5IVXE

Crystal structure of b4.2.3 t-cell receptor and h2-dd p18-i10 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
194
structure length
194
Chain Sequence
QQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSNKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASASFGDNSKLIWGLGTSLVVNPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2016-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ivxE02
3SDCB 2HFEA 4HULB 5M7QA 1NH6A 2D4DA 4FQIH 3ZE2E 2H9GA 4OKVA 1G7QB 3T4AA 5SWQA 5EU4B 3GM8A 3LQAH 3WDIA 5HBBA 1JHTB 2EDHA 5L0QC 2FGWH 3H9SD 4Y4FD 3WSQL 2AP2A 4B53A 5HYFA 1DQDL 4MA8H 1JYWA 4MNQD 5J3HC 4B7LA 2DQFA 1LEKA 2GYSA 4UTAL 2CLVB 4WU7A 1ZSDA 2D7NA 1MLBB 1YJDH 3NOIA 4LVHB 3CDGB 5D1XC 4OQTH 5FOJA 5D93B 5KVDL 3OZ9H 3V0WH 4TSBH 2E7HA 4UB0H 3G5XB 3A6BL 43C9A 4HWZA 1NCDH 4HBCH 1YEHH 1NFKA 3S36X 4J6RL 4LAQH 2PUQT 4TNVK 3S88L 3ARSA 3AC0A 4X4YB 3L6FB 3O6MH 4KY1L 1FDLH 2OCFD 1U8LA 5F8RC 1EVTC 4WIQA 4ZFZB 3QBTB 2DYPB 1HH6B 5SWZA 1FIGH 3MJ9L 3LEXB 2QHLA 2J8HA 2R9HD 3QPQC 3VMOA 5ID0A 1DEEA 1PSKL 3EO9L 5FAAA 3QEUB 3BEVB 2V17L 4NRZA 4XVJL 5KZCB 5FECA 3SCMB 5AAWA 4QRUB 5T33H 4NRYA 3GSRA 2WK2A 3UZVB 2L4OA 3QWRA 4O9HH 3QNZA 1X5YA 4HIIA 3UPRA 1CU4L 4YUEL 4X8JA 5TF0A 3VGFA 4EUPB 4ONHB 4JHBA 3WNPA 1QKZL 4WW2F 3FONB 1OP9A 3TPKA 2O5XH 4AY0A 4XHQA 5JDSA 1PD6A 3C6LB 3GK8H 4DGIL 4ZS6C 1MCNA 3S4SG 1LP9F 3ZE1E 1QFUL 4QTIH 1H9VA 4LEXH 3VXSD 2VJXA 3IYLW 4NM8H 1EAPB 5E00B 2K7PA 3MUJA 3CXDL 4Y5XC 2VLJD 1FVEA 4U1SB 1S7RA 3ARBA 4YHLL 5E24E 1UJ3B 4PYGA 4U0RB 2NY1C 3HC0B 3VXUB 5K9KB 3LD8C 3GNML 1X5HA 5SWZE 1H0DA 3GB7B 5E8PA 5DRZA 4OT1L 5KG9B 5I76B 4LQ1A 5KS9A 5GGRA 3HAEH 5L8LB 2VXSL 4PJ5A 4IDJL 2P5WB 3TA3A 2F15A 2XKNB 4M7LL 4YIQA 3LY6A 3RNQB 3ZE2F 3JVGC 3FFCB 3FFDA 4AEFA 1HYRC 3CFEB 5EU3A 1I3GH 3EOAB 3RWCB 5DRNA 4Z77A 1UQSA 4MYWB 4RFEA 3BESR 5DVLA 2ERJC 4RWYL 4NFCA 1UM5H 3QIBD 4YZFE 1AH1A 1FV1B 2JIXA 2HLAB 2BXZA 5GZNC 2F8VA 5DVNA 2AV1A 1FO0A 3SGKA 2EE2A 1ZV5A 4YDLB 2XPGA 4G6JH 4F15C 1YPZF 4WGVB 1JNHB 4Y4KA 3RX7A 2Z92B 1UJTA 3BQUD 3GBNH 1UB5A 4URTB 2FX8H 3K4ZA 4YHIB 1MRCH 5C07A 5HVHB 4WFFD 5SWSD 1XF4B 5LXGH 4RGND 1F2QA 1T5XB 1CVSC 1A7RH 5TPWL 5LGHL 5I1GH 4NNYA 4L5FH 4Q97A 3MLVL 3E3QC 2B4CH 5EU6E 1VFAB 2FWOA 2V7NB 3L3OB 4PJ5E 3Q48A 5D7LB 5ICXB 5LCVH 4I0PA 3KYOB 1NLDH 2J8UA 1A3LL 2B20A 4Y4FC 2R23A 3SBWC 3T3ME 4KKBD 3KG5A 1RK1B 4M8QB 5DUBB 4UT9L 5DQJA 4K7PH 3BZFA 3HNSL 2X1PA 1KJ2A 3CFBB 1CTOA 3PL6B 5IMKA 1CG9A 1WT5C 1V3KA 2H2PD 2GKIA 3LRGA 1KV3A 3VXRA 4MCYA 1K8DB 5FF6B 1EEUA 3ARQA 5FYKE 4C56A 1A7PL 4NNXB 1L7TH 1CFNA 1ZWIA 4M4PA 2UV3A 1JE6A 1FYTA 1KIQB 4KGJA 2ICWA 3DV4B 4PJEE 4Q2ZB 4FQIL 4U1LB 1S5HB 1XGPB 1UWGH 1VDGA 4RGMB 1TJIH 2R9HC 4X9BA 2C1PB 1HOCB 1NJ9B 5IMLB 1P6FA 4I48A 5GS0H 2FGWL 2YD6A 3RDTB 4MA8L 4G3YL 3T1FA 1SYSB 5IQ7L 5D2LA 2J8UE 1SQ2N 1URLA 2NLJB 5E8OA 3O9WA 4POZD 3VD9A 3TJHD 4KMQA 4QCIB 5IFHH 1OB1A 1X44A 4OQTL 2XKUA 1MFNA 3JWDH 3MXVL 3I2CH 4KUCD 4LIQL 2D7OA 3V0WL 4TSBL 1WWBX 4GW1A 4YZFF 3V6FA 4LU5H 4N90D 3FO9A 4U7KA 1BREA 1ETZA 1NCDL 4HBCL 2O61A 5TQ0L 3VFOA 2Q7YB 3KLHD 3DYMA 3PDOA 3U7WL 4P46A 1U8IB 3FJTA 5DRXA 4PJDA 4LNRA 3ZZ1A 3C5SA 3VXRE 1F11A 1XAUA 4HUUA 1OOAA 1C1EL 2BSTB 5IJVA 4O4YH 1CZ8H 4KMLB 4PLOB 1N6QH 1N6VA 1YN7A 1KGCD 2HJKA 1CDBA 1UFUA 1FYTE 4LBEA 4TVSa 3EJYD 3WKNA 5ETUA 1C12A 1KT2B 1S9XA 5EWIL 1NC2D 1XGRA 5EO0B 3G6AA 4D0DB 3RWFB 4KHTL 3IDXH 4N0UB 4PGBB 1MCLA 2DAVA 5DJCB 3OL2A 2DDQH 3VXNA 5DEFA 3LRSA 2YSSA 3QDJA 3SKJH 4WTWA 3TYGH 4QF1A 3B2UC 3GK8L 1QLEH 4NCC2 3QIBC 1T7XA 1A9BA 4RZCA 3T3MF 5H35B 4QTIL 3G6JB 4OZGE 4AZ8A 1Q0YH 1PY9A 5BQ7A 4FQHA 2B8OT 1AO7E 3BW9A 3S35H 1OL0A 1DDHB 3Q2CA 3O11A 1Q0XL 1LVEA 2PTTA 3BH8A 4ORGB 1JGEA 3BQUC 4AH2A 2L7JA 4MAYD 3RIFK 3RTQC 2Y4SA 3TM6A 5HDQH 3RWJB 4F7MA 4XP5L 3PWPA 1SY6H 4F9LC 1C5DB 5L2KA 2VZUA 4QRRB 4HC1A 3QP3A 4HH9A 3CVIH 4PJEF 5A2JH 4WHYH 4X5WA 4J3WA 4G8FA 1RQ5A 5C8JB 2IAMC 4JFEA 4V1DD 2BNUB 5B38G 4PJBA 4GBXB 2OMBA 2FEEL 2YD1A 1ZLSH 4TNWF 5HXMA 3T08A 1CL7H 4X6FA 3NFPA 3VCLB 2DQJL 3H0TB 4OUUA 4JDVB 3QDJE 5K59E 4Y1AA 2OSLA 1BFOB 3MV8A 2BSSA 5C0NC 4N0CD 5TDOA 2HFFA 2VABB 4P2QA 2VN7A 1BIIA 1VEMA 2OL3L 1AGFB 3BPOC 5IOPA 1ES0B 1JWMB 3BIAX 4Q74A 2WANA 4EN3B 4M93B 2IEPA 5C9KA 4GRLA 5H8DA 1HWGB 1WIUA 1MJJB 2HKFH 3GMLB 3DI3B 1ADQL 3GBNL 3IFPB 1A6ZB 1FZJB 4UDUB 3WV0A 3MBEC 4Y5VC 2FX8L 4P3WA 1DFBH 2H2PC 4IJ3C 5LXGL 4I3RH 1MCBA 3SE4C 1A7RL 2XWJB 5D4QA 4PJ8B 5I1GL 3TN0B 5DK0B 5I16B 3HG1B 5C3TA 1K85A 5MEQA 3WIFB 5BCAA 4WNQB 4X6DB 4CKVX 2C4XA 4HMCA 4P57A 1C08B 1T5WA 1FG2B 4WV1A 5L2KE 1KN4H 2YWZA 4I5BA 2NW3B 4J23A 4OKDA 1B2WH 1N8ZB 1KB5A 1MI5E 1V7NL 1WAAE 3ETBF 5AG8A 1IEAB 5DC9B 2X4TB 1IEBB 4JFEE 3O2DH 5TDPB 3CVHB 3QPXH 1BF8A 3MJ8A 4PJ7B 1JZ5A 1YY9C 4JY4A 5I8OL 3F12B 5DJ6A 2MKLC 2VLKB 4P4RA 5ISZE 3MV8E 4XVUC 1CFSA 5C09E 5IB5B 4K7PY 3TO4A 3LRHA 3MV9E 4R4ND 4GLRI 4YFEA 3U4EB 2Q8BL 2EEAA 1JPST 5GGVH 4PGZA 1H3VA 1YECH 4OZGF 2BXYA 1L7TL 3F65A 1BFTA 2FSEB 1KELH 4XC1H 2CDFA 2CUHA 5F1IA 4R0LC 3PWUA 1OPGL 4J1UB 1VGKA 1W8OA 1UWGL 2OJZH 1NFDF 5DFVD 2AK4D 3P4OB 2XZCH 1J05A 4NIKB 2VDML 1CD1A 4JREC 4XP6L 3P73B 3U1SH 5F9DC 4APQB 4JM2A 3RGVB 2EICA 4L8DB 4R7DA 4MA1B 2X70B 2AJ3A 2VISA 4JO3H 5I1EL 4L4VA 4P5TD 1G7LB 2UWEB 3ZYJA 5GIRA 4M5ZH 3L3JA 4LU5L 3RVVC 1CVRA 5DF0A 1QSFA 4MXVF 4K7PX 2QJDA 1PEZA 3ZKNC 4LDLB 5IR1B 4M9PA 4OIAA 4OCXH 4Y7MA 2GT9A 3P4NA 4JY6B 4X6BA 2XQBH 5B8CA 2CIKA 2AQ1A 3MRPA 4NJAH 5I8EB 3IRPX 2ATPA 3WNNA 1GGCH 1CF8H 3ZKQD 4HIHB 5HHOA 2PF6A 3S4SA 5FYLD 4AT6A 4GG6E 1UACL 4JZJA 4PJHA 4FA8A 4I77L 4MAYC 1IC1A 3QHZH 1QPXA 4LOUD 4PY7B 4E5XB 1YYLL 1KJMA 4PJAF 4P4KC 1MQKH 3NACL 4YPJA 4PP2A 2HG5A 3IDXL 5JUEH 1X5KA 4XNXH 1BIHA 4HKJA 5D1ZB 3ALPA 5D1QD 35C8H 2PW1A 1WAAF 4FQXB 4D94A 1X7QB 4KDTA 3SKJL 3TYGL 3B6SB 2A1WL 3CSBA 5CGMA 4ONGL 4ZQKB 1F4XH 5DUML 1X5FA 2A6DA 4HIEB 1JTOA 4Z7OF 4HKZB 4O02H 1WBZA 1RZ8B 4IRJD 1AFVL 3PQYE 1Q0YL 4KC3B 4P5KA 2HT2D 2X4OB 3LAFA 3STZA 4N0CC 3VXMB 3BXNB 1QSFE 3VFNB 1RJLB 1QOKA 4K3HA 2RR3A 5IKCA 3MRLA 5AWNL 3S3PA 4HKBA 3WBDA 5CIPA 4W68A 4M62H 1GGBH 1XCTB 1BFVL 1Q9WB 1QBML 1FSKC 4R7NB 4XNMA 2R2EA 4U1NA 2WIIA 4CADA 2AEPL 5HHOE 3GMRB 3T65A 4PJHE 1L7IL 5J1AA 4GQPH 3CVIL 4N8VG 1NC4B 5DGQA 1JYVA 1FFRA 2NYYD 2Z8WC 5CP7A 2JJWA 2PTUA 4DEPB 3PHOA 1NKRA 1P9MA 1EMTL 3QEHA 3IGAB 3P0VH 3PP3H 1I8IB 5DMGD 5DZNA 3TYFA 5ESAB 5EIIB 1D7FA 4QHLB 3N85H 3F7YB 4U1KA 5C0JA 4UV7L 5I19L 3ARFB 3WD5H 4PUBH 5D7JC 4NZRL 4NQCB 4QHUA 5BOPA 2IH3A 3O4LA 5E8EB 3BJ91 3T4YA 2BJMH 5BMFH 4WW2B 4E9LA 5GGUA 2AV7A 3ZT7A 3UEZA 3FQXA 3SO3C 2Q6WB 5DJ0A 1FL5A 4MCZA 1U42A 2HKFL 3EYOA 5BZWA 4QY8B 5IVOA 1DVFB 3W2DL 5DJXB 5J6GA 3U82B 1LP9B 4MWFB 4R4NC 4LHQB 4JR9H 1AXIB 2SEBA 3QIUA 4OGZA 3O3UN 2UYLB 4JRXB 1T1WA 3HC4H 2DLHA 25C8L 3UTTB 5EULV 4NQDB 4V2BA 5F1SA 1I9RH 1AGDA 2PYEA 1RU9L 3G6DL 4XMLL 2J88H 1KLFA 3LPWA 1XZ0A 3GIVA 2XFXA 1U3HB 4FNLL 5K9OB 1KN4L 3L7FB 1B2WL 3I02B 4R4BB 2P44B 5IV2A 2GK0B 1JWUB 2W0KA 2YPLA 4Y4HB 5IW1B 1FCGA 4HHAB 2IQ9H 4XNQB 1ZHKB 3NZHH 4PJIF 1H8OA 5GISL 3QPXL 1O0VA 3R8BB 4KFZC 1CWVA 2R39A 3PABB 1W8NA 3MODH 5DD6A 4JFOA 4CMMA 2WWMD 2FJFA 3E8UL 1QLFB 4LVNB 1VGEH 3UYRH 3O3DA 4I18B 4JPWH 3RPKA 4MJ5A 4QOKB 3KDMB 5L6YL 1Q1JL 1EA9C 1O7SA 3NCJL 4PTUB 5GGVL 4LLVA 1YECL 1QFWH 4ZFFA 1YPZB 3C60B 3FCTA 3DVGB 5IB3B 3BO8A 5GGVY 3NIDF 4XGZB 2BFVH 3E3QE 1MY7A 4TN9A 2G9HA 4EQ3A 3FB6B 4Y16B 4BQ8A 5IMOA 4ELME 4YQXL 2DI8A 3OKOB 1BLNA 1FL3A 4N8VB 4LLUA 1FBIL 4OCMC 1EFXD 5J11C 4K3JH 3G08B 1RIUH 3JV4A 4LLWB 2Z93A 2WQRA 4YE4H 4LKXA 4XCCL 4HV8A 3MLZH 1WCBB 4GUPA 2WWKT 3U1SL 1RZGA 2Q76A 2XG4A 4R97B 1P84J 2WBJA 3WUWG 2RJMA 4XP9H 2CQVA 4UQ2A 3PWVA 3VFPA 1ZHNB 3CSYA 4I4WB 5CEYA 5DI8A 4P2OD 3EO1A 3SGEH 4ZAKA 4JO3L 4CRPA 3OJVC 5AAMA 4PJ9D 3RWIA 2RIKA 4NDMA 5EOQH 4ZO9A 1BBJB 2Q3AA 3KHOA 3GRWL 2PO6B 2C3XA 3T09A 2HT2C 5FYLL 1NMAL 3LKNB 4KROB 2XQBL 5F6IB 2JELH 4JRYA 43CAB 4F57H 2OZ4H 2G2RA 1ED3A 4ENED 3HR5A 4NJAL 3W11D 1CF8L 5KAQF 5F7DA 4L4TA 3S97C 2IBBA 3ES6A 1FZOA 1S8DA 5SX5H 3D2UD 5C0GB 3TCLA 2ICEB 1XGTA 5BS0E 2GTZB 1U58B 2R2BA 5IIEA 4LASH 4ZFOL 2OR8A 4ZUUB 1MQKL 3QUZC 1IAIL 4JANB 4XNXL 1WWCA 2YXFA 2NYYC 3ZLQC 1OQOA 1I8LC 3PE9A 4HJ0C 4UBDC 2C5DC 1DQQA 2YMXH 4K7FB 3LKSB 4QT5B 1X5JA 5DMGC 1OGTB 1F4XL 2ID5A 2UUDK 3J8F7 1P7QD 2P47B 3IFNL 1FGVH 2EO1A 1OT2A 4P3DB 5DVKA 4J3SA 3AS3A 5E03A 2KQNA 3WL9A 5EO9B 3O41A 5B38A 1TNMA 1RZJH 3ILQD 4KVNL 3TESA 4LPYA 5B4MD 1H15A 3P9MB 4PBXA 3MRMB 1J0YA 1GGBL 1AQKH 4M62L 2GITB 3MOQA 1CICB 4HKXB 5DD1L 1Q8MA 1FFOA 2DWDB 1U9KA 4PRPA 3ARGB 1FVDA 3R1GL 3VFRB 2HVKB 3H7BB 4G9DA 4HT1H 5DFWH 3G5ZB 4IRSD 3DGGB 4ELMF 3U46A 2YD5A 4OD2B 3WUWB 3CSPA 1RUPH 3P0VL 4NO5A 5B3JE 3MLWH 4PGJA 4GOSA 1C5BH 1NCAL 4NO2A 4C4KT 1LE9A 2H32A 3OKNA 5EU6B 1IAOB 4Z9KB 2VDLH 3ULUH 1DBJH 2FNBA 2LV4A 1UH2A 3KPPA 1YNTA 2D03H 2COQA 3FMGH 2XQYG 2BJML 3THMH 5BMFL 2WWMC 3DRQB 4RQQB 4ODTH 1K5NA 1M7DA 1MJ8L 5JXED 3L3KB 1G6RB 5LWYH 1DN2A 3LOWA 1PG7W 5JXAH 1FH5H 3D0LB 1KCRH 5F8QC 2BVQA 1A6VH 1YN6B 4OFPA 1M7IA 1JRHL 3T3PF 4HGKC 2BDNL 1R5IB 3ZKXB 5IFAL 1I9RL 5HHVH 3AFLA 2J88L 2Q1EA 1D9KC 1KCSH 4PRPE 3N1FC 5I66B 1HDMB 3LN5B 3UJTL 5JNYA 3V7AE 4TOYH 3C5JA 4W6XB 2CDEB 1AIFB 3RA7H 3T8XA 3O2VH 4PJEB 4BA8A 1D5BA 5HGDA 1AGCA 3P4MB 3CZJA 5DC0A 2FX9H 3P0YL 1MWAL 3MRRB 1AE6L 2JK5B 2OTUA 3DBXB 3IDIA 2EEDA 5D7IF 5DJYB 4CU7A 2K3TA 4PD4K 4HS3B 3TBTB 5IFJA 4H1LA 5C0CD 3UYRL 2B2XH 1BZ9A 3AROA 3HZKB 3MRIB 5MENA 1KC5H 2NXYD 4J8RB 1GPOH 4UU9A 4JPWL 5IHZA 2QLVB 3C5ZD 4PJ9C 3OPZH 2P5ED 5K9JL 2NY3D 3WFCH 1PY4A 2VLRD 1T20A 4PRIA 4C83A 5E8DH 4Q6IA 2FIKB 3ROOB 4ACPA 2BFVL 4NO0A 4WRLA 2X4RB 4XXDA 1HINH 4YR6B 3WIHA 2ADGA 4Y5YA 2ED9A 5ECJE 5HYJA 5DQDH 1G6VK 4MA7L 4DQOH 1NMBH 3P2TA 4K3JL 4ZNEA 1RIUL 3SQOH 1FVCB 1KG0B 4QXWA 5FUCC 4YE4L 5BRZD 1B90A 2QHRH 4TNWK 1PZ5A 3RKPA 1EV2E 3MRHA 4G7YL 1UM6H 5FYJU 4XP9L 1P5UA 1NCCH 1Z9MA 1YQ2A 2A6IA 3EZJB 3MNVB 5IGXL 3VFUB 1VACB 3IDMB 1WSST 5KN5B 5I1IH 5B3JF 4TPRH 2A6KB 4LRNH 1XH3A 5IBUB 3BN9C 3MBXL 4KKCC 4H26B 1J1OH 5DSCA 1MFDH 1RUMH 4RNRB 5EOQL 1U93A 3QUKA 3RL2A 2AABL 3L5XH 2Y72A 3QFJA 3HMWL 4K8RC 3ZT5A 4QRTB 4Y2DA 2VUOA 4WWKA 5C0RL 1GXEA 5CSGA 3DXAA 1RAMA 2ADFH 5D8JH 5I9QC 1TITA 3F7QA 5IVZA 1CE6A 1UWEH 4PRIE 3I6LE 2OZ4L 5B22A 4Y8DC 1I1FB 1RVFH 3L3GB 4HUVB 5I17B 3RGHA 2V9RA 4OZGB 2JB5H 3BN3B 1J7VR 1BX2A 5HYJE 1YC7A 1AO7B 2O61B 4D0BA 2VERN 1AKJA 4N8CH 3ROLA 4LCWE 2FB4H 3RVXD 3P4LA 1NFDB 1ZHLB 3V6OC 1QP1A 2ZPKH 1T0MA 4IRSC 3RWGA 3CC5B 1M05B 1SMAA 3KR3H 5EBWB 3SGJA 5CEZD 5C6PB 3W82A 3IJHB 1MHCA 3GKWH 1OAXH 2JB6B 2VZVA 4LFHG 3ZTNH 1BD2E 4X5XA 4FQQA 4MQXD 3QIWA 1BQLH 3KWWB 1FGVL 3L7EA 4JB9L 3N1QC 4LHUB 4UNTA 4N9GA 4Q9QL 4LLYA 1KPVB 2QBWA 4M7ZB 2W9DH 4GQ9L 3X11B 2B1HH 3RI5K 2DQTL 3RFZC 2GFBA 3GO1L 2DI9A 3GSVB 3O4OC 4X83A 5DK2A 1HSBB 4M1CD 1YY8A 3LRSB 4K2UL 4R2GB 4K55A 3VRJA 5JXEC 4F3FB 1W0WB 1EJOL 4YLQT 1AQKL 3K0WA 4AG4H 3RQ3A 1U8JB 3FT3B 2Z91A 4F33A 3GMOB 2X4PA 1EZVY 1P1ZA 1EXUA 5F97E 4EVNA 3QCUH 4YHPA 4QXGH 3BKYH 4ZXBB 5F7UA 2OJEA 5HJ3A 2VITB 4LVOC 3NMEA 2HLFD 1BMGA 5CGYC 4WO4D 1M6OB 4YH6A 3MLWL 4UOW1 4TUKL 2YOCA 5CD3B 5HYSG 1CK0H 32C2A 4Z8FH 4RMSA 4MDIA 3WFDL 5JZ7C 5HGBA 4YNYA 5DMJB 3QQNA 4MSWB 2N56A 1DANU 1MI5B 5JOEA 3HMXL 3RWEA 1FHGA 3FMGL 3NA9H 1S7VA 1X5GA 2LU4A 2DBJA 3MJ7A 4Q0XL 4Z0XA 2ZKHH 1N0XL 1G6RH 5EBMB 2OM5A 5AZ2L 2CK0L 1FH5L 2VL5A 4ZPTA 3UAJD 5JXAL 3EGSA 2E7LA 2IBZX 3MFFB 1KCRL 5ELIA 3C5ZC 5T3ZE 2EC8A 4KUZH 3VWKB 1S7SB 5ISZB 3PHQA 2NY3C 3DI2B 5C09B 1V8HA 3B9KA 1FO0H 2FECL 2BRRH 5HHVL 1CFTA 3W5NA 2IMNA 2YEZB 3MV9B 1D5MB 3WHE1 1IM9B 4ZOAA 4XCEB 3ULVH 1TCRA 1NKOA 2YK1H 2JCCE 4F8TA 3X12B 4LSSH 2EH7H 4L8BA 1HE7A 4TOYL 3BAEH 3X13A 3RA7L 4NCC1 4M00A 4JQVA 3F7VB 3V4PH 2MCPH 4XVSH 3C6SA 4NQXB 4YJZL 4JHAH 1BQHA 5D6CA 2FX9L 1LILA 4BQCA 5HHXH 5FGCE 1I7UB 1HSAA 4O51A 4PJXA 4ZTPH 3H6JA 5JA8B 3V5KB 3VXPA 2B2XL 4RIRB 3JXAA 1GPOL 1GOGA 3RVUC 3G04B 5MEOA 4HQQH 3FQTA 3O3AA 4WUKH 3WUZA 4PLJD 1PQZB 2EYRA 2UY7A 4KK9C 3SKOB 4MLIA 4WCYH 4UIMB 4IOIB 1NSNH 5JW5A 1P5VA 1TQBB 4MNHB 5DMKA 1W0VA 3O6FD 5FCSH 2HVJA 5D2NB 1KJ2H 3IS0X 2R0WH 3BVNB 3QXAA 4LCYA 4PY8J 4S10A 3BSZL 4DQOL 4N0YH 3BIBX 4QYOB 2NZ9D 4H8WH 4UT6H 1AR2A 5T3XH 5KAQG 4EJ1C 1QRNA 1U95B 5HYSB 1UM6L 3QULA 2C1OB 1WC7B 1TMCB 4JFZH 4GG6B 3TBSA 2ICES 1IKNC 5I1IL 5L0QB 1QQDB 4TPRL 1BPVA 4DWHA 4LRNL 4PJIB 1CN4A 3L3IA 1J1OL 2XG5A 1EIBA 4PJXE 4L3CB 4NQVA 4UI2A 6FABL 5ILTH 3U9UB 4FTVE 1ZLUK 2Z31C 4F80A 1WBXB 1WZ1H 5FA3B 1MAML 2PCPB 2OI9C 4UILH 3T0ED 3LKRB 5IMMA 4RMTA 1WK0A 4NWUH 3HA0A 4OFYA 1CXLA 5F3HB 1BAFH 1UWEL 4WHCA 2P8MA 1RVFL 2H2SD 1N5YH 2AXGB 1T03L 1UB6A 4YHKH 3PQYB 4IS6A 5GIRB 3RPIB 3VH8A 3VDBA 4PJGA 1GGUA 1XCQA 3ZHKA 2J7LA 2JB5L 2DQEH 4X6CE 1UZ6E 1AR1C 1ZA3A 3EJZD 5IVXA 3V0VB 1TVBB 1P7KB 2Z4QB 3B5HA 4BSVB 4KRNA 1HNGA 3S8WA 1OGAA 1CBVL 2ZPKL 3TVMD 4F37F 3LQAC 3KR3L 1J88A 4KRPD 4MJIA 4RAVB 4V2CB 2MPAH 2QQLH 1V3LA 3GKWL 1OAXL 5HPMB 5JW4R 1SM3H 2VQ1A 3QUXD 4XH2B 1INQA 4XBGA 1BQLL 5E6ID 1FQ9C 4LCUB 1CLZH 3AREA 2VQUA 1Y6MR 2B1HL 4DW2H 1YJDC 5KSBF 3OB8A 1S9WB 1D5IH 4U7SA 3LS4H 3AU1B 4R4FL 3UAJC 4AG4L 1YYMH 4Y5XB 3HE6A 1QFPA 2R1XB 4FG6D 2BMKB 1H8SA 3AAZA 3QCUL 4P23D 4QXGL 3SDCD 3BPCA 2GTWB 2NY1B 5GSVB 3LD8B 4XNUH 5IVXE 1YA5A 1RUAL 2HTKC 5E6ZA 3DX7A 1J1XH 3MRCB 1CK0L 5J6HA 3X3FL 1KENH 4LGPB 4FQ1L 4GRMA 3LN4A 4KGLA 3JZ7A 3GJFB 4WU5A 2MHAA 4JFFA 1SBBA 5MERA 1C7TA 1N7MH 1ZVHA 5GGRY 3NA9L 4PS4H 2ERJB 4UNVA 1JYXA 5T1MA 2V5YA 1K3IA 4PRNB 1XMWA 4QTHA 5D7KE 3U36A 4QNPF 4GAYB 3FOMB 3GGWA 2W0FB 4NWTH 4GLRH 3GMQB 5A16A 7FABH 1U92A 4F15B 5AD0A 1NGYB 4EBQL 2R1WA 2Z8RA 4LSTH 4U3XA 1WIPA 1U8PB 1E4XI 3WEXA 5C7XH 2MSPA 1FO0L 2N7BA 2BRRL 2DYPD 2HYMA 5IJKA 3GJFK 3ULVL 3OXSA 1JUFA 3P3YA 2YK1L 3QEQA 4HX1B 2J4WL 2EH7L 1R0AH 5I6XC 3F5WB 4M7JH 3NCFB 3UJJL 1I3RA 4X6CF 5KZCD 5C0BE 3SCMD 2P8PB 1REIA 4JZNA 3IXTA 1Z3GL 2MCPL 5ANMB 3VGDA 4JHAL 4PJFF 4BFEA 1VESA 4ELMB 2RQ8A 1TQCC 1TDQA 4I0KA 3E6HA 4ZTPL 5HI5D 4ODWA 2XFXB 2Y06H 4RMQA 1T89C 3Q1SH 1ZEAH 4E41E 3VFGH 4JFFE 3ZO0A 3GMPA 4KZEL 2CKBB 1ORSB 5E2VL 1GZQA 3MLXH 2PW2B 3KPRE 2AJUL 5C0EA 4OI8A 4XI5C 4HQQL 1IGIH 4WUKL 3O8XD 4JFXA 3V4VH 5DUPL 3MV7A 3EZ8A 4WCYL 2F8XC 4PV8B 2ED7A 1YC8A 3DO7B 2C7UA 2DM3A 2C3VB 4X7TB 4CNIB 2XXCB 1KJ2L 4G43A 2R0WL 3PV6B 3VXUD 1RJCA 5L8JB 4HZLB 3DMMC 4N0YL 2CRIA 4WI7A 1KTDB 4PTTA 1NLBH 3WS6C 4H8WL 1I4FA 1JPSH 5E0QA 5T3XL 3O6LH 5JHDA 4WFHD 2P5WD 4FQJH 4KU1A 3QCVL 1IQWL 2MQ0A 3EJZC 4YXHL 2B4CC 3FFCD 2MWCA 4JEGB 4AL8H 1ZT7A 3DX9B 2ZOLA 4F58H 1EO7A 4MVBC 2R1YA 2W59A 3TVMC 4AJ0A 5BS0B 4L8CB 2L0DA 4KRPC 3CIQA 5ILTL 3K8LA 3P40A 4K3DL 1OAUL 5I1AB 1TJGH 4MD0A 5FO7A 5I16A 15C8H 1R5VA 5D7IB 2HJLB 4L3EA 5F7HA 2RB8A 4LQFH 3ECBA 4OGYL 1WZ1L 5C08E 5JOPE 1UA6H 4UILL 3JTTA 1T7ZA 2J3SA 4NWUL 2XA8H 3S3JA 5KSAA 1I1AD 4AENB 1Z0NA 2Y36H 2WAHA 5DD5H 3UBXG 4NC0B 5GS2H 1GHFH 3MA7A 4PG2C 5CJ8A 3WNMA 1JHLL 4RBPK 3HE7C 1N5YL 1HEZB 1MFEH 4GG8B 2EIBA 3U30C 5FUCE 3BRGC 3SE9L 2EDDA 5D9SB 3VXSB 2DQEL 3NABH 5F9JA 2IQAB 5DYOB 5CZVL 5HYIA 1UYWH 5HDLA 1F3DH 3QJHA 3MREB 1MFAH 4KDVA 4PLKC 4S0SD 5D7LD 4IRZH 3TIEA 1R3LA 3HLAB 3BP7B 1IZJA 2MPAL 2QQLL 5FUOL 4OLXL 5FDWB 5GS0C 4WGWB 1QLRB 3JWNC 3DIFB 3DVNB 1JVKA 1KTLB 4YHNA 2D7MA 4BSWA 5CLWA 4XMPL 3UTSE 1N5AB 4LF3B 3MXWL 3DTXA 1DTUA 3PL6D 4OB5H 2VMFA 4DW2L 3EO0B 3MNWB 1OARH 3QRGH 1MRFH 1S7XB 4OI7A 1ZLWK 1DQQB 2OQJA 3JWDC 2HP4A 3EOTH 2DM4A 1BBDH 1AQDA 3BP5B 1A1NA 5LQBH 5HY9A 3CFIC 4JFDA 2DQCH 1YEIL 1FNFA 2I27N 2GSIA 2Z35B 3RZCA 1DANT 2XY1A 5ALCL 3OX8B 3MJ9A 4NN5C 4UNUA 4LMQE 1LNUA 1SBSL 4Z95L 4QRSB 4EQ2A 2I9LA 3S5LG 5F7MC 3VW3H 4G8GE 4FFVD 2DM2A 3W5MA 1D5XB 2ZCLL 5GRVK 3V6OE 5IEHA 2VDNH 5ACZB 2C9AA 3RTQB 3MO1B 2AQ2A 2QEJA 5D1XA 2H26B 3C09C 1Q9KA 4BH8A 2FBJL 5E9DB 2V7HA 3D69B 3RDTD 2GJ6A 2NZIA 3H2WA 4BUHA 4Y0GA 2ZUTA 4PRDA 3KPLA 1SJEA 3DJ9A 2IAMB 3CDFA 1KTKE 1LHZA 4K07A 1DBKL 5CINL 3VFVB 3GHBH 4HC1L 2H3NA 5F44A 2N1KA 3VWJC 2AEQH 2VLMD 5FB8B 1N7ML 4KI5C 5JOFB 2ITCB 3ZT6A 1BQSA 4FZ8H 4PS4L 3FO0H 3WXWL 5BXFB 1RZIA 1OP3K 1IE5A 1MCOH 4DN3H 3VI3E 3KLAA 4KKLD 4LCCA 4NC1C 3UBXB 3H3PH 3BPOB 3MCKB 7FABL 3O8XC 5F1OB 1JN6A 4LSTL 1MAKA 3QO0B 5KSUB 3MBEB 4Y5VB 1JPFA 4DKDC 2V2TB 4NN6C 3MRNB 4IJ3B 3QI9D 4XPFH 4MXWH 3NN8B 1XF3A 4TTDD 2DJ4A 4Z7VF 1R0AL 3FO2B 3KXFA 3ARDC 4M7JL 3V5DB 3MOBH 4ESKA 2KDGA 2FX7L 5ESQA 2OS7A 4MNGB 2J5LC 1UCBL 1DQJA 4S1SH 1J8KA 3MRFB 1JF6A 2Y06L 3Q1SL 3A6CH 4OLUH 3VFGL 4LDEB 4Z78B 1KB5L 4NOFA 1MQ8A 1MIEH 4PR5A 5EZLA 4U49A 4O2CB 4QRPA 3LQZA 2WUCH 2LABA 5FCUH 2V2XA 1KEML 1MHPL 1Z6JT 4IHOA 5ALBH 3SDDA 3LZFL 4XPAH 4KKAC 3VXTB 5CCKH 1KCVL 3RVTC 3MGAA 4JN2A 3AY4C 1VFMA 3HRZB 3IU3A 1CLCA 4GFTB 1I7ZA 1I1AC 5IK3A 3VFMA 1T83A 4OLVH 3QH3B 4KRLB 2BVOA 2XZAH 1CIDA 2PYFA 5I74C 1PYWA 1QEWA 3FHAA 4R0LB 3ESVF 1JPSL 3SDAC 5F7KC 4UTBL 5MEPA 4FQJL 4PGDA 2P4AB 4FFWD 1MCSA 3K4AA 4S1DC 1Z5LA 5EFIA 4AL8L 1A3RH 1VKXB 4F58L 2DWEA 2WZPD 3DLQR 2ADGB 1JGDB 4GBXD 5GGSA 2C3WA 4NRXB 1NC2B 4LCWB 3W9EA 3WNLA 4BKLB 1DBBH 1NAMB 1TJGL 4HSQA 4D8PB 1OP5K 15C8L 1RZKH 3BKCH 5DQ9B 5JIHA 4X7FC 4DOHE 4KTEH 3IDGA 2CKNA 1UA6L 5D96C 3WS3A 3BZEB 4EN3D 1K6QL 2XA8L 4P5MA 5CHNA 3MRBB 3SGDI 1RUQL 2Y36L 3V2AR 1BD2B 1GHFL 5T1LB 3MUHL 1J18A 2VR4A 3QG6B 1SJHB 2I60H 3WN5A 5EO1B 2B1AH 1EJ6A 1IGYB 1IAKA 5JDJA 5I30L 4S0TD 4GKNB 4PJ8D 3TN0D 4U6YB 3HG1D 3X3GL 3H9SA 3QQ4B 4Y4FA 1X6NA 2VC2L 3FRUA 4HXBH 1E4JA 1UXWB 1PEWA 4MNQA 1HQRB 4FFVC 1DLHA 1UM4H 5CBAB 1MSPA 1IZKA 4MAYB 3U4BL 5JA9A 2VAAA 2Y5TB 1H3WM 1R5WB 1A64A 5C2BL 3VG0H 5CILH 4GJTB 4P4KB 4CN6A 3BPNC 1PAMA 1W72A 4FXGB 3O0RH 5FKPB 5JO5B 4BK5A 3ARUA 3OGOE 2VLKD 1A6AB 4MLSA 4X98B 1SEQL 3BWAB 4OB5L 2IPKA 4MB5A 1U8NB 1G7HA 2UY6A 3QRGL 3BHBB 2IANB 3QNYB 5EC2A 5BJTA 4N68A 4XWGH 3KHQA 4RWHA 3I6GB 3CH8A 2AXFA 2QR0A 4TVPH 1TTFA 4ODXA 3TT1L 4XCYB 3SQBA 4FFZH 2ARJA 4NQED 5DJDA 4EEEA 2E9WA 4OV5A 1NQBA 1L0YA 2VDNL 2MTPA 5SV4A 1FSKB 2A73A 3JUYA 4HFWB 5DXWA 3QI9C 4ISVB 4I3SH 5ITFA 4DN4H 5JPMB 2E27H 3S96B 1IRAY 3QZWB 5HVFB 4APQD 1G7MB 1WBYB 3FAXA 3MR9B 3RGVD 3TF7C 3DUSB 3NFNA 3PWNA 3S37H 2JCCB 1YMME 5HHQA 3GHBL 2OXGA 2VL4A 5TFSL 1U8MA 4PGCB 2AEQL 1MFCH 3T04D 2D4FA 1DR9A 5C1MB 3BRFA 4FZEL 3M07A 1JZ2A 3LKQA 5ADOH 2VLJA 3BJLA 3BFOA 1MCOL 3GM0A 3QCTH 4LIQE 1B6UA 1XR8A 5D7JB 2NY4D 3H3PL 1KPRA 4RA3A 2VXUH 3FB5B 4XWOD 4IM8A 2CD0A 5DS8B 4YK4C 1I85C 3U2SA 4H25A 5KJRH 5ICYA 4ZYKA 4MJ6B 3HC3H 1A7BA 4OAWA 3MGTB 3HZYB 5HGHA 4XPFL 4MXWL 1MCWM 4H20L 4F37K 1UWXK 3MUGA 3KLSA 3ZHLA 1U8HB 4G9FB 3V95A 1I3UA 3UTOA 5L88H 3OTTA 3QIBA 1OTTD 3N9GH 4ZSOA 3U0PB 3U7YL 1P2CB 2WINA 3PDGA 4K94H 3BI9X 2IALB 3MRQA 5IT2H 4S1SL 1BWWA 3ESUF 5DTFA 3KPNA 4FFWC 4G42A 5D1ZD 5KVFH 1FG9C 3MSPA 12E8L 4J12A 5JORB 4HGWB 4ZO6A 3NIFF 3A6CL 4FQXD 4OLUL 5FEBA 3QUYC 3RAJL 3B9DA 1GGYA 3DECA 1QFOA 3L5HA 1MIEL 3BQUA 3VDCA 4O2FA 3X13B 2OL3A 3WFBL 2WUCL 3T0BA 5HI4C 3GI9H 5SWSA 4ODSH 1WFTA 3MLTA 5TE7L 1MHHB 5ALBL 4HWUA 2FR4B 3NH7H 2YHGA 4XPAL 5C0IA 4KWUA 5JLZB 3TNNB 5AUMA 1ITBB 5GQBA 5IW3A 5CCKL 1T04A 4U6HB 3OMZA 1EPFA 4W4OC 2YPVH 3SJVB 4H1LH 1SJVA 4FTVB 1JF1A 3HPLA 4OLVL 3S98A 3ALWA 1I9EA 2EYSA 4M6AA 4S2SB 3SKMB 2XZAL 4BM7A 1ZA6B 5EUOE 3H9ZA 3IDNB 2YA1A 4LPUA 4ZS7H 5FA4B 4RISL 3OKYA 3QISA 4K3EH 4OD1L 3RX5A 1E6OL 4DVBB 2VE6A 1INEH 2G5BA 1A6WH 8FABB 1R3KA 5B39A 1NC4D 2PXYC 2OR9L 5J11B 1XGQA 4JO4L 2YR3A 2M8XA 4U1GC 4F7CB 3GSUA 5DMIL 3WIHH 1B6DA 4X6CB 2R69L 4JCMA 4XZUA 3L5WB 4XP4H 2YD4A 5GRYA 1IGFH 1EK3A 4RDQF 1QFHA 1F3JA 3ULUD 4PJFB 1DQTA 3KNBA 3ARFD 4EDXA 3UTPD 3BKCL 1R3IL 3DYPA 4NQCD 2DQDL 1MIML 3GI8L 3CK0L 2Y7QB 5F7EH 4YAQA 3VXOA 1RULH 3L9RA 4ZD3L 3CFKA 1DVFD 1K2DB 1KYOJ 3KPOA 3P30L 5F96L 1T66D 2VQTA 3VFTA 1XEDA 4NJ9H 2GCYA 2B1AL 2AXHA 4GAGH 4JKPL 2XN9B 5C0FA 2WUBH 4JRXD 5DVMA 5JQHC 3UTTD 2YBRA 5LAXB 4G6KH 5F7FA 4YHMH 5ERWB 2OR7A 3QJFA 4NQDD 2GJZB 1AXTH 5BVJB 1MEXL 3IFOA 4HXBL 1PBYA 1RHHB 4F7EB 1WZLA 1Y6NR 4OIIL 5ID1A 4OLYH 2JJUA 1U3HD 2WIMA 3HUJE 3I50H 5E94B 1JV5B 4NO3A 4EZMA 2ADIA 4Y4HD 3GEWB 3OKLB 4MD5B 1OM3L 4DZ8B 3VG0L 1UB6B 4HWBL 1FLRH 3QQ3A 3QUZB 4QRQB 4GKSB 5IG7B 3S5LA 1L6ZA 2R2CA 1IT9H 1QR1B 1MF2H 4RFNC 1UVQB 2X7LB 3IF1A 3SO5A 3CJJA 5DJ2A 3MYJB 3REVA 3DARA 4B0MM 3LIZH 3BUYA 4OV6F 3SDYH 2DTMH 4TVPL 1B0RA 2NY4C 5ITBL 1CQKA 5KSVA 5F21B 3C60D 5DHVA 5EPMA 4PBVC 1PVHA 4FFZL 1G7IA 2F53E 1QA9A 4Y16D 5EBLA 4DFIA 5ACLA 3IKCB 5GZOC 3IXAB 4AYFA 4QHNB 1KIPA 3BGMA 5T3ZH 3MGOA 3MRKB 4HK3J 1EAJA 4YXKH 5EUOF 4JFYA 1I8KA 4IMKA 5FK9B 1RJYB 2H1PH 2HJFB 4HG4K 1FJ1B 3V4UH 2P7TA 3QUMB 1S7QA 1NDMA 4QXUL 2CDGB 3S37L 2VLLB 4YX2H 4CL7A 1VFBA 2DD8H 4G6ML 1KN2H 3KJ6H 2VTFA 4XAWL 1MVUB 1U3JA 5AZEL 3TWCH 1J0KA 5C0BB 3IRZA 1Q94B 4GXVH 1MFBH 4X6EA 3BZDA 1UKTA 3QCTL 4JFQA 1TZIA 2NX5E 5EDXA 4TUOA 3W81A 1LEIB 3O3EB 5AG9A 3C8KA 2ZUUA 4IDLA 4MGXA 2I9TA 3FB7B 3FHQA 3FT2A 4Z7NE 1KGCE 1N6UA 1D6EB 2EC9T 2EYTA 4E41B 4JFFB 4NQSB 3DO3A 4KROD 1AY1H 2ZG3A 2VDOL 1KSRA 1TVDA 4KXZI 1RZJC 3KPRB 4N1CA 1C8PA 4XVTL 1V7MH 3GKZA 4OZFG 4HIJA 1S5IH 1ERNA 3QDMB 3ZKMD 4OCWH 5HDBF 2EDOA 4QWWC 1UT9A 2VDKL 3QFDA 3JSSA 4HJJH 5GPRA 2HMID 4ZUTB 5IM7A 4Y19E 1P4LA 1A1MB 5L88L 1D9KB 3CFCL 5GS1A 2XNAB 2G5RA 3DUUA 5DHYA 1FIEA 1J86A 3HI1B 5IT2L 3QXDA 1EFXB 1RPQA 1E27A 1F45A 4KI5E 2BNRE 1A0QH 2J8OA 1FNSH 1ZS8A 2V5RA 3S37X 3GMNA 4PRHA 1OAKH 3ULUC 3D39E 3RY6A 2A83B 1TIUA 3VMNA 1J11A 4X7SH 4R96B 1AXSA 4F2MA 4X0KA 4DKEH 3QWRD 2BVEA 1N26A 4LGSB 2XT1B 1QR4A 3OKKB 2YPVL 4PJ9B 1MHEB 3KYAA 3V6ZA 1N0LA 1DVFC 4DVRH 5D5MF 1FFNB 1CICD 1U91A 5C08B 2NPLX 1B9ZA 3BPLC 1T66C 1BOGA 4ZS7L 4Z7UA 5HGAA 4K3EL 1HIML 3ARGD 1AC0A 3C8HA 4MXQD 1INEL 1U2HA 2NY0B 1A6WL 3KPQA 1IC4H 1NCUA 3S34H 3ME0A 3G9AB 4Z7VB 4KK6D 5DHXB 3WIHL 5KSBA 4PYHA 4XP4L 4Y4HC 2E7CA 3W0WB 1FL6B 1GH7A 2AVGA 5EU6D 3W9DA 3DURB 3WJLA 1OSPL 3RL1A 1Q72H 4PJ5D 3Q6GH 3CFJB 4JAMB 4KHXH 1H5BA 2GSGB 4OZIA 4PRHE 3GSWA 4JO1H 1EO8H 4I13B 4LPTA 5F7EL 1S9KC 1A6UH 2CLZB 5HD8C 5GRZA 4KVCH 4X8XA 3ZDXF 2AKRA 1I1YB 1IM3B 4R6UA 3QWOB 3UTSB 1F3DJ 1P7QB 2AK4A 4NJ9L 2DOCA 4OZFB 5I9QB 4GAGL 4Z7NF 2WUBL 2CIIA 2IFFL 1M71A 3OB0H 5H2BA 3NTCH 4U1IA 4YHML 3CLFL 4N0RA 2EE9A 3C60C 3ULSA 4EI6A 4G80B 1AXTL 4D2NA 5CS7A 4Y4KD 3ZE0E 3U4AA 1XIWC 5FYKD 4N0FA 2EDYA 3TLRA 3IVKB 3F7PC 4Y16C 3VA2C 4DGYH 1G7JA 3I50L 4IOFD 3OAYK 4PJCA 5IROC 3L95A 1CDJA 1NUDA 3X14A 1E6JL 4LLDB 4JPIB 1DLFL 4P5TA 1MCPH 5DZOA 4G8GB 4JQXA 4Q58C 3UJIL 4IRSB 1IT9L 1MELA 1MF2L 1QSEE 3C8DA 3GUTB 3M1BA 1FZMB 4KMTH 1NFIA 1A4KB 3TBYB 4LKCB 3SY0A 3TBWB 1NUGA 2A0LD 3LIZL 4GKZB 4NNPL 3AGVA 5HHMB 3HS0A 2JE8A 4JVWA 1HYSD 3CH1A 1B4RA 3LKPB 3LSOB 3PXHA 2AK4E 4L8SA 4U1JA 3NAAL 1HH9A 1HHGB 4G6AD 1I9JL 2VIRB 1OF2B 3GSNA 3ZL4H 5I2IA 1KB9K 3DX8A 4YXKL 3REWB 5GSRA 4PRBB 1EVUA 5D1QA 5KANG 4ZFOA 2H1PL 1RK0A 2X4UA 2EZ0D 2HMIC 1LO4L 3CLEH 4LVOB 1F6LL 4YBQD 3QUMH 1H8NA 2HN7A 1U6AH 4NSKA 1KN2L 1S7UB 2AAVA 3KJ6L 4OSUL 4IRJA 5LKNA 2WBKA 4FN0A 3STLA 4GXVL 1T0NA 4TQEL 1MFBL 4NZDA 4HH8A 3SE8H 3HFMH 2DL9A 2CMRH 2J6EL 1YEEH 1YQVH 3BH9A 3SDXF 4E0RB 1C16A 2BHYA 3VE0A 4A2LA 3U9PL 5C0DA 2RHEA 1FNGB 1YNLL 1QYGH 1HHKB 5DD0L 2NNAB 1AY1L 5FYLE 3D3VE 1B0GB 4JGUA 1OHQA 2F74A 1E28A 4JDZA 3RJQB 1JZ3A 3WFHA 3DETD 3C5ZB 4U7MA 3O45A 1S5IL 4HUWB 3LHPH 1QFWM 1AD0A 3OJMB 1G7PB 4TUJB 5A2IH 4HJJL 3GSQA 4AM0A 1AO7D 4XP1H 3LEYL 1X3DA 1ZHBA 3CX2A 3LEVH 4P46D 1A1OA 1GYAA 2IG2L 1JN6B 1NBVH 3HZMA 1D3CA 3ZE0F 2NY7L 5E4EC 3L1OH 5DJ8A 4FABH 1A0QL 5FGSA 1FNSL 1PG7L 2YUWA 2R15A 4NM4H 5J12C 3C2AL 4JLRA 2H8PB 2A38A 3RP1A 1VENA 4ZOCA 2H6PA 4LHUD 3SOBH 5DFTA 4RDQG 3B4NA 3TA3C 2ATKB 4BH7B 5J7CC 1N59B 2WLYA 4G8EA 3FT4B 2RFXB 1FFPA 3CPLA 1YMHB 2R56L 5IB2A 3QDJD 2LE9A 1QVOB 4FQ2H 4DOHB 3I6KB 4OZ4B 3V5HA 4HK0B 5M95B 3K74B 4LSRH 1NGXA 3MFGB 4G5ZH 1KULA 3QDGB 4CVWA 1F02I 4P2RE 3D18A 4FQCH 4RA0C 3SGKC 1U8QA 1IC4L 5I15L 2XWTB 5CEXB 4M61A 2Q8AH 1LO0H 4Y4KC 4AIZA 5I1DB 5IP4A 3ULVC 2A74A 1AGEB 2YUZA 3TT3H 2IADB 4IOFC 1KCKA 1R24B 2KPNA 1Q9LA 1MWAA 2O26U 3SE3A 3BP4B 1N4XH 4YO0A 3PP4H 2UZIL 4JO2L 3RNKA 1WZKA 2CLRB 5CP3A 1JGLH 1Q72L 5CJXA 1IQDB 3Q6GL 4KHXL 4MA3B 3DX6B 1MI5D 1F6FB 4PREB 3D48R 1PG7X 1EO8L 1A6UL 4IIQB 5JW3H 4HUXB 4WW1B 4KVCL 4AQOA 2Z31B 1KCLA 1IGTB 5E5MB 1A9EB 2OI9B 3VWKD 5DDHB 2HH0H 3EKCA 4QGYA 4BFIA 5ISZD 1F42A 3MV8D 3L3DA 5C09D 2IH1A 1AJ7L 1N2RA 3BYYA 5J1TC 4K9EH 3MV9D 2YXMA 2WP3T 3EYVA 4S1RL 5KVEL 1CDYA 4TULL 3WO4C 3FOLB 4ETQB 1E4KA 4EXKA 3PNWB 1YUHA 1IGJB 3FQUB 3AVEA 3B43A 2W9EH 4P2OA 5FM5O 3DSFH 1INDH 3QQ9C 4H8WC 1MCPL 1YEDB 5TJWK 2GAZA 3ALXA 1YDPB 3BDXA 4DZBA 4YBQC 4N1HB 1T22A 4ODUB 2A6JA 4YGVA 4HDIA 3ZSSA 5FDYA 3JV0A 4KMTL 1DQDH 3UDWA 2R0LL 4L29A 4P2CG 1TZGL 1YMMB 3H8NA 1WCQA 5IHLB 1JWSA 1I7TA 3DUHA 1BJMA 1MLCA 3D2UA 4ELKB 4UTAH 3GDBA 1ORQB 5HYEA 3O9WC 3CZFA 1ZVSB 1CGUA 1E4XL 2YC1B 3HPJA 4UDTA 1K4DA 4GS7C 3A6BH 4WUUA 2P24B 4NZJA 3ZL4L 1JL8A 4PG9A 3PWJA 3WCYA 4DKFH 1LD9B 5BJTB 1TVHA 1R3HA 4ALAL 5M94B 4J6RH 4J4PD 3S88H 1A2YA 2AXFB 1NANH 3MMEB 2GQHA 1DCLA 2X6MA 3I3BA 3JV6A 3FO1B 4P46C 3MJ9H 1IAMA 1U6AL 3FN0L 2EDTA 2XYCA 1QPPA 2P8LA 1OWWA 2GY7B 1ZT4B 3P11H 3VGAC 4P3CL 4KPHL 2V17H 4WHTA 4XVJH 5E8NB 2BSRB 1MREH 2NW2A 3HFML 2P43B 1YQVL 1K4CA 5J3HD 1XF5A 4N5EC 1A02N 3I9GL 4ZUSB 2R8SL 3LKOB 1AHWA 1NCTA 3MLRH 5EU5B 4Z76B 5GS2D 4M7ZC 2VZOA 3KPMA 4FXKB 2LVEA 2H41A 3PQYD 4HF5H 1VERA 1EH9A 1QFUH 2X4QA 3JTSA 1DE4B 5DJZB 4WUUE 2NMSA 4XP1L 3OKEB 1AGBA 3LEVL 4H0HB 3CXDH 4MQSB 2VDPL 1I1RA 1BZ7B 2ZUWA 3VG9C 4OZHA 1S7WB 5L2JB 4CVXA 3QPQD 3QO1A 4X4XB 5I6XB 3GNMH 3CUPA 3BZ4A 3GJEB 5EUOB 4FABL 2RBLA 4OT1H 5DRWB 3CCHB 3U6RA 3TO2B 3HAEB 1F4YH 4NM4L 1UXSA 2VXSH 4UUJB 4ZNCD 4IDJH 1LEGB 3VXQB 4M7LH 2VZ1A 1NBZA 1TQCB 2M26A 5CKGA 4Z7WA 2X4NB 3OKDB 4JHWL 3SOBL 3C08L 4F7PB 3OR7B 2ZJSL 2ZUSA 4U6VH 3OHXB 4ZS6D 4RWYH 4WDIA 2F54E 3EW3B 4FQ2L 2M2DA 2OTWB 2YN3A 3RX8A 4JJHA 4X4ZA 4MQ7B 4HJGA 1NGWB 5TDNA 2D0FA 5FYJL 3TZVA 4JKKA 4LSRL 3MRDB 1B4JH 2NY1D 5TH2A 3EFDH 2F19L 1BEYL 3ILPA 2I07B 2QADC 3DMMB 2Q8AL 2XIDA 1HCVA 3VFWB 4GRLC 4OZHE 2W07A 3RUGA 3TT3L 1JF1B 2MQCA 4U1MB 1A4JB 5C0CA 1NDGA 5LGHH 2OLDA 4NHUB 2LAAA 1TTUA 3L5JA 3WXVL 5C9JB 3UPAA 5DVOA 5EOTA 3EFFB 2IWGA 1JGLL 3OR6B 2P5EA 2KUTA 3HUJB 4CVZB 3DV6B 1UH3A 2VLRA 3TVMB 5EN2A 3LDBC 2EIZB 3SEPA 4E42A 4KRPB 1QHPA 1A3LH 5HPOA 3ARWA 4WV1C 1OTSC 3OJDA 5KTEH 4DCQB 1Y0LB 2GUOA 5IB4A 1K8IB 2HH0L 1I9IL 2QQNH 3NZ8A 4UT9H 4UINL 3CFDB 1T21A 3L3HA 1EBPA 4PV9B 2BY1A 3O6KL 2XWBA 3HE7B 4U1HB 4C54A 3V52H 1QZ1A 2UZXB 5KOVC 3STBA 3OKMA 4NKDB 3U0TB 4UOW0 3DSFL 2EIDA 1A7PH 4JKMA 4P59L 3TO4C 3BUTA 1INDL 1NBYA 5JW4Q 2NY2D 3IETA 5IESH 1OSZB 5TGBA 2F53B 4FFYL 4HS6A 3M17A 4Z5RB 3DGCR 1CFQA 5ABDE 3UROR 4U33A 1NEZB 4KKNA 2F8OA 3Q6FB 3RKDD 3EOBA 5TQ2H 3FRPG 1HXMA 2ADIB 4WHYG 3LVEA 5GJSH 5FO8A 4ZUVB 1QSVA 4MAUL 4G3YH 4D3CL 5IQ7H 3N50A 2O5YL 4RMUA 4JM2C 5I8CB 1W72H 4Z0BL 5I1LB 4BZ2L 4KJYB 2IJ0C 1XF2A 2JJTA 4J3UA 5GGTA 1JCKA 1DUZA 3O3BB 2BNQB 3AXLB 2NX5B 4JFPA 3MXVH 4LIQH 4HGMA 4HXAL 5EIQA 5F9WC 3WLBA 3BD4A 4KV5E 3MUY1 3EOYG 4DKFL 5TQ0H 4GRWE 4PGEB 4XC3H 2ZSWB 1G9MH 3U7WH 4M3KB 4NN5B 2MOVA 4EI5B 4YDJB 4U3CA 3OF6D 1FNLA 2DLIA 4G8IB 1C1EH 5HHNB 2X89D 1MCWW 1BP3B 1KPUB 2DLFL 7CGTA 3GBML 1S7TA 1U2CA 3C09B 2G75A 2LAGB 5INCB 1U3YA 3P11L 3UTQB 5JPNB 5LGKA 3H9HA 5B8CC 1A6TA 4A6YA 1HQ4B 5BS0D 3AM8A 2WNGA 4Y19B 5EWIH 3BEWB 5ENWB 2BC4A 1MREL 2YRLA 5JIIA 1WZMA 4JZJC 1AC6A 3PWLA 3AUVA 3ULUF 3VWJB 4KHTH 2BOBA 2BNRB 3PJSB 1FN4A 1NAKL 3MLRL 2G60H 5CGTA 4MD4B 1GZPA 5KANI 4OFDA 1KIRB 4Z7QE 5CMAA 3D39B 2RAMA 1K3ZA 4NUJB 4ZMAT 2DLEA 3O8XB 4WO4A 4JFQB 4HF5L 4KDTC 1SEBB 2CRZA 1ZXQA 1T1YB 1JFQL 3TBVA 3P9LB 4MS8D 1I7RA 3RWHB 3ZMRA 4NN6B 5H94B 2YUVA 5ICZA 1Q0XH 3JV5A 5FHAH 1A7QL 3G5YB 3I75A 3VD3A 4M7KL 5IEKB 1N3NA 2CRYA 2EKSA 1BVLA 3ARDB 4WI3A 3IDJB 3P9WB 4FHBD 4JFHD 1F4YL 3FQWB 4XP5H 1JK8B 2J5LB 3Q3GB 3MTRA 4POYA 1MNUH 2EXWC 5EZJB 3SN6N 1ULVA 3AB0B 4NQUA 3RHWF 1U8KB 5IM7B 2CPCA 2YPKA 4RAUB 2C4FU 3DHJA 3GSOA 3VJ6A 2BHUA 4U6VL 4NYLA 1PKQA 1NBQA 3B2UD 1TPXB 5DEGB 1UGNA 1NGZA 1CR9L 3SDXB 1P9MC 2YD3A 5INDA 3UC0H 2DQJH 3BIKB 3DVFA 2VSCA 4PB0L 4LLQA 1TXKA 2OL3H 1HI6B 1EHAA 4XPHL 3TFKC 1MH5A 3UTZB 1HHJB 2CK2A 1KACB 2ITDB 1I1AB 1B4JL 5CWSA 4FXLA 3DRTB 3EFDL 4M1GH 1ADQH 3GSXA 2ZOKB 1R3JB 3SPVA 4F9PA 5I74B 3RTQD 2X9YA 2AW2A 1GIGL 3SDAB 1IC5L 3TNMB 4F7TB 4WI6A 1EGJA 5B21A 1EEYA 5E9DD 4RSVA 3JWOH 1JPGA 2NY2C 3QIUC 4PRPD 4ZDHB 1AD9A 2IAMD 5KS9E 4PD4J 4UQ3B 5F1NB 1UC6A 4GKOA 1RHFA 5DJAA 2RCSH 1ZT1A 2WV3A 1V7NH 4RMVA 3RKDC 1D5ZA 3O6FA 4ZPVB 5KTEL 1HXYB 5C0ND 4NBXB 3KPSA 2VH5L 3E2HC 4HPOH 1QSEB 1RUKL 2ZG2A 5D96B 2QQNL 4OLWH 3MNZB 3UMTA 5I8OH 4YDVB 5GHWL 3W39A 5F3BB 3MBED 2AEIT 2ADJB 5CSZA 3V52L 2Q8BH 4L9LA 3ULVE 4ODHL 5CBEB 4MX7B 5KOMC 3ZE1F 3WIIL 4LRIA 2Q87A 3MQIA 1VADB 2ESVA 5FOBA 5C07E 5IHUL 3ET9F 1MUJB 5IESL 1ZMYA 4JG1L 1J8HA 1OPGH 4H5SA 4ZUWA 1D6VL 2YA2A 1XGUB 4MDJA 3WO3B 4PB9H 3T0EA 2VDMH 2FJGA 2BOCA 4MJ4A 4NKOA 5TQ2L 4XP6H 3BPNB 3FB8B 2HT4C 4NT6B 2ENYA 5GJSL 1YY9D 1BM3L 3SKNB 3PGCB 4XB7A 3MJ6A 4M6OH 5ESVA 1E0OB 1RZKC 2JTDA 4XVUD 1W72L 4ZOEA 4U2ZA 3NPZB 3KPSE 2WBJC 1TZHB 5IF0A 5I1EH 4XB8A 4POUB 1LE5B 2QSVA 3GMMB 4NPYB 5E1AA 3WE6B 4YXLH 1ND0A 3I85A 3LV3A 4LARH 4XRCA 4ZAKC 5CJBA 1KUMA 4XC3L 1G9ML 3WKML 1HHHA 5HTSA 5LVEA 1DUYB 2FJHB 1EHNA 3TJEL 4EIGB 5BZDB 3OAUL 1PGRB 3D3VB 3PV7A 4MS8C 4PRAB 4C56E 5T3XE 3I6LD 1S78C 5ACMA 5DHVH 3N0PB 2ESVE 2R2HB 3QUXA 1RJZA 2IGFH 3QI9B 5F7YC 5E6IA 4U31A 1LO5A 2FL5B 1J8HE 1UACH 4I77H 5T1KB 3MRGA 4R3SB 1JPTL 2HWZH 1G1YA 1T1XB 4LCWD 4CW1A 1CGWA 1YYLH 4MMZC 5D5MA 5KS9F 3NACH 3FZUC 1HHIB 3MRJA 3QNXB 5D2LE 3EHBC 5F89A 2AGJL 4P23A 2G60L 3SDCA 1BVKB 1BD2D 2V5TA 2EDKA 4YPGB 3RVVD 2A1WH 4ONGH 5T1LD 1G7QA 2VDRL 4U6XB 5EU4A 5DUMH 3D85B 3HNTL 4YK4B 1HILB 1JHTA 1AFVH 3ZKND 4LLMB 1S9YB 2DIAA 1J12A 3HZVB 2ZNWA 2EXYC 4LEOB 2VXVL 3PGDB 4WWKD 1IBGH 5CJ5A 2NTFB 4PJDE 5FHAL 3CDYA 1NGQH 5AWNH 3ORJA 5I18L 3ULVF 1BFVH 1QBMH 5GRVL 1WLHA 2CLVA 2XTLA 1MLBA 3CXHK 4QGTA 3CDGA 3MV11 2AEPH 2OK0H 4P4KD 4P2RB 3EYFB 3QA3B 1MNUL 4L1DA 1L7IH 3TH3T 3G5XA 3R4DA 4OBRA 5H37H 1EMTH 3MYZA 1HKLH 3MROB 1PKOA 2FHFA 3QUYB 4X4YA 3L6FA 3RBSA 1FNHA 2XTJC 4KQ3H 4ZFZA 1T2JA 2IAND 4GH7B 2DYPA 1HH6A 4M43L 4OGXL 3UC0L 3LEXA 4UV7H 5I19H 2R4SH 2AJYL 2X4SB 1SYVB 5DA0B 2J8UF 4NZRH 2GY5A 3VGBA 1T3FB 3QEUA 3BEVA 1QO3B 3QIWD 3FN3A 3SCMA 1XGYL 2AJSL 4QRUA 3D25B 4M1GL 3WHXB 3W2DH 4G8EB 1OCWL 2AQ3A 4YDKH 2XOTA 3UZQA 5T3ZD 3ZYZA 4LCIH 5IUSA 4JJ5B 4EUPA 4ONHA 1XR9B 1RIHH 25C8H 4X99B 3FONA 5FKAB 1UWXH 2PXYB 3JWOL 1M4KA 1LK2B 2D0GA 4M4RA 3C6LA 3PUCA 1RU9H 3G6DH 4XMLH 2RGSA 2KQMA 4WI9A 3PWPE 4U1GB 4FNLH 1S3KL 4K94C 2YUXA 2RCSL 3FKUS 4ZODA 1EAPA 5E00A 5E2WL 2DQIH 2WLZA 1IL1B 4AIZB 1KLUB 2UVFA 4U1SA 1X4XA 1UJ3A 5GISH 4PJBE 5D7JD 3HC0A 3VXUA 5K9KA 4HIXL 3FQRB 4HPOL 5F71A 1VB9A 3MA9H 3GB7A 4OLWL 4HWEL 2QQQA 1QTYT 3E8UH 5KG9A 5I76A 5FO9B 1SY6A 4Y1AE 2W60B 5A43C 4P2QE 5E99H 5C0AB 2BCKB 3B3IB 3FRPA 1N64H 2XKNA 3TH2T 4GW4B 3RNQA 3FFCA 5L6YH 3ARVA 1Q1JH 3CFEA 3NCJH 4O2EB 2VUYA 2Q86B 3VFSB 3EOAA 3RWCA 4G9FD 3FTGB 2Z0BA 2N7AA 2D31B 4P9ML 3R06B 1TJHH 1FV1A 4NQEB 1DBAH 4PJDF 5DD3L 2HLAA 1MJUH 2QV2A 4KJPD 4Q6IC 4HFUH 1DN0B 4YQXH 1FBIH 4WEMB 2NTSP 2FEDC 2ZUVA 4XX1E 4PB9L 1JNHA 2A2QT 2O5ZL 4XCCH 4Y5YC 5F7WC 2Z92A 5BO1H 1QUNA 3TPUB 1KJVB 4M6OL 4D9RE 4YHIA 2B5IC 1XF4A 4RFNB 4FQPA 5CUSH 1J0HA 1T5XA 4RGOH 1DQML 5GRXG 3K4DA 1A14H 3UO1L 3SJVD 1JBJA 1EEZB 1VFAA 4YXLL 2V7NA 4FTVD 3L3OA 4OCYL 4PPTA 4X80L 2NY4B 4LARL 5D7LA 5K59F 4CU8A 1FNEB 3GRWH 5ICXA 4Q9CA 3KYOA 1KNOB 3O2DA 5FYLH 1NMAH 2I25N 1CXEA 3N1PC 5EUKB 1YEJH 4Y2DC 4WWKC 4LP4A 5T5FL 3OGCB 4XCNB 1RK1A 2IGFL 1FAKT 4M8QA 5DUBA 3T77B 3ZYOA 2BVTA 1F58L 3CFBA 2X41A 3PL6A 3E6FB 1FZKB 3GSNH 1J9CT 4GW5B 2HWZL 4GXUN 2A77L 2KKQA 3VDAA 1CL7I 1J0JA 3PF2A 1TETH 4UAOC 5JW4N 5FF6A 1K8DA 2J2ZA 3VI4E 1IAIH 3B2VH 1A7NH 1EUTA 4NNXA 3NVQA 3B5GA 2AI0H 1KIQA 3RWDB 3DV4A 1X5IA 4XPGH 4Q2ZA 3HCVB 1S5HA 1XGPA 3BKJL 4PJBF 1KLGB 4I9WE 3OXRB 3BP6B 1LQSR 3SGJC 4NHCH 5GRJH 4L4VE 3IFNH 1YEFL 2FO4B 2XN9D 2C1PA 1HOCA 1NJ9A 2C4FT 5SX5K 2Y23A 2P46B 4KTYA 5IMLA 3RDTA 3QIWC 4JCLA 1IBGL 4KVNH 5K33A 3C87A 2CR6A 1NGQL 1SYSA 2F54B 3J7HA 4I2XB 4OFYD 2NLJA 1GGIL 4QCIA 5DD1H 5LGJB 4CMHC 1MCFA 2OK0L 3R1GH 5F88B 3IJSB 3QUZD 4IMLB 4OF3A 4D9LL 2Z9TA 3HB3C 2Q7YA 2QKIB 4HJ0D 4UBDD 1U8IA 1HKLL 3VRIB 5MP6H 5K93A 3ZDZE 4KQ3L 2BSTA 1NCAH 2W65B 4KZDL 4U3HA 2R4SL 5E2UH 4YFDB 1KT2A 2F58H 4RX4A 4WEUD 5GJTL 2FZ3B 5EO0A 1MJ8H 2ZZUT 2ZSVB 4YHOL 5D7KD 4D0DA 4YDKL 3RWFA 3BPLB 4N0UA 4PGBA 4KK5C 4LCIL 1MCKA 3QG7L 5DJCA 4NOBA 4NKIL 1JRHH 2V2WB 1RIHL 3D9AH 2E7LC 2E7BA 5J1SC 1WWWX 2BDNH 5IFAH 2VLME 1UZ8B 1HNFA 4KI1A 1Q9OB 4OLZH 5H35A 4PFEA 3G6JA 3B9KC 4KJPC 4D0CB 4LGRB 1Z0MA 3UJTH 4GG6F 2DQIL 5C0BD 4U6TA 1DDHA 2NXZC 2MJWA 3NCYP 1II4E 1MCQA 4ORGA 3P0YH 1MWAH 4OCSL 1AE6H 3KYNB 3VI4F 5J9PB 1CT8B 3MA9L 4JM2F 4JQVC 1C5CH 5F1KC 5CP3H 4E41D 4JFFD 3RWJA 3FQNB 4QHMB 2Y6SC 1C5DA 5E99L 4QRRA 3KPRD 3O4LE 5IQ9B 1N64L 5IW6B 4XBPB 1ZGLB 3QR2A 4JZOB 4LNVA 3QDMD 5C8JA 2R0ZH 3TIDB 2BNUA 1S9VB 5K9JH 4GBXA 4BYHA 5BV7H 1F4HA 3E0GA 1D9KD 3D0VB 3DROB 1TJHL 1XIWB 3VCLA 3H0TA 1DBAL 3RHWK 4JDVA 1MJUL 3KYKL 1F6AB 1BFOA 4HFUL 1CLOH 4MA7H 2VABA 2PYEE 1AGFA 1I8MB 1ES0A 4W4OA 4EN3A 5A1AA 3PIQB 5BO1L 1U8OB 1MJJA 5FIEA 3GMLA 4CJ1A 3IFPA 1A6ZA 1FZJA 2YPLE 4PJHF 4UDUA 4G7YH 5IBLD 5D71H 3PGFH 4WJ5B 2DICA 2IMMA 5CUSL 2HFEB 3RIAF 4XCFL 1H3PH 5IGXH 4RGOL 2H9GB 1V3MA 4OKVB 3T4AB 2XWJA 3BT2L 4RFOL 5SWQB 3WFEH 4PJ8A 3TN0A 5DK0A 3HG1A 3ZDZF 1A14L 3V79C 2F5BH 3MBXH 2OX5A 4FMKA 3WIFA 4WNQA 5MHSE 4OTXH 4X6DA 1NUNB 1C08A 1FG2A 2AABH 4QRRE 2NW3A 1N8ZA 1QSZA 3M45A 3HMWH 5E7FA 1PX3A 5C08D 5JOPD 1IEAA 5C0RH 2X4TA 4U2YA 1IEBA 2DQFB 1F4WL 5TDPA 1LEKB 3CVHA 1T4KA 5TF1L 2NY0D 4PJ7A 3KYMA 4WU7B 1ZSDB 1CGTA 4XHJD 1YEJL 5GXBB 1Z9LA 4HWBA 3F12A 2UVEA 2VLKA 1JTPA 43C9B 4HWZB 3RBGA 3GSNL 3OAYH 5IB5A 2AEWA 3W0WD 3NIGE 5FYKU 2VAJA 4XNZC 4AQ1B 1TETL 3U4EA 1U8LB 3V6BR 1BJ1H 3B2VL 1A7NL 1GSMA 1V5JA 5SWZB 3TCXA 3BN9D 3H42H 4KKCD 2FSEA 4GO6B 2AI0L 4UOJA 5ID0B 4HUMB 2KZWA 4XPGL 1DEEB 4KH2A 3QXTA 1HKFA 2AJXL 4J1UA 4NRZB 3HG1E 4K8RD 4NHCL 5FECB 2BC4B 5GRJL 3IU4H 1JZ6A 3UTSD 3P4OA 4L3AA 4NRYB 3GSRB 4JB9H 2D7QA 3K1KC 5L7XL 4Q9QH 4HPYL 4M1DH 1T7WA 3QNZB 4LHJB 3P73A 4GQ9H 4HIIB 2DQTH 1LO2H 3GO1H 4APQA 2BP3A 3QXWA 3UPRB 1BFSA 4X8JB 3EYQC 1QD0A 3RGVA 4K2UH 4L8DA 3AREC 1EJOH 3MOAL 5JDSB 1RZFL 3NCBB 2F5AL 4JRYE 2X70A 4JVUA 2XZQL 4L4TE 1I1CA 1G7LA 2FBOJ 5KVGL 2UWEA 3C9NA 4X4MA 4G8GD 3PXJA 5E4EB 3HE6C 3HTLX 2C26A 5EC1A 1FVEB 1S7RB 3ARBB 2EDBA 2EECA 5IB1A 4NCDA 2ED8A 5MP6L 4DAGL 4TUKH 5IR1A 5J12B 1N3NB 3AS2A 3DPBA 2P48B 4JY6A 4X7DC 1H0DB 5E8PB 3QAZB 5DRZB 2FGZA 1WITA 5I8EA 3WFDH 5KS9B 5GGRB 4HIHA 2NQCA 5E2UL 5EOCL 4LLAA 3GBLA 2HTLD 4PJ5B 5HHMD 4TVPE 3TA3B 4YIQB 3HMXH 1QFWI 5IBUG 2F58L 4P49A 3FFDB 4GMTL 1HZHL 2EDFA 5EU3B 4PY7A 4E5XA 4RAHA 4Q0XH 3EYSL 5DRNB 1N0XH 5AZ2H 2CK0H 4TRPH 4Z77B 1UQSB 4RFEB 1LDPL 4HCRL 5D1ZA 2JIXB 3D9AL 4X9FA 4FQXA 1X7QA 1F4AA 1SJXA 2AV1B 1FO0B 1CIUA 3B6SA 3NCYS 2XY2A 4ZQKA 2XPGB 5CGYD 5E7BA 4Y4KB 4HIEA 4LSDA 4ONOA 4OLEA 3LMJL 4HKZA 2UWEE 4OLZL 1RZ8A 4X4ME 1UB5B 2X4OA 3B9EA 3VXMA 3SGEI 3BXNA 5C07B 3VFNA 1RJLA 2XTJE 5IJKC 2I5YL 3F58H 4OCNC 5JHLL 1WQVT 2YKLL 5JZ7D 2DLTA 1C7SA 3NIGF 1ZGLP 2HFTA 1XCTA 4NNYB 2BY2A 1Q9WA 2QTEA 5IBLC 1JPGB 1C5CL 2FWOB 4R7NA 4LSQL 2X05A 5FGRA 1M7XA 2FIRT 1VFOA 3CX5K 4I0PB 1OVZA 1NC4A 1UKQA 4KTDH 2J8UB 4C55A 4LHUG 2R0ZL 4JRWA 4XXCA 3IGAA 2R23B 4KJQD 1I8IA 5BV7L 4NC2B 4HLZH 5ESAA 5EIIA 4QEGA 4PP1D 4QHLA 5DQJB 4EDWH 3BZFB 4XNYL 1KJ2B 3WO4B 4QXTA 3ARFA 5IMKB 2NY0C 1CLOL 2BX5A 1CG9B 3BSZH 4NQCA 4GRWH 4XHJC 3K2UH 5E8EA 4WW2A 5I0DA 4OF7A 3VXRB 4MCYB 4CN4A 2LTQC 4M6MH 4M6NL 4C56B 2Q6WA 2ILLA 2BERA 1JP5A 2HKHL 4QY8A 1R6VA 1DVFA 1CFNB 3VXME 1ZWIB 4BK4A 5DJXA 5D71L 3PGFL 1LP9A 3V8CA 4MWFA 3TV3H 1FYTB 4DKAA 2DQUL 2ICWB 3NFSL 1J8HB 1H3PL 4OUOA 2A9NH 3T0AA 4H5SB 2UYLA 4JRXA 3UTTA 3WFEL 3RVUD 4NQDA 2F5BL 4OTXL 3T2QA 6FABH 1H3XA 4I48B 2DBLL 4OBSA 1U3HA 5K9OA 5MENE 4KK9D 1ZLVK 1OTUC 3L7FA 5EIVA 3I02A 4R4BA 5DEZA 3T1FB 1QNZH 2GK0A 1JWUA 1MAMH 4Y4HA 5IW1A 5D2LB 5E8OB 1FAIH 2CSPA 3O9WB 4HHAA 4XNQA 5GRUH 1ZHKA 2VO5A 3QDGD 2CUIA 4GS7B 5GGTH 3UXFA 1OB1B 3PABA 4K9EC 3Q5YA 1T03H 5KSAC 4DUWA 4GW1B 3V6FB 2VN4A 1QLFA 4EOWH 3EYUH 3FO9B 1ETZB 3CAFA 3VFOB 1F90L 3PDOB 4P46B 4I18A 3U83A 4ZNEE 2XQYK 4PJDB 4LNRB 5DRXB 3C5SB 5CEZH 4QOKA 3KDMA 1F11B 4HUUB 1IJ9A 1KCUH 5C6WH 5IJVB 3VGAB 1CBVH 1YN7B 1YPZA 3C60A 3H42L 2HJKB 3DVGA 5IB3A 4LBEB 1IARB 2DQGL 4XGZA 3ABZA 5ETUB 1C12B 3S36L 5CFHA 4NBYB 3FB6A 2GEEA 1S9XB 2Z31D 4A6YH 3OKOA 1XGRB 4N8VA 3IU4L 3G6AB 3G08A 4LLWA 4WI4A 2HTLC 2W38A 4M1DL 4YC2C 3BD3A 1WCBA 2IBZY 4KK8C 2VKWA 1LO2L 2D7TL 3DOSA 3QFJE 4GMSL 4G6FB 1IC7H 3VXNB 5DEFB 3DXAE 2YSSB 3QDJB 4NGHL 4QF1B 4OF5A 1ZHNA 4R4FH 3HR6A 4I4WA 1AR1D 2F9BT 1A9BB 4RZCB 3VG9B 5LJYH 5BQ7B 3ZTJH 4FQHB 1BBJA 1TTGA 5DR5H 3BW9B 3RZCC 5BW7A 1CQYA 1IEHA 2PO6A 3O11B 1BHGA 5IWLA 2PTTB 4QOKE 1RUAH 1EFQA 3BH8B 1WISA 1JGEB 2J6EA 4AH2B 5EU7E 3LKNA 3X3FH 3BDYH 4FQ1H 1YPZE 43CAA 4TYUA 1P4IL 4F7MB 1YMMD 3PWPB 5L2KB 3QHFH 4HH9B 5C0GA 4X5WB 2ICEA 4G8FB 1DQLL 4JFEB 5DURB 2GTZA 1U58A 3FAWA 2CO6B 4X9HA 3BWUC 4PJBB 2NY5H 4ZUUA 4GAFB 4TRPL 4B50A 3NA4A 1EHLH 5DC4B 3QEGL 3RU8L 4JANA 4Q9RH 4X6FB 4JPKH 1WEJH 3NFPB 4OUUB 5EG6C 4EBQH 4Y1AB 2OSLB 3MV8B 4O58H 2BSSB 4LCCC 1VA9A 5TDOB 4K7FA 2HFFB 4P2QB 2P42B 3ZKSD 1BIIB 3LKSA 4QT5A 1VFUA 4KJQC 2NY6C 1LMKA 3T2OA 5IOPB 2QADB 1OGTA 4WHDA 1YEGH 1ZTXL 4UIKL 4LSUH 4PP1C 4GRLB 2HTKD 3AMLA 2J4WH 4P3DA 5EO9A 1G9EA 4Z6AT 2EDRA 3UJJH 3F58L 1Z3GH 2XKSA 1DSFH 1EGJH 4LSPL 1A6PA 3P9MA 3MRMA 5MEQB 3LPGA 2GITA 1CICA 4HKXA 2MKWA 3LDBB 2WBWB 4P57B 2Y07L 1T5WB 2DWDA 4WV1B 2YD8A 4I5BB 3ARGA 4HEME 4KZEH 1VSCA 1KB5B 5FM8A 3VFRA 2HVKA 2PKDA 3H7BA 2HT3D 5E2VH 1F8TL 3RRQA 4QO1A 5SV3A 4KTDL 2AJUH 3G5ZA 4MHHG 3DGGA 3A67H 4OD2A 3WUWA 5J57B 5FV2A 3MJ8B 5DUPH 1JMXA 4JY4B 4N5UA 5I8KH 3RY4A 4EDWL 5DJ6B 5EU6A 3SDDC 1IAOA 4P4RB 5I0ZA 1CFSB 4BFGA 1X5LA 3TO4B 2APVA 3K2UL 3DRQA 4RQQA 2NR6C 1PW3A 4M6ML 2XZZA 1T83C 3IFLL 4ZO7A 3L3KA 3OV6A 1G6RA 4NQTA 1PJ9A 4Z18A 1DBMH 3QCVH 1IQWH 3D0LA 4YXHH 2CDFB 5F1IB 3TV3L 3HI6H 1YN6A 3PWUB 2A9NL 1VGKB 4Q9BA 2GJJA 4KAQH 3MZTA 3HHRB 1R5IA 2CUMA 1J05B 4XI5D 9CGTA 1CD1B 1MCEA 4YHZL 4IIQC 4K3DH 3H3BC 1OAUH 4LVEA 5I66A 1HDMA 2IF7A 3LN5A 4JM2B 4OM0L 2VXTH 1X5XA 4OGYH 1QNZL 3K8KA 2LFGA 2CDEA 5A3IC 1AIFA 1FAIL 2Z8VC 4R7DB 5D6DA 5GRUL 3RZWA 4PJEA 5F9WB 1VPOL 3P4MA 4P48A 3L5IA 3MRRA 5GGTL 5HI3C 2VR9A 2AJ3B 2JK5A 2VISB 3DBXA 1JHLH 3DMMD 4L4VB 5EZIH 5DJYA 1IGCL 2B39A 3L3JB 3INUH 4HS3A 3TBTA 1OW0A 3EYUL 4EOWL 3SE9H 1QSFB 3HZKA 3MRIA 3WJJC 2YRZA 4J8RA 5CZVH 4MQTB 3WN5C 5CEZL 1KCUL 2GT9B 1E4WL 2JJSA 3P4NB 4JKLA 4X6BB 4MVBD 1QRNE 2JCCF 5B8CB 2CIKB 2DB8A 3SKUD 1ZVYA 3MRPB 2ATPB 5D7SL 2FIKA 3ROOA 5HHOB 5FUOH 4OLXH 3S4SB 4AT6B 2X4RA 4JZJB 4PJHB 4YR6A 4A6YL 3Q0HA 4W6YB 2JLLA 5AYUL 3U7AA 4XMPH 1KJMB 4JHZA 1FVCA 1KG0A 4L4JA 3MXWH 1L4IA 4PP2B 2HG5B 3A0OA 2W0PA 4HKJB 1IC7L 3DSNA 3HE7D 1KJ3L 1X5AA 2PW1B 4NFBA 4LDOB 2EEBA 3MNVA 3VFUA 1VACA 3IDMA 5KN5A 4HG4J 2A6DB 1YEIH 1G9MC 2ZNXA 2A6KA 3LQAL 5ALCH 1WBZB 1GAFH 4H26A 4P5KB 1SBSH 2F53D 5JMRA 3STZB 4RNRA 4Z95H 4PJGE 4PLKD 1OAZH 3H9YA 5DR5L 2ZCLH 4NKMA 3RIAK 5FGBA 5IKCB 5F6HI 3MRLB 4QRTA 4HKBB 5CIPB 1NCWH 5GS0D 2FBJH 5EOCJ 1OGAE 2B0SH 3ZHDA 3BDYL 1YJDL 4XNMB 2R2EB 4U1NB 4MJIE 1I1FA 2WIIB 4CADB 3L3GA 4HUVA 3EAKA 5I17A 3T65B 3QHFL 4OZGA 1DBKH 3OZ9L 5CINH 1IVLA 4HC1H 3V9FA 3MPCA 4UB0L 5J1AB 4LSVH 5ADPH 2N4IA 1AO7A 1YEHL 5CP7B 5C2UB 3PHOB 2ZUXA 3WXWH 4LAQL 2BNQD 3QEHB 2NX5D 2MFNA 1TNNA 4PJXF 3O6ML 2NY5L 1FDLL 1NFDA 2HAZA 3TYFB 1ZHLA 1EHLL 2HT3C 1MRDH 4Q9RL 1FIGL 4JPKL 1WEJL 4U1KB 5C0JB 3CC5A 1M05A 5EBWA 4EI5D 3IJHA 4O58L 2JB6A 4QHUB 2IH3B 3O4LB 3T4YB 2VDQH 1YEGL 5E2TH 4LSUL 5GGUB 4ERSH 2AV7B 4LAJH 1MVFA 3FQXB 3KWWA 5DJ0B 5T33L 1FL5B 4MCZB 3EYOB 2ICWI 5BZWB 4LHUA 1KPVA 4WFED 5J6GB 4O9HL 2PN5A 3I3DA 3X11A 4D9QE 4Y19D 1FCCA 5A2KH 1UZ6F 2SEBB 2FX7H 2NY2B 3QIUB 3GSVA 4EUPH 1HSBA 1T1WB 1DSFL 1EGJL 4F3FA 1W0WA 2O5XL 4K3GA 1UCBH 2X1OA 3VWJD 2PYEB 1AGDB 4MMXC 2W9LA 4KI5D 1U8JA 3FT3A 2BNRD 2W91A 1XZ0B 3GIVB 3GMOA 4LEXL 1WWAX 4FQLH 4ZXBA 4NM8L 1KB5H 2VITA 5IV2B 2YPLB 2OBGA 1W0YT 3E2HB 2X40A 5E5RB 2FLBT 3D39D 1KEMH 3A67L 1MHPH 1EUUA 3LZFH 1M6OA 1NFDE 1BZQK 5CD3A 1KCVH 5DD6B 4JFOB 4CMMB 1HCFX 5I8KL 2FJFB 4PJAA 3TEUA 4RGNC 1P53A 3O3DB 4MSWA 1MI5A 3ARDD 1WAAA 4WI8A 4MJ5B 1GC1H 1WUNT 1I3GL 3QEQE 4LLVB 4ZFFB 4UTBH 5EBMA 3FCTB 4PJGF 1DBML 3JWOC 3BO8B 3MFFA 3HI6L 3D5OF 1UM5L 2G9HB 5IVXF 3VWKA 2EIEA 5EBGA 1S7SA 3VD5A 5ISZA 5IMOB 2KH2B 4MXVE 4FRWA 4KAQL 1BLNB 1FL3B 5C09A 4LLUB 3HKFA 4W4NA 5D70H 1ACZA 1CDGA 4KKBC 3JV4B 2Z93B 2YEZA 3MV9A 4G6JL 4LKXB 1D5MA 2P45B 4HV8B 1IM9A 4GUPB 4XCEA 3V7AG 4KKAD 1RZGB 3X12A 2Q76B 2FD6H 2VXTL 5HHPA 4WENB 3NGBB 3RVTD 2WBJB 1GOHA 4PRHD 1MRCL 1WTLA 4UQ2B 3PWVB 3VFPB 5FYJE 3CSYB 1K6QH 3MLUH 3F7VA 5CEYB 1RUQH 5DI8B 3EO1B 3MV7E 4NQXA 3AS1A 4RRPG 4ZAKB 4U05A 5EZIL 4L5FL 1I7UA 4PJAE 2B4CL 4JGMA 3HN3A 4NDMB 3RWIB 3INUL 3SDAD 4J3OC 3V5KA 2VZ3A 4RIRA 5I30H 1BJ1J 5LCVL 3X3GH 2VC2H 3H3KA 3G04A 1NLDL 4S1DD 3MUZ1