACL 3EO1A 5B3NA 1H0DA 5FYJU 5GIRB 4OLZH 1D5BA 3QXAA 2BY2A 5I1IL 3ARBC 1GPOL 3VXMB 3H42H 3I75A 3JWOC 4JE4B 4UMGA 3NOIA 3TA3A 2L7JA 2EIEA 3SE8H 5E2VL 3VRJB 4GKSB 3O6LL 3MRKB 4NO0D 4WCYL 3GO1L 2ICEB 4OLVH 2OL3A 3ARGC 1MFDH 4KMTL 4J6RL 4Z7OE 3BPNB 5E8EA 5B8CA 2J5LB 4K9EC 5HYIA 3FCTA 3CLEH 3SOBH 2O5XL 4WY7H 4HPOL 1BBDL 2IAMA 2GTWA 2JF1A 1DSFH 2EDYA 1VHPA 4Y4HB 4JHBA 4LGSB 1K8IB 3MGTB 1INDH 5FM5O 1SY6L 3T0DA 2DLTA 1DUYB 3IFNL 5I8OH 3B43A 3JWOL 4DVRH 4ZFOB 2XACC 5IBLC 1K85A 5TJWK 3RU8L 4MJ6B 2NX5D 4YIQA 3W2DH 1E4XI 4PRNA 4MQXD 4X5WA 5HHOD 5CSBA 1LEIB 3VXSE 1XGRB 4U7SA 2VDMH 5CINH 4KKBC 3QNYB 5L6YH 1A9BA 5TE7H 2YUXA 4K9EL 1NL0H 5IQ7H 5D70H 4RGMB 3UP1A 5D1QB 5MHSD 1T03L 3LQZB 2VB5A 4NNYA 2V7HA 3FN0L 2XA8H 4X6DB 4YDIH 4RMRA 3GMMB 2UWEF 5GZNC 5FHAL 1INQB 4KDWA 1J8HB 4YHPB 5DSCB 4H0IA 3ARFC 2E6JA 2WANA 4LU5L 3MNVB 3V9FA 3KPMA 5CSZA 4KUCD 1S9XA 3V0VA 4G43B 4HUWA 4MNQD 2R69L 4OFYA 4XH2A 3CFKB 4FFVC 5FM4A 4LCUA 1RK0B 1JN6B 1JI2A 4WTZA 1HWGB 3MV11 1HOCB 3PGDA 2NXZB 3BIAX 1A1NA 4OQTA 3I6LE 4KHXH 1ZAGA 5TH2B 2IPUK 3N1MC 5E6IA 1RZKH 1BM3H 5F6HJ 1HYSC 1U8JB 4XPGH 5HGBB 1BZ9B 1EO8H 3NTCL 5EU3B 1QYGL 4PV8A 4YDLB 4LSRH 3RZCA 4XCYB 3OKDB 3MFGB 1BLNB 2J1KA 1GC1H 5BO1H 1E6OL 2BOBB 4QHKI 4X8JB 4N0RA 4JFEB 1I8MB 3TC9A 5C0RH 1ETZA 4DW2L 3EGSA 2AW2A 5C92A 5TF1H 4PGZA 4OIAA 5KSBF 1A0QH 1T22A 4EUPB 1ZXQA 1NLDH 1PEZA 5EO1A 3QEQE 3BX7C 3HG1B 5IMMA 1VFMA 1ZLWH 4IDLA 3I6GB 4B5EA 3LV3B 1NSNL 5HVHC 3SE9H 4X99A 5EBWA 1N6UA 3ARXA 3QDJA 4XNXH 1X44A 3GBMH 4MNQB 2XWTA 3LQAH 4DGVL 4N5UA 2P5ED 1HI6B 4LQFL 3VG9C 5IKCB 4ODWA 2DJUA 3BKML 3DX6B 4ZXBB 3AS3A 1AFVH 3BQUC 3HE6D 5GJSL 1QBML 1WTLA 4NQUA 2AXHA 2AQ3A 1I8IA 2NY5C 2EDFA 3MRNB 3W9DA 4ODTH 3SDDC 3TWCH 3SGKA 4D0CB 4I9WD 5CMAB 2V5MA 4HFUL 1QSEE 4MXWH 2HWZL 4EXKA 3GNML 3MR9A 4IRJC 5EC1A 4QRQB 4DK3A 4J23A 4HKJA 3VFPA 3TBWA 1YNLH 3ARDC 4AIOA 3VJ6B 5JW5B 1MCBA 2QL1A 3V52H 5KSAC 1JPSH 2O5YH 4L5FH 5I16B 2ZUVA 4L29A 3VRLE 5D7JD 3ZMRA 3O4LD 5GGTL 1YC7A 3MV01 5L7XH 3EOBA 1C5DB 5FO7A 3SO3C 2NLJB 3BUTA 5EU4B 1X5GA 2GTZA 2NY5L 5CCKH 3BW9A 5A2IH 1HCVA 3U0TA 3LEXB 4LDLB 2VLJD 4XI5D 5FUOH 5C08D 4F80A 1K5NB 3DO3A 3O6FA 2ORBH 5IIEA 2LQRA 3QHFH 4ORGB 3KPNB 1WWWX 3TBTB 1LDSA 3TO4B 1IGCL 2E7BA 4X7SH 1HSBA 4QXGL 4S10A 1QO3A 3TLRA 2CQVA 4JPWL 5ISZD 4KI1A 4CMMB 4NM4H 4V1DA 1J86A 4X7TB 3Q5OA 3MYJA 4N8CL 1FZMB 4XC3L 5BOPA 4U2YA 1ODAA 1UB5B 2P5EB 2EDRA 5C0BA 1KIPA 3MCG1 5KBNC 4AT6A 4OUUB 3CFBB 5C07E 1DEEB 3PHOB 3I6KA 3LN5A 2CGRL 5CLWA 1S7QB 2FR4B 2OTUA 5E95B 5E2TL 4NQED 4HH9A 2A73B 3KS0H 1OD9A 2H41A 5C6TL 5L2KE 5FGCE 4HBCL 2B1AH 4B53A 4RFOH 4Y5XA 3D48R 3RJDA 1KV3A 4F7PA 2EDTA 3PUCA 3V8OA 3MZTA 5IJKC 5FGRA 3LKOB 1FNFA 2ARJB 1AE6H 5I8CB 2WP3O 4NUJA 1CFVH 5HDBE 1QFWM 3HNTL 3MRHA 3AVEA 2J4WH 3WEXB 3WS6C 2DQUL 5C0FA 5D7JB 3QI9C 3CH8A 3GSRB 3O4LB 4TSAH 2DLFL 4PJEE 5EZJB 1QFHA 1OSPL 4NQTA 2K7PA 1FSKC 2VLJB 1LD9B 4PJ5D 5C08B 1BJMA 3V8CA 4CNIA 1OP3K 1E6JH 1PG7X 4QXUL 5CZVL 5B3JE 1AC0A 1FE8L 2WW8A 5ISZB 3PWUA 3M1BB 1T89C 1I1YB 1UWXK 1IL1B 3BKYH 3PWLA 3RAJL 1JGEA 5D5MF 4KVCH 1YEFH 3R8BB 3U0WH 3VGAC 2EDLA 4U1JB 3KGRA 5BOZG 1QFWL 5DMKA 3MNWA 2VDNH 4C56A 4Z7UE 4OCMC 3VXQA 2FBJH 1S7VA 1M71B 1PD6A 3QG7H 1QVOB 2E5EA 4BZYA 3I3BA 4GAYB 1S3KL 4B50A 4JFXB 5EU7C 3RIAF 1G7MA 3FKUS 4HXBH 1KBGH 2FIKA 2C3XA 3J8F7 5IOPB 4JO1L 3QXUA 1DBMH 4GBXB 3LCYA 2EXWD 1G7IA 3OV6A 3REVB 2VDPH 4P3DA 2SEBA 1I7ZB 2ZG1A 1WICA 3MJ7A 4RIRB 3KLHD 2BK8A 5IVXF 1RQ5A 1FO0A 5CD3A 2Y23A 4GAJH 3MC0A 3C5ZD 5FEBA 2APBA 3W39B 2CDGA 4M62L 3SDAB 1I9JL 4W4NA 1VGEH 1FO0L 5JDJA 2B5IC 4RBPK 4KMQA 2IPKA 1AQKL 1ADQH 1MJJB 5IFHH 4NFCA 1OOAA 3FAWA 1NUDA 5IM7A 4WJ5A 1FL5A 4HKXA 4Y4FB 4HIHB 4L3EE 3HB3D 1CGYA 1W8NA 1LK2B 3S36X 3L7EB 1KCUH 2XYCA 5DJ0B 4OLXL 4I0PD 5D7SH 2ZOLB 2XNAA 5J3HD 3VXUD 5ACZB 2HT4C 2GT9A 1NCAL 1PKQE 3AROA 5D7IE 4N1CA 3SDYH 4X7FC 4X7EC 1EX0A 4AYFA 4HC1H 2A9NH 1UG9A 4O58L 4UIKH 1KPRA 3PIQB 4UT6H 2YD9A 4YFEA 4R0LC 3OKKB 3P77B 3TZVD 3U7YH 4OV5A 3RVTD 5L0QB 2J8UF 3MV8A 4WV1C 4CVZB 1RZ8A 2LFGA 4POZD 3GMRA 1HKFA 1LO4L 1KTLA 4LSUH 5MENE 5B4MC 2G75B 1OTSC 1DE4A 4L9DA 1UWEH 5D2LA 3C08L 4UU9A 3X12B 3REWB 3WNLA 4OFDA 2R1YA 4X0KA 2AJ3A 5B39A 1N0XL 5IWLC 2DQDH 3RVXD 1R6VA 4GSDL 4RGNC 4QHLA 3FB6B 3DXAE 4RDQF 1HH9A 4MNHB 1CGVA 1MF2H 1VGKB 3VW3H 1FG9C 2FSEA 3WS3A 4POYA 3B9DA 2BY1A 1IAIL 1FBIH 5D2NC 3QH3A 5D1XB 4EOWL 2L4OA 4TNWF 3DX9A 4DEPB 3B5TA 3QUML 4KRMB 3HZMA 1YECL 4GKOA 3BGMB 5I30H 4I0PB 2WV3A 1HKLL 4FOMA 4MA1C 4PJXB 2DL9A 5CBAB 3CXDH 4CGTA 3V7MA 5E1HB 1Q1JH 1XGPB 4XAKD 2R1XA 5HY9B 3UJTL 4PP1D 1CICC 4AM0B 1CN4A 2HH0H 3OPZL 3T0AA 5BW7C 3V6ZA 1FL6A 2KZWA 2AJYH 2FJHB 1XGYH 1YQVL 4A6YA 3U4EB 4F37K 1RZIA 1JL8A 1JV5B 1J1PL 4LARL 4CL7A 5ANMB 5JW4M 1R0AH 4JDZA 3UZVB 4TVSa 3TBYB 3PWPD 1ZVSA 2XFXA 5CFHA 2P8PA 3OL2A 1XF2B 1B90A 4APQA 1WT5C 1SEBB 3TH4T 5KS9F 2MOVA 32C2A 3ECBA 3Q1SL 4G8IB 4JM4H 3L1OH 4WI5A 3KYNB 2XTJE 3EYUL 5BS0D 5E99H 2FB4L 5DFVD 3TPUA 1W72H 5DRWB 1CQKA 4NFDA 4PBXA 4P2OB 3EDKA 4KV5E 1MI5E 5FDWA 2VLRE 3RGVB 3MLSH 2VISB 4KUCF 4EI5A 4U1NB 3LH2H 4LAQH 3QCUL 4FS0A 4ZOEA 5IF0B 3KAAA 5DD3H 4FFYL 1KEGL 2PO6C 3L95B 3A6BL 3LY6A 1IGFL 1DBBH 5E5UB 4K71B 2IANE 4DZ8A 4L1DA 2CMRL 1DLHB 4ELMF 4JVUA 3GBNL 3MLWL 5C3LD 2YD8A 1OARH 4K8RC 3QDMA 4RDQG 2W59A 3FFCD 1F11B 1RUAL 2GY5A 4JKWA 1AY1L 4QRPD 5I1DA 1ZT7B 4MNGE 2EO1A 1L0YA 4HHAA 2PYED 4M43L 5KJRH 2CKBL 2Z92A 5JW4Q 5KSBE 3IXAB 4UINL 1FZJB 1S7UB 4PGJA 1BAFH 3IDMA 4U1IA 5F8RC 3TYFA 1X5YA 1KB5A 3JBG7 4OD1H 3SKJL 5C0ND 1EJOH 4HF5L 4HIJA 4OIIL 3VCLB 4UTAL 3CDFA 4DN3L 5ID0B 2YRLA 3QWRD 5FHBH 1OT2A 1HILB 1U3YA 3N85H 3IRPX 1NFKA 1BQHA 1YDPB 4QRRB 5JHLH 4K8RL 1FN4B 5DQDH 5EU5B 2YD6A 4ISVB 5ICZA 5D93C 1QLRA 4YHLH 3SBWC 4EDXB 4R2GC 3EYVA 1CR9L 4UAOB 5E2UH 4ZPVB 1I85A 3RTQB 1QKZL 1R3KB 3H3PH 2Q8BL 4KKLD 2HTLC 4PUBL 5J13C 4HK0B 3P0GB 1O7VA 4HJ0C 3HR6A 1U3HA 1T1ZB 3E6FB 4FQXA 1QR4A 1KB9J 4OZGB 4N0YH 4JFQA 2VXTH 4L9LA 3MOAH 5CZKA 3O2VL 1KGCE 1T5WA 4IRSD 4XP1H 2ZSWA 2AGJH 4D0DA 3QCVH 3GSWA 4JFDB 3BEVA 1JWMB 1P4LA 3FFCB 3WXWL 1B2WH 1XZ0B 4CADA 1U8NB 1V3JA 5FYKD 2X4UB 3HLAB 1MNUH 3JUYA 5TGBA 2PYEB 1QPPA 2PXYD 3ABZA 4AIXA 1U2CA 1FIGH 4UOW0 2VL5B 5C09A 3TBVA 2VQUA 1JZ5A 5C7XL 3O8XD 3GSXB 1C1EH 4K23L 3V7AG 1A3RL 4BH7A 1HQ4B 3VWKD 1JTTA 5CKAA 2V5YA 3MRPA 3G6JA 4MLIA 3MUGB 5DJ6A 4KHTL 5DA0B 5BV7C 4DGYH 4NM8H 4NRZB 3HR5B 4U49A 2GITB 1M7IB 4PFEA 1SVZA 5E9DD 4ZS6D 3P3YA 4LHUA 4LSTL 3S5LB 4XRCA 1HEZB 1GZPA 5EFIB 4W6WB 4JFHD 1U8KB 3Q5YA 2BDNH 2COQA 4NQXB 1MRCL 4P0DA 5AZEH 3B9AA 3VH8G 3C60C 4XMPH 2IFGA 5M7QA 3ILPB 4NO2B 4ZSOB 5ALBH 3W5NA 2CDFB 4GKZA 2HKHL 4Z95L 5IR1A 3FQNB 2LTQC 3QIUD 3BSZL 1DQTA 1KACB 4LIQL 4PRHA 3DNKA 5D96C 5BV7L 2LE9A 2D4DA 3TPKA 1MFBL 3B9KC 4WGVB 1KNOA 1XCQB 4KK5D 4O4YL 3T0EA 3X17A 4IRSB 3TESA 2BNRB 2GJ6E 4X80H 1YY8A 4LCWE 3UAJD 3S88H 4RMWA 3WJJC 2R56H 3V95A 3DUUA 1FFOA 1I9RH 3R8QA 4M93B 4TN9A 5DO2C 1R3IH 3QHZL 3FB8A 4LPCA 2EYSB 5E2WH 4KXZH 2PXYB 5BZDA 1JPTH 4IHOA 5EUOF 2VDLH 1JNNH 2EKJA 3EKCA 2EDXA 4XBGA 4MHHG 2ZUTA 3BPOC 3WHXB 5LAXA 3D18B 3RWDA 3O8XB 3NPSC 1YPZB 3O2DH 1WBZB 3MLTA 3P9WB 1WQVT 1NCCH 3EYQC 4FFWC 4O2FA 2GK0B 1SJEA 3TIDA 1ZWIA 2I5YL 2HJFA 4JG1L 4YPGA 1C16B 1J10A 5D5ME 5FYJH 5E9DB 2I9LB 3TJEL 2D3VA 3HUJA 2NY0C 4OJFH 5T3XE 2DQEH 4BFBD 4DOHB 3K74B 4NKMB 1GXEA 3ZKSD 3O6KL 5T5FH 3NIFE 3K7UA 1IC7H 3Q6GH 4AH2B 12E8H 2A6KB 4NWTL 1J7VR 2H8PA 2W9LA 1T7YA 3QIUB 2D9CA 5DMIH 5CEYA 1Q8MA 4Y1AA 1YN6B 4PRPE 5J1TC 2Z91A 2EZ0C 1PG7H 3D87B 4OM1H 4DKFL 3DBXB 1LE9A 4FRWA 2F54E 5IVXE 4LK4A 5L2JA 5HGAB 1DQML 5IV2B 4G8EA 3D2UD 1AO7B 3VFVA 1EV2E 4Z7VB 2AJZB 1B3JA 3C9NB 4DVBA 4YEEA 5DQ9A 5LGHL 3BZDA 3RVUC 1R3HA 3G6DH 1SYVB 2IC2A 1NAMA 1QBLL 4HAFA 3VXOB 1IKNA 5GSVA 4ZAKD 1H8NA 2GJZA 1A3LH 1CG9A 1K6QH 2XXMB 1LEGA 5DHYB 4XZUA 1LO2H 4HMEA 5MEOB 3EYFB 3PWJA 3RWGB 5K9OA 4CVXB 3OKMB 2C4XA 4YE4H 4PR5B 4PJFF 3MJGX 4XXDB 2NTFB 5IUSA 3O41A 4CN4A 3VXRD 4F7TB 3IKCA 9CGTA 5I6XB 4JLRB 1LNUA 3OHXB 3F62A 5MERA 5T1LA 1MJUH 1W0YT 3KXFE 3HFMH 3NFSH 3NPZB 1EERB 4JFFB 5CILH 3MUY1 3KPRE 2F5BL 2ICES 3WV0A 3PXJA 3UJJL 3QUKA 2WWKT 3QDGD 4JRXA 5EU6D 3RDTC 1QFWI 4Y19A 4Y5VB 3IGAA 4AEFA 4JJHA 4P99A 3MRGA 5KVFH 3GRWL 1DVFB 5F7WC 3IAPA 5KVDH 3FZUD 5FYJD 4S1DC 4GMSL 4HSQA 3D2UB 4O2EA 3LDBC 2YEZA 4FG6D 3FRUB 4YO0A 1DQJB 3EAKA 1MCQA 3WFEH 4Z77B 4ZFFB 3SKUD 3NCMA 4JKMA 1TTGA 3VXPB 3NFPA 4EIZC 1HSAB 4HCRL 1U0QA 4L4VD 4P5KA 2ZUUA 4ZAKB 3ZKXC 5F1IA 1VACA 5C0DB 1BD2B 4PJ9C 4RGOL 1RZJH 3IDJA 3HPJA 3CH1B 1ORQA 2VITB 2X7LA 4WW2A 4XNUL 4C83B 1DBAL 1MLBB 1JWSA 5C0CA 3PP3K 5CWSB 3N1GC 4TRPL 1U9KA 2EC8A 3L7FB 3VXRB 2L0DA 4WHCA 4M6MH 25C8L 1JNHB 2BRRH 4Z7WF 2EDJA 3S34H 4LBEA 4I77H 4PB0L 4GRLB 2W9DL 1KLUA 4CN1A 3MBEA 4NC0B 5T3ZH 3SKMB 4Z18A 4WWKC 1AD0B 1NBYA 3N9GH 3FONB 3S96A 2FX8H 1NCBL 5EOQH 4NN5B 2NX5E 3GMOB 3EHBC 1N5AB 2VLMD 1NMBH 5HHOE 1QRND 5EZOL 2AK4B 4ACPA 1M7DB 3AAZA 2NY3D 2ZCKL 3KS0J 2YPLB 4M7KH 4MXVF 4JHAH 3TJHD 4X6CB 2CIIA 3S9DB 5CEXB 1Y6KR 2VDQL 3QQ9C 4OT1L 2NY4C 4F58L 5KTEL 1HHIB 4TVPE 4L4VB 4YBHA 1EFXB 5F9OL 4M6AA 4KH2A 4RAUB 1TJHL 5I1IH 4PY7A 1AGDA 3BP5B 1GPOH 2A38A 3VFOA 4PGBA 5JA9A 1KG0A 3X13B 2XPGA 1WSST 2EE9A 2F58L 5FKPA 3SKNA 2VN7A 4NGHL 5IB2A 3V7AE 4NBXB 1JGUH 2AJUL 2Z4QB 5FKAB 2VDOH 4JKPL 3WL9A 2R0KH 4KMTH 1D5IH 2ICWB 3T65A 4MVBD 3CSYB 4PJCF 3UTSE 4EN3C 3F7YB 4Z0BL 3LPFA 4JFOB 3BWUC 3VXNA 4HPOH 2FRGP 4OZFG 5EN2B 5HXMA 4FMFA 1IAII 4RNRB 1S9YA 4UQ2A 3C8KA 5K33A 4O2CA 1B6UA 3H0TB 4PTTA 4Y8DC 3AY4C 4NQCB 4PTUB 3IFNH 4G3YH 4WFHD 5SWZB 1IAOA 4LCCA 3TV3H 1OPGH 3IFOB 1PZ5A 3H9YA 4OD2A 3TF7C 4WFFD 1K8DB 1CLZH 2ARWA 1X6NA 3QYCA 4HIIB 5E24E 4FXGB 4OGYH 4BM7A 4OGXL 2NY3B 1I3RB 2ATPB 3TNMB 4DZBA 2WBJA 1WWAX 1NCUA 2G9HA 3NZ8B 3MV9A 2NTSP 4XPFL 4WUKL 2WUCH 3O2WL 1AIFA 1QSEA 2DDQH 1NGPL 4J7RA 4ZTPH 2WBWB 3P30H 5FB8A 4PG2C 3B9VA 4JHWH 2JCCE 5JIKA 4P59L 4HX1A 5F6IC 2AKRB 3UPAA 5DC0A 3LEYL 4Z0XA 3AMLA 2DQHH 3C2AH 4Y16D 4OZIB 1VFBA 2H2PD 1FZOA 2BZDA 3RZWA 2MFNA 3BP7B 3I3EA 1P7QD 1C7SA 4MWFB 4PJBA 2JJTC 4HWBA 1EO5A 3PQYD 4XPBL 4BZ1L 2QADD 3WKML 2FATH 1C12A 1MHHB 3GHBH 1JBJA 1JZ6A 4F8QA 1KN2L 1CVRA 2RFXB 2XZCL 3RP1A 3HN3A 3IT8D 3SKOB 5I1AB 1XGQB 3QXDA 4MZ2A 2MPAH 3PL6C 4WU7B 1WBYA 2E8YA 3NGBB 5J9PA 1JRHH 3GSVA 1IGML 5DK0A 4ZOAA 2Z31A 5DD5L 4PGDB 3BT2H 5CJQL 3NTCH 1NMAH 3WD5L 2QQKH 3QUYA 3LAFA 1QEWB 1ZGLA 2FEEL 1IGTA 3MQIA 4I0CC 5C07A 4OZHB 1T3FB 1BEYL 1TVBA 3PABB 1I1AB 4G9FB 3ZKMD 3RWCB 1E6OH 1HHGB 4MX7A 3P0YH 3JWNC 1TJIH 3A67L 1D5XA 2VR9A 3BH8A 1Q9KA 4OCYH 3S4SB 5F3HA 4U31A 1S7XB 4GXVL 4JZJA 2Q76A 1OAXH 1ZA6B 4NSKA 1FFPB 1OGAA 1A6VL 3HA0A 3RVWC 2EDDA 1YYML 2VAAB 2A77L 3QWOA 2QSCL 3CVHB 3QNXB 5HHQA 2CRMA 5DYOA 4Z9KB 4Z78B 3ARBD 3FT4B 4KJWC 5BJTB 3DGGB 1UA6H 2YPKA 1P7QB 3SY0A 3D9AH 4PJEA 1MUJA 5TDNA 3SN6N 1HWHB 2AAVA 1CFTB 1UVQA 3WJLA 3BIBX 5GRJL 5F7FA 2OCFD 4DGVH 3OSKA 1IARB 4G42B 1G9NC 3DGCR 3IFLH 3KLAA 3L9RA 5HGHA 4LQFH 1QR1B 2HVKA 3ARGD 4MXQC 3BKMH 5EOCJ 1QBMH 1QBBA 3NACH 2GFBA 4Q2ZA 4OCWH 1NDMB 4NQEE 4GH7B 4PRIB 3HNSH 3FT3B 5IB4A 1MCPL 4Q6IC 4E41A 3D39A 5FECB 5EUOE 3G08A 5E8DL 3WLBA 3WO3B 4DK6A 5TDOA 1XGUB 3N1FC 2J8HA 3HPLB 5T1KA 1T1XA 4G7VH 1F13A 4JB9H 4ZPTB 5IBLD 5A2LH 1AGFB 2EE6A 1LO3L 4J3VA 2IG2L 3VWJA 1G9NL 3IU4H 3OJDB 1J0JA 4QRTA 2HJKA 2ZUSA 4M8QA 1ED3A 3KJ4B 2XZQL 2D7NA 3I75B 4KKBD 2PTTA 3ARZA 1WC7A 1ZHNA 4PJ5E 3KWWA 1T6VN 1EGJA 4X83A 4MS8D 2DKSA 1EMTH 1CLOL 3DX7A 3NFNA 3C5SB 4ETQA 3ARBB 3K8MA 3ARTA 5JORB 4GQPH 2BVOA 1RHHA 5GZND 1U8QB 5K59F 3ARFD 4M61A 5E8PB 5FV2A 3UROR 2AK1H 4JJ5A 1G9MC 4D9RD 2N56A 2EE3A 3ARGB 5IMOA 3MO1B 4FFVD 3HRPA 1DN0B 1Q0XH 3GEWB 4FQHB 1MREH 5I71C 1JPGB 1UYWH 4PJAE 4JO3H 1PLGH 3C5JA 4TUOA 5C6TH 4PP2A 1HYSD 1S7SB 1KIUA 3LB6C 1CFBA 1S8DB 1Q9LA 1EO7A 3H9SD 3QXWA 4FHBD 3P0VH 1M7XA 4XP6L 1N3NB 3HNTH 1G9ML 4XT1C 4NNYB 4LCIH 3D0VB 5B38B 1KCLA 1PKQA 1DQLH 2DQUH 1GHFL 5FO9A 3UTTD 2ZOKB 3L3OA 4X4XA 4ZD3H 2JB5L 2X4OB 1FV1A 2Y5TA 2AEQH 3QP3A 3IYLW 1KJMA 3HAEG 3M45A 1XAUA 4FQIH 4UV4H 4HS3B 2QR0B 3DMMD 2IF7A 4PJFE 4XH2B 1R3JA 1S5IH 1ZHLA 3MJ8A 4FTVD 4L8BA 5F70A 3P4NB 3WLWC 4ZOBA 1AH1A 1FPTH 4YFLI 3ARFB 3GI8H 3U1SH 1AQDA 5HYSG 1HXYB 1S7RB 1D5MA 3QFJE 4PRDB 5F9WC 4UBDC 5F21B 4Q9CA 3LS4H 1QFWH 2YN3A 5HD8D 2BVYA 4NKQB 2QQQA 2C26A 4U1MA 2VO5A 3VXUE 2Y1VA 1RJLA 1A2YA 2IH1B 4HWUA 1YEIH 3BQUD 2UYLA 3OKOB 3WKNA 2GSGA 1FL3A 1J1OL 4X4YA 2GCYB 1JHLH 4LFHG 5DZOA 5DS8B 5I76A 3SDDD 5A43C 4UV7L 1KUMA 1P9MA 2DKMA 5KOMC 3HS0A 4X9FA 1ZVHA 4P2CG 1H8SA 3H9SB 3PWNB 3O11A 4OUOA 3UBXG 4IRJD 4QT5A 2X4TA 4LVHC 4X6BA 3BEWB 1T22B 4M1CC 4N0UB 2ADJB 4Y0GA 3ARDD 5KSAD 4LKCB 5HYJA 5SWQB 2OMBA 5LQBL 1OWRM 1Z3GH 4KQ3L 2VE6A 1CD1A 2FD6H 4RMTA 5EBWB 2QV2A 4AENA 2YD5A 2G60H 3MRQA 4F15C 4EBQH 1DBKH 3BMVA 2HVJB 2XTJC 5DHVH 3TN0A 4ODWB 2UWEA 3JUZA 5GHWH 2EC9T 4G5ZL 5HVHB 3FOLA 1UXWA 2OLDA 1TZHB 1MPAL 1WZLA 1CDGA 1JFQL 3W9DB 2GSIB 5HHPA 5T33H 2HTKC 2XN9A 3U4AA 3HI5L 4LEOA 3MV7D 4OLXH 1WGOA 3VG9B 3C2SA 2M1KA 3L3HA 1RJZB 3BQUB 4XAKE 2BSED 3QPQC 3V5KA 4PJ7A 3VFPB 1OHQA 1UCBL 2NR6C 1R5VB 4P9HH 2ZCLL 5IBTL 3WSQH 1B6DA 5F93C 4L4TB 5TFSL 3OR6A 3WIHH 5EH1A 2VLKA 4U7KA 5HDQL 4MXVE 1U8MA 5A16B 4I18A 5EOTB 4E9LA 3FO0H 5GS3A 4IRJB 4GKNB 1R3LA 2V2WB 4QHUA 3QZWG 1F4WL 4LKXA 1G6RA 2Y06L 35C8L 4WHYG 1UENA 3ARDB 4OIBA 2HG5B 4LPUA 2GYSA 5EB9A 1MHCA 7FABL 5KSAB 3BE1L 5ILTL 4UNVA 3ULSA 4M4PA 1DL7H 1FORL 3DVGB 4HZLA 3QI9D 3STBA 1HSBB 2IALB 2WIIA 3IDNB 3BUYA 4NN7B 3C09C 2ADIB 5BS0E 2CK0H 4ODSL 4WFED 4LDEB 2R15A 4PJCE 2YC1A 1T83A 5DT1L 2NYYC 3O9WA 1OAUL 4CW1A 2JB6A 3QR2A 3U6RB 3HZYA 2JLLA 1L7IH 4HUUA 1YNTB 3LKQB 3MA9H 4FP8L 4Y2DA 3H7BB 3WFHA 2YBRA 2P1YA 1LHZA 4LVOC 1UM4H 2OTUB 5D1ZD 4MAYD 4NO3A 3MRMA 1T04A 1HKLH 2ZKHL 5JHDA 2EH7L 2OK0H 4KDVA 5GGSA 4HV8A 3GK8L 4ZOCA 2BHZA 4G80A 1TETL 3PHQA 1ACZA 2D31A 2BVUA 1PY4A 1S7WA 2IFFH 3CFDA 4QRPE 3TNNA 1BFVH 3VA6A 4PJ8A 3LN4A 3KNBA 3FRPG 2GKIA 3U83A 4WNQA 5J11C 1IZJA 1OD7A 3QCTL 5ABDE 1T21A 3Q48A 5IG7A 4BZ2L 2YPVL 3BKCH 1V7NL 3SO5A 2FGZA 1ND0B 4BK5A 1IFHL 2AJVL 2R23A 5HI5C 4JAMA 4M5YH 1I8KA 1JGEB 3LHPH 4YFDB 1FSKB 5I0ZA 1MCFA 2YXFA 2X2YA 1G7PA 4JKKA 4C56B 4RCAA 1GJIA 4X8XA 4YNYB 2DWDA 2F19H 4HGKC 3ISWA 2P46B 4NZDA 1UKQA 3SCMC 3MLZL 2P8MA 1QSFE 3OX8A 2FO1A 2DICA 4LEXL 1YN7A 4MDIB 2WBKA 3VFGL 3QCUH 1X5FA 2VJXA 5T1DL 1ZHKA 3MSPA 1F58H 4LSVL 3QQ4B 4J4PA 4AEHH 2DN7A 3RL1A 1G84A 1KC5L 2EIDA 2A74A 4G6ML 4BH8A 5TE4L 1ZT1B 4PGCA 3OKEA 2HT4D 1REIA 2VWEE 2XWJA 1FO0B 1QHOA 3JV4A 1EXUA 1SEQL 2OR7A 4N5EC 1DP0A 3MLVL 5I2IA 5DK2A 1KELH 4QF1A 2AVGA 1KIRA 2IADB 5EDXA 4UQ3B 5AYUL 1HHJB 2CDGB 3F12A 1ZA3B 3TGXA 4HT1H 4BFGA 4LNVA 1XMWA 3SDXF 1CXLA 1E4JA 4XNQA 5B4MD 2IPKB 1OCWH 1QACA 2GIYA 1D6EA 3OJVC 1OTSD 4H1LA 3SKJH 3PHSA 3JV5A 2VL4A 4PLJC 5ENWA 4AMKH 2B1HH 2P5WE 1FL5B 4K8RH 4RGND 5BVPL 5A3ID 3AFLA 4N8VG 4JRYD 4X6EB 2B5IB 5DJCA 3GIVB 4HGWB 3VFUB 2FWOA 4LLMA 2HRPH 1NC2D 3GKWH 4MJ4A 2CPCA 4MSWB 1EUTA 1XIWA 5DJAA 1G9EA 2GUOB 3IDIB 5CGYD 1Q72H 1YEGL 3OWEA 4FXKA 5CHNB 5D5MA 1OW0C 3L5XH 1ZLVK 1PX4A 4PB9H 4OI8A 1I8LC 4LLWA 5ITBL 2DI9A 2HLAA 5HYQA 4IMLB 1S5HB 1DFBL 1CWVA 3OXSA 3RNQB 1RAMA 4XP4L 3QSKB 4KDTC 1CICD 2RCSL 5T3XL 2VSCA 4N8VA 1UJ3B 2BHUA 5TQ2H 3U4BL 4R0LB 3RIAK 1CTNA 3O3DA 4WV1B 2R4SH 3DO7A 4RAHA 2RAMA 4QHLB 4WUUD 2E7HA 4YHML 4GAFB 3EO0B 1MVFA 3QEGL 5DLML 3VFWA 3QUMB 4PJHF 4WO4A 3QT2A 5ALCL 1HHKA 3QH3B 5K59E 5AAWA 2P7TA 2D7QA 4RGNB 3RL2B 3M17A 2BVQA 1MRFH 4M6OH 2B2XH 4XPHH 5E4EB 3ELAT 5GIRA 1NC2B 3NA9L 1G7LA 1CU4L 3VXMA 1NGWB 1YYLH 5F7EH 2XY2A 4P2QE 2RB8A 2R1XB 1OY3B 5GISH 2R29L 2ZNWA 3VRJA 4GKSA 3QEHB 1UB6A 2R0WL 3B8YA 3MRKA 1WIPA 2QSVA 4LIQH 4J3SA 2ICEA 2PO6D 2MNUA 4Q0XH 3I9GH 1BECA 5BRZD 3ZTNL 1C5BL 1RZIB 3T2NL 5JOPD 2VQ1B 3CCHB 4KGJA 4B0MM 1LEKB 3MGAA 3THMH 4JDZB 2F53D 1CDYA 3ZTJH 4UILH 5DI8B 3RY5A 4JO2L 4TTDC 1CICB 3B2UC 4K8RD 4QCIB 2PR4H 4ZYKA 1K8IA 3FB5B 3KXFA 3MGTA 4LHJB 4OCXH 5GGQL 4LGRB 4APQB 1DUYA 1K4DA 3STZA 1NMCC 2J8UA 4WUUB 1NUGA 4FNLH 1QG3A 3LEVH 4JR9H 5IMKB 5KANI 4MJ6A 1WWCA 3IAQA 4Q9QL 1QLEH 2V6HA 4QY8B 5C2BL 1AR2A 1FGVL 1A6UH 2H45A 5DGQA 4NHCL 2BY3A 3QNYA 1OTTC 1NDGB 4MQSB 5C0AD 2I26N 4MB4A 4HQQH 2KBGA 1V3KA 4X5XB 4AQOA 3LQZA 1FVCB 4LP4A 2AQ2A 4X6DA 3RI5F 3BD4A 1FNLA 4R2GD 1OF2B 3GMMA 4FXLA 1DBJH 4OBRA 5IHUL 2IPTL 4YHPA 5DSCA 3E8UH 2CKBB 3VD7A 3UTZB 3OZ9L 3MNVA 4P5MB 5GGUB 1EHXA 1FFQA 4NO0A 4G43A 1GL4B 2PO6B 3QDGE 5EU6E 4S1SL 5LVEA 5BRZB 1G0XA 3E6HB 1RK0A 1JN6A 3OAZH 2Z92B 4JO4H 1AI1H 1FNGB 3WBDA 1HOCA 5ICXB 5FYJE 3GGWB 1IC5H 1JGVL 2BOCB 1DQMH 5K9QG 4OGZA 4C4KT 1YEHL 5JW4R 4HIJB 3K3QA 1TZGL 4M1GL 1U8JA 4U6YB 3WIIH 1S7TB 2ZCHH 1HZHL 5EU3A 1YMMD 1BQHB 3KYOB 5LGHH 1DQDL 1CF8L 2NX5A 4XCYA 3OKDA 1QBLH 5HHOA 1BLNA 3JZ7A 2BOBA 4X8JA 4JFEA 4DUVA 2O93L 1FGNH 1QFPA 1PKOA 5C0AB 5KS9A 1CFNB 1CD8A 1JWUB 3W0WE 4RAVB 4EUPA 5D93B 4FQXB 4XB8A 4F2MA 2R4RH 4R2GB 3HG1A 3I6GA 3C60D 5L8KB 1T5WB 1B4RA 2DTMH 2E7LA 2ZSWB 1EFQA 5CP3H 5I74C 2C3WA 4TVPL 5DDHB 3QG6B 1P4LB 5J13B 4MNQA 2X89D 2H2SC 4JN2A 4RFEB 1QBAA 5E0QA 5BVJB 2APXA 1A6WL 3UJJH 5I73C 1HI6A 1OGTB 5JOEA 5DMYA 5EIIB 3VE0B 3B9KD 5IKCA 4B41A 3DX6A 4ZXBA 1QRNE 3MJ9H 5DHXB 1YJDC 4ELMA 2VYRE 5E94A 4OD3H 4HS6B 3ROLB 1Y6MR 4JVPA 4Z76B 4OLUH 4S0TD 3MRNA 5DO2D 1B4JL 3HMXL 3A6CH 4D0CA 2FL5A 5CMAA 3DOSA 3J7HA 1YMMB 4U1LB 4QOKD 5GJTH 2QQLL 5GSRB 4QRQA 5L9DH 4FZEL 4G8GB 5GZOC 2Y6SC 4XTRC 4HCRH 2DB8A 4ZS7L 2D7OA 1M1SA 4OLZL 3VJ6A 5JW5A 1AP2B 3KPSB 1JNLH 1GGTA 4NP4L 3VMNA 3EYQD 5I16A 2J6EA 1CK0H 4FFWD 5BV7B 1A21A 1T0NB 2XKNA 2JIXD 1C5DA 1G7JB 4U6TA 2OJZH 1TNNA 4GKZB 1I7TB 5EU4A 3SE8L 4AG4H 3U79A 1CE1H 2NY0D 2ATKB 2FH6A 1K5NA 1KSRA 4PRHB 4OAWB 3WNPA 4BA8A 2D4FA 4ORGA 3KPNA 4IS6B 3TBTA 2VXQH 3HE6C 3CAFA 1CTOA 4M3KB 2P24B 3SOBL 3CLEL 2EEDA 4CMMA 5SX4I 4PB0H 1A7OL 1DSFL 2CKNA 4X7TA 2LTQB 3RQ3A 1II4E 4WFHE 1L6ZA 4F57L 3IRZA 3SGJC 1INDL 2P5EA 1UB5A 5D96B 4KKCC 3B9KB 2BNQE 4YXKH 1NCBH 4WFFE 5I8OL 4U33A 1I9EA 5DD1L 3QRFM 2EZ0D 5LAXB 3CFBA 4V2CB 4V2BA 1P6AB 5K9KB 1A6TB 3PHOA 2ESVD 5EG6C 3W2DL 1S7QA 3TEUA 2FR4A 4BSVA 1WAAF 2A73A 3TIDB 3BJLA 2VDML 5CINL 2X4NB 3ARVA 4QOKB 5L6YL 2HJFB 5TE7L 4YAQB 1NL0L 5MP6H 3BPOB 4DKAA 5IQ7L 2ARJA 1B9ZA 5I8CA 3HUJB 4PLKC 3RVUD 1FCGA 3NPSB 1TJHH 2XA8L 3FQRB 4M5ZH 2CLVB 5D7JA 1EH9A 5T3ZE 1RZKC 5M95B 3GSRA 1T0PB 3O4LA 4NKIL 4D2NA 2JIXB 3WFCH 4NGHH 4GG6F 5EZJA 3GMNA 4LPVA 2XKUA 1VSCA 2MTPA 5JR1L 2VLJA 3PQYE 5C08A 3BRFA 2EIZB 2RHEA 2E9BA 3QJHA 3MRJA 1MJ7H 5C6PB 4JM2C 3FMGH 5ISZA 4W4OA 3RY6A 3M1BA 4BFIB 3CUPB 1LE9B 3JTTB 3V6OA 3SE3C 2ERJC 4WVRA 3B3IA 2EH8H 4KHXL 4G8EB 1WFTA 4I4WA 3I85A 1QUNA 1HYRC 4FQLL 6FABH 4U1JA 1RZKL 2X40A 3VFVB 1BM3L 4XPGL 2H6PB 1A14H 3QRGH 3RDTD 1RIUH 3K4ZA 4RRPA 4LSRL 4TPRH 3SDXE 4OGXH 4N90E 1NAMB 4O5LH 4S1DD 1MFEH 3LKSB 3PP4H 3CFEB 4X9BA 4Y88A 2GJZB 5IOPA 5C0RL 5J6GB 1LEGB 3MXWH 2M8XA 1HH6A 2C1PA 4XZUB 5F7LB 1NGPH 3BJ91 3REVA 3PWJB 1WF5A 1A0QL 5F8QC 1MQ8A 1D3CA 3RWEA 4RIRA 2XIDA 4U6HB 2MCPH 4BQ6A 2R2HB 3GI9L 4PJ9D 1MCOH 1MWAH 3W11C 3EDJA 4U1GC 3QUZC 3SE9L 4PJ5A 3W39A 3QIWC 4XNXL 4JQXC 3SDAA 3MX0A 3GBML 5FXCH 5I1LA 3UZQA 4GJTB 2Y72A 4QGYA 3LQAL 1TVHB 3KR3H 3S6CA 3R0MA 1IQWL 3IGAB 4HUVB 4XWGH 2I60H 3MRGB 2VC2L 3EZ8A 1J0ZA 2XA3A 3WO4B 1RUQH 3I6LD 4PYGA 4F7EB 3MNZB 4ODTL 1LK2A 1NBQA 3L7EA 2DM4A 2HYMA 3TWCL 2JE8A 5FF6B 4RMSA 4NDMB 4WWKD 5HVGB 1RZGB 5DJ0A 4MXWL 2F9BT 5F1NB 2ZOLA 3VRIB 4CDHA 3EHBD 5ACZA 5KSUB 3UDWC 3QDAA 4O51B 1CCZA 2BC4B 5ELIA 2KKQA 3ILQC 3P4MA 1YNLL 4PJHE 4MA8H 2VH5H 4R7NB 1JPSL 3LDBB 1IGIL 2O5YL 3VXSB 3IDJB 5JXAL 3C5ZC 3PIQA 3IFPA 3BXNB 3DRQB 3OKKA 3P77A 4MCZB 2X7LB 5L7XL 3WN5A 2XWBA 4WW2B 1KEMH 4CVZA 2NY4D 1UEYA 2QSCH 5CCKL 5HHVH 5IK3B 5FUOL 3GJFB 4HJGB 1O0VA 3ZKXB 2G75A 3MRRB 1YY9C 2ORBL 4PIRF 3QHFL 4HEPG 4HLJA 1F4AA 3REWA 5SV3A 4X7SL 1N2RB 2X41A 5F44A 3Q3GB 4NM4L 5IW1A 5INCB 2IH3B 3FB6A 1YEKH 5GRJH 3WNNA 1YMHB 4MNHA 2N7BA 3D1MC 1IMHC 3HI6H 1KXVC 4EN3D 1ROWA 1BX2B 3HNVH 2OL3H 5IW6A 5EUKA 1FP5A 5D1XA 3X14A 1U6AH 1ZT4A 2BX5A 3AAZB 5TDPA 5CGMA 1KJ2L 5E8DH 4WWKB 4HWEH 5C3TA 1GCFA 4I0PA 4RFOL 3S97C 1FG2B 1KTKE 1AE6L 3BRGC 1XGPA 4S0SD 4H5SB 1A47A 1CFVL 3UTTE 4FZ8H 1AGDB 5E2JA 1I9IH 2J4WL 4AM0A 4PGBB 1KTDB 4TNVK 5JPMB 2FJHA 4HS8H 4TSAL 1J1XH 1HE7A 4G6JH 3U4EA 3GSNL 5IB2B 1SHMA 1JV5A 3HC4H 2CK2A 4ZG1A 1XR8B 5F7HA 3FN3A 4FTVE 3RA7H 3QQ3B 4P46C 3T65B 1F3JB 1E6JL 4I48B 3QEQB 1IQDB 2W60A 1QSVA 3QFDB 3KPTA 1DANT 1SEBA 1IE5A 1S9YB 3VDCA 3C8KB 3OJ2C 4G8IA 1T66C 3SJVE 4KVCL 2ED7A 1EUUA 3KYNA 3U0WL 2JK5B 1IAOB 4HAGA 4LCCB 2VDNL 4EN3B 3QQNA 4FABH 2FBJL 5EA0H 1C5CH 4Z7WA 4LRNL 4Z5RB 4RFNC 4ERSH 3QG7L 3B5GA 2VISA 4JY5H 4U1NA 3PL6D 4ESKA 2FECI 4DZBB 5IF0A 4OQTH 4HXBL 1FYTD 2G9HB 3MV9B 1CGXA 5H94A 1BWMA 3RKDC 5L2KD 1AIFB 1QSEB 4ZTOL 4XP6H 2OXGA 1DLHA 2VDPL 3EIFA 4XXCA 2DJ4A 4MA3B 5JZ7C 4DGIH 1FDLH 4KPHH 1GHFH 3MLRL 3QUXC 2Q8AL 4XVSH 4D0BA 5DVOA 1F11A 5KAQF 4Z0XB 3V0WH 2BRQA 5FGSA 3WNOA 1ZT7A 5D7KD 4GAJL 1IM3A 5JMRA 1X4XA 4K55A 3IXAA 1JGLL 3EBAA 4D9QE 4J3WA 3FQWB 5JNYA 3RVWD 1JPFB 3PWPA 4PJGF 3DV6B 4IIQC 4I0KA 1C12B 4HG4J 4YC2B 1IJ9A 3NZHH 1ADQL 4DN4H 2IAMD 2HJLA 4KJWD 1BVKB 3VCLA 5IFHL 2ADFH 5ID0A 1NH6A 1HILA 4HBQA 1WBYB 1FN4A 5EU5A 3MV7E 4ISVA 4LAJH 4OZ4B 5JXEC 2ED8A 4EDXA 1KCUL 2X1PA 3ZYJA 4MXQD 4HC1A 3ARSA 4ZPVA 5D7SL 3RTQA 4K2UH 1R3KA 5C07B 4JDVB 4EXPX 4YDJB 2JJSA 1J1OH 4UB0H 4LQ1A 4QTIH 4L8DA 3SDYL 4HK0A 4YXLH 1D5XB 3CVIH 4YFLF 5HDOA 1Q9KB 1T1ZA 3E6FA 2A9NL 4UIKL 4UT6L 1JF5A 5FGCB 5L2KB 5E08L 1ZLUH 2EEAA 1H3VA 3U7YL 2IWGA 3S5LG 3I3DA 1IEBB 1RUPH 5I1HH 4LSUL 4JFDA 5DYOB 1JWMA 3FFCA 1XZ0A 1EEYB 1U8NA 5C0NC 4AEEA 3HLAA 4XCCH 3PNWB 5ETUB 4LCYB 1UWEL 1PBYA 2PYEA 4XCFH 4NKOB 4PJEB 2DQDL 1MUJB 5IROA 4R3SB 3IJSA 2VL5A 1ACYH 4PD4J 4F9LC 2YD3A 1MF2L 2BFVH 5HGHB 3KLAB 3GJEB 4U0RC 3VW3L 4OLWH 2CLRA 2YOCA 2WM0A 4JPKH 3MUGA 4G5ZH 5JPNB 1FBIL 1U92B 1MY5A 3QWRA 4NRZA 1YEJH 2WUBH 1M05B 4PJIF 4KKLC 1HIMH 4HJJH 5FYLH 5E6ID 5IB4B 2VIRB 4JFZH 3G08B 4L3ED