3FSWA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaaahaaam)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCAAAAHAAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fswA00
3T9WA 3HB3B 4K9JA 1AG6A 3CVCA 4FAAB 1AZUA 1L9OA 3PCYA 1A3ZA 4KNUA 3PAVA 4JKNA 3AG4B 2IDQA 4L0PB 1L9QA 1AIZA 2PCFA 5AFAA 1GS7A 2VW7A 2FQEA 1BYPA 1DZ0A 3H4HA 1PLAA 3FPXA 4F7KA 4Q8BA 2CAKA 1GYCA 3GYRA 3TBBA 1W8EA 4G72B 1NZRA 2TSAA 5B1JA 1SF5A 2H3XC 2XXFA 4DP9X 1V54B 5I28A 2Y1AA 5ANHA 4KNTA 1OV8A 3HEIB 2FQDA 1NWOA 3NJFA 2PLTA 3AY2A 4YSSA 2IDFA 1GR7A 2JKWA 2R7EA 1MZYA 1AAJA 3UGEA 1GY1A 3FYIB 2YAEA 4G71B 3CG8A 1M56B 1NTDA 4CSZA 3S8FB 5I5MA 4DP0X 3OD3A 4A2HA 1PZAA 2BWIA 3ERXA 2PP7A 3NT0A 1KBVA 2VW4A 2CCWA 5TK2A 4A67A 2ZXWB 2XU9A 3CVBA 3QJSB 3AG3B 4PCYA 1MDAA 7PAZA 3OMNB 4E9RA 1JZIA 3QPKA 3ZIYA 4WTQA 1ZDSA 1BXVA 4MFHA 4HHGA 1OCOB 3CDZA 4YSRA 1OCCB 1AZRA 4A66A 1ETJA 1UATA 3QJTB 2IDUA 1KCBA 1I53A 2XV0A 1NIEA 2BZ7A 1KDIA 2GIMA 1JERA 1HAWA 2VM4A 3EF4A 3OQRA 4YL4A 1NIDA 1E5ZA 1OOWA 1KDJA 3FPYA 5F7BA 4KO7A 3IN0A 2GB2A 3PAZA 3FU9A 2GC7C 5EHFA 3NJNA 1PZCA 1URIA 2W8CA 2CBPA 1E30A 1PAZA 2IAAC 3GXUB 1AG0A 1HFUA 1QHQA 2AZAA 1BXAA 3ABKB 3NJKA 1ASOA 1IBZA 1TU2A 3IE9A 1N68A 2N0MA 2AVFA 2VSMB 1JZGA 4W9ZA 5B7EA 1J9TA 4HCIA 2P80D 1SDDA 4A2EA 3SBPA 2QT6A 3SQRA 3IBOA 3X1GA 2JXMA 4AKQA 3KW7A 5A7EA 4KO5A 1BQRA 1PNCA 1KYAA 1NIFA 2CUAA 5I6NA 3NSFA 5I26A 4UF7C 1IUZA 6PAZA 1ZIBA 2H47C 3PAUA 1R1CA 4HALA 2VMJA 3AZUA 2FT7A 3NJIA 2ZOOA 4QKTA 2VN3A 4E9XA 3V9EA 4M4RB 3EHBB 3X2QB 1ILUA 2HX8A 5FC9A 3UAAA 2XV3A 2GC4C 1PMYA 3TASA 2FT6A 5I5JA 1V55B 2XWZA 4GY4A 4DPCX 3QJRB 1TKWA 5I6PA 2IWKA 4HCGA 3KW8A 4X4KA 1V10A 1B3IA 1HAUA 2EIKB 2YAFA 2CALA 1E65A 1A65A 3NJMA 2B3IA 2YQBA 2ZWNA 3EH3B 3NJGA 4ENZA 4N8UA 3WNIA 2PPDA 1JVLA 3T6WA 1OE2A 2GSMB 1FA4A 2AANA 1JOIA 2FWLB 1RCYA 2BHFA 1SFDA 5E9NA 1WA0X 3TA4D 4DP4X 1JVOA 2J56A 2YAOA 2HLEB 2QDWA 3OMAB 3SBQA 3NJLA 3QJQB 1MZZA 3T71A 1BAWA 5AZUA 1GW0A 1AS7A 2BP8A 1NPNA 2GBAA 1BYOA 3FQ1A 3MX0B 4YSUA 2BO0A 2J55A 5LDUA 2MRYA 2PP9A 9PCYA 3WKQA 2X87A 2YAMA 1XB3A 2HRHA 4AI7A 2I7SA 1SNRA 1GS6X 1SFHA 1IBYA 4DP8X 2IWFA 4YSCA 1TEFA 3C75A 1SDDB 3H56A 1XMEB 1WS8A 5D4JA 2AFNA 3PLYA 3UAEA 4BXSV 2EILB 1JXGA 3FQYA 3IEAA 2BW4A 4BDVA 1L9RA 2WSDA 3FQ2A 1ET5A 1WAEA 2OJ1A 3IN2A 1J5DA 3JTBA 4DP7X 1ADWA 3U25A 3FU7A 4YSQA 4JHVA 5B1KA 2VM3A 2DV6A 1BQ5A 4KO9A 1J9SA 2FQGA 1RZPA 4HAKA 1DYZA 2PPCA 4BK5C 1CUOA 1OF0A 2LLNA 4HCFA 4E9TA 1FWXA 4A2FA 2HXAA 1J9RA 2TSBA 2FNWA 1BEXA 3ASNB 2XUWA 4A68A 1ET8A 3PXLA 2DWSA 1ILSA 3UACA 1ZDQA 4GP5B 3L45A 3FS9A 4E9VA 1L9TA 1XB6A 3TBCA 1ZV2A 1F56A 1X9RA 1JZFA 5I6LA 4HZ1A 3N55A 4E9YA 1A8ZA 1VLXA 3TU6A 4F2FA 1NPJA 3QJVB 4FA7B 2YAQA 1JZEA 1MG3C 3NSCA 2YAPA 2YXVA 4AKOA 1CURA 3NSDA 3BVDB 3ABLB 2XX0A 1A4AA 4G70B 1FFTB 1RKRA 4YSAA 4HIPA 1CC3A 2GI0A 3S3CB 1OCRB 2MTAA 2EIJB 3FSVA 3NJJA 2BW5A 4GYBA 5IY5B 1TEGA 2R7EB 2P80A 2FQFA 3FSZA 1MG2C 3ABMB 5PCYA 1OE1A 2BZCA 2HZHA 1W6LA 2PCYA 2PPEA 3WNJA 4P5RA 1PF3A 2QDVA 2PPFA 1SHXA 1WA1X 1AS8A 3QQXA 3EH5B 3DKHA 4DPAX 4AX3A 2YXWA 2WO2B 2I7OA 2PP8A 3RYMA 2Q9OA 1NIAA 1WA2X 3X1EA 4YSTA 2IDSA 1SF3A 3D12B 2VW6A 1KV7A 2ZONA 4DP5X 4E9QA 2OV0A 1KGYE 2XXGA 4BDVB 4KOCA 5D4HA 4F2EA 6PCYA 1ASPA 3CDZB 1CYXA 3T6VA 4EF3A 5TK4A 4BWTA 3FU7B 1AZBA 3WIAA 2B08A 5D4IA 2OCCB 2Q5BA 2YAHA 3WKPA 1OE3A 1T5KA 3UABA 4NB7A 1EHKB 3X1NA 2E86A 4TXVB 1XB8A 3SBRA 1NDTA 1OCZB 2BWDA 2QPDB 2RACA 2HRGA 4RH4A 2EINB 1JXFA 3OMIB 1SHWA 5B1JC 2J57A 2BP0A 3FYEB 2XVBA 3EH4B 3NP4A 4YSDA 2PPAA 2DYSB 1PLCA 4JHUA 4DPBX 2YARA 4HHWA 2UX7A 3NJHA 7PCYA 1NINA 2A3TA 5F7AA 4A2DA 1E67A 2UXVA 5I6MA 2I85A 3AG1B 4UANA 5B1AB 1YLBB 5PAZA 1PNDA 2VSKB 3ABGA 4KOBA 4AZUA 1GY2A 1PY0A 3BQVA 1SJMA 3JT2A 1NWPA 4YSPA 4NERA 3MBWB 2Y69B 1JXDA 4PAZA 5B1BB 4M3HA 3DTUB 1NIBA 1PZBA 2HX7A 2XX1A 2NRDA 1KCWA 1AANA 2JFCA 4DP1X 4UAHA 3X1BA 4Q89A 2UXGA 3V9CA 3G5WA 2IH8A 2XLLA 4DP6X 1A4BA 1NICA 4G7RB 2AZUA 4YSEA 1AACA 2IH9A 2IDTA 4YVNA 3FSWA 1E5YA 1PCSA 3GDCA 5I5IA 2XYBA 1IC0A 4G7SB 2XV2A 1AOZA 1GS8A 1ZPUA 5AKRA 1L9PA 2QPEB 1QNIA 2FJSA 3WG7B 3NP3A 1IKOP 2WO3B 3FU8A 3ZBMA 4GP4B 8PAZA 4E9WA 2CJ3A 4YVUA 1AS6A 1M57B 3CZUB 1BQKA 4E9SA 3DIVA 1W6WA 1ASQA 2DYRB 2IWEA 3OM3B 1GSKA 1M9WA 1AR1B 4G7QB 1X9UA 3T6ZA 5B3SB 1L9SA 3QJUB 4BWWA 4DP2X 3UADA 1AZCA 2EIMB 1A4CA 3NSYA 4KO6A 1JZHA 2BP0B 4YSOA 1AQ8A 1J9QA 2W88A 3H4FA 2BP8B 3FSAA 2UXFA 3ZX1A 3PPSA 1KBWA 3S3DB 1ZIAA 4GP8B 1AZNA 2DWTA 3CVDA 4ZK8A 3ASOB 3S8GB 1CYWA 1RZQA 2FTAA 2J5WA 4N4YB 3WI9A 5I6KA 3X1FA 1N70A 2UX6A 2DY2A 3AW5A 2GHZA 4GXFA 4QLWA 4AKPA 1WS7A 3ZDWA 3S3BB 2H5UA 3NYKA 4WKXA 1PLBA 1ID2A 5B7FA 3N2JA 2FT8A 2HX9A 5B7MA 4W1TA 2X88A 2UXTA 1EZLA 3AG2B 1JZJA 4CSPA 4P5SA 1ET7A 1BXUA 1QLEB 4NAJA 4BWUA 4A2GA 1J5CA 4KNSA 3FT0A 3T6XA 5I6OA 4BXVA
chains in the Genus database with same CATH superfamily
4PGCA 3E1F1 4JFHE 4X7SL 3DURA 1HS6A 2PO6C 4N8VA 3SQOH 3QARA 3LEVH 1G9ML 5INDA 4AL8H 2Y6TE 4I3GA 2E5EA 2V2WA 4Y1AD 3UTPD 2YSSA 2HWZL 4KK5C 1B0RA 1Y6NR 4L9LB 4AMKH 5C07A 2GJRA 2VW7A 5CUSH 3PP4H 4KVCH 2H1XA 4K73A 4X7FC 1A6AB 3QIWB 1IBBA 3IF1A 3TNNA 3C5ZA 3IGFA 3LKQA 3T4AA 3P0VL 1YEFH 4L5FL 3H2QA 4GXUN 2QR0A 4O5LH 3N1GC 4PJ7B 2WXJA 3NZHH 4B9ZA 1N5YH 4PW3A 1F58H 2CIIB 4U0RC 5I74B 4RRPM 1GZQB 2VOTA 4D7PA 4MD4A 2I60H 1QYGH 4GXVH 5EBWA 1ZLUH 3T3PE 1HQRA 2HJFB 3TVMB 2HT3D 1L0XA 5ANHA 5JW4R 4KNTA 4MHHI 3S36X 1TNMA 1J86A 4LPWA 3BO8B 4NHUA 4EDWH 3BVNB 1SXZA 4JQVA 2PLTA 4KK9C 2NPLX 5HXMA 2XN1A 4HW6A 2AJ3A 2R7EA 4PG9A 1UB5B 3K6NA 1GY1A 1LO2H 3JVGC 2WPGA 4PM1A 1LILA 4JY6A 4EQ3A 4DP0X 2ESVE 2WLIB 4YHZH 2ITFA 1U8KA 3DIDA 4U1MB 3BUPA 3WNMA 1U8PB 4N8CL 3C6SA 4M8UA 2YXMA 2DRUA 4UBDC 1YECH 1LEGB 4ZNEE 3HB3C 2X7LA 5FLVA 2R1XA 3FT2B 2CU9A 2MJWA 4V2BA 1QRKA 4QHKI 3IDIB 1OAKL 4TYUA 3ZL4H 1SGKA 3MV7B 1TJGL 3V4PH 1T1WB 2VDNB 5D5MA 2G60L 4F7MA 4ZG1A 4NBXB 1H6UA 4OSUL 1C1EH 1BAGA 5IR1A 1NOFA 4ZMAT 1QEWB 3VA2C 1HZHH 1VAHA 1PSKH 3DOIA 1IGIL 4TVUA 4UTBH 2QSCL 3AREA 2VLRD 3FPYA 1H8SA 3NDYE 4AG4L 1ACCA 2G4GA 3UZVA 2QGBA 4P07A 2IH1A 4YWGL 4IDJH 2WAHA 5F7FA 3DHMA 2YD6A 2YBRA 2P5WA 2XRAH 5ID0B 1R5VA 4TN9A 1Q94A 3DSFL 1I1CA 4MJ2A 2IAAC 1PPIA 1JD7A 2G5BB 4XPGH 1S7UB 3CC5A 3TOPA 4LPUA 4NOBA 3DVGB 5E4OA 3BSGA 2JK5B 4NKMA 5E2VH 4NNYB 2VDKL 5F3BB 4WLCA 2DQCH 4FHBD 2NUPB 1U8HA 4IS6B 4L23A 4MAUH 4FQXC 5ITFB 1NOAA 1ZS2A 3SE6A 3SDDB 2CXGA 2FLBT 4NWTL 4FXGC 1GH7A 4QRUB 5CN2A 3FCGA 1U3HB 1YJDH 1ZVSA 4JFXB 3MYZA 3R06A 5KSUA 4GLRI 1BQHA 4GQRA 2BRRL 4F3FB 3X2QB 4L8BB 3RL1B 1QP1A 4UM8B 4GS7B 1NC4B 2Q3XA 3BZ4A 5DK0A 2O1AA 2LOEA 1DDHB 2O5XL 5EEWA 1FZOA 1HI6A 2VC2L 1P0SE 5F9JA 4F2MB 5I8KH 3GUTB 3H2PA 1UJTA 2FT6A 3FW6A 4H20L 2XWZA 4L0ZA 1AFVL 5E94B 4IM8A 5GGTH 4CVXB 4KTDH 3ZDZB 3NCWA 1QSFD 3GK8H 3TN0C 4EKXA 4XAWH 4GAGL 1A6TB 2CALA 2GTWB 1A65A 3CSYB 4MRBA 1BFTA 5I0WA 3BX7C 2WQRA 3BPOB 1RZ7L 1ZWIB 4OCSL 4QRTA 3GMNB 1J5HA 4C56B 2CR0A 1FA4A 3FF8A 5I23A 2VO8A 1L5GA 3NEEA 2F54E 5LBSL 1PTZA 3ZTEA 1E4WH 3KCPB 1ETZB 1XF4B 2K9FB 2EC9T 3KEHA 5EMYA 5DS1A 2CO7A 5JHDB 2HLEB 3OKOA 1ZGLA 3OMAB 1OAQL 3X17A 4KKCD 4LCVA 4X5QA 2A4ZA 3QUKB 43CAB 2P5ED 5I30H 1NEUA 1C8PA 1ZSDB 1U2CA 1RUAH 2YPKA 3BUBA 1I9IL 4HD5A 2GBAA 4K3HA 4ODTL 4ABWA 4WNJA 2H41A 1ID5I 3BE1L 3JYBA 1SVZA 4PJBA 3VXMD 4FE9A 1NDMA 4J5VA 2QQKL 2WLMA 1X5FA 4OGYL 4OIIL 5AW7B 3T3ME 1JPEA 4OCRL 5JW4N 3WTTA 3B9KD 3AITA 4AJ0A 3CFJB 2NXZB 4P2QE 5LHDA 4R9HA 1RY7B 3HE6A 5F7WC 5FYKE 3VQLA 2C1PB 4FZEL 3H56A 2CR6A 2KT6A 2YLHA 2H32A 4DWHA 2HLAA 4PJCA 4E42A 3C5SB 3OBAA 4G8GE 5K59E 1TYEB 1A4KA 2ARJQ 3GMQA 3T09A 4HEME 5J8OA 5CJQL 3VXPB 4XP1H 1EGJL 2OJ1A 3U4BL 1FP5A 5JHBA 4AQEB 3FU7A 3CE1A 5IVXA 1CGXA 4PJ9A 4ZTOH 1MHHA 4X6CB 2K70A 3QI9C 4YDMA 3RWCB 3E6HA 1DYZA 2J4WH 3Q8FA 5BO1L 3UPAA 5LLIC 1BF8A 1KEMH 4PW4A 4X5WA 3LJ3A 2NYYC 3RU8H 1YEIL 5M7QA 5FIEA 3RJDA 4FQ1L 2ICWB 4R0LC 3BEVB 4BCXA 4CVUA 2B2XL 1OSPL 1WZ1H 3PWUA 4TLTA 2X4SA 4S1RH 1WPCA 3B34A 3DX1A 3H0TB 4JR9L 4WFGD 4YHPB 2VDRH 2AQRA 2LLGA 5DHXB 3PWLA 2X3AA 3L3HB 4L8DB 4CC1A 3VI4B 4HPYH 3IYLW 4ZX6A 3N43F 3G6DH 5KS9B 1T0OA 5I1KL 3CDCA 1VDGA 1Z0MA 4ODSL 1FVDB 3MUGB 2P1YA 1FYHB 4PGBA 4NNPH 3TU6A 1ONQA 3MACH 3AM8A 3WMQA 2WBWB 3UO1L 1L0PA 4Y88A 1S7TB 1D7BA 2Z35B 5DQ9A 4JRXA 5IJKA 4ANWA 3EOTH 2F1AA 2IAMC 2R2CA 4PJ8D 1FFTB 2Y6SD 4UOW0 3WKML 1RKRA 1QI5A 1ZMYA 1NCJA 2X4PB 3EFDH 2IPKA 5DFVC 3KLAB 4XBPB 1R4XA 1EPFA 4ZUTA 1OE1A 2RGSA 4JPSA 5PCYA 4Z8FL 1KJMB 2PPFA 1IJ9A 1PS3A 1UQSB 1FNSH 4MA8L 2AEQH 4Z7WA 2M2DA 5A43C 4NHCL 1QA9A 3KL0A 1W72B 4PREB 2FGWH 4GO6B 1RZKH 4X6DB 1P4BL 1NM4A 5DEZA 1SF3A 3UG3A 2FATL 3ZIMA 1AIFB 2ZONA 3A24A 1EAQA 2DD8H 5HGDB 4UQBA 5EC2B 2ZKXA 4OCMC 1KSRA 3QQDA 3G5XB 5FYJE 6PCYA 3MRQA 1RMFH 2EVJA 4EF3A 4JREB 2JJSC 2XZZA 3UZQA 3I50H 4C4KT 5I17A 3BISA 5J11B 4WHYH 5AOMA 5EU6A 3BSHA 4N0CC 3RI5K 1MELA 1AGDA 4G82A 3EBAA 2GT9B 2MEJB 3IRZA 3U36A 3T3MF 2BM3A 3O11A 3QORC 3AGWA 3R0NA 4MSWA 3DMMB 4XBMA 5C8JA 4LBEA 2XVBA 4DGIH 4IRJB 3MSPA 4NYLA 3RWFA 2F15A 4JFPB 1MCNA 2CO3A 1F97A 1SVBA 2XDHA 3DUSA 1U3YA 1LNUB 3BVUA 4ADIA 1K5NA 3NIFE 3QFDA 4G2AA 5DUPH 5K59F 4POZC 3SD2A 1MWAB 2W0FB 5I0YA 5FA3B 1B6DA 5KVFL 4PTUA 2R69H 4P9HH 5LCVL 2QTVA 3UTTB 4N0FB 3D09A 2NY0D 1MI5D 5PAZA 3ZTJH 2DEXX 4MMYA 3QIBA 1UA6L 4Q74A 1MFUA 3PS6A 4I3RL 1UA7A 2B15A 4EI5B 3JT2A 1CDBA 1I8KA 2DIBA 4ANVA 5J9PB 3DETC 1EFQA 2K6YA 3OX8B 2XV6B 3QEGH 4WTWA 4HIEA 5BXFB 5CU5A 1S5IL 3IJEA 1TLKA 3DTUB 2PXYB 4CU8A 2YOAA 1UVQB 3HRZC 3LEXB 1IGFH 2XQYG 2ZXEB 4U6HA 1DQTA 4D7BA 2K4WA 3ZKNC 2CM5A 1IO4C 1DE4A 2NY1B 4QRRD 4LEXL 1EUTA 4UM9B 1DN0A 1KPUB 4XTRD 3SY6A 2VERA 2R1WA 2XLLA 5LVEA 1SY6L 3C5JA 2VZSA 3VFUA 5I8EA 4BZ1L 1FFNB 4DGVH 4PRID 2WGNB 3BAYA 4OUOA 5L9DH 2AJSL 1IC7L 4I5BB 4G9DB 1QNIA 4MDIA 2BNRE 2D9QB 2JJWA 2FIKB 4XPBH 5D7KE 4PJDE 5D1XA 4TUKL 3M7OA 2V9RA 3RTQC 1DVFD 1JYXA 3GZPA 1MFNA 3P9LA 5E1AB 4CGUB 4CADA 2KZWA 2ZUVA 2VXSH 3CDFA 4FI8A 4J7RA 4Y1AB 2GIYA 1ADQH 2OTPA 2QQLL 4LHUD 5TGBA 5KVEE 3VQ1C 1CR9H 2R9HC 1E4KC 3OAYH 1DBMH 3V4VL 3I9GL 3CCHB 4PMFA 4NLHA 3COOA 4BKLA 1CDUA 4XRCB 5L88H 2KLRA 2V8MA 4PG2A 2BK8A 1X9QA 4X7SH 1GJWA 4PCTA 4ZPTA 1PW3A 2XCMC 3L95B 5HI3C 1G9MH 4NXKA 1D2OA 1WCBA 2DWTA 2MCG1 4Z7QF 2HWZH 3GMOA 3S4SB 5I6KA 4QTIH 1WZLA 2H1PL 2GHZA 1ETA1 4GXFA 5CAYB 3CFKB 2Z4QB 4U1NB 2CGYA 5B8CC 2E3VA 3P0VH 4KX8A 3HVDA 3QEQD 3D4CA 5IROD 1YMHB 4B3EA 2NTSP 3PJLA 4UDUA 2HVKA 3CX5K 4G8IB 2G5RA 2HFFA 5E0QA 1NCHA 3QDJE 3SQBB 3QH3A 3QC6X 4ZUSB 5JW4Q 4LSDA 4X80L 3DUHA 3D0VB 1BXUA 2D7MA 3VXTB 2F53D 1HSBA 5LAXB 3NIFF 5AVQB 4J4PC 3KMDA 3AG4B 3SYAA 4KK5D 1JPTH 3QIUA 2XWDA 5TF1L 4BSWB 4FABL 1J05A 5AFAA 6FABL 1SYSB 3IETA 1CFSB 3LQAC 2CCLA 4QY8A 3WXWL 5KYWA 4AYMC 4IBWA 4QHLA 4N8CH 5C92A 4NUPA 3QNFA 1GYCA 1HWHB 3GEWB 3BUYB 4N0YL 1UXWB 1NZRA 5BRZD 1M7UA 3MRGA 3VRJB 3WTVA 3V5KA 1WBXB 1WC7A 2LFGA 1BECA 1QRNB 2VLRB 2VDLL 4DP9X 2X9YA 4PWGA 2K7PA 1V54B 2WTRA 3MNZA 1OAKH 5FECA 1TJGH 4KK9D 3KWUA 3MBXH 3UMTA 2G60H 5C3LD 3LNFA 1G7JA 4AC2A 5FUCC 4OSUH 4YDLB 5DRXA 4J6RH 4WW2B 5ACMA 2I9LA 4MMXC 3DO4A 1NMCB 4GRWH 2YFOA 4W9FC 1IBGL 2QSCH 4TUJA 2HPTA 5EF0A 1GVIA 5AVZB 1TR7A 3BDXA 3SJVB 4AG4H 3V9FA 4DFHA 5B39B 3QDGE 3HC2A 3JV6A 3MRPA 4GBXA 5D7LA 5E03A 4YWGH 2XNAB 1PY9A 1CICA 1BZ7A 1TVBB 4UBDD 3BP5B 3PIQA 3HB3D 3DSFH 2M26A 5GRZA 3RZCC 3UXFA 1ZEAL 4AEHH 3ZIYA 4GAJL 4PJDF 1BXVA 1SEBA 3B9VA 3CHQA 4K23L 3TEWA 4RFNC 3IJYB 5F9AC 2BCMA 1QFWI 4OKVA 4MJ5B 4WUKL 5TPWH 3UC0L 4A66A 1IBHA 4H4NA 2A0LC 4JPWL 2CIKB 4H8WC 1XCQA 3H42L 4LQ1A 1X4XA 3CD4A 2DMGA 3QJTB 1B9ZA 4IRZL 4XCNB 4P2OA 1CT8B 5KYUB 2DIJA 4JFDE 5I15L 1NIEA 2CE6A 4NWTH 5DJAB 1QLRA 3BEWA 3FQNA 4NQED 2GK2A 1RJLB 2ZKWA 2WCPA 3HZYA 4GUPA 1QSFB 4J3VA 5BJTB 5MENA 2DIEA 1P2CB 1ANUA 3RWJB 3UTSD 2EVGA 5BZWA 3P11L 1QWUA 3DWTA 4M1CC 2PCFB 2FLRT 2O5XH 1S8DA 4XNQB 2WYZA 4U1LB 1ZA3B 1N8ZB 2N0MA 1GCYA 1A1OA 4PJ5E 2O6FA 2ZAHA 5CWSA 2K8QA 3GBDA 1AFVH 1N8OE 3RVTD 2ZOUA 4TQHA 1X4ZA 3MCKA 3W5NA 3O3AA 4L3EB 2FZ3B 1AGBB 2YPVA 4OFQA 4BH8A 5JOPE 4AUUA 3IDMA 3EXLA 1TCMA 1SXNA 4GAGH 4U1JB 1Y18A 2QZ5A 2GPZA 5FO9B 4QXUL 2CUAA 3IB4A 3NSFA 2O26U 1CCZA 1K4DB 2PCPA 1YPZA 4PY8J 4MB1A 3BAKA 5EF2A 2P5EB 1RZ7H 4OCSH 4WI0B 3VGEA 1DVYA 5L7XL 4NQXB 5LBSH 3SPVA 3RWEB 5KTEL 3WS6A 2VN3A 3T1FA 3CVHL 3RUGE 4R26L 2H6UA 5E9DA 5AYUL 3QVAA 2HX8A 3HI1A 4QXWA 3L17A 5HDOA 2SODB 1OAQH 1QOKA 5DJYB 5EIIA 1WFMA 1O6VA 5FOJA 2GJ6A 3PL6C 4QT5A 3HUJB 3R7RA 4B5EA 4IIQC 3HRPA 4P3WA 3RL2B 1I9IH 5ILTL 2YMXL 4ODTH 4PN6A 2RFXB 3SKMB 2CK2A 1I31A 4YDIL 3BE1H 4UTCA 3IKCA 4P5TC 3DOSA 2CLZA 3JUYA 2VDMB 1ZAGA 2ZX5A 4IOFC 4OIIH 3U6RA 3WNIA 5E6IA 5CP3A 3T6WA 2WKLA 2GSMB 2BIIA 4OZFA 3F58H 1ZRUA 4FZEH 1KPVA 3QNYA 4L29B 1JTPA 5ANMA 4OCXL 4S10A 2AS5M 4OM1L 4P0DA 1WA0X 4XP4L 4J3OD 5KSVB 1JVOA 5IM7B 1P6FA 1HXMA 2QDWA 1EGJH 3U4BH 4U05A 1MAKA 1Q9LB 3FQ4A 3F7VB 2GAZB 4Z78B 4KI1A 4LL1A 1R3HA 2WGXA 2Z31C 3MO1B 5BO1H 4AT6B 3FOLA 5GGRA 3ARQA 3PQYD 1JF1B 1RUKL 4PJFA 4RAVB 5F7UA 2MHAB 3K3QA 3H9HB 2HRPL 4FQ1H 4TNVK 3U4EA 2KS0A 1KBBA 3SBWA 3S5LB 3KJ6L 5D6CB 2B2XH 3T2LA 4UZSA 2NSXA 1MREH 2RR3A 3OKLA 5I1IL 1E3XA 1I1YB 2IWGA 4JR9H 4KKBC 4XODA 3P3SA 2EILB 3V7MA 5GRWA 3IEAA 3AS0A 4WWKA 4PJ8B 2BY3A 4ORZC 1YDPA 3GMPB 5KJ4A 3RKDC 4A7GF 3MRMA 2FX7L 2HLFD 5I1KH 2I27N 4ODSH 1EDYA 3LN5A 4PJXA 4Q9QH 2BVQA 1X7TA 2WZ6A 3QA3A 1DJHA 2CBMA 2F58H 4GO9A 4NN6C 3UO1H 1RZPA 2FEEI 1E7VA 2R0LL 2HTLC 2Y1VA 1KTLA 4B5ZA 2ARWA 4MA7L 5IESH 1HOEA 5GGUB 3WKMH 1ZJBA 4HX1A 4I77L 3I75A 5EN2B 2DWYA 3EGXB 4XNBA 1DL7L 4NAMA 1AJ7L 2OL3B 2BINA 1XR9A 3BGFB 5KBKA 3RIFK 1I3GL 1T0MA 1XHHA 3EUUA 2NW2A 3BZDA 4M48L 4MA8H 5CLXA 3ML9A 2QELA 3ZL1A 4TSBL 2Q2EB 3AXLA 1QWNA 4UOW1 3S36L 3Q8BA 4O51A 1PQZA 5DMKB 5A2JH 1IM3A 3H53A 4JPIB 3QJVB 1EBPA 1MLCB 3KJ4B 4EZMA 4LLUB 4F2FA 2EIZB 2FATH 2YBGA 2VN5A 4PGDB 5ESAB 4AKOA 2LE9A 3KM2A 5FHBL 3U0WL 3NPSC 5DJ8A 4D8PA 3MRIB 2Y25A 4WEMB 4KI5C 4HJGB 3L3GA 2WC7A 4N2LA 3L5HA 5EO0B 5TDPB 2XG4A 1NKGA 2BVOB 5B1CA 2WIIA 5C0GA 3KLDA 5J1SC 3WNNA 3T0VA 4GYBA 3KWVA 2VABA 2DQFB 4PQXA 2ZE0A 4OGAC 5GHWH 1TQCB 3MDJA 1KJ3L 4GJTB 1SHXA 3SDCD 3VGBA 3QAZB 3OF6D 5DHVA 3ZQWA 5L2KA 2EDYA 4AUYA 2NY0B 1MI5B 3ME0B 5LG1A 1I8UA 2JTDA 5ABZA 4M7JH 2PP8A 1JHTA 1UYWH 4YO0A 5IW1A 1RIUL 3Q43A 3X1EA 3KLHC 5IBLC 3D12B 1DR9A 2HN7A 1KB5A 4S2SA 1E3ZA 4LVNB 3N3EA 5T1JA 3UJJL 3IJSB 4DP5X 3E9UA 3BI9X 3CFBA 5KVFH 3HMXL 5D4HA 5LCVH 1ASPA 5E56A 1KBKA 4APQA 3GSNL 4XH2A 1R47A 4X6EA 1R3KA 1UA6H 3VGAC 1Z5LA 3VRIB 4I3RH 3OR6A 2AJVH 4FS0A 3FAXA 3BIAX 3UABA 4PY7A 1C5BL 1FYTE 2OSLA 3L5WA 4QRFA 4F7CA 2BXZA 2WSPA 2VLKE 2EINB 4IHBA 5GSVB 4J8RB 3CFUA 5J5EA 1G4RA 3E2HB 1S5IH 1V7ML 3EH4B 4X4XB 2AEPL 2X4TB 3AADB 4EO5A 4EUPB 2DDQL 2LU7A 2B5IB 1RFDL 1PLCA 1YN6B 2UV3A 2WXNA 4PRIB 2AQNA 4I7ZC 1NDGB 2FUTA 4DESA 2ENQA 1QTSA 5FM5M 2MNUA 2ZXCA 4YPGA 5KYNA 3QQ4B 2QSTA 5E8OA 4WAFA 4RSYA 4FX5A 4AYDC 5ID1A 1E4JA 4P04A 5F7AA 2V5RA 2C9AA 3CDYA 5AVTB 1E67A 5IMOB 3MRDA 2R8SH 1SY6H 2E9WA 4FLHA 1A4JB 1DVFB 2FHBA 2ITDA 4EOWL 4ELDA 4Y19E 2JF1A 2W80C 5TQ0L 4NI6A 2AJSH 1DN2A 1IC7H 3OZLA 5L2JA 3QUXB 3DETD 5GS0C 4A7SA 1H3UA 1FO0A 3MUY1 3C08L 4YSPA 1A47A 4NERA 4LHUB 3CSGA 1Q9KA 3K8LA 3I3DA 2DWDB 4PTTB 5C0FB 4IKIA 5E7BA 3SE4A 2Y9RT 3Q3GB 5DJCB 1BVKA 5EUOA 5EUKB 5BZXA 4HBQA 5KVGL 4G8EB 4N2GA 4PRNB 1WHPA 4G1MB 2YKLL 1MHPL 1O9ZA 2BOLA 3OSVA 4ATTA 2V2XB 5ICXB 2EDLA 2N3JA 5JHMA 2UXGA 2QQLH 3WO3B 3HZMA 3V4VH 4L9LA 1GGUA 1SJHB 3I9GH 4OLUL 3VXRD 4DP6X 2CDFA 2O4EA 4ONHA 1X6NA 4G6JL 3DXAD 4Q6KA 4Y4FD 2IDTA 3QIWA 3NRPA 1QBBA 4JUSA 3QEQB 1GL4B 4N2KA 3ZU8A 4QRQB 3AB0B 3U6XS 4ODHL 2IQAB 4OT1L 1WT5C 2CIIA 3VI3E 4W81A 1WBYB 4GP4B 3WL9B 3HNSL 2HJFA 2H1PH 3TVMA 3CZUB 2F53B 2AKRB 2DZEA 2AMGA 1XVSA 2P42B 3BVNA 3K2MC 3BUIA 5D55A 3UBXA 4KK6D 2B0SH 1A6WL 5EEZA 3SGEI 5B3SB 5DSCA 2R9HD 3MLTB 2CHZA 3FHAA 2IANE 4DKDC 2VDPB 3S3PA 2I24N 2M8XA 4K5PA 4X80H 2E7LA 4C54A 3VFMB 4FA8A 5KBMA 3PF2A 1JNLL 4AE1A 1U8PA 1BX2A 3HI5L 2OMWB 1A02N 2UVFA 1CFVL 2WKOA 5TF1H 1LEGA 4FABH 3FQXA 4LOEA 4HG4J 6FABH 3FT2A 5CCHE 3VAEA 1A3QA 3PPEA 2E6JA 2R0WL 3IDIA 3WXWH 3QCUL 4I48A 5D7IB 5AVSB 1T1WA 4OUUB 2H5UA 4QHPA 4WI8A 4N0YH 5IG7A 2Z34A 1BZ8A 2D03L 3FMGL 1QEWA 5CJ8A 1LE5B 2VDLH 1XZWA 2DBLL 2OULB 1YMMD 3AG2B 3AROA 3MTXA 3FJTA 4P5SA 1Z9OA 1A6VL 3HFFA 4QJ4B 3PHAA 4KNSA 1D6VL 3HB3B 1AZUA 1JZ7A 2GEEA 3CUPB 4E9LA 5ID0A 3BUQA 4FTVA 3K80A 1HL8A 1T2JA 5F1NA 4N0UA 2G5BA 1S7UA 2D0GA 2V3EA 1IBGH 3DVGA 3OXRA 3ZMRA 4AQ1A 1VCBC 4K3EL 1BYPA 4MZ3A 4QRAA 3HE7A 1HDMB 1AQHA 4NNYA 3F64A 4DTGH 4ELKB 5F3BA 1RZJL 4JM2D 2NNAB 2DICA 5BS0D 1PD1A 1ZEAH 4IS6A 2OP4L 1DVXA 4N6RB 5ITFA 3WIHL 1U21A 3O2DL 5I1AB 4KJQC 2TSAA 4UV7L 4GAJH 5B1JA 3SDDA 2PYFB 2X1XR 4K5LA 2W65A 1VA9A 5AEAA 3WD5L 4NQEB 3ECUA 5CEZE 3VDBA 5JO5B 3H42H 1D3CA 4IRZH 3UTSB 4PP2B 4EN3A 4F3FA 1J8KA 3Q5YA 3RL1A 4UM8A 2BVUA 4BQ9A 1NC4A 1VGKA 3IJHB 5CBAA 1DDHA 1MFBL 2NSQA 1JV2B 1MNUH 2VISB 2WLJA 3TT3L 3FO1A 3NOIA 4BFJA 2GBVA 4NKDB 3RZCD 4CVXA 4PJAB 2QKIC 2Z92B 2VRQA 3GJFK 4P49A 3HHSB 5IUSA 1P9MC 3N9GL 3O0RL 4FXGB 3VI3F 4MNQE 5JIIA 3KGSA 3AABA 1A6TA 2ZWZA 4ZMNA 5E00B 3CSYA 1M9SA 2D7QA 2D9CA 4YE0A 3IWUA 4JM0A 4OLWL 3EO0B 1SN0A 2A0LD 2NLJB 1PKOA 3H55A 1ZWIA 2SEBA 4OF0A 2EO7A 3HR5A 2FO1A 5AAPA 1J7VR 2WINA 1BMWA 3KCPA 3NBNA 3II2A 1KBPA 1IQDB 3DECA 1RK1A 2J72A 3HS8A 5DMJB 1ORQB 1JERA 2HT2C 4BFEA 5E4EC 3TURA 1JGUL 1CD9B 2OZNA 5ISZA 3KWTA 1JZ4A 5L7XH 5HHQB 3GZQA 4JKPL 3IU4L 5EORL 3WGVB 5KTEH 3P4OB 3FU9A 3TN0B 4TSAL 3EJTA 2AXWA 4CBPA 4PI0A 2ZNWA 3CVHH 1PZCA 4FQCL 4R83A 3QXUA 3MJ8B 4KWUA 5AYUH 1F6AB 4NSKB 1MCWM 3FN9A 2OJEA 1XGUA 2ZF9A 3IE9A 2VXVL 1MQ8A 4L5FE 3NGBC 2NY5C 2X05A 1BFVL 3CFJA 1JZGA 2H4EA 2YWZA 1PG7X 3OAUL 2IXQB 3ROOB 5ILTH 3QXTA 4PMEA 2YMXH 4LSVL 2C1PA 4YMPA 5KVDE 4OZGB 4YDIH 4YR6B 4P23C 4JFFE 2R39A 4X5LA 4ES9A 3B2XA 3T8XB 3KLLA 1ACXA 2B14A 3NFNA 5A7EA 5G2NA 4X7TB 1KYAA 6PAZA 2WP3T 5C9JA 3WJJC 3VXPA 3FH5A 2IMMA 2AQPA 4JHBA 4OF7A 1UKQA 1TOXA 4AQEA 4WTZA 2O93L 2BIHA 1CL7L 3WUZA 3QWRA 4LCUB 4X6CA 2G75B 4U3XA 2ZUYA 4OCXH 1J1XL 3CFMA 2XKNB 1SMAA 2A83A 3PQYB 3W56A 4XP4H 1LP9B 4NC0B 3TH2T 4H44C 4JDVB 4QOKD 3D25A 1Q4NX 3DOHA 4NP9A 2VAAB 1DANT 3HLAB 4QGTA 4JZJB 5I5JA 1F3DH 4JFHD 2IADB 4P2RE 1NFKA 3VFVA 3H0TA 5HYFA 1MCSA 1RUKH 4IOFD 3WEAA 4U1IA 3L3HA 2HRPH 2Y7LA 2QGEA 3KJ6H 2EABA 2IBZX 3QI9B 1FSKC 3S9DB 3DI3B 1SOQA 1UUNA 1C5DA 3TCLA 5I1IH 3GSRB 3HPJA 4YOKA 3TYGH 1S7TA 4AVIA 3IDXL 1FUNA 5E99H 5E9NA 4POYA 4R0LB 4HMEA 3A47A 2J56A 3NQIA 2VN4A 1Z9PA 2QGCA 5FKPB 2FX7H 1AXTL 4A7QA 1BREA 2X4UA 4LF3A 3P4MA 4JMNA 5CEXB 4LQFH 3QR1A 4OGZA 4DKFL 1ZY9A 3FQUB 1KB9K 4I13B 2JNZA 4QRBA 3MRHB 3KLAA 1TQTA 2R0LH 3G9AB 3WEXB 3ECWA 2EDKA 3WMPA 2R51A 1CVRA 2BSDA 2PP9A 3G5ZB 1UQSA 3PHSA 2ESVD 2DH3A 3QT2A 4KU1A 3C60A 2XY1A 2BSRB 4NKQB 1W72A 4QO1B 1SFHA 1W80A 4KKBD 5KEZA 4X6DA 3HG1D 1DL7H 1AJ7H 3NSXA 2PW1A 1BG1A 4I85A 4RGNC 1I3GH 1AIFA 3WMSA 5HGDA 1HWGB 3Q1SL 4M48H 4QHMB 1J12A 4MS8D 1VEOA 4BFRA 3H54A 5GS2D 4TSBH 5A40E 5DT1H 3S36H 3TWCL 5AB1A 3EGSB 1XBRA 4WZ9A 3D08A 3RGBA 1CIUA 2C3GA 1FL6B 3VFPB 1UJ3C 4JO3L 5FHBH 1DVSA 4W9CC 3U0WH 4B9JA 2PPCA 2ZUXA 4QTHB 5M94B 4HCFA 2GT9A 1IGML 3RX9A 2BNQE 2YGPA 3BPCB 3CQPA 2AJXH 3MZGB 3DMMA 5H37H 4MCYB 3VB9A 5FAAA 4IRJA 4HU8A 2PMZA 5HY9B 3V4UL 3EIFA 4AV5A 1A5FL 2PWFA 1KJ3H 3L45A 3MVSA 5DYOB 4JQIA 2AXGA 3UJIL 3SPCA 4F5CE 3CHPA 1PCXA 1UGKA 1YNTB 3KPLB 3PHOA 2CRZA 5KZCD 1F4YL 4W9HC 1OALA 3QJXA 3UTTA 1DQQB 4N2OA 1BXXA 1RIUH 5HDRA 5DUMH 1LWRA 1JZEA 3BCFA 4E41E 3LZPA 5MI0B 1T5WB 5FFLA 1BPLB 4RMQA 5HJGA 3VJ6B 2GYSA 4EI5A 4KMTH 3HMXH 5J9PA 5CZRA 2GVYA 5K9KB 5BXFA 3WY1A 4N86A 2J8UE 4BIKA 1S9WA 3KYAA 3T2PA 4TLSA 4Z7NE 3VWKC 2CO4A 2EO9A 5AKTA 1VF5C 3FUMA 1UVQA 3LEXA 2BW5A 3T4YA 4F58H 5HYSA 2P80A 1DEDA 2ATKA 1C5BH 4AL8C 4HS6B 4M03A 2OXGA 4Y4KD 4UM9A 5G4NA 3GFUA 1KPUA 5BZZA 3VQMA 1IZKA 4QR7A 4GG6E 1V7MH 5EZLB 4KRLB 1RFDH 3RYMA 4GKSB 1FFNA 1LO0L 2J8OA 1AD9A 1OKEA 1ZHKB 4YFLF 1CXKA 5J1AB 2ODHA 4BKSC 3FU5A 3SIKA 4G9DA 4WU7B 4KVNL 4MJJA 1H5BC 5CD3B 2RIKA 3PDGA 2FIKA 1CYXA 3A3YB 4KMLB 1IRAY 3KYKL 1X5MA 4XMLL 4EOWH 2F54D 2NT0A 3OKDA 4NZFA 4YHKL 4AQ8C 2NW3B 2MNJB 1KLGA 3MBED 6TAAA 3VVWA 4D94A 3NEXA 3TBYA 2JB5H 5EZPA 2NQDA 4Y1AA 2OSWA 4HK0B 4A7UA 2HRGA 3SKUD 1JGLL 5L4MA 4JFZL 3VXRB 1P5UB 2D8KA 5CN1A 1BOYA 1R34A 3RWIA 4X4YA 2J57A 3AS2A 4JPKL 4Y4FB 5ICUA 2O72A 4KGJA 4HQQL 4XRCA 4NQDE 5T3XD 5IIEB 2QADC 2YKLH 1MHPH 3MV11 2ZCLL 1ZA6B 5JYLA 5FA4B 3UGXA 3L95A 4PLNC 2JCCA 3BSZA 4D8OA 1KT2B 1WUNT 5KSAA 4M5ZL 5AWNL 4N90E 3GSQB 4IKNA 4OLUH 4V11A 2H8PB 3FKUS 1NFDE 1N3NB 3L48A 1SXAA 4P2QD 3KPPA 5FYKD 2Z4QA 3ABGA 1SLXA 3WJLC 4ZOAA 5J6HB 4FKHA 1I8LA 4ODHH 3W39B 4G8GD 1MCOL 4OT1H 5E5LA 2AXFA 4F92B 1NWPA 3ULVL 4IBUA 1EAJA 2KYIA 1EV2E 1VADB 1UT9A 4OU3A 1DFXA 3L1GA 3SQBA 1CZ8L 3HNSH 4JG0L 1FC1A 2MQ0A 3LPGA 4FNRA 3L3OB 4HWBA 3D0VA 4M3HA 3BGMB 1I9RH 4Y5YC 1G7IB 2J73A 4TNEA 1VJSA 4IHOA 1R9FA 2ORBL 4JJOA 1RU9L 1A6WH 4MLIA 5DK2B 3AWEA 4OI8A 3OKKB 3EYFB 4Q89A 5CMAB 5DVMA 4BSWA 2C9QA 1F13A 4AEFA 5DJXB 3GZOA 5B8CB 5BVJB 1SYSA 3STZB 1TEYA 4A2MA 5J0BA 4H5SB 1T7YA 1CGSL 1JYNA 1JNLH 1PY4A 1XCTB 3HI5H 4OLVL 3TF7C 3WN5C 5D70L 4FF9A 1GS8A 1CFVH 4C57C 3BUYA 2FSEB 2WXQA 2HJLB 2I26N 1UXWA 4R7NA 5ENWB 3VRJA 1YMMB 2J8UF 1WBXA 2AGJL 1YJDC 2DMHA 2WD0A 4Z7NF 2R0WH 2A6IA 2X6MA 3QCUH 4Q6IC 5E1QA 1KGUA 2JLLA 3DIVA 4JZNB 2YMOA 3UROR 4JG1L 3G3LA 4AYGA 1FVCB 1M42A 3UP1A 3FMGH 2DBLH 5KUMA 2R2BB 4AOFA 4GG6F 4K0OA 2Y4SA 1RH8A 1C7TA 1MHEA 4X98A 1LO4L 1A6VH 4FQLL 3IKKA 2AJZB 1FAIL 1JN6B 3AWGA 3BPLC 3ISYA 1DJWA 2OMVB 3KBHE 1D6VH 1OTTC 4JM2B 4G9FE 5KVFE 5BS0B 4KK8C 3ZGHA 3E8UL 1XFPA 5FV1L 1ML0A 2GJJA 2BFGA 4OBSA 1XO8A 3AXHA 4ZK8A 4AZ8A 4EN2A 2W07B 3CZFB 5JIDA 4A38A 4AVJA 1WG3A 1XGTA 2ICEC 1WTGT 2C9SA 2JV6A 4WU5A 5DQJA 3L3DB 4H7VA 2DOCA 4MX7A 2UX6A 3TX4A 2LLLA 3AW5A 4U1SB 2W5PA 5E8PA 3VFNB 4AKPA 5CCJA 1XGPA 1RZJH 3ZDWA 2YD2A 3EXJA 3EAKA 2BX5A 2OP4H 2I69A 3WIHH 3O2DH 2IALB 4UV7H 1TF4A 5FYJD 3KZ8A 1HNYA 1XX9C 3F7QA 3M1OA 4GNKB 5DJAA 3VYPA 4L8SC 5C70A 4NAJA 4ZUUB 1RJLA 1QBLL 4NQCD 3RZCB 2PR4L 3MV8E 3IU3A 2P7TA 4KH9A 5BJTA 2EYRA 1G6RB 3U7AA 3KPNB 4RFNB 4UT6A 3V6FB 1UCTA 1U42A 3H3BC 4CMHB 3UAJC 2PCFA 1NFDF 1GYUA 1T6BX 3SYQA 5AZ2L 4U1LA 5CGBA 3VSVA 1W2KT 3TT3H 3W9DA 2HJKA 4NT6A 1DZ0A 5SWSE 1Q0XL 4CILA 4LFHD 2ADIA 4M29A 5I8CB 3N9GH 4L18A 1AGBA 1F42A 1PG7W 4Y5XC 3TH3T 4U1JA 1NCWL 1H19A 1WEJL 3LB6C 3S98A 2H3XC 3DX2A 5DRWA 5JHAA 4G6KL 5AW1B 5EPMB 2F1BA 4UT7H 2P5EA 4H88L 3DHJA 3SY0A 3FB5B 1CDGA 4XO8A 1BFSA 4YSSA 3B9EA 4AYEC 5FGSA 1AAJA 4PS4L 3VXMA 1GOHA 3EJCA 3VNYA 2ZX6A 3HZKB 1E0OB 4HGWB 3ZT5A 1JGUH 1LO3L 2YUXA 3B9KA 4JKPH 2FWOB 2APBA 3IU4H 1UFUA 3OD3A 4JPQA 4PV8B 5EORH 4A2HA 3ERXA 5ABDE 1YY9D 4TSAH 2BDNL 4FQCH 1S7QB 2JQZA 5JIHA 5I9QB 3SGJA 5IT2L 4R4ND 1XH2A 2QV4A 4KZCA 5E4IA 4KXCA 2HA1A 5EU3B 4Y7MA 1YYML 1YY8B 2JKJA 2VXVH 1BVNP 2HKHH 1BFVH 1HN1A 3APDA 1JNNH 1EEZA 3F62A 3OAUH 1JUFB 4KHXL 5TE6L 2L7EA 4LSVH 2VDQB 2YOCA 4L29A 4PWFA 2XV0A 5BV7H 1F4WH 2HT2D 4UOJA 2BZ7A 2BNRD 4YEEA 5HHNB 4QOKB 4IIQB 3ZPDA 5IM7A 5D7KD 3OG4B 3E38A 3EG9A 1NAMB 1Q9LA 1U4EA 4BE6A 3F7VA 2GAZA 1CL7H 2E7MA 4P5TB 2W1NA 1B4JL 2YGQA 1J1XH 2D3JA 4L3FA 1FN4B 2ZTBA 4AT6A 1DVUA 2F5BH 4YX2L 2L7QA 1JF1A 5F7KC 1A1NA 3CXHJ 1TJIL 4N1EA 1BXAA 4LEOA 4UT9A 4IDLA 2ENSA 3RIAF 5JDJA 1IBZA 3H9HA 4B9CA 3KNBA 3QULA 1EFXD 2IVFC 1RZKC 3MQIA 3S5LA 1BGXL 5D6CA 3V6OA 4P23D 5A7BA 4LSUL 4FNLL 1HOCA 1I1YA 2VMFA 3CU1A 1ITCA 1MFAL 1CD1A 1UADC 1U93B 3T3PB 2GBUA 4PJ8A 5E5UB 4UF7C 4HV8B 3GMPA 1IVTA 5JHLL 3UDWC 2AVGA 4FERA 5KOMC 2VMJA 2Z31B 3RLSA 3APNA 1N10A 4IBTA 4E9XA 1PX3A 2OS7A 3CSBA 3DRTB 4FYSA 4XX5A 2JKLA 1QUPA 3LQZB 1H3PH 3U1QA 4XVSL 3TT1L 1SEQL 5AW8B 5ACZB 3SE3C 5IW3A 2ESVB 3QDJD 2EVFA 1PLGH 1AXTH 1E7UA 3PDOB 4AENA 5GGUA 3TBWB 4G5AA 1BLIA 2XFGB 4E36A 1J0YA 4HH9A 1V55B 4K7FB 4ZSOE 4ANKA 4DKFH 2JI1A 4IRSC 4RQQB 2ADGA 4LB8A 2BSCA 2FO4B 3EGXA 3MRFB 4FQJL 1DJXA 1J48A 4P9HC 3F6JA 2Z4TA 5CJXC 3ESOA 1KG0B 3NFSL 4ZFFA 1WFIA 1OGSA 4QHNA 5DMKA 2A2QT 4J8QA 1MLCA 1IKNA 1UXLA 3SKOA 4FEMA 1RCYA 4NRZB 3D0AA 1WZMA 2BHFA 2CWRA 2A6KA 3EOBB 1Q90A 2CO6B 3Q1SH 2Y2YA 3TWYA 1PBYA 3K74B 4N1CA 3MRIA 4UILH 2G4EA 4M56A 5DJ0A 4YBLC 3OTTA 2K6WA 5EO0A 5IVZA 2BVOA 5CR8A 2XWJB 2WK2A 5DVNA 3TZVC 5KBDA 3PG2A 2DQFA 2WZAA 2PR9A 5AD0A 4JO3H 1HILB 3MX0B 2OMZB 4G7VH 3EHBD 1IGMH 3VG9C 4GMTH 1KGJA 3QUZC 5KZCB 4QEGA 5F8QC 3RWGB 3BFWA 4Y0GA 3KG5A 2HRHA 1MI5A 3ME0A 2ZJSL 3QDGD 4WDIA 1BD2E 2GJZB 2H3NB 3Q6GL 3V0WL 4DP8X 3V4UH 5LGHL 2X40A 2XTSA 3NPSB 1A5FH 3M88A 1TFPA 4UAOC 1WS8A 3LX9A 4LKCB 3IDGA 3UJIH 4DKEL 4J23A 1JXGA 1OWRM 1S3KL 3FRUB 2CJTA 4Q14A 1G5GA 2WO4A 2ED6A 5IGXL 4BUGA 3OHMB 4KFMA 1ET5A 1WAEA 1WAPA 3SZ6A 5DGRA 4YSQA 3F84A 3T77A 3T0EE 1B90A 5I6XC 1XH3A 1N18A 3CFEB 5J06A 4JFDD 4QRRA 4WUUA 1CUOA 4S0SD 2WWKT 4WGWB 3VW3L 5GSVA 2GFBB 2UZIL 2H32H 1BEXA 2J1YA 5BPPA 2C4FT 3NTCL 4X4XA 5HJ3B 4EUPA 4YS4A 3PGDA 5C7ZA 5INCA 1TKWB 1MCRA 1QHPA 5GPRA 1G9MC 2IIJA 1K72A 1I3RB 4PR5B 4WI5A 4PY8I 3EFFB 3HHMA 4H8QA 3QZWG 12E8H 4UI2A 2K6ZA 3VGAB 4NQQA 4PJ5D 3UBFA 1DVFA 5FGCE 2F54B 4BQ8A 1UM5H 4JEGB 5F7LB 2E7CA 5JOPD 1K4CB 1FH2A 3MBEB 1F3DJ 3ECQA 4N5UA 5C0AA 2Q2LA 4PCKA 3OWRA 2DWDA 2EC9U 5H4ZA 2GQHA 4RVBA 3WU1A 3KYKH 4XMLH 5F7DA 1OCRB 3AAZB 3R19A 4YHKH 1MIML 5F1IB 2WNXA 2H6OA 4A1RA 1I4FB 4KXBA 1KXTB 4XO5A 1KWGA 4KZEL 3TM6A 1UG9A 2APVA 5FK9B 1JGLH 3A6CL 2AEIT 4JFZH 4NGHH 4LCYB 3T3MB 4XO4A 4UU9A 1WA1X 4JPKH 3EH5B 4P2QB 4N6QA 4AX3A 3K91A 2NXYD 5SX5H 4PYGA 4HQQH 1T7ZA 1NIAA 5IEHB 3LPOA 1DZBA 3OJ2C 2OAAA 2ZCLH 5DRZA 1E3FA 4G8GB 5IROA 5AWNH 3JWDL 4X5PA 4FNPA 1AE6L 3U9UB 1BLNB 1E40A 1U33A 2HVJB 4MAYC 1QFOA 4RCAA 1MPAL 4KV5E 2AKRA 4NZUL 1OB1B 3VM7A 1IIIA 4EIZC 3RNKA 3MRKA 4YBHA 2BSSB 1MCOH 4BELD 3ULVH 4JFOA 4ABVA 1CE6B 4MS6A 5D1QE 3WFBL 3MLSL 2DQGL 1CZ8H 4JG0H 3NESA 1XR8A 4HLJA 2QADD 2QVKA 2VXTL 3KCWA 1TZIB 4U1KB 5FWQA 4K7PX 2ORBH 4RDBA 4DPBX 1RU9H 5FGBC 4ZMVA 4XC1L 2OMWA 5E2WL 1OF2B 5BRZA 3TCTA 3PE9A 2A3TA 3F3HA 5T1DL 5EU4B 1F18A 4BINA 3AG1B 2CHDA 2EIBA 3QR2A 4RBPH 3ARFC 5JPNC 3BDBA 3B7UX 3PWJB 1YQVH 4G6MH 5D7IA 1CGSH 4GKNB 4OUUA 2XBTA 2DTSA 4OLVH 4TMPA 4HHAA 3US9A 3DTXB 5D70H 2ZXBA 3GTVA 3GWJA 4BJLA 4RAHA 1U8CA 3S6CA 4U33A 5B21A 3ESMA 1KB5L 3RVUC 4CA4A 3DV4B 3HC0A 2AGJH 4NKOB 3BJ91 4NZRL 4GT7A 1JXDA 5AQ0A 3BVTA 3C8KB 1BJ1H 3QRGL 4QXTB 4ORGA 3DX9B 1WISA 1MCPH 3GT6A 3HS0C 4JG1H 2R2EB 4DZ8A 5HHXL 3RY4A 3CUPA 3OVUB 3NCEB 2FJFB 2UY7A 2ZX8A 3HC4L 2MQ3A 4PJ7F 4ZUWA 1GAFH 3VSUA 3V9CA 2V3FA 1A9EB 4YHNA 2Q7NA 2VXQL 5A6MA 1LO4H 4FQLH 1FAIH 2DB8A 3KS0H 1E8XA 3RBSA 4OR1A 3GS7A 3VD1A 4I4WB 5GGSB 2E0PA 2IFFL 4ELKA 4AYID 2NNAA 5DRNB 1KCKA 5AB9A 3KWWA 3ZE1E 3HN5A 3NCYS 4N6RA 2F8VA 3UO8B 4ZTPL 1T21A 3NP3A 5F96L 5I1AA 1KXQA 2X9WA 1VPOL 4I1PA 4RIRB 3CVIL 1EH9A 5IV2B 4KROD 4WFFE 1NGWB 1GZPA 4NQEA 1DBJH 3U1SH 3K6SB 3WN6A 5JIPA 2EE0A 1WAAA 4AQAB 2IWEA 3NVQA 1AKJB 5E6SB 4LEBA 1S9XA 3UTSA 1X9UA 2BCKA 2VMEA 5DD0H 3FHEA 4WO4C 4LASH 3LXAA 5I1DB 2G3XA 1AZCA 1RP9A 2EIMB 3IJHA 4QXVA 4Z95L 4EIGB 5IREA 3BP6A 3N40P 1FO0L 1JV2A 5FM8A 2VISA 1OTTD 3FSAA 4Q9RL 2UXFA 4FFWC 1QBLH 5G4OA 2E4TA 2ZYHA 3L08A 3NCJL 3NIFB 1W8NA 1TLMA 3S3DB 4PJAA 2YO3A 2Z92A 1TYJA 3OZKA 4LPVA 1N5AA 2E9GA 2HAZA 4UB0L 4YDJA 5JOFA 1ZV5A 4U49A 3B2VL 4A7TA 1FI8C 3BHBB 3GI9L 5E00A 5AZ2H 1G0XA 5FO7B 4QGYA 4Y9CA 1N70A 4KV5F 2DY2A 4MLSA 1U8JA 4JN1H 3TPUA 2WY3B 1Y1DA 1L7TL 3S96A 2AK4E 4TTGA 2HP4A 2AV7A 2ZZUT 3M1CA 3S4SG 2P24B 5HDQL 4OZIE 4LL9A 1I7TA 4LDEB 3MRBB 3WE6B 1VHPA 1IQDA 1NCWH 1WEJH 3W9EB 1NCTA 3M6DA 3JV0A 4L1BA 4G6KH 4WI4A 5KVGE 4FRWA 2OMUB 5EBGA 3VRLF 1UWYA 2QKIB 4B9PA 1EJOH 2DKMA 4YAQB 4JDZB 3T6XA 3QNZA 3P4OA 1HHGB 1EMTL 5EOQL 1FYTD 1UWXK 1AG6A 3WAJA 2G3NA 4PS4H 3VFSB 3UAJD 5C09E 1CWVA 2VLKD 2WXGA 4E68A 3HAEB 1AIZA 2LAGB 3N41F 5DQDL 2WOBA 1RUPL 3AVEA 1P6WA 5IB4B 3SKJH 1F3JA 3X12B 4MHHG 2DS4A 5EV7A 2IXQA 3VWJC 2ZXQA 3FPXA 2BDNH 5IMKA 1UZ8B 2WQUA 1FBIL 1MCLA 5AAWA 5IK3A 5IT2H 3GBNL 3AT0A 2XZAL 2BNRB 2EAEA 4P4RB 2BHZA 4LSPH 4X7TA 3MJWA 4PJDB 4ALAH 2DI9A 3P0YL 1OHZA 4PV9B 2ZOLB 3ARTA 5K9JL 3X13A 2H45A 5DURD 4Y19D 2D3LA 1U8LB 2HRLA 3N1QC 3D85D 3QFJE 2G75A 4MXVE 3GJFA 1ORSA 1MRCL 1L9NA 2DJUA 3MV9E 2XKNA 3PQYA 4Y5VA 3ZDZF 4H8VA 3NGBB 2P8LA 2XBDA 3KL5A 1LP9A 4K3JH 1M56B 1E2ZA 1EFXB 3KPMB 1QAWA 1OQXA 4WSKA 5HVHB 3I02B 3HLAA 1I7UB 4P23B 4JZJA 2APTA 5D7SL 1S7SA 4R97B 1B4JH 1HEZA 4JKKA 1ZT1B 2WLYA 3EYSL 4XB8A 3QJSB 5B39G 5CM1A 3KPSE 1ZLWK 1S9KC 3AFLA 3G5VA 1H8OA 1TJIH 2J8HA 4XMXA 5DD5L 3VFTA 1CTOA 3TJHC 2NTFA 4XPTL 2BY2A 1S2EA 2QKSA 4LVHC 3GRWA 3ARSA 1U8OB 1HWWA 3L54A 2J3SA 1D9KC 2X9XA 1VRSA 2JI2A 3GSRA 4FNLH 4JZOB 5CILL 1MFAH 5EWIL 1VFBA 3B7RL 2FECI 3QDJB 4EKJA 1KELL 2CA3A 1Z3RA 3FNKA 1GPOL 4O2FB 3FQUA 4GSDL 2EEAA 5IEKB 3FN0L 4MCZB 3MRHA 4WV1B 3F7LA 3WEXA 4XVSH 3TT1H 1SEQH 2IAND 1QHQA 2AZAA 2DAVA 5FF6A 1LO5B 3G5ZA 1KJ2L 1N0LB 1YUKB 2EEBA 3TEXA 1XT5A 3UX9B 1X5JA 3MGTB 1D5RA 4HZAA 5KWYC 3I3BA 4QO1A 3RRQA 4HCIA 2KKQA 2ZX7A 5IMMA 4U6XB 4OZIF 3GKWH 4UDTB 3F7KA 5AVVB 5IB3A 2OCJA 4FQJH 3EO1B 4FTDA 3ARDC 2H0FA 4QHMA 1CDCA 2Y7OA 4CC4A 4JMXA 5BUPA 1I1AC 2JLPA 3FC8A 3NFSH 4JAMA 1A1MB 3PAUA 1QPXA 1H9VA 4XBGA 2QPUA 5G55A 2FT7A 2ZOOA 4MJ4A 3HC3L 5IHUL 1FL6A 2OI9B 4O9HL 3VFPA 3RGHA 3EHBB 3NN8A 3G7TA 3SDCA 4L48A 4QTHA 1D5MB 1RV6X 5T1LA 4JN2A 3FT4B 3UAAA 1F3RB 2YPVH 4TRPL 3QDGB 1PMYA 4GIPD 3VI4F 3QW9A 4MCYA 4C55A 3LY6A 5D93C 3CMOL 3QJRB 4X9IA 2EZ0D 1EANA 1RSYA 1TTGA 4G1EA 4YHIA 4L3AA 4K5OA 4RA3A 3D18B 1AHWA 3L16A 5IQNA 1B3IA 5H35A 5C0RL 5HSFA 1AQKL 2W92A 1E27A 2ZWNA 4ZAKD 3KPLA 4UIMB 1OLZA 1S9YB 5ADOL 1AP2A 2ZJSH 4JL1A 4C58B 4JB9L 3P2DA 5TTRA 3Q6GH 1UJ3B 1N6VA 3V0WH 4NFBA 5LGHH 1X7QB 2Z65C 2O30A 4MXVF 1F11B 2EH7H 4DKEH 5AOIA 4KFZC 5DDHB 3VJ6A 5IGXH 1NFAA 1EA9C 5CEZD 4AXWB 2KBGA 4ZS7L 5D1ZC 1I8IA 4WKZA 1GW0A 1VACB 2BP8A 2NZIA 1EDHA 2M1KA 1OHQA 2X9ZA 5CP3H 2PNDA 1PIFA 3ZZSA 3FQ1A 3FO0L 3QUZD 3TBVB 1X5XA 3F2LA 4FFYA 4HS6A 4OZFH 2MRYA 1N2RB 4FJYA 3O3UN 3VW3H 4U6YB 3A4FA 2UZIH 4P5KA 1UASA 1E8ZA 5DMGC 2YAMA 3QUMB 3NQKA 4PJ5B 3Q44A 3WJMB 3NTCH 4AH2B 3BP7B 5EZLA 4OD1H 3RFRA 1RZFL 4BSVB 3VD0A 3DYPA 4GKSA 2GBTA 1LDPH 3PNWB 4N2DA 1ZHKA 2WUBH 4OIAA 5LB1A 2AFNA 3ESVF 4MNQD 3GSWB 1FGVH 1INQB 2UYLB 1YN7B 4BH7B 4LSTL 5CD3A 3VWKB 3WTUA 1CDJA 2PYEE 2WSDA 3ZGIA 1I9JL 1J1OL 5H94A 2DI7A 1MDTA 3RUGB 2CKBA 2MPAL 3V5HA 3QNXB 2R23A 5GSRB 3MRCB 4WCYH 3FT3B 3IK2A 4UOZA 3NRFA 4NCC2 2VUKA 5KG9B 1G6VK 3QJFA 3JTTB 2XY2A 3VMNA 3VXRA 1P5UA 1ZXQA 2J44A 3HJEA 2QLYA 2NXYB 3DXAA 4Y4FA 1TPXC 2XUWA 5D8JL 1ET8A 2R0ZL 4HUWB 4K9EH 1H5BB 1U91B 1ZA6A 3X3FL 2P5WE 4KZEH 3WTSA 3VD3A 4S1SL 35C8L 4H1LB 3NCFB 4F8OA 1L0YA 3A6CH 5J6GA 1R17A 2Y0SA 1LJMA 3U0TB 2AI0H 4NJAH 1UTDA 2CJSA 3GSQA 1X9RA 5EBLB 1VFAB 3CLFL 5D7HA 5I2IA 4XNZB 4NIYE 1QRNE 1KIUA 4Y4HC 1VLXA 4HIXL 4Y9BA 4JFFD 2YAPA 3VXUE 4EPSA 1F02I 5ITBL 4YZWA 5ERWB 5MERA 3IM1A 1ZV9A 2AXHA 3JWDH 3NABH 1DBAL 3ARGC 1AE6H 4ES8A 2QADB 1JPFB 3GM0A 5D2NC 3H7BB 4AW4A 1MPAH 4H26A 3L3OA 4YSAA 3NJXA 3BGMA 3DX4A 2NDGA 2A9ML 4IQHA 4M6OL 4BA0A 1FF5A 2X5PA 5GXBB 5TDNB 3V5DB 3WNJA 3OKKA 4QIRA 3V4PB 3EYFA 4X5XB 4TSCL 5CMAA 2DQGH 3WFBH 3RHWF 5DJXA 2CLVB 2YXWA 1NUDA 2VH5L 3STZA 4MAZA 2OXHB 1WA2X 4P2RD 4P05A 1EUUA 3GS0A 2RD0A 4XC1H 4JDTH 1SJXA 2VW6A 5D9SA 2NR6C 2BS8A 3WAKA 4E0RB 1AD0B 2HJLA 2A6JA 5T1DH 3RY5A 5ENWA 4E5XG 3ARVA 3G6AA 4Y5YB 1FHNA 3WDIA 4HXAL 1GOGA 3CN2A 1ROCA 5DHVH 2ZUWA 3L3IA 2VJ8A 5FEBA 3S7GA 3WKPA 2VERN 4Z7UE 4I87A 3OL2A 4IBYA 1FVCA 1U8NB 3D48R 5DEFA 4FLSA 4ETQB 1KB5H 5DS8B 2R2BA 2VL5A 4DFIA 3VDCA 3OB0K 1TTCA 4PBVC 4XMVA 15C8L 1R3JB 2QMKA 3WN5B 2HKAA 4JM2A 5BOPA 1CLYL 2E7BA 5HHXH 5BS0A 2KQNA 3D50A 1WWBX 1B9KA 4XWOD 3K2IA 2BMKB 4EUPG 4PJBE 7PCYA 4GKZA 1NAKH 1ZE3H 3CZFA 4Q6IB 4M93C 3VXNB 5B1AB 1QKZL 1LEKA 2QHLA 1U8IA 2DQEL 2WXKA 1JJUA 2XWBB 2A38A 2NNFA 3VFNA 4F8NA 2IFFH 2CDGB 2OKMA 3D07A 4AZUA 1PY0A 3SGKC 4K5NA 1WLHA 5IB1B 3ETTA 3J2PA 4ZTPH 1JPGB 3BVVA 2XN2A 2EDWA 4XOAA 1KJVB 5F96H 3CVIH 4BZYA 3BPLB 5HGGS 2A1WL 3WNPA 3ULUH 1NEPA 1TYRA 3B6SB 2H9GB 3KR3L 1SLUA 3O3DB 1NA8A 4HXBL 4NRYB 4U31A 4XN7A 4ZUUA 3VTTA 4LHUG 3MLZL 2X4RA 5F0JB 2XN9E 1JV5B 2NRDA 3T0EC 1GYAA 2NNCA 2ZUSA 3QWQB 4FFZA 1G6RA 1KCRL 1AANA 2B9BA 2WB7A 3SE9L 2BNQD 2ZSWB 4FP8L 1KCUL 3V6FA 4Z95H 4JRYE 2P8MA 4GPVA 2KLTA 4Q9RH 1GKEA 2V5TA 3EDDA 4BFIB 2O5ZL 4JQXC 1HE8A 4XGZA 1NUFA 4BK5A 5I8CA 5JPMC 5AKRA 4LOFA 3B2VH 3PJNA 1RIHL 2V33A 4ZFOA 3GI9H 4L8SB 1TDQA 2YN5A 2VN7A 1H3VA 4WFEE 1HHJA 1CQYA 1NKRA 2WQXA 5EPMA 2CJ3A 3OAZH 2NY2D 3BSZL 1L7TH 1VENA 3WY2A 3O6KL 2IQ9L 4E9SA 4X4ME 1FYTB 2QL1A 4IU3B 5EC1B 2X4NB 3FB5A 5HDQH 3UYRL 4E41D 3IDJB 2F8XC 5MEOB 5BW7C 3TS8A 1GSKA 1M9WA 2VLKB 2BVPB 3VCLB 5HHOA 1FDLL 2DI8A 4BWWA 1SLVA 4URKA 2X1QA 1TTFA 5BO0D 5LWYL 1AXSB 5E2TL 3GSUB 3VFWA 4AC4A 1OANA 4NAQA 5C1MB 5IQ7H 5D4QA 2VDOB 5L4FA 1EMTH 1SRDA 3OPUA 4Y5XB 1MW1A 5EOQH 3V4LA 4HYTB 3WS3A 4HWBL 1ZGLP 1IL1B 5DQDH 3ASOB 3QQNA 2C3VA 5EU3A 3S8GB 4FLRA 1CYWA 3BLPX 1RUPH 1HSAA 1YY8A 5CSBA 3WIFA 3WI9A 4Z7WE 3DBXA 4PJHE 2BP3A 5DURB 4OFYD 4Y19B 1TENA 2XBZA 3D85B 1JUFA 2P43B 4UQ3A 4Z7UF 1XDTT 1EEUA 3ULVE 1FBIH 3ZVVA 2EDNA 3GBNH 3O4LD 2XZAH 2EIEA 5T3ZH 5D7JD 5B7FA 3V0DA 3E80A 4X83A 4W9EC 5HHNA 2X28A 2XFXB 1H8NA 2QEJA 4B9YA 2VDRB 1NAMA 1BJ8A 3P54A 1J5CA 5A2KH 3O2WH 1EXUB 4RRPA 3BLBA 4P46C 3V0IA 2B1AL 1MRCH 4N26A 5IFHL 5EU6E 4CU7A 3CTTA 3GTTA 4JKNA 1D5BB 2B4CL 5GZNC 1IZJA 3R0MA 1L9QA 3A4EA 2V7HA 2PTTB 1RP8A 2WWOA 3CXDL 1RAMA 2Y2WA 1IU1A 2FQEA 1NBQA 4PRHE 4NQDD 4MQTB 1GMIA 2VNCA 3P30L 4JX0A 5D7SH 3EYSH 2CHWA 3BKCL 1BJ1J 1OW0A 3VI3B 4Y2DD 5DD5H 4Y1SA 4N90D 4RGMC 2ZPKL 2XXFA 4XPTH 1OARH 3P4LA 4HV8A 5I28A 3D7PA 2XWTB 5ADPL 3MJ9A 3IXAB 1NBYB 2WHVA 5B4MC 1DJZA 1OV8A 4HWNA 5CBEB 2FQDA 1S7XB 1NWOA 1WV7T 2CGZA 4HSCX 3KS0J 4J3BA 1FIGL 5CILH 5EWIH 4BD4A 3DRTA 2ZUTA 3P2TA 2IANB 3LQZA 4J3SA 3FYIB 5L8KB 3QXVA 3CG8A 1KELH 3JWNH 3S8FB 3PDOA 2GUYA 3C6LC 2N59A 1GPOH 1CB4A 1F90L 3HG1A 4GSDH 4RQQA 2Y5EA 3KDPB 3KHOA 3ZUNC 3A22A 3CN0A 3FQRB 3S88L 4M6ML 1V3LA 5DMIL 4QTFA 4ZNEA 4KRPD 2ZXGA 5MP6H 4IGBC 2MOGA 3ILPA 3LZFL 3QRFM 2HG0A 1KG0A 3OB8A 4XOCA 3TYFB 1D9KD 4UT6L 1E5CA 2FHFA 1J8HB 3WIIL 4QPEA 1OAYL 2NX5E 1XF5A 1P84K 4NO3B 4APXB 4HF5H 3EOBA 5MEPB 1MCDA 3H1ZA 3SODB 2NY3C 3RGVA 1WTLA 1HAWA 2DMCA 2ZF8A 4XZUA 1KXVC 4FD0A 4M3JA 4Z7AA 4OLEA 4UQCA 5D1XE 2V9QA 5I1JL 2DEWX 5FO8B 1J5OL 2CXKA 2NY4C 3C09C 2GB2A 4QRPA 1VFOA 2XWJA 2ZNXA 3HC3H 1UZGA 3JV4A 1KMGA 3I6KB 5IHUH 4O9HH 1CU4L 1URIA 1HILA 4WTXA 2W8CA 2EUWA 2QMJA 2OMNA 1F45A 4ZAKB 2CNYA 5DO8A 4PJHF 3RWGA 3SZKC 3WDJA 3NK3A 2V7NB 2V4LA 3MLWL 1MH5A 3ETSA 3CMOH 4PLJD 4G9FD 4D3CH 1IC4L 4U0QB 3TJPA 3NCCB 5ECGA 1P4UA 5C0RH 3OLEA 1LQBC 2Y7QB 4BM7A 1AQKH 3FRUA 3GXDA 3AQZA 1U6AH 3OZ9L 4YBLB 3RVVD 4EE2A 5ADOH 1K8IA 2Y7NA 4JB9H 3G04B 1AQDA 1HT6A 2YPLA 4HALA 1JTTA 2OX5A 2Q76B 5EOCL 4ZMZA 3AZUA 3MA9H 1QTPA 4QKTA 1IFGA 5FYLD 3B7TA 3FN3A 3E3QC 2LT9A 3QUZB 5TDOB 1VB9A 3TTSA 5G4MA 4ACPA 2ZOKA 3P3UA 4LP8A 1S78D 4Y4KA 4G80A 5CEYB 4KKAC 4TQPA 2GFBA 3U4AA 3VG0H 5DEJA 4P9ML 4HK3N 2WXHA 3BJLA 2G30A 3FCBA 3B3BA 4NQTA 2V2TB 2Y7SA 5BRQA 3B3IB 4B6ZA 4UAOB 1KCVL 3FTGB 3MV8D 4GI6A 1WBZA 1OP5H 1I7RB 4M43H 1F1DA 1G7HB 1TKWA 5D1ZI 1Y0LB 3FO0H 3K1DA 4MNQB 4YGAB 2VQTA 5B3JE 2OPCA 1LMIA 2GK0B 3TA3D 4PR5A 2OSXA 3EFFA 1P4IL 3EH3B 3AMLA 4GW4B 2PPDA 1NMBH 5DZPA 2IOOA 4XVUC 3NK4A 5SWSD 2F54A 1RZFH 4HFWB 5EOTB 2Q7YA 2FWLB 3QS3A 1CD0A 3L2NA 5AW9B 3MBEA 4Z77B 4UNVA 4PWEA 4LSTH 2UZXB 2EADA 4OF6A 2WNGA 3O41B 1E4XH 3FOMA 1QUNB 5D1ZD 1I9JH 1J1OH 3GO1H 3IVKB 5IHBA 1MJJB 1UOLA 5AAMC 3VTMA 4LCCC 2MPAH 3SO3B 4LDCA 3BQUA 3QDHA 5F1IA 1LEIB 3ARBC 3D69A 1I4FA 5DA4A 5JLZB 4W4OC 5FK9A 4LCYA 3WKQA 2D31B 1FFQA 1QX1A 4PRPD 2WWMC 5CINH 2F18A 1EHLL 4BUHA 1MVUB 2I7SA 4FKEA 4L3CB 1DQML 3UZEA 2R0ZH 3ETBJ 1GGCL 4UZUA 2ZP9A 5IEHA 1J0ZA 4JG9A 5IOPA 4JFFB 3U9WA 1ZPLA 4ZMYA 1NM9A 2OTWB 4W70A 3X3FH 5D4JA 3STLB 4BUQA 35C8H 4HEMA 4R5VA 1FPTL 1CLOH 2P48B 5DF0A 3Q9PA 4WHTB 1XMWA 4X8GA 1V05A 3OLIA 3CLFH 3U9UA 2QQNL 2ILLA 1SLWA 4HIXH 3O6FC 1R3LA 1LQSR 3O9WD 4I3SL 4KJWD 1W72H 4FG6C 5ITBH 4HAKA 2BSEA 3UL4A 3MREA 1OF0A 3EDEA 5C2BL 1CE6A 1DBAH 3BYTA 4OCLC 1QW9A 3MRLA 2NCEA 2FL5A 1OP4A 2IBGA 3D51A 1D2PA 3I74A 1FFRA 3FO9B 1MY5A 4P2RB 1PGRB 4ZQKB 4YLBA 2A9MH 3IXTB 1OY3B 4M6OH 3TO4C 1NSNL 2QPFA 2DWSA 2X2JA 4GP5B 1A0QL 1CG9B 4OLYH 2R2HB 2E9BA 4TSCH 1T2QL 3X11B 4L4TE 2ROYA 5EU4A 1YVLA 5TF0A 1F56A 1P1ZB 4NZTL 2XPZA 4MBOA 2VH5H 4HZ1A 3RKPA 1RZJC 4I88A 1IAIM 4FA7B 1NGXB 3GJEB 1E90A 5LNGA 4UMSA 1GTFA 3ES6B 3C9NA 3BVDB 4HS3B 4DW2H 1A4AA 3ZXAC 4JQIH 3LD8C 4GMSL 4NKOA 1YPZE 4GFXA 3FB6B 1MWAH 3RTLA 1MCHA 3GBML 3GUFA 2MTAA 5KW9L 3FSVA 5IY5B 4Z76A 5B3JF 4B7IA 1E9OA 2R2EA 1TZGL 2PCYA 1W6LA 4XC3L 2QDVA 3PWNB 1QLEL 2OMBA 2VDKB 2ZWYA 5JPNB 3Q8CA 5EBMB 1A9EA 3PAYA 1A2YA 3MGAA 2GJ6E 2I7OA 15C8H 4EIBA 3V7AE 5HP5A 2WM0A 1CLYH 4TUOB 5DRNA 3UIZA 4YIQB 3WLWD 1SJEB 3S5YA 2Q0ZX 4BDVB 1PAMA 4POUB 4RIRA 5HGBA 3MLXL 1TG8A 2VR3A 2X2YA 3IJ7A 3HZ3A 3M46A 4U1HB 2DQEH 3HS0B 4ZXBD 1NGWA 2DLFL 3I9PA 4OVUA 2LU4A 4NQCA 1N67A 2EKSB 4A6YA 3VD2A 4J3XA 1I8MB 4HLZH 2VC2B 4NB7A 1RK0B 3C5ZC 3RDJA 3Q48A 2BNQB 4TXVB 3T4AC 4LLVA 2BWDA 3IFNL 5A2LH 3VFRA 2JJUA 4KXZH 4H25B 1JXFA 2A1WH 1SHWA 5I1DA 3KR3H 3PYCA 3KYOB 5EFIB 1UKSA 2H2SC 1IFHL 5DC9B 1R5IB 2PPAA 3BWSA 4HEPG 3EYQC 4HXBH 5F9OL 1ZCRA 3MJ6A 4BRVA 3MLZH 1OL0A 1XGYL 2XTJC 4Z3JA 4YDKL 5BOJA 1U3ZA 2Z91B 1KCRH 2DL2A 2F7QA 4JQVC 4I0PA 3SE9H 4FP8H 5GGVY 1KCUH 1THAA 3U30C 5HI5D 1LWJA 1SN5A 3BHBA 1XL6A 5CD5D 5FDYA 1HHIA 4NDMB 2NY2B 4UANA 5GISL 4HJTA 3TV3L 1BD2D 4X42A 3TXAA 4BQCA 4E41B 2C9VA 2O5ZH 5BV7C 1FNGA 4YJZL 3MRBA 3WE6A 4XMUA 1RIHH 2CDEB 4WJG3 1KN4L 2ZG3A 4XXDA 2DM7A 5DO2D 3RVXC 3W9EA 2J8UB 1WCQA 4WHDA 5IQOA 3NCMA 1F4HA 2EXWD 4Z7NB 3BSZH 2BLFA 3O6KH 2IQ9H 1X5LA 5CSZB 3UYRH 1HHGA 3UFIA 2RTTA 4GSRA 4UAHA 3FK3A 1FDLH 2BC4B 1FNFA 1MCIA 2KC0A 4PVLA 3I6LD 1KGCE 3L6FB 3LH9A 3HOGA 1KIPB 2DLGA 3ZOAA 2Y07L 3ECBB 5C0CE 1QYGL 3BKMH 5E2TH 5LWYH 4NKIL 2AZUA 2FD6L 1RURL 3AREC 5LGJA 5EF1A 1AC0A 1DCLA 4LAQL 2VDPL 5LQBL 3SKNA 3PGCA 3NZ8B 4MXWL 4AGNA 1JWSA 3PXJA 1KPRA 5I5IA 4HWBH 3S8WA 5D7JB 1M2OA 4HUUB 5H2BB 4XN4A 4AIZA 4BFFA 5MHSE 4P4RA 1K8DA 4OGXH 4HPOL 1X5ZA 3HPLB 4PJDA 1MAML 2XHNA 3H8NA 4XX1G 3BN9D 2KMWA 3BD4A 2EDBA 1AS6A 5AW2B 1IC5L 2IF7A 4I2XE 43C9B 4YHZL 5DMYA 3HCVA 3ZE0E 3QO0A 3CFTA 4XMKL 3U9PH 1C12B 5F2FA 1YECL 4PGEB 3IGUA 4KJYB 3LKNA 3QJHA 3RVWC 1EFXA 1PKQE 2XKUA 3VWJB 1A64A 4KKRA 4NQDB 4HIHB 2HFEB 3V55A 2G3ZA 2WNKA 3CN3A 5EEYA 3ZL4L 1F1AA 2B1AH 4K94L 2KHAA 5IFHH 1AZNA 2N7AA 2B4CH 2DM4A 4OAWA 4ZQTA 2DQDH 5HYJA 1NFDB 5AUMB 1RZQA 1ACYH 5FUZH 1HZHL 1LD9B 3X1FA 3CXDH 3ZZLA 2CHNA 1SOSA 1R0AL 3P30H 3I84A 3PJSB 32C2A 1F6FB 2J20A 1TZHB 3BKCH 4YBQD 3PWVB 1KIRB 5KN5B 2DLHA 4JZOA 4MNGE 2H26B 1DJYA 3UTZB 2XRAL 4BFOA 2ALAA 4OCYL 4CJ1A 2W91A 2ZPKH 1RHHB 3WDHA 4PIBA 4CSPA 4NQSB 4X7CC 4P46D 4YC2C 2MCPL 2CUHA 4A2GA 3JQOB 1F4XL 1FIGH 5IEKA 5DVPA 3CVCA 4FAAB 4WV1A 4KRPB 1WH0A 3NZSA 4K3DH 3GLDA 3DJTA 3CFQA 4OZGF 5ALBL 1T03H 1BEYL 4LVHB 2QTEA 5D1QD 3FRPB 1N0LA 3PHQB 3ZMNA 2JB6A 1M1XB 2DJSA 1D9KB 1QFWL 2ZWLT 3MGTA 4LMQE 4F33B 3H4HA 3D5OF 4ZYKA 5GGVL 1PLAA 3VXQB 4U6XA 4UDTA 1TMCB 2XWEA 3S88H 2QHRH 4M6MH 2CAKA 5DMIH 2FDBP 3HG2A 1OB0A 3EO1A 2ZP0T 3U2SB 4MXQD 3LZFH 3DO3A 1D5ZA 2VB5A 4GI9A 4OJEH 3V8OA 5GIRB 4UT6H 5DZAA 1AMXA 1RUQL 1FNHA 3DROB 1JPSL 3T0BA 3GTNA 3HEIB 3WIIH 1OAYH 3QR0A 3AY2A 4JFQA 3DRQA 3HE6C 1JVKA 2IDFA 1FL3B 2JKWA 3OMZA 5GGTL 3WYRA 7CGTA 1MW0A 3UP6A 5AKSA 1D5MA 3AY4A 2EYSB 2XG5A 3QGVA 2O6CA 3MOQA 3S37X 5HPMB 4B9GA 3II1A 3T8VA 5I1JH 4K7PH 1J5OH 4FCAA 4G9FB 3UH8A 1EZVY 1C16A 2G5UA 3U0PB 4UCFA 4PJ9C 4LLWB 1E4WL 3WNKA 3FZUD 3D18A 3OMNB 4LARH 2JIXB 1E28B 3F05A 4Q2ZB 3CPLB 4ILDA 4UIMA 3QG6B 1S9YA 2YXFA 2XSKA 1JF5A 1XSKA 1UJ3A 2DMKA 2GJPA 1EAPA 1IC4H 1RUAL 3WTWA 4JFDA 2NY3D 5ALCL 3NIGE 3OZ9H 4X5RA 4NRXA 4XT1C 4A7GA 4WFFD 4I9WE 5KANI 2F2HA 3MV8B 4TQEL 2GTZA 3CN4A 4OD3L 4WK4B 1GW6A 1QLFB 1VACA 3EYOB 5FFOA 1A8JH 1II4E 1UWEL 4N2HA 3H6JA 4RMBA 5FPIA 3TA3B 3AM8C 4RAUB 3P3YA 4FJ6A 4PGZA 5AVYB 5IJKC 3QP3A 3ILQD 4OZHA 5I1EL 3AQYA 1O6SB 3O8XD 4P9MH 5IHWA 1B0WA 2YEZA 1TU2A 3FCUB 3QUMA 3HKZA 4PJ5A 4EDXB 3WJMA 4AH2A 5SWSB 5IW6B 2OW6A 3PV6A 2IG2L 2VSMB 3DGGB 1G7QB 2ITCB 4OF3A 3FTUA 3VD9A 3PNWA 4GQ9L 1H6EA 3QPXL 4ZTOL 2C4XA 3GSWA 1FFOB 5FX3A 1INQA 2UYLA 1HVXA 1NIFA 1YN7A 4LOUC 4BH7A 5I75C 5D1ZB 4JLRB 1NJ9A 2RQ8A 3MNVB 2RBLA 4UT9H 1BW8A 1MN4A 1O6TA 1QWHA 3V4VB 1E8YA 2KI6A 3ULVC 2BOBB 3GRWL 2F7OA 4M4RB 1UENA 1AC6A 5GSRA 3KDMB 3MRCA 3FT3A 3T0AA 4CAGA 2DWXA 3F6LA 4WEUD 5DI8B 5HGAB 5KG9A 2VR4A 1OTUD 4OH2A 2Z8RA 1YNTF 4NBZB 5C6TL 1KFGA 2Q1EA 5F93C 4PWKA 1TJHH 3GHBL 5L4JA 5GS1A 1CIDA 2OM5A 3VGFA 4HUWA 1JDDA 4G43A 4NNPL 3BZ5A 3WFHB 1DFBL 5IWLA 1U91A 5C09D 1DJSA 2E59A 4F9PA 4FTVE 4XX1E 4NIKB 4N0UE 2CRYA 1EHLH 1F6LL 4BSJA 1IILE 4CJ0A 1O0VA 4N8UA 1VCAA 2VM9A 5EBLA 1VFAA 1O5DT 1DQMH 4K3GA 1GGCH 5IQ9B 4RWYL 5IF0