3FSWA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaaahaaam)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCAAAAHAAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metal binding protein
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fswA00
3NJNA 2XX0A 4BWTA 5B3SB 3NSYA 2XWZA 1A4CA 2ZOOA 3V9CA 1AZBA 4E9WA 4ZK8A 1BXAA 3KW8A 3QJVB 4PCYA 3WNIA 1F56A 2QDWA 2ZONA 2EIKB 1JERA 1SF5A 2PPFA 3BQVA 4TXVB 6PAZA 1KCBA 4AKPA 3T71A 1J5DA 4HALA 5AKRA 1E5YA 2FTAA 3AG2B 3JT2A 2HRGA 2IDQA 1KBVA 1SFDA 1ASQA 1ASPA 4GXFA 5F7BA 4K9JA 2VMJA 1AZNA 1CYXA 2UX6A 1IBZA 1NWOA 2BW4A 2HLEB 3DTUB 2J55A 1BQKA 1ZV2A 2QT6A 2I85A 4WTQA 5I28A 2XYBA 2YAEA 1M56B 1OV8A 2XX1A 1FA4A 4ENZA 3X1BA 2FT7A 1PF3A 1ADWA 4GY4A 2B08A 3ZDWA 4A2GA 3KW7A 3S3BB 2GSMB 8PAZA 1JXGA 3IBOA 1BQ5A 1V54B 2AZAA 2VW4A 3IE9A 4G7SB 1PMYA 2XXFA 2GHZA 3X1GA 1NIFA 1PLBA 1W8EA 2BP8A 1J9QA 4GP8B 5PAZA 2WO3B 1JZJA 4QLWA 4HHWA 2Q5BA 3AG3B 4YSPA 1AG6A 1NWPA 1ET7A 2VM4A 3NJJA 2CJ3A 1N70A 1AACA 1GY2A 2H5UA 1HAWA 3T6XA 1KDJA 1CYWA 1TEFA 1JVLA 3NP4A 1QNIA 1XB8A 3NJLA 1BAWA 5B7MA 4KNUA 1TU2A 4M4RB 2VSKB 3FYIB 5AZUA 4KOBA 1JZFA 2YAHA 2H3XC 5I5IA 4YSCA 1ET5A 1OCOB 4KNTA 2RACA 5F7AA 3FPXA 3ABGA 4A67A 1JZIA 2A3TA 3QJUB 3S8FB 3NJIA 2HZHA 1A4AA 5AFAA 1OCZB 4HIPA 1OE1A 3QJQB 1IBYA 4P5SA 3DIVA 2CUAA 4DP0X 4JKNA 4G7RB 1AAJA 1GYCA 1A3ZA 2IWKA 1ZIBA 2CALA 3S8GB 3PAUA 2DWTA 3EH3B 5A7EA 2XLLA 1I53A 2AFNA 4YSTA 4FAAB 3QJRB 2BZ7A 1J5CA 2W8CA 3G5WA 3NJGA 4DP5X 4DP8X 4CSPA 3WIAA 1SNRA 1DZ0A 2B3IA 2EIMB 1KDIA 1SHXA 1M57B 4YSDA 2PP9A 1OOWA 3S3CB 2BHFA 2GI0A 2UXGA 3T6VA 3X1NA 2CAKA 2VM3A 4A2DA 4E9QA 3GYRA 4E9XA 1B3IA 1EZLA 4KO7A 3N2JA 1X9RA 2AVFA 3AG1B 1RZQA 5I6LA 5D4JA 1WAEA 1IUZA 1JVOA 3QQXA 3PCYA 2EILB 1IC0A 4DP6X 2MTAA 3NJFA 2BP0A 1HAUA 3WKQA 2BW5A 3ABMB 2AZUA 3X1FA 4G7QB 4F2FA 3S3DB 1TKWA 2XV0A 5E9NA 4P5RA 4M3HA 1JOIA 2P80A 4QKTA 5B1KA 2BZCA 1UATA 1BXUA 1KGYE 1OCCB 1E67A 1WA1X 3CVBA 2Y1AA 3SBQA 2EIJB 2BWDA 1X9UA 4Q89A 5I6KA 5EHFA 1OE2A 3NYKA 3JTBA 1QHQA 2X87A 2FJSA 2PPEA 2DV6A 4JHUA 1N68A 1PY0A 1BYOA 2EINB 5B1AB 4A2EA 3EF4A 3FS9A 2YARA 4E9RA 1SDDA 3FQ1A 2X88A 1VLXA 1JZGA 2FNWA 1GY1A 3TU6A 1WA2X 3AW5A 2QPEB 3OMIB 4BDVA 1PZCA 3CDZA 4GYBA 1WS8A 2E86A 1NPJA 4KOCA 3T6ZA 2FT6A 1NIAA 4KO9A 4BWUA 1WS7A 1ID2A 2BP8B 1V10A 2I7OA 3L45A 3OM3B 3TBCA 1AS6A 1BXVA 2IDTA 3EH4B 4A2FA 1NTDA 1SHWA 3UADA 1FWXA 4E9TA 1PAZA 5D4IA 2UXFA 1RZPA 5IY5B 4DP1X 3IN2A 1TEGA 4YSSA 1R1CA 4KO6A 3WNJA 2XUWA 1PCSA 2XV2A 2YAFA 4A66A 2QDVA 4N4YB 3OQRA 1E30A 4AX3A 1GSKA 4Q8BA 4UAHA 3MX0B 3EHBB 5B1JA 2XV3A 5I26A 4E9VA 2HX8A 4G70B 1ETJA 7PCYA 1EHKB 2GBAA 3NJMA 1IKOP 2FWLB 1MZYA 5TK2A 3UAAA 2XVBA 1OE3A 4HHGA 5I6MA 4HCGA 2GC7C 2QPDB 4A68A 2GB2A 3TA4D 2J5WA 3AG4B 1M9WA 4YSOA 2IWFA 2YXWA 2XXGA 3C75A 1A4BA 3OMNB 3X2QB 4HZ1A 1BYPA 2IH8A 2PP7A 3H56A 2IH9A 4PAZA 1CC3A 2HXAA 1ZIAA 1AZUA 1NINA 2PLTA 2IAAC 2TSBA 4BXVA 2IWEA 4F2EA 3FU8A 1AOZA 3ABLB 1FFTB 1QLEB 4UF7C 3AZUA 3U25A 4AZUA 2FQFA 2VW6A 3PPSA 3NSFA 1L9QA 1NIDA 2BWIA 3FT0A 3OD3A 4DP9X 4YSUA 1WA0X 1ILUA 1PNCA 1PLCA 1PZAA 3UGEA 4E9YA 1GW0A 2YAQA 3H4HA 4DP7X 3TBBA 2XU9A 5B7EA 3SQRA 1W6WA 1ZPUA 5I5MA 1SF3A 1SFHA 1L9OA 5B7FA 4DP2X 3UABA 2PP8A 5I5JA 4DPBX 1NPNA 3IN0A 5D4HA 4DPAX 4X4KA 1CUOA 2ZXWB 3FSZA 1DYZA 2PPDA 4AKOA 3PXLA 3NSCA 1NZRA 2R7EA 2BP0B 4KNSA 1KYAA 3ZBMA 1AS8A 4YSAA 4FA7B 1XB6A 2PPAA 3H4FA 3RYMA 3FSWA 3ABKB 3MBWB 2OJ1A 3FU7B 2UXTA 3PLYA 4YL4A 1GR7A 5I6PA 2DY2A 3UAEA 4GP4B 3V9EA 2W88A 3OMAB 2N0MA 1NICA 2UX7A 3FU7A 2CCWA 3ASNB 2FQDA 3SBPA 4YSQA 4W1TA 1GS7A 3QJTB 1MG3C 1L9PA 2Q9OA 1ZDQA 4NAJA 2JFCA 1AQ8A 1SDDB 4EF3A 2CBPA 4BDVB 3WG7B 1L9TA 2BO0A 3EH5B 3CDZB 2LLNA 1ZDSA 1JXDA 2J57A 1AR1B 3GDCA 2JKWA 2MRYA 4AKQA 4A2HA 1NIEA 1E5ZA 9PCYA 3PAZA 1JZHA 1GS8A 2OCCB 3FQ2A 1OCRB 3FSVA 2PPCA 3IEAA 4NERA 2FT8A 2JXMA 3NJKA 1MZZA 3TASA 4CSZA 1J9TA 1KCWA 4RH4A 1L9RA 2IDFA 1AG0A 1SJMA 3QJSB 3T6WA 5ANHA 3DKHA 2IDSA 3FU9A 3HEIB 4YVNA 2DWSA 1ASOA 2GC4C 2UXVA 3HB3B 1NIBA 1XB3A 5PCYA 5TK4A 4G71B 5I6NA 1NDTA 4E9SA 2H47C 1RCYA 1OF0A 2PCFA 3CG8A 2Y69B 4G72B 3GXUB 4YSRA 1W6LA 2DYRB 2IDUA 2P80D 3D12B 3N55A 6PCYA 4HCIA 4WKXA 1BEXA 3NJHA 1PNDA 2AANA 3NT0A 1ILSA 2OV0A 2TSAA 2YAOA 3NP3A 1KBWA 5I6OA 4F7KA 2PCYA 1JXFA 4KO5A 4N8UA 3FSAA 3X1EA 1URIA 1A8ZA 2NRDA 4YSEA 2YXVA 3ERXA 2VW7A 4DP4X 5B1JC 2ZWNA 2FQEA 4BXSV 1J9SA 1PZBA 1ET8A 4HCFA 4BWWA 1BQRA 1E65A 3WI9A 5LDUA 1YLBB 3FPYA 2VN3A 4GP5B 4W9ZA 3PAVA 1XMEB 1T5KA 2I7SA 3ZX1A 1AZRA 3QPKA 4UANA 2J56A 1V55B 2HX9A 4MFHA 3T9WA 1AANA 1RKRA 3WKPA 1AZCA 5B1BB 4NB7A 2FQGA 1KV7A 3FYEB 4BK5C 2YAMA 3NSDA 3ASOB 1HFUA 2YAPA 1GS6X 1A65A 3AY2A 1PLAA 3BVDB 2R7EB 3CVDA 1J9RA 1JZEA 4HAKA 1L9SA 1MDAA 3CZUB 4L0PB 7PAZA 3FQYA 4AI7A 3UACA 1AIZA 1AS7A 1MG2C 2GIMA 2YQBA 4YVUA 2WO2B 5FC9A 3SBRA 3ZIYA 2WSDA 4JHVA 3CVCA 2VSMB 4DPCX 1CURA 2HX7A 2HRHA 2DYSB
chains in the Genus database with same CATH superfamily
4OJDH 4P2RA 4EI0A 3A6BL 2A4ZA 3ARSA 4J3XA 4CBZA 4J6RL 2XWZA 3O6MH 2XBZA 2F0CA 3CXDH 2X0VA 4BZ2L 4OIIL 5C07E 4KHTH 1NOAA 1OP4A 1QYGL 3H9SB 5J1AA 4QMEA 2RB8A 4PCYA 2GAZB 2ADJB 1F56A 1O9ZA 1UXMA 1A5FH 3DTXB 4JDTL 3PL6D 4KROD 4MD5A 4QR7A 1SF5A 4ABUA 4E41E 5M7QA 3QXAB 4I3SL 1FO0B 2OXGA 2P5WB 1RZKC 3LQAL 4MCYA 1DVQA 1P9MC 5GS0L 3ULSA 4LLQB 2E47A 3CSGA 3F84A 1A6WL 5F1IB 1BCIA 4JFXB 4EKJA 3KLKA 1GZQB 1HWWA 1SFDA 1J8RA 1YDPA 2D7NA 2DDQL 3DUUB 2DLFL 4PTUA 5ESVA 2AEPH 5B1CA 3E6FB 5T3ZE 5CMAA 4PJBB 1NCBH 3O6KH 2QBWA 5I8EA 3ZHDA 3WAJA 3LAFA 4PCKA 3UIZA 3KL0A 3TZVB 4ZFOA 3U46A 4E2OA 1IO4C 1S7RA 3C6SA 5E2TH 3QC5X 1UOLA 4U05A 1KBKA 3APDA 3QDGD 3ULUL 5IFHH 1NGXB 3WU1A 2BSRB 4BFIA 1NCWL 3BC9A 4NENB 4MAYD 4N0CC 2WJ5A 2O93L 2MQCA 2FEEL 1G9NL 3AT9A 3ZO0A 3FT9A 3LTVA 4HMDA 5JR1L 3FN0L 4AVKA 1QLEL 5E8DL 3FU0A 2CIKB 3FOLA 1W8EA 3LN9A 3US0A 1YUKB 3LNHA 5PAZA 3IGUA 2HRPH 3MJ9H 4P5TD 3AG3B 1PL3A 1F6AB 4UQIM 3M6DA 3R8BB 3NCYS 4HJGA 3Q9PA 3ETTA 2LOEA 1F58H 3RB5A 2XWTB 3ESUF 3OZKA 5C92A 5F71A 1UENA 5HDWA 3WHE0 5BVPH 3L5WA 4B3EA 3ZDYF 3D2UD 5GGRA 2IPKB 3B9KD 1SRDA 4GUPA 4J3OC 1R46A 2KI6A 4UOZA 4UQBA 2L04A 2WXRA 3V8CA 5LN8A 3SB3A 5DYOA 3UTSB 2FL5A 2NY3D 4H8VA 3QDMB 1G87A 3C2AH 3O8XA 3HRZA 4U6YA 4R97B 1DL7H 1BBJB 3IBEA 4JZJA 4KNTA 4MA7H 1DQJB 1N7ML 4JRXA 3HE7A 5FM5O 4POYA 2Q87A 5FYJU 2KZ1B 4OJCA 3TBWA 3KVPA 2CWRA 3L3DB 2PYEB 4ZD3H 4D2NA 2NUPB 3N04A 4ZUVB 2X89D 3CVHL 4JCWA 4G7RB 1G0YR 2O6DA 2ZYIA 3OJVC 3P4LA 1VERA 1MCOL 1JXJA 2Q20A 4R83A 1CS6A 2FD6L 4UZUA 4KTDH 3G5WA 4LSUH 5L2KE 1KFAH 5C0JA 2CPCA 5JO5B 4MA3A 1SN2A 1FZKB 3L48A 3FCSA 4JFVA 1SNRA 5F96H 3I3DA 4BK4A 4ZO9A 4AYBA 4JO1H 4NN5B 5EUOA 1CDYA 3IDMB 1I1AD 4QXWA 3ARDB 3GMRB 3S4SA 3MRDB 3IMVA 1OAQH 4K3JH 2O5YL 4YFLI 4ACTA 3ZDXB 3NUKA 4XP5L 3V4PH 1AGFB 2Y0SA 2YPLB 2A2QT 4P3CL 4FFYH 3E9TA 1SPDA 2HT4D 2OMTA 5FYLD 5T5FH 1XXFC 3QRBA 2N3JA 2LTQB 2YPKA 3SDCC 4GRLA 3LS4H 5CKGA 1FP5A 5C86A 4RFOH 5EDXA 2ZYRA 3MJ8A 1LXMA 3APFA 1FFNA 2D7QA 1ED3B 5EN3A 3LNFA 1FL5B 5DCCA 3VFWB 3QI9C 4ZI8A 3DXAA 3OSKA 4Y2OA 4OLXH 1IC4L 1S7TB 4YMPA 3RRQA 5B8CC 2VLJB 3TNNB 1PY0A 3TIDB 4P57B 3EF4A 2YARA 3GRWH 3ALXA 1CFVH 3P4OB 2CLVB 4XMZA 1SXCA 3L7FA 3N5AA 2MNUA 1OHZA 2FT6A 1WC7A 3LDBC 2Q8BH 2EACA 3QYNA 2VDKB 1IGIH 1BM7A 1AO7B 3OM3B 3MA9L 4EN3A 3BLPX 3FB7A 4TULL 4WUUB 5E2VL 4P5KB 4ZNCD 3MOBL 1EHNA 1KPRA 4JCLA 2UXFA 2DLIA 5DDHA 3UROR 4C56B 2FECL 2PR4L 4HIJA 1GRWA 2HH0L 4D9LH 1WBYB 2VRKA 3MLYL 4MB5A 1FIEA 3TESA 1OXYA 3HZYA 3G9VA 2HVJA 3SDXE 1UB5B 1KXTB 2NTFA 4HLEA 2R69L 2YA2A 2DL2A 5HHXL 1BDYA 1JFQH 1CGSL 4DEPB 2HX8A 4KRPD 4MVBC 4G70B 1Z66A 1ETJA 3VACA 4FE9A 2VWEE 5EBWB 1DVSA 4TSBH 4NIYE 4K23L 4AGNA 4IBSA 2A6IA 5F3BA 5GRUH 3QO1A 1G6RA 1CFQA 4F15C 3UAAA 1KTBA 3ALPA 2C1PA 3VSTA 1S7XA 2OYLA 1UVQA 4GKZA 2UZIL 1NLBL 4XZUA 3U82B 5IHLB 2DI7A 3SYCA 2APXA 4LCWB 5J6GB 1FN4A 2OMZB 4NUQA 4Z9KB 3CFMA 1I3RA 2V5MA 3L3JB 3QEGL 4NC2B 1MRCL 1MFCH 2RH0A 3C75A 1W8OA 4U1IB 4PRIB 3KLLA 3PWPE 5DMIH 1KUMA 4CVZA 1OSEA 2DD8L 2GTWA 2PO6A 3KD4A 4JO4L 2WTRA 1L7IL 4S1SH 5EUKB 3TBVB 3UEZA 3MRLB 3LQAC 1BSIA 5FECB 5GS0C 3LRKA 3MRHB 4I3RL 3RWIB 1S5HA 1ZA3B 3NIDB 5DS1A 4UIMA 3WFDH 3EGDB 1T6VN 2VJ0A 4E9YA 1BMGA 3IAQA 2ZCLH 4AW4A 5KW9L 3FBQA 4IDLA 4PJ9B 2BJMH 3ZKNC 1AD0B 1OTUD 2FX7L 3LKOB 1NANH 2OR9H 3WS3A 2OA9A 2Q7YB 1JMXA 1SFHA 2Z92A 3UTZB 3QC6X 2PP8A 2F54E 2OMVA 1NAMB 3F12A 5EZOL 5GJTH 3UTTD 4N5ED 1XTLA 4UNVA 5EU3A 1EEYB 2WMPB 4GAAA 3OWEA 5SWSB 1ZLUH 4HXAL 3M17A 3A0OA 4PSRA 2XWDA 3DHMA 3GHBH 4JKLA 3ZDXF 6TAAA 1OIOA 4EI5A 5KYWB 4MNHB 3KYNB 3IF1B 4PJ5E 2ZNXA 1SQ2N 4OIBA 4BZ1H 4YDKL 3UTSD 2EC8A 5CCGE 4LVHB 4WW2B 1PYWA 4FTVD 3V9EA 5E1IA 5IMLA 3OGOE 4DGVH 1M71B 1YUHB 4QKXB 3O41B 3QP3A 5FM8A 1X7QB 3B2XA 4PUBH 4UDUB 2R29A 1OGAE 4HWEH 3L3OC 4WWID 5EEYA 2BFVL 3GRBA 4L4VB 2WIIB 1UZ6E 4CVWA 4ZOEA 5E2JA 4B3VA 3TYFA 3WG7B 3QNXA 2NT1A 5DMKB 4PJHE 1KGUA 2BY0A 3U4BH 4YGVA 2W92A 3ZL1A 3GDCA 5DHVA 4KK8C 4N5UA 2BSED 1JXKA 5K9OB 1E9OB 1Q9OB 3FQ2A 1FJ1A 2WB1A 5C97A 4K7PX 3X13B 3BUYB 1BX2A 4UT6L 2HPOA 1MY5A 3WMQA 4B9CA 2UUDH 1N64L 3DHPA 1JGLH 1R3JA 3II1A 4TVPE 3NPSC 2DIBA 5HGHB 3PWVB 2O5XL 4B97A 1BA9A 1C08B 4JLRA 3VXTA 3DJRA 4WHTB 3SD5A 2AXFA 1ZJAA 2VXQH 5A40E 3LZLA 1TJHH 4W6XB 1ASOA 4NHUB 5IOKA 1E27A 3RFZA 3B6SB 5I82A 4WI9A 4CUCA 3AROA 5TDPA 2VLMD 3MUHL 1FZJA 2H47C 4KFZC 1NGQH 5IB3A 4ONGL 3RX8A 4MQTB 1S78D 2M83A 1MHCB 3MXWH 2DYRB 5AW7B 2RAMA 2A74B 2Y72A 2NY5H 4K0OA 1WF5A 2ZF9A 1KXVA 5GSVB 1J8SA 4G8FB 1RP9A 3EYUH 2G0LA 1IEBB 3VXRA 2PUQT 4MQSB 4ANUA 2O6EA 3RDJA 1KTDB 4YZFF 5JOPD 2NY0C 4JJHA 2VL5B 1WYJA 3P02A 4OCMC 5TF1H 5CD3A 2YFOA 4N8UA 4OR1A 1RULL 1A8ZA 3I02B 4X7DC 4JR9L 3TM6A 2VW7A 4PJDE 2X1OA 5GGTH 1PZBA 2ICWJ 2OTPA 4HQQL 2FO4B 3BP6A 1SLVA 2FEDC 2YKKA 4GIPD 3JWNC 2F58L 4HK3J 4KXBA 4MXWL 3DO3A 4UM9A 3GDBA 3L3KA 3GD1C 5EZIH 1ES0B 4TOYL 3P9LB 5BRZB 2I07A 1U8QA 4M4RA 1Q9KA 2OW7A 1HYRC 3RX7A 3B8YA 3TYGL 4DESA 2WXHA 5FDWA 4FFZA 1WHPA 5IWLA 1F11B 1Y6NR 2JI2A 1CT8B 2J5LC 2HX9A 1P4IH 4DKEH 2HFGH 2AF2A 4F20A 1GIGL 3FYEB 4XP6H 1MCRA 4K3DL 2B9BA 3MLZH 4B9IA 2K9FB 1KY6A 1U4FA 3H2WA 4H88L 1SLXA 2BY3A 2XT1B 4ZJ9A 3VH8G 1W0WA 5IM7B 2Q3AA 4PGEB 3TN0B 5JQ6L 3S97C 5ICUA 1O75A 5IQNA 4Q2ZA 2CKBL 2NY4B 1PG7L 3BQUB 3HBQA 3ATEA 4V2CB 4UV4H 3V0FA 2WO2B 4DZ8A 1TSRA 5I19H 4C4BA 1X5MA 1XF5B 3MLSH 2JKJA 2IADA 2JCCE 4WJ5B 1I9RL 5AVUB 1BFVL 4XPFL 4JE4B 3QIUC 4M6ML 4WW2F 3QCVH 1A4CA 4DERA 4PGJA 4WI0A 5I66B 4IRJC 1SEQL 3IDNB 3K0WA 4E9WA 3US1A 1C8PA 1EVTC 1O6VA 4NRZA 2ICES 3D52A 1OTSD 2E9WA 1LO2H 3MMEA 1MEXH 1KCSL 1E9QB 5IMMB 2EH8L 1WH0A 4V33A 4HUXB 5E9DD 5AEAA 3JT0A 3L3GB 1YEHL 4PTUB 3B7TA 5I8EB 2H2PD 5GGSB 4FXGA 12E8L 1I8KB 5GS2H 4K7FA 3W9DA 3HC2A 4OM0L 2NW2B 1S7RB 1WSST 2HA1A 2IBZX 3FQ4A 2OP4H 2E7CA 2AV1A 5C8JB 4JAMB 5F70A 1IBZA 3WLWD 4I88A 1ANUA 2VR7A 4ZQTA 5E2WL 4L4TA 1ZV2A 3FFCD 1R24A 2F1BA 5DD1L 1Q1JH 5BCAA 4XX1G 5I15H 1IB5A 3WN5A 1FA4A 1L0QA 4ZXBC 5IGXL 1QP1A 1TENA 2NZ9D 3MRIA 3A67L 1WLHA 1NCOA 3WMSA 1FE8L 2W9LA 3EYFA 3L95B 4U6XA 3UEQA 3ZPDA 1X5AA 3QHTC 4YHLH 4F9LA 4IOSA 3H42L 4BH7B 4P23A 2I32A 5AUMB 1VEPA 2VW4A 1FFPB 4JFWA 4MCMA 2COQA 4NC1C 3GLEA 4AUYA 4HS3B 1PLBA 4XN7A 4BBWA 4UV7L 3U9PH 2WO3B 4POUB 2J6WA 2CJTA 4NZUL 1S9XA 4PJGA 3VI3F 1T2QH 4XCEA 1AG6A 4H8WC 4U1NA 1ZTXL 4PJ8A 2OMYA 5MEND 4Z7OE 3CZFA 1YEFH 4KX7A 4XCFL 4PJCB 1KDJA 3KCPB 4GUPB 1QR4A 4KJWC 4WV1C 4X50A 4MSWA 4OQTH 4L37A 4MJHA 1RP8A 2VXUH 4TUOA 4U1GB 3M8OH 3LNEA 4Z7NB 2CCVA 3UXFA 4CVUA 1OAZL 2CPUA 5KN5B 4KNUA 1JG9A 4JZJB 1HXYA 4HEMA 5ESAA 1U92A 4KK5C 3W0WA 4FA8A 3HS0B 4FNTA 4HCRL 3D25A 4K5PA 3CU1A 1CGTA 1EBAA 2PWHA 3S35L 3V4VB 5CS7A 3PHSA 4PY7A 3WHE1 4GSDH 2CUMA 3WLBB 2XTJE 3RTQD 5T3ZL 2ZKYA 3B1TA 1M2OA 2YBGA 3DMMD 5KSAA 1AKJB 1F8TH 2HJLA 4LCIH 4YDVB 3FO0H 3SGEH 1XH2A 1AP2A 4MMZC 3FT4A 2BOBA 4Q9CA 2DLHA 2G2NA 2DWEA 1JGUH 2NY7H 4AZ8A 2C9XA 3LH2L 5IHZA 5EU6A 4WNQB 3MLVH 1XGYH 2Z31A 1KIRA 4LOVA 2F19L 4MJ5B 4DQOL 3EH3B 5ITBH 3FONA 5I0VA 3D39E 2GITB 2R0KH 2R39A 1FRGL 4Y4HD 4N8PA 3EDJA 4H20L 3GM0A 2AVGA 4IU3B 2W8CA 4ORGA 3UPCA 1CLYL 2DICA 3Q1SH 5EUOB 5LBSH 4KZEL 3ARTA 1T6WA 2XSKA 1GKOA 1KGCE 3S4SB 3WFBH 3UAFA 4Y1AE 5HTSA 4AYSA 5CN3A 4AE1A 3DVNA 2X1QA 4Z76A 4QYOA 3IU3A 4GAJL 3QUZA 3BAXA 3FXIC 1WAAA 1QRNE 3RL1A 2AK1H 5LXGL 1ZANL 2O30A 2P24A 4KXZH 4LLMA 3TGXA 2EH7L 2X4OB 1UG9A 4KVPA 1UFUA 1Y1DA 3ZL4L 3F7PC 3LV3B 4UILH 3ZKMD 3PCYA 4Y5VB 1U93A 2GSIB 4AGOA 1A7QL 1HAUA 1FFNB 3L5XH 3SDAB 1A6AB 4PB9L 3S3DB 4HJEA 2IOIA 2HCZX 1IZJA 5FA4B 5BZWB 1GPOL 4LAJH 4N0FA 5DQ9B 1M3IA 3BDYH 1A6PA 2UZXB 3QPQD 3GKZA 3RZCB 3L9YA 1X9UA 3IJEA 3MV7D 3V8OA 3BZ4A 1KN4H 3L17A 4HLJA 1QEXA 5C9JA 2IALA 3GBDA 1CE6A 3KM2A 4XNMB 5D72H 2EVIA 3MLUH 1NMBH 1RK0A 3QEHA 4G6ML 1Q9WB 3N1QC 3ZHKA 2ORBH 4BDVA 2R2HA 3CDZA 4G6FD 4BSVA 4HDIA 3FQUB 4EN3B 3VMNA 1NIAA 1BVNT 4LASL 4YAQA 3PHQA 3QG6A 2FUTA 4HS8L 4KFMA 4MQXD 4PIBA 1AGCA 1RXLA 4J5VA 1CVSC 4P2RD 3QJFA 4Z7UE 1FWXA 4E9TA 3L08A 3OPZL 4OJFH 1BVLB 4KJQC 3KNBA 2HVJB 1QI4A 2XY1A 3HUJA 2DAVA 1OOAA 3VMPA 1PCSA 5I8OL 4NN6C 3BD3A 4A66A 3SSGA 1QD0A 4N4YB 2YK1H 4G6AC 4X5WB 5FYKD 2P52A 2ENJA 1M7DB 3G6AA 3ZT7A 4M48L 1EDHA 4LVNC 5F3BB 2UWEE 1K6QL 4ODWB 4YE4H 4R4FH 1ECZA 1G6RB 1F4XL 5E51A 2F08A 5F7YC 5FGBA 4M43L 2WXKA 4JMXA 5EEVA 1S7UA 3V7AG 1NJ9A 2ISDA 1MJUL 1CK0L 3DJTA 3WFHA 4UUJB 3VDBA 5CP3H 1FN4B 3PFUA 2R1XB 4HBCH 3OAUH 4QLRA 3N91A 3WUZA 1MHHA 4JFHD 3PWNA 2OX5A 4HIEA 2J25A 1J1PL 4X5RA 1WEJL 2IIJA 4NO0A 4XOCA 3PJSB 2QEJA 4LE8A 4HZ1A 1FZMA 4JBSA 2BNRB 1GOFA 4P2AA 3B3IA 1LO4L 2IH8A 3G6JB 2GIYA 3N06B 4P3WA 2YSTA 3UIYA 3VD7A 4NNXB 5ESQB 1HNFA 3DROB 3DIDA 5DK0A 2DQGL 1DJGA 1NINA 2C9RA 2BNQB 2CCLA 3CIQA 5IBUB 2E8YA 5EO9A 4N2DA 4EAEA 2P8MA 4AZUA 4DEWA 3MPCA 5FO8B 1WA0X 3QBTB 1W72L 4GB9A 3GMLB 3SBWA 2OMUB 3MQIA 4KJYB 5EUOF 4O2EA 1BV8A 2Y36L 2VZ3A 1K4DA 2WBJC 3QR0A 1BGXL 4DGIL 4ANKA 2RTTA 3ECBA 3QORB 5CZRA 5ALCH 3OKYA 4MCZB 2JK5B 1BG1A 3RBGA 4JKWA 3B7UX 5IW3A 1OSZA 5EC1B 4DPBX 3TX4A 1NPNA 3DDFA 2VZTA 3LEXA 2VT0A 2AHIA 3HZKA 4QRPA 4EI5B 4KGJA 3DBXA 3KPSA 4HPOH 4M7LT 4NRXA 1EAPB 4QEGA 1QSEB 1CN4A 1P6AB 1XV8A 3O8XD 4DOHB 3D0AA 3H4FA 3RYMA 1TZHB 3UAJC 3OKDA 4LOEA 4JRXD 1QQDB 4P2YA 4YC2B 3H3KA 2YBRB 3HE7D 1MF2H 1GR7A 4LSRL 5I0YA 3X11B 3DX6B 4AV5A 2RA1A 4HC1H 1K85A 4JPWH 5FO2A 3QRGH 1NPUA 4PRHA 4TPRL 5IZ7A 2IG2H 3DPBA 4HS6B 4BFEA 1INQB 1CFNA 1KIQA 5F89A 3UC0L 2H1PL 3BP5B 1CD9B 4JY6A 2YPVH 4K2UH 1PZSA 4UQEA 2E8ZA 5HDBE 1ZLVH 1ZDQA 1SDDB 2ZYSA 3ZU8A 2VDQB 4XZ4A 3H3PH 3T65A 3ZE2E 3FT2B 3O6LH 4XN5A 2K70A 3EDKA 2CDFB 1N5AB 3NOIA 3V0VB 4KAQL 1FJ1B 1F4AA 1KY7A 2PWFA 3NN8A 3TBSA 1FZOB 3D18B 5DJ6B 4S0HA 1D7DA 4N8CH 2NX5E 1GS8A 3G7TA 1A4KB 5I1LA 3LXUX 3PGCA 5B3JE 3TC9A 1MZZA 1QBLL 3HHMA 1CR9L 4JLRB 4NSKA 5E0QA 1I1RA 3RIAK 2WZ5A 5FF6A 3HC4L 1KCWA 2ZG3A 1NCUA 1T83C 3HS8A 1OQOA 4FA6A 3RFZB 5E5LA 1SJVA 2EECA 3VWJC 1RZFL 5C0AE 2H0JA 1YN7B 1R5VB 3P3TA 3AQZA 5CBEB 1CCZA 3FU9A 4LL4A 2YA0A 1C7SA 4N3UA 1MIML 3BH9B 4NO3A 3LIZA 5FFGA 5I6NA 2C34A 1O7DC 2Y69B 4NQXA 4NQCB 3ALWA 3T0EA 3KLQA 4OW6A 3HN3A 4GRLD 2IDUA 7FABH 4ANWA 3KBHE 2EO1A 1EV2E 4U1LB 1MCIA 5L0QC 3LQZA 3FFDA 43CAB 1G9HA 4M7ZC 3RIFK 3JTSA 3MO1A 2YZ8A 1BEXA 1B2YA 1S7QA 2OSXA 1TCRA 4HUMB 2YAOA 3HCVA 3RAJH 1KBWA 3DXAD 1XWVA 1P4BL 3STZA 4YEFA 4LPVA 1CDUA 4IOIA 3LKPB 3NCJL 4KHXH 1SJHB 4Z7QB 2Y1ZA 3L3KB 3RGVB 1J9SA 1Q4NX 3MLXL 3MR9A 1SYVB 3ZRSA 3BPOB 1FLRL 2AS5M 3QRLA 5EPMA 4FKEA 1ZPLA 2MOVA 1KCRL 4EN3D 3Q13A 1BQHB 1XT5A 5DC9B 3N6YA 4AYMC 4XXWC 4XO5A 2G2RA 4YJZL 2AEWA 1QSVA 1JPGB 4KQ4L 5E0FA 4IDJL 2EVGA 4OZHB 9CGTA 2J56A 5TGBB 5I0ZA 1SXSA 4HIIB 4APQB 2DJMA 3TO2A 2NXYC 3OKLB 4ZOBA 1J5HA 3LPFA 4TVPL 4P05A 3UZQA 3WJMA 4ZDHA 3VG9C 5TDOA 5GGQH 1WT5C 2W94A 3N50A 3CSBA 3P9MB 2XPZA 3QEUB 4POZC 3GUTB 1UJTA 1CD1B 3BVDB 3BUDA 3P2DA 5F1NA 5IMKB 1D5RA 1L9SA 5GGVY 3T4AB 3V6ZA 1U3HB 5JYMA 4ZYKA 4DZ8B 2QQNL 3MLRL 3GSNB 4OCWH 4J1UB 1XR8B 1IEAB 5T1MA 4KKAC 5HY9B 5DUJA 5I76B 3KYOB 2Q10A 2YQBA 4JM2C 4N3TA 2OZ4L 1YQ2A 5BJTA 4YHYC 1G84A 2DMGA 1UWGL 3CLFH 1ORSB 3SDCA 1S7WA 2R2EA 1SM3L 5E6UB 1HXMB 3KH3A 4PJFE 5GRZA 1P2CA 4I87A 4YBLB 4OLVL 2OMXA 1ZCRA 1OQXA 3GJFB 5H35B 3J27A 4AH2B 5E5UB 3P0YL 5ABZA 3NSYA 2Y6SC 5SV3A 1EXHA 3G5YB 1LO5A 4CW1A 3NG5A 4FYTA 5BPPA 4UM8A 4OGXL 3VFOA 3WUWA 3LNGA 4QY8A 4A2LA 5I1HH 2PO6D 3VGBA 4P4KC 4TNWK 5B8CA 5C2BL 3RUGA 1R47A 1KCBA 2FSDA 5IT2H 2AK4A 1E28A 3T3MF 4RMUA 4J8RA 3T71A 3JVGC 4LCCA 3NQIA 4XPGH 1HOCA 4HU8A 2P7TB 4HWZA 1A2YB 4JRFA 4PY8I 5F7EH 1ASQA 1PX4A 1VFBB 4Y9GA 1E9PA 4Y5XB 2YA1A 4ZAKA 4WFGE 4NUGL 5E9AA 2CU9A 3GS4A 1T22B 3WIIH 4BUHA 2B3RA 2GJZB 3JBG7 4NQEA 4DFHA 5I8KH 1A7NH 2FLBT 2DI9A 1YEKH 5E8NB 2QT6A 4KMTH 1ZRUA 4AEIH 2WGXA 1ZE3H 3HHSB 3DSFH 4OFYA 4UTBL 1UKQA 3TO4B 3K6SB 2AABH 3MV8B 4U1SA 5EZPA 4F2MB 1ADWA 1HKLL 2VKWA 4XN8A 1EXGA 5AWNL 3U48A 2J44A 1DVFB 2BCMA 1PFCA 3BCFA 1V7ML 5IB5A 1TITA 5GXBB 4CJ1A 3K2KA 4RGNC 4XXCA 2OZNA 5MEPA 4XCEB 4HUUB 3MACH 4Z0XA 3VXOB 1IKNC 3D8MA 2WN2A 4RSYA 3SDDB 2VLKB 4IW4C 1BZOA 3PABA 4YQXH 3RNQB 5K9JL 4Y8AA 3P11L 2QVKA 2WLHA 5E4AA 1NFDA 2QTEA 3LOWA 4GLRH 5IMOA 4L37B 3EH2A 4ZPTB 2VLRB 1HL5A 4WHDA 5B38G 1EUTA 2YOCA 3UTPE 4AQ1C 2NY1B 1HK6A 4ZTOL 4BZ2A 4Z78A 5DZLA 1TEFA 4UIKL 5ESAB 3RVWD 2LW3A 5DI8A 5EA0H 5KVGH 3QCUH 1HQRB 3K72B 4Z7QF 4N0UA 2K6WA 2FYYA 3D25B 3IXTA 4U0QB 2G60L 2VSKB 3FYIB 4AYFB 2OK0L 5IKCB 4P99A 2BSBA 3BKJH 3RPIB 1CI5A 4F8NA 2X70A 4W81A 3ZKXC 3O3UN 5CSZB 2KDYA 2W0KA 3FPXA 4FQLL 1S3KL 1HHHB 4U2YA 4QHLA 5HHME 4YHNA 1AP2B 1TMQA 3WCYA 4FNPA 3WNMA 5F7KC 1QR1B 1IGCL 2DWEB 5E1AB 5TE7H 3V5DA 4F7MA 3KJ6L 3QSKB 3CFBA 4GRWF 1U8LB 4PHZA 2E27H 3NDZE 2K4WA 4WEMB 4XC1H 4HJIA 2IVFC 1ZS8A 3UMNA 2Q7AA 5EWIL 4Q74A 3U7WH 3MNZB 4ORGB 2YOAA 5DS8A 3BSZH 1KCUL 1K4CA 3VB8A 3ULVF 3B5GA 4H40A 3SKJH 1KLUA 3RFRA 3UYRH 2YGNA 4F7EA 4HK0A 1XF1A 3GWJA 3ZT5A 2Y5EA 1ORQA 5JMOC 4OM1H 3VXRD 4XNUH 3AAZB 3EO0A 3GSVA 1JTOA 2B3IA 4IGBB 3KH4A 1MJ7H 2BS8A 4Z76B 2Q3ZA 1Y07A 2DQHL 3PWLA 1A9BB 1LP9E 4ZUWB 4XB3A 4JKMA 4RGOH 4X8JB 1JL8A 1TFPA 4O02L 4AL8C 4FXKC 2DMKA 4PV9B 4E9QA 5EF3A 3DVGB 2FZ3A 4UM9D 2D7MA 5G5DA 3S5LG 3NTCL 1N6QH 3AG1B 4NT6B 4JY5L 3T09A 1IUZA 5LNGA 4P46C 1B6DA 1NL0H 3D0VB 1Q72L 4ELMA 2F8XC 1MAKA 4JG1H 2IFGA 3IFNH 2YEZB 3ILPA 3NEXA 5AZEL 3TVMB 5SWZE 3O9WB 3QUMH 43C9B 1H3GA 2PCPA 3BVWA 1QUNA 2P80A 4NPJA 1OB1B 1ERNA 3GRGA 4WO4C 5DO2C 5FKAA 3TA3B 2R2BA 4OCYH 4FG6D 4B41A 5D93C 1MCBA 3FO1B 3H9SE 4NKIH 1Q90A 4NJAL 1WZKA 3QEHB 2NYZA 1EX0A 1X9LA 1UC6A 2I60H 2IQ9H 2ZCKH 3NYKA 3P1VA 1E8ZA 3QH3B 5IEKB 1IGMH 4MB4A 3QDAA 4OCSL 1A6TB 2PCXA 2HJKB 1VZIA 3ULVD 4KH2A 2P5WE 1PKQA 1RHHB 4G8GA 3CVHA 4XBGA 4M6NL 1JZDC 4HJJL 3BXNA 4PGDB 4ETYA 2A6JA 1WS8A 4ERSL 1JCVA 1QUPA 4P5MA 1TTGA 1DUZB 1OAJA 3AB0B 3IKCB 4ENEC 3RTLA 2V2XA 2H32A 2RBLA 3KNBB 2VUOA 4TNVF 1NEUA 1ZWIA 2QZ5A 4N2LA 1A3LH 1II4E 4PJBE 5FM5M 4ZMNA 1VRSA 4PJGF 5ID1A 3LN5A 2XPYA 2UY7A 3PREA 1P69B 1KB5L 2JB5L 1AKPA 4O2FA 1CFSA 4YSSA 3BESR 4FXLA 1IBFA 2BMKA 4ALAL 4F1SA 1NDMB 5BW7A 3PV6B 4FQHA 4YNYA 4Q9QH 3MX0B 4G43B 4FI7A 1TU2B 4XMTA 3TEWA 2MPAH 3VGAB 3D9AL 1CDIA 1XSJA 4JN2A 2OTUB 1TZAA 2HPTA 4G6KH 1UJ3A 2GBAA 4LU5L 5FUCE 1I75A 4NUJA 2FWLB 1MZYA 1H5BA 5DRZB 3D1MC 3KVQA 4LEOA 2JI1A 5IV2B 2X9YA 4NO0B 2W9DL 4AQ8C 1TT6A 4YZWA 4L4TD 3HZ3A 2G3MA 3TA4D 2R0LL 1FQ9C 2B1HL 2XZZA 2A0LD 1ODUA 5CGBA 3B3IB 2E59A 4GQQA 1XCTA 3IMWA 3FRPB 2OL3H 1QZNA 4Z95H 5HDQH 5F7FA 1FL6B 4X0KB 2PABA 4IOSD 4P23D 3HE6C 1ZIAA 2KZWA 3UTSE 5E95B 3QDME 5CLZA 4G1EA 1G7PA 2XQYG 4S0SD 4AG4L 1NAKL 3FL7A 3D06A 5H4YA 1SMOA 3TP4A 3LZRA 3NSFA 4YOKA 1NIDA 4X5XA 1PSKL 2JJWA 4Y19B 5DEZA 5E2TL 5EU7C 4Y8DC 2BHZA 2VDLB 2G9HA 4FRWA 1C8QA 1YCSA 4FLHA 4PJ8D 4UYPA 5F6HI 2YJLA 2ZT9C 3CFQA 4MRCA 3LRLA 1V7NL 4ZOAA 1I9IL 1U3YA 2PYEE 4PJAA 3VH8A 2ROXA 2WXNA 3QIUA 1W6WA 5LAXB 2XN2A 1U95B 3MRFA 3RWDA 4DWHA 1WAAF 4GO9A 4BUGA 1O6TA 5T5NF 4IRJA 3T3PB 5D1ZI 3GGWB 3IN0A 5D4HA 5E5MA 1HN1A 3HG1A 1OP3K 3L5HA 1BLNA 3OXRA 3IGLA 3W0WD 2BP0B 2R69A 4FLQA 2HRPL 4LSSH 2JKRM 2AJXH 1AY1L 5BVJA 3FSWA 3NCYP 4PRBA 3V0WH 2EDKA 2FB4L 1I9JL 1J86A 3RL2A 2C3XA 1EWHA 2F53A 3A4EA 4YHML 3WEXA 2N0MA 3ZTNH 3WIFA 1ZHBA 1TF4A 2JNZA 5KSAD 2BPBA 4G3YH 4FQJL 2WB7A 5CZVH 2Q6WA 4HH9A 2J88L 5HHQA 3ZDZB 1D5XB 1VSCA 2C1OA 1B0RA 4LSPL 3Q1EA 2JKXA 2F2HA 2Y4SA 1HZHH 3T65B 3FTSA 1DZBA 5C0BB 3JSSA 5ACMA 3ZDXE 1HEJC 2M26A 1U8IA 2D3LA 2K7PA 2NSQA 2YPLE 3AT8A 2Z31D 3ILEA 4NQDB 5EU6D 4WWOA 1FAIL 5DUBB 2Z35B 5KAQF 1L9TA 1FVCA 3RI5K 2EDTA 2ZPKH 4A2MA 4XO3A 4XPBH 4O58L 2AXGB 1IFHH 1YPZB 3C12A 4JRWA 2XZAH 2C9SA 3HNTL 4PBXA 2R0ZH 1CFTB 1JE6A 1IAII 4XHJD 4PRPB 4LIQH 5DO8A 5F0PB 5FW6A 5ILTH 4R5XA 3MRQA 3UOAB 4RAVA 5DT1L 5BUGA 4BKLB 4OD3L 5GGSY 3JV5A 2HJFB 3QUZD 2A9MH 1EUUA 3HUJF 4ZFZB 5BRQA 6CGTA 4UMSA 2VLJE 4DKFL 4ZW3A 2EXTA 3EGSA 2HKAA 1HL4A 1S6NA 3B43A 1PDKA 3G6DL 5LGKA 3G5ZA 1NIBA 4LSUL 4K8RL 3QO0A 2GFBA 2BSTB 5LBGA 5DJZB 4YR6B 4WVRA 1T1XB 2TAAA 1DFXA 1NCJA 1OF0A 4QRUB 4FHJA 4ZQKB 1ZLDA 2G4GA 2BS9A 4O51B 3IB4A 3V0DA 1NQBA 1FNLA 3CPUA 3TV3L 1AO7E 1G9ML 4L18A 3D12B 4BFOA 4WUUE 1G7JA 4JQIA 3DC0A 3DV4A 3EADA 1QA9B 4C56E 5D2NA 4PVLA 4H25B 3HNSH 5DD6B 1S9VA 3QR2A 2AQ2A 2G3XA 3QA3B 5ICXA 1BPLB 4QHMA 1TJXA 4TS6A 1L4IA 2VR9A 3GZKA 3I2CH 4KO5A 1QLRB 1DSWA 1QNZH 4IKKA 1UZGA 4KY1L 2YXVA 2EYTB 3QS3A 4FLOA 3C5XA 4LCUB 5EPMB 3I9PA 3BE1H 5TFSL 4NQSB 3C60B 3II3A 4X42A 1AR1D 5LCVH 1Z7JA 4GXUN 1HIMH 5FW8A 1DFBL 5IJKA 1E8XA 1LO3H 5JPNB 1RLBA 4ZFGL 4QXTA 1MLBB 4WK4B 1IC7H 3EBAA 4LCWE 2VDMH 5C0RH 4UT6A 5TDOB 1EDQA 1MI5A 1VFAA 1BIIB 3O3AA 5TE4H 2XTJC 2GCYA 4PRIE 4Y9EA 5GISL 3LPGA 3ARGC 3HVDA 3VWKA 4R0LA 4HOXA 1JZEA 4HAKA 4O5LH 4TSCL 3O3EA 5MHSE 1W2KT 5HD8C 1OAYH 1D5IL 5D7IA 5FCSH 4E5XB 3NIDE 1S7WB 3CFTA 5D96C 1YA5A 1BFSA 2EO9A 1V3LA 3MJ7A 4FG2A 4UTAH 2OYKA 4JHVA 1JF1B 2IH3A 4FLSA 4PGCA 5EN2A 5JLZB 3OKNA 1CURA 3V6FB 4GQPH 4JDEB 4PSPA 4DUXA 3REWA 3GZPA 3QI9B 3VFOB 3WUWB 2XC8A 4QY8B 1U8MB 1G1YA 2WZ0A 1JFQL 1FGNL 1XH1A 5KSVB 1D7FA 3BEVB 3CBRA 3GXNA 5E24E 3RUGB 4K3EH 3T0BA 4FEMA 3VE0A 4ICWA 3I6SA 1L7TH 1AQKL 4UT7H 1B2WH 1JNLL 3FB6B 3RVUD 4TSBL 3ZW3A 3NZHH 4KDVA 5SWSE 3QUXB 4XP1H 4WI6A 2ALAA 3LDBB 2B4CH 3PGFL 5H4ZA 4YDJA 3INUL 3L4CA 3Q3GA 3IJ8A 4Y4FA 3HI5H 25C8L 4R4BA 4N26A 2IANA 4D0DA 1YPZF 4MQ7B 3CH8A 5FK9B 1Z6JT 5BZDB 4I0PA 4AM0Q 5JIPA 2C9UA 1B6UA 5J13B 4L4VE 1DDTA 4U6TA 1GZPB 5J8OA 2HLEB 4HAGA 1VDGA 4Q97A 1PZ3A 4IMLB 3SD2A 4MDIA 4Z77B 1I8MA 4KVCL 4QRPD 3KPSD 2Z91A 5I28A 1SLUA 3LRHA 2P8PB 3ET9F 1Z9OA 2QKIC 1C1EL 4MDJA 5T1LB 1BZ9B 3FH8A 4S1RL 1MFNA 1U8HB 3EGXB 1KJ3H 3E6HB 3LQMA 5DVNA 4F15B 1KMGA 5DRNA 4J3OF 2CKBA 1PTZA 2NDFA 4N2NA 1KPVA 1YMMB 2VL4A 5CBAA 1YVLA 2OR9L 1XQ4A 1PQZA 4PRHD 4Q52A 4AENA 4K5OA 3I85A 3E7JA 2ADIB 1BMWA 3CXFA 4I9WE 4L3EB 4HHWA 1KNOB 1FV1B 1N2RA 4Z78B 1NM4A 1B4JL 1ET7A 3QFJA 3GXIA 2BVYA 4PRDB 4TQ8A 1N70A 4HPYH 1V3JA 1DANU 4M61B 1DEEA 3IDGA 4OCXH 1HAWA 3EOYG 3IGAB 2FYYB 3BZEB 3MRMA 3E8UH 3BN9C 3WTWA 5D7JC 1JYVA 1IAKA 2J8HA 3B2VL 3ESOA 4UAOB 3KPNA 4QF1A 1E7VA 4ODVL 5E8OB 3HW7A 2ZUTA 4Y9CA 3IJHA 5F9OL 5E94B 3FRUA 1J05B 2DM2A 2ZOLA 4KK9C 2QR0B 4F7PA 5AW5B 5H94A 4IU2A 2ED7A 1A1OA 4XN9A 4QOKA 1E4JA 4PD4J 3F04A 5CUSL 3CHOA 3U7YH 3DUSA 4PJXA 1M6OA 2Y3AA 3QJUB 5I17A 1QFUH 4DEUA 2EP6A 3I6LD 4J27A 3VVVA 4ZUSA 4E36A 5E03A 2K7QA 4BK5A 1ZA6A 2DW5A 3B5HA 5HGGS 3TPKA 4YDLC 2R51A 3BLKA 2V2WB 2XDHA 3T0ED 3GSXB 1KYOK 1X5GA 3AY4C 2P1YA 5IF0A 4J3OD 5BRZE 1P7BA 4PTTB 3EO0B 2IC2A 4YIQA 2J7LA 4DP8X 5DJ2A 3WIHH 1G7IB 4GG6B 1YNTA 5D7LB 3I50H 2ATPB 4QDGA 3CZJA 2DMBA 4ZS7L 4GAYB 3VXPB 4KV5E 4JFZL 3L3OB 1LE5A 1KC5H 3VGGA 1DDHB 4FC3E 2APSA 4I48A 4XT1C 1ETZB 3RA7H 1HXKA 1BZ8A 1U6AH 4XN1A 5IUSA 4QRAA 3BKCL 1EQWA 3FQWB 3GSQA 3LKQA 3LVEA 3FCBA 3X1NA 2AJYL 3LS5L 3MXWL 1M7XA 1EZLA 5IEHA 3S36L 4AQEA 4NKMB 1J5OL 3ZTJH 3RUGF 4XRCB 2EUWA 1D9KA 1G7HA 2J6EH 3GKWL 5DRWB 5C07A 1IAIL 5AAWA 4NS0A 3DJ9A 2Y1YA 4XO8A 2HKFL 1SXAA 2XG4B 3D4YA 4W9GC 2ZSVB 1QUNB 2MTAA 2J20A 4X6EA 5DD0L 3S37H 3UC2A 3VGHA 3WKQA 1G9MC 2FWSA 4I18A 3FQRA 1M42A 4IOFC 1JBJA 5C0CB 3X1FA 3QUYA 2X42A 2GY5A 2D7OA 1DBKH 1YG9A 4WJKB 1FNFA 4DN4L 1BF5A 1JOIA 4HCRA 1R3IH 1M6UA 3W2DH 1KGYE 2NZ1A 3DWTA 3FT3B 3NPSB 4LRIA 3ZTDC 1QASA 4MB1A 1CL7H 3ZGIA 4R8WH 5FWQA 4U1MA 4A7GA 3TT3H 1RK7A 2FBJL 5CINH 1VPOH 2GT9B 3ZUNC 4YHPA 3FSOA 3BHBA 2VXVH 3VWJA 5EZIL 2KUTA 2PPEA 2DV6A 5GZOC 4AIZA 3C5SB 2CG9X 2MNJB 2BY1A 3ZQXA 2VAJA 4E9RA 3L8QA 1GY1A 3D7PA 3EO9L 1ZWIB 5DU7A 4LSQL 1UACH 2H8PB 1CF8L 4LAQH 4U1JB 3SDCD 4AEFA 3CK0L 4QXGH 3N43F 3VXNA 1MHPH 3ETSA 3RPBA 1TFHA 4MLIA 2NMSA 2NY0B 3IPEA 4I5BB 4FZ8H 3RPKA 2CGZA 1NA8A 2DQDH 1DR9A 4F8TA 1TVDA 3RKDC 1EXUB 4LSTL 1U3JA 2YGQA 2ZSWA 3FFOA 4L3CB 3WNJA 3KAAA 4WGKA 2XV2A 4PR5B 3ZXAC 2Q7NA 3PU7A 1MKFA 5FGCB 5BMFH 1E30A 2AK4D 2OYMA 3ZT6A 1EEUA 2VMEA 5AVRB 1SN5A 4YHKL 4E9VA 1RHFA 2Y22A 2Y7SA 4RWYH 1PG7X 3MLSL 3OKOA 5JZ7C 3ILQD 1I7RA 4PV8B 3TFKD 5ISZB 3KDMA 3QJHB 1M2VA 4MB3A 1TQTA 4ZAKD 1Q94A 4JDZA 2XFGB 5DD5H 2OJEB 2J5LB 4RESB 2NXZC 4J4PC 3OAYH 4NQED 1RIVL 3N0PB 1MN4A 4JHWL 1OGTB 4N2FA 1HE7A 1LO2L 1U8PB 4GG8B 5FYLH 3SPHA 1THAA 1CIDA 1H3VA 3HZVB 1UQSA 1RUQH 3MXVH 3V5HA 2WWMD 4OFYD 4PJCE 4WFHE 4IRSA 3JV4B 2XXGA 3HFFA 2YFNA 1E4KC 4N9GB 4ZNEA 3HAEG 4N1EA 4Z7NE 1DJIA 8FABA 3ULUF 1WT5A 3HG5A 1FO0L 2AJVH 3P40A 3ZE1B 3FMGL 1QI3A 4NP4H 3SOBL 3H7BB 3PHOA 2EEBA 1TJGL 2IAAC 5FCUH 4BXVA 3U0WH 2H3NB 4IIZA 3OTTA 4X8CA 1DUYB 1T04B 5I1IH 5E8PA 1MVUA 3OD3A 1BAFH 4PJAB 5FYJE 35C8L 4AMKL 3EXJA 1I1FA 2DKSA 3QXDB 4GG6F 5FGSA 2QSQA 4FFWD 3W37A 5L2KA 1OCWL 4F33B 4QTHB 1J8KA 1N10A 5C08D 3GUFA 4Q6IC 5IQMA 3HG1B 3UPRB 4MWFA 1AOHA 3RWFA 3OXRB 1KENH 2NW3B 4OAWB 4XVUC 4GOSA 3DX7A 3MCKA 2NQCA 1ZHKB 1GGCL 2FJHB 3C6LC 4P4KA 3GZQA 2R7EA 4OGAD 5E99L 4KNSA 1BVKB 5GS0D 4YO0A 2Z93A 5EUOE 3VNZA 4ELMF 1T2QL 3FTUA 1RJYA 2QVIA 2LHAA 1LK2A 1SEBA 1SXNA 2OJ1A 1HEZA 3PLYA 4NN7C 3V5KA 1J9CT 1BVZA 5B3NA 4GP4B 1DQQA 3HI6H 1TTUA 3SE9L 3GINA 2HWZH 4D9RD 3ZKND 3LZPA 4NYLA 4YSQA 4WI5A 5T3XE 1JK8A 2XWJA 4HGWA 2I9TB 3SKOA 2Q9OA 2DQFA 4UQCA 2M8XA 4ZXBB 3ULUD 3SQBB 4EOWH 1QHOA 3SPGA 1XFPA 2DLEA 2NYYD 4PWIA 2WQVA 5E4EB 4HU2A 1I7TB 5EC2A 1CXHA 3O4LB 1DJWA 2OTWA 1JXDA 3L9BA 4G5ZL 4M7KL 4ZMYA 1JPTH 4N1HB 3KYMB 4XMLH 3KPPA 3S35X 1F8TL 3VQMA 3GIZL 1JK9A 4GAGH 2W81C 4GSUA 1MWAB 3CPLA 4JZNB 2PW2B 3WOVA 3VB9A 4XMVA 4EBQL 3ZQ9A 1WGVA 2WVSA 1W72A 1DLHA 4F3FB 2EXWC 1JV5A 1DQLH 1EEQA 1XGUB 1YO4A 2JB6B 3QO0B 5ITBL 1TNNA 4QTIL 5GGVL 1QSFB 3CDGA 4HD9A 4WV1B 1R5WA 4MJ4A 1XEUA 4XN2A 3S5YA 2CBMA 5L8LB 1QOKA 2XWBB 3VXSB 2W38A 5TK4A 5DD3L 3EOBA 1T21A 3PDOA 5JHLL 2DWYA 2VR6A 1D3CA 5KEZA 1CD8A 4N2MA 3SDXA 4PRAA 4GEJA 1A7PL 4OLZL 3GIVB 3WFBL 1L5GA 5EEZA 2D7TL 2ODHA 2P80D 2X44D 3OSVA 3UBGA 2AGJH 1JPSL 4CAGA 2HKHL 1LEKA 3VFRB 2W1NA 5B38A 5I1AB 1H3UA 5FKPA 2P43B 4F8OA 3TONA 1D5ZB 4UB0L 3GEWB 1RZGA 4MMZB 4W6YB 2FX8H 3VFPB 1PCXA 2KZBA 4G8GD 3RDTA 1M05A 1NKOA 4YSEA 3X3FL 1RZ7H 5B1JC 3BPNC 3HB3C 3FUFA 2DEWX 2NY5C 3IXAA 4X4ZA 2WXQA 5DMGC 4X6DB 2NCMA 1ZVHA 4TMPA 1YHPA 1C5BH 1DO5A 3PWPA 2K1MA 3KR3L 5I1DB 5EV7A 1YN6A 5GSRB 4OD1L 4ETQB 3T8XB 1JPEA 4MNGB 2WZ6A 3FCTB 4M6OL 1L9NA 2I7SA 3FU6A 2HUEA 3OJDA 3VVWA 2OR8A 5HYJB 2OS7A 1XZ0B 4K71C 2MCPH 4MMYA 5CJBA 5C7XL 5FEBA 3X3GH 2XKNB 2QMKA 1V55B 1CTOA 1E2VA 2FJFB 3T9WA 4JFFE 1AGEA 4FABH 2LVCA 3MGOA 4PJAF 2OCJA 4WEUD 3CX5J 5B1BB 1RUPL 2VC2B 1HDMA 1KV7A 4FLRA 1RIHH 5ADOL 1G7LB 4OD2A 2BNRE 5AVSB 3G6JE 1KPUB 4FXKA 3GHEH 2X28A 3A6CH 4H0GA 2BNQE 5D7SH 2F54A 5SX4I 1MFEH 4OJFL 2C3VA 3UACA 4PW3A 4IK6A 1FORH 1Y0LB 5FC9A 5JA9A 2N1KA 2ITEA 4HUCA 4PGBB 2VDKL 4RETB 3HZMB 1JNNH 5CSBA 1BFTA 4NRYA 3KHOA 1G7MB 1NH6A 4L9LA 2HX7A 1EFXD 4PJ5A 3KGRA 4GEIA 3F58H 2AEOA 4NIKB 4R26L 4XNYL 3T1WA 3IMTA 4MBOA 1T4KB 2YSSB 3S5LA 4ES9A 4R4FL 3V9CA 3WO3B 4B6ZA 4ZK8A 3KLAA 1BXAA 3AXHA 5KYUA 1OGAA 2CO7A 1UA3A 1OANA 1QEWB 3CLEL 3KW8A 3L3IB 4HIQA 1BM3L 3QZWB 2QDWA 3EH1A 4H8UA 1TG8A 4WSKA 4X6CB 1IGYB 1M7IB 4EQ3A 4GKSA 2L7UA 4TXVB 3MNDA 1QSEE 1Z5LB 3N1PC 4OIFA 5EU5A 4DOHE 3JV0A 4F58L 1ZGLM 1IJ9A 2Y06H 5IBLC 1EJ6A 5GS3A 5INDB 2ZUUA 4JG5A 4WUKH 2CDGA 2W0FA 4M03A 3LRGA 4QRRB 4PJHA 1S7VA 2LV4A 1T89C 3OVUB 4K9JA 3GMNB 2PTTB 2UVFA 3HC0B 4IS6A 3ARBC 4LESA 4ODXA 3QIUD 1AD9A 1I8MB 5E6IA 4PWGA 2Z91B 2UX6A 1HX0A 4IRJD 3TEXA 4GKNA 3MV9B 3RVTC 2CR3A 1F3JB 2HFEA 2ED8A 2ZUQC 4HD5A 1YNKH 2HP4A 4LVNB 3ZUCA 5C0IB 3ZRFC 2F61A 1HHIB 5LQBH 4OVUA 2GJJA 3ZZQA 1R0AL 8PAZA 1IKFL 1N59A 2VQUA 1UURA 1IM3A 1N9PA 4HUKB 1C16A 1MW1A 2F53D 2R83A 4A38A 1ACCA 2L3BA 1EA9C 1WJ3A 3UJJL 1QRKA 3CVIH 5MEOA 2OZ4A 5CCKL 4IEFA 4LRNH 3NJVA 5EZJA 4LHUB 1E5UI 4AIEA 2A6KB 1CE1H 4M6AA 3RWCA 1JCKA 5DRXB 1DEEB 3QIBC 4IMKC 2WLZA 4OSUL 2YR3A 2VXTL 4MJIB 4R7LA 4AQ8A 4FQIL 4FNUA 4L5FH 4UQ3B 3TZVC 4B0MB 4N2AA 2H41A 4NWUL 4W9LC 2GK0A 2CJ3A 1ZHNB 4ONHB 4RMBA 3KZ8A 1GY2A 1RJZB 5GHWH 3VFSA 2IXQA 3KPNB 1NAML 4IM8A 1JDCA 2J3SA 4IKJA 2WUBH 1JVLA 1PU0A 4HFUL 4NQCE 5DK3A 5EOQL 5HHNA 4AVIA 5I0XA 2ZOLB 2RCSL 4PWEA 1A7RL 4F7PB 3MROB 4FMFA 4GUCA 1WDAA 1UM4H 4PJDA 5JXEA 4GINA 3NRPA 2VERN 4JN1L 2VQ1A 4LP5A 1BVOA 1FYTB 3CFUA 4PJXB 5I5IA 3VFVB 3M7FB 1WV7T 3I74A 2IBBA 1BQLL 2H2SC 2RACA 5CEYB 2IGLA 4P9HH 2X2JA 2WBJB 1DBMH 1X6LA 4IKNA 1RPKA 4IIQA 1O6SA 1KTLA 3GJEB 3NJIA 5AYUH 1JZ4A 4RZCB 1UM6H 4Z7QE 2X2YA 4FQQA 4S2SA 4JZOB 4KJWD 3ELAT 2CA3A 4LSVH 2YC1B 1A3ZA 3LEYL 1KCVL 3B9AA 3VJ6A 4UTBA 5E4IA 1FG9C 1X5LA 4YHZH 1UB6A 4NNYB 4D7PA 2P8LA 1I53A 5D7IF 3VFMA 4ELKA 4FFVC 3DX9A 2YMXL 1LE5B 5L7XL 3LD8B 3NACL 5DSCA 4OZHE 3VFTB 3K6NA 4QCIB 3WL9A 1LQSR 3VSQA 2PP9A 4XODA 4OF5A 1P53A 3LKNB 5DK2B 4YXKH 1RURH 3C2SA 4DAGH 3BI9X 3Q2CA 1DBBH 2JCCA 5F2FA 2CAKA 1SY6H 1BBDH 3R06A 3FH7A 1VFOA 1RZJH 3ULAB 3WTVA 4B9YA 3MN8A 4X6EB 1OVZA 2W07A 3FQRB 1FNHA 4OV6F 1SBBA 2EE3A 3BZFA 2YD8A 1G5AA 3K1DA 3SYOA 3UJIL 2O6PA 4GMTH 4LKXB 3RU8L 4F2FA 2J12B 4HT1L 1YEIL 4QRSA 4XCCH 1T03L 2BXZA 1BXUA 1MI5D 2PF6A 4YHPB 1NBCA 3TWCL 2NNFA 4EUPH 1FF5A 3NZUA 1FGVH 1Y7VA 2DPKA 2FRGP 1KT2A 2Z4QB 3VWKD 4BV1A 3D0LA 5EFIA 2G3ZA 1XF4B 4YFLF 2QJDA 2AC0A 1TJMA 3CHRA 4Z6AT 3L4WA 4KMQA 4BH8A 4LO9A 3FS9A 3QQDA 1GOGA 2YXMA 1GMIA 1NGPL 3RIAF 3TU6A 4BIKA 3OZ9H 4JO2L 7TAAA 1PZCA 2LE9A 1FPTL 2AMGA 2E86A 3BKYH 4BFJA 3CH1A 3F7YA 3L2LA 4KUCF 1KJ2H 4XBPA 4RAUA 1USQA 3O6FA 1V10A 2B8OT 4OCLC 4B53A 2YUZA 4ZUUA 1SHWA 4JO5A 1B0GA 2MJWA 3VFGL 3JWOL 5JUEH 1XIWA 3UMTA 1ACZA 2H1XA 1QHPA 5D1XB 3Q0HA 5I1GH 5LXVA 1W0VA 1P4LA 4NWTL 3MV8E 4PLKD 4F2ME 3VRIB 3ROLB 4JM4L 4O02A 3RIFF 1OAXL 1PVHA 3RNKA 5T1DL 3V4UH 2P45B 4ZODA 5JIDA 4L8CB 2DQCH 3EHBB 5H37A 4EJ1C 3UCRA 4HP5A 3Q6GL 1L0PA 4Y4FD 2FO1A 2DQUH 1MREH 4HUWB 2IAND 4LARL 4Q0XH 4QO1A 5EO1A 1E3ZA 3DRTA 5D6CA 5HHVL 5C0EB 2JTDA 4TLUA 4LBEA 4I0PD 3VRJA 4HEPG 1KIUA 2WLIA 2VLKE 4Y7OC 3NH7L 1JWMA 3N9GL 4KPHH 4A39A 3D34A 1CB4A 4NP9A 2QPDB 4X7SL 1W15A 2JKLA 4PJXF 5D9SA 5A2FA 2JH2A 3OQ3B 2NXYB 2VLRE 3BMVA 3P77A 5DJYB 2XRAH 3AG4B 1M9WA 4XPTH 3VG9B 3DYMA 1JHKL 4B5ZA 4X98B 2E9GA 4AM0A 3OMNB 5DF0A 5AOKA 4DNLA 2N4IA 3DX8B 1NLDH 3HC3H 4PJEB 2WOYA 2AI0H 2IPUG 2K4AA 3ARGA 3BDXA 4A6YB 4YXLH 3SODB 5IW6A 5EIIB 1S9KC 4KUCD 1L6XA 3H9HA 4ODHL 5FAAA 4JM2B 4F2EA 4YHYB 2IWEA 5I1KL 2Z0BA 4Y7MA 1YNTF 2RQEA 1OAUL 3RX5A 1R3KA 4MS8C 5C0DB 4TQEH 3D39A 4MXVF 2DM3A 1J1OL 1YEKL 4LPWA 3MNVA 1YEWA 3QFJD 4TN9A 3GBEA 5SX5H 3OR7A 5JW3L 2CRYA 3BP7B 4N9OB 5HHOB 1U8NA 1KB5A 3AWGA 1CTMA 1F4YL 4Y1AA 1UTDA 2BHYA 3CSYA 3SDYH 1AVAA 4CVXA 5CEZH 2ZF8A 4OZFB 4AE0A 1KXQE 2CDEA 4PJ7B 2L7QA 5DEFA 1QRNA 4BQBA 3NZSA 3B7SA 4AYDC 4HF5L 2L7EA 4U6HB 1CGYA 2VUYA 1NCCH 4QOKD 4UOW0 5AOLA 2XN9B 3UAEA 1UXSB 5FYKH 1P0SE 2VIRB 5DZVA 3GBNH 1MUJB 1RQ5A 4ZTPL 4TNWF 3BAYA 2D8KA 1J10A 2DQFB 3SBPA 2R23A 2YN5A 3T2OA 4PJ9C 5EOCL 3V95A 2E4FA 3QYMA 4A7QA 2SEBA 4OZGB 2AQRA 2XI9A 1D7BA 3LEVL 1WP6A 2OQJB 3L1FA 3Q8AA 3KGSA 3VQ1C 1OK8A 3MRJB 5B4MD 4C4KT 2Q2LA 5KVEH 4H2CA 3ECQA 4DO6A 4RGNB 3OHXA 1CICA 2BSDA 4Y5YA 1JZHA 1OL0A 5I18L 4G6JL 4LVHC 2MFNA 3B2UC 1UASA 2IJ0C 5HPMA 3V4VL 1DCEA 4NO2B 4Q6KA 5FYJL 4X7TB 1NCTA 2WJ7A 2G75A 5EBMB 4NBZB 3JWDL 3AACA 4AQ1B 4GMSL 2WLNA 4Z7UA 3VA2C 3VXQB 5KBLA 4YWGH 4D9QE 1SJMA 3QJSB 3L2MA 4HKJB 2H6OA 4PREA 4P4RA 2CLRB 4Z7VB 5IB1A 3ROOB 3H6JA 4YVNA 4AGLA 1D9KD 4OGQC 5C07D 1YMHB 1NMAL 2RFXA 4NAMA 1ZLEA 4PRAB 3R19A 4QRQA 1OW0C 5C0GA 5HGBA 5CJQH 2HT2C 3IJYB 1DBJH 3ML8A 5E6ZA 1F90H 4OZ4A 5H2BA 4E41D 4XNQB 3BWSA 2X6MA 2DBLL 4FJZA 2BX5A 4QRFA 3KPOA 3QUYD 1YQVH 2EDXA 5I8CA 1HE8A 5TE6H 3ZKXB 1Q0XL 4FF9A 4GXVL 2CGYA 2E7DA 3LSOB 5EZLB 5L4IA 1D2OA 3ZKSD 3T2PA 3EFOB 1RZGB 1XXDC 2EIBA 3QPXH 3BJLA 3NP3A 1P7KA 4HKBA 5T3ZD 4JFOA 1QTPA 2UZPA 2VTFA 3CSTA 3VWJD 1FDLL 3TTYA 3FF7A 5JIIA 4I0KA 1ZGLB 3RURA 1PG7W 4GW4A 5FV1L 5T3XL 2F7QA 4JQXA 1GGUA 3NDYE 2Q86A 3WSQL 2Y7LA 4WWKA 5IVXB 2FQEA 1ZLWK 1I3UA 5IFJA 3EJUA 2HVKB 3KPQB 4PS4L 1I3VA 1ND0B 1M1SA 1XMEB 2AKRB 2IPUK 2QHRL 3I6KB 3OJDB 2A74C 4MMYB 5FB8B 1ADQL 5DVPA 4YHOH 3C8DA 5DURB 1T5WB 1AGEB 2I60L 5L88L 3WXWL 1EHLH 1JGEB 3NSJA 4KQ3L 3MUGB 3C09C 2ZWSA 4FXKB 5IOPB 1I8IA 2ZXGA 5FA3B 4NNPL 4M3JA 2CM6A 1WBZB 4U3SB 1FG2B 1OALA 2DM7A 3HHRB 2MKWA 2CZNA 3U6RA 5KS9B 2H6PB 3NFPB 4P46B 1X7TA 1VIWA 4HZAA 1MCPL 3L9RA 1XCWA 3MNWA 1K72A 4Y19E 5IK3A 4WO4B 3Q2LA 4QUOA 3CVCA 1VACA 1BREA 4DPCX 1GMEA 5D93B 1AE6L 1NBYB 2HRHA 4M5ZH 1AI1H 2OI9B 3A24A 3NJNA 5JA8B 4IRSD 4NPKA 3TT1L 3MRCA 1B3JA 3OB0K 3VW3H 3T3PE 3WY3A 3MDJA 1MFBL 3BWAA 4GBXA 2FVNA 3GLZA 4PLOB 4XX5A 5DQDL 4CU8A 1GGBL 5J89A 3AS1A 4OLWL 1XTMA 5E2UL 4BEIA 5JORB 3WD5H 5GZOA 3CFCL 3MOAL 4OZGF 4N2GA 2L8AA 4K7PH 2AEQL 2WM0A 2Q3XA 5TH2A 1G6RL 5I1CL 4NCC1 4PCTA 5JHMA 4KKAD 1LTXA 2HRGA 1CLOL 3BOVA 3PNWA 4M3KB 2H0EA 4HWBL 4NXKA 4X6FA 3HVNA 3NCFB 4NUMA 3JV6A 2N7SA 2PYFB 5LUMA 1TLMA 5L2KD 4ZMQA 3EYVA 4J12A 3ZDZE 5HI3C 2NY2C 2H3KA 2Y6SD 2KLSA 1AQDB 5C0BE 3RB7A 1J8HB 4NQDE 4PP1D 3ARRA 3GRWA 5CJ5A 1CXEA 2ATKB 4WU7B 4JY4A 2DMCA 5JXAL 4P4KD 1N59B 5BXFA 1HINL 3GSRB 5C0AA 1YPZE 2WVTA 5A6IA 1YRKA 3SDXF 2HB0A 2IQAA 1QFWI 3IBOA 4C4UA 1BQ5A 4CMMB 2ADYA 4PRPE 1KJMB 2AZAA 3DSNB 4IEFB 4TUUA 4M1DH 1MDTA 3CDCA 1CQKA 3I6LE 4HX1A 3GXTA 5KVDH 1MH5B 4I0CC 3EFDL 1ZE3C 3L5IA 4J4PA 5CU9A 5DJCB 3B34A 3VFSB 2OSWA 5FIEA 3ECVA 4L05A 2X41A 2F5AL 5IG7A 3GMMA 2AQNA 1AACA 2WOBA 3INOA 1ITBB 5EOTA 1A3RL 2VSDA 4H1LH 2YKLL 3MBXH 2AQQA 2BIOA 3HE6B 3WJLA 4CNIA 3O0RH 1AR2A 1BJ1J 1MY7A 3NGBB 3NJLA 2EE9A 5IVXF 1KEGH 1O9WA 1WZ1H 3Q05A 4BJLA 1XZWA 2Y7QA 5BV7H 4H0HB 5KSBB 1KTLB 2F9BT 3DDGA 2B1AL 2EO7A 4WY7H 3RY4A 1Y18B 2A3TA 4FQPA 3HAEA 2AQ3A 3D5OF 1LVEA 2V3FA 3MNMA 3LVTA 3P4NA 2HT3D 1JZ6A 3NK3A 3DIVA 4AEHH 4MZRA 4I2XB 1ZSDA 3VFMB 4ELKB 3BH4A 4XO9A 5LBVA 2J2ZA 2VB5A 2VDQL 3SHSA 4U1GC 5JDSA 1QSZA 1JZ3A 1F2XK 2PW1A 5EDSA 4RRPG 5FHAL 3C6LA 1H8LA 2ICEC 4R2GC 2G4EA 5KS9F 1NCDL 4QHNB 1AYRA 2J21A 1JI1A 2K9UA 4AQAA 2VXSH 3GMPB 4LLDA 1CL7I 3GLDA 1MFMA 5DR5L 3FC8A 5F6IC 1OOWA 5JOFB 3TIEB 1N5YL 2BIIA 4PMFA 3QCTL 3GSOA 4XCNA 5KOMC 3E1F1 3RDTD 1YAIA 4PJFA 4FQXC 4JDVA 1ZT1B 3F5WA 2IH1B 1TJIH 2Z6FA 4E9XA 2R29H 1KG0A 2QELA 4LEXH 5GZNA 3S4SG 1UZ6F 4XMKH 3F7LA 4XP9H 3PWPD 4URKA 1JV2B 2G3NA 4Y2DC 1WAEA 4QRSB 3EJRA 3MRPA 4YX2L 2O6CA 3OBAA 1QKZL 4P3DB 1HH6A 4HULB 1IV8A 4ZT1A 1HYSC 4HV8A 5AZ2L 3AS3A 4ZMZA 2E7LC 1TKWA 1QLFA 3HPJA 3BIBX 3OXSA 3TEUA 4RBPH 1MXDA 5DHVH 1CBVH 2CK0H 3RI5F 4O4YL 3IKKA 1Z9PA 1WD9A 1BJ1H 3G5XB 3RUGE 1MRDL 1XD1A 2FNBA 3NAAH 1AXTL 3ZR5A 3QQDB 4RISL 2FH8A 5D1ZA 4FG4A 1A02N 5CIPA 5FLVA 4X4YB 5B1AB 2BIMA 2BOCA 5D70L 2QSCL 2F54D 3D3VB 2CJUH 3CH1B 1P5UC 4M7JH 3D50A 3OMIB 2R4RL 1R19A 4ZZFA 1SDAB 5IQ9A 4KOCA 1MRFL 4Y5VC 3CMGA 3N1MC 2NSMA 2GTZB 4JPSA 3SCMC 4PJ5D 4U0RC 3BUQA 2LLGA 4WEBL 1KN2H 1QFHA 5DO2D 3CN4A 2W65B 3KXFA 3L54A 1EAOA 2BDNL 1HILB 3C5JB 5D4IA 5HYQB 4XN4A 4RZKA 2JKSA 1VGEH 1OGAD 2Q76A 3HNVH 2NLJB 1X5XA 2A73B 3ATDA 3OQRA 4LHQB 5K39A 3PF2A 4AX3A 2DOCA 1H6UA 3SE3C 4K94H 2X9ZA 5B1JA 2VDNH 2AJZA 2CXGA 3GSNL 2VZ1A 2WLIB 3WO4C 4PJDF 3F3HA 3MGTA 4MD0B 3CIAA 4ENED 1ZV9A 1NDGA 1YMME 2JKNA 2LU5A 3MRNB 2WZPA 1FC2D 1A6ZA 1Z2KA 2MOGA 4YLCA 1S9YA 3TJPA 4L3EE 5E6ID 1JSYA 2BVOB 4ZX5A 5F44A 2DEXX 4ODUA 2Z8RA 1WGOA 2X0UA 3GSWA 4LNVA 4MJ6B 1VB9A 1Z9NA 3APMA 4FFZH 4TVPD 4ONFH 5L2JB 4HPHA 1P7QA 2ZKHH 4Y4KC 4U1HA 5K9KB 4E0RA 4OGYH 3H9HB 4FQ2H 4JG0L 4JFDB 3FTGA 1QBML 5J11B 1IM3D 4CN1A 3OR6B 2IH9A 5GQBA 5D96B 1JN6A 5AOZA 4GRWH 2GVYA 4MMXC 3UG4A 1FFOA 2PLTA 4D94A 1PGRB 4I85A 5FOJA 1OPOA 3WE1A 4NBYB 4TSAL 1L9QA 4D9RE 4Q58C 3ULVH 2KMWA 1DQDH 4OV5A 4N6RB 1C12A 3P0GB 1HI6B 3DETC 3L5JA 4WZ9A 2YAQA 2K45A 1OGSA 3ARFA 3GB7B 5IBUG 3CSYB 1PJWA 4DK5A 4KX9A 4F9PC 2SODB 2VCOA 2XBDA 2JCCF 2DWDA 3FZUC 1EPFA 3S34L 1NFIB 2APBA 4LPTA 4Z3HA 3WTUA 2ESVB 3ESVF 1I3GL 3FOMB 4DW2H 1MSPA 1LP9A 3WDJA 1IC5L 2VABA 3QZOA 5IB4B 5JXED 1DLFH 2F5BH 3BVNB 3NIGB 3KEDA 2WXJA 1KYAA 4OLYH 5HI4C 1XGQB 4GG6E 2P48B 5KZCD 5C7ZA 1EANA 5D7LE 4IBZA 3WTSA 3VYOA 3EOAB 5D5MB 4UOQA 1OSPH 2D3NA 3ARWA 4XNXH 1IAIM 4HUVB 2DLGA 2X4NA 1PEWA 3OJMB 3CHPA 2W60B 4MA8L 4DKAA 3AFLA 3HJEA 1ETA1 3ARBA 5SWZA 3MI6A 4HXBH 4QRTB 3RWEB 4W1TA 1FH5H 5DVKA 1E0OB 3CC5B 3BIAX 5T1KA 3QW9A 1GS7A 4KZDH 2EE6A 4UOW1 4ANVA 3FHQA 2X0WA 4XTRD 2QKIB 3DTDA 5HYSB 1IFRA 1MVYA 2R1YB 3H9SA 1QFWL 2TRHA 4S1DD 2GAZA 2ADJA 1YEEH 3LZFH 1S5IH 4JHZA 2J57A 4NQVB 1PX3A 2RQ8A 2JKWA 3QFGA 1FO0A 3N85L 3QXAA 5C0CE 5LHDA 4XNAA 2P5WA 4DPRA 4XXDB 4OJYA 3SE8L 5F7DB 9PCYA 3C9NB 1MLCB 1MFAL 5HHPA 4LLQA 1HSBB 1TYRA 3LY6A 5F1IA 1CU4L 4JFXA 5L4FA 1H3XA 1GZQA 4Y89A 3ZE1F 5JHDB 4XNDA 3E6FA 4N2IA 4PJBA 3WTTA 1A1MB 3A5VA 1Q38A 3U6XS 5EIVA 5BOJA 3TZVA 1YJDL 2ZJSL 3B2MA 4DK6A 3WIHL 3KPOB 4NUPA 5D7JB 5C0ND 3I50L 2CH8A 1EZVY 1NGXA 3A4FA 2BSRA 2EDNA 4NENA 1RCYA 2BVPB 1KZYA 4TQHA 4N6QA 1DCLA 2JJTA 1FNSL 4YE0A 2XA8L 3ECUA 4D0BB 3NRFA 2EEDA 2VQ4A 4P2QB 2ZXEB 3UL4A 2VO8A 1N4XL 2CIKA 3CHSA 2R0WL 1OZUA 3BSHA 5FGCE 1F6AA 1JGDB 4QGTA 3JWNE 4L1BA 5CFHA 2BRRH 4GT0A 3VQ2C 4LLUB 2D03H 2XWTA 1D5MB 2XZCH 3K71B 1CDHA 3QWOA 5GJSH 5ISZE 5HVHB 5A1AA 3KMDA 1PFOA 2WLLB 3L6FB 3O6FD 5I71C 3MBEB 2DJUA 1E6OH 4DVRH 1CL7L 2IPKA 2ZNWA 4R8WL 3GNML 2C7UB 3Q2VA 4D3CH 1CXFA 1YNLH 4PG2C 4X99A 3MKGA 3EG9B 3QDMA 1XIWD 2XZQL 3O2DL 4S1QH 1BBJA 3X14B 1DQJA 2VDOH 2ED6A 4KKRA 3DX3A 1BQHG 4PB0H 3SJVB 1CZ8H 1LDPL 4JVWA 1MNUH 4DN3L 3L3DA 2PYEA 4ZX4A 2NUPA 3ZE1E 4ZUVA 3QZMA 4QXGL 4N0RA 3CZUB 4YEEA 1R5IB 5CZXC 5JHLA 1VACB 2D3VA 3UG3A 4KQ0A 2DF3A 2ENPA 1C5DB 3H54A 3QXWA 4M02A 4PJAE 4YVUA 2VGLM 5CGTA 3K3QA 3LRMA 1U30A 4XB7A 4G7YH 5CEZE 5JW5B 1AIFA 5JO5A 3MRCB 4UTCA 3AABA 3V4PB 3AQXA 3M07A 1XAKA 2CHZA 3HG1E 1P5VB 3S2CA 5KJRH 4XC3H 1S9WB 2IMMA 2XTJD 4MA1C 1M9SA 1LD9B 3AQYA 3BSGA 3IDMA 2V17L 3ARGD 1C5CL 1I7UB 3SPJA 3ARDA 4EMZA 3GMRA 3MRDA 5AL8A 1K2DB 2ICCA 4LLWB 2RIKA 3GEFA 1R34A 6PAZA 3BZ5A 4KJPD 2R9HD 1AGFA 2YPLA 3JV6B 1VFUA 4CKVX 1XF2B 1QABA 2YXFA 3D39D 4M8VA 4B9ZA 2N7BA 1MIEH 4Z7WA 3HIZA 4UNTA 1EEZB 4RAHA 5AYTA 2JXMB 5HDOA 4B27A 4PI0A 3O3BB 1DBAH 1AZNA 3BT2L 5C6PB 2DQEL 1BJMA 4YBLC 2H45A 1SDYA 1U8OB 4Z0BL 1DJXA 4YFDB 4Y1AD 1ED3A 3VXUB 1IGTA 1FL5A 3IRPX 4Z7UF 1NCIA 3VFWA 5J4MA 2B4CC 2ENYA 1BQKA 3EDFA 4ZG1A 5DMJB 4OCRH 1IMHC 3D30A 5I1EL 1QRND 1U8JB 3O4LE 1S7TA 2Q8AH 4XH2B 4DKDC 2MMXA 1LMIA 2FT7A 3GHPA 2VLJA 3TNNA 2B08A 4U6VL 3TIDA 3ZMEA 4ZS6C 3IMBA 2QQKL 4P57A 4G8AC 3BVUA 3P4OA 4PVBA 2YRLA 2CLVA 3FCUB 3NK4A 4F57L 2AJSL 3WGVB 4OB5H 2NXZB 3OX8A 1ZLSH 4R90L 2GHZA 4Y88A 4Y5XC 3ZYJA 4NI6A 4JGNA 2VDLL 4OF3A 4H0LC 1KENL 4M62L 1AO7A 4H26B 3QWRA 1WRFA 4WUUA 1IE5A 3LJ3A 1QSFE 3NJJA 4XMPH 4C56A 2J1KA 2CO6B 4V1DB 1DN2A 3FHAA 4HGMA 4ODSL 4XOAA 1NSNH 1DQKA 1JHTB 3VXSE 1A0QH 1WBYA 1SLWA 1X7SA 3ZHNA 5I73C 3JYBA 3V0EA 5J9PB 1A14H 4BKTC 1QW8A 3D87B 1RZKL 1KXTA 1UB5A 1XL6A 4HEPA 5ID0A 1CICD 4NPYA 3NBNA 5AZUA 2IFFH 2O5ZL 2YRZA 4Z3IA 5CP3A 4R9HA 4V2BA 2HMID 3R4DA 4XGZB 4CGUB 2G0KA 4HHAB 2OYPA 4G9FB 4KUZH 4W9FC 4Q6IB 3P4NB 3ZK0A 4PCSA 2RD0A 1JZIA 1Z5YD 2A9NL 2PTVA 3RQ3A 3T2NH 4XPAL 5J1TC 3Q48A 1JRHH 2D2OA 3ORJA 1JYXA 4HG4J 1AJ7L 2HTKD 4WIQA 4LCWA 5J6GA 2OMZA 2W9EH 4PMEA 1IT9L 1PW3A 4XMLL 2G9KA 3L3JA 5DC4B 4R6UA 4X6DE 3I75B 4U1IA 1H3PH 4MNQB 3QG7H 4PRIA 5EEXA 4P59L 4OT1L 3F83A 4KROC 4C4KO 1GW6A 3EOTH 3BX7C 3LKSB 4NN7B 3DYPA 1KTRL 5EUKA 3B5TA 3TBVA 4DP5X 4MNGE 3MRLA 1SVZA 5FECA 5HYJE 3MRHA 4NZRL 1FC1A 4WFFE 1QBAA 4KI5E 3RWIA 5A3IC 1ZA3A 2EIMB 3GSOB 1ACYH 3C8KB 5HXMA 3U2SB 2QV2A 1XCQB 3EGDA 3NESA 2BXYA 2R8SH 1TVBB 3NCCB 3QAZC 1E5BA 2BHFA 3EJTA 4OFVA 4L0ZA 1PZUB 4I4WB 5EU4B 5D6DC 4PJ9A 3ZZ1A 4WWKD 1AD0A 3H53A 3LKOA 3DOIA 1WISA 2Q7YA 1Z9LA 4XVJL 1U91B 3IJ9A 3UTZA 4LGRB 4WW1B 1DSFH 1I8AA 1NAMA 3P0VL 1MQKL 2A1WH 5HDBF 1RU9L 1EEYA 2WMPA 4N86A 3HPJB 1HQ4B 4MAYC 3WFCL 5KOVC 5SWSA 4MX7B 4XAWL 3GJFK 4G59C 3K6FA 4C47A 2BW5A 3SZ6A 3NABH 5KYWA 4MNHA 5IBTH 3KYNA 3IF1A 4P5RA 5ELIA 3EFFB 5F9JB 2R1WA 1E67A 3EYSH 2YMTA 3GF8A 2GQHA 4P0DA 1YUHA 2YLHA 3O41A 1X7QA 4UDUA 4HIXH 1YYML 2ZOKB 2Z8WC 4X6CE 1JHLL 1JNJA 1A6VL 1QHQA 2FJSA 4L4VA 4ZW7A 1OTTD 1AGDB 1IM9B 2WIIA 3CN2A 3G5VB 5DHYB 4CMHB 4K8RD 5TJWK 3HMWH 5L6YH 2Z8VC 3RJOA 3TH4T 5E08L 5AQ0A 2FNWA 3EO1B 1OW0A 2D2CC 2EEFA 4CC4C 5GRJH 3IAPA 4BYHA 3RY5A 1FFQ