1YUHB

Fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
QVQFQQSGAELVKPGASVKLSCKASGYTFTSYLMHWIKQRPGRGLEWIGRIDPNNVVTKFNEKFKSKATLTVDKPSSTAYMELSSLTSEDSAVYYCARYAYCRPMDYWGQGTTVTVSSAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPASTWPSGTVTCNVAHPASSTAVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of affinity maturation: the three-dimensional structures of complexes of an anti-nitrophenol antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 88C6/12 FAB (LIGHT CHAIN)
total genus 41
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 1996-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yuhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yuhB02
3WN5A 3C6LA 4LSDA 3RDTB 4QY8A 4Y88A 1X5JA 4Y19D 4LPWA 2GK0B 4JFYA 4ODHL 5E5MA 4GMSL 5ALBH 5IR1B 3RWHA 4UINH 3U4BL 4H20L 4FQIH 1AD0B 1A0QL 1FZMA 3VWKD 2W0KA 3WN5C 2MQCA 3EOTL 1NEZG 3EO0B 4X6FB 3FTGB 1D5MB 5EOTA 1QSEB 3OKDA 1D5ZB 4JFQB 1B0WA 1VENA 2NZ9C 5C71A 2C1PB 2GY7B 3CPLB 4L29A 1M6OB 1E4XH 5EBWA 1ED3A 1MJ7L 4P49A 3FN9A 2VZ3A 3W0WB 5C09B 3VG9B 5D1XD 4G80A 3ARTA 4RIRB 4XZUB 3KVQA 4LPVA 4PJ8D 2R2BA 1HKLH 3FFCA 5GQBA 1MJUH 3QCTH 1YYLH 4HIIA 1U92A 3W0WE 3STLB 4LIQL 5BS0B 4NDMA 4M7JL 4O2FB 4RAUA 2IG2L 5CZVL 1KN2H 2APTA 4LARL 5IKCA 5D1QD 5F6IC 4NQDB 5KVFH 2HTKC 1IM3B 1CF8L 1C08A 3K1KC 2OCFD 4QTHB 5BS0E 4UUJB 5C0JB 1J7VR 1R5IA 1JPFA 1HNGA 1R3IL 1VADA 4QHMA 3DGCR 2Y36L 4U1JB 3CPLA 1DBJL 4ZOEA 2BVOA 3EZJB 1PX4A 1CGUA 2DICA 1E27A 1H0DA 4JN2B 5FYKD 5E99L 3WFBL 4IDJL 3P2TA 3BPCB 3DV6A 3NFNB 1PQZA 2PW2B 4Y19B 3KWWA 5BQ7B 3QUZD 5I1AB 1WFUA 3HHRB 1CLYL 1X9QA 4QXUH 5SWSE 3HRPA 1M7IA 3FRPA 4RMWA 4GKOA 4LRIC 1JNLH 3LPWA 4CUCA 3U46B 1UZ6E 2D0FA 3HNSL 2WBWB 2FGWL 2FB4L 4RWYH 5AD0B 2NY3D 2HKHL 5ICYB 5C0IB 1S7WB 2OXHA 2P7TA 3ZT6A 1FL6A 1NANI 2A9ML 1Q9OB 3GK8H 5A2JH 5C0CE 3IRZA 3MBXL 4WFFD 4MNQE 4GLRH 2CDEA 1HWHB 4ZUVB 5DJYA 2Y4SA 4RQQA 1H3WM 1OP9A 5A16A 4N1EA 4Z7UF 4XCCL 3FOLB 3QUMA 4ODVL 3WS3B 4KQ3H 1J0JA 3LN4A 3SE4A 1JNLL 2DBLL 1JYXA 1R3LA 1RZJH 2YRLA 5HHOE 2DMCA 2W9LA 4PJFE 1IAKA 3MRIB 1FPTH 5F7NC 4B5EA 1MRDH 2RBLA 1I9RL 2J5LC 5SX4I 4PJDA 1RPQA 4KKBC 3OJVC 1KELH 2NXZD 3UTSE 4HK3J 2AP2A 5D1ZD 1ZHNA 5EH1A 4R7DB 1OAYL 2O61B 3GI8L 4OCYH 2KQMA 3BWUC 5K33A 2ERJB 5I6XC 5JNYA 2DI7A 2APVA 1C5CL 1Y0LB 2XZCH 2FEEI 5MEPB 5DEGA 1DQDL 1HQRB 4DEPC 1KLFA 1OGTA 4G5ZL 4GS7C 4AIZA 5H35B 1X4XA 1DR9A 1NL0H 1MRCH 1XEDA 2ENSA 5KS9A 2GFBB 4KDTA 1PYWA 1KJ2B 5SWZA 1VERA 5EOTB 4BQ9A 3QULA 3IFPB 3LN5A 1K6QL 3NA4A 5ESQB 2CRZA 2NY3B 1M4KA 4NC1E 4KRLB 4PBVC 2EYSB 4R4BA 5HJ3A 5ILTH 1OT1A 5AYUL 1ZVSA 5FF6B 3IF1A 4OCYL 1WIUA 5HTSA 5A3ID 4IOSD 3ARBC 5FUZH 1UCTA 1CXKA 4QXWA 1L7TL 2W0FA 1LEGA 4PB0H 4MAUL 5ITBL 1KBGL 2CJUH 4ZS6D 1D7FA 5J11B 5HPOA 2QSQA 4JO3H 5KS9F 5ENWB 5H35A 4OCXL 1SJXA 4M48L 3TYFA 4W6YB 5HVHB 1M1SA 1C08B 4DN4L 5L9DL 1NAMB 4MNGE 2GQHA 3QIWD 2A6IB 4Z77B 3GRWL 1UVQB 3I3DA 1QKZL 1LDPH 1DQQA 5ETUA 3H42H 1J12A 4KV5F 4WGVB 5F21B 1SY6H 5L2KA 2EYTB 4I1NB 1OM3H 4X5WA 2ZP0T 3HFML 5IGXH 3AVEA 1MJ8H 2PO6C 1EO8L 3MCG1 4MYWB 4NQUA 5EIIB 5EULV 4TVPL 5K9JL 2VLJE 3HPLB 3HMXH 2R1YA 3VXNB 1TNNA 4CU6A 5SX5K 4ELMB 1J86A 1EDQA 3EYFB 5J6HB 3SE4C 1HCFX 2D2OA 5DD1H 5CJ5A 2AW2A 1EJ6A 4J7RA 3VGAC 2B4CH 1F11A 4LMQI 1QLRB 3GKZA 3DWTA 5B8CB 2FHCA 4UNTA 4JM4L 1LE5B 3RX7A 4WRLA 3UPRA 3QJFB 1VGEL 3IU4H 4K3EH 2CK0L 2NZIA 4BQBA 3VW3H 4CVXA 1X5IA 5KBNC 2ADIA 2EH8H 1X7QA 3WO4C 4OZGE 5I8KL 4U1GB 2DJSA 1LO4H 5C09A 1T89A 4GAGL 5GGQH 3MGOA 4LIQH 4Z7QE 5ICZA 5IG7A 5DD1L 3GO1L 3DIFB 3SDXA 2YMXL 5FCSH 2FWOB 4DQOL 2BMKA 4DKEL 2Y1VA 2NY0C 1AO7E 3UROR 5CCKL 5MI0B 3TIEA 2ZPKH 3SE8L 2Q6WB 4Z7WE 5IJKC 1DBJH 3PGCA 3LH2L 4JFEA 3VW3L 2OI9C 3BIBX 1NBZB 3MODL 4DGYL 4O58H 5DQJB 4OD1H 5D1ZB 5ALCL 1JNNL 1G7LA 1X5FA 4V2CB 1A6ZB 5EORL 3IJSB 4NOFA 4S10A 5IM7B 4UILH 1WWWX 5BZWA 5FECA 2HT4C 1FGVL 4RFNC 4G9FE 1KACB 3F6IA 3LS4H 4R9HA 5F8QC 4Z95L 4OQTL 5JXAH 4P2QD 3WJLC 2QQLL 2FECL 1ADQA 4NFBA 4NFCA 4P46B 3C5ZA 1K5NA 1OB1A 1OY3B 5IOPA 1YQVL 1KCSH 1E0OB 3BISA 1FVCB 3U4EA 1U91B 4PJEE 2XIDA 4KJYB 4UV7H 1J5OH 4B53A 3HPLA 3EOBB 1I8IB 3I6LE 4N90E 4WTZA 2ZKHL 1WEJL 3AM8A 1YY9C 2EE6A 3Q1SL 1XR8A 3DVNB 3A6OA 3OG4B 3FO1B 3WHE0 2OZ4L 4X6CA 5EOQL 5E6IA 3CH1A 3VI3F 5JLZB 1SJEB 1OQXA 3H7LA 3UBXI 3DGGA 4LCUB 4WCYL 4WJ5A 3DX8B 3FQRA 1QSEA 5E4IA 1I7RA 3MA7B 3U7YL 2P5WD 4JFPB 2XKUA 3MUGB 5INDA 1HHHA 2E9WA 3DURA 2VH5H 3MBEB 3CNKA 2EDJA 5K9QG 5IG7B 4G6AD 4I4WA 1K8DA 3HNSH 4RMTA 5GGTH 3MNVB 1OW0A 3WSQL 4AM0A 3HUJB 2CQVA 4PG9B 3AXLB 3VFRB 3EDFA 4G3YL 3KLHD 4LSPH 3QXAB 2QADC 4WEUD 1RUKL 4LPTA 1TTGA 3MOAH 4UOJA 3RWJA 1MFAH 5I1IL 5I1EL 3IXAA 5GGRA 5LAXB 3VFUA 2QBWA 3QUXA 3D18A 4KVCH 5C0EB 2IQ9H 3O41B 5HYIA 2YPKB 5BV7B 1RUKH 4DKAA 3NZHL 1ZANL 3BOVA 4P4RB 5C0BA 4YFDB 1DQDH 5I1LA 4HUXA 2CKBL 1I7RB 3BQUC 1NQBA 3RIFF 1AGEA 5SWZB 3V8OA 5EBGA 5EU3A 2P24B 3CFIC 4I48A 3QQ4A 2R1WB 2X4NB 1U93A 1MCBA 2FJGA 3AMLA 4UQ2B 4OSUH 4RFNB 4QTIH 4ZNEA 3VGHA 4HS3A 5I19H 4FXKB 4QLRA 2FEDD 4UT9L 1TZGL 3CD4A 5JW5A 4LEOB 3VFNA 1RZKC 3DUUB 4JKLA 3HLAB 5DJCA 5B3JF 4NQCE 3UCRA 1KCRH 3WBDA 1V7NL 5EBMA 2ICEA 5J1AB 1NBQA 3FRUA 3I9GH 1F90H 3OKKB 5KSBA 1RULL 2JJWA 4NCC1 1WCBA 4Y4FD 4KI5E 1RJZA 4P48A 3CK0L 2R4RH 1WVZA 3OB0K 3MMEB 5DMIL 4XWOD 4LLAA 4JFFB 4HWEL 4JHWL 3O3EB 5I18H 1G9MC 3P77A 1RU9L 3A67H 1QSEE 4Q6IB 4X4ME 5I18L 1BQSA 4GBXC 4F15B 1QR4A 3RGVC 2ZJSH 5D2LF 1EZVX 3DNKA 5HGBB 4FQIL 1FC2D 3VXSB 5EIIA 3HN3A 3DX9A 3V7AG 3FB6B 3SCMA 3I9GL 4N8VG 3TT3L 4G6FB 3VWKA 1GXEA 2VE6A 1KCUL 4Y1AB 3IDGB 1MHCB 5CCKH 1CFQB 3KJ6H 4LF3A 3C6LB 2ORBL 1XCTA 1EFQA 3MNVA 4XH2B 5ACMA 4LU5H 4TVPH 3KYMA 3O2VH 3PG2A 1CE6A 3RY6C 2CLRA 1L9MA 3MTRA 5C0ND 1N0XH 4MZ2A 5I8KH 1NCBL 5GZNC 3CVHB 4NOBA 1BVZA 4B7LA 5F7DA 5D9SB 1QKZH 4OZIE 3ALPA 4OF7A 4MJIE 2AXGA 2RFXA 4FQXA 3B9DA 1G7IA 4JDVB 4H26A 1XGPB 2FX7L 4YEFA 1ZS8B 3SCMB 3RIAK 5IV2A 5CSZB 3ZDZE 3F7PC 3HG1D 1N59A 5IW6A 2BOBA 2J7LA 1KEMH 3CZJA 1BFVL 4QXTA 5I66A 2VXTH 4MJ6B 4NRYB 5D7JC 5MHSE 2OK0H 2EKJA 2IALB 3VD3A 3BN9C 4Z8FL 3WFHB 5CD3B 3IKCB 4YDVA 2ESVB 4WY7L 4HGMA 1YJDC 2KH2B 2N4IA 3DMMA 1NCCH 2UUDH 2B2XL 2G9HA 3ILPB 3QPQC 4NHCL 4HBCH 4K3HA 4W6XB 2EZ0D 2NNAA 3RNKB 4OF0A 3GBNH 3WXWH 3WDJA 4A6YL 5DD3L 1C16A 2DM2A 3QT2A 3SDYH 5F70A 1UADC 2YD8A 5C0GA 5EC1A 1I1FA 4ZMAT 4J12A 5BRZD 1MCWM 4A6YH 1EZVY 3C8HA 4D3CH 4UTAH 4RSVA 3S37H 4N5ED 4D9RE 1UKSA 2FR4A 1OB1B 2YXFA 3REVB 4PBXA 5IMLB 3VXOA 1E6JL 5I30L 3AY4A 3MLWH 3MRQB 4OF5A 4CVZA 3QEQE 1U58B 3T2NH 4M1DH 4NKMB 4PBWD 1SBSL 2X4SA 5AZ2H 2H26A 3QG6A 5E95B 4DW2L 4MZ3A 3HI5H 4HUWA 4UB0L 4Y2DA 1J11A 2FJFB 3U2SB 2DQTH 3NA9L 4LLMB 5E6ID 3MV8A 4AK1A 2AJVH 4JB9L 5JIPA 3L3OA 5DTFA 3U7YH 5BJTB 4OZIA 3BKYH 3O2DH 2CKBB 4HX1B 1HHGA 2VQ1A 5DXWA 5BRZA 5J9PA 1XGYL 1A7NL 3ZTJH 4X6EA 5JHLL 1FBIL 3KDMA 4LNVA 2ATPA 5DJZB 1U42A 4RGOL 4YBQD 5FO7A 2WK2A 3QUYC 5FXCH 4IMKA 3EJZC 3LEYH 1FG2A 1U58A 5KS9E 2PYEE 2X4SB 2AV1A 3SY0A 2IC2A 1ZT4A 2NY7H 3C6SA 1PG7X 1ZHBA 4KMLB 1RIVH 4NJAH 2A77L 4C4KT 3TO4B 3ZTNH 4DGVH 4NO0A 5FYJH 3TBTB 3MV8D 2EDYA 3DXAD 3WYRA 5EBLB 2BOBB 4YAQB 1WZKA 4YXHH 3NCBB 4JZNA 2GCYB 2KUTA 3HZMB 1HHJA 2LV4A 3PL6A 1I8MA 2RAMA 4X7CC 4E41B 1IGTA 4XMLL 4F2MB 3MACH 5BMFL 1XR9A 1EEZA 4JO1L 3OHXA 3O0RH 3IKCA 4NP4L 5DYOA 5F89B 1DLFH 4UDTB 2XTJD 2XZQH 5E2VL 4W4OA 3L5HA 4OSUL 5DA0B 5KAQG 2MQ0A 4K8RL 5MEPA 1X4ZA 1TQCC 1QD0A 5JW4N 5BS0A 2V17H 5A1AA 3HC0A 4HJGA 3MNWB 1U8OB 2AXJA 1T7YA 4HAGA 1YEDB 2Y07L 1Q9LB 1FO0A 2YKLL 5DT1H 1S3KL 3QRGL 1RFDH 3S6CA 3H9YA 2J8UB 2VLRE 3CSGA 3MXVH 5KVMC 1KCUH 4KFZC 1IC1A 1NH6A 4LEXL 3HTLX 3KPQB 4X7SL 1H3UA 2DM3A 1U3HA 4LSUH 2BC4A 3QUZA 2IBBA 4V1DD 1MCPL 3RAJL 1OGAA 4P5TB 4YFLI 3VXUD 3ARZA 3FO9A 4X99A 4JFXB 3RDTA 1GHFH 3UJIH 5DK3A 5J1TC 2C7UB 2P47B 5C0DB 1M05B 4GAGH 5HI4D 3BP4B 5CEXB 2V7NA 1F2QA 3UDWC 2ZWLT 2X89A 3PWUB 1N7MH 3FT4B 1U6AL 3SGJC 4CVUA 3SGKA 3WV0A 3D5OF 2VR9A 1RZGA 4ZXBA 4LBEB 1WITA 3RWIB 1GGBL 4OD3L 4DUXA 5ADOH 2JF1A 1RULH 4GAJL 5E5UB 1NGYA 2QQNH 3KDMB 3MJ7B 3IDIA 2HLFC 3K0WA 35C8H 1GGUA 1F4WL 1KTKE 2GYSA 1A0QH 3IDNA 3OX8A 1HOCB 4NQCB 5D8JL 3U4BH 3QUYB 4E42B 3MV7A 1JTOA 2NZ9D 3C60C 5C9JB 3W0WA 1OGAB 2WIIA 3W11D 5DC4B 5CP3A 2UZYB 1IKFH 1NMAH 1RV6X 5TE6H 4P57A 1DANT 3VDBA 4RZCB 2VXSL 2H26B 3QG6B 5J6HA 1U92B 4XBPB 3Q5YA 3AB0C 1QLFB 2WANA 2HLFD 2P5EE 5EWIL 3B9VA 4JG0H 4N8CH 1KEGH 4PJ8B 1A7OL 4BH8A 2YUXA 1ONQB 3W5NA 4HV8A 1AJ7H 4YIQA 4F9LC 5IEKA 5AAWA 3LKPB 3HI6L 1RUAL 5C0BD 3ES6B 3FOLA 3VG0H 5EOCJ 1WZMA 2DQGH 1QPXA 5TF1H 3RL2A 3S96B 1LO0L 3L5XL 1JHLH 4E5XB 3JV6B 3FTGA 1SYSA 4A2MA 4G80B 2B2XH 1NGPH 2BSTB 3GSOA 4G7VH 1A9BB 4M9PA 3RX8A 2Y5TB 4HIJA 1FG2B 1GOGA 3RZCD 1FLTX 3HI1B 3DVFA 4YGVB 4PJGF 2VLKB 4S1RL 4J3VA 2NW3A 3S35L 1KTLA 5I1JH 1LD9A 3FZUC 4JZJB 1IC7H 2O5YL 3QG7L 3MRRB 2BC4B 3QUZB 4HS8L 1NFKA 3VG0L 5C08E 4KUCD 2O26U 3GGWA 5ITFA 3INUL 1A7NH 2C7UA 5C0DA 1JHLL 2A6KB 1XF2A 2P7TB 3DROA 1X5HA 1E4JA 1AR1D 2QSCH 4ODUB 1DQJB 5DC9B 1FNSL 3LN5B 1I7UA 1A8JH 1FYTB 1VGEH 5D2LA 4Q6IA 1MHEB 5JZ7D 3SDCB 3MXWL 1WTLA 3HC0B 5FF6A 4ZNEE 3HI5L 3HI1A 2OTUA 4UB0H 1LWRA 2V7HB 4TSAL 3ARGA 3CVIH 3TC9A 1A6VH 2YK1L 3KWWB 3TCXA 1S9VA 4LNRB 5E5RB 5GISL 5I1CL 3EFDL 2FJFA 4JFDA 1CGVA 5DQDL 2BDNH 2YA0A 1GPOL 2EYTA 4HD9A 5H94B 5DDHA 2YRPA 4FNLH 5M95B 4ZS6C 1NCTA 1QOKA 4NZUH 2LU7A 2P44B 2GTWB 4JHZA 1ZOXA 2H2PC 3VXRA 4JANB 4XC1H 5HGHB 1WC7A 2F54A 4U1HB 2IBZX 4MB4A 3RIAF 1OTSD 5CWSA 2QSVA 1B2WL 3SGDH 4PRPA 3EYFA 3MODH 4OZHF 4P46C 4JZOA 4GO6B 3D0VA 4ZOCA 3P40A 1NUGA 4PB9H 3PWVB 3UP1A 2WBJC 4PLJD 4DN4H 4HK0A 5DHVA 4Q97A 3CDYA 5DJYB 1HZHH 4HZLB 1G7QB 1FAKT 3H9SA 5F7LB 4YHOH 5E2VH 2C4FU 4M6OL 4PRHD 1NGWB 2DQUL 5FYJD 1OD9A 4R7DA 3WLBB 2CIIA 3QQ9C 1HH6A 4EN3C 2DF3A 1YEFH 3TYGL 1URLA 1BBDL 2WLYA 3UJTL 2YD6A 1ZHKA 2VDMH 3GSXB 5I19L 3FHAA 3BZEB 1UM5H 1NGZB 3BMVA 3GSNH 3MJ8A 1YECH 2OP4H 1Z0MA 4JPWL 4L5FL 3S9DB 2COQA 4XCFL 1OAQL 1OSZA 3UYOD 1DCLA 1JPST 1DLFL 3UTPD 1FZJA 3LD8B 5J89A 1AI1L 1MCEA 5B3NA 1NL0L 5HHMB 2FX8L 3WLWD 4LLVA 5E70A 3DIFA 2EYSA 4R4BB 2NW2A 4JFED 1F3JA 4YHPA 4DJMA 2FR4B 3BAEH 2MCPL 4YHKH 4UQ3B 3IFPA 3ULSA 6CGTA 5DWUH 1YNTA 3BKJL 3UTTB 1V5JA 3UPAA 3CLEH 5LQBL 4K9EC 1HZHL 1XCQA 4PJAF 4P5KB 5FCUL 2G2RB 3HFMH 3VXRE 5J3HD 3CC5B 5BOZG 1SY6L 3VXNA 1QEWA 2CR6A 2J4WL 5EZOL 4PRAB 2DQJL 5DJ0A 4NKIH 2I24N 2YSSB 3IU4L 4RMSA 5IOPB 2P5WB 2JIXA 3VXRB 1HH9B 4MNQA 2VLLB 5MENE 1AGBA 4HQQH 1I3GH 4UINL 3MV9A 2DQGL 3CSYB 4YJZL 3MJ7A 1EVTC 5I8EB 3MFGB 3LKQB 5DRWB 5GRJL 3PHQA 2A6IA 2Q8BH 3P11H 3T8XB 4MAYD 1L7IH 4NQXA 2C4FT 3EYSL 2BSRA 5FCUH 4WEBH 2B1HL 4CDHA 3NIDF 1TZHA 3H3PL 5T3XH 2BHUA 4NNYA 4QNPE 5L0QB 2C1OB 4RZCA 1NEZA 3CMOH 5KN5A 2AK4E 1DBML 4XVUD 1J0HA 3NGBB 4HIEA 5E2WL 1G1YA 3TJEL 1CFBA 3WKMH 4S2SB 5I2IB 5MENB 2EICA 3MBEA 1F13A 1S9YB 1MH5A 2K7PA 3MV9B 2VABA 1S7QA 2EDBA 4KUZH 1OL0A 3X14B 5HHXL 4PLKD 5JXED 4WTXA 3MA7A 1FP5A 4RGNE 3EYOB 3MYJA 5HHVL 5I8OH 4UIKL 4LLYB 2WMPA 4JPVH 3VCLA 1J05A 1E6OH 3M8OH 4HJGB 4LPXA 3EJZD 4LQFL 1FH5L 5T1KA 4DGYH 5GGRB 3B2VL 2H32H 4H1LA 4XVSL 2PXYC 3HE7A 2PNDA 3P0YH 2BNQD 3KPTA 3MZTA 4P3CL 4QXTB 1J5OL 1EHLL 3E6HB 3P4NA 2FNBA 5KJRL 3GHEL 4AMKH 1A64A 4DQOH 2YC1B 2YRZA 5KSAC 1RZJL 4IS6B 2ESVA 5IMMB 1S7VA 1QVOA 5ERWA 2XKNA 1FSKC 1T1ZA 1XCQB 3WDHA 1MFBL 3QCVH 1A7BA 1XGQA 5F7WC 4BELD 1H3VA 4WHYH 1J1PH 3BQUD 4HJJL 3VXSD 3L7EB 1NCUA 5T3ZL 1FZOA 1JF1A 1T6WA 4OI7A 2A0LD 4HJJH 3RKPA 3RVVC 3OTTA 5T1KB 3IETA 3QHFL 3MLXL 2UVFA 2WWMD 4C56D 5JW4Q 1LP9B 4P2YA 1VGKB 3GSNA 1QSFB 4H8WL 2PR4H 5TQ2L 2ZCHL 5JW5B 4PY8I 1JF5A 2XWJB 5BW7C 5E8EA 5K9KA 3TF7C 5IMMA 1A6VL 4F7EB 5EN2A 5CUSL 1QUNA 5DK2A 1F3RB 1JYWA 4Y2DB 4JRWA 3QR2A 4Q9QL 4N9GB 4OCSH 3L3HB 5LXGL 4F9LA 1HXMA 2IJ0C 3GSWB 4HC1A 1K8IB 2NY0B 3O3EA 4TNVK 3VWKB 1BF8A 5IR1A 4L4TA 3IDXL 2R9HD 3SOBL 3B9KB 2EH7L 1GAFH 4BH8B 1GGTA 3MO1B 4TULH 5DK0B 1QYGL 3EOYG 1IJ9A 4OZ4B 5DHVB 3S36X 1JL8A 4HIHA 3LHPH 4D0CB 3VFSA 3SKMA 3QAZC 3DGGB 4PJFA 3MRDA 4Z9KB 4G42A 5J3HC 3IDGA 2W0LA 5DURD 3GB7B 4EOWH 5CBEA 2BRQA 2BSTA 3MXVL 2Q7NA 4Q2ZA 5FM4A 2FECI 3ZMRA 2DWEA 3QWOA 5F9JA 3UC0L 1IAIL 4QHUB 1WISA 4ZUUB 1AO7B 2YKLH 4LSTH 3PL6B 4FN0A 1I8MB 1A3RH 1L7IL 3QIUB 1EEZB 3QPXL 2BFVH 5DHYA 4UAOB 4U1MA 2FJHB 5E6YA 4M1GH 3GSUB 5C92A 2R23A 4OIIL 4K71C 1U3JA 1DVFC 4PJFF 4D9QE 1I3GL 3EOTH 1FGNH 4OCLC 4P5TD 1AQKL 1XGPA 1U95B 1Q0XH 2YD2A 4FFZL 3LRSA 2B4CL 3MRDB 3NZHH 1NFDA 1TJGH 5D7KD 1AXIB 1KN4H 2GSIA 3Q6FA 4F80A 5BMFH 3VXTA 3R06B 4MJ6A 3G08B 3VRLE 2VDQL 4UQ3A 1F42A 3QH3B 3N1MC 1K85A 3VG9C 1MQ8A 5C09E 2Q76A 5E8NB 2RGSA 2V7HA 1NSNH 3D48R 4G8IA 2MCPH 4GMTL 3JWOL 5EU7C 1KPRA 3D9AH 3BWAA 4WFFE 5ESAB 2FX9H 5HVWA 4MNQD 5CEZD 3TA3D 4ODTL 3ZKMC 3MRQA 4CVZB 2DN7A 2VDPL 1KJMB 1T5WB 1JWSB 3FQNA 4J3XA 4UT6L 4EDWL 3NFSL 2IWGA 5GHWH 5GSVA 4JPIB 3RIFK 1S9XB 5JW3L 1AR1C 3OZ9L 2CDEB 4JY6B 4HH9A 1MCQA 1RU9H 3OXRA 3VFOB 4QHLA 2CH8A 3D0VB 3FQUA 5F1IA 1KEGL 4TSCL 2CRMA 5J0BA 2VQ1B 4NNYB 4YE4H 4XNUL 3C9NB 4P5MA 4OGZA 2CDGA 3SKUD 4NN5C 3VGEA 5IBUG 1TCRA 1IKFL 2YPLA 2VN7A 1OGAE 1R0AH 2UY6A 5FAAA 2A83A 4ZUSA 2EXYC 4WO4D 4FHBD 3WFHA 3RUGB 1Z9OA 5ANMB 3WXVH 4BFGA 4JRXE 1I4FB 1T2QL 3AM8C 4JKKA 1DDHB 5IBTL 1BJMA 4FQCH 2AJUL 2CK0H 2HYMA 1MI5B 1ONQA 5GXBB 15C8H 2DD8H 5BOPA 3VFGL 4NKOB 4QEGA 1D5XB 1N8ZA 3E2HB 2XY2A 3RVWD 4KHTH 1NANH 5HYFA 1F6AB 4MMZC 3KPLA 3IFNL 5IK3A 1BIHA 3PWJA 2HVJA 1JCKA 3F8UB 4UOW0 3TBTA 5LCVH 3L3KB 4Y4HC 4YAQA 1VEOA 4IRJC 3RVTD 5IB3A 2EYRA 3V0AC 3TIDB 3B2UC 4XCEA 1Y18A 1KEML 4FFYL 2VDNL 4U05A 5IMLA 1I85A 3AU1B 2YA2A 2ZUSA 4OZHB 4XPAL 1RIVL 1KCLA 3SE9H 3BJ91 1FO0B 2VDNH 5C07D 2K7QA 1LD9B 1JWUB 3LEVL 3K4AA 2I5YL 4IIQC 3U46A 4LLDA 3HZYB 2FBJL 1T0MA 3D69B 5FM5O 5JDSB 1XGRB 3LEXA 4PJXA 1P7QD 2J1KA 3LPFA 4MQTB 2LABA 5BVJB 2V2XB 2FEEL 1WIPA 3TBVB 4HIXL 1BECA 4P2RD 3QIUD 4ZO9A 1J0IA 1QSFD 1JRHI 3MV11 4WI3A 3O6LL 3GSNB 3PDDA 4JREB 3U6RA 1CQKA 3WLWC 3S5LA 1I3UA 4QRUB 4AMKL 2F53D 3G08A 4P3DB 2L4OA 1VPOL 1OAUH 5DO2D 2ZKHH 5TE4H 1JWUA 1GRWA 2IFGA 5DC0A 2XQYK 2ZCHH 1KLGA 4LLWB 1L7TH 3SDXE 3SKJL 3WS3A 2Y7QB 1Q94A 3SJVE 4DW2H 3MNZA 1MCNA 2YPLB 3NCJH 4Y89A 2VLKD 3C87A 4ORGB 1QRNA 5KVEL 1NAKL 4U1HA 1JPSL 3T1WA 4CKVX 3LKNA 5HYQB 1S7QB 3DI3B 3TN0B 4OUUB 4OZIB 4M1CC 5E8DH 3QEHA 4O9HH 3I6KB 5I1IH 5MEOB 1F90L 4D0CA 2B0SL 1HILB 3FO2A 1Q9KA 25C8L 3MLPA 3DYPA 1XFPA 2ATPB 5DFVD 3ECBB 3QPXH 4P3DA 4PJXF 3VXMB 3ARYA 3KNBB 5FA3B 5GS0C 1G0YR 2IPUK 5CBEB 8CGTA 2VXUH 2CJUL 3I02B 3MRFB 5FM8A 3OF6A 1KXTB 2LVEA 4K23L 3KYNB 1QNZH 4Y19E 3VA6A 5JPMB 1VKXA 4E41E 2E6PA 3SDAD 3SPVB 1I9RH 3SGEI 4U1SA 5SWSD 5CEYA 4O9HL 1PY4A 1SMAA 1VADB 4QHMB 4TRPH 3DRQB 3EO1B 4MA7H 4DZBA 4IIQB 5CEXA 4PJAE 5GRVK 3QEGH 4U6VH 3DBXB 3LEXB 4PJXB 3LQZB 5EU6E 4BA8A 1J87A 4PPTA 3R8BB 3EJYD 1UEYA 2QV2A 3BT2L 3HC4L 1YDPB 1XGTB 4CU8A 3ARXA 4MQ7A 3TJEH 1NCBH 2DQDL 3O3DB 4U3HA 2R4SH 1F6AA 2EDXA 2PXYD 3P9MB 1XF2B 2UVEA 1ZGLP 3KXFA 1RD6A 5ISZB 1UJ3B 1OQOA 1T7VA 4AZ8A 3GRWA 3RI5F 5E6IC 4Z7UB 2EEAA 2F8XC 2H45A 5F9OL 3G6AA 4LAJH 4IBLT 1KPRB 3T1FA 5CINL 1JNHB 2JCCB 1NCDH 4K55A 2Q8BL 3HZKA 3KPSE 3K4DA 3WNLA 2R0ZL 4LHJB 3QUYD 4PS4H 4GAFB 4IMLA 1F6FB 3HNTL 2OJZL 4WWKC 5B8CA 3LY6A 2P5WE 3VWJB 1JNNH 4G6ML 2X5PA 5C0CA 4MB3A 1DQLH 3Q3GA 2OTUB 1FYHB 4RFOH 3MUHL 5L6YH 2V9RA 4M00A 5AWNH 4NHUA 5HYSB 2LAAA 3BD3A 1IAKB 3BGFB 4BKLA 1YJDH 5IQ7L 2Q87A 1NFIB 4XPBH 4GW4B 3IDNB 4PGBB 4WENB 4ODSH 4WTWA 3S5LB 2KDGA 3TBWA 2W9EL 4JDZB 5JTWA 5K59E 5D7JD 1OLZA 3FB5B 4PP2B 4XNXH 4PJDF 4L8DA 2NLJB 3IFNH 4PG9A 5D96C 4EKXA 4PTUB 3DX7A 1BLNB 1W8NA 1YYMH 1G9NC 4PRPB 2YBRB 3MOBL 3QXAA 2Z93B 5EU6A 4EUPG 3TVMA 2VTFA 4AEFA 3FONB 1A6WL 1JTPA 3SGKC 3WFCH 4JFZH 4TOYL 4YDJA 1PYWB 5EZLB 4LAQH 2M1KA 1F6LL 5GGUB 5L0QC 4FMKA 5GSRA 4NO0D 4HFUH 2MKWA 1NGWA 2Y5TA 4HIJB 2VWEC 3Q6GL 2AEIT 4GXVH 4LARH 4ETQA 2BDNL 4IJ3C 4D9LL 3FN0H 5F9DC 5EOCL 2NX5B 4GOSA 1LO5A 4K3DL 4GRMB 1I8LC 2NLJA 1UJ3C 3HR5B 1E6JH 1MNUL 1S8DA 1H9VA 2WUBH 2BCKB 3ZDYF 3VH8G 2HVKB 1H8OA 3C8KA 5C3LD 3F65A 4JR9H 5IQ9A 3AAZB 3LKRA 4WW1A 4GG6F 1JPFB 2MOVA 4TPRH 3CX5J 1PKQE 5HDLA 4MNGB 4WUUD 4N8PA 4LRNH 2X44D 1WCBB 1WC7B 3L7FA 4KI1A 4LMQE 1BD2E 1OT2A 2WWMC 4YHZL 2BNUB 2BRRH 1LDSA 1VCAA 4NRXB 3WHXB 4NHCH 3BZFA 4ZFZA 5TE7H 4HIXH 2B4CC 3OV6A 3QFDB 4M5ZH 1YNTB 1WFTA 5D5MF 3WNPA 1INQB 5GRVL 3F6LA 1OSPL 3RL1A 2O5XH 5I71B 4NC1C 4P5MB 4JR9L 2BNRA 5C6PB 3MNZB 5TF0A 5ICYA 1RJYB 3VRIA 4MVBC 2R4SL 5DJXA 4JQIL 2HTKD 1ROWA 1R3KB 3BSZH 4MQSB 5CJBA 4Z0BH 4LP4A 4WFEE 2OSLB 5IB5B 1A7RL 3MRPA 1MY5A 1AI1H 4OGAD 1MUJA 1B6DA 3QEGL 3Q2CA 4LHQB 3RWHB 2Z4QB 3HE7C 4KK5D 4F57L 4JM2A 4PRDA 1UH2A 1WCQA 4NM8H 3ROLA 3REWB 3C09C 4WI4A 1CFTA 4XCYA 2VDML 1QACA 1RJLB 4PD4K 2BNRB 1FIGL 3V95A 2VRAA 3SDXB 3IFOA 2VLJD 1C7SA 3OR6B 2CLZB 4KKCC 5AYUH 4BSWB 4UZGA 4R97B 1CFNB 3V4UL 2FDBP 2OL3B 3O0RL 3ZE0F 4KXZI 1PG7H 1IRAY 1F00I 1FNEB 1P1ZA 1LK2B 3GI9L 4I0CC 4JO4L 4OFYA 2OX5A 1VFUA 1J9CT 2BVYA 2XWTB 1ZSDB 4WHCA 4R3SB 4FXKA 2NTFA 2VDOL 2VO5A 5D5MA 4AIOA 3WS6C 2R23B 3QUMH 4FQJL 1EMTH 2R1XB 1UCBL 3I75A 1BGXL 3RWEB 1YMMA 1QG3A 4GW5B 1CFTB 2IANB 2ICEB 1N7ML 1T1ZB 1XT5A 5C0GB 2P8MA 3O3DA 2D9QB 5FFLA 1AGCB 2X4TA 3WJJC 4A6YA 1FVDA 1CQYA 3ULSB 4KKLD 4KJQD 4L3CA 5T1DL 4JO4H 3NN8A 1MPAL 3RTQD 4EI5A 3JV4A 1O0VA 1EO5A 4CL7A 1FSKB 2B39A 1TZHB 1MPAH 2EIZB 4P59L 4X83A 5IHZB 4G8FA 2ZUUA 4LCCC 1AIFA 4ACPA 4X6DA 2X4UB 2Z31A 2HMID 1CDHA 2YWZA 3PP3H 1RZJC 3WIIH 5T5FH 3L3IB 1PJ9A 1NGXA 1U8NA 2R29H 3FQWB 3QI9A 1QP1A 1A7QH 4MDIA 2VE6B 4Y1AA 1WFOA 4GW1B 3PXJA 3QDMD 4X8JA 4YC2C 5GGSB 1ITCA 1HSBB 4HFWB 4R90L 5GGVL 4CU7A 1BJ1H 3LZFL 1H3GA 4FTVD 5GGVY 3MLSL 5D2NC 3DYMA 4FQJH 5KSUA 1MHHB 1HILA 3FO2B 5B39G 5E8EB 1KFAL 4GW4A 4BQ6A 1CGWA 4M3JA 4OJFH 1EXUB 3UTSB 2DWDA 1CXFA 2EDOA 2EDQA 1I7TA 2VC2H 3MRFA 1F97A 2BSRB 2X4QB 2Z0BA 3HE7B 5BV7C 2NY0D 4PJCB 2E5EA 1AHWB 4HHAB 2MQ3A 5FM5M 4TUOA 3QQ3A 1ZS8A 1I8KA 1W72B 5KSVB 2VZSA 3P9LB 5CGYD 5F7UA 3P0YL 1FL5A 4KH2A 3IXTA 4AY0A 3P4OB 3EBAA 4AEHL 3CSPA 3QA3A 3ILPA 1I1YB 3OKYA 1CU4L 2WBJD 1OPGL 3RTQB 1MI5E 1WBZA 5JNYB 3TNNB 3F58H 1BD2B 2R1WA 3S36L 3DMMB 3RY5A 3UTZB 3QZWG 4S0SD 5EWIH 3OGOE 5GPRA 4F7MA 4NZDA 5J57B 4OZFH 3BP6A 3K2UH 4FA8A 4HKBA 5HHOB 1I7TB 4PRDB 1BZ9A 3ZE1F 4XP9L 3DV4B 1Y6NR 5IHUL 1RZ7H 2LTQC 1S9WA 3EGSB 4MXVF 4OBSA 3VXUE 4E9LA 2DJ4A 4KU1A 1KPVB 1QSED 2GI7A 4PP1C 5HVGB 2D7TL 4PJHA 2VXTL 1V8HA 5ELIA 5EN2B 5CJOH 3QBTB 3PF2A 5AZEH 4P9MH 5DMGC 4RGOH 3WUWB 4G7VL 4JJ5A 4Y1AE 3TZVA 2CUIA 5GRZA 2I07A 3GMPA 2BJMH 4Y16A 2HJKB 2PTTB 4KKAC 1M7DA 4PJAA 1BD2A 3HAEH 3PQYA 5F9WC 3T3PE 3MLUH 4HULB 5DJ6A 4XP4H 4QRRD 3LHPL 1JGLH 1QFUH 3T65A 3OMZA 2ERJC 2VZVA 1IC4H 3DO7A 4OT1H 2Z92A 2N1KA 4LRNL 3V0VB 1ZA3A 4UV7L 2A9MH 2D7QA 2HJLA 3QNYB 3CU7A 3NFPA 3QRFM 1FNHA 2VKWA 4TN9A 5BZDB 5DF0A 3MLRH 5EUOF 1U3ZA 4YFLF 3UTSA 2F74B 3E3QE 4LKXA 3ET9F 3U0PA 1HXYA 5IJVB 1C8PA 2XA8H 1O7VA 3PHSA 3KLHC 1ULVA 3HG1E 1CLCA 1U8HB 3O4OC 4KI5D 1CI5A 3BDBA 1R6VA 1L6XA 1IGYB 1UWEL 2ADFH 3U9UB 3IXTB 4XI5C 2CLVA 1S7XA 3W9DB 5JORA 4GKSA 3DVGA 3R0MA 3V0VA 1T3FB 1ZEAL 3UO1H 5E2UL 1CFSA 4KHXL 2XZQL 4RGNB 1CS6A 5EZLA 3H9SE 5GGUA 5DEFB 2BVQB 4JG1L 1KULA 2IAMC 5E8PA 4NRYA 4NUJB 3HNVL 1CFNA 1ND0B 2J88L 4Y5XC 1KNOA 4KRPB 2YZ1A 4OCWH 5F7EH 4XXCC 4R96A 4QHNA 4NJAL 1IKNA 1NJ9A 2AJSL 1T5XB 3BZ4B 2Y72A 4HK3N 5DSCA 3HR5A 2DQIL 4EI6B 5AWNL 3KS0J 3ARDD 3PNWA 2J8OA 3QI9D 1CDUA 1BWWA 1ZGLA 1KENL 5CGYC 1YMMB 5GRUL 1Y6MR 4OM1L 4NQDE 1X5KA 1WZLA 2OJZH 5EU5B 2X7LB 3AREA 1FAIH 3GNMH 2D4FA 3SDDA 1GGCH 2X4TB 4W6WB 4XP6H 3O6FA 1MAMH 3CFBB 3GSVB 4HPOH 2B1AH 1IGIH 8FABA 3JV4B 4NJ9L 1A4KB 2CDFB 4XRCA 3V0WH 2F5BH 3KHOA 4NNXA 1HHIB 1RIUH 3W11C 3MJGX 3RL1B 3DSNA 1X44A 2VL5B 4P46A 3C60D 4M02A 3U2SA 2QQKL 4JFOB 3TV3L 1AXSA 1G6RA 5F8RC 3S35X 4OZFG 5JMRA 2M2DA 1PFCA 3RVTC 5IGXL 3MMEA 1AXTL 4YE4L 4Q58C 1SEBB 3BP5A 1G9ML 2BVTA 2ZSWA 3S4SB 4LSSH 3QIUC 4PJ7F 4NN6C 2V5YA 4JO2H 3DVNA 4K7FA 4RFEA 2D4DA 4MA8L 3QDJB 3G5VB 3BYYA 4MA7L 5INCB 1MFAL 5F93C 4JDTH 1HIML 5DA4A 4JY5H 1T3FA 3FQXA 4JY4A 3CZFA 2YEZA 4R6UA 1KB9K 4OM1H 4XP5H 4PLJC 3ZDZF 3T0EA 3QEQD 4IHOA 1II4E 2VL5A 3PIQA 2J2ZA 5IB1B 1TLKA 3G6JF 4RGMB 4TTDD 5F7MC 4QYOA 4PRID 1XR9B 1TJIH 5TJWK 3D25A 4WV1C 3O2DA 3ZKXB 2IF7A 3WIHA 5ACLA 1GOFA 4QY8B 4YDKH 3V52L 2PW1B 1SVZA 3G9VA 3QSKB 1A6UH 4JRXB 5D9SA 1QLEH 2AABH 3TPUB 4LVHC 3ULUF 1WBXB 1NGZA 5GGVH 3KLAB 4KZEL 3D69A 4PJEF 4YBQC 4TSBL 1ZGLB 5IFAL 5I1DA 1AQDA 2PO6D 5IK3B 3VXMA 3PWJB 4GG6E 1FZJB 1IFHH 2PYED 3NAAL 1NAMA 2FBJH 3W9EB 5KZCD 1MRFL 2JB6A 1N6QH 3W5MA 3CXHK 4Y2OA 3DRQA 3EO1A 4DZBB 1M7XA 3DXAE 2C26A 2OS7A 1D5BA 1R5WB 1UB5B 4JRYD 4N0FB 5IB2B 2AQ1A 1G7HB 4M8QB 2AQ3A 3L3DA 3QIBD 4OBRA 5E8PB 3GUTA 1ZLUK 4JQXA 3SPVA 4NZRH 1LEIB 3U7AA 4HW6A 3G5YB 4LGPB 3VWJD 3U36A 3QZWB 2JLLA 2NCMA 3G5XB 5E9DA 2YHGA 2H3NA 1MWAL 4P5KA 1CN4A 2XTJE 3F5WB 1QBAA 3STLA 3DUUA 3CC5A 1G6RB 4P2OC 1JTTA 5T1MB 4RAVB 2GT9B 4Z7VA 3L3JB 2R0KH 1WGOA 1TPXB 3S34H 4JQXC 3S37X 4UNVA 2F54B 4MNGA 4I5BA 3N06B 4I0PA 5JR1L 1W8OA 4S1DC 2GIYA 2ZCKL 3TPKA 4ZUVA 3IJHA 4IRZL 3QEHB 2JJUA 2QR0B 3JV5A 2UWEF 3SDDB 3BJLA 1A4JB 3LDBB 3J8F7 3RJQB 5JPNA 1AY1L 4KQ4H 3SQBA 1AD9B 4XNQB 1A4KA 4J3SA 3SGDI 4HDIA 3H0TA 1TQCB 1YY8A 2C1PA 3QEQA 1QRKA 1G0DA 1P84K 2AEPH 43CAA 1KGCD 5ADPH 4M6AA 5JIKA 2Y9RT 1JIBA 4G43B 4X6EB 1JF6A 1RY7B 1TQBB 3TN0A 3FO0H 4KZDH 1V3JA 5CEYB 4HS6B 4NNPH 3ROOA 1NUFA 3QUML 3P0GB 5HGAA 3BEVA 3LKSB 2IANE 2NX5D 3JWDH 3BKMH 2Y36H 3HNTH 4WV1B 4F8QA 1A4JA 2BNQE 2VAAA 4XNYH 5TQ0L 3FOMA 1CFVH 3ECBA 2VDPH 1N5YL 4FQLL 1A6PA 1UWGH 2GFBA 4ZFGL 3V7AE 2OTWB 4TRPL 3WO4B 1XIWC 2XI9A 1DJSA 4MA3A 2R1YB 2BSED 1FZKB 4TVPE 2XG5A 4X9HA 2CXGA 4M62L 1H15B 1F58H 5IF0A 5BO1L 5F96L 3T0EB 3IS0X 3UBXG 5MEQB 4YHPB 4L8CA 4JZJC 5IW6B 1YJDL 1H0DB 4JN2A 3U0WH 1NMBH 1IAII 4K23H 1FVCA 4UI2A 3OPZL 3G5YA 5EA0L 1EBPA 1ZHNB 2ZG2A 2H3NB 5C0JA 1J0KA 5FK9B 1BM3L 4W4OC 4OJFL 2AERT 4NJ9H 2WW8A 4AIXA 5IROA 4R8WL 2J3SA 1YEIH 3RA7L 4Y5YC 3RQ3A 3VXPB 3CFKB 4PJBF 1MVFA 3SDCD 2OBGA 3VMOA 2R0ZH 3LZFH 2DIAA 4X4XB 1KIUA 3MCLL 4QRPB 2XQBH 1DSFL 3QDMB 4XAWL 1BAFH 3QWRA 4ZQKB 5DUBA 1LO5B 1U8KB 4PB0L 1AXTH 3QNZB 5HYJA 2EDNA 3JWOH 4I0PC 1YNLL 3GEWB 4N0YH 4XTRC 5E2JA 1XH3B 2D7PA 3GJFB 5DJAA 4X99B 4P46D 4MDJB 1ZVYA 5C0IA 1T04B 1VFBA 3SDAB 1HEZA 5C08D 4KTDL 1MWAA 1LEIA 2ED7A 1LEGB 1RIUL 2FL5B 2Z31B 5EUKA 1FFRA 3HUJA 3BFOA 1KF9B 4N0UB 5EB9A 4JQVC 3F7RA 2Q86B 5F1NB 3EYUH 5DD0L 4KROB 4POUB 3B5HA 1GZQB 5T1DH 3QXDA 2PYFB 2IEPA 1MH5B 2GJ6E 3IS1X 2Q8AL 4FZ8H 3IJYA 3P4LA 4LSRH 4Y0GA 3FQXB 4JY4B 2GJZB 1JGUL 1U8PA 4HUXB 3VRLF 4Q9CA 2VISA 1CFSB 2YN5A 4LRIA 1KTDB 1H3PH 4NCDA 4LP5A 3F7QA 2Z8RA 3MOBH 2M26A 1GIGH 1TTUA 4MVBD 4KK9C 2VSCA 1NKOA 1QLFA 1T2XA 1RJLA 2CPCA 5JW4M 2MPAH 4KVNL 2XTJB 3K8KA 4U6HB 3AGVA 1NC4D 4QRPD 4PY8J 4N8VB 4G6FD 4GXVL 2GJ6B 1JUFA 4U4BA 2I25N 3QIBB 3AY4C 4EN3A 3QA3B 3CXHJ 3B9KC 1GAFL 4PJ9D 4G9DB 1PAMA 3QXUA 3MRJB 1CICB 1KYOK 3U30C 3ZDXE 3QO0B 5GSRB 3RNQB 4Y16D 2BX5A 4Q74A 3HUJF 3D0LA 4KGJA 4Y5XB 5ABDE 1KG0B 2AEWA 4R97C 1F4XH 5GS1C 3V4VL 4BSWA 5DLMH 4GG6B 2XV6B 3NABL 5E7BA 3UTTA 4I2XE 2W0PA 4ZSOE 1RK0B 1P4BH 5F1OB 5C0FB 3JTSA 8FABB 4ODWB 3ZYJA 4BFIA 4P4KD 4CNIB 5I1AA 5J11C 2HVKA 3K3QA 1YPZF 3N85L 5GGRY 1U36A 3BGFC 4NZTH 5TQ2H 2DYPD 3GMOB 1KPUA 4DTGH 5F97E 2XTLA 4YHMH 1JI2A 4PJHB 1T20A 4HC1H 3BWAB 2YPKA 4MAYC 2DMBA 3TIEB 3TH2T 1DE4A 3V2AR 3NCMA 3OR7A 5FV1L 4CJ1A 1FORL 1Q0YL 5CGTA 4FXLA 4I0PB 2AJYH 5EPMA 3UTPE 3W39A 2AK4D 1BFSA 1S7WA 4X6CB 1EH9A 1E28B 3MRPB 5SX5H 3P3YA 4KPHH 1TJGL 3PWLA 4ZG1A 5IM7A 3SKNB 5DK0A 1EGJH 3B8SA 1YY9D 4J1UA 5GS0L 4BFIB 4C57C 2WM0A 3HLAA 5DJCB 4M7KH 4X7SH 4KROC 3TBYA 2VAJA 5DQ9A 4LLQB 1AD9A 4XNQA 2NXYD 3QJFA 4AQ1B 4G7YH 1JFQH 5E03A 3GBML 1K5NB 2J88H 3ZHKA 1T20B 5FGCE 3NPSB 4GMTH 4MCYB 2GTWA 3STZB 1B3JA 1F11B 4M6ML 3UTQB 4XPTH 4OGAC 5CBAB 5KANI 3PWNA 2KL6A 3GIZH 4Y8DC 3D85D 2PUQT 3LMJH 1B4JH 2GUOB 1YC7A 2APFA 1RZFH 1Q1JL 4OLVH 5IVXA 3EW3B 4WUUB 2A6DA 4ETYA 4DVRL 3AUVA 4BQ8A 1KB5L 1IM9D 2DTML 3Q5OA 5HHQB 4R3SA 2ICCA 4JVUA 5LAXA 3VFUB 4ZDHB 1WBXA 5E0QA 3ARBB 5EZJA 4EQ3A 4XTRD 2NY1B 4Z7WF 1W72H 4ZPVB 4JREC 5KTEL 4PJ7E 5B38G 1P4LA 2WBJA 5KVEH 3JWDL 3ORJA 4AIZB 5GZOC 4WWKD 4G5ZH 3BIAX 4JM2B 4ZSOA 1EO7A 1G7MB 2FX9L 4HJ0D 2V5MA 4XWGH 2NXZB 1PVHA 5C07E 3NMEA 2EO1A 1Q38A 4Y4HD 4YDIH 3SE3C 4CMHC 1NBYB 4RIRA 4OUOA 1S5IH 1CD1B 4ONOA 3DURB 2VYRE 4NGHH 1MCKA 3O6KL 1CE6B 4IS6A 4WHYG 1S5IL 5E24E 2MWCA 1R3HA 3WEXA 2VXQL 1AIFB 3D3VD 1ZT7B 2H9GA 3F7VA 2GK2A 1NDMB 4PJIF 2ARJQ 3LS5H 4X6BA 3BKML 4X80L 1WWBX 4AG4L 3EHBC 3MLSH 2NY5H 1KJMA 1T5WA 2HN7A 3L5XH 4HQQL 4PJ5D 3OAZK 1LP9E 4HKBB 2GHWB 5DRZA 5ESAA 3CAFA 3H6JA 1YYML 3QDMA 3QUKA 1MFDL 4RNRA 1XIWB 5C1MB 3M1BA 4IRJB 2AGJH 5K9KB 1F8TH 3MZGB 5L8JB 3U0WL 5JO5B 4HXBH 4UV4L 1KTRL 3PXHA 4FFWC 1CL7H 5GRXG 1G7JA 5IHUH 4F9PA 1I1AD 3SE9L 1CD8A 5DMJB 5DRNA 3VWKC 4EI5D 4XVTL 3AS1A 4JFDB 3ZKNC 3I6GA 3UTQA 4E41A 4F2MA 1KJ3H 2E6JA 2VLLA 3OJ2C 1L0QA 3BH8B 3PHOA 3OKOB 5DZLA 2V6HA 4WU7B 1IGIL 2F58H 4U1NA 1N6VA 2B5IC 2QHRH 32C2B 1YZZA 3MOQA 1KSRA 4UDTA 1IEHA 1WWCA 3DX6B 4G8GE 3R1GH 4GJTB 5FYKU 5HHPB 5ADOL 1XIWA 2FO1A 3QNYA 5SWZE 4XAKD 1W0VB 1RHFA 3PL6C 5GS2D 3LOWA 4WV1A 3PWPB 1I3RA 2ZNXA 3V6FA 5F3HA 1E4WL 4L4VD 4KZEH 5HHME 3C2AL 3JXAA 4OZGA 1UH3A 3O41A 4GSDL 3O9WD 4N5EC 4Z5RB 2F19L 1ODAA 1YNKH 1RVFH 1HKLL 4PGDB 5D1ZC 3L9RA 4JFYB 3GSQA 3ZE2F 5I8CB 5I2IA 1LE9B 4PJCA 2NY6C 3WLBA 1XCTB 2AK4A 3PQYE 2AS5M 1T7WA 2E6QA 5C0EA 2WINA 3GMRB 2EDHA 4HS3B 4NWTL 3PL6D 1LDPL 1QA9B 3KPSA 3OSKA 1KB5B 3TGXA 3VFMA 1DFBL 4P9HH 2R0LL 2EXWD 5JDSA 2FH6A 1QTYT 2I07B 3VWJC 4LDEB 4JFFE 4PB9L 2HFEB 3PQYB 1JGUH 5IBTH 4C83B 4M6NL 2IAMB 2ZUQB 4Z7QF 2DD8L 2BJML 4KTEL 4HCRA 5DVNA 3V52H 1VDGA 2GCYA 2HRPH 3HZMA 5TFSH 2Q76B 4XGZB 3OKNA 4F8TA 1ZVSB 3BPNC 1U8KA 4XMPL 1BZ9B 1WSST 3T0VA 4NRZA 5FKAB 2BERA 4I2XB 4FQ1H 2XPGA 3RX5A 4OQ1A 5J7CC 4MXQC 1FIGH 1H5BC 4X98A 3RPIA 1GCFA 1DLHB 3QDGB 3F5WA 1MCRA 3V4PH 1ERNA 1Q94B 4LL9A 3HAEG 4F7PA 5MERA 1JF1B 1FZOB 3H7BA 3EAKA 4WUKL 1B4RA 2HMIC 5HVHC 3QXDB 3G04B 1MF2H 5IESL 4NPYB 2D7MA 4X7TA 2J6EH 1QFUL 3KYMB 3O6MH 4RX4D 3C60B 2BNQA 3RTQC 3NVQA 1UKQA 3RPKA 4BZ1L 4GKZA 4ZO8A 4DVRH 2C3VB 3V6ZB 5BXFA 4WGWB 4OV5A 4JKPL 3ILQC 3PV6B 1M05A 4H26B 1FL6B 3LAFA 5D70L 3WIHH 1HXMB 5I15H 4PJ8C 4TYUA 4K3JH 2Y23A 3BZ4A 4ZXBB 3S7GA 4M62H 1GZPA 4BFEA 5AG9A 4LVNC 4LKCB 1YUHB 4OFKA 3MLTA 4HAFA 4OCRL 4OM0H 4XWGL 2LVCA 3HNVH 5FHBH 4HWBL 4P23A 2WINB 3GMRA 1MIEL 4JRYB 1CG9B 3LDBC 5C0RL 1KB5H 32C2A 2R2EB 1EJOL 3BZDA 3UZQA 1Q1JH 1UT9A 4OLVL 1EFXB 3LB6C 1X6NA 1F4HA 2R29L 3UO1L 5C0BB 5I1LB 1OAYH 4IRSA 3WNOA 1BMGA 2YA1A 1G9EA 3QFJE 4LHUB 1EBAA 3PV6A 4XCEB 5D2NA 3WNNA 1X5AA 4AENB 1QSFE 2AK1L 2BVQA 4MNHA 1KJ2A 1PLGL 5I17B 3QULB 4IRSC 5I73C 1IQDB 1VACA 4L4JA 2HP4A 3QI9C 5H37H 3C8KB 3GM0A 5IW3A 2F53E 4OZFB 1CXEA 1AQDB 1AHWC 4J3TA 2AGJL 4XMKH 1LO3H 3ULUC 4NKQB 1OAXH 1NLBH 5DS8A 4H88H 4TTGA 4YQXL 3VFMB 3H9HB 4YNYA 4X7FC 2YUWA 1BVKA 3O6FB 3H42L 3HZKB 1FCGA 3SO3B 4IRJD 2EH7H 3U79A 3FFDB 2UWEB 1HHIA 3N1GC 2ICWI 1JI1A 3M45A 1M71B 2B20A 1BJ1J 3RKDC 5E08H 1U8MA 2NY2D 4PV9B 1MJUL 4WFED 2ZG3A 4U6TA 5GJTH 3OKNB 4U1IB 3ZDXF 5L2KB 1D6VL 1JRHH 1MFEL 1IM9A 3O8XD 1RMFH 3FB8A 1QBLH 4F7EA 3MV01 4LSQL 3SJVA 4ODUA 5EG6C 3X3FL 2PXYA 3ARSA 5HHNB 3TNMA 4PGBA 1T66C 5DI8B 2P8PA 4G8GA 1R3IH 4DOHB 1TETL 1J88A 2I9TA 2NY4D 3BZEA 3GSWA 4ZXBC 4AT6B 2CLRB 2IH3A 5IFJA 4XX1G 3BD4A 3B9KD 3LVEA 5DMKA 1BF2A 2UWEE 4IEFB 4NQSA 4P23D 4OLYL 5IJKA 5GZND 1P4LB 2WBJB 3EOAA 4X7TB 1I9IH 3UPRB 4BYHA 1LHZA 3VFVA 1CVRA 1OP3K 4R0LC 1JGVL 1EIBA 1CL7L 5L2KE 2OYPA 3PIQB 4NUGH 3TO4D 4OLEA 5HHOD 1IBGH 1ADQL 4JLRB 3GIVB 2XN9A 4OKDA 4O4YL 1VFOA 3OF6D 2APWA 3K8LA 4O2EA 5E9DB 1N6QL 1JJUA 3UTSD 4JKPH 4TQEL 1N8ZB 4EUPB 5I6XB 5MEQA 3VH8A 2GJ6A 3DETD 5I1DB 4Z6AT 1LILA 2X2YA 4BH7A 3GSUA 2FO4B 4HF5L 3IYLW 3TPUA 3KPSD 5J13B 1CTOA 4UT6H 3PGCB 3VFVB 4JFXA 4Z77A 1BVKB 1N3NB 4G6KL 5TDOB 4OQTA 5L2JA 4YK4C 5FYLD 5GZOD 3B9AA 3G6DH 5FHAL 1TITA 3PUCA 4KJPD 1YEJH 4IRJA 4YX2H 1YQVH 3QCUL 1U8MB 4NYLA 4APQC 4JFEB 3ARWA 4GLRI 1F58L 3FT3B 4PR5A 4YWGL 4UDUA 4ELKB 5FV2A 5I17A 5D72H 1YY8B 4Z0XB 5C08A 2BXYA 4Z95H 4FTVE 3IDMB 1FNSH 5FKPA 3O6ML 3UZVB 4JEGB 2EDRA 3V5DB 1C5BH 1PEWA 3GGWB 5ITFB 4D3CL 2P8PB 1MELA 5DJ2A 5SX4H 3DRTA 4XPFH 4DVBB 3GFUA 4ESKA 1XR8B 4UTBH 3L5JA 3MLXH 4XBPA 2O5YH 3QG7H 4PJ9B 2ZCLH 4RMQA 3SE3A 2LE9A 1FDLL 4I3SH 1KUMA 4KDWA 1XH3A 3MLZH 5JIIA 3ARVA 2C3VA 3V6ZA 4OV5B 2FBOJ 1BEYL 4DZ8A 2ITDA 5C07A 2X70B 4K9EH 1M71A 1KCKA 2FL5A 5EUKB 1ZT4B 3C6SB 1Q72H 4BZ1H 2P8LA 4KRNA 1HSAB 3TZVC 2ZSVB 5EC2B 4OCWL 5F7EL 2G75B 1LK2A 3H0TB 4FQLH 2JTDA 5H94A 3GIVA 5JLZA 5D6DA 4ONHA 2AKRA 3FMGH 4P2OA 1X5LA 2CLZA 4Y4FB 4X7EC 2A6JA 4O2CB 4TUKL 3O3UN 4POYA 3TFKD 6FABH 2DLEA 4YQXH 1FGVH 3FO0L 3GMNB 3ARBD 3R4DA 2AXFB 5A3IC 1TJHH 3QNXB 2IANA 3WFDL 2ARWA 5CZXD 1QHOA 43C9A 4RWYL 3FOMB 3TO2A 5KN5B 2NX5A 1IGML 4MLIA 1QBBA 3KYNA 4GRMA 2QHRL 2DQEL 1MRDL 4Y1AD 3KPPB 1CTNA 3C5ZB 2VLRA 3O6FD 1CICC 5F9OH 1U93B 1N5AB 4PJCE 4PJHF 4CVWA 4YDVB 3TFKC 2NY2C 1DL7L 3QIBC 5A43C 3MGTB 4JG1H 2WWKO 4OZHA 2MFNA 1VB9A 4PR5B 4X6DB 2AJZA 4QRSA 5JA8B 1FAIL 1NCAH 1CICA 1G6VK 1NDMA 5DMIH 2GJJA 3MFFA 2Q86A 4M5YH 3D6GA 3W82A 5DJ6B 3H3KA 1Z3GL 5KANG 5E7FA 2NXZC 5D2LB 5GRJH 4GT7A 3ZE2E 3FMGL 3TO2B 4K8RD 4H88L 1AGFB 3DRTB 4MS8D 1UACH 3O3AA 3E1F1 4F3FB 4GW1A 1P84J 1FC1A 1RURH 3QIWA 3U7WL 4PREB 5DUBB 4OI8A 2VXVH 2DQJH 2AVGA 3OXSB 3UJJL 2BY3A 3U1SL 3IB4A 3MC0A 1X7QB 1N26A 2VKXA 4YHNB 4TTDC 3CH8A 4NO5B 4YFEA 2VLMD 3C09B 4ORZC 5LGHH 1AO7A 1CK0H 1GGIL 1HSAA 3C5JA 3IDJA 3VWJA 1NCWL 4AJ0A 1EERB 1ZT1B 1ZANH 2NY3C 3AC0A 2CUHA 4WHTA 1IGYA 3F62A 1UEMA 1P6FA 4HUUB 3P0VL 3B9EA 4JN1L 4HMEA 4P23B 2D0HA 2H41A 5C0AA 4JG0L 3MBEC 2EIBA 4U6VL 2D9CA 4JM2F 3SBWA 5FO9B 3PWPD 3SKOB 4JO3L 3QHZL 1TJIL 3JBG7 1AC6A 3GJEA 3MLRL 1GVIA 1NLDH 3BKJH 1D6EB 1F8TL 4QXGL 3NCJL 2X4OB 1ZXQA 4NUGL 4K71B 5TFSL 5E2TL 5DSCB 1JGEB 5D7IF 2VLKA 4C59B 1LE9A 1G1CA 4PJXE 3OAUL 2VXVL 5DJ8B 4J3UA 3SN6N 4GAJH 2QSTA 3KPSB 2FX7H 5C8JB 5GJSL 4QRSB 5KG9A 1F3DJ 2ZUTA 1LO0H 1HYSC 4YO0B 5FIEA 2A6JB 1R3HB 2NY2B 3I2CL 3WUWA 1YEDA 4U1LA 3HMWL 3KR3H 1HDMB 2AXFA 1ETZA 3QDME 1A1NA 2IPKA 5DVLA 4K94H 1XF4A 1TENA 1JK8A 2EKSB 3CH1B 5MP6H 1I9JL 3A6BH 4I0KA 4PGJA 3FKUS 5F1KC 4MLSA 2NTSP 4FFYH 4DEPB 3KPRD 2E7LA 4FQQA 2Z8VC 3LQAC 3T4YB 4WJ5B 1YNKL 1P7QA 1KCSL 1JMZA 3PHQB 1HQ4A 5DK2B 5ID1B 1GC1C 2FIRT 5CP3H 3VRJA 3JWOC 4MCYA 1OCWL 5GS0H 1IQWH 2VDKL 2ZUQC 2A73B 4IOIB 2P42B 2YS4A 3PJSA 5I74B 5ALCH 2DBJA 4L3EA 4L9LB 4XCCH 3R06A 3L95B 5F7KC 2J8HA 4WDIA 3ZYOA 4HBCL 3CXDH 4OFVA 2V5SA 3BPLC 1TJHL 1NGYB 1MHHA 3E8UH 5CIPA 1CICD 1EAJA 2HWZL 4PRIE 3HPJA 3PGDA 3ULVL 2ZPKL 5D7LB 3SE8H 1S7UA 1N64H 3ARDC 3M17B 1U8QB 1YEFL 4YXKH 3NZ8B 5K9QI 3LH2H 3QUYA 2PYEB 4E42A 3TVMD 1N59B 4OD2B 3WE6B 4ENEC 4S11A 1NAML 1T21B 2MMXA 4EDXA 3VXQA 5FUCC 1KCRL 3QDAA 1OD7A 4ENED 1J05B 4XMLH 2X4NA 3U0TA 2HRLA 4K94L 1OLLA 1S9XA 5T5NG 1HH6B 4PJ5A 1SY6A 1FFOA 1KIPB 2P5EB 3KPNA 5HHPA 3E0GA 4ZOAA 3GKWH 3ARBA 2DI8A 1K8IA 3PABB 3UMTA 2H9GB 4IRSD 1XGRA 5IVXE 3D2UD 3OKMA 2JCCF 4NIKB 1G9NL 1OAXL 2F58L 5HPMA 4XI5D 5K59F 1LP9F 4M48H 4I77H 4NQDA 1EFXA 2EDLA 4DFIA 1I1FB 4OCSL 3VGGA 2APBA 1WT5A 3RFZC 4JO1H 1DVFA 2IPTL 5FYLL 1UXSB 4ZPVA 4EBQH 1DL7H 3L9RB 4MQXD 1CD1A 4AG4H 5CP7A 4QOKD 3B6SA 2VLRB 3F7YA 4GG8B 5KW9L 2X1WL 4Z7OE 2E8ZA 4OLUH 3SKOA 5IB2A 1PSKH 5HDQL 5F89A 3BDYL 2DQEH 4ETQB 3BPCA 3DV6B 1WICA 2XKNB 4LVEA 5HI3D 3WD5L 5LWYH 1BFOB 4YHLH 2W0FB 1BZ7A 5HD8C 4U0QB 3MLYL 3O45A 4WI6A 2DJUA 2HFFB 1PX3A 1MFDH 1DBBL 1QFWL 3QUZC 1A1OA 2VZUA 4I8DA 3C6LD 3BEWB 3GRWH 4OZGF 3L5WA 2EDTA 4ZYKB 1NLBL 5L9DH 2EDDA 1Q9LA 5IMKB 3V5DA 1WAAE 3NTCH 1DLHA 3O4LD 4BJLA 5E8OA 3ULUH 4I3GA 3GMMB 5D7IE 5E94B 5C9KA 5FO7B 5LGHL 4XCNA 1U3HB 1KGCE 4PREA 5FGBA 1NGQH 4R4FH 3LSOB 4GRLB 4XVJL 4Z8FH 2OI9B 1A1NB 2IPKB 3M1BB 2FHFA 2G5RA 5IB1A 4B41A 3QDGA 1T0MB 2V7NB 3H9SD 4XB8A 3MLVL 3L3IA 1CDGA 1RMFL 4XP5L 3VFSB 4L3ED 4XWOC 4HUWB 2F53A 1UC6A 5JPMA 1Z2KA 4I9WD 1CZ8L 5E6ZA 3QUXD 3TBSB 1F4WH 1P53A 3B9KA 5JIHA 1WLHA 1AH1A 5T3XD 2Q8AH 1R3JA 3S88H 3U9PH 4GSDH 1FFPA 4QYOB 3DVGB 5EIQA 1KFAH 4KK6C 2I9TB 4EIGB 1CDIA 5DO2C 2Y07H 3PJSB 3KPRA 2BNQB 1DBKH 1AGDB 3PWPA 3VDAA 3BRFA 1FORH 4OCMC 4IMKC 3H9ZA 5D72L 3MGAA 1DFBH 1OWWA 1VHPA 5GRYA 5TE6L 1OGTB 5D7SH 1KNOB 3MCKB 5EO1A 3X11B 1T22B 1MAJA 5CKGA 4I13B 4FQ2H 1T1YA 4LCYA 4C4KO 5IB3B 3NZ8A 3E6FA 4B50A 1BFVH 3TO4A 4OKVB 5T33H 2A38A 4DUVA 4GG8A 3JV6A 5I1KH 1DANU 1SYSB 2ORBH 1A1MA 1AP2B 1S7TB 3MRKB 1FL5B 4P4KC 3DOSA 1VEMA 2ZJSL 2KKQA 1R5VB 5FOJA 1U8LB 1T66D 5LGKA 4MS8C 1G7HA 5EU7E 3L3DB 3NPSC 1SEQH 3O6LH 4YO0A 2MCG1 1BX2B 2NPLX 4KY1L 2UZIH 2R8SH 4F33A 1Q0YH 4DFHA 4OTXL 1JVKA 3JUZA 1FNAA 1JP5A 4NPYA 4GW5A 2Z8WC 1JPGB 1QO3B 2Z35A 3U6RB 1FRGL 1AGFA 4ZOBA 5ADPL 1L6ZA 3N85H 2JK5B 3CFCL 4JPIA 4YXHL 4HUVB 4PFEA 4D0BB 1IARB 3O6FC 3SDCA 2EEBA 5BV7H 5DD6A 2FSEA 3JWNC 1Q72L 3LS4L 4D2NA 4ELKA 5TPWL 1E4KA 1MWAB 3LQZA 4G8FB 4KI5C 4Q9BA 1A6TA 2CDGB 4MSWB 4V1DE 1MAKA 4FQPA 5AG8A 5HHVH 4KC3B 4JVPA 3EDJA 2EDWA 3G04A 3SQOH 4GRLC 2E27L 2V17L 2PYFA 1K4DB 1FH5H 4CGTA 2F5AH 3G9AB 4UOW1 3VFGH 4ONGH 4F37K 4L4VA 3VD7A 3ARFB 1KXQE 4M7LL 2BK8A 43CAB 3CZFB 4XMKL 4RISL 4TNWF 4X8XA 1HSBA 4Z0BL 1XZ0A 3F58L 4W68A 3GMQB 4NZUL 4HWBH 3RGHA 1XF5B 4ODXA 4HWZA 5IVOA 3O8XB 4MMXC 4U1IA 1HHHB 2VOTA 5FHBL 3V5HA 1OWRM 2NY1D 1QBML 4NC2B 3S8WA 3ZTNL 3GJEB 3DHJA 4HK0B 2HT4D 4AENA 1EXUA 5E08L 1AY1H 4K2UL 1VESA 2EEDA 4MJ5B 4GUPA 3BXNA 3P4MA 2HT2D 1J8HB 3WIHL 3T77A 2VUOA 1PG7W 2VN4A 5C0CB 1S7XB 1JFQL 2NXYB 1S7SB 2X4RB 3PP4L 2IMMA 2B7DT 4BSJA 3B8YA 5JHLH 2HH0H 1AC0A 5C8JA 4L1HA 4OIIH 4U2YA 5C0BE 4HSQA 2FRGP 1XGTA 2DQTL 2YD1A 3NA9H 1FYTA 4HCRL 5I1EH 3DETC 3GJFK 1NAKH 5GIRA 4LSPL 1A6ZA 4ZD3H 5I1CH 2VZTA 4MNHB 4MD4A 1YC8A 4NQEE 5D2NB 2AEQH 5J13C 4NN6B 4LASL 5ILTL 3ARGC 3PNWB 2BHYA 3QYCA 2OMNA 4BSVB 2L0DA 3U1SH 1F02I 4WWID 1YNLH 2OR9L 4HXAH 5DJXB 4L4TE 3BT2H 3EFFB 3MV7B 3RZCB 5DJAB 1NPUA 1BJ8A 4FFZH 1A6TB 5LJYH 3SDXF 1GZQA 4JO2L 3ARED 1CL7I 3BIKA 4LVNB 3SDDC 4OD3H 5LG1A 1JZ3A 3ALWA 4R8WH 2V5TA 3MRLB 3R1GL 4KRMB 4GRLD 5CIPB 3T04D 4RCAA 1DQMH 2C9AA 1B9ZA 2DKUA 2QLVB 3ETBF 3LKNB 5ACZB 5HYQA 1EAPB 3H9SB 3ES6A 3U48A 1HCVA 1DBAL 4HUKB 3S5LG 2PYEA 3UJJH 4YLQT 4GKNB 4WW1B 3FQRB 4NN7B 3V5HB 3C9NA 2X1QA 3LQAH 1Q9KB 4ORGA 1MCIA 2WWKT 2C3HA 2YD9A 5JUEH 1I9IL 2YN3A 1JRHL 1JNHA 2JCCA 3LQAL 4TVPD 4K94C 5IJVA 2DQCH 2K3TA 4ZUSB 3CSYA 2QQNL 1IL1A 4HKJB 4OUUA 2EIEA 2ATKB 5DLML 3NTCL 1RSFA 3P0VH 4JN1H 2EE9A 1LGVA 1X5XA 2UZIL 5D5MB 1DDHA 4Z78B 2EH8L 4ZO7A 4X5LA 3CJJA 3Q3GB 3QO0A 4YBHA 4YR6B 2X70A 3T0ED 4EN3B 3KJ4B 1CBVL 3PDOB 4XT1C 3D85B 5CP7B 3MRNA 5FOBA 2UY7A 4EI5B 2ZOLA 1T03L 2FATH 2DLGA 2ZG1A 5JOPD 3QAZB 2FJGB 2G60L 3DUSB 5JHDA 1ORSB 1MHEA 1NCDL 2F54D 2YD7A 4PRHE 4DCQB 2YMXH 4PJ5E 5F88B 3ISWA 4QGYA 4WI8A 3FB5A 4PP2A 3X14A 2XN9E 4UDUB 3DBXA 3BH9B 3RUGF 1JV5B 5I8OL 5K9OB 3JUYA 5BW7A 2IAND 3F7VB 2YOCA 1FRGH 3OR7B 4POZD 4X6BB 3MJ8B 2AJXL 3MX0A 1J8HD 4MDIB 1CGSH 1SEQL 5TE7L 9CGTA 5JQ6H 5ESQA 4YR6A 1G7PB 3I2CH 1B0RB 1MLBA 4M4RA 2Z91B 5L2JB 4OM0L 2GW5A 3BZFB 5DD5H 4LSVL 1KJVB 5FUOH 4PRIA 2V2TB 5EPMB 4WIQA 2HKFH 2OZ4A 5EU4B 3D3VB 1MFCL 4U0RC 1CE1H 2PO6B 4OLZH 3V6BR 4XRCB 3HG1A 3O9WB 4DGVL 5T1MA 4QRTB 4ZFFB 4G8GD 2X4PB 2ZCLL 4LFHD 3VRJB 2EO9A 2RHEA 3I50L 5C70A 2EE2A 4D9LH 4LK4A 1G7PA 4Z7VF 5DJ2B 4QCIB 5D7JA 5IVXB 2QHLA 4OQTH 1BQLH 3NIFE 3O3AB 4KRPD 1D5IH 2GTZA 3G6JB 2PCPA 4LPCA 5MEND 1PGRB 4OI9A 4QRPE 4KUCF 4MHHG 4TSBH 4YDLB 4LLYA 2W9DL 2A1WL 3KYKH 2F5AL 2VXQH 1FV1B 3T0BA 4HJ0C 1I1CA 1ZHBB 4JDZA 4ELMF 3BUYB 3MCKA 5EO1B 3X11A 2D31B 1P2CB 2DAVA 1H5BA 3Q0HA 1U8NB 3VDCA 4PJFB 4Y5YB 1TVHA 2DQHL 3DX7B 3NBNA 4ZSOB 5GS0D 4H5SB 1P4IH 1UZ6F 3DTXB 4M5ZL 3ZL4H 4HIEB 2Z9TA 4DCQA 4DAGH 1MRCL 4O51A 1VFMA 4IJ3B 3EKCA 5E8DL 4LLUA 2AV7B 1D6EA 1S9YA 4UT7H 4Y16B 4PRPE 1AQKH 4M1CD 1MJJA 3RA7H 1EK3A 1UACL 1TIUA 3V6OE 2ZUWA 3C8DA 3N1PC 2FJHA 3QFJA 3PP4H 4MX7B 1LVEA 2SEBB 1GGBH 4U1KA 5EZOH 5KS9B 3MV9D 1P2CA 1A3RL 2WQRA 5GRUH 1YEHH 3MQIA 3TIDA 2JIXD 2Z31D 5BCAA 2VITA 1KT2A 2JK5A 5HSFA 5IWLA 3BAEL 5E1HB 1Z9SA 1MCPH 3RAJH 1D9KB 4PUBH 3CFDA 3MRCB 2J12B 4F37F 1LO4L 1RI8A 4P4KB 4RMUA 1EGJA 1KN4L 1Z9LA 3B2UD 4MQXC 3MRBA 3O81A 4PGZA 4X6CE 4TNWK 4CADB 5CD5D 4FQQB 1TZIB 5T3ZE 4NM4H 1OVZA 3TYFB 4IMLB 1N2RB 2GITA 3GKWL 4QRPA 3SGEH 5JOEA 4M1GL 1XMWA 4LOUD 1TETH 3HR6A 1TVDA 4S2SA 1PZ5B 1MLCB 4HIHB 1CXIA 1I8LA 1IAIM 2EDKA 1T80A 4S1QH 3BI9X 3K7UA 5CZVH 3DYOA 3FN3A 2VDOH 5GS1A 4U3CA 3T4YA 3KYOA 1CF8H 1EX0A 3KLDA 4UMGA 3O8XA 4YHYC 5DVKA 4F3FA 4NSKB 1Q8MA 2WNGA 3P73B 5F1IB 3BD5A 1M7DB 1MJ8L 1UFUA 5JW4R 1I9JH 2Y7QA 3A6BL 5EFIB 5IQ7H 4L8BA 5I74C 3FFCE 3GSQB 5E99H 1GL4B 4Y5YA 1MCHA 2Q3AA 3ARFC 4XVSH 5IBUB 2ESVE 1KIRA 5KSBF 4RAHA 1DQLL 3VXQB 2ZCKH 1FFPB 2AJXH 1EA9C 2V5RA 4U6XB 1U3HC 3KR3L 4KK8C 4JM2C 5B39A 2MHAA 3CFEB 2OLDA 5CMAB 1JZ6A 4K07A 5TPWH 3T3PF 3EO9L 1OTTC 4NKOA 4ZS7H 2OZ4H 3U0PB 2DYPB 3BGAA 4MD0B 4CW1A 2XXCB 2BNRE 3K81A 5IIEA 3I84A 2AJVL 1FV1A 2IBGA 5J1SC 3O3BA 5AZEL 4H0IA 5IW1B 3WEXB 4XNZC 1FN4A 5D70H 4U6HA 1KCVH 4QRRB 1WV7T 3D2UB 5I16B 4ZUUA 4X4YB 1C7TA 3UZEA 4WO4A 1D9KA 3B43A 2J8UF 1D5XA 5KSVA 3RPIB 3T2NL 1Y18B 12E8H 2LU4A 2R1XA 3MRCA 4X6DE 5FYKL 1HINH 2YPLD 3AMKA 3QP3A 4UIKH 3TESA 4Y2DD 1YMHA 1UWXK 3V9FA 4D94A 3WNKA 3P4OA 3PV7A 1ZLVH 1BQLL 2X1XR 5DRXA 1C1EH 2D3VA 1UXSA 5HGDA 2IGFL 1MEXL 4L3AA 3LRSB 5E56A 1FO0H 1IC7L 1EHNA 3SDYL 3VFOA 3GI8H 4KDVA 3QFJB 2W38A 5JO5A 4JQIH 4LBEA 3RWIA 3ARGB 3Q1SH 3UYPA 4P9ML 1KXVC 5IMOA 5A40E 1EAPA 1NCCL 3QO1A 4I3RL 4XAKE 3BPOB 4Z7WB 4MXVE 4PP1D 2DQHH 2DKSA 5HGGS 3D3VE 5C09D 1OSPH 5KSUB 4XHJC 1G6RL 4FZEH 4XXDA 3BKCH 5KVDH 5TF1L 4KROD 5E1AB 1E28A 1P69B 4EOWL 1MEXH 3MBED 3MJ9A 1IVLA 4GXUN 4YHYB 2UUDK 2W9DH 3WJJA 4KKBD 3S37L 4G9FB 3V7MA 1UWXH 2XZCL 2YZ8A 2IADB 5C2BL 2QTEA 4XCNB 3IRPX 3CXDL 2FEDC 4HGKC 4KMTH 3TA3B 5L7XH 1OAZL 3SKJH 1QSZA 3WSQH 1IAMA 1T21A 3SCMC 4LCIL 4HKXB 3RWDB 2W91A 2JELH 1CVSC 3AROA 3OJDB 1FPTL 4GAYA 5GS1B 3BGMA 5A2FA 2DQIH 3KYOB 2ENYA 4NKDB 4R4FL 5FO8A 1SEBA 4QXUL 4RMVA 4F7MB 4HLZG 1UXWA 1UGNA 2AEPL 4NBYB 5HI5C 4IOFC 5HI4C 1J8HA 3RY6A 1VACB 1MCOH 2AK1H 2QADD 1WBZB 2RQ8A 3BMWA 2RFXB 3CVHL 3NCYS 3JZ7A 1G0XA 2IPUG 1SJVA 4GRWF 4OZFA 2IH1A 2CMRH 3GK8L 1AE6H 4GBXB 1UA6H 4F15C 2QL1A 1YPZB 4K8RH 2RCSL 3L6FA 5GGTA 4G6AC 4PJ9C 3O2VL 4ONGL 3I3BA 4FABH 1LEKA 4XB7A 5EU3B 2B8OT 4HGWA 3RKDD 4AYFA 5F1SA 4NRZB 1WZ1H 1PEZA 3KLSA 1IE5A 4QRUA 2HTLD 5IEHA 1P4IL 3OXRB 4NO3A 3TZVB 1SMOA 5DJDA 2UYLA 4HMCA 4OIBA 3FJTA 3HG1B 3MREA 3O9WA 5B38A 4EI6A 5HXMA 4P3WA 2Y06H 1NLDL 1ZA6B 4BQCA 4JFFD 2MJWA 1XF3B 5CLWA 4WW2C 5HHNA 3TNMB 4B0MM 3ESVF 3B3IA 1NGXB 5E5MB 3FAXA 2IBZY 4JANA 5HGHA 3X3FH 3THML 2DQCL 5DRWA 2J8UE 4PRNA 5HHXH 1T7XA 3HI6H 5E8OB 3QDGD 3U36B 4XBGB 3ZE1E 1U8JA 3C2SA 2EECA 4GKSB 1ZHLB 3VXSA 4OAWB 1C12A 3BQUA 4X5XB 5C07B 1CXHA 4NNXB 3WKML 1GGIH 4LLQA 3CX2A 5E2WH 4YWGH 1QSVA 3HE6B 1VKXB 5AYQA 3MLVH 4KK6D 3TA3C 1SVCP 7FABL 5B4MC 4NWUL 5CBAA 4H1LH 3SJVD 3FFCB 4LPUA 5T3XL 3WFEL 4YH6A 4BK5A 3KLAA 3VH8B 3O2WH 1Z6JT 5J4MA 4PJGE 3D39D 5IKCB 2VJXA 3LS5L 1BLNA 2VDKH 4O2EB 1RUAH 3I6KA 4JDVA 4MQ7B 5EBLA 4MX7A 3T0EC 1WEJH 1OSZB 1CR9H 4Y8AA 5CILH 1QLRA 5SV4A 4FQ2L 4JAMB 1T22A 2FGWH 3NIFF 2AK4B 2HLAA 4X0KB 5I16A 4HBQA 1K2DA 1X6LA 5CD3A 3WUZA 3GDBA 4PGEB 4RBPH 1HHKA 1ZV5A 5CJXA 4UTAL 4XBEL 1YEJL 3E3QC 3TCLB 2A1WH 3KYKL 3LKSA 2HFEA 4H0HB 2X7LA 1WWAX 2XICA 5K9OA 1FCCA 5F1NA 1UH4A 4YXLL 3NFNA 4X9GA 3KJ4C 5F44A 2J8UA 4Z0XA 5C08B 3QFJD 4N0RA 1AGCA 2I26N 4H0GA 4DOHE 1CYGA 3ZO0A 1ITBB 3IJHB 3ZL4L 1RK1B 2ZZUT 1BOGB 4JCLA 2IQAA 1S8DB 3S35H 4TPRL 4HUVA 4K2UH 2XWJA 4C56B 2KZ1B 3IDYC 3QEUB 1MSPA 3D3VA 3HKFA 4Z7UA 3UEZA 5FK9A 2DL2A 3BVNB 4OB5L 5SV3A 4OZHE 5HBBA 4EXKA 5MERB 4LCCB 1JGDB 3HUJE 5C86A 3QEQB 2VZ1A 2AJ3B 1RUQL 4D8PB 3G5XA 2DBLH 4DKEH 4OB5H 3U4AA 1BHGA 2XOTA 5DD5L 3BESR 1QYGH 3K74B 2WBKA 5B8CC 4TOYH 3LV3A 3BUTA 5IFJB 1LE5A 1MY7A 4QCIA 3PWPE 5D7JB 3LEYL 4ZUTB 1AE6L 1HHGB 3LN4B 3WIFA 1RK1A 3TH4T 3TT1H 1L4IA 1MOEA 3IFLL 4CBPA 3MRMB 5MENA 4N5UA 4FOMA 2Y06L 1XF5A 4ODXB 1MCSA 2CKBH 4OGYL 1GH7A 2BVUA 2CO6B 4DK3A 5IT2H 2OP4L 1T2JA 1SQ2N 5LGJB 3VXME 1U91A 1W2KT 5CMAA 4ZTPH 2R0WH 2DWDB 5F3BA 1FZKA 2AV1B 1IZKA 4RX4A 2DYPA 2ILLA 4OFYD 5FGBC 4HWZB 3RVVD 1X3DA 4XBGA 4PJEA 3TYGH 2OSLA 4ONFH 1I8KB 1W72A 4J3OC 4TVSa 2DQUH 1IGMH 5D1XA 1VSCA 4K9EL 3ME0A 5K9JH 1GGCL 3IJYB 5F6IB 3FT2B 4N0FA 1FL3B 4U33A 1NBZA 1A9EA 2DLFH 2FYYA 2X09A 3DPBA 4G6MH 1BGXH 2AV7A 2YBRA 3RTQA 3KPOA 2A9NL 3EFFA 4EI5C 2Z93A 5EU6B 3SOBH 5KSBE 1UYWL 4RFOL 3RVUC 4FTVB 4F9PC 2R4RL 3ULVE 4KMTL 3EYQC 3CVHH 2XT1B 5DR5L 1UM4H 1W72L 4G8EA 2CMRL 2GSIB 3Q6FB 1IGCH 3KPRE 4M9OA 4NRXA 1JHTB 4LDOB 3WHXA 5L2KD 1E27B 5IROC 5ITBH 2EDEA 1NC4A 2WP3T 3RWEA 4LSUL 4J2XA 4X4MA 3MFFB 4BFBD 4I5BB 2ZOLB 2NR6C 4W81A 2RR3A 3OB0H 4KAQL 1HK6A 4PTTB 5GIRB 1HN1A 2ICWB 1QSFA 2JCCE 4PUBL 2NMSA 4XNMB 2PF6A 5D7SL 4ZTPL 1OM3L 1RJYA 3VRIB 1P7KA 5TDNB 1DQML 4CMMB 1I75A 3V79C 2BCKA 4P4KA 4GQPH 1U0QA 3RVXC 4V1DB 2N7AA 1A3LH 3OXSA 3NCFB 3QHZH 2XQBL 3CU1A 2A6DB 1GOHA 4L3EB 4L9LA 4OGXH 1FVDB 2DLTA 3MOAL 3U9PL 4NO5A 4U7KA 4PRIB 4H20H 4PRNB 5TQ0H 5FYLE 1OP5K 1BD2D 2OM5A 1MIEH 3FQUB 1U8PB 3IGAB 3DXAA 3REWA 5A16B 5D71H 1I1RA 1CGTA 2PO6A 2ITDB 2ICWA 4HFWA 3QQNA 1B88A 5HGAB 1HOCA 4D0DA 3OKKA 4HKXA 4XPHH 3RWDA 3NIGF 3O4LB 3KG5A 3SKMB 1MJ7H 2G75A 3FQWA 3B2VH 3HA0A 5D8JH 5B3JE