3FSWA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaaahaaam)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
b'ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCAAAAHAAAMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
molecule tags Metal binding protein
source organism Pseudomonas aeruginosa
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fswA00
2IH9A 1ID2A 2QDVA 2XVBA 4HCIA 3AZUA 4HCFA 4WKXA 5I6PA 2WSDA 3FSWA 2GHZA 1SFDA 2YAFA 2TSAA 2YAHA 1DYZA 1A3ZA 4DPAX 1GW0A 4TXVB 3WG7B 1TEGA 1UATA 4DP9X 3ZBMA 2YXVA 2JKWA 3AG2B 4QKTA 2W88A 5B1BB 1GS7A 2IWEA 3X1BA 1A4AA 1TU2A 3ERXA 1ZDQA 2PCYA 3OM3B 4NB7A 1E30A 2FT6A 1EZLA 3DTUB 3ZIYA 3T6ZA 5B3SB 1JXDA 4DP6X 2I85A 2GIMA 2XX1A 3UAAA 4YVNA 2J57A 3ASNB 3SBPA 2HX8A 4KNUA 2EILB 1OCZB 2IH8A 1JXFA 3FYIB 1SDDA 5B7EA 1IKOP 3S3BB 1WA2X 1JZGA 1NPNA 2CUAA 1OF0A 1AZBA 2NRDA 1AG6A 2BP8A 1KYAA 3BVDB 3HEIB 6PAZA 2XV3A 1AZRA 2Q9OA 2GC4C 5F7BA 4DP2X 3N2JA 1HAUA 1GSKA 1A4CA 1BEXA 1SHWA 1AZNA 3HB3B 5B1JA 1HFUA 1NICA 2B3IA 2GB2A 4PCYA 3PAUA 1NIAA 2XLLA 4ZK8A 3UABA 2VSKB 5D4IA 3KW8A 4P5SA 1L9SA 3FU8A 4AI7A 3U25A 4YL4A 3AW5A 2MTAA 3OMNB 2FT8A 1PMYA 2BW4A 3ASOB 3CZUB 5A7EA 1AS6A 1URIA 3X1NA 3FSZA 3V9CA 1CYWA 1XB8A 3SBQA 1AZCA 2YAOA 2PPAA 1YLBB 4RH4A 6PCYA 1ET7A 3FQ1A 3PCYA 2XYBA 2PPCA 2LLNA 5AZUA 1QHQA 3T9WA 2X87A 3T6WA 3GXUB 4HHWA 3C75A 5D4JA 1IBYA 2VW6A 3UADA 2J5WA 2PPEA 4W1TA 4W9ZA 2FQFA 3ZX1A 2QDWA 3X1FA 2DYSB 3ABLB 1ET8A 2IWKA 1TEFA 4A2DA 1AOZA 3WKQA 1MG3C 3IN0A 3N55A 4FA7B 1JOIA 1EHKB 1DZ0A 1GS6X 2CBPA 3S8FB 2AZAA 1KGYE 1BYPA 1KDIA 3FU7B 3FPXA 1BQRA 1AAJA 3CDZA 3X2QB 2E86A 5D4HA 5I26A 3T71A 2XWZA 4DP7X 2BZ7A 3JTBA 4HALA 1KDJA 1W8EA 2Y1AA 4YSEA 3EH5B 1AACA 3FQ2A 3EHBB 2N0MA 3OMIB 4A66A 2FQGA 2AVFA 1ZPUA 1E5YA 4N4YB 1WS8A 3H56A 3NJNA 1VLXA 3DIVA 4BWWA 1ILSA 2IWFA 2JXMA 1PY0A 2PPFA 2Q5BA 4KO7A 1X9UA 4AZUA 1KCBA 3NP4A 4DP5X 3CVCA 4Q89A 3QJVB 1NIBA 1FFTB 4G70B 1ZV2A 3ABGA 4G7SB 1PLAA 1NDTA 3NP3A 1KCWA 2WO3B 1E5ZA 1J9RA 1PCSA 2EIJB 3PAZA 4N8UA 1NIDA 1N70A 1OCOB 2BZCA 2I7OA 4BXVA 4FAAB 5I5JA 5LDUA 3CG8A 1ASQA 2YAQA 3MBWB 5E9NA 1N68A 1BAWA 2IDSA 4JHVA 2Y69B 4BDVB 1PNDA 1I53A 5B7MA 1SF5A 2BWIA 2HRGA 4KOBA 5TK4A 2OCCB 4E9WA 3JT2A 4YSCA 4KO9A 4QLWA 7PAZA 1OE2A 1ASOA 3ABMB 4KOCA 1IC0A 1ADWA 3S3CB 1GR7A 2PPDA 2FT7A 4BK5C 1V54B 1X9RA 5B1KA 4YVUA 1OV8A 4A2GA 5I6LA 1FA4A 1NIEA 2EIMB 1XMEB 1BXUA 1BQ5A 3V9EA 1BQKA 3PXLA 1V10A 2ZOOA 4HIPA 3S3DB 2FJSA 4X4KA 3MX0B 3AG4B 2PP8A 1QLEB 3OQRA 1JZFA 1SF3A 2AANA 4DP1X 5I28A 2VW7A 4E9TA 4YSDA 2IDFA 3OMAB 1OE1A 5B1AB 3QPKA 3NJIA 1MZZA 2UXTA 9PCYA 1NTDA 3NYKA 4G7QB 2IDQA 1NZRA 4A2EA 4F2EA 1NWOA 5PCYA 4E9VA 2P80A 1CURA 4CSPA 4KO6A 3TU6A 5TK2A 4MFHA 1ET5A 4G71B 2EIKB 3H4HA 2JFCA 3FT0A 1AR1B 2AZUA 2I7SA 4GP8B 2FTAA 2ZONA 1T5KA 1GS8A 4HCGA 1JZIA 1OE3A 2GSMB 3FU9A 1PZBA 2VW4A 2XV0A 4A67A 1OCRB 4HHGA 3QJRB 4G7RB 5PAZA 2OV0A 2PCFA 3IBOA 3G5WA 1GYCA 3FYEB 2BP8B 1A8ZA 2J56A 3KW7A 2IAAC 4NERA 2X88A 5ANHA 4KNSA 1J9QA 1RZPA 1W6LA 2CCWA 1RKRA 2UX6A 4Q8BA 3UGEA 3EH3B 3TASA 2YXWA 1MDAA 4DP0X 2H47C 5B7FA 1ZIBA 4BWUA 3NT0A 2AFNA 2BW5A 2HZHA 5B1JC 1PZCA 4HAKA 1AG0A 4M4RB 3EH4B 1A65A 3TA4D 2QT6A 2UXVA 4P5RA 4L0PB 4F2FA 4YSOA 3CVBA 3QQXA 1QNIA 5FC9A 1PAZA 2YAPA 1W6WA 1JZJA 2YAMA 1E67A 2XXGA 2MRYA 4GXFA 4JKNA 2GC7C 4DPCX 4AKQA 4K9JA 2ZXWB 3NSYA 3TBBA 1JXGA 1SFHA 5EHFA 2FNWA 4G72B 3DKHA 3TBCA 2GBAA 3QJSB 2CALA 1FWXA 1ETJA 2BWDA 3GYRA 3NJKA 1AIZA 2DWSA 2W8CA 1OCCB 2CJ3A 4F7KA 3ZDWA 3H4FA 4CSZA 3EF4A 4GY4A 1WS7A 4BXSV 2FWLB 1PLBA 3FSVA 4DPBX 2H3XC 1NPJA 4KO5A 4EF3A 2HXAA 1AS8A 3AY2A 4A68A 1BXAA 2R7EA 2XX0A 4DP4X 4E9XA 2VM4A 3D12B 2BP0B 3IE9A 4AKOA 2BO0A 5I6MA 3SQRA 4GYBA 2XV2A 3T6VA 3FSAA 1CYXA 1F56A 1XB3A 2ZWNA 4YSPA 2XU9A 1TKWA 4UAHA 4YSSA 3WI9A 4AX3A 3QJUB 2PP9A 5I6KA 2R7EB 1KV7A 4M3HA 4BDVA 3AG3B 3FU7A 3NJFA 4A2HA 5I6OA 1SDDB 3WNJA 3WNIA 3PPSA 1RZQA 2YQBA 1SHXA 2GI0A 1JZHA 1ASPA 4YSUA 1PNCA 2VN3A 4E9SA 3X1EA 1J5CA 5I6NA 1AANA 1M9WA 3CVDA 1JVLA 1RCYA 3UAEA 1BXVA 2DV6A 2HX9A 1JVOA 2QPEB 4GP5B 1MZYA 4GP4B 1IUZA 1L9PA 2PLTA 2OJ1A 1J5DA 2YARA 3GDCA 2UXFA 1PLCA 2PP7A 2WO2B 4E9RA 3NJHA 1NWPA 2CAKA 3BQVA 1IBZA 4JHUA 5F7AA 1J9SA 3UACA 2BP0A 4BWTA 1AZUA 2IDTA 2YAEA 3OD3A 3PAVA 2XXFA 2J55A 1SJMA 3IEAA 3PLYA 1AS7A 5I5IA 1CUOA 1HAWA 2TSBA 4ENZA 4E9QA 2VMJA 1M57B 1KBVA 2VM3A 1L9QA 1J9TA 1B3IA 2DYRB 1KBWA 3NJMA 1L9TA 1E65A 1L9OA 1XB6A 1L9RA 3T6XA 1ZDSA 1A4BA 3WIAA 4DP8X 2HX7A 3RYMA 2HRHA 3WKPA 1GY2A 4A2FA 8PAZA 3ABKB 1AQ8A 1R1CA 3QJQB 3QJTB 1WA1X 1BYOA 2FQEA 2A3TA 3L45A 4E9YA 2FQDA 4WTQA 5AKRA 2UX7A 1SNRA 3NSFA 1MG2C 4YSRA 2UXGA 1NINA 1JZEA 1WA0X 4AKPA 1V55B 4YSQA 3NSDA 1M56B 4YSAA 3NJGA 2XUWA 1ILUA 4UANA 3SBRA 2H5UA 5I5MA 3FS9A 3S8GB 1ZIAA 1GY1A 4NAJA 2DY2A 2HLEB 2EINB 3IN2A 3FQYA 4KNTA 4PAZA 1JERA 2RACA 3NJLA 1OOWA 1NIFA 3NJJA 4UF7C 5AFAA 7PCYA 3X1GA 5IY5B 2BHFA 2VSMB 3NSCA 3CDZB 2DWTA 1CC3A 1PF3A 3FPYA 4YSTA 2IDUA 1PZAA 2P80D 1WAEA 2QPDB 4HZ1A 3AG1B 2B08A
chains in the Genus database with same CATH superfamily
4L3ED 4BZ1L 3EJYC 4X5PA 1OSZB 5DYOB 4JFDE 1O7SA 4ZPVA 2VDPB 4U1LB 2J1WA 1YMMD 2IQAB 1U8JA 4WEEA 2V7NA 1PQZB 1P5UA 4XWOC 4E41B 3BIKB 1EEUA 4AGMA 2BY1A 1GGYA 3QNXB 5JHAA 5CEZD 3B34A 5DWUH 3ZL2A 4S1QL 4BFBD 3BZ4A 2WWNA 1JWUB 1S8DA 1MCOH 3AQDA 2CO7A 3ERXA 2DLHA 3QZWB 1QRNA 5ABAA 1MKFA 1V7NH 4NN5C 4DP6X 1GYUA 1TZIB 5D7KE 3KJ4C 3ASNB 3QUXC 4FYQA 4L3EB 3QYNA 4GIPD 2XVLA 1QG3A 1X5YA 1ETZB 3SODB 4WI0A 3KWWA 1G0XA 1CD1B 3FTWA 3HLAB 1UKSA 5A2KH 4KX9A 1G7MA 2K6WA 5I16B 5DJZB 1CMOA 2F2HA 1PX4A 4Q0XL 2VDMB 5GZNA 3SJVD 1JFHA 2GSGA 5LBSH 1T1WA 3QJOA 2PTVA 2R23B 3PWVB 2EC9T 3U6RB 2XKSA 5C08E 2HFTA 1GSKA 1BEXA 1CICA 1FVEA 2DQDH 4IMLA 4JM2B 1GZQB 4NPYA 2D7QA 4ODWB 2DH2A 1PL3A 1NC4A 2WTRA 3GZQA 4ONHB 1GAFH 5HDBB 4QJ5B 2YS4A 4HQQH 2XRAH 5E2UH 2PXYD 2ZP0T 3FOMA 3QB7C 1ADQA 1O6VA 5FLVA 4KJPC 3KPQA 2XZCL 4XXCA 3G6AA 1O6SB 2FYYB 1OGAA 3CFJB 1IE4A 5AKVA 3I6GA 4AGPA 3ZDXE 1XVSA 1KBKA 3T3PE 5BV7H 4Y0GA 1HOCB 4FFVC 4K4KA 1H5BB 2F74A 4E0RB 3TT1L 1Y1UA 4BE6A 3KPRD 1T7YA 1URIA 1XCXA 4X83A 4KZEH 5CP3A 5C3LD 1A1NB 2MKWA 2YAOA 1KBGH 1T1YA 1CXFA 3Q2NA 4PJFE 1FFOA 4RQQB 5C09E 4Z0BL 2YWZA 5AZUA 4H1LH 4KK9D 2FWSA 5K9QG 3MREB 5ENWB 4W9ZA 5IUCA 2V5YA 2BHYA 1KIQB 2ARJB 4JB9H 5CILL 3CC5A 1S5HA 3G08A 4HW6A 3V52H 5T3XE 4PJIF 4J3BA 2E9JA 4ORZC 4PR5B 4QHLB 3WKQA 1TVHA 4CGUB 1U8LA 2GYSA 1ZWIA 3FQWB 4LOEA 3W0WD 3T8XA 1UGKA 5EEVA 1Q38A 4RSYA 3M1OA 3S98A 2NZ9C 2PYFA 3L5JA 4M48H 3RL1B 4MZ3A 1AAJA 2X1XR 2P8PB 3X2QB 1CDBA 4HUVA 5IFJA 1ZJBA 2H2PD 1CIDA 5ID1B 2RBLA 1JV5B 4HEPG 3T2NL 2A83A 3OAZH 4WNSA 4QT5B 1CXHA 5I1HH 2BZ7A 2JXMB 4H0LC 3NCYS 2IANA 2HWZL 1VGEL 4APQD 1DHKA 3N42F 4JRXB 4PFEA 3REVA 4A39A 4HKXB 2VLKD 4A66A 2VZSA 4A7GA 5TDOA 2AVFA 3FBQA 3VX1A 1E5YA 1F3DJ 2LQRA 3KAAA 3ISYA 4L0ZA 1MDTA 1WGOA 1WS8A 3D69B 3EBAA 2ROYA 4RX4D 5C70A 1UKTA 2R2HB 4ZS6C 2IQ9H 1P5VA 2LW3A 3ZL4L 4WKZA 4GXUN 4Z7WB 4ZFFA 3QNYB 1V7NL 4HS6B 1CWVA 3DURB 3O9WD 5DZJA 3B3IA 1ICTA 3O11A 4S2SA 2DJUA 1JRHI 2Y36H 2CDGB 3KHQA 1NIBA 2D31A 4FZEL 3HG1B 2R51A 3QEGL 3OZLA 2HB0A 4FNLL 4GKNA 2QQNL 3OC5A 3T1WA 4RLDA 4HIQA 3RGVB 3QCTL 2B0SL 3UEQA 4JZJA 4P3WA 3WXVL 4LFHG 4WO0A 5CEYA 4TPRL 5LDUA 2EADA 5LBSL 4Z3IA 3B83A 3T3MB 4HC1A 1G7QB 2NPLX 5DJ0B 4BH7B 3GZPA 3TYFA 4E9WA 1OD7A 1U3ZA 4KO9A 3FT2A 1U3NA 2AQ3A 1ZT1A 2LT9A 1I8UA 4YBQC 5JW4R 4JO1L 3DYMA 3IGAA 3GDBA 2OK0L 3BWZA 3UTSD 5DURD 5FGCE 2Y9RT 4ERSL 3CHXA 5IG7A 2PO6B 5KBDA 2O61B 1U8OA 5FUZH 3U46A 1F1DA 1UM4L 4KZDL 1TJGL 4XAKE 5AD0B 3F85A 3DIFB 5CJXC 3ILQC 4FQLH 3ZDYE 1NKGA 5CAYB 3DVNB 5EZPA 1U8LB 4HK3N 4Q9QL 4KFZC 2QSTA 4PJCE 3WO4C 1IBBA 1MJ7H 5F3FA 2ZOOA 3MV8D 1U93A 5I8EB 4F8LA 4HPHA 1B2WL 2E9BA 1RPQA 2BRRH 4JLRA 3EJCA 4Y5XC 1BQLL 4E9TA 1FZKB 3VFOB 3GM0A 4QAWA 4U7SA 3RNQB 2W59A 5EBGA 4J2QA 1TQBC 4OR1A 2Z8SA 5AG9A 5EIQA 1FG2B 4N0UA 2ZAGA 5GIRA 1Z32X 4A2EA 3LKRB 5E00A 1NWOA 4E9VA 2EQDA 4H1LB 3N6YA 4NKIL 4Y2OA 2IH3B 3LIUA 4M5TA 2AEPH 4XN4A 1K8IA 1KN2L 2CJSA 4TNWK 4X6DF 1JPTH 4B53A 4H1LG 4OFKA 2GSMB 2CBTA 3NCFB 4A67A 4OJCA 1KXVA 2CLVB 3O6ML 4KDWA 4KPHL 4L37B 2GG1A 4JFEA 2IPKB 3WFEH 1BVKA 4I1NB 4R2GB 5D1QC 5HYJE 1WK0A 3A0OA 1Y1DA 3MLTA 4NO3A 1I8LA 3LIZH 3C2SA 5LLIC 3RAJL 5E4AA 3ATEA 2HT4D 3MLUH 2OMZA 2Q2EB 3ZE2E 3H0TB 1RZPA 2VC2H 4X6FA 2UX6A 3L95B 2YWYA 2DQEL 3KD4A 4UQEA 4MXVF 1YNKH 5CJ8A 2EICA 2EDMA 3OPZH 1ECYA 2OMNA 3OMZA 4EO5A 1LO3L 2O5ZH 3KPMB 2MKLC 4OD1H 4J3WA 2HTKC 4WQOA 1YRKA 3WY1A 4DQOL 4ODVL 2ZG2A 3MJWA 4QO1B 3UJJH 1BOYA 3IXTB 2ZP8A 1QW9A 4HZLB 5ICYB 4P2RD 3WJJA 4ELKA 3I9GH 4D9QE 3EDEA 4XNQB 1RP9A 1FN4A 2Y7QA 4EAEA 2FD6L 2YAPA 4UBDD 2GK0B 2VO5A 3VFUA 3KYMB 4GKSA 2JKLA 3W81A 4MGXA 2QFPA 3TBBA 2QFRA 3A6BL 4IIZA 2WP3O 3M8OH 4AH2A 1N8ZB 2VMEA 1QABA 3PWPD 3MNZA 4H25A 2CM6A 1EAPB 1FWXA 5AVQB 2XG5B 3ET9F 5EU4A 1H5BC 6TAAA 2XPYA 3HMXL 1FNEA 2FJHB 2X44D 3ARRA 3CK0H 2VDNL 4CJ1A 5BRPA 4H0IA 3TEUA 3PGFH 4OD2B 2UZXA 1YEHH 4OVUA 3W9DA 1D6VH 3C5SA 1NPJA 3MV8E 1INEL 1VPOH 2HT3D 4X0KA 4AV4A 3C08L 4PJEB 2JI3A 3AY2A 3BIAX 3NG5A 4ELMB 2N7SA 4JANA 3RDTC 4S11A 1ZGLM 4JDZA 1R9FA 5K1VA 4JFFB 4BFIA 1UZ8B 3LAFA 1ZSDA 4DJMA 3FB5A 2G0LA 4YXKH 3NAAL 2EUXA 5F1IB 1QFWL 1XB3A 2G2RA 3WL9B 4JFEE 5HYJA 1M05A 1ZT1B 4FE9A 3S96B 3D39B 3NQKA 4NHUB 5D1ZC 3HTLX 2X4OB 1G9NH 2JI1A 4OUUA 5BW7A 3BLPX 1BVLB 3N1MC 5AVSB 4U49A 2IGLA 4PGCA 3H3BC 5CNHA 3K8MA 1IBGH 1A6WH 2XQBL 1NUDA 5JR1H 3FQNA 3FQTA 3KVQA 5EO9A 2AJXL 2EDHA 2ATKA 2L7QA 1K4CA 4OZGF 4E9SA 5BQ7B 3VFOA 1WF5A 3VMPA 2CDGA 1X4YA 4IBQA 5EU7E 3UAEA 1BXVA 3TA3C 1VESA 1JVOA 1JZ2A 1TJIH 1SMOA 2YARA 1LNUA 2F19H 4KK5D 4IBTA 5E6IA 4GT0A 5JHBA 4JHUA 2ZCKL 4CNIA 2GW5A 3NDZE 4TVUA 1QNZH 5CLWA 1MJJB 5LVEA 1R3HB 4N20A 3CZFB 3HZMB 3L81A 3QG7H 4X8GA 3PLYA 1NAKH 3GXTA 5BVJA 1BD2B 2NXZB 4YL9A 3WNNA 2ADGB 2IPTL 1T5WB 4GI6A 3RG1C 3T4AB 3C8KA 2MH4A 1E65A 5C0CD 2QVTA 1YDPA 1P9MA 3W38A 4ABWA 2IALB 3FBKA 1YYLH 3BVNB 4YHIB 3HE6B 3KPMA 1UJ3C 1LDPH 4FJYA 1TJHH 1KTBA 2RFXB 4R7XA 1ZVSA 3OWRA 2RGSA 4PS3A 5E5UB 1BQHA 2D0FA 1BYOA 3QEQD 2R2BB 5IT2L 3R8BB 3SE8H 3UTPD 4PJBF 2Z92A 4P8QA 1E50A 3BOVA 4OJAA 2DL9A 4UT9L 5I1JL 3NH7H 3WS3B 1NGQL 5DRNA 1N9PA 4Y4HD 4ZTOL 3G6JF 5BZXA 5IFHL 5MEOB 3TNNA 5EU7C 1JRHL 4X9YA 4CMMA 4CUCA 1M56B 1JMZA 5EOCH 1NKRA 4D0DA 2XFGB 2XA3A 3MOQA 4A2MA 5I1AA 2ZKHH 2NT1A 3HCVB 1EEYA 4G6MH 5LN4A 1CDUA 2ESVE 3UTTA 4A1RA 1VDGA 3T8VA 1ZJAA 4P5KA 4YBQD 1UQSA 3TBSB 2WNXA 4U6HB 1OALA 3FW6A 1K2DB 5ESAA 2UZIH 5AW3B 1S5IL 1ULVA 2PMZA 1RUQH 4ZAKC 4NKQB 3TO4D 5IHZB 3KLDA 1SJHA 3OG4B 5DK3A 3NJJA 1MIEH 1HNFA 3AXLB 3Q6GH 5D2NA 4WDIB 4NENA 3ETBF 3MO1B 5CO1A 3FOMB 3VM7A 3LQAC 3WHE0 2JQAA 1E4HA 4Y19A 1VKXA 3HE7C 3W1ZA 4HZ1A 3MBXH 1Y0LA 1NBZB 2B08A 2YGQA 3WMSA 1BIHA 4P59L 3EYOB 3TL5A 5KAQG 2ATPB 5HTSA 3A6CL 2TSAA 4TLKA 4Q4EA 1A3ZA 5IW1B 3H2PA 4NT6B 1FSKB 2Y72A 1LXMA 4U0RC 4W6XB 4B9JA 4MCNA 3STLB 1CK0H 5DJYA 3IJYA 1UATA 2AMUA 5KUKA 3G9VA 1ZLUK 2IMNA 1KENH 1TVBB 2EE6A 2AJXH 1B90A 2FT6A 4H8WC 4KZEL 1LO5A 5DQ9B 1EJOL 2OI9C 2XC8A 1XF4B 3MBED 1LWJA 4GB9A 5FB8A 3RRQA 1NOLA 5T1DH 4AQAA 2NY5L 3ILPB 3US9A 4F7CB 2F74B 3FQWA 2F0CA 2IGTA 3NJXA 3SYAA 4E0RA 4IBWA 4QRRE 2WWKT 1UXWB 3MJ9L 1JZGA 1XEUA 3GTVA 3P02A 1AG6A 1I82A 1Z5LA 3VA6A 1QNZL 3HC3L 3MLRL 5BS0D 1EMTH 4HPOL 4X8JA 3M6DA 1FL5B 3GPEA 2Z4TA 1TENA 1YJDC 3O2DH 2G3MA 4JN1H 1DQQA 2R0ZL 4AQ8A 2Q2LA 3ETSA 4FTDA 1HAUA 2PWDA 2DQMA 1MI5B 1Q94B 4F7EA 1KT2A 5FOBA 4KAQH 4H8UA 2B9AA 4ZW8A 1EEYB 3RA7H 1H8LA 2W0KA 1BVOA 3Q5YA 4WFFE 1OANA 1NIAA 2XLLA 5IQ9A 3T04D 2R4SH 1WD8A 3P11L 3HAEB 1ZWIB 2YRBA 1T1WB 1TZGL 2DB8A 3PNWA 4S1SH 1LDPL 2ROXA 1HJBC 4TUJA 3UJIL 1U8MA 2YD0A 3IJ9A 4N6QA 2BC4B 1XXFC 3RWGB 3Q6FB 2HJFA 5AOMA 3P3UA 3RVWC 1TKWB 3CQQA 3V0WL 3W11C 3C5ZB 4UNIA 1J1PH 2YJLA 4ENEC 3Q7JA 5DSCA 3OG6B 2V5RA 4LLYB 5J11B 4G7VH 2XA8L 1E28A 1E4WL 3SBQA 3J2PA 4FQCH 1YPZE 4XC3L 3SPVA 5IFHH 1GMEA 2OXHB 5KTEH 3U7YH 5DJDB 5KSAD 2JH2A 1CE1L 1LP9A 2QKSA 2XN9E 3NFPB 3LH8A 4XO5A 5F7WC 4AYMC 4NFDA 1D5XA 2VMCA 1F3JB 3CHQA 1G43A 1A9VA 4UIKH 4EDWH 5I18L 1S9YB 4LCWA 5IQNA 5DS2A 2FR4B 4HWNA 3HS8A 4HD9A 1FIGH 4P2OB 5AW2B 2XZQL 5E4OA 1JGLL 4FQHB 4XVTH 1CXKA 1MIEL 3BUIA 3GGWB 2JVUA 5C0EA 4IKLA 2KPNA 1GYWA 4JFDA 1F1AA 2JJSC 4E36A 4MA3A 2IBBA 4NKMA 4PIBA 2B3RA 4F15B 4M7LT 4OIIL 4CVXA 4DEUA 3HC4L 3CFIC 4Y2NA 5GGVL 3TNMA 5JQ6L 4D9RE 1OOAA 3KCPA 4HYTB 3TVMA 4HUCA 7FABL 4JFDD 1URZA 4IGBD 3FUNA 4OCMC 1OD9A 3P3SA 3MRIA 4TSCH 3SJVA 3TFBA 4GQRA 3BAEH 3LQZA 2D3VA 4GNKB 1WFJA 1A4KB 1BM7A 2CHZA 1AZZC 1MJUL 3ARQA 3BLBA 4M4RA 3HS0A 1SEBA 2OI9B 4HBCL 4AQ1C 1TLMA 5IQLA 5ICUA 1KJMA 1XGYH 2VXVL 5IB3A 4OFPA 1EAJA 1KENL 3DO3A 3GB7A 4PGBA 1CG9A 1C12B 3CFCH 4IS6B 4UMGA 1MCPH 1EK3A 1UC6A 1UJ3B 4AYFA 4BWWA 3KGRA 2Z8VC 1X9UA 2Q0ZX 4E41E 1WUZA 2VR6A 2YO3A 4B9CA 5LG6A 4NYLB 4LEOA 3IETA 1AHWA 5IF0B 1NDTA 1CD9B 1CE6B 2ZJSH 2XZAL 4P4KC 4KTDL 4OTXH 3RVUD 1UWXK 2I7OA 1YMMA 3E3QC 4JFUA 5I0YA 3H0TA 5E1IA 3H3KA 4HFWB 4R7DA 1BAWA 5B7MA 1UURA 4LOVA 3VFVA 3VI4F 4ZW3A 4TSAH 4HJGB 3O6MH 2BY2A 3EDDA 4KVNL 7PAZA 2Z91B 5CEZE 4Y19B 1AHKA 1VKXB 4KAQL 4FD0A 1IC0A 4OIBA 4F2ME 1RJZB 4S1RL 5AAMC 3DMMA 4ELKB 4AXWB 5CLZA 3J7HA 1UXSA 3HA0A 4UDTB 3DETC 3Q2WA 4JZJC 4WFED 5B1KA 4LQFH 2R4SL 5L88H 1VGKA 3E80A 4ZDHB 4OJYA 4ZPVB 1YNKL 4QXTA 1J12A 2A6DA 3DO4A 1KIRB 3O41B 3IGLA 1G6RB 3QC5X 3UPRA 1BLIA 1ZHKB 5C08B 1AQMA 1TVDA 4M7JH 4H8PA 3BZEA 2MNWA 1WISA 1KG0A 5ACMA 4PJAA 1BZEA 4I1PA 4G8FA 2ZYRA 3SKNB 4N2CA 2V3DA 5CS7A 5E9DA 1BQUA 3ULSA 1JZ8A 2R8SH 4G7VL 3LNGA 4HT1H 5DC2A 3KLHC 1OP9A 3QPKA 4XB7A 3QH3A 2LE9A 2VLJE 3CFKA 1JTTA 4JFHE 4QOKB 2CE6A 2Y5QA 4UNVA 3CXFA 4X5WB 5TDNA 2WQUA 1XCWA 5CIPA 1ML0A 3VXUE 3E0GA 3KEHA 4P99A 2OA9A 5EC2A 3S5YA 1AE6L 5AG8A 1TETL 4GP8B 1XGRB 2Y6TE 2ZXDA 3E8UH 5E6ZA 5KUMA 5SX5K 1FIGL 4PJ7E 1ORSB 3G6JA 3RZWA 4PP2B 2YGPA 3G5WA 2FX7H 3GRWA 4U6VL 5I1DA 1IJNA 3KPLA 1U8QA 4P5MB 3RWDB 3CWGA 2WQRA 1J9QA 1E5AA 1E9OA 1P4LB 2ED9A 3B2PA 4Y19D 5JQ6H 1MUJA 1JK8B 1P4BH 3OLDA 7FABH 3CX2A 3NPSC 1UCBH 3SGJC 4XPTL 2PYED 1SQMA 4EIGB 4L3AA 2BW5A 3GQFA 4PS8A 2BSTB 1OAXH 4XNYH 3BWUF 2H26A 4M6MH 1SRDA 2OTWA 2OX5B 4PJFF 5EPMA 3L3IB 4KVCH 1U8HA 4UAOB 1FAIL 4ZFOB 4FX5A 2CLRB 2QV2A 1BJ1J 2IV8A 3IXAB 4JFQA 3MFGB 5I1EL 1J0KA 2LVEA 1G9NL 5HHME 2YA1A 5JPNC 1NFIA 5D1XA 1MCWM 3LKOB 4U2YA 1RURL 2EDWA 4LRIC 3W39B 5C92A 1BVZA 2A1WH 3U7WL 1IEBA 3L5XL 3PUCA 4Y1AD 2KI6A 3ALXA 1JXGA 4F33A 4PLKC 3FH7A 2FNWA 4WF7A 5IWLA 2LGNA 4XP4H 4Y5VB 5HBBA 4QT5A 1DN2A 1OAQH 5BXFA 4CN1A 5EOCJ 3Q5OA 1GHFH 5BO0D 2L3BA 4L1TA 1AQKL 4N90D 4UMSA 4W9GC 3EF4A 2IEPA 3QQ3B 3EO9H 3MX0A 4H26B 5CGYD 5C0RL 1FC1A 5I76B 3FSVA 1BVNT 1NJ9B 2H3XC 5FYLE 4PTTB 4X8CA 3V0EA 4AMKH 1UEMA 3T8XB 5T33H 1DP0A 1BOGA 3D0AA 5D7KD 3V4PL 3KDMB 5E6RB 8CGTA 4U4IA 4N8CH 4DFIA 5IEHB 4M1DH 4UZUA 3HMWL 4AKOA 2F15A 3MR9B 1D5RA 2VLJD 4PJIB 5I8CA 4XVJL 3K71B 2WGNB 3RX7A 4FS0A 2UZXB 3COOA 4KMTH 4LF3A 4JN2A 3IU4L 2EKSB 5ESVA 5AVUB 3VGDA 1TTCA 3NZUA 1LEKB 3ZZQA 3MA7B 3OJDB 4YSSA 5FO7B 2ZD0A 2WLIA 4PJ7A 4GSDH 2FSDA 4M3HA 3QFDA 3AG3B 4JM2F 1VFOA 2MHAA 4GW5A 3WNJA 3QUMH 3Q3GB 4HSAC 4RFOL 1KWGA 3CN0A 4HT1L 4RNRA 5E2JA 4MAZA 4XX1G 3D69A 3QUXD 3V4UH 2QVFB 4UT9H 1N7MH 2R1XA 4LHUB 5F9AC 4AUUA 3CTTA 3QG6B 4LPCA 2DZEA 5IG7B 2NW2B 1ZTMA 5I19H 3RZCD 4XXDA 4FDWA 2HX9A 5CBEB 1KXQA 4OCWH 4RMSA 5EOCL 1ZGLB 2XN1A 3S48A 4J27A 1AE6H 1CYGA 2ZKHL 1J5DA 2OMTB 3GDCA 3MACL 4BFNA 1Q9OA 1ZOXA 1X5XA 4BWTA 2BP0A 4DH2A 3MV8B 5C0JA 3ZDZF 4QCIA 1I9JL 4PR5A 1BLNB 1MH5A 4HWBA 5HYJD 1XR9A 3N5AA 5EH1A 2FX7L 1MFNA 3SE4A 1HI6A 3KPTA 5IM7B 1FHGA 3QIWD 4PLJC 4K3EH 4L0YA 1HSBA 1NQBA 5F7LB 5EZOL 3TYGL 3EYQD 2V5TA 3FMGH 3HS0C 4IEFB 3FT2B 1OAUH 3MRNB 5JUEL 3UTSB 4YZFE 5GRJL 1LM8V 5LO7A 4Y9FA 1Z2KA 3D39E 4Z7WA 4ZFZA 4DP8X 4QHUA 2HX7A 3VGAC 5D7JB 1JUFB 2AQQA 4R0LB 4KVCL 4ZUVB 3OKDB 1OT4A 2HKHL 3QS3A 4G11A 4JRXA 3VTTA 3HE6C 1ZEAL 3KDMA 2UXGA 1IO4C 1E3XA 4Y4KD 4LSVL 2N1TE 4X4XB 5F88B 2ZUSA 1LO4H 3H53A 2A4ZA 3LEYH 3MC0A 4X6CA 5D70H 1A7OL 3F12B 5KANI 3HUJF 3KWXA 4R5XA 4A6YL 1CF8H 2H41A 4BKSC 4ECNA 2NY4D 3U0WH 4A7QA 1FZMB 3DVGB 4G7YL 3VXQB 3SBRA 2ZSVB 4UT7H 2VWEC 2Z4QB 4MXVE 2YSSA 5TD4A 3RUGA 3QI9B 4ZUWB 2BIHA 1FNGA 2DYPD 5K9QI 5L4FA 4BBWA 4PRHA 2VLKB 1SLXA 1SHSA 2VGLM 4ONOA 4AM0A 3VG0L 4S1DD 4LCCB 1AO7B 1JN6A 3OKEA 2RACA 2X0VA 4KFMA 1OOWA 4WK0B 2J1XA 3MCKB 1MCBA 3I75B 4J12A 4NZRL 2P5EE 2CHWA 2ZYIA 4KUCF 4OLVH 1MFBL 4M3KB 4NWUL 4L8DA 4YSTA 3VYPA 2BHZA 5HHVL 3TZVC 1IRAY 3FDWA 1QSEE 5BOPA 1WFIA 2QPDB 5J12B 1WH0A 2G2PA 2HKFH 2X4PB 4H25B 3M07A 5H37A 1O0VA 3VE0B 1EAOA 3SE9H 5ALBH 2GHZA 1SFDA 1UUNA 4JL2A 1GIGL 1P7KB 3RIFF 2E7HA 1JL8A 3N3EA 4LBEB 1ZKAA 2XQYK 4XP6L 3UJIH 2AXJA 4DGIL 3T0EB 4P2QB 3DK2A 1F3RB 1WTLA 3K8KA 5I8CB 3LV3A 1MQ8A 2C9UA 2C26A 3D5OF 3OM3B 1N7ML 2WPGA 3ECVA 3MJ7A 4JN2B 4WFHD 1MHPH 2J6EA 4OFVA 1CXLA 2ESVB 3CVHB 3MBEB 4J6RL 3UYOD 1XCTA 3CZJA 4YVNA 1Z0MA 1IGMH 4URKA 3SCMB 4LEXL 3NIDB 1AC6A 3U9PH 1CE1H 3SOBH 3Q43A 3ARFD 3LD8B 3QP3A 4KK8D 3U4EB 4L8SA 5JHLL 1MLBA 4KWUA 1Y18B 3LN5B 2XWRA 5JIMA 3C2AH 1AO7D 2CRZA 3WY4A 4C55A 4L37A 2DQHH 4JZOA 5DMKA 5F0LB 2EP6A 4RA3A 4LCUA 2NW2A 4ODXB 3WXWH 4ZX6A 4K3EL 2AEWA 4MQSB 5TH2B 5E8PB 5BMFL 4Y5VC 1WBYB 2GAZA 5CN3A 4YFDB 5SWZA 2JQZA 4KXAA 3O6KL 1NC2D 1AZNA 3OKOA 4UB0L 5IIEB 2JK5B 1M3IA 5EZIL 1K85A 5HPMA 1LO2L 3KPNA 3GJFB 3C60B 2H0EA 3ILDA 1J9CT 1HSAA 4WW1B 5H94B 3ZQXA 4N9OB 3P2BA 3VO0A 4BV1A 5H4ZA 4AUJA 3GI8L 3CBJB 3U25A 4ODSH 3DTXA 4POYA 1PMYA 4LLMB 3UZEA 3BGMB 3AWGA 3GC3A 3V9CA 1SJVA 2X0UA 2WYIA 1CE6A 4A04A 2VSDA 2ZX5A 2VXQL 6PCYA 2WANA 5B38G 1OSZA 1IGIH 1ADQH 1NBCA 1INQA 3KE0A 4PVBA 2Y06H 4OF7A 3E38A 4JZNB 5K93A 3VSUA 4P2YA 4HXAL 1XSJA 1IC4H 3GXFA 3I6GB 1EPFA 3FT1A 3PJNA 4PGBB 2E7MA 2Y25A 2DYSB 3KLLA 2X4UB 4FTVD 1CFTA 4GPVA 4P57A 5F71A 4E5XG 4HZLA 1JWMA 3MRRB 4JM2D 4H5SB 2OXHA 3VACA 2Z7WA 1MG3C 4FA7B 2WTRB 4N2OA 1J8HD 1CZ8L 3DUUA 2XTSA 4Z5RB 3VB9A 1XIWD 3HUJB 3WJMA 1YEKH 3GMQA 4ALAL 1L6XA 4AYBA 3FU7B 3BDYL 3U2SB 4AGLA 1M42A 1XGZA 3B9KA 4XMTA 3BEWB 5IB2B 2E86A 4NO0A 4Z78A 3DMMD 2EUVA 1S3RA 3PWVA 4FLQA 5LCVL 3H7LA 3VXSE 4Z0XB 3UPCA 1ORQB 2R4RL 3NABH 3DV4B 2OJZH 4TNWF 1NSNH 2Z91A 2FO8A 2ADYA 5E2TL 1G7IB 5EBMA 1IAII 3VSTA 2RALA 4K94C 2AJSH 3H2WA 1JYNA 3TEXA 1NMAL 3WTSA 2CKBH 3FN9A 4W70A 4IU2A 5B4MD 3U4AA 5T3XL 4EZKA 5IGXH 1J1XH 1FGNH 2B59A 4KI1A 1V27A 2F53B 3C87A 4XE0A 1ZHKA 2JWYA 3NJNA 4R7VA 5I82A 3I6LE 3MV9A 1OXYA 4Z7OF 4AJWA 2JXMA 5BV7L 4J3SA 5JPNB 1NANH 4A6YB 4MA8L 4NLAA 3U9PL 5CXPA 3ULVE 4MQTB 3ARFB 4P2QA 1PFOA 3P77B 3AUWB 1MREH 1UOKA 2L7EA 5T5FH 1AY1H 3ARSA 4NQUA 1HH9B 1T5XA 2C4FU 4E2OA 4UBDC 3DPBB 3WY3A 4BXVA 4CILA 4P2CG 4LAQL 4LLVB 2A5UA 3OKNA 4OZGB 5E9NA 1IMHC 1N68A 3H9ZA 3IMRA 1INDH 4X6DE 1PNDA 3HZVB 3ALPA 3ARBA 1A0QH 4JB9L 4UIMB 3TCLA 2VDNB 5SX4H 1NC4D 5AKSA 3STZB 4B9KC 3IPBA 4TMPA 1S5HB 2V9UA 1R5VB 3S3CB 5L2JB 1EGJH 2ICWJ 2JCCF 4Z7VE 3W2DH 5DRZA 2BSSB 4GI9A 1KCUL 1BCIA 1G1KA 3JBG7 4GJTB 3TM6A 3PS6A 2BVPB 4YVUA 2X1OA 3AAZB 3LIZA 4FQIL 5IVXB 5JW4M 5HYIA 4NKDA 1S7SB 1P4BL 2NR6D 1XMEB 1UADC 4MJ2A 2NY5C 2XHNA 4OU3A 4U1MA 5HGBB 4JHBA 5FR3A 3RPBA 1ZLDA 3AQXA 3IFPB 2GTWB 4PCSA 4WW2B 5T1JA 3GSRB 3O6FA 3T2NH 5TQ2H 2X5PA 1BZDA 3U4BL 4OF8A 1C5DB 1KCKA 3AS2A 4MRCA 4LCWD 1QWUA 3O3UN 4WEMB 1P0SE 3EAKA 4X7FC 4AOFA 3BW9B 4XP1L 4FYRA 4XT1C 3QZWG 3DX8A 1MOEA 1OCWH 4Q74A 5JA9A 3RKDC 4FEMA 1BJ8A 4XNMA 4BFGA 1NCUA 4F2EA 5IQ9B 5LAXB 3KYNA 3NRQA 4OH2A 1FGVL 1LO0H 3VW3H 1I1AA 4B9FA 2A6KA 5DD6A 1N18A 1KJVA 4JHAL 4BM7A 3A4FA 4KITB 1XTLA 1NLBL 4OD3L 1IX2A 1JZIA 3VGGA 5KSVB 2Y3AA 4QRPD 4JY4B 3QEGH 5ISZB 3SY6A 4TQPA 4FNLH 2MPAL 2PO6D 5IW1A 5J12C 3WFBH 3GSVB 1RIVH 3C6SA 4XXCC 1DUZA 2IAAC 4RBPK 5FWRA 3BQUB 3QZMA 1I1CA 4QMEA 2EABA 1JHKH 4DUXA 4PY7A 1W6LA 3C60A 4U0RB 5FYJU 4ZSOE 4D8PA 1GTNA 3UGEA 4M1CD 4DP0X 2K3HA 1N5AB 5ACZB 5I5RA 1NJ9A 2D9QB 1CICC 1FP5A 3BFWA 3RB7A 5L8KB 1JNNH 1UA3A 3EH4B 3DX4A 2VUOA 2WINA 4BKLB 5FWQA 4D8OA 4F2FA 3VFSB 4BQ6A 3C5ZA 3QDMA 2IG2H 3MNWB 4URTB 4XPAL 4ZOCA 4YO0B 2SEBB 4HKJB 1HZHH 1YQVH 4MA1B 3U9WA 3WGUB 2HPTA 3MYJA 3SE3A 5C0DB 3ML9A 4HWZA 1DQQB 1BBDL 1N2RB 4MA8H 5I1LA 3Q8CA 2QTEA 2YN5A 1FL3A 1J5OH 5T5FL 3QXWA 4QOKD 2ICES 1B9KA 3NESA 4LRNH 1NGWA 3ARGA 1XH1A 3IYLW 4C56D 3CHRA 3OLIA 5F70A 5K69A 3F58H 4Z95L 4DPBX 2AQTA 5LGKA 3GS7A 1BZ7B 3ULUE 1I9JH 4IQHA 4HAFA 3GHBH 3PU7A 5I66B 4ZX3A 4HCRA 5DJAA 1T66D 5DHVH 1H9DA 1GGBH 3W2DL 2BFGA 3APMA 5BUGA 3EXJA 2BP0B 2DIBA 1SBBA 2OMWA 4FFWC 1II4E 5DRWB 2XV2A 3IJ7A 4HMEA 3UYPB 5F8RC 2DLTA 3EH2A 4XHJC 1U8NA 1PD1A 4PPTA 2GIXA 1NCCH 3C5JB 2FL5A 3IM1A 4ZUTB 4ELMA 5GGUB 2ZWLT 1A3QA 3PPSA 1YYCA 3L5IA 5A6IA 5K1JA 5ANMA 1OZUA 3UERA 1U92B 3VXUA 4PBXA 2KZKA 3I9GL 5DK2A 1NL0L 1T04A 1FH5L 1J18A 2KQMA 4FFYH 4PG9A 4GG8A 4UUJB 3M1CA 1SVCP 1L9PA 4PBDA 4WU7A 4NIYE 5HJGA 4IIQC 4XXWA 5JNYB 3UC2A 3TO4C 4O9HH 3VTMA 4G7YH 1MN4A 3HVNA 2EYSA 5F7EH 2VLJB 4TQIA 3H6JA 3GD1C 3HPJA 3BGFB 3HE7B 3IEAA 3QUZA 5I24A 1KGUA 2CDFB 5FA3B 1RJLB 1JUFA 4FG6C 3QIBC 1A25A 3LRSB 2OYPA 5E23A 4PWFA 1L9QA 4PWEA 3LKPB 1JHKL 2BOBA 4U3CA 2CDEA 5KSUA 5IOPA 3S37H 4G42A 4EUPH 1BF5A 5C0CA 3BT2L 1ZLVK 4K7PH 1A6UH 4YHMH 2AXHA 1KN4L 1R0AL 1D3CA 2DQCH 3LPWA 4HXBL 3DHJA 1IAOB 1G1YA 3EBHA 2X4SA 4LLDB 3PREA 4RBPH 4KZCA 3CC1A 3S3JA 4B9ZA 1FBIH 1T89C 4QGYA 4TVPH 3BMVA 1XGUB 3F5WA 1YEJL 2A74A 2QVMA 3PWUA 4NQSB 5JIKA 3IETB 3I50L 2FNBA 4MB5A 4XPAH 1CD0A 3MJ9A 4YDVA 4JFXA 2FSEB 5EA0L 3ECBA 15C8L 4R7LA 2G3ZA 4IU3A 1F11B 5DGRA 2BIIA 3F00A 4GRMA 5CU9A 4APQB 1WITA 3Q2LA 4L2YA 2J88H 5GRVK 2AVGA 5FM4A 5FS5A 3MODH 5K9OA 4JHWH 3AS3A 1CGWA 1HKFA 4NPJA 1A6WL 3FCTB 4OSUH 3VRIB 3WYRA 1A1OA 1FNEB 5L8LB 1KB5B 2OMVB 4X7SL 2F58H 2RCSH 4DO4A 1PKOA 1T5WA 4LESA 5J11C 2KHAA 2OKMA 3QFJD 4OT1H 4PH8A 4C8XA 4JCMA 4JJ5B 1WWAX 1PTZA 2VABA 1F8TL 4FP8L 4K8RC 3CX5J 1PG7H 1FDLL 4KBPA 1VEPA 4JFPA 2HLEB 3I3EA 4K3DL 4Y2DB 5DS8B 2XVGA 2VDML 5I1GL 2D3JA 4J3TA 4UF7C 7PCYA 2XVKA 5G4OA 3BX7C 4AIEA 4XNZB 1F58H 1IFHL 4Z8FH 3LPFA 3LS4L 4YWGH 1PZAA 3KPOB 3VTAA 1FNGB 2Z65C 1GC1C 1WEJH 2ZOLB 3O6KH 4NI6A 5L2KB 3PQYA 4PW9A 2FEEI 4PGDA 1KGCD 1ES0A 4EQ3A 4PJGF 1I4FB 3RWCA 1TJXA 2YAFA 3ZTJH 1B0RB 1U95A 2NMSA 1DBBH 3IKCA 5DGQA 3IMTA 3QIWA 5LGJA 5E0FA 3DUSA 2JCCA 1AI1L 3CH1A 4XCYB 4DKEL 3FCSA 4Y16D 4EI5C 5DRWA 3ARDA 1VACB 5B1BB 1Y18A 1GS7A 3X1BA 5JXEA 1WQVT 4P23C 5KAQF 3MLPA 5D4QA 1EZLA 3ZIYA 5GGRB 3G5XA 1WCBA 1X7QB 3IDIB 5GHWL 5HDRA 5KSAC 5LAPA 4N0UB 2B1OA 2WUCH 5AVWB 1OK8A 1KPVB 4AIZA 1XAUA 2XQ0A 1GL4B 2WD0A 2YQ3A 4YBLC 1LMIA 4MSWA 5JNYA 4NQCE 2DI9A 1IQWL 4PREB 5CBAB 1MFCL 3DNKA 5AB2A 2I9LA 2OL3A 1OSYA 1AZRA 3DC0A 3ZJAA 1XGPA 2QPSA 1I8IB 2NX5A 4RIRB 3VXNB 2ZX7A 5J89A 4ONGL 1NEPA 4IJTA 4L2LA 4P5TA 3BT2H 3L16A 1EUTA 3Q9PA 4FFYA 1YEKL 3EDKA 4PCYA 4U1KB 1PZ5A 1MUJB 3UAJD 1SY6L 4LL4A 4YFLI 4HHAA 3Q6GL 3U6XA 2XXMB 2EZ0C 3FFDB 1GH7A 4PRAA 1W0WB 4DW2L 4Z6AT 3AU1B 5HGDA 3RNQA 1RMFH 4G6AC 3RQ3A 4FNSA 1U8OB 2OL3L 1WBYA 2EDLA 1GJUA 1HHGB 5CJQL 4RFEB 4CVZA 1SUHA 2CDEB 3Q2CA 4F7CA 3WIHH 3VXUB 4XO4A 4JZJB 3VRLE 4FZ8L 3QEQB 4PS7A 1CYWA 5JLZA 2PPAA 5FGBA 5HHNA 5DZAA 4GI8A 2UZYB 5A7BA 4XC1L 3RE0A 4JHWL 2XYBA 4M9PA 2PPCA 4F7PA 5CZVL 4QJ4B 5D4JA 2CPUA 1OAYL 3IGAB 5GIRB 3HBPA 3S6CA 4ODHL 5F7HA 5D5MF 1KGCE 2DQTH 2W9DH 3IDNB 3TX4A 1IL1B 4XH2B 1IGFL 1PEZA 1IE5A 5I8KL 2MEJB 3KBPA 2NY5H 3GRBA 4NUGL 5DMIH 3R19A 2ZP9A 5CR1A 1UACL 1FHNA 2APVA 2IWGA 3N9GH 1DSWA 2FJGB 4P4RA 5GISL 3LMJL 5I74C 4XB3A 5F3HB 1JOIA 2ODHA 4MJIE 4PG2C 5DR5H 4A7SA 1E5BA 5BO1H 1DVSA 3L4UA 4Q56A 3P9MA 2P24B 1X4XA 3HZKA 1TQUA 1MFUA 4OGYL 3IU3B 2EAEA 3HC3H 1NFAA 4HIJA 2K70A 1AXTH 1DQVA 1MCHA 1YN6A 4GQ9L 5B8CA 1N3NB 4CC0A 3UTSA 2XTJC 2R0ZH 3CD4A 1PYWB 1TQWA 1FL5A 4RDQF 2X9ZA 5JHDD 1OP3H 1FG2A 4PJ8C 4O58L 5DUML 1MXGA 1KDJA 4KV5E 4B3EA 5C86A 2KBGA 2DM3A 1XWVA 3FT3A 4RZKA 3L3JA 5T1MA 2X6MA 2HPOA 5DJDA 3G3LA 1DQMH 1URLA 4D7PA 2IXQB 4EE2A 5FO8A 5KSAB 3Q2VA 3VG9B 1M3JA 1O6TA 3MOBL 1Q9OB 1TFPA 2PN5A 4ZTPH 4PJCF 2CRYA 2EDXA 3LSOA 3B9EA 4JY6B 1A6PA 5H35A 1VLXA 3LJ3A 3RVTC 4NO3B 2J8UF 1UXMA 3FK3A 4F92B 4Z3GA 3JV4A 3L1OH 2WUCL 1N5YH 2JJWA 1XF5B 1ZV2A 2VJ8A 3KXFD 4FLRA 4GBXA 5FO9B 1QVOB 1OY3B 1HXMA 1T20A 3QIBD 3O4LD 5DVPA 5EIIB 2XN2A 2WO3B 3LHPH 2WBJD 4LF3B 4R8WL 3R7QA 2BZCA 2Y0SA 1VENA 4W93A 3RJQB 5B38B 1BFOB 4NQDE 3ZO0A 3VXPA 4KKBD 3NCCB 4I88A 3JT0A 1KJ2H 1NLBH 2YC1B 4UIKL 3OAZK 1SF5A 2BWIA 5TE6H 4KRPD 3TN0D 4L1LA 1ED3A 3NIDE 4ZUVA 4ONGH 2IV9A 1OW0C 5B3JF 5DJCB 3P4OA 3VGAB 2X40A 1ADWA 3D0VB 3QUGA 2FT7A 4I77H 4JGJA 4QJ3B 2MQCA 3FTUA 2C3HA 3PWPE 3D3VB 2N1KA 3UBFA 1KTDA 3FFCE 3SBWC 4Z3JA 8FABB 3BPLC 3CFQA 1FJ1B 5HJBA 4XI5C 2NUTA 4OIIH 4AV0A 1DL7L 4MXWL 3BIBX 1GPOH 4H0GA 3TN0B 3V9EA 3HC4H 25C8H 1TQSA 2VR8A 3WTVA 1P7QD 3O2VL 1L5GA 3E9UA 2J20A 1GZQA 1YMHA 1BLNA 1MH5B 1OGAB 4U1GB 3ULUF 4G9FA 3VJ6A 2XBTA 4WHDA 3QEUB 2R1YA 4IHOB 2XZCH 1MZZA 2WHVA 4F80A 4HGMA 3WS3A 3KXFE 5AW7B 1I7RA 2BSED 5DJ6B 4AG4H 5ADOH 3A67H 2AI0H 4JVUA 5LXGL 1CI5A 3F7PC 4ODHH 3WMPA 2DQTL 3H4HA 4OZGE 4JRYB 1MVUA 2WXMA 3L3DA 2I7SA 3FAXA 1EERB 1T5KA 3L4CA 4PLJD 5JIPA 1F1GA 1X5IA 4P3DB 5CGYC 2G2RB 1UXSB 1UACH 4UU9A 2Z31D 4XNZC 1XGPB 2XV0A 4XVSL 5GISH 3QJRB 3ABZA 3NSXA 4G5ZH 2OV0A 4IBYA 4LXFA 4F7MA 1EHAA 2A2QT 4ZODA 3GXNA 2BP8B 1E43A 3CSPA 1SJHB 4PLNC 1YEDB 4TNEA 5CILH 2X88A 1TEYA 5DYOA 3RDTA 3JWOL 2XN9A 4Y4FB 5DZOA 1BP3B 1MRFH 3RWHB 2NSMA 3EH3B 3QNZA 2J6WA 2DJSA 5E8EB 5TQ0L 1T7WA 3MYJB 3GLAA 1HE7A 3ZKMD 3HN3A 1BPLB 4FNUA 1PZCA 4HAKA 4DKTA 3VD1A 4NO2B 3PABA 3OGCB 3ARDC 1P6AB 4IK7A 5I1DB 3PJSB 1DQML 1SVBA 3EYUL 5DZVA 1A3RH 1H5BA 1V7ML 4LL1A 2FGWL 5IMOA 3AB0C 4LVOB 4WSGA 4XMUA 4ILDA 4M7JL 4ADIA 5CD5C 2X41A 1TTGA 5JOPD 1RZGA 4X5QA 3U2SA 3B9KB 5IB2A 1BFVL 4RISH 2YPKA 1I85C 5E8PA 1X5JA 4QTIH 5F0MB 3TBCA 2IFFL 4AEHL 3FFCA 4L1SA 5F9JA 1N5YL 3QEHB 4HGKC 3IFNH 5C08A 3ULVL 3FB6B 2BWDA 4W68A 4EI5D 4JY5L 1V3LA 2NQDA 4F7KA 2IQ9L 3ZDWA 1EZUA 1YEFH 5IKCB 4G9FB 3BMWA 2N3JA 3DRTA 4Y4KC 4I13B 5JQIB 3B8YA 3TIDB 5GS2D 4L1BA 2PWFA 1CU4L 3QIWC 4NM8L 4D3CH 4EF3A 2O6CA 1HILA 5C0FB 2O1AA 1BXAA 4PTUB 2R7EA 4HUWA 4BCYA 3D25A 4F8TA 3RB5A 2WKGA 3MRHB 4P49A 3LNHA 4QRQB 4XZUA 4I3RL 3VYNA 5I6MA 3GINA 2NY1D 2YEZB 2W1NA 2Y6SC 3BYYA 3UFIA 3CFJA 1VZHA 3VFPB 4O51A 1CVSC 2X10A 1S7RB 4IOSA 4WEBH 2PP9A 1JTOA 2E47A 3ULVF 4MJIB 5C2BL 3MXWL 1YEJH 4Y1AB 2Q3AA 5LB1A 2DTMH 5I6OA 4X6CF 3FQXB 3A4EA 5TE4H 3WNIA 2N7BA 2YQBA 2D8KA 1EFQA 4M62H 4TNVF 2GI0A 1C5CH 3A23A 1JZHA 1KTRL 1T89A 3I6KA 4FQXD 3C8DA 1ACYH 1NC2B 1PNCA 4LQ1A 3RGVD 5J9PA 1OHQA 3D18B 1TLKA 2WW8A 2YXMA 3CVDA 1XF5A 3ZPDA 2E27L 1S7XB 1FYTA 1UA7A 1W91A 3KLQA 1Y6MR 1NBYA 4PJEF 4OW6A 2F53D 4YBHA 3SQOH 4GLRI 3QO0A 5HGAA 4Z7QF 3V7AE 3MRCB 3ECBB 3TPUB 3FQRB 2GSIB 5DEJA 4MJ6B 2RCSL 1JCVA 2XKNA 2VXTL 4N86A 3LQMA 2BIOA 2YAEA 4XRCA 3ZE0F 3X17A 3SB3A 4FQQA 3DSFL 3C09B 1N4XH 4LK4A 5I1IL 2YD3A 1U8KA 4JREC 5TF1L 1PG7L 1CS6A 5J3HC 1MW3A 1XH2A 4QRTB 4MAYC 1VCAA 3MRMA 1N0XL 4Z9KB 4PJ9D 2V8MA 3D2UB 4TM9A 7TAAA 3KBHE 4BUGA 5DMYA 3VI3E 1MPAH 1AOHA 3QNFA 4P9MH 4PGJA 2CLVA 2Z64C 4QF1B 2QQLL 2WBWB 2Z0UA 2ZQKA 5C07B 1HOEA 4YDIH 4M3JA 4LKCB 2VC2L 4UILL 4M1GL 4E9YA 2X89D 1VFAA 5JMRA 1F2XK 3RP1A 1CT8A 1RZKC 1DLFH 3MRNA 2DQFB 3OB0K 4PRDB 3B2UC 1AI1H 1S7TA 5TE7H 3KBEA 4LCWB 4MLSA 1J10A 1I7RB 3BJLA 4AKPA 1RP8A 1R46A 3IDXL 4NZJA 3ZRFC 2VXUL 3GMNB 4EN3D 4LBAA 3NIGE 4Q6IA 5E9AA 4JRYA 5DQDL 2GJZA 1SGKA 5ITFA 4OFIA 3W0WB 4HWEH 1LMKA 4JY5H 1P69B 3F7KA 2RD0A 4GAJL 2N0KA 1MWAB 3I84A 4M8RA 3K6SB 2AXFA 1FO0H 3H9SA 3ILEA 4OCWL 4U1HB 4X5RA 3K1KC 5D72H 3NEEA 3RVTD 3II2A 2HJFB 3MACH 4GO8A 2BSCA 3RVXC 4QHKI 3OHMB 3X1GA 4GUPA 4HS8L 3NRFA 1CC3A 1RIUL 4HMDA 4JNXA 2WY3B 1BMGA 1MVYA 3AITA 1OQXA 2V2XA 4H2AA 3KVPA 3L9YA 4N0YL 4FERA 1WAEA 2C4XA 3PRZA 2K8QA 4P46D 3IFOB 4NO2A 4XPGH 1SY6H 4MMZB 2ZOUA 5MERA 2X6BA 5T5NG 4M8QB 4QRRB 4DPAX 1T6WA 1KV3A 3F12A 4D94A 4BFFA 5JUEH 2X28A 3DWTA 2E6JA 5BRQA 1J87A 4X8XA 1ACXA 2E3VA 1MRCH 5EU6A 1VCBC 1E4KA 1PFCA 2JMRA 3CLWA 4L8CA 4LKXB 5CJ5A 3ULUC 4QYOB 3QK0A 5E6ID 4WNQA 1ACYL 1NCDL 3DTUB 2VQUA 4UWQB 5HHQA 1ZXKA 3VX0A 5I1LB 1G7LB 4IYKA 2E27H 4QAMB 3GNMH 3T3PF 2BMKB 3CNKA 4PHXA 4QRSB 3PDDA 3C6EA 3QQ9D 2VO8A 4XNBA 5ALCH 2IH8A 3HRPA 3FYIB 4PY7B 5GRUL 4QCIB 1GZHC 1OF0A 3OV6A 1AXSA 3JSSA 2CXGA 5B4MC 3O9WB 1JGEA 3QPQC 5EFIA 3U0WL 3NTCL 3AU1A 3CAFA 1GGIL 3DYOA 4DO5A 2EDBA 5MP6L 2W91A 4JY4A 3L7EB 1TNMA 2FJUB 2ZX8A 3QARA 5GRZA 4BH8B 1YUHB 4P07A 3RLSA 3N9GL 3MV7D 1AHMA 1KNOA 2V9QA 4ACPA 4GXUM 3THMH 1O7VA 5I1CH 3R7RA 3JWNE 5JIIA 4PJHE 4MA7L 2EJ1A 4PRHB 4BFJA 2XPGA 3QZLA 1WZKA 4OVVA 4YHZL 3BPCB 1DFBL 3KPSA 3MXVH 4PY8J 4CNIB 1XR8A 3OXSA 2QSQA 4ONFH 4P9ML 2Z31C 1KIUB 2HUEA 1XGQA 1H15B 2I5YL 3IMVA 4OLVL 3QR1A 2JV6A 4FCHA 4QY8B 5T1KA 1BG1A 2EDTA 1G0DA 1BF2A 1CFMA 3P0YH 3KJ6H 3HG1D 4YPGB 3QUHA 1H19A 3VGFA 2IPUK 3AT8A 5IR1A 2ZIDA 5E6SB 4M1GH 5B8CB 1FFNA 3B7SA 32C2A 4RVBA 1QATA 1I1YA 3GMOB 3C8HA 4LKCA 5A7EA 1IGYB 4LOUD 5KW9L 3X1NA 4HOWA 4HHAB 5TE7L 4BUQA 3EFOA 3CSYB 4N5EC 3CBKB 4TQEH 5BUPA 1XGTA 1YLBB 3IJEA 4PB9L 4JK0D 5IFAH 3VE0A 3CZEA 3BE1H 5IT2H 3V10A 2VZOA 5AUMA 2WYTA 1U9KA 3D39A 3IK2A 4HHWA 3FT4B 4HMCA 4OCSL 4XCFL 4D0DB 4X5XA 3KS0H 1YEWA 4PJXF 1HC1A 1SYVA 4CAGA 1MHPL 2D03H 4W4OA 3QT2A 4JX0A 3NRPA 4HUVB 4DF9A 5IFJB 2QQKL 5EC2B 1K5NB 3BT0A 1JRHH 4RMQA 4GSUA 4YE0A 1MW1A 3E2HB 1F90L 4MXQD 4Q52A 3VWKC 2J73A 4JANB 1O5DT 2WAHA 4HJ0C 4AENB 2YGOA 1A8JH 1JHTA 4NC1C 2IAMD 5L0QB 5HJ3B 3RX8A 2GJZB 3KL3A 3NCMA 2D7TL 2G5BB 3GEWB 3EBGA 2QV4A 2P42B 4M61A 1IAOA 4F5CA 2QHRL 4P2OC 1MFEH 2QLYA 2KKQA 1EO7A 3H9HB 3BWAB 1JPGB 5KVMC 3HIZA 4KDTC 5BVJB 1LO2H 4YSEA 1TSRA 1IAKB 2PO6C 4F15C 2J21A 2VDLL 5J56B 2RB8A 1A6ZA 1G7JB 3LN4B 4NXSA 1HJCA 3OR6B 3ARXA 4MJ5A 2ATKB 5IROD 3EGSB 1T0NB 5CHNB 2DQUH 1AR1D 3EJUA 4DUVA 5HDQH 4K07A 4XR8C 1C7TA 5DRXA 3GRGA 4FFVD 1KGXA 5C0NC 1GOFA 1SM3L 1ILSA 2H6OA 4QYOA 1PY0A 3SD5A 3T0ED 1R17A 4UQDA 3KPLB 4YLQT 1CK0L 4B50A 1KGWA 5ESQA 4GMSH 3QJVB 3B9KC 4PG9B 5FW6A 1U6AH 2CLZB 3V0HA 3A67L 1KCWA 3U0PA 3HN5A 1J9RA 2Z6FA 3R18A 5GZOD 3PAZA 2JB6A 3U36B 5IJDC 2VABB 4M8UA 2Y06L 3MUJA 3CG8A 2YAQA 5CKGA 1GGIH 1F4AA 5MP6H 2Y69B 3MV8A 1RIHL 1I53A 2KYIA 5FYLH 4ZNEA 4RGNE 3ZHFA 4JO4L 1N6VA 3DV4A 4ES9A 4YGVA 4JQIH 3CFUA 4GQQA 4ZUSA 1W72H 3RGHA 1DVFB 5JO5A 2ZTBA 4XCNA 2MMXA 2BOBB 3QDGD 3GJFH 4Y5YA 4ISVB 4AZ8A 3BSZA 3VA2C 2BVOA 2JKIS 3MXVL 4R2GC 3TBTB 1TZ8A 5AYUL 3MGOB 1EMTL 4HPOH 5KS9A 1QUNA 5I71B 1I7UB 3BISA 4ALAH 4PRPA 2YGNA 1WAAF 3DUHA 2J44A 5FCSH 3U9UB 4ES8A 4OFYD 4NAQA 1UWGH 4LZKA 2DBLH 2ZX9A 3JWDH 3DRQA 4MD5B 4U0QB 1UHVA 4JO2H 4YK4B 4P05A 1G7HA 1AGCB 32C2B 4GAFB 5AVXB 1NGXB 1NGYB 1QLEB 3NK4A 4BINA 5I28A 4S1SL 4JGMA 2FEDC 3OMAB 2QLVB 3UDWA 2E7DA 5EUOA 1CFVL 4FJZA 5K59E 5DS8A 2ZZUT 2BLFA 3PGDB 2WUBL 2WYZA 2YKKA 4IOFD 1XH0A 5CP3H 2H0FA 2FJFA 1BFVH 4RISL 3WNMA 3WFCL 4YXLH 4LP4A 1SEQL 3PWLA 4IMKA 4MFHA 1ET5A 3PYCA 4OLUL 1KPVA 4KK6C 4JDTL 3QEQE 2D03L 4B97A 2ZXEB 2FTAA 1QTPA 4FXLA 4UOW1 3FU9A 4RSVA 4QPEA 4WK2B 2P8MB 4HHGA 1LEGB 3D8MA 1S7QB 3LEXA 2ZSWA 4KRMB 5EU6E 2VLRE 3HZYA 4JFXB 4F58H 3OF6A 3D9AH 4XMKL 4V1DD 4BQBA 4IIQB 2JKXA 3N04A 2X2HA 43C9B 4WWKA 5AB1A 2VE6B 1G6VK 5GS0D 2DAVA 2IOMA 1R3KB 3N50A 4I3GA 3RDJA 1L3NA 2AK1H 2C9QA 2Y7LA 4TRPH 3SDAD 4KRLB 4B9GA 5F7DA 1FNHA 4PGDB 4QHMA 5EEWA 1ES0B 2GBUA 3M86A 4UQCA 1IC1A 3FT9A 5EF3A 2UXVA 2WXQA 5CEZL 2WN2A 2GY5A 1QO3B 5BV7C 1T22B 2OQJB 2E5EA 1W6WA 4O02L 3ILQD 2QGBA 3KNBB 4OLWH 5H4YA 4G82A 1J8KA 5F7YC 3BAJA 4PRHE 2LABA 5CHNA 3MCLH 5DVMA 4WCYL 4WFGD 5KVGE 2CIIA 2VAAA 4ZMLA 3QPQD 2ED7A 1OARL 3VXRE 4BFEA 2ESVA 4LSPH 3UTTE 1C9SA 1E2ZA 4P0DA 2YK1H 2R69A 4ODUB 1C08B 4G8GA 5I9QB 5JPMB 1L0XA 4L8DB 3SQOL 4Z7VA 4P48A 3NPZB 1R3JA 3ARVA 5JHDE 1TYJA 2AJ3B 3MRDA 5B3JE 1GRWA 4GY4A 2F08A 4NC0B 4XOEA 2FWLB 3SKUD 4BSWA 5K9JL 2CD0A 2WNWA 1Z3RA 2VXTH 3II1A 4IW4C 5HJ3A 1OGAD 3LZFH 1H3XA 2O6DA 4Z7UE 5ABDE 3QQ9C 4BHUI 5EMYA 4JPWL 5JDSA 2AMGA 5KVDH 1GGCH 2OP4H 5CIPH 4KMLB 1NCAL 1XF3A 3FSOA 3SQRA 3SQBA 1JNLL 1U91A 2F8OA 1DJSA 3CFTA 4O5LH 5DXWA 4NEHB 4GEIA 1TKWA 5K33A 6CGTA 1U3HB 4Y16C 3VI4A 5DMGD 5A40E 1DBJL 5D7JC 3HI5L 4MNHA 4OLXH 1UWGL 2KPWA 3FRPG 4FTVB 2QQLH 3K2IA 4S1RH 3WI9A 2G75B 3SDDB 1V8HA 3TWYA 3VAEA 2P48B 3QRFM 2PW2A 2OPCA 1K5WA 4ZUWA 1FL3B 3TA3A 2DIJA 3KLHD 3GB7B 4JFZL 4HX1A 4C4KT 4NRZA 3SGEI 4LT7A 2PCXA 3RWEA 1CB4A 1OP5K 4YHLL 2OMUA 2Y7SA 1A7RH 1WFOA 1C5BL 5AOJA 4WU5A 3C9NA 2YOCA 1M6OB 5DFWH 1HINL 3V6FB 1H6EA 5D9SA 1NCIA 4F8PA 1L7IL 3VWKD 5MEND 4YO0A 4ZFFB 2JIXD 1HH6A 4J39A 3FAWA 2PLTA 4HS6A 4JFTA 3U1QA 4CVUA 3S2CA 3IDGB 1VF5C 2VUYA 5HVWA 3BQVA 2BVTA 4HWZB 4K8RD 4C57C 1OEZW 2VDOH 4P46B 2R29H 2J55A 1B4TA 1SJMA 1YQ2A 2P4AB 4MA3B 2WBJB 4NKMB 5MI0B 4HLJA 4DVRH 5E5RB 5I5IA 3ZUNC 1A3LH 3MOAH 4LRNL 1D9KB 5D7LA 4E9QA 4JVWA 3WTWA 5KBMA 1BBJB 2H4EA 2YD2A 2YPLA 3JVGA 4P3CH 3EOAB 3TZVB 2KLRA 2DYRB 3HHSA 4ZAKB 2Y07H 4OLEA 5JIDA 1D7BA 4F1ZA 3VD2A 3QJXA 1SBSH 2CJUH 2AK1L 4TRPL 4PSRA 3L4TA 4N0YH 4XO9A 5CSZA 1AR1C 4C4BA 4JJHA 4KX7A 5E1AB 3EW3B 5LBGA 5BNXD 3B6SB 4POZD 5LBSA 3ZTNH 3R4RA 4R5VA 1F4WL 2VRAA 1WA1X 2E7CA 5FO9A 2OMWB 3RNKB 3U30C 2IXQA 1SYSA 3BPOC 3ALWA 5FO8B 2RHEA 1P1ZB 3EIFA 1SNRA 4XPTH 5EOTB 5JA8B 1U41A 3HHMA 5GQBA 2DLGA 2X4UA 3EO1B 4FFZA 3LXUX 1LK3L 4G1MB 5GZOC 1WHPA 2O4EA 4LLUB 4N24A 5CSBA 4JEGB 3GSUA 4UM9B 3NSDA 3MREA 2C9PA 2YUXA 3FTXA 1NCDH 1CFQB 4S2SB 4PJ5E 3FN0L 1NGWB 3ARGB 3L3HA 5EO1B 5B21A 1INQB 2CGYA 4XP9H 1E6OL 4UTAL 4N0FB 4YHPB 2VXSH 3X11A 4ODUA 4H8VA 3M17A 4MMXA 1RK0B 4FFYL 4FHBD 5A16B 3QORC 5HY9A 4JE0A 1HH9A 1T5XB 3G7TA 4EZMA 5EDXA 3W3BA 3MUUA 3P4MB 2EINB 3RHWF 1Y07A 1EJFA 1LWRA 4PUBH 4YIQB 5A6LA 4WU5B 3K6DA 4HIEB 3KEDA 1H3TA 5IY5B 3NFNA 5MHSD 3GEFA 1EFXB 2C3GA 3S34H 4AL8C 3MRBB 1NCAH 3EO9L 3HUJA 2FYVA 3SPHA 3UAJC 3WJMB 5CEXA 1JGEB 2NY0D 2WJ7A 3TZVD 3QUKB 3ZYJA 3EDFA 4O5LL 1ACCA 1TZOA 3T6QC 1WUNT 4JQXC 2X4NB 1NAMA 3AAZA 4G6AD 1LTXA 3SYOA 4OGAC 2FEDD 1E3FA 4OBRA 4QRSA 5BRZD 4I89A 4TXVB 5GGSB 2B9BA 1GCFA 1TEGA 3BZDA 3FOLB 4ZQKA 4NPKA 1UM6H 1KC5H 2YXVA 2H2SC 5E1QA 2WNKA 5JW4Q 4O02B 2FIKA 5BQDA 1TU2A 4Y7MA 4Y7OC 1RZJL 1A7RL 5AAWA 1GW6A 4XPHL 5ADPL 1R5WA 3OKNB 4O4YL 3QJFB 4OZGA 4TQEL 1HINH 3ZYOA 5HP5A 3SDCC 5IB4A 1NAML 4N2AA 3BE1L 4Z7QB 15C8H 3T3MF 4MYPA 1JXFA 5DI8A 3BP7B 1UYWL 4F7EB 1B6DA 5ELIA 2XN9B 4DKFL 4NI3A 4AEEA 3TEZA 5HHXH 3LDBB 3VXOA 5CJXA 2E46A 2Y7NA 3C12A 4OSUL 1WWWX 3FH8A 2HSIA 3HEIB 4NJ9L 5EU4B 3VQLA 5EU3B 5GJTL 4I0PB 1TQVA 2F18A 3H42L 1YN7B 4M43H 3QJHB 1MXDA 3VFWB 5L4JA 4PJAE 2EO7A 2LFEA 2X2UA 4AGQA 5EZLA 1JD7A 4U2ZA 3O2WH 2CIKA 5CF3A 1SY6A 4L3EE 1IBHA 1DO5A 2NY6D 1T0OA 2OMVA 1NICA 2GB2A 2FO4B 4BGLA 4KI5D 3WTTA 2BCKA 4WUKL 5D93C 3SGJA 4UTAA 2AABL 3UABA 2JKJA 4A7VA 1HN1A 4ZXBB 4PJ8D 3D50A 1SXNA 1QFWM 2BIQA 2WLMA 3FU8A 2AK4D 3HG0A 2G75A 1MFEL 3HKFA 5FGSA 2OYMA 2GJ6A 3AW5A 4NQDD 5MEPB 1LE5B 5IV2A 4RGMB 5FO2A 4JQXA 4FLSA 4NQCA 1ZVHA 2W0LA 4QRBA 4Y9CA 3ASOB 1OKEA 2YQGA 3ROOB 1XXDC 2X1QA 3VI3B 1C1EL 5GS2H 4L3CB 1C16A 1AZCA 1DCEA 2QR0A 1RFDH 4RMVA 1E40A 3FQXA 4UOQA 2MTPA 2FLMA 12E8L 1A66A 5AVTB 3OGOE 4OZFB 1X9LA 3FCSB 5D1ZI 3T9WA 1J7VR 2CGRL 2OR9L 2J5WA 3BZFB 4XP9L 4UTAH 4AMXA 2NY2B 4YDJB 4CSTA 4QNPE 3W37A 1F97A 1HWHB 3B7RL 1DSYA 1ET8A 1HYSD 4KTYA 1H3WM 5E94B 1AOZA 5EEUA 1JPSH 2DTSA 2N4IA 2R56H 5HI3C 5GGQH 3IN0A 3N55A 3ESPA 3V0VA 2VZ3A 1U2CA 2XOTA 3ZHKA 2UWEF 4NLHA 4XCCH 3OKMB 3OAWA 1XSOA 3WE6B 2XICA 3BUTA 1MQKH 4ZX5A 1MY5A 1W72L 3K2UH 4J3OH 2XJKA 2GK0A 3AXHA 3W82A 4I5BB 4NAMA 4OBSA 1A7PH 1EJ8A 4Y2DA 1G7HB 1W8OA 1SXZA 3ES6A 4GSXA 4U1GC 5E8NA 4DP7X 2EXSA 5KWYC 4J4PD 2CU9A 3P73B 3N85L 3K3QA 1IFRA 3GTTA 4QRPE 5D7IB 4PJDA 2ENJA 1P7KA 5DC4B 3WUWB 4AQ1A 2FB4H 3ZVVA 4ZZKA 3ZOAA 4OJDH 4F9PA 4F91B 1CF1A 2VERA 1S2EA 2FL5B 2WP3T 5L4IA 4TTGA 2IMMA 4FXTA 2DEWX 2R69L 3IDIA 2DQGL 1B0GA 2ZUXA 2F1AA 4DEWA 4P4KA 1M71A 3ZTJG 3J27A 1LLAA 3VQMA 4NQEE 2CBQA 1E4XL 3GJEA 4PN6A 2ID5A 2DS4A 4IRZA 4ABUA 2EO9A 3CN4A 4XNXL 4V2BA 3ARWA 1A64A 1AR2A 2ZSWB 3D4GA 1HHIB 3L4ZA 4NN6B 1UD3A 1ZE3H 3I9PA 3GMMB 4R4BB 2V5MA 1PCSA 3V8OA 2K8MA 2EIEA 4KUZL 4FAAB 4U1SB 4HJEA 3ZZ1A 4I48B 5CGBA 2CKBB 2CSPA 3MJ7B 3II3A 5GJTH 3V5KA 1PKQE 1KACB 2VISB 4M43L 3C09C 1S9XA 5TK4A 5AZEL 2W9DL 4JG5A 4YJZL 4WIQA 1IT9L 2D3NA 5F9WB 3O2WL 2Y23A 5E08H 4TQHA 4X6BB 1GR7A 2CMRL 1GJWA 4F58L 2EE9A 3EFDL 1JXJA 1V54B 1ID5I 4OCNC 4W9CC 5FDWB 3ZHNA 3AGWA 4IHBA 4DGWC 3MROB 5LHDA 3S37X 3BP4B 2FLBT 3LKQA 2CK0H 4DGVH 2EIMB 3ZKMC 4MMZA 3ZMRA 3SPIA 5H94A 1WFMA 1AXTL 1T03H 2VLKE 4EDXB 1BQ5A 2A6IB 4RRPA 1PPIA 4XGZB 1X5MA 1QD0A 4H88H 3QXDA 4MNQA 1LL1A 2WCGA 3RTQD 5GPRA 3OKOB 4H0HB 1MELA 4GG8B 2P5EB 2JK5A 5IBTH 1DZBA 1CLYH 2JJTC 1TU2B 1XX9C 2WZ0A 3Q5TA 3RGBA 3SYCA 1OB0A 1C1EH 5AAPA 5KS9B 2WLYA 1IJ9A 4C83A 1QSEB 2IDFA 3FB8B 4HUXA 5B1AB 3VVWA 5HHMB 1NDMB 2GJPA 1Z3GL 1YA5A 4IU3B 1CQYA 4J4PA 1G7LA 1D7FA 2DJMA 2OSYA 2VSCA 1CURA 3RUGB 1QKZL 4BRJA 4N8PA 5BZWB 3KPSD 4X42A 3ATBA 2ZOKB 3KWTA 2WQWA 5ITFB 2AERT 2DDQH 3C5XA 3B56A 1TZHB 3P4NB 1GS8A 3NCBB 5J3HD 4Q7DA 3VMNA 4BK4A 4HC1L 3H6AA 2CBMA 1PLGL 3G6DL 1XSIA 3LHPL 4XODA 3DX9B 3QA3B 2EDKA 1Q0YH 1JI1A 3DURA 2OTWB 2OX5A 3B3IB 4XBGB 3T08A 4AT6B 1AD9B 1KJ2L 1LK2A 4IBUA 3ZRSA 3EBIA 3T8MA 3T4YB 2WTPA 2BNQD 2G4GA 3ARED 1OF2A 2C9AA 4MJ4A 1YECH 5F3HA 3D06A 5HHQB 4MD4B 2ZUQB 2GFBA 3M88A 3EHBD 3D4YA 2HH0H 3HNVL 3TV3L 2HJLA 1QP1A 4K7FA 4Q6YA 3TA4D 2DMGA 1BIIA 3B2UD 4ICWA 2A9ML 2D2OA 4AK1A 3DI2B 5E5LA 1QNIA 1PAZA 1WIOA 3CE1A 5DJYB 4NUMA 5ID1A 1PY9A 4LSRH 5E7FA 1DL7H 1E67A 1KJ2A 4MXWH 1P4IL 3MLWH 3SO3B 3SPJA 4IRSD 1X6LA 3WFDL 3BPOB 1PS3A 3WIFB 5HI5C 4K9JA 3KPSE 2ZXWB 2VL4A 2ZWKA 4BH8A 4WLCA 4FXGC 2KUTA 1SFHA 4G72B 5AOKA 5FYKD 4RGMC 3DIFA 4UZGA 1K3IA 2WLLB 3UROR 3KL0A 2ZKWA 4WY7H 5IESH 2C5DC 4UT6A 1GZPB 1IGJA 1UOVA 4I0PC 1AIZA 1OCCB 2CJ3A 2GK2A 4JUTA 4V1DB 2Y2WA 1MAKA 4ZAKA 2HYMA 3QW9A 4PRIE 1L6ZA 4A63A 2EVJA 1RL1A 1DQJB 1QLFB 5AL0A 1UB5B 4Y5VA 3IRZA 2EDQA 4ZD3L 5KVGL 1G9MC 2YEQA 2NQCA 4M00A 3B4NA 1Y0LB 4OCYL 3DX7B 4XVUD 5EN2A 3MNMA 5KANG 3N1GC 5CP7A 1INDL 3IDYC 4YFLF 5DEZA 1AMXA 4CDHA 5KZCD 1P6FA 1WWBX 3EGXB 1DJYA 1RUKH 2UV3A 1KTJA 4EN3A 3D3VD 4UTBA 1T3FA 2F54D 4UAHA 4DVBB 1GA2A 2VQ4A 5D9SB 3AUVA 4FULA 1U93B 5GXBB 3RJOA 5BJTB 1JSYA 4U1LA 5J6GA 3D0LA 1Q90A 3KM1A 2F68X 4HUWB 1SDDB 1CLYL 1RSFA 2X89A 2M26A 2D7NA 4FQIH 5CINL 3FRPA 5E0QA 5IHUH 4LARL 2ZUUA 1SHXA 5IQMA 2HAZA 1TCRA 4DHLA 1LK2B 1QUPA 3UJTH 1S7SA 2WOBA 3KH4A 3EYUH 5IJBC 3CQFA 4HUXB 1E5CA 1X5GA 3PP3K 2Z35B 4P2RB 2V3EA 4AL8H 2WM0A 2P5EA 4O2FB 5I8OH 4YDLB 2CH8A 5FM5M 2DDQL 2YFOA 3O3DA 3SDXA 2G60H 2UXFA 4FF9A 4QTIL 4M9OA 1JFQL 1PZ5B 3P4NA 3UGUA 1DVZA 2DLFL 2NY6C 2YBRB 3RWCB 4LHUA 5ACLA 1PLGH 3SHSA 3HRZB 1NCJA 4N5UA 1GC1H 2O5NA 5EIVA 3B6SA 3TV8A 5DDHB 1KBVA 4U6YA 1YEFL 3HB3D 4JHAH 4PUBL 4XCEA 1JF1B 5HGAB 3INUH 4AJYV 1S8DB 2RIKA 5CFAA 2CO7B 1MAJA 2NNRA 4PJGB 2F54E 1MRDL 1Z9OA 4K15A 3MYZA 2ICEC 4ZZFA 3BVXA 4L05A 5C0FA 4N26A 4XWGH 2GABA 2BXZA 5IMMA 4I3RH 5LNGA 3AWEA 4QRQA 3PXHA 2A3TA 3PP4H 4XZUB 1DQLH 4Y4FA 5FCUH 1YMME 2FQDA 4JRFA 3NSFA 3FB7A 4YSRA 5C8JA 1K3ZA 1FL6A 1NDGB 4P2QE 3FQRA 1EH9A 1WA0X 3VD0A 3D7PA 4B95C 1L4IA 3QEHA 1G9NC 4R5TA 5IBUB 4EKXA 5LGHL 4FFZL 1MFAH 5F1IA 2P1YA 3BGAA 4YSAA 4JFYA 1U8KB 2DJ4A 3BWUC 1F4YH 3FTZA 3RILA 1C5CL 3MLSL 5F89B 2B15A 3SYPA 5IESL 1J8HB 2R9HC 3I6KB 5IBUG 3S8GB 3E6HB 2D2CC 1RAMA 3FFDA 3QUKA 5IUSA 4W4OC 1ZS2A 2YPLD 3CH8A 4KDTA 5J6SA 4J5VA 4ODWA 2VKWA 2FO4A 3ZSTA 3EZ8A 1QI3A 4PAZA 2OTUA 4I3SH 2AK4B 4NWTL 1R5IB 4NJ9H 1NIFA 2ADJB 4NQED 1FC2D 2WVTA 1MHHA 3FC8A 3MTRA 1IM9A 2GSIA 4I2XE 2VN6A 2GEQA 2VH5H 3FPYA 4G8FB 5DFAA 1KWKA 5I1IH 2BINA 3F58L 3HW7A 2UUDK 3CLFH 1QLEL 5TF1H 5C08D 4C47A 2M8XA 3IMUA 5HGHB 3GZKA 2VL5A 1ID2A 4PRDA 2XVBA 1CO1A 2DEYX 2HT3C 1UOWA 2XYCA 2CGZA 2WSDA 3LH9A 2QKIA 2COQA 4YUEH 2EVGA 4L1DA 4XNUH 5EORL 2YOAA 5EZLB 3FO2B 1RZKL 1ZTXL 5E1GA 7CGTA 5FYKL 5ISZE 2L04A 2CA3A 3KG5A 1U3HD 3QULA 2A9NL 3VXMA 2GCYB 1J0HA 2NY1B 3MGTA 4YNYA 4G8EA 4KV5F 4IBVA 5CP7B 3VXOB 3S9DB 3W5NA 4B6ZA 4NZUL 3RY4A 1L7TH 3K6OA 5JYLA 1IIIA 1N8ZA 3TH2T 1P7QB 4KNUA 4K23L 5IVOA 3BVUA 2VN7A 4NRYA 3PPEA 5FK9A 2B5IC 5SWZB 4MXQC 4GRLD 1SXAA 3T77B 2QR0B 1AZBA 3QXVA 3IF1A 4F7TA 2YPVA 2W65A 2BZDA 5G5DA 2X4RA 4WW1A 3V8CA 1WBZB 1CGSH 3PFUA 2GC4C 1QFOA 4JKMA 5HDOA 1S7XA 5ICXB 1WAPA 1AD0A 1NBYB 3T3PB 5GGQL 3QZOA 3ROLB 2H9GB 4OZFH 4F8NA 1A4CA 1KXTB 3VXRA 2K0RA 4N68A 5F1OB 5C0AD 1P7HL 4GG6B 3FUIA 3BEVA 2VE6A 5JW4N 4JR9L 4JG9A 5DLMH 4OZIE 1RZIB 3NVQA 2GQHA 4PRNB 5I0WA 3UPRB 4AWJC 4HS8H 2A0LD 3LEVH 4I0PA 2W80C 2FECI 2XV6B 4PHZA 1UWXH 4U33A 1T4KB 3UG5A 2YD5A 3QIBB 1ZA3B 4AI7A 4WHYH 1CGXA 4CDGC 4OCXL 3QRGH 5IROC 5BJTA 1I1FB 4RETB 5CJOL 5I0ZA 5JDJA 1BPVA 4LCIH 5D2NB 3QDJE 4G9FD 2LU3A 4K7PL 1OP5H 3IB4A 3VFRB 3J8F7 5F9WC 2X6AA 4XPGL 3D6GA 4HXBH 2AGJH 1OAKL 1RZFH 3GSXB 3LRKA 1YEGL 4Z18A 3BP5B 2P5WB 2Q8BL 4TVPL 4YDVB 5GJSL 5C0ND 5JHMA 2FDBP 2I27N 3NZ8A 2Q8AH 1J5IA 5A43C 1AJ7L 4O2EA 2P3YA 2X87A 3I2CH 4MAUL 5CUSH 4L23A 1G94A 3QCVL 4KUCD 4B96A 1MWAH 5TTRA 4IKNA 4A37A 4HOZA 4M5YL 2IWKA 3INOA 4FNRA 2C1PA 2NZIA 3CZNA 3GNML 3VXME 1FF5A 2IGFL 2WLKA 3ARFC 2ZWYA 3L5WA 2HVJB 2IDCA 4NUPA 3V95A 4MZIA 2FO1A 1FLRL <