1YUHB

Fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
b'QVQFQQSGAELVKPGASVKLSCKASGYTFTSYLMHWIKQRPGRGLEWIGRIDPNNVVTKFNEKFKSKATLTVDKPSSTAYMELSSLTSEDSAVYYCARYAYCRPMDYWGQGTTVTVSSAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPASTWPSGTVTCNVAHPASSTAVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 88C6/12 FAB (LIGHT CHAIN)
publication title Structural analysis of affinity maturation: the three-dimensional structures of complexes of an anti-nitrophenol antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 1996-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yuhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yuhB02
2EDOA 3ULVL 3D0LA 3MODL 3G6AA 4ZUSA 1AGBB 1ZS8A 2NYYC 4G7YL 3ULUD 2FX7L 3I50L 2ADIA 3FFDB 1MCIA 4DUXA 4NKIH 4ZS7H 3LIZL 1MHPL 3EYSL 3MUY1 3MSPA 3LZFH 4GQPH 3PWPB 4HPOL 1S7SA 3ROLB 3HUJF 1ZA6B 2BFVH 3FFCA 3VXQA 3NFSH 3S4SA 1G6RB 2P45B 3GMQB 1ZLVH 2ZKHH 4KGJA 1ZSDA 2A6JB 4DW2L 1DVFC 3QT2A 3B3IA 1EO7A 3UTZB 3TNNB 1DANU 1NUGA 3MJ9L 4BFEA 1D6EA 4X7EC 5HYJD 4N9GB 3TBVA 2LFGA 3NPSC 4TSBH 1KTLB 2P8LB 3Q2CA 3SEPA 2BHYA 4OV5B 4CADA 2WBJA 3ARFD 5I16A 1OF2B 3QAZB 1A6UL 3G6AB 5JHDD 1EAPA 1SHMA 4ORGB 4XCFL 1RZIA 3LQAH 4DTGL 3HS0B 2RFXA 4PRBA 4P59L 3QDHA 4O4YH 1H3GA 1JPGB 2ADIB 4XCEB 1PW3A 2VWEC 4NCC2 4WW1A 3GM8A 1NGPH 2LU7A 3UJIH 3QEQA 4X6DE 4ENEC 3PNWA 4HKXA 3IU4L 4WDIA 3ZE0E 4UOW1 5KAQF 1BMGA 3P0YL 1S7SB 4YFLI 3N85L 4NN7B 3W11D 4YEFA 1FFPB 3VFMB 5BW7A 1C5CH 1ZLWH 4Q9RL 1QUNA 5HBBA 2I9TA 4V1DE 1AR1C 4YO0A 3AS3A 4XPHH 4Z0XA 4HLZG 2EEAA 2J4WH 2Y06H 5CEZE 2H32A 3CLFL 4JHWH 3WS3B 3MCLL 2OS7A 4R2GC 25C8L 3GK8H 4NFCA 5FKAA 1SM3H 3FO0L 4G42B 3RBSA 5HSFA 3FB7A 3RX7A 4JM2D 5DJ2A 4CADB 5I16B 3LOWA 4RGND 5D7JB 3OHXA 4CN6A 1SYVA 2NY1B 1EAPB 2VLKE 5D7IA 4EI5D 4OD3L 1OSZB 3ZL4L 1RJZB 2OJEA 1T1ZB 4U2ZA 2WWKT 4L8DA 2RBLA 1DQJA 3C6LC 4WO4D 2R0ZL 1RURH 3WXVH 4JLRB 4WDIB 1LVEA 3FTGB 4I3GA 3B2VL 1KELL 2Q6WB 1MF2H 2CIKB 1A1OB 4D9QD 4P9HL 2BY0A 1S7VA 4GXUM 4M7LH 4AH2A 3F58L 1U8QB 4D94A 1P7KB 5D72L 3FZUC 1QBAA 1NCUA 3S37L 1F02I 4QRUB 5E03A 2VXTH 3VD3A 4PJFB 4XXCC 5INCA 3WEXA 1ES0A 3FB7B 3CFEB 3TP4A 2QQNH 1Y18A 5GZOD 1F4XL 1CICB 4MAUH 1SYVB 3KG5A 2PW1A 4UB0L 3IDJB 3CLEL 3D2UA 3PJSA 5CSGA 5GISH 3ULVC 4L8DB 1DQJB 4NQDE 2DI8A 3WFCH 3L3IB 1CLYL 2V2TB 5EN2A 1J1XL 4ODUB 2C4XA 1EBPA 1FE8H 4S1SL 2QQLL 4LEXH 4JQXA 4FQHA 3V0VA 5A3IC 2EXYC 3C9NA 5IESL 2DQFB 5K9JL 1FN4A 4ELMB 2I9LB 5E8EA 2CKBA 1S7VB 4K9EL 3HPLB 4KUZH 4KTEH 4NN5B 5B39B 5C8JA 3ARDC 1G9EA 1KFAL 3F7RA 5C6PB 2FO4A 1Y6NR 3PQYA 1RI8A 2X42A 3MA9L 1ZE3C 2X9YA 3STZB 1NH6A 4F8QA 2W9EH 5JXED 2X1WL 3OKOB 1B3JA 3S4SG 1Y18B 5I66B 1EVTC 2ORBL 2H3NB 4PJ7E 5DS8A 1BBDL 1T20B 3GMRA 2GEEA 1FL6A 4LCYB 3VJ6B 1RJYB 1TITA 2VLLA 3CFDB 1N64H 1DQMH 4CVXB 3MLRL 4WW2F 2OP4H 2COQA 4I0KA 5EZLB 3W9EB 5IROC 1SJHA 4OCMC 3CCHB 3QUZB 3SDAD 5L0QC 4XPBH 2Z92A 3AXLB 2AXGA 3BYYA 1YEJH 2GSGA 5EBLB 4GW4A 5H37G 4WY7H 2ZG3A 5C8JB 5FCUL 5FOJA 1I8KB 5D8JL 1S5HB 1IC5L 1RMFH 2VSCA 3PQYB 1A1MB 3IFOA 5CMAA 3RNKA 1VACB 3V4PH 3DRQB 1PZ5A 2O93L 1WT5C 4Z6AT 3QQNA 1YY9C 3DX9A 3QEHA 3T0EC 3HE6C 3GSXB 5SV3A 1MQKL 1DBBH 4NQCE 2J5LB 1CT8B 3HUJA 3P4MB 5LBSL 3ZHDA 1LK3L 1GOHA 1QSFD 4GMTH 3P73B 3C2SA 1WAAA 3MRPB 3WDHA 1CZ8H 4EJ1C 1AD9A 5CZXD 4Q0XL 1JGVL 4QRRD 5C0FA 1KN4H 3EOTH 2H2PD 4JE4B 3ZLQC 3D3VD 1A14L 4XZUA 4C57C 2APXA 3WIHL 2QKIA 1NAMH 4NCC1 2Z92B 4JO3L 2VAAA 1T80A 1SJEA 2A9MH 2GHWB 1WUNT 2CDFB 3LKOB 5AUMA 4PGEB 2R1XB 1REIA 4UOW0 2YD4A 1EBAA 1S8DA 3F5WA 4J4PD 2N7AA 3IXAB 4FNLL 1KC5L 3ILPB 4HFUL 4P4RA 3RNKB 3PGDA 2VDKL 5F1SA 1GH7A 2VDOH 5TFSL 5HDBF 3OSKA 5DJYA 3NCJL 1EHNA 3QEHB 4UMGA 2R2HB 4H25A 2PUQT 3TGXA 3CDCA 2BSSA 3MJ7A 5B39G 4JPKL 2BVTA 2DMCA 4WIQA 1QNZH 2OR9L 3LMJH 1KYOK 5EZOH 4CDHA 2G2RA 5J9PA 3BVNA 3QNXA 5J8OA 3LKQA 1MJUH 1FDLH 1Q9LA 3Q0HA 1Z0NA 2FD6H 1ORQA 4XZUB 3VFPA 3X3FH 3BRDA 3P4NB 2D03H 4HUUB 3CZFA 2VAAB 4XWOC 4JR9H 4HBQA 4OSUL 5FDYA 1X5IA 3NVQA 4U7KA 3PHOA 5MEQB 4NQVA 3MYZA 2AGJL 4DQOH 4HG4K 1MCOL 3BP4B 4KRLB 1UADC 2XTJD 4J3OC 4KHTH 4YHKH 2YKLH 3VDBA 5H2BA 1DQTA 4P4RB 3DARA 3QH3B 3V6ZB 3I9GL 1CL7L 4M43H 1U6AH 1HK6A 4QXGH 4YPGA 2EO9A 4ESKA 5SX4I 4H25B 2V5MA 3VXUB 3MJ7B 2BSSB 4YGVA 1H15B 3LN4B 1QSED 1DQLH 4GRWF 3V0WH 1H3UA 2XI9A 5CJ5A 2BCKA 2G2RB 2D0FA 2ZSWB 4L9LA 3S34L 3QNXB 4PD4K 3WD5H 3EJZD 1CTOA 3NGBC 3BIKA 1L0QA 4A2LA 4JFZL 3MBXH 4K7PL 5I1DB 3ARBB 3UJTH 4JO1H 2MQ3A 2CDGB 3O6FC 1Q9OA 5CP7B 4K23L 3UMTA 3VGBA 3TESA 1N7ML 4TUKL 1A6WH 2JJWA 5HVFB 3NH7H 1IVLA 4BK5A 2UY6A 1P7HL 15C8H 4LVNB 1IMHC 5BZDB 1AXTH 3IDIA 1QFOA 4ERSH 3NZ8A 1Q94A 2X7LA 3IDMA 4X5WA 3RWFA 5JIIA 4NBZB 1UWGH 1EHLL 2C7UA 4ZFZB 3P9WB 1WF5A 3QFDB 5KN5B 3QA3A 3K0WA 4NM4L 3OKNB 4J3SA 4X7SH 1IAKA 1HCFX 4KXZI 4HUKB 5BZWA 3RZCB 1UCTA 4Y4FB 2PXYD 2EEBA 4DK6A 1OGAD 4L9LB 4BSVB 1VB9A 3X17A 3BFOA 4QO1A 3BIKB 4G9FA 5IBTH 2UWEF 4HK3N 5IVNA 1CE1L 1NLBL 1M6OB 1YMHA 1Z9OA 4GW1A 5GS1A 1UENA 3HC4H 3OKLB 2PYEE 1WVZA 4BH7A 3CMGA 4BSWA 3WE6B 4KDTA 2R4SH 1LE9A 4X6FB 5HHQB 5B8CA 4HH8A 4BFIB 4MJIB 2C3VA 1IGCL 3I2CL 3MGOA 3NZ8B 1Q94B 5JQHC 2X7LB 4X5WB 5FECA 1YPZF 4ISVB 2CUIA 1F4WH 2FB4L 2IGFL 4HWBH 2BNUA 4LLYB 2ICWA 2GYSA 3SGJC 3MZTA 1JYNA 3MACH 4KK6D 1EEYA 4CKVX 2LABA 5E2UH 5BZWB 2JIXA 3VRIB 1IKFL 4MB3A 4JY4A 1EJOH 5ICZA 3K7UA 4DKDC 2GY5A 4Y5XC 4AJ0A 4HFWA 1WBZA 4GW1B 1YNKH 2ILLA 3RIAF 3QR2A 1NAMB 4XVUD 2VL4A 1EUTA 2A83A 5TQ0L 1JZ8A 4GKZA 4OTXL 3LS4L 1RUAL 1LE9B 4EZMA 3JBG7 4OQTL 1RIVH 4AG4L 2H1PH 5DUMH 5E6IC 2EYTA 3LRGA 4M6NH 3WKML 3MGOB 4PJ8A 2X4SB 5HI4D 3B9AA 5L9DH 4XXDA 4QXUH 5MEOB 3ZYOA 3OX8B 4JFQB 1IGTA 2ICWB 1A7OH 5EIIB 1KYOJ 3L5JA 4X6DF 5GGVL 3ZE0F 4XAKD 1JGUH 2JIXB 3QNZA 5CP3H 4J3XA 1UZ8B 4OV6F 4LPVA 4JY4B 3N9GH 3B6SA 1PAMA 4NP4H 1D9KA 1OAXH 4KGLA 4HMDA 2Z31C 3FONA 3MRMB 4YK4B 1RIHH 5GGTL 2NY0D 5MENE 1FORL 4X7TA 5DZLA 3RVTC 4HQQH 1Z2KA 3ROOB 2IG2L 2A83B 5J13B 4HG4J 3FB8B 5F6HI 3QCUL 1WCBB 2WW8A 3ET9F 4I77H 3SGEI 2Q8BH 5D4QA 5J3HD 3VFNA 5EC2B 5MI0B 3HG1A 2EYTB 3L1OL 1QR1A 4NHUA 1T0PB 2DL2A 3WLBA 4PJ8B 3O6MH 4U05A 4AQOA 3BP7A 3N50A 5LGKA 2FBJH 4JFEB 4XXDB 2K1MA 1QBBA 5KOVC 3WFDL 4DKEH 3SDAC 3CPLA 4P2QE 2ARJQ 2HT2D 1PYWB 1KCVH 4HH9A 4Y8AA 4OF3A 1WK0A 3M17A 2RCSH 5TJWK 2HFGH 1G7LA 1MCJA 2AAVA 4NNPL 43CAA 1FZMA 4IRJD 3LS5L 3VFVA 4HT1L 3VXTB 3TNMA 1FG2B 1TETH 5B38A 2IANA 3K8KA 3MBEC 4N0UE 1N5YL 3CSYB 1C5BH 1HKLH 3VE0A 3F65A 4WI9A 2J8UE 2QADB 4IHOA 4L3AA 5SWSB 3VG9B 4F37K 4R97B 3DXAB 3EOAB 3H8NA 4FQPA 3HG1B 1FFOA 4LMQE 3OJVC 3BP7B 5KSVA 3RGVA 2YUVA 3DWTA 1DEDA 1ONQA 2X2YA 3BPLB 2F8XC 3WN5B 1BVLA 3ARQA 3BKCL 3HAEB 1IEBA 2O5ZH 1JRHL 4I2XE 2YEZB 3QDMD 2VB5A 4HH9B 3FQTB 1ZANH 2V5RA 1IGML 5F21B 1LGVA 2XNAA 1G7LB 1X6LA 2LQRA 5DF0A 43CAB 1BJMA 4QWWC 1C1EL 5LQBH 2VITB 3CX2A 1LP9F 1SY6L 1R3KA 5IBLC 1GCFA 3ZDXE 2ATPB 4OLYL 3C8KA 5E8DH 5CD5C 4LSSH 5F7LB 5IHBA 1KIPB 1NCTA 1WSST 4P48A 5EWIH 4NZRL 5I6XC 2GW5A 4TRPL 3STBA 3VE0B 4WTZG 4IHOB 3LDBB 1OLZA 1EERB 1BQLH 4S2SA 4DVRH 4FTVA 1FZKA 2BXYA 5HPMA 1BGXH 4P49A 3OTTA 1FFOB 4JREC 2I5YL 1S7UB 1AY1L 1I8MB 4HV8A 1T7ZA 3R1GH 4PJ7F 1OP3K 3RGVB 5I8CA 4MA7L 5HHXH 3X14A 1UKTA 2UWEA 5JW4R 5GSRA 1IEBB 3TO4B 2VLRA 5IFJB 5DJDA 4HPYL 3RDTB 4BZYA 1AHWB 1CR9H 1FSKC 4OLXH 1KGCD 1OB1A 1R3KB 1TFHA 3PWVB 4WU7A 3X11B 4TVPE 1UM5H 5IG7A 3QIUB 2VLMD 4P2RD 5EULV 4R26H 2GT9A 4TYUA 4KKNA 1QRNE 3FJTA 1IAOB 5I1AA 3HI1A 4K8RH 4FXLA 2O5XH 4RX4D 3DX6A 3F62A 5HDQH 3REWB 1FZKB 1RPQA 4LHUD 4LP4A 4NKOA 4Y4KA 3OXSA 3MLTB 4O2FA 3UYRH 3UTTE 4HV8B 4P23A 4WCYH 3MGTB 3SCMD 4MCYB 4U1KB 2PCPB 3X14B 2P5ED 4FQCH 3WYRA 2XTLA 4YH6A 1JYXA 1WEJH 3L7EA 4D9RD 4LSPH 4FQXA 5DJDB 3QI9C 3BUYB 4NKDA 5JQ6L 1GYAA 3MJ6A 3VXPA 4XVTL 5TF1L 4KRNA 1YNLH 2DQHL 4IRSA 4QY8A 2ZJSH 1T4KA 5E2WH 1Q0YL 2V7NA 5C9KA 1OM3L 2PO6A 2OTWB 4UDTB 1U8JA 2AJUL 3R0MA 4U1GB 4J7RA 1QFWL 1KJ2H 4MQ7A 4BZ2L 2DL9A 4KI5D 4N90D 3KPMA 2MFNA 5DEZA 5M7QA 4HDIA 1SBBA 5LKNA 1QPPA 5I1AB 3BOVA 1YEEH 3G6DH 3BPNB 2X9XA 1T7YA 2FATH 4N5EC 5E4EC 2FHFA 3I6GA 2YXMA 3THML 5DMGC 4OT1L 2C1OB 3TJEH 4JKKA 4N0YH 1JZ5A 3K2UL 1KCRL 2E8YA 1TNNA 2GJ6E 2WK2A 2DQUL 3LD8C 4P5TD 4Y2DD 2IWGA 3Q6GL 5CGYC 4OLWH 3VXPB 1E4WL 1D3CA 1P7QB 2YD3A 4HJ0D 4IRSB 4YUEL 2JB5L 1T4KB 3BSZH 4MMXC 5ILTH 1MAML 2R69L 5DK2B 3G5VA 3BX7C 4AQ1B 4NGHL 2ZZUT 5DEGA 2XWBA 5HVHC 1D5ZA 4IJ3B 3OPZH 3GSWB 2VLKA 3KPMB 4K7PY 3RA7L 1KV3A 3QULA 5GHWL 2JF1A 4GXVL 5D1ZD 2AQ1A 1CGSL 3NIFE 5GIRB 3J8F7 5F7DB 1A3RH 1Z6JT 2YN5A 4I5BA 3MRCB 5HGGS 2F8OA 4X4XA 2VKXA 4L4TB 1JE6A 2EKSB 4FFWC 5ADOL 4GRMB 1TVBA 4YLQT 2F5BH 1E0OB 1LO0H 5JW5A 2KKQA 3ARZA 4EIZC 1T0NA 4KROD 4RFNC 5JIKA 1H8OA 3U9PH 2BSRB 1BIIA 2R29L 4TUJB 3LEYH 3Q5YA 4RAVA 5KVMC 4EQ2A 2YZ8A 5KSAB 1U8IB 2DS4A 1L0XA 1T1XA 3D87B 1RJLB 5HI4C 5TDOB 4WEBH 4B0MM 4XBPB 4BQBA 3BGMA 4MA1C 4V2BA 5HVWA 1ZKAA 2YMXL 4NQDA 4D3CH 1JMXA 1LHZA 1UXSB 5IFHL 4BFBD 1VENA 1M7IB 4YHPA 4I5BB 1TVHA 5BS0D 1JGLH 5L2JA 3V5DA 1MOEA 4LVOC 1KPVB 5E8NA 5ANME 3WFHA 4PP2A 5ALBH 4BH8B 3OGOE 2ZOLA 1KXVC 1TVBB 1JN6A 3GKWH 2VNCA 5EO0B 4LQ1A 4B50A 2NY0C 4FP8H 3GIZH 3KLHD 3FMGH 4OKVB 4L8SB 3RWIB 1SVCP 1ZHLA 1DBMH 4KY1L 2AJSH 3GMPA 4KKCC 4WHCA 1EJ6A 3CK0H 4MNQD 1S5IH 3N1MC 1T1XB 4ZUTB 1OT1A 1XEDA 3MV9E 4WI4A 1KJ2A 2WIMA 2M2DA 4V2CB 5MP6H 5JNYA 4M7KL 4PJFF 3LKSA 3DMMA 4XC1L 3HPJA 2NY6C 2IAMC 3GMOB 2R56L 4OFPA 4KUCF 1K4CB 2AXJA 43C9B 5JUEL 2QLVB 2P47B 1M71B 2Y5TA 4YHPB 1TVHB 1EFQA 4PJAE 5DI8B 1MJ7L 3WJLC 1XGTB 5C0BB 4M03A 5L2JB 2NY2D 4L4VE 5E8NB 1K2DB 1GGIH 3OAZK 2VMFA 3SKNA 1YDPB 2ZOLB 3MRIA 4KV5E 1GPOL 1EO5A 1C16B 4FZ8L 4LCWB 4U1HB 4GRLA 1MJ8L 2DIAA 4PRHD 4CVUA 3VD9A 4ELMF 1PY4A 4FXKA 5GGVY 4PV9A 2YPLE 3S6CA 3EBAA 3L3JB 3KLSA 2Z4QA 3TA3A 1KJ2B 4APQD 2GJZA 3PWNB 3ARXA 3G5ZA 4O5LL 4X80H 1DDHA 5GRVK 1R3JA 1S3KH 4K94H 3DMMB 2XZAH 5GZND 5KSBB 2H6PB 2CR6A 3BO8A 3QCVL 4P2CG 1NGYA 4NC2B 1I9JH 4PJBE 4KKAC 3BKJH 3O4LD 1F3DH 1BECA 3WO3B 4DGVH 5LWYH 3DLQR 3MNVB 3TIEA 5ACZA 5FYKE 2PKDA 3C09B 2XG4A 4S1QL 2E8ZA 1IC7H 3MLSL 3OR6B 1CBVL 3WL9A 1MCLA 2MQCA 4FQ1L 4FFVC 3B9DA 4XPGL 2KL6A 4GRLB 4PJ9C 2VR9A 5A2FA 1VADA 3MLWH 4KH2A 1QACA 5C07E 5IJVB 1F90L 4NO2A 1KT2A 4IOIA 5I18L 1IM3B 3U30B 1A6TB 3FKUS 1MFDH 1A21A 4NJ9L 4LSDA 1U3HD 2FX8H 4JO4H 3DECA 3I3EA 1GGCH 2AEIT 3O3EA 3G5ZB 4JDTH 5F9WC 3FOLB 2QR0A 4WFFD 1CXIA 2ZUTA 1R3JB 4UUJA 2AK1H 4JZJB 4XCNB 1YQVL 2HTKC 1BQUA 5I2IA 2D7MA 1MIEH 1NGYB 3TWCH 5JR1H 1EMTH 3AM8A 1J1PH 4PJCB 2M26A 5AYUH 2FJHB 4EDXA 3QQ3B 3S98A 4XMLH 3T08A 4QT5A 3CVHH 1N0XL 1BZQK 1LO3L 1F6AA 4EBQL 3HZVA 5IMOA 4Q9CA 5C0ND 5A40E 1UVQA 4ZSOA 2B1HH 4MAYD 3OR7A 2R2BA 3WL9B 2ZCHL 4L3EB 3X12B 1D5MB 3MMEB 5F88B 3LRSB 4I4WB 3ARTA 1KN2H 4BZ1L 4OD1L 5IQ9A 1VADB 2Q86A 1I3GH 1KT2B 5SWZD 4ZPVB 1AO7A 2AVGA 2XPGA 3C8DA 1KB5H 2X70B 1FYHB 2BOBA 1JGDA 2GCYA 3O3EB 4DK3A 2X4OA 4Y5VC 2XWTA 1OTSD 3QDJD 4OIIL 4BYHA 1DUZB 5IVXB 3ZTJH 3IDYB 2B4CL 4F33A 1BJ1J 1NCAH 1V3KA 2DQEL 4K3HA 1C12A 2APBA 5LXGH 3V7AE 1NC2B 5HJ3A 4YEEA 4OB5L 3SE9L 5CWSB 3EO0B 4ZG1A 3NACL 4B53A 5GS0C 3UTOA 4ZSOB 2RQ8A 1RHFA 4RISH 1K3IA 1F13A 1YEDA 4P46B 3ZDXF 3IRZA 1WITA 4YHYB 1JYWA 4KZEL 4PRDA 5IT2L 3IFLL 3I02B 5IQ9B 1A1NA 3PWJA 2Q86B 2EIEA 4HZLB 4ONGH 4KJYB 1AO7B 2VIRA 2XKUA 5I17A 1FO0H 3RY5A 4JHAL 1LEGB 2GCYB 2PW2A 3IKCA 3QPXH 1JHKH 3U7WH 4PS4L 4LOUD 3FT3A 5AAMA 1Q38A 4JFDB 5BV7H 1MAJA 3T3ME 4Y5YC 2DTMH 5AD0A 2DTSA 4P5TC 1C12B 4KPHL 2FJGB 3E8UL 1CFVH 3SDDA 5C0IA 3FT4B 4Y4HC 4QRPE 2OQJA 2PYEA 4YWGL 3RWEA 4IIQC 2DYPB 1IT9L 1BWWA 4K71B 4JRYD 1RK0A 2FX9L 1HSAB 4MA3B 1S9WA 1ETZB 3BEWA 5HGBA 2AJVL 3LSOA 3MRFA 5JA8B 3IF1A 4P4KD 4P99A 5GGSA 4JO2L 3TYGH 1UEMA 5AG8A 1PLGH 2X4QA 2G9HA 4JHZA 5C0RL 3VWKD 4OZFH 4HIEA 1AIFA 1P1ZA 3OQ3B 2CLRA 4JN2A 3H9SB 3MRJB 1XF3B 5D2NE 2VIRB 4TPRL 1U92A 2GQHA 4X6EA 3VXNB 3QIWA 5HHOD 2I60H 3C60C 4IRZL 3DRTA 3CC5B 4MHHG 3R0NA 5C08D 4Q6IB 4Q9QH 4I0PD 5FK9A 1UYWH 3QRGL 4DN4L 4CU8A 4QHUA 1BIHA 3HFML 3R4DA 1KIRB 1MI5E 4NZDA 4NM8L 1QA9A 5FA4A 4GS7C 1CGVA 4ZAKA 5T1LD 1IAIH 5C0IB 1UH2A 2P8PB 1VEMA 4XNYH 5EU5A 3TFKD 3AY4C 4AK1A 4G6KH 4F58H 3WXWL 2Q7NA 3NPSB 1RK0B 4PJXB 1U36A 5A1AA 3MNWA 2UY7A 3U46B 4I18C 3BIAX 3LSOB 2BVOA 2XN9D 4HS6A 4XNXH 1CE6B 5DRNB 3RX8A 2VH5L 3SKJL 1MCPL 2HMIC 2G9HB 2H9GB 3P3YA 1PX3A 4YDKL 2CLRB 5LG1A 4QTHB 1XGUA 2J6EH 2VSDA 3IVKA 2IFFL 1SVZA 3RPIB 1KB5A 3PL6A 1S7XA 2P24B 5ITBH 4AEIH 3E6HA 3TO2A 4O2EB 1PSKH 4NUJB 1ZHNA 4C56E 3VMNA 5T3ZE 3DVIA 3O3DA 2VZ3A 3ARGA 4HEPG 1KJ3H 5D2LE 3V52H 3KLHC 4KQ3L 3UO1H 1QA9B 1FCGA 5AZEH 5FA4B 2DMKA 5HGAB 3KYKH 3L5XH 4TVPH 2B4CC 5MENA 2XZQL 4JFYA 3KYNB 3QSKB 3CVHB 5E1AB 1OL0A 1G9NC 1UWXK 3MRHB 5E2TH 1PKQB 4UILH 3KPSE 3NFPB 1WBXA 1UM4H 3HR6A 2DLFH 2OX5A 5TE4L 3Q5OA 1G0XA 4CVZA 5E2VH 4S0SD 1AI1L 3D85D 3HE7A 3MPCA 5F9DC 2IPTL 3C6LB 2FO1A 2VLJD 1NBZA 4O02H 3TVMA 3T1WA 1U58A 1Z3GH 3FFCD 4LF3A 1JMZA 3UBXA 3NIFF 3GSNH 1GGYA 1KB5B 3HMXH 3MUGB 3TO2B 4H5SB 5ESVA 4P2QA 1U3ZA 3IJHA 5HD8D 1OAYH 1RZKC 1CXLA 4LAQL 4PGDA 2APVA 4YDJA 3U82B 2ZPKL 1MCWM 1XIWA 3AS0A 4CVWA 4HCRH 1JI2A 2EDRA 4EKXA 1I3RB 3ULUH 5EG6C 3O8XD 5TE6L 2WBJD 1JF6A 2F54B 3KXFE 3L6FA 4JFYB 2VUOA 4RFOH 4YDVB 1SBSH 4N0UA 5BQ7B 1B4JL 3DUUA 4ZNEA 2J8UA 3SE3A 2Y4SA 1IGJA 3KS0J 1FZJA 3F12B 3LN9A 4PJHE 2UZIL 5IV2B 1ORSB 1E6OH 4KK8C 3MRKA 4X0KA 1UACL 3QEQD 1VCAA 4OZFA 3L9RA 7CGTA 3MRDA 3AS2A 1HEZB 4E0RA 4OLUH 1ZWIA 5FKPB 1U58B 1DN2A 2IPUK 2KQMA 1MCWW 2GI7A 3UBXB 1FO0B 2GSIA 1U95B 1CVRA 5LCVH 3E6FB 5FB8A 4I2XA 4YXLL 2VXSL 2AJXL 2FGWH 4ZOBA 1XF4A 2IQAA 4TOYH 1XIWB 2CRMA 1G7HB 2V5TA 5EU6D 4OGYL 1T0MB 5BV7B 1A4JA 2AQ2A 3F7PC 1V7NL 4M00A 5BVPL 3ARDB 1VPOH 1I9IL 2CIIA 4X8JB 4YHZL 1GIGL 5JW3H 1TZGL 4D0DA 1KCSL 1I9EA 4HGWB 3QUMA 4HIIA 3ZSTA 3M8OH 4ZYKB 1DLHA 3ARWA 3JWOL 3X13A 3IB4A 5IJKA 1D6VL 3S88L 1B2WH 5J1AA 1FZJB 2A6IA 3NBNA 2HJKA 2KBGA 4PR5A 4XNQA 3MRKB 3S3JA 4B7IA 4G7VL 4RAHA 1HINL 3MRDB 2YHGA 5J6HA 1RVFH 4J8RA 1ZWIB 5J0BA 3O6KH 3L5WA 4ZFOB 3EYFA 4OM1L 3GHEL 2WNGA 3QO0B 5ISZB 2QJDA 4G6AC 3AREC 1NL0L 3EYOA 4PJAF 4K3JL 4OGAD 1AGCA 4ZXBA 2IQAB 1UGNA 5DJAB 3ILQD 1A4JB 2W07A 3BQUC 4JPWH 4ZUWA 4KV5F 1G6RL 2IBZY 4ZFFB 1I7RB 1P4BH 1WWBX 3VD7A 5B4MC 2DAVA 3MRBA 5TPWL 4PB0L 2ZCKL 4PRNB 4GG6B 5IMMB 3AB0B 4O58L 5I30H 4ODXB 2P42B 3TZVA 1VSCA 2B2XL 3D2UD 3HE6B 1EEUA 2A6IB 2C3XA 4PR5B 1JHLH 3F7VB 4LVEA 1F2XK 3UTTA 5D1XC 1NFKA 5BO1L 4PG2C 3OKMB 1J12A 4HHAA 3TN0C 4IDJL 3BZFA 4NYLB 3GSNA 3L3DA 3VWJB 2J3SA 1K8IB 4EI6B 4PP1C 4PJBF 3EYOB 5GRZA 5FF6A 4S11A 3UJJL 4ZXBB 1J1OL 2PR4H 4E41B 1H0DA 2Q3ZA 3C08L 1YN7A 3GJFA 2WWMC 2J12B 3GRWL 3PHQA 4HCRA 4K07A 5ALCH 2ENYA 1AJ7L 4HS8L 5KS9E 3W9DA 4HXBL 3DETC 4G8EA 3UBXG 1JYVA 1AQDA 4G6FD 3P30H 1YEHH 1QTYT 3S7GA 1JPTL 1LDSA 2F5AL 5K9OB 1URLA 2FEDC 3UTQA 3QXUA 1NMCB 3BD4A 1MEXL 1LD9A 3SDCC 4QHNA 4QXTB 4YC2C 2AJ3A 4R0LC 1NMAL 2AEWA 4GG8B 1I8IA 3BKYH 3QPQC 4PGCB 2D7QA 4G3YL 1I1AB 4MJ2A 2IJ0C 5F9AC 2NXYD 4WFHD 2H45A 3P9LB 1EHXA 1LDPH 3FQXB 2Y6SD 2R0KH 1NBVL 3H9HA 3UZQA 3GSNB 3L3DB 4HUXB 1XR9A 2JKXA 2YA1A 2A0LC 4E5XA 2GJ6A 4NBYB 4FQIH 4PJ5B 3ARFA 3DVNA 1RUML 1A02N 3QUYC 5BRZD 1UC6A 4OZFG 4BUHA 3PHQB 4KI5E 4JY6A 4NO0B 5FUOH 1NUFA 2R15A 5HHPB 5JO5A 3NA9L 2GUOB 1YQ2A 3OAZH 3MXVH 3U4EB 5D5ME 4I8DA 1NC4D 5HHME 4BQ9A 3V7MA 4F7MB 1AE6H 4MMZC 1MCDA 3O2WL 2H8PA 3DTXA 4DAGH 5FXCH 5JIHA 3B9KA 1I8IB 5J57B 4LCCA 1WV7T 2VWEE 1RUQL 4ZQKA 5FA3A 1OWWA 5F3BB 4KJQC 5T1MA 5A16B 5C0JA 1S7TA 5DD6A 1WTGT 4M5ZH 4EDWH 1MHEA 4WFEE 3T0VA 3H9HB 2VC2L 3A67L 3TFKC 5D7KE 2IQ9L 5HYJB 1CDUA 2Y7QA 3O6FB 3ARFB 4PG9B 5C0GB 2NY4D 4KU1A 4YXHH 1S78D 1LE5A 2QSCH 4OCXH 4YHOL 5JHDB 1RZ7H 4JY6B 3CDYA 4HD9A 2HRPL 3L7FA 3ZT5A 2Q7YA 5IP4A 4HMEA 1PKQE 2W65A 1LO2L 5JXAL 1A6ZB 3GI9H 3PV7A 4HK3J 1BFOB 5E8PA 3V6FB 3FQRA 1CU4H 3ZKMC 4LCCB 5FA3B 1DBAL 2DQGL 2KQNA 5F9OH 2NXZD 5DJ6B 3ALWA 5ANMA 4HUWA 1KG0A 5EPMB 1K3ZA 1XGRB 1F42A 4QGYA 3SHSA 4MS8C 3MV7E 1MLCA 3T3MF 3ES6B 4M1GH 4GAJH 1CFQA 4NRXA 4WENB 4DEPC 2Y7QB 5C2BH 4JM2B 2ZUQB 4RGNB 4D8PB 2YZ1A 3LZFL 4FXGA 2IC2A 2X4RB 3AFLA 1Q9KB 3W5MA 1ADQH 2BFVL 3NOIA 5D6DC 3NFSL 4EI5B 1N6QH 2B0SH 3MJ8A 4F7PA 2E9JA 3MV9A 5SWQA 2ZKHL 1MHCB 4WO4B 1A64A 3CFKA 4NN7C 3F7YA 4NWTH 5DRWA 4UIMA 5IKCA 4TNWK 3KNBB 1GAFL 1IGIH 4K55A 3ULVE 3FQRB 4R4BB 4TSBL 1CK0H 1NPUA 1MH5A 3T1FA 4N0CD 1BQHB 3VXOA 4L4VA 2CLZA 4HUWB 4I1NB 2VO5A 3LQAL 2AV1B 1FGNH 3BP5A 4O4YL 4LSTH 1MLCB 2Z9TA 3RHWK 4OGXH 2A73A 4S10A 1CFQB 2K3TA 4MNQE 2NY1C 4WRLA 3UJIL 1VGKA 1N26A 3P0VH 4J6RH 1RZ8B 1OVZA 1UJ3A 1TLKA 4FXGB 2FRGP 4I3RH 4M7JH 4HX1A 1CGYA 5E5MA 4F7TA 5IEKB 5E6IB 5DUPH 4EOWH 4NZTH 5SWQB 5I1IH 4MXVE 5L2KD 2BC4A 1A6PA 4GXUN 3F7YB 1MRCH 4AENA 5IBUB 1T2XA 2J4WL 2Y06L 4UIMB 3BRGC 1D5XA 4JHWL 4LBEB 5E9DD 2FH6A 3GK8L 2FR4A 1SM3L 4TSAH 3ZTNH 4OD2A 1CDBA 5DRXA 3LPWA 1CG9B 1T6VN 3P4OB 5IW1B 4XP6L 4NO3B 4OZHE 5IW6A 2EDEA 3GM0A 5DQ9A 4PRHE 1DJSA 3OKYA 3Q3GB 1QKZH 1QQDA 3SY0B 5D2LF 5DTFB 3MREB 3WLWD 1VFOA 3WXVL 2LV4A 1X5GA 4MA8L 5LGJB 1H3WM 5C07A 4F7TB 5E5MB 3D18A 1MF2L 3JSSA 5T3XL 5HDOA 1T21A 4JFOB 3EIFA 2XG5A 3SQOL 3LEXA 3T0EE 4QOKE 2BC4B 4ZOEA 4QRRA 4P9MH 1X5KA 3EYUH 2VISA 1F5WA 4PPTA 1JPSH 1D5XB 3D3VA 3SDAB 2XXCB 4NN5C 3GIVB 1TQBC 4KAQH 3QEGL 3ILQC 4MAUL 1XF5A 1ZT4A 2UUDK 3FRPA 3QQ9C 4J4PA 2ZNWA 5EA0L 5I1CH 3TJHC 3HMWH 3WFCL 2OTUA 4YFDB 3NIDF 3MBEB 2MKWA 5A2IH 4K7PX 2A74B 1BQHG 5J7CC 4LEXL 1ADQA 4G6JH 1KENH 12E8H 1QSFB 3VGAC 4XP1L 4FOMA 1RZGA 4HUMB 1FRGH 4NZUH 4JQXC 2VXVH 5ELIA 4QRRB 3QCTH 3OB8A 4WI8A 4RMRA 1RSFA 4ODWB 1KLUB 3D3VB 1MRDH 3D69A 1ZT1B 3QFJE 3TPUB 5DEFA 2W9EL 1D9KD 1E4KA 5EU7C 4KKBC 3MNZA 1UG9A 2DQDL 3GJEA 2QTEA 3VFSB 4CMMB 5IBUG 3ZDZE 4PJCF 2HKHH 2YBRB 5IGXH 4LLWB 1DQML 2OTUB 2J5LC 2OP4L 3O9WA 5DHXB 5SWZE 3G5XA 4GKNB 5I6XB 1AC6A 5IB5A 4XPBL 4X4ZA 3IKKA 3QDJE 4JREB 2YRLA 1NCWL 2R1YB 5FGBC 1JWSB 1YEJL 1HYSC 1UWXH 5CUSL 2DOCA 4E42B 4GAFB 1KPRA 3TYFB 5GRJH 1YNTB 1U93B 3G6JE 1U91B 3RWCA 3CFCH 5TE7H 4XGZA 3V4PL 4RWYH 4PLKD 4ZS6D 4Z7WA 3CXHK 3FO1A 5C70A 5EUKB 4RMUA 1DBBL 2V5YA 3MFFA 1RULL 4JFPB 3OJMB 4I13B 1FSKB 3RKDC 1U42A 2IAND 4GMTL 5BXFB 2XTJB 4YHLH 2YUZA 2D7TH 1Z5LA 3I6KA 1CZ8L 1I4FB 4G5ZL 4Z7VE 3PIQA 1JZ6A 5SX4H 3SDYH 4H8WH 1KN4L 4J2XA 3EOTL 3G5XB 1UJTA 3QUXD 1HH6B 4C54A 3U0TA 1OQXA 5I1GH 4OKDA 1NAML 5GSVA 1TIUA 1MFBH 1QSEB 5C0CB 2A9ML 4CRPA 5I73C 5B21A 4CNIA 1QHOA 5JZ7C 5T5FH 2PXYA 2Q76A 1KULA 3IAGC 5DJZB 5CIPH 2V6HA 1QLFB 3HTLX 3FO9A 2IEPA 1FYTE 4LGPB 1HILB 2HJFA 4KRPD 4Z7NF 3DURA 1UZ6E 4IS6A 3IETA 2XZCH 3DO7A 1WFTA 4U6TA 2ZUWA 1J8HD 5DT1H 2VDOL 5DLMH 3SE8H 1T3FB 1UB6B 3FO1B 3ZSSA 2NY4C 4WU5B 4HKJA 3T04D 4HKZA 4Z7WB 2NY7H 4XAWH 1KJVB 3O4OB 3MFFB 3WUZA 1RY7B 1PEZA 2V7HA 5E00A 1QNZL 1ZGLM 2EC9U 3LMJL 3JUZA 5EZOL 1CFSB 3D39E 5FO9A 5KS9F 1MJUL 1FDLL 5GJTL 4QYOB 4FTVD 1CFTB 4RBPK 1MREH 4KXZH 4LIQL 3U0TB 4JRXB 2DKSA 2D03L 4XRCB 5GSVB 5EO9A 4JR9L 3QZWB 1U8NA 2NXZC 2Q76B 5E4EB 4KMTH 1OGAB 3ARBC 4HWZA 2FIKA 2R2CA 2ZG2A 5F7WC 4C56A 1J7VR 4DQOL 2VLRD 1HHJA 4MNHA 4UAOC 4NUGH 2VN4A 4GBXA 1C8PA 4KHTL 2YKLL 4BJLA 4TTDC 3GNMH 4C83A 5D2LA 4IMLB 1CWVA 3FAXA 2VL5A 4XTRC 2BNRE 2EE2A 4M43L 4LVNC 1U6AL 2EDLA 4HKJB 1IGFH 5CJXA 4M93B 1TPXC 4PRAB 4KJPC 4ZMAT 5IHLB 1EIBA 4M1DH 1INQA 1DQLL 4OI8A 3KPSA 4FMFA 3V0WL 1AD0A 5E00B 1F3JA 2GTWB 4RWHA 4HIHA 1OP5H 4YXKL 2HVKB 3EHBD 3HI6L 4R7DB 5D5MF 1R5WA 1A0QL 3EJJX 4DWHA 3UJTL 4JO1L 4DVBA 1YEKH 4L9LC 4P23D 3PV6A 4U3XA 5EO9B 1DFBH 4HKBB 5KZCD 3TV3H 2D4DA 3ZHKA 1A6WL 3MQIA 3NH7L 3RNQB 4ODTH 5ETUA 2VZOA 2AJZA 3OG6B 15C8L 4LLMA 2YSSB 5EU4A 5E2JA 4FQXD 3JTSB 3KLAA 4PJGE 4Y16A 5BVJB 4ERSL 5CS7A 1G7PA 2QHRH 3EGSB 4JGMA 1KLGA 3QYCA 2EDDA 5F7EH 2CXGA 4RFNB 1ZLSH 2JCCE 3HZKB 4HGMA 3WMSA 4U1LA 1JP5A 1OTUC 3GMNA 3GMLA 3KXFA 4FFZH 4X7SL 4BM7A 3V79C 3SOBL 1F8TH 4H0IA 1IKNC 1GC1C 2XZZA 1ZT7B 5I0ZA 4G43B 5B3NA 1AD0B 1KPUA 4L8CB 4PJHA 1F3JB 4OBRA 4MSWB 4FZEH 2ITCB 5IBTL 2L7JA 5C9JA 1GVIA 2W0FB 1JNNH 4QTIH 1FVCB 3QXAB 3DSNA 1J05A 1XGPB 3P40A 1KTRL 3PV6B 2R23A 1XH3A 4D2NA 1UH4A 2A6DA 2R4SL 3MRQB 3FN9A 1QFHA 5B22A 3ARPA 5FOBA 4V1DD 4QRQB 1ZXQA 4IRJA 5EU4B 1F00I 5FFLA 2XQYK 3OZ9H 3TT1H 5GS0H 3CXHJ 5CEZD 4KDTC 4MXQD 2NY0B 3JV6B 1NUNB 3C5ZA 5INDA 1NLDH 1F4WL 4L4JA 3QZWG 4HWBL 3SGEH 1H3PH 1A6AA 4YDIL 3RUGE 2V2WB 1YEGH 3GMNB 3SQBA 4PRPE 4EN3D 2CGRL 1EEZA 5I8OH 2N7BA 4QF1B 2VLKD 3QUKA 2XXMB 4HMCA 4X9BA 3D0VB 5CZKA 1MCHA 1DBJH 2CUMA 4L5FH 1EJOL 2ZCLH 4HXAL 4M9PA 1NJ9A 4RRPA 1IM9A 4XP5H 3VFTA 3BEVB 3MV01 1YNKL 4U6VH 1B9ZA 1CLZH 1TJIH 4NNXB 3U0WH 5D9SA 3T8XA 1ZHKA 1LQSR 2R23B 3E0GA 2A6DB 5FYLL 4YK4C 3V95A 3ULVF 4PLOB 1W2KT 1VEOA 5FOBB 5FO7B 5CIPB 3OWEA 1RIVL 4JJHA 4YHIA 2H1PL 3PDDA 4IRJB 3BE1H 5J13C 4M6NL 3U6RB 4XMKH 4JCLA 3B8YA 3W0WE 4QXUL 5MI0C 3VI3E 1A6AB 2WP3T 2HJLA 1X4ZA 4PJ8C 4UU9A 1A7OL 1CFNB 2H2SD 5F3HB 4KJWC 1EVUA 4YHNB 5T5NF 4P3WA 4WWKD 5GPRA 5L6YL 1JGUL 2DBLH 3IJYB 3WJJA 5SX5K 3N9GL 2OSLB 1F4YL 4R4NC 4URTB 4OLZL 4NP4L 5ENWA 2PETA 1OAXL 1R0AH 4DKFH 3PWUB 3GSQA 1E4XI 3LQZB 4YR6A 4MXVF 1RIHL 3D48R 4RMVA 2VDNL 1CCZA 1YN6B 3BH9A 1GZQB 2IMNA 1PQZB 1G6VK 1LWRA 4HQQL 4LNRA 3QDMB 1ZHKB 3S5LA 5L7XL 3FT2A 3TBWB 5IB1B 1MPAL 4QEGA 4U6YA 3FOMA 4I77L 4GO6B 2Q8BL 1AGDA 3NFNA 4LP5A 5IB4A 5EFIB 2ESVD 5BJTA 4RGOH 4PJEB 4X4ME 4O2CA 2W91A 3O6ML 3VG9C 4O9HL 4DCQA 4R97C 2F53E 4NQEB 4ZNCD 3BISA 2OTPA 2FBJL 4DKAA 4OZIE 4F37F 4PJ9B 5CBAA 5ICXB 4DKEL 1IQWH 1KB9K 5AWNH 1MUJB 2UYLB 1ZVSA 4RMWA 1JF1B 3R06B 5CGTA 4LARH 2R0WH 2ZSVA 1KCVL 3BPLC 2GK2A 2JELH 3B5HA 3WN5C 2RCSL 1YECL 4XNZB 2HFGL 1T6WA 5ENWB 1MCRA 1TJGL 3QJHA 5HYQA 3SCMA 4UT7L 5DK0B 3MLVL 4ZO6A 3GSQB 4TN9A 4IEFB 5I74B 4YR6B 1TETL 4OCYH 4LNRB 4HS3B 2HFEB 3LIZH 3V5HB 4L3CA 4GFTB 4HPOH 4P5KB 4Z7OE 1DVFA 4O2CB 3B2UD 4X7DC 1N6UA 4DCQB 1TCMA 4P57A 1GGUA 4KKLD 1UCBH 3CH8A 4U3CA 4P2RB 3A6CH 3H2WA 5E8OA 4AZ8A 4NHCH 4YNYA 1AXSA 2DJ4A 4DZ8A 3TA3D 2R8SH 4L9DA 1KJMB 4MD5B 4NQCD 2O5ZL 2EXWD 2FLRT 3RGVC 2VDLH 1XF1A 1CVSC 2ZSVB 4K2UH 3NCYS 5CZVH 4ZUVA 1BVKB 3EO1B 4LHUB 1MQ8A 4ETQB 2JJTA 1FVEA 1NBYA 5J6GA 2DJUA 5LQBL 1ZVHA 4UT6H 3VCLB 4XCFH 2AJYH 2P5EB 1HQRA 4DTGH 1HHGA 5E8DL 1XGQA 4LSSL 3U0PA 1JV5A 1J18A 5IB2A 2IPUG 4Z7QF 3QIBD 4U1JA 4XX1G 5EWIL 3HI5H 1AKJD 4PY8J 3REVA 2ERJC 5AZ2H 2FCBA 2DLGA 4M6ML 4Z7UB 1QHPA 3GSVB 3IU4H 4RRPG 4FQ2H 4DVRL 4CU7A 3FQNA 4KK9D 3QIUC 4NQSB 4LLUA 1R3HB 1BGXL 4ZPTB 2DWDA 1O7VA 1R5IA 2Y07H 3DI2B 1NGQH 3PP3K 3R1GL 4PJIB 5FGCE 3SGKA 4NCDA 3RVVD 5HHXL 3ZDZF 1ZA3A 3P9MB 1RUKH 5FHAH 3GSUB 4BKLA 1XCQA 4NJAH 2WINA 2NZIA 3MC0A 2H26B 2ZOKA 1X9QA 1NBYB 1A3LL 1NGZA 1BVZA 2QQQA 3NCCB 5FM5M 4OLXL 3ZKNC 1EZVX 1G84A 1VFBA 3TT3H 5CJBA 1UM5L 3TCXA 5IB2B 3BH8B 3WUWA 4P5TB 1S7QA 4R26L 3MV7A 4Y2DB 3ULSB 1CD0A 1W72A 2X89D 2WV3A 4K8RL 2O5XL 4IIQB 5DJCA 2L7UA 5DMIL 3RVWC 1MHHA 2KPNA 2C4FU 3B2VH 5HDQL 2ZUXA 3UYRL 1A9BB 4WCYL 5DD3H 4CW1B 1D5IH 3F58H 1CTNA 1N3NA 2OZ4A 3S5LG 2UUDH 2HFFA 3CDFA 4FQCL 5D1ZB 5J56B 3T4AB 4Y4KC 1WEJL 4LSPL 2AK4E 3JV5A 1G7IA 1MJJA 1JVKA 2X4TB 2BNQE 4U4BA 5EBMB 1I1FB 2Z93A 1T5WA 2BHZA 2ZJSL 3CDGB 4JZOA 1CDCA 3HNVH 4UB0H 5HPOA 5C0AE 1S9KC 4IRSC 2NW2B 4KROB 4YAQB 4XH2A 1S7QB 1UZ6F 2PO6C 2O61A 4LHUG 2BOCB 4FRWA 2IADA 4JFFB 3I84A 1F6LL 3G6DL 2EDHA 2HH0L 3G5YB 4MNQA 3JWDH 2ED7A 1N5AA 1E27B 2FATL 5DHVB 4LHJB 5D93B 5IIEA 1FVDA 4I18B 4OIBA 4HK0A 1I1YA 5CLTA 1KB9J 1KXQE 4HF5H 3GFUA 4K9EH 3DIFB 3DGCR 3H7BA 4LMQI 4PIRF 3TJEL 4MJ6A 1KFAH 5AYQA 4N0YL 3O41A 3MJ9A 3T0WA 5BS0B 3MA9H 1I7UB 2EIDA 4OLWL 1TCRA 4NC1C 4I9WD 5CAYB 5ID0B 1JIBA 1W8NA 3MV8E 3BSZL 4R96A 1B0GA 4H0GA 3BESR 2ORBH 1I3UA 1OSPL 3SDDD 4OCNC 4LLAA 2X4NA 3P0GB 3OPZL 2PYED 4OZHA 3L3HB 3LKPB 3AUVA 2NX5E 5JOFA 5KSAC 3PWLB 4PRHA 3MLRH 3BYTA 3C5SB 3LKRB 5TGBA 1JZ4A 5DHYB 4CDGC 1A3RL 1A7NL 4JB9H 4FN0A 4H26A 1XAUA 5E70A 2VZ1A 5IIEB 2GIYA 1ZGLA 3IU3B 4APQA 1CQKA 2X5PA 1N8ZB 3FN3A 5L2KE 3ME0A 5CSBA 4KUCD 2FZ3B 1CYGA 2F5BL 2W9DL 3DHMA 4PGJA 1K4DA 2FEEI 4YJZL 1LO0L 1IC5H 3VFOA 5E9DE 3T0EA 4QOKA 1V7MH 2DM4A 1P69B 3EAKA 1T1YB 3U9PL 4AT6A 1L7TH 1MVUA 2NY2B 1MCKA 4FG6C 1FQ9C 2OM5A 3CXDH 4L8SC 5DFWH 5FM4A 4ZAKD 4Z5RB 5LBSH 5DVKA 1LK3H 1R24A 1VGEH 1WBYA 2X4NB 5IB3B 2LU3A 4OFKA 2WMPA 4PJGF 2FIRT 1HHIB 1JI1A 2P43B 4RZCB 4Q0XH 1K6QL 4MXWL 5GQBA 5IVOA 2H2SC 2JCCF 2PTUA 4PJDE 1DN0B 3JXAA 1BZ7A 3A6BH 3DGGA 4DOHE 1A6VH 1FNAA 1ZEAL 5E0QA 1N2RB 4APQB 1MWAH 3FL7A 5ALBL 3DBXB 3O0RH 1L4IA 3P4LA 4HC1H 4NRZA 2VQ1B 3QDGB 3GKWL 1CXEA 3EJYD 1MIMH 5D7LB 3LN5B 3JV4A 3PL6D 3VFOB 3GIZL 3RVUC 1KC5H 3QWOB 3FMGL 5DQDH 3C2AL 5F7FA 4AIZB 2VDKH 1DBML 3O4LB 2AJSL 3PGCA 4PRIE 3V4VH 2DQCL 2CUHA 2YRZA 4RBPH 3CK0L 3NCJH 4OF7A 1S5IL 3QUZD 4LQFH 4NQXA 5CBEA 4LEOA 2NW3A 4OUUB 3TLRA 5MP6L 1Y6KR 1R24B 4MAYA 5MEND 3KPRE 2OJZH 1VESA 2W59A 1KCUH 2EH7H 1ZGLP 5SWZA 5M95B 1BZ7B 1U3HB 3O11A 3DMMC 1BFVH 5DVNA 4A6YH 3HE7D 3AU1B 3H42H 5CHNA 4R4FH 5HGHA 1H5BA 3QDJA 3MYJB 3K80A 4IBLT 2AGJH 1KTDA 1I7TB 3GO1H 3VRLF 2P8MB 5F8QC 4G8GB 3SJVE 3A0OA 3EFFA 4KQ4H 3G6JA 1RU9H 4TUOA 2WIIB 4G80B 2B5IB 2XWJB 2CMRH 3BAEH 5JLZA 4KK5D 4GRLC 4Y19E 1V3LA 3O3AA 4IOFC 3MLXH 2VE6A 3VXSE 2VUYA 4MAYB 4N1CA 4KKLC 5IMLA 1SMAA 2WSKA 4X80L 1S3KL 4JJ5B 3S34H 4DUVA 3VW3H 5F96H 2AW2A 2QSTA 2XZAL 4JFZH 5BMFL 1M7DB 3FCTA 1I9JL 5C0EA 4Z7VA 3VI3F 3IT8D 2YD7A 3BKJL 4JZJC 3O11B 5EOTB 4K23H 1F2QA 4DGVL 5LWYL 3KPPB 1QEWB 1AGFA 4OZGE 4TUKH 3AVEA 5CHNB 5EORH 3VMPA 5FO8B 5HYIA 1J86A 3TCLA 3IFNH 4U1MA 1H5BB 5J89A 3HCVB 4QHKI 1IC7L 1KTDB 1LK2A 1WWWX 1HNGA 3SDXB 5KJRH 4RDQG 4PLJD 5IHZB 1FYTA 4OIAA 1QFWM 4JPIA 3UPRB 3BKML 3BGFB 8FABA 4Z77A 4M61B 1Y0LB 4UT9H 3MV11 4G9DA 4NFDA 1CGUA 3VGEA 3LH2L 2OL3H 4JRYA 1G9MH 1T5XA 4F2MB 1MFDL 3O3AB 2FX8L 5D1QD 2BRRL 4JO4L 4XNUL 2VE6B 4P4KA 5T3XD 3BD3A 4L8BA 4JDTL 3RVVC 5E5UB 2BXZA 2NY3D 3CU1A 1A9EA 3VMOA 3VWKA 4O51A 3W2DH 1CE1H 1UKSA 3D39A 1JUFA 1MIEL 3TWCL 4GRWE 4OZIF 2JB6A 2FJFB 3HLAB 1R3IH 1NGWA 4M6AA 1J1PL 1T22A 3IDYC 1OHQA 5AYUL 3CMOL 4YC2B 4R0LB 5HHOA 4EEEA 4PBVC 3CVHL 1HHHA 2X1XR 3VXUD 3TCLB 4I0PA 4DZBB 1I7ZB 1WZ1H 2FGZA 4U1IA 2CLVA 4OJFH 5C09B 3D25A 1IGCH 5I1LB 4AIXA 1B90A 4DJMA 3SGJA 1YYMH 2CK0H 5T1LA 1TZHA 2ICWJ 4LGSB 5IFAL 1A7QL 1NDMA 2IGFH 3QG7H 4M1CC 1U8OA 2C26A 2NZ9D 1JZ3A 1I3GL 2BNRA 1XMWA 3B9EA 3L3KB 3GSRB 4JRYB 1X7QB 1T5XB 4EQ3A 1KB5L 3BDBA 1X44A 2FL5A 2FSEA 9CGTA 1HOCB 4P4KB 2XN9A 4W81A 5JPMA 5CEYB 4Z7OF 2ADGB 2BERA 3BN9D 5HI5C 3HNSL 1A9EB 1QRND 1AGEA 3VWKB 1S7WB 3TZVD 2I25N 1NCAL 1JUFB 4HJGB 3EOBB 3P77A 5EBWA 2JB6B 5C6TL 5K9QG 5LXGL 3VXRE 1Z0MA 1TDQA 3QQ4B 1HN1A 1CXHA 1INDH 3GBNL 5HHOB 1KIQB 1MWAB 1JNJA 5GGRA 1M4KA 1YZZA 4NRYB 5C08B 4I0PB 3CFBB 3G04A 1TNMA 4U1IB 2CLVB 3U79A 5F1KC 4Y4FD 1KOAA 3HKFA 3MCG1 1J88A 1XR8B 5DJ0A 4K71C 4PJGA 4W70A 5T1LB 2HT3D 1BM3H 4UIKH 4WNQA 4X9GA 1NDMB 1AP2A 3N0PB 1YPZE 2JCCA 1PBYA 4PREB 5ACLA 3RIAK 2EIZA 2Z31A 1ZHBA 2ADJB 1FO0L 3UTSE 2FL5B 1B0RA 1EGJL 2XN9B 1JHKL 1TXKA 4YBLB 3U7WL 3D85A 1OQOA 3T65B 1AGEB 4JFXB 5BV7L 2DIJA 1CFBA 1BF2A 2DTML 4ZTPH 1UXWB 2VLJA 5CSZB 3WCYA 3P77B 4ZO9A 5LJYH 3BZ4A 1CFVL 3PDOB 1FORH 3PGFH 4Q6IC 2V9QA 3Q6FB 4X5XA 4K94C 5EU3A 5FYJE 2IG2H 4H1LH 3UAJC 2CKBH 5ACMA 4A6YB 1W0WB 3MXWH 5GGRB 4GT7A 4XVJH 3SDDC 3G04B 1OARH 1TZIB 4NPYB 1FL5A 4GKOA 2UVEA 1XCTB 1HSBA 3MRLA 3U4BH 3TYGL 4PUBH 3O8XA 5I1HL 2GJ6D 2HA1A 2F19H 1PLGL 2JJUA 3D0LB 1R3LA 5ESAA 3WFDH 3BP6A 5DO2D 4DEPB 4ZUSB 2OL3A 3IDXH 1ZS8B 4UNUA 4ZFOL 3ALPA 1NGXA 3HB3C 2EO1A 4JN1H 2EIZB 5H94A 4AM0A 4BQ6A 3RUGA 2I60L 4PRPA 5TDNA 2QSVA 3NMEA 5IF0A 4Q9QL 2X10A 2P7TA 1FJ1A 2ADFL 4NNPH 3UYOD 1VDGA 2E6PA 3QIWC 3BT2H 2VLJB 4RA0C 1D5BA 2Q1EA 3B9KD 3FFCB 3VXQB 1U2HA 3TPKA 1LO5A 4XNYL 3S4SB 4X5XB 4XHJC 4F58L 2V2XA 1ZSDB 1C7SA 3QHZH 1DUYA 3B3IB 1IL1A 2DB8A 4OGZA 4X6CE 5EU6A 2HT4D 1FL5B 2F74A 1MCQA 4XNXL 1D6EB 5K9KA 3TBVB 1JFQH 1HKFA 3O8XB 5CEXA 2VDQH 1QR4A 2WBJB 3ARSA 1J0IA 4WUUE 3QEUA 5KG9A 3BP6B 4KZDH 2OL3B 3W0WA 3BKCH 2J6EL 1RZIB 1NGXB 2RFXB 2XRAH 4PRBB 4LKXA 4AEIL 4WI2A 1PSKL 2D7PA 4WW1B 2J7LA 4XPAH 3OL2A 2P7TB 5AG9A 4D0CA 3QEQB 3T2QA 1C1EH 3PNWB 4HKXB 5IEHA 1KJ3L 3V52L 5DFVD 3UO1L 5DWUH 1FCCA 3PP3H 3KYKL 3L5XL 4NZRH 3ARGC 2I9TB 5KVDH 2V2XB 4YDLC 2I24N 3PE9A 4UV4H 4YO0B 1OAUH 1IL1B 4OCWH 5E2TL 4UILL 4G8GE 4ODVH 4Z0XB 2CO7B 1HWHB 4PYHA 1UM4L 5EU6B 1EPFA 2H32B 2DLFL 2F74B 5L8LB 2E3VA 4LDEB 3K4AA 5DR5H 4LCIH 5E2VL 5F6IB 1PVHA 1NFIA 5FKAB 4X4MA 5IHUH 1FNEA 5DJ2B 3IJSA 3EDDA 3OHXB 1YMME 5ID1A 4O02L 4S1DC 1BLNA 3RWDA 1Z3GL 2E7BA 3DV4A 5D7IB 3FRUA 1A22B 2OJEB 2XACC 3BPOC 3HE7C 3HMXL 3MV9D 2MTPA 2QADD 1PEWA 1OAYL 3TVMC 3T4YA 3ARYA 1UM6H 2EDBA 1WC7A 2BVQA 1OAQH 2KH2B 3K81A 4R8WH 3U2SA 1NAKH 4OLVH 1NCBH 5GGTA 4POYA 2D3VA 4IOSD 3VXME 5EUOE 4MB4A 1XIWC 5TH2A 1GSMA 1LP9E 4H1LA 4LKCA 5BV7C 4MVBC 4AH2B 4L4VD 4RFOL 1HCVA 1SBSL 2ESVE 1TQBB 1DBKL 1CLCA 4G8FA 2G75A 2YD5A 1CS6A 1MFCL 5FGRA 3ECBA 5INCB 3WEXB 5KTEH 2F9BT 1ES0B 5JMRA 1DE4A 2MQ0A 3SE3C 2YD1A 5K93A 2PW1B 5ID1B 1J10A 4OLUL 1BLNB 1FPTH 2YPLD 4X9IA 4PJEF 4ELKA 4GSDL 1J0KA 3D2UB 1JBJA 2AEQL 3PJSB 5LCVL 4PJDF 5SV4A 1NANI 4I48A 4Y1AE 4JPVL 3MOBH 4AEHL 2FGWL 3Q1SH 4TOYL 3T4YB 1RZFH 5EN2B 1OM3H 3MR9A 5DRZA 3VGAB 1OPGH 2EYSA 2CO6B 4PLJC 3U83A 4W6YB 1NFDA 4FQHB 3V0VB 4Z8FH 4M3KB 3C9NB 4M5YH 5EZIH 4BZ2H 1L9NA 5F7UA 1NKRA 5JW3L 2L0DA 5GGQH 4XCYA 3UEZA 1FN4B 5E8EB 4H1LB 2CKBB 3WFBL 1KF9B 5C09E 3BWAA 5FYKD 3M8OL 2VAJA 5JDSA 2CDEA 3TO4D 3ZKXC 4F80A 2FO4B 2P5WE 1U3YA 5BRZA 1BD2E 1B2WL 1M1SA 1CDGA 1X4YA 2QL1A 4JVUA 5J12B 2XQYG 1GC1H 2HTLC 3W39A 3AB0C 4LRIA 4OT1H 4G6FB 5IJKC 5FYKU 3TH3T 1NC4A 5C07D 1WWCA 3O6KL 5DS8B 3GMRB 1FL6B 5DJXA 3O2DH 4U1SA 2VLLB 5FYLD 1DR9A 4FS0A 4I48B 3MLYH 2JB5H 5DURD 1A7PH 2NXYB 1FNFA 3D9AH 3LHPH 1SJHB 3VWJC 2XOTA 3MRRA 4FHBD 4RMSA 3QXDA 5F72S 4X5LA 2RAMA 1NFDB 4JPWL 1XZ0A 1J9CT 4Y8DC 1HDMA 4ZXBC 2WUBH 4UNTA 4QXWA 2AXGB 4XCYB 2DQIL 2V5SA 2NZ9C 2GSGB 4GW4B 2E6QA 1U8KA 3BWAB 1CGSH 2G60H 4P2OA 2CDEB 2D7NA 5I30L 4IMKA 1C7TA 5BRZB 3IFOB 5CMAB 3KPQA 1CF8H 5C1MB 5IWLA 3QP3A 3FB5A 3WFEH 1K8DA 4M4RA 1JHLL 5ADOH 1PZ5B 1MY5A 3W39B 1NMCC 5DD0H 5I76A 3DROA 1H3TA 3TZVC 3DX9B 4Z7UF 2C1PA 3CFJA 1NC4B 5MHSE 3HR5A 3HUJB 1I1AC 1AC0A 3OMZA 2NY5H 3VD4A 3T77A 1OTTD 3JVGA 3DV6A 5ICYA 2AK4A 1AD9B 3PWPE 2BNQA 5F7MC 2PR4L 1KIUA 1OGTA 5I73B 5C0FB 4OZGF 4Q2ZA 5ALCL 5FHBL 1RUPH 2ICEA 2QKIB 1IRAY 4XWGL 5C0AA 3V5KA 4MQXC 1HDMB 1SJEB 1B0WA 2VXUH 4MD4A 5AUMB 1YEHL 3O45A 5HGDA 3EYQD 3ULUC 1S8DB 3F5WB 2NY4B 3L5IA 3U9UA 3OGCA 4RQQA 4Q7DA 1I8LA 3KPQB 3BKYL 1P7QD 3PGDB 3SKMA 5DMJB 2R39A 2GK0A 1SYSA 3O9WD 2ITDA 3DOSA 1JF5A 1NSNL 5DJYB 4FABL 4H1LG 1ZTXL 3CFJB 3DVFA 5E95B 3OKKA 1VERA 2R0KL 3HR5B 5D70H 4B41A 2IALA 5J9PB 1LEKA 3BVNB 3LKQB 2KZ1B 4FQIL 2XIDA 3ZE1F 2N56A 1OGTB 1Q9LB 2NXZB 3B8SA 1QG3A 1BOGA 3MV8A 3KYOA 3SPVA 2IAMA 1ORQB 5DSCA 3VFPB 4DGYH 5FUOL 2OBGA 35C8H 4NO5A 2ICEB 4UAOB 4M7KH 3CZFB 2UVFA 3ARFC 4QRTA 4YBQD 2EE3A 4QRPD 4EUPA 1JZ2A 3PHOB 5F70A 4NQVB 2DDQL 2NX5A 3O45B 3GGWA 1J87A 4OZ4A 5HVGB 3ZZ1A 4DAGL 2EKJA 3RTQA 3U9UB 5HI3D 5H2BB 1TPXB 5FCSH 3RL2A 2GK0B 3VGFA 1W0VA 1BEYL 1T66D 4YPGB 2EE6A 2I07A 5L2KA 2K7QA 4EDWL 4ZFGH 3W11C 4LCCC 4YGVB 4FZ8H 2ATKA 1A4KA 4G8IA 4I9WE 3CUPA 3O2DA 4L1HA 5E9DA 1JPFA 4U1NA 5GRVL 5ESQA 3RL1A 4JM4H 2BCKB 2IALB 5DJ8A 1LEKB 4UTBH 2R4RH 1SQ2N 4Z78A 4YXHL 2RR3A 5MERA 2QSCL 2HN7A 1MI5D 1RZ7L 2A6KA 1Q9OB 4JM2C 2ZUQC 3M07A 1BX2A 4RGNC 4NDMA 4CJ1A 4NT6A 2VQUA 4QRTB 4FMKA 2LTQC 3GI9L 1A8JH 4PJFE 4LU5H 1OW0C 4EI5C 3IDIB 1YEIH 2XKNA 4Z9KB 3IDMB 1CU4L 4WO4C 3RWFB 1TJHH 4PJDA 2C7UB 4WW2A 5F9OL 4DGIH 1U8HA 4S1QH 3QA3B 4A2MA 1EUUA 2HG5A 3U7YH 3DJ9A 2DICA 1IAKB 2FYYA 3HC0A 4FQ1H 4M1GL 1MELA 4XPGH 4GAJL 2QQKH 2VXQH 4RFEA 4U1NB 4J23A 4RMTA 1G7MA 4K8RD 4YX2H 4C56D 4G9FB 5H35A 4JG1H 5T3ZD 1YMHB 4GBXD 5I18H 1CIUA 5GS1B 4PRIA 1CXKA 3GKZA 2HN7B 4ELME 5C0BD 1ADQL 1C08A 4BH7B 2A6KB 1P5UA 5KAQG 1OAKH 3RHWF 1QBMH 2B0SL 3TBYA 4BSWB 1Q0XH 3C6SA 5GZOC 5D6CA 5JORA 3U1SH 3QXVA 5B8CB 1ZLUH 1F4HA 4LASL 3T2OA 2C3VB 1IGIL 3KPSD 5DC9B 2YPVH 3E2HB 2ZUSA 5FECB 1CK0L 4HIJA 2FWOA 4WW2B 1P5VA 1N0XH 1LO3H 4EBQH 2BNUB 3CU7A 2HG5B 3KAAA 4MNGA 4MB5A 1EEYB 2RB8A 4LSTL 3HC0B 4OGXL 4RFEB 5ICZB 1G7MB 4J6RL 3P0VL 3I85A 2OCFD 3SJVA 5H35B 4HFWB 3IFPA 1WBZB 4Y16D 1V3JA 1EO8H 3H3KA 2J88H 4I3RL 4M7JL 1BBJA 4LSUH 5DUPL 4Y19A 1A3QA 4X6CF 5JXEC 4EOWL 3TIDA 5T33L 2WAHA 2WQ8A 1UJ3C 5I1IL 4GKZB 5EU7E 3RVXD 3PQYE 3KXFD 1NEZA 3AS1A 5C86A 3OJDA 1MRCL 3W82A 1RZJH 4R3SA 5A2KH 2Z91A 5GRXG 4TSAL 2SEBA 3ZTNL 5KSUA 4LLQA 5F1IA 1FLTX 4F9PA 4HBCH 5B3JE 2D31A 2MOVA 2QV2A 1IGTB 4OZGA 2Y72A 3O2VL 4HGKC 4MNGB 4WHDA 5MEPA 3V4UL 1FZOA 4PD4J 3CFIC 1F97A 2WUCL 1QKZL 3QNZB 4UINL 2EDKA 1XGYL 1IFHH 2XA8H 3B6SB 3BWUC 2X6MA 5IOPA 1D9KB 3FONB 4XP4L 1BZ9A 5EO1A 3BI9X 3C5ZD 3H9ZA 4Y5YA 4X7TB 4TSCH 2OMBA 3PUCA 3TIDB 5A43C 3DYMA 2VZSA 4Y4HA 2YA0A 4ORZC 3STLA 4X7CC 5DMKA 2CJUH 3EYUL 4HWEH 3VFNB 1F3DJ 2W60A 4L3ED 3QUXA 1JPSL 1CN4A 1QR1B 4NHUB 1S9XA 3LPFA 4M8QA 3K4DA 3WLBB 5EC1A 5CZXC 1IM9D 1SJXA 2SEBB 4LLQB 1IT9H 4KAQL 3HC3H 4POZD 2H2PC 2FX9H 1BREA 3B5GA 3CPLB 1RK1A 2EEDA 5CJOH 3RWJA 5CEZH 5I1CL 3M17B 4DN3H 1J8HA 2BHUA 5EUOF 2EICA 1FZMB 4J4PC 3VFVB 4LLDA 3TNMB 3KYMA 5T3XE 2BRQA 1HXMA 1IJ9A 5B38B 2VABA 5IR1A 1KENL 3VH8A 1FFRA 2IANB 12E8L 4IRZH 4U49A 3RIFK 1N59A 2NTSP 1G7QA 1ED3A 1FHGA 3INUH 1FRGL 1QO3A 4DN4H 4NZUL 5DMKB 1CDHA 4GJTB 3QCTL 4NM8H 3S36H 4P46D 3IS1X 3OAUL 1S9XB 5I1EH 4M8QB 5KSVB 2NLJA 1HQ4A 3VXUE 3VXRA 3UZEA 4U2YA 3CSBA 1ONQB 3NCEB 3RWGA 2PTTA 1BVLB 4X7FC 2E7MA 3DI3B 2MJWA 4KRPB 4X6BA 1E4KC 3GSOA 4ONFL 3RWJB 3V8CA 4QCIA 5IGXL 2VH5H 2XNAB 5E5RB 3MCKA 5LGHH 1R6VA 1J8HB 3KR3H 4UBDD 4U33A 3DYPA 2ERJB 3TBTA 2LU4A 2MCPH 2XTJC 5KANI 1AFVH 3C8KB 2IFFH 1HXMB 1YPZA 3FB6A 2DYPD 2B1AL 1G7QB 2VDRL 4OFVA 4GAYA 5DA4A 2W0KA 3GJFK 4S2SB 1S9YA 3LV3A 4FTVB 4F8TA 2NYYD 5HPMB 3KJ6H 3CFCL 2E9IA 3QWQB 2CR3A 3EJZC 4RWYL 1NDGA 5I8CB 5I15H 3RJQB 3HZMA 3RU8L 4JKPH 4N8VA 2UWEB 5F97E 2AKRA 4JRWA 5GSRB 2VLRB 3ZE2F 4X6BB 4YHLL 1SEBA 2D7TL 3ELAT 4QCIB 3MCKB 2IPTH 3O4OC 1IQDA 3NPZB 3SDYL 4H8WL 1FNHA 4BFGA 1T03H 4C55A 4PV8A 1DVFD 1OB1B 2D0HA 4L29A 4WU7B 5CD3A 5I1GL 1TQCB 5IG7B 1MFBL 1T83C 4YIQA 2DWEA 2GT9B 5T5FL 1LEIA 1GZPA 4MJIE 5DK3A 2ZPKH 3HI1B 1J0YA 4BSJA 4GAYB 3DX6B 5HHMD 3C5JA 2F8VA 4X6DA 5F7HA 2E7CA 2PXYC 2XZCL 4NKOB 3NZHL 4Y4KB 5TE6H 3OXSB 4O2FB 3BPCA 1BAFH 1BP3B 1RHHA 4P23B 5B38G 5DT1L 5I8KL 5DLML 1TENA 3SE8L 1NDGB 5KZCB 3VFGH 1CI5A 4N8VB 2CQVA 2NY7L 4MZ3A 4OLEA 1B4JH 4XAWL 1EXUA 4V1DA 3MRGA 3L7EB 2X1QA 4FQXB 4GW5A 2UZIH 4NKDB 4WFED 4Y88A 1JGEA 4X6CA 1SEBB 4KTDH 4G9FE 5FDWA 5D7KD 4QY8B 4M93C 2V7NB 1RAMA 1HI6A 1AR1D 2PO6B 1Z9MA 1D7FA 2YD6A 3QB7C 5C3TA 1U8JB 1YA5A 2YWYA 4S0TD 4EN3A 1OY3B 4MQ7B 3WNNA 2D2OA 1YJDH 2E7HA 2HWZL 4JAMA 4R2GD 4HDIB 1GZPB 2VXSH 4X99A 2AJXH 4RGMB 4KK6C 1TVDA 3C5JB 4NUGL 3K8LA 2Q20A 4X6DB 2PYFA 1TTFA 2RHEA 3I6GB 2YOCA 1KNOA 4NOFA 5IQ7H 4ZUUA 2BSTA 3JWOH 1CDIA 3WS6C 1IGFL 1HH9A 3QG6A 1X5JA 4V1DB 1D6VH 4W4OA 1FAIH 4XVUC 4M1DL 1F11A 3MV7D 3VFWA 4PYGA 3AMKA 5FDWB 2EIBA 3B9VA 3AREA 5CJXC 4LIQE 1FNGA 3G5VB 2AXFA 2VZTA 2Z8SA 5DEGB 4OM0L 2XWBB 1D5ZB 3SKOA 1YMMA 2EDWA 3FZUD 2X4PA 3RX5A 1O7SA 3FHQA 2VLKB 4WWKA 1DFBL 3TV3L 4K3JH 3UROR 3QULB 4D9LH 3W81A 4MCZA 4ODTL 3BGAA 1U8PA 2XFXA 2VDMH 4F57H 4JFEE 4TTGA 4X4XB 2QHRL 5T1KA 3KDMA 1X5HA 5F7EL 3ULVD 4X98A 1ZLSL 2C3WA 3VXMA 1HXYA 3MA7A 2YD8A 4JG0L 1LP9A 2BSTB 3KPOA 5JOPD 1HH9B 5JW5B 3QG6B 3RY6A 2B2XH 2ESVA 1F8TL 4PG2A 1T0NB 1J0ZA 3L95A 5A3ID 2EXYD 1BIIB 4LDOB 5DD5H 4RAVB 4FZEL 4F15B 5J3HC 1HIMH 4KRMB 1JNNL 3ARDD 1CD1A 4QTIL 4N8VG 4BUGA 3SKOB 4KHXH 5SWSE 4NOBA 5L8JB 3DXAE 4PJ7A 4J3VA 3BGMB 4H8WC 3UJJH 1FG9C 1J1OH 3HG1E 2XFXB 3CAFA 3PDGA 4NQDB 1E4XH 2HT2C 3VFUA 3GRWH 1FFQA 1P9MA 1FL3A 4RSVA 3FO2A 1CGXA 1AJ7H 4HS8H 4H20H 4K3EH 5D7IF 3R8BB 3TT1L 5GS0L 3DPBA 2MSPA 2V9RA 3BHBA 3NCMA 3V5DB 1QVOA 3SDCA 2EH8H 3KDMB 4WUKL 5ERWA 3WFHB 4XPTH 4PP2B 1NLDL 4WFGE 4IRJC 4X9HA 4AIOA 1JN6B 2F5AH 1MEXH 5KVEH 5I8OL 1P2CA 1NMAH 1DBJL 4L5FL 1ZHLB 2A9NH 2ZCLL 4G3YH 3GMPB 4P3CL 5F9JA 3MROA 4XP5L 3SKUD 1EFXA 1EHAA 1T04A 3MLPA 4U6VL 1LO4H 1NBVH 3OKDA 3U0WL 4LPUA 3QUYA 4NQCA 5JNYB 3PP4H 3OXRA 4PJ7B 3N1PC 3NA4A 1CDJA 1CGWA 3LKSB 4CBPA 3HPJB 4BQCA 3UC0H 1YY9D 4UQ2A 4CN4A 1NCDH 3T0ED 3HE6D 4N0FA 1JWUA 4QOKD 2Y5TB 4UTAH 3BE1L 4GMSH 3D6GA 1MLBA 4XMKL 2WANA 3E3QC 3O81A 1QLRA 2HLAA 3UDWC 3QIBA 2BMKA 3SKNB 1DQDH 1AKJA 1IARB 3MRIB 3CGTA 3IDGA 3V6BR 4LPYA 4LDLB 3EDEA 1JNHA 3VFRA 4YHMH 4QHKJ 4TQEH 5C0DA 4FXKB 4PV9B 5F9JB 4DKFL 5EOQH 2OI9C 3BD5A 5F8RC 1GGTA 2Z4QB 3WJJC 1MCNA 3TA3B 1WLHA 4XNZC 3FFDA 2GJZB 4M62H 4NQCB 5FYLE 2R0LL 2IQ9H 1DDHB 3BDYH 1L6ZA 5I74C 3WKNA 1JK8A 3BO8B 1CD8A 3PWPA 1JWUB 1V3MA 4YHOH 1ZA6A 4RAUA 1MLBB 4NN6C 5B3JF 5J4MA 1G6RA 2JLLA 1RIUH 2HRPH 1ACYH 2HLAB 3QFJD 3IRPX 3GMQA 2B7DT 2F58H 1UWEH 3QIBB 1U9KA 3TIEB 3WIIH 1CL7I 1VFMA 2A6JA 4UBDC 5ACZB 2EE9A 1FC2D 2JE8A 4XC3L 2X89A 3UTZA 1IQWL 3WSQH 2R0WL 3K3QA 3RZWA 3VFRB 4N9GA 1KTLA 2P8LA 4XWOD 4PJ5D 5C0DB 4OV5A 1DBAH 2DQGH 1OF2A 1UA6H 4I0CC 1I9RH 1ROWA 4NO2B 4IOIB 4NO0D 4ORGA 4NKQB 3HS0A 2PTVA 3ZDYE 1JPGA 5IK3A 4OCYL 4XCEA 1BHGA 4UZGA 2QR0B 3SCMC 1FNSH 4UUJB 5D6DA 5DD1H 1U8LA 5I2IB 1JK8B 2OK0H 2EDFA 2DD8L 4ODSH 3GRWA 2GY7B 1G9NL 4RAUB 1FFPA 4OCLC 3KPNA 4EDXB 1WAAF 3VFMA 3W5NA 1UCBL 4QT5B 1FH5H 3A6CL 5FYJL 1F6AB 3HZVB 4NHCL 5IMOB 3LQMA 2R8SL 1UVQB 4MQTB 3V6OC 1GAFH 4KI5C 3OR7B 3WS3A 2R2BB 2VDLL 5CZVL 4K2UL 5IUSA 4X9FA 4G42A 3O6FD 2YN3A 2ICES 5CFHA 5EH1A 5D7JA 5DUBA 4PFEA 1RZKL 3RI5K 4UT6L 2AJYL 2XPGB 5ADPL 2JJTC 1OSZA 4W4NA 1RJZA 4LSVL 1T1ZA 2BOBB 5CLWA 5IK3B 3T2NH 1JGDB 4WV1A 2X4OB 3HI5L 3AMLA 2APFA 3TH4T 2XWTB 5AZ2L 4F33B 1U8LB 3MOAL 4JLRA 1KCKA 4FQ2L 3FTGA 4L4TE 2VRAA 4MX7A 1FYTD 4PTUA 2Q6WA 4Y2DC 2AABL 2CIKA 2Y07L 1A1OA 1NGQL 2RGSA 3KPNB 4HJ0C 4NC1E 5HJ3B 1U8QA 1RUKL 1QFUH 5FHAL 1P7KA 3OG4B 4X83A 4CMHB 5KOMC 5CINL 4QRUA 4NJAL 3SGKC 2R9HD 1YEDB 4PJFA 3RQ3A 3ARUA 3O6LL 1OOAA 3CFEA 5D1ZC 4XMPH 3KYAA 4PRDB 1CXFA 3D39D 5F7YC 1CICA 4XP6H 1A1NB 3PWJB 5DUBB 2HRLA 4AYFA 1P4IH 3IDJA 5I19H 1T89A 3TT3L 1QFPA 5I17B 3ZMRA 5HTSA 8CGTA 4WV1B 2PW2B 3IKCB 3FT3B 3L3IA 2V2TA 4JQIH 4ODUA 5LAXA 3QHFH 4KROC 4MA8H 5AD0B 4MX7B 4PTUB 2WBKA 3SDDB 2DQFA 2Y23A 5T3XH 3QUMH 2DBJA 4ELMA 2I9LA 1H8SA 2OQJB 2PYEB 5DD3L 3RWEB 1D5IL 3HPLA 3SQOH 2BNRD 5B39A 4XBGA 5D93C 1S9WB 3BEWB 4GQ9H 5HGBB 2YD9A 3FN0H 3MRFB 3IF1B 2KDGA 5GGSB 1MCEA 4JFHD 3STZA 3NTCL 2X4QB 3OKOA 5CKGA 4HIEB 5I66A 1AIFB 1P1ZB 3QEGH 4JN2B 3HNVL 2H3NA 1Z9SA 1T20A 5E6ID 4X4YA 1U92B 4X6EB 5JW4N 4LCYA 5EA0H 1KEGH 2DI9A 3QIWB 3VJ6A 1RJYA 3CFDA 4OF5A 5L8KB 4CVXA 3DRTB 3MLZL 5JHLH 4HIXH 5FK9B 4KMQA 5EZLA 3W9EA 4QHUB 1IC4H 5LAXB 5C0BE 5E08H 3VG0L 3CCHA 3QUZA 3JWDL 2Q8AH 3HZYA 4ZAKB 3JUYA 3AXLA 4BQ8A 4N8CH 5DFTA 1QYGH 5EU5B 5BOZG 3CX5K 3ZKQD 4HF5L 1BFTA 4XP1H 5EBLA 3DNKA 4XBGB 4LCWE 1I8KA 1S5HA 3MNWB 2Z31D 3WV0A 1A1MA 5E24E 2BVOB 4HS6B 1VACA 2QBWA 2CKNA 3RVTD 3DRQA 2B20A 1WQVT 5E1HB 5KVGH 2DQDH 3GSXA 5E7BA 4OCRH 1CT8A 1XGUB 1P4LA 3P4MA 5FM5O 3IVKB 4X4YB 3PL6B 3P73A 1S7XB 2NY2C 3E6HB 5KSBE 3MRPA 1ZHNB 5GRYA 3PABA 2Z8RA 3WFZA 2CPCA 3O3DB 3SO5A 3GJFH 4OCSH 1DL7H 3ARGB 5FGBA 5FUZL 3KPTA 4JB9L 4YDLB 3NIDE 1G0YR 3HZYB 3NABH 1IEHA 3DYOA 2CDFA 3LKOA 5MENB 1NCWH 1Q8MA 4PGEA 1DANT 1N4XL 2R1XA 1NUDA 4M6OH 5CUSH 5CCKH 3ARRA 3IXAA 1WBXB 4APQC 3ILPA 4PRPD 1V7ML 1JRHI 1CIDA 4FQJH 1GHFH 3OV6A 4CVZB 1L7TL 2NPLX 3MBED 5GZNC 3BPOB 3HE7B 2D9QB 4TULH 2OLDA 2R2HA 2QEJA 3CXDL 1NBZB 3TVMB 4LF3B 1RULH 1P4LB 1YEFH 3PXJA 1VGEL 2BVUA 1GGBH 3K8MA 2RIKA 5ESVB 4P2QB 2AI0H 3IJHB 4G5ZH 4X8XA 1EZVY 3PABB 4PGDB 4YDJB 4LLVA 4BELD 1A5FL 4NQTA 4PJCE 1Q72H 5GRWA 4OFDA 3BJ91 3SBWC 3P4NA 1WZKA 3A6BL 4HUUA 5D1QA 1A6VL 1A7RH 1MWAL 1F3RB 1U0QA 3O0RL 4HC1L 3L6FB 1F58H 5MEQA 5I71B 3W0WD 4NWUH 4N0UB 4L3EE 3T0XA 1L7IL 1U3HC 1MIML 2GAZA 2GJJA 3DUUB 2J8UB 3BP4A 4QWWD 5IBLD 5DGRA 4P9HC 1IGJB 5CD5D 5DQDL 2EDNA 3QH3A 3V6ZA 4PB9H 4LGRB 2OMNA 4LHQB 2AS5M 4X0KB 4LSQL 3V4VL 4OZFB 3L9RB 4LPWA 4GOSA 4LQFL 3T3PE 3VXUA 4E0RB 1H15A 3WO4B 3LN4A 2ENSA 2YD2A 4LPTA 4YBHA 5IVXE 2GSIB 2B5IC 3DSFH 4WHTA 2ZSWA 2GTZA 4I2XB 5FB8B 1T2QH 2OJZL 1XF4B 3LEVH 5GJTH 1QSZA 1KCUL 4LLVB 5C0NC 4BA8A 1OP5K 4MAYC 7FABL 2EH7L 5I1DA 3ARBA 4LIQH 5FV2A 2CIIB 2CDGA 4GUPA 5D1QB 5CP7A 3ZKXB 1BFVL 4A6YL 4D0DB 4CU6A 3QUMB 3H42L 4R4FL 2F53D 3F7QA 4TNVK 4ZSOE 4HIIB 2FDBP 3JWDC 2NY3B 3GBMH 5EBGA 1DLHB 1QRNA 3GO1L 5BZDA 2GAZB 3PG2A 3X13B 3ZTJG 2LAGB 3X3GH 1KACB 5J1AB 4R9HA 2HJKB 3IYLW 3FAWA 1DLFH 4XB7A 4K9EC 4FFYH 1H5BC 1OTSC 2Y25A 4KQ4L 1RU9L 4XNQB 2D7OA 4Z7NE 5EOCJ 4ZFZA 1AO7E 4OBSA 2CMRL 3BAEL 3QFDA 5KN5A 5M94B 3OKNA 5J6HB 3BZDA 4J8RB 1CLOH 3L5WB 3MLXL 3BGFC 3EYFB 4BK4A 3QJFA 1A7BA 5C0CD 1QFWI 5I1JH 3RZCA 4Y4FA 1I85A 4JFDE 4F7CA 3EO9H 1LMKA 3ETBF 3RWHA 4LK4A 1E6JL 4WHTB 4BSVA 2GTZB 1AGCB 1NMBH 3VW3L 5F96L 3S35H 1MFEH 1M6OA 5DVLA 4YXKH 3HI6H 3CX5J 3OKLA 4M7ZB 4UV7H 1A0QH 4ZUWB 4GUPB 3QI9D 4LSRL 3WDJA 3FQUA 4MYWB 3WE6A 5IVZA 5EORL 4X6FA 3MRBB 5HHQA 3IFNL 4ZO7A 1WWAX 4BFIA 5EIVA 4MLIA 1QRNB 4MJIA 4OAWA 3TZVB 3BRFA 1MRFH 5KJRL 4HJJH 2YK1H 2DQTH 4LOUC 1KEML 4ISVA 1IKNA 4UT9L 5F1NA 3H9SE 3G9AB 3UTTB 1RFDH 4LLYA 2OL3L 1G9ML 1U41A 4JRXD 3HAEH 4HHAB 3SE4A 1U8MA 3SOBH 3QJFB 3BZFB 3VI4E 3VRIA 4N5ED 5AAWA 5T1DH 2R1WA 4F7CB 2WM0A 4KVNL 3RWHB 5FF6B 5DMGD 1UT9A 2V17H 1H0DB 5I9QB 1AQKL 3W2DL 1YN7B 3GJFB 5HY9A 4P4KC 2R9HC 1R3IL 4XBEH 4AMKL 3W9DB 3AROA 1NAMA 4GAGH 4PJXE 4G8EB 3FQUB 3VWKC 1BWMA 1AQDB 5CGYD 5IVZB 4CAGA 1MNUH 3P11L 3QWRA 1HNFA 1WZ1L