3FSWA

Pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaaahaaam)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCAAAAHAAAMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Azurin
publication title Metal-binding loop length and not sequence dictates structure.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fswA00
4FA7B 4A2DA 1KYAA 4A68A 1NZRA 3V9EA 4BWUA 5B7FA 1IKOP 1X9UA 2YAQA 1JXGA 3QJTB 1NPJA 3WKQA 2PPCA 3HB3B 1PZAA 3DIVA 4UF7C 4HALA 2EINB 1KCBA 1SHWA 3X1GA 1NDTA 3UAAA 3IN0A 2ZOOA 2FQGA 3OMNB 4HCFA 1J9QA 3QJUB 4KNSA 1ADWA 2XV3A 3EF4A 1CC3A 3H4FA 1MG3C 1QHQA 4KOCA 3NJKA 1E5ZA 3RYMA 3DKHA 5TK4A 4AKQA 4E9SA 1KV7A 4E9VA 5B1BB 3TBCA 1XMEB 2GI0A 5B1JA 2AANA 1A4AA 1GY1A 3IE9A 2OV0A 4P5SA 2WO2B 4GXFA 5AKRA 4A2FA 3NYKA 1JZEA 3ABLB 1L9TA 1KBVA 1GY2A 1AOZA 1KDJA 5B7EA 2FTAA 2XU9A 4DP8X 1GS6X 1SJMA 3ERXA 4YSQA 1V54B 2Y1AA 1E5YA 1PZCA 2CCWA 2CBPA 2PCYA 4JKNA 3MX0B 4BK5C 7PAZA 1WA2X 2PPAA 4DP5X 2JXMA 4QKTA 2NRDA 2BW4A 3FS9A 3BQVA 3X1FA 4CSZA 4G71B 3PAZA 3TASA 1SHXA 2IWKA 1ET5A 4G7QB 1V55B 2HRGA 1KCWA 5AZUA 3NJNA 3QJQB 1J9SA 2EIKB 2IAAC 5I6KA 4HCIA 1SF3A 1BQRA 1ID2A 3FU8A 1EZLA 2YAFA 4HCGA 1WA0X 1OF0A 1SNRA 2BP8A 3N2JA 4HAKA 1A65A 1R1CA 1EHKB 1SFHA 2FJSA 5B1JC 4ENZA 5LDUA 1CYXA 2BO0A 2DYSB 2EIJB 2DY2A 3SQRA 1E65A 2FT7A 4EF3A 2TSBA 1L9OA 1CYWA 1GS7A 3V9CA 1GYCA 1J9TA 3FQ1A 3FSZA 3JTBA 4E9QA 2FT6A 1VLXA 2BW5A 3NJFA 3JT2A 4G72B 1A8ZA 2EIMB 2FQEA 2CUAA 4P5RA 1WS8A 3FQ2A 2H5UA 3TU6A 1OE2A 3PAVA 2BP0A 4N8UA 4YSOA 1NIAA 1PLBA 2XX0A 5I6MA 2XX1A 1UATA 3QQXA 5TK2A 3FPXA 5PAZA 1I53A 5D4HA 1BYOA 1KDIA 1NIFA 4UAHA 4JHVA 1M56B 2DV6A 4E9YA 1AZNA 3WNIA 3ABKB 2BWDA 3AY2A 3CG8A 1JZJA 4YSSA 2HX8A 2H3XC 2HZHA 2MTAA 4NB7A 1IC0A 1GW0A 3S8FB 1PLCA 1WA1X 2J57A 4KNUA 4YVUA 1WS7A 3NSFA 1JZFA 5B7MA 3ZX1A 2PP9A 1JXDA 2AZUA 2PPEA 3NP3A 3KW7A 3FU9A 2AFNA 4GP4B 2VM4A 3ASNB 2Q9OA 5B1KA 2XXFA 3QPKA 2HRHA 4W1TA 4A2HA 1BYPA 1AG0A 2UXGA 1GSKA 2YXWA 3X1BA 4YSEA 4DP9X 2XVBA 3CVCA 4BDVA 2B08A 1AR1B 1XB3A 2VW7A 1QNIA 2X88A 1OCCB 5IY5B 2R7EA 1JVLA 3IBOA 2XLLA 1OV8A 3X1NA 1AS6A 1M57B 1BQ5A 1PNCA 2P80A 4CSPA 2JKWA 1IUZA 3OMIB 2CALA 1IBYA 4X4KA 2BP0B 1L9PA 1BXUA 1TEFA 5I6PA 1M9WA 1PF3A 1TEGA 4MFHA 2EILB 3S3DB 3SBPA 2YAEA 3CVDA 2GC4C 3FQYA 2LLNA 3CZUB 4AKPA 2Y69B 1BXAA 1PCSA 2YAPA 4HIPA 4KNTA 1JZHA 4HZ1A 4DP6X 1RZPA 3ZDWA 4Q8BA 2GC7C 1NWPA 4YSTA 5D4JA 1RZQA 4YSAA 3SBQA 4F7KA 1FA4A 3C75A 1ZDQA 2MRYA 2I85A 2HLEB 4GY4A 1ZDSA 3GDCA 4A2GA 2IH8A 5I5MA 1L9QA 2PPFA 2FWLB 1ASQA 1T5KA 6PAZA 2YAOA 3ABMB 1E30A 2IDSA 2J55A 1J9RA 2VN3A 1NINA 3CVBA 3IEAA 3FSVA 3NSDA 3NSYA 3T6ZA 2PCFA 1PMYA 4DP7X 2X87A 4KO9A 8PAZA 3WI9A 5ANHA 5I5JA 1GR7A 1JZIA 1NIEA 2GIMA 1MZZA 3S3CB 3FSWA 4YSUA 3HEIB 3NP4A 2IH9A 4NAJA 5I5IA 2I7SA 3ZBMA 4BDVB 3TBBA 3D12B 4HHWA 4L0PB 3AW5A 2GB2A 1AZBA 5PCYA 2VM3A 2I7OA 2BZ7A 1A4CA 2TSAA 4A67A 2R7EB 4PAZA 1AS8A 1ASPA 1FFTB 5F7BA 2AVFA 2HXAA 1ETJA 4GYBA 3UAEA 2XXGA 1HAWA 1AZRA 2GSMB 2XWZA 1AQ8A 3GYRA 3PXLA 4BXSV 2OCCB 3FYIB 3WKPA 1JXFA 1TKWA 2IDFA 1IBZA 2UXFA 4KO6A 9PCYA 3X2QB 4F2EA 2VW4A 4AKOA 2BWIA 2BZCA 1NICA 4WTQA 3AG4B 1OCZB 2ZWNA 3NJHA 3WIAA 1MDAA 5I26A 1ZIAA 1BAWA 2IWEA 3QJRB 4A2EA 2FQDA 3PLYA 3NJMA 4FAAB 1OCRB 1PZBA 1AANA 1NWOA 2IDUA 2DWTA 5E9NA 3PAUA 2VSKB 2QPEB 4HHGA 1B3IA 3UACA 2DWSA 2XV2A 3H56A 3NJJA 4WKXA 4BWWA 2BP8B 3KW8A 3T6XA 1NTDA 4UANA 1J5CA 5D4IA 4A66A 3FSAA 4DP2X 3FPYA 3OD3A 3UADA 1BQKA 3FYEB 1WAEA 4YSDA 2WO3B 1OOWA 2XUWA 4W9ZA 4YVNA 2JFCA 4G70B 3FT0A 4DPCX 1AZUA 1AZCA 5I28A 2IWFA 1L9SA 1L9RA 3T6WA 4E9RA 2VMJA 3UGEA 2AZAA 1JOIA 3NJLA 4KO7A 5I6LA 3NJIA 5A7EA 1AS7A 1AAJA 1CUOA 3T9WA 3NSCA 4AX3A 4PCYA 3AG3B 1TU2A 4AZUA 3H4HA 2VSMB 1ILSA 3NT0A 4M4RB 4GP8B 4KO5A 1JVOA 4YSCA 4E9TA 1SDDA 3ASOB 3EH4B 1OE1A 2B3IA 2QPDB 1PNDA 1OCOB 3TA4D 1PAZA 2IDTA 4KOBA 1JERA 2IDQA 3EH5B 3G5WA 7PCYA 3PCYA 3UABA 4BXVA 1OE3A 3CDZA 5AFAA 2HX7A 1E67A 3AG1B 1NPNA 3L45A 1GS8A 3FU7A 1NIDA 1A4BA 1MZYA 2YAHA 2RACA 3GXUB 2ZXWB 2E86A 3ABGA 2HX9A 3BVDB 2PPDA 1AIZA 4K9JA 2J56A 4E9XA 4G7SB 4Q89A 2PLTA 4N4YB 1DZ0A 2QDWA 3EH3B 1CURA 3T6VA 3MBWB 2YARA 5I6OA 1HFUA 1XB8A 3ZIYA 3EHBB 3WG7B 1SF5A 1J5DA 2DYRB 3U25A 1ET8A 2CJ3A 1DYZA 2UX7A 4TXVB 1N70A 1PLAA 1BXVA 2XV0A 4RH4A 4E9WA 5F7AA 1AG6A 5I6NA 1F56A 1ZIBA 2UX6A 1N68A 1QLEB 5EHFA 1ASOA 3SBRA 1W6LA 1X9RA 1ZV2A 2GBAA 5B3SB 3IN2A 3OM3B 1ZPUA 2FNWA 2ZONA 5B1AB 4DPBX 2QT6A 4JHUA 2YQBA 3PPSA 4YSPA 1V10A 3N55A 4YSRA 1A3ZA 2BHFA 1XB6A 2H47C 4AI7A 4BWTA 4M3HA 3S3BB 3AG2B 6PCYA 2QDVA 2W88A 5FC9A 1SDDB 1W8EA 3DTUB 1YLBB 2J5WA 1FWXA 1SFDA 4DP1X 2UXTA 2A3TA 1AACA 2PP8A 3X1EA 1ET7A 2P80D 1URIA 4QLWA 1NIBA 1KGYE 4DPAX 1W6WA 2YAMA 3AZUA 4F2FA 3S8GB 3CDZB 3QJSB 1RCYA 3OQRA 1HAUA 1PY0A 1RKRA 3FU7B 4ZK8A 4G7RB 2VW6A 2XYBA 2N0MA 1ILUA 2UXVA 4DP0X 2PP7A 1KBWA 2YXVA 3T71A 1MG2C 2Q5BA 3NJGA 1JZGA 2OJ1A 2W8CA 1BEXA 2FQFA 2CAKA 2WSDA 4DP4X 3QJVB 4GP5B 2GHZA 3WNJA 2FT8A 3OMAB 4YL4A 4NERA
chains in the Genus database with same CATH superfamily
2X44D 1KYOK 5C08D 3LKOA 2GK2A 5C0DA 2KPWA 2YGQA 2UZIH 4XNZC 1KOAA 4MB4A 4OCXL 1RZJC 5DEGB 3GGWA 4NN5C 4DN4L 4F9LA 2CHDA 2OPCA 1JXGA 2ATAA 4XBMA 5LCVL 1NPJA 3I6LE 5C0CB 2IAMB 2P43B 4L8SB 2Y5QA 2OLDA 2VL5B 1J8SA 5JPNA 2HJLA 1UACH 2CRMA 5FDWB 4JFED 2V8LA 1GGBH 1UZGA 4UOW0 4J3VA 4WSKA 3VQ1C 1MLBB 3AS3A 4M1CC 4QNPF 3FH5A 2IGFL 3DTDA 3QA3A 1HSAA 1WEJL 3HPJA 3KLAB 4KH9A 4Q9CA 2NTSP 4JKKA 2P9RA 2XWXA 3QH3B 3MV7E 4OUUB 5DI8B 1KV7A 1TMQA 4X9BA 3VXSD 4S2SA 5DQ9A 3PWPE 5E1AB 3TBCA 4KK5C 5DWPA 2CMRH 2QGEA 1A4AA 2CKBH 3TZVC 1A1NA 1KIUA 2WO2B 4CC0A 3HAEB 1QSED 5DLLA 3IDIA 4N25A 4JFDA 1PKQE 1U95B 2B1AL 2YPLA 2VKXA 1J18A 4XPAL 2VR9A 1OY3B 2H26B 3K6SB 3CFTA 2G9HA 3K80A 1OLZA 4KVCH 2KZKA 4G80A 1MNUH 4LPCA 4QHNB 3QG7H 2JELH 2OL3L 4YOKA 1NFAA 3GWJA 3MLWH 4HUXA 1FIGH 4Y5XB 1T1WB 1YUHB 3VU1A 4MDIA 1I7UB 4C56B 4C83B 4GG8B 4M3JA 3VD9A 5K1JA 1CICD 3B7TA 3T8XA 2YMOA 4J3SA 4G71B 5JYMA 2DJ4A 1MCBA 2ZUQC 3TX4A 1HCYA 1FCGA 2EIKB 1MF2L 1C08A 1L4IA 2I07B 4N68A 4KQ4H 5BZZA 3KHOA 1YPZA 4J3XA 1FZJA 4HAKA 1GYWA 1ZAGA 2BP5M 4NYLB 5C1MB 1X5HA 2DY2A 3MBED 3EIFA 4FF9A 3SQRA 1XGPA 3B3BA 5J1TC 4K9EC 4G82A 4HISA 5HY9B 2ZWZA 4KK5D 3NEXA 4NT6B 4P4KB 5HSFA 4MCZB 4OF6A 4R3SB 2EC9T 4OZHF 3L4XA 5GRYA 5JW5B 2F53A 4PBVC 4LXFA 3OKYA 1SXCA 2CUAA 1IL1B 3GJFB 3RTQA 4XBGB 5EEXA 1A6ZB 4W9EC 2H5UA 1U8CA 4NKMA 5GRJH 4X8GA 3HE6B 3MRMB 4JANB 1WGVA 3CLEL 3IGUA 4XCYA 2JKNA 3SE9L 5PAZA 1T2XA 4C47A 4G1EB 2XG4A 1X5FA 5HDQL 3S88H 1VACA 1BMGA 2VRAA 3S4SB 3S2AA 4JFFB 3HC3L 4DOHB 2X7LB 4HUMB 4NGHH 3QXAA 2FIKB 4AEIH 1AZNA 2VTFA 3NIFE 4K8RH 3THMH 3VFVA 5C8JA 4FJ6A 5EF1A 3ZL4L 3OC5A 1AHMA 2Y7SA 1YMMB 4OCXH 3LQAC 4DN4H 4YVUA 4HVBA 5IF0A 3PF2A 4HJ1A 3V55A 4GRLB 4NQDA 4NRYA 5LCVH 2X70B 3S35L 4I3SL 4PJIF 3PS6A 3KJ6H 1CZ8L 1HWGB 4U7MA 3S96A 2UYLA 2AQPA 3GINA 4RAHA 3UYRH 1JZ6A 4K7PL 3ASNB 5JNYB 1IM9B 2C7UB 4G8EA 2BFGA 3DRTB 3OHXA 3QULB 2B1HH 2IGFH 2VLLA 3CVCA 2C1PB 1WEJH 4FQ2L 3I6GA 4ISVA 4UB0L 4WU7A 2ARJQ 2KH2B 5DUBA 3QZWG 3Q2VA 1ZLVH 3LAFA 5IUSA 4X9IA 5C0NC 1CFQB 1CF1A 4EJ1C 5JW4Q 3L4CA 4PJ9D 1IBGL 4LSSL 3KGRA 3UPAA 3NESA 5CKAA 4YGAB 4CSPA 1I3GL 3ULVC 1AXTL 2B1AH 3PNWA 4XPAH 2UY7B 5CJXA 3SBWC 3FRPG 4G6KL 2F15A 4KITB 1A6TB 2I60H 5I6PA 3X11A 3VCLB 4MFHA 2R1XB 1G7LA 4WGKA 3C6LB 3GXPA 3I9AA 3QWOA 1A6PA 4FCAA 1BZQK 2GCYA 4LLYA 1QABA 1YNKH 1AIFB 4NQVA 3FTWA 1CD1B 2CSPA 1LDSA 4FQ1H 3WYRA 4ODVL 4WTWA 5D1ZC 5L8LB 3RDTA 5I1IL 3GXMA 4OGAC 3O8XA 3WTYA 1RZQA 3BH9A 1R9FA 5KUKA 2JB6A 3AREC 3UAJA 4PV9A 3DMMB 4FTVD 1ZCRA 2FEEL 1TTCA 4CJ1A 3IMRA 4HUWB 5BVPL 4YMPA 2PKDA 3GDCA 3FHEA 4PWGA 4U33A 4LSVL 2B4CL 3L7EB 2I27N 4JGUA 2RA1A 5KZCD 3IRZA 1LO3L 2J55A 1T1YB 3W39B 3SZKC 5FKPB 4GRWE 4KTGA 5DU7A 5GS2D 1OTTC 3TBVA 4X6BA 2PYFA 1PMYA 4DP7X 3K2MC 1XAUA 1A64A 3BVUA 1KENH 3WI9A 3S3CB 4YSUA 1T6WA 3AWGA 5CS7A 1A7QL 3U4BH 5AOZA 1MCQA 3B7UX 4DUWA 3VTMA 3TBBA 2CLZA 1MCHA 3AW5A 3F5WB 4AV0A 2NY6B 3LIZA 1ETZA 2IMMA 3IJSB 3RZCD 2ZP8A 5HTSA 4A67A 1AD0A 2A6IA 1I8LC 4ONHA 1BLNB 3EGSA 4Y1AE 1BMZA 1QFWI 4L8CB 1Q1PA 3CLEH 2F54D 5DK2B 3VH8A 2IANB 1FL5B 3VA2C 5LN4A 3SE9H 4WK0B 2H4EA 2QPFA 3O11A 3FQUA 3IFNL 1KBGL 2NW3B 3VVVA 3ECQA 4G1MA 3FUFA 5I1EH 4FKEA 5C07B 2BHYA 4Y2DD 2TRYA 1IAKA 3TP4A 1RERA 4AKOA 3V8OA 2J43A 3T0ED 2GJRA 4IBYA 4ETQA 1FBIH 5AL8A 1U8OA 3FQXB 4QHKJ 4I13B 3I85A 3A4DA 1CDJA 3FQRA 4DT2A 4BCYA 3UYPB 1QSFD 2EE3A 5D5ME 4AGMA 3NJMA 4LL4A 4OCLC 5FW8A 3S35H 5I75C 5FYLD 3JWNG 1IAII 4I3SH 1SJVA 1UH2A 2FJGA 3WGVB 3O9WA 3PAUA 4WW2F 2WB1A 1BF2A 4PJAA 1CZ8H 2GW5A 1N9PA 4MB5A 3VXRE 1UZ6F 3AQDA 3DURB 5KSAA 3WJLC 2HB0A 4K7PH 3W9DB 5I0ZA 1PKOA 4UMSA 4N9OB 1I8IA 4Z5RA 2XQYK 3O0RL 4ZMNA 2CO6B 2VDRL 2PCFB 1UCTA 4B9CA 4Q6IA 3P4LA 2HT3D 2XN0A 4FQ2H 2LQRA 3KYMA 3D0VA 3ZW3A 1CQKA 4EOWL 3KXFB 5TDNB 2WO3B 3PNRB 5HJBA 4OTXL 4W9ZA 4XNXL 4LGRB 5KYYB 5I8OL 1KT2B 1IBGH 2XWTB 4LRNH 4LSSH 5CGYD 4HMDA 1XSKA 1NGWA 1OKEA 4I7ZC 5DJDB 3BW9A 4HCRL 5DD6B 2WLYA 3QDME 5EFIB 4G5ZL 5IROA 2JJWA 3KBEA 4X5WA 1KLGA 4G6KH 4C54A 2QSCL 1H6UA 4LLWA 1S8DA 5T1KD 3OWEA 3F7VA 4S1SL 5KYUB 1FG9C 1E43A 1TEYA 5HHQB 2WBJA 3S8WA 2NR6A 4EN2A 1F4WL 4BFGA 3FQWB 5L88L 1S7QA 5D6DC 3OTTA 4ODVH 2ICWB 4KVPA 3VYPA 1TNNA 2WYHA 4J1UA 4N26A 2HJFA 4JFHD 3P40A 3QEQB 4CADB 3ALPA 4P07A 2VOTA 1OO2A 2VQ1A 3EHBC 3P4NB 5HGDA 1Y1DA 5B38G 1QPKA 5BVPH 1UKSA 1USZA 5D7HA 2ARWA 1T03L 3P2BA 4RISL 4HJ0C 1FUNA 2E4TA 4HZLB 2YAHA 4X6FB 3GXUB 3H2WA 3BVDB 3E38A 1I1CA 2X05A 5GRVK 2WUBL 3MDJA 2DYPD 1AHKA 5FKAB 1A7QH 3S9DB 3IGAA 1CWVA 1XO8A 1JSYA 3H42L 3N42B 5GGSA 3WG7B 4H0IA 2C8NA 4DESA 5E95B 1S7RA 1H0DA 3GSNB 4E42B 1MH5B 5C2BL 2CJ3A 4NCC1 3RWGB 4TYUA 4PBDA 2W0FB 1YVLA 3LHPL 2JV6A 4P2QB 3VSTA 4JMNA 1IVTA 3CFIC 1ZIBA 1EAOA 4GRMB 4MMXA 1ASOA 2CO4A 4MAUL 2IIJA 2HRPL 3C6EA 4RFOH 1K72A 5F9WB 2VO8A 3PWUA 1XSIA 2ATPA 2OP4L 1AJ7L 3IFNH 1FNSH 4N2MA 1KBGH 5B1AB 5IHLB 4M7LL 3EHBD 3KG5A 1OD9A 5C0EB 2J8UF 1B4RA 1A3ZA 4LE8A 3FSOA 3IAQA 3FUIA 5DJZA 4AEEA 2VDPB 2VXQL 1YHPA 2NY1B 3C12A 1Y18B 3L3HB 4IRSA 4N2NA 5IUCA 3G04B 2AEOA 4FFZA 2Q8BH 1SFDA 4DP1X 1MEXL 1MCFA 5IG7A 3WIHA 3MC0A 2GIYA 4L5FE 5L7XL 4Y2NA 3UBXI 4PRBB 4X7SH 4PJXB 5EDXA 4POZD 3BIKA 4RIRA 4TQPA 3EO0A 4FQXB 1NC2A 4J6IA 1PLGL 4IGBA 5BRZD 1IC4L 2VDRH 1I1AA 2Y6SC 1FZKA 3L3IB 5DMGC 1NCBL 1J05A 2IFGA 4PJ5B 1GIGL 1OL0A 2P5WE 3B9KB 3WY4A 2ZIDA 3T71A 3MX0A 3Q43A 1XAKA 4EOWH 2WQSA 4FXGB 3SE8L 5JYLA 1WP6A 1DANU 2ED9A 2WSDA 5F7NC 2DQIH 2F1EA 2FLRT 4OTXH 4XNXH 4MA1C 4D7PA 4YL4A 4Z78B 3KPNB 3GDBA 2NZ1A 5E2WL 1ID5I 1K9TA 4V2BA 5AQ0A 5HYIA 2Y6TE 4NP4H 4G5ZH 5GGUB 4XRCA 1MHHA 2J1XA 2VT0A 5HPOA 2R29A 1R3IH 5DT1H 4KY2A 4JZJC 4DVBB 1PSKL 2MMXA 2YAQA 1MWOA 2QR0A 3C09B 3QUYC 4NO5B 4S1SH 1IO4C 1E90A 3BRDA 1P4UA 3RY6C 3HR5B 3MV11 1F4WH 4N2HA 5L88H 4ZXBC 3QCVL 1S9YA 1NGXA 3SE6A 3HG1B 2ZCZA 3N91A 4UQ3B 3MNMA 4NNYA 2NDFA 3NRPA 3U0TB 1A66A 1P5UB 1IGJB 2C9RA 5IVZB 3GUFA 3U7WL 3EF4A 2FEJA 1EVUA 5D6CA 3RGBA 5CD5C 3TEZA 1QX1A 3WTUA 4YEEA 4NXKA 1X5GA 5D1XA 5B1CA 4BELD 3HC2A 4FP8L 4QO1A 2Y6SD 4D8PB 4RISH 3E7JA 1IJ9A 3HHRB 2GI0A 2PWDA 3L08A 4I2XB 4LSUL 5B1JA 4UYPA 1EDYA 1OAUL 2YGPA 4R9HA 1LILA 1RY7B 1KG0A 1Z9SA 1ZA6A 1Y6MR 4GQPH 3SDDB 2WUBH 2VDMB 2A6DB 6CGTA 1IZJA 2QMJA 4HWEL 3GI9L 2YQGA 4Q2ZA 3H42H 5GISH 3K71A 5J1AA 5GSVA 1J48A 1KTLA 2YPLE 5HDWA 4BQCA 3CFJA 5EZJB 1I8KA 5FF6A 4M1DL 5CFAA 4R0LA 4LPWA 1ZKAA 3L3JB 5AZUA 1BJMA 2YMXH 4U1IB 3E9UA 1J9SA 5GGTH 4MAUH 1LO4H 3ECUA 3S0PA 4IRJA 4LDLB 5EBWA 3V0IA 3WEBA 1AJ7H 4ZYKB 4XI5D 3TYFB 4ZMPA 2X4TA 1WA0X 3WN5A 1YJDC 4M7LH 4PV1C 2FJSA 2ENYA 4MJ5A 1XCQB 4JRWA 3F6JA 1X5IA 2A4CA 3BPLC 3BRGC 4Y88A 4ZMZA 1TFHA 3DLQR 2VXQH 1M1SA 4M6AA 2N56A 3MJ7B 2KC0A 5CINL 3WHXB 3HCVA 2SEBB 1YY8B 2WP3O 4Y1SA 1Q0XL 4C57C 4QRTA 3HC0B 3AU1A 2ZKHH 2N0KA 1CFSB 3GT6A 1GOHA 4XHJC 3ZKND 4WI6A 5L7XH 2YK1L 3JWDC 4IHBA 4WW1A 3T3MF 5KSVB 1DQDL 2FT6A 4HWZA 3N9GL 1KCRL 2DLFL 1MNNA 3WBDA 4XWGL 1PLGH 5J12B 1XEUA 2D4FA 1M7DA 1IC4H 3QRGL 2BNQB 2LAGB 3QUKB 1PLBA 1NCBH 1IFHH 3B37A 3EXLA 2F53E 1I53A 2H1PL 4LLMA 4I87A 1FG2A 3FONB 1KDIA 1NIFA 3SE8H 1BECA 2X40A 4IHOA 4MNGE 3OKNB 4UAHA 3NIGF 3UH8A 4YDZA 1HC1A 2WWMC 2XTJE 2DWXA 1NAKL 5HI4C 5CN3A 1IEAA 5IB1B 4NBYB 1F0LA 5EOTA 2IBBA 1O6SB 2K3HA 3POCA 1T66D 5EDSA 1I1RA 1IBFA 1BFTA 2PXYC 3GC3A 2R4RL 1KWGA 2IH3B 4QXUH 3OJDA 4FI8A 4Z3IA 5FYKE 1PSKH 1EAPA 2UY6A 4XMUA 1ZWIB 3VXOA 4EKJA 4FXTA 4FQIH 4ZQKB 1BJ1H 2BNRA 2A5UA 5EPMB 1VEPA 3QCVH 1HQ4B 1AQDB 4IKLA 4P2OC 4K7PY 1KLFA 4J3WA 4PR5A 4QY8A 4AH2A 5M95B 3AVEA 5B1KA 3JWNH 4D0CA 3ARFC 1TTUA 5DRXB 1FZOA 2UXGA 3RZWA 3D18A 3FK3A 5KBPA 2I69A 2XVBA 2HFEB 4PGDB 4P23A 2YKLL 1W0YT 3F7QA 4NSKA 4DEPB 4E5XA 4LGSB 4Q6KA 4JCWA 2O61A 4FP8H 2FO4A 5JOEA 4IBUA 1P7KA 3V0JA 3VW3L 4HUKB 1CO1A 1RJYB 4LSUH 2Z31B 1BD2B 4Z3GA 1F3JB 2G5RA 1OXYA 2JVUA 4N0RA 4RFNC 1ED3A 4NN7C 1DP0A 4LNRA 4ZFOB 2EYTA 2WWMD 1TTGA 5HI4D 2YBRB 2VISA 2FECI 2CGZA 3B56A 3L3OB 4XB8A 3S3DB 3B34A 5EU6B 4DGYL 4DKFL 1D5MA 2K3TA 5ID0A 2VZUA 3FQYA 3T2NL 4I1RA 4AKPA 4UDTB 1PCSA 2PTVA 3GMOB 4X98A 4KNTA 4HEPA 1P4LA 1HI6A 1G1CA 2BSTB 2X6UA 5ACZA 4OGZA 2QHLA 1FAIH 1RJCA 3L3DB 4ZPVB 5EOQL 1BZ8A 3LZOA 1H5BA 4U1HB 4F1SA 3IT8D 3UTSA 5C08A 4RWYH 3JXAA 3KLHC 1ZXQA 2CPCA 2EE2A 2GFBB 2VQTA 1L9QA 2DICA 2PPFA 2X0UA 4LLQB 4JPKL 5HVFB 2DB8A 2ERJC 1KEML 2HKHL 4A63A 1JZ4A 3ULUC 1VGKA 1X44A 3FSVA 2OMVA 3FTXA 4MZIA 4W6XB 5IIEB 3D2TA 1YY9D 2W5PA 1FVCA 4XMZA 5DFTA 5CINH 4JFEA 1JZIA 3BGMA 4LVEA 2ZG1A 4JUSA 4B9PA 3SYPA 2FL5B 4W9FC 5KBNC 4DZ8B 4PGCA 1YECH 1T0MA 2YK1H 5FO8A 3CSYA 1DQDH 2Y1VA 5EA0L 3W11C 5EN2B 4JJOA 3TV8A 5EUKB 1PX4A 1ACZA 3EXJA 2X2JA 4J3OD 2DLFH 4XC1L 3JT0A 3MSPA 1KPRB 4TSCH 2VO5A 4OZGE 4XWGH 5E4AA 3GJFK 4MWFA 3VXSA 4OB5L 2WWNA 3QRGH 2B59A 4KROD 5ALBL 5CM1A 3K1KC 4OUOA 3QIBC 5EU4B 4HUNB 4K7FB 2H1PH 3R0NA 3QDJE 2OCCB 4NHUB 1OPGL 4N0YL 5GZOC 4AJ0A 1TKWA 4EN3B 3L4WA 2NYYC 1NAKH 3ZDYB 5H37H 3HE7D 4C59B 4R26H 4R4NC 3UTPE 3DYPA 2EXSA 1HT6A 1P7BA 3H9SD 1GKEA 2GAZA 2R4RH 3QHTC 2E9IA 5L9DL 1SM3H 5LBSL 1CICA 3ULUD 4LCWD 3RHWK 4JHWL 4ZAKB 4CBPA 3UJTL 3BPNB 1SJHA 4YLCA 3CWGA 3HZ3A 1T89A 1OAKH 1ACXA 5JPMB 2X6VA 1DQQB 2XWJA 5JQIB 4X99B 5EBMB 5EOCL 2NPLX 2XFXA 3SDAA 3CN1A 2NUTB 3FUJA 3NJVA 2JLPA 5KVMC 4D0DA 3HVDA 4GLRH 5C0IA 3AJ7A 3WFHB 2IH1A 1D6VL 5A40E 2YWZA 4WO4C 2GUOA 1GYVA 5E23A 3SJVD 2ESVA 2ZSVA 4PJAE 3MBEA 1NTDA 4UANA 2XA8L 1ZT1A 2K70A 1H6TA 3RQ3A 4WRLA 1WLHA 5BXFA 1S5HA 2A77L 2Q7YA 3VW3H 4YSDA 2YC1B 5HI5C 1U93A 4Z7OE 4DPCX 4PTUB 2EH8L 4JZOB 2X4QB 1IGIL 3MR9B 4F7EB 2DLEA 3TA3A 3FMGL 3MTXA 1G9MH 3NJLA 3GRBA 4EZLA 1U8NB 5CILL 3RKDC 4DGYH 1I9RH 3A23A 1AS7A 1U33A 3U6RA 3WL9A 3T2NH 3L4UA 1MAKA 1I4FA 2R2CA 3MRLB 1TU2A 1JPTH 1TJGL 2A6KB 4RX4D 4PYGA 1S7TB 2CU9A 2V4LA 5F6HJ 4FJZA 5C0AD 4KO5A 4JZNB 1MY5A 3GSXB 2R9HD 3PQYD 4X8JB 3IWUA 3DUUB 5CSGA 5EOQH 3VXUD 5E70A 4QXGL 2B3IA 4XHQA 3GLAA 4NUQA 4R7NB 1INDL 4B9KC 3AMLA 3KLLA 1OGAD 2A74A 5CSZA 3FUEA 3AXHA 1FYTB 3MLYH 7FABL 1JG9A 3E3QC 2IPUG 1KEMH 4BXVA 3N0AA 2HKHH 1NPUA 2QGBA 3DX6A 5C09B 1TJXA 3BQUD 3QORB 1PZ5A 4N2AA 3ZHDA 3DRQB 3Q2CA 4FG0A 2BOLA 5E94B 1N59A 5IMMA 2P49B 4XCFH 5HI5D 4OCWL 1MRFL 3RL2B 2QDWA 3DOSB 5FW7A 2HKFL 5F7DA 3SE3A 4GFTB 3SKOA 3BAYA 4N28A 1JD9A 1SF5A 2FBRA 4Y8DC 4PJCA 5EA0H 3DGGB 4HOXA 4LZKA 2DYRB 5IVXA 1KJVA 1NAML 4XODA 3S3PA 2AW2A 3WO4C 4XC1H 4WTZG 4LKCB 4PB9L 4F7TA 5I18L 5F9DC 1B2YA 4FFTA 4RH4A 4OB5H 3VI3B 4R4BA 1WWWX 1TO4A 2AJVH 4PJ9A 3J27A 5DZ9A 5B3SB 1J0HA 4PP2A 2MTPA 1OPGH 1PX3A 4ONFL 3TNMA 2F7PA 4N0YH 4BKLB 4CC1A 5KSBA 3WEMA 1E27A 5FUOH 5JORB 5I9QC 2WXKA 2BOBA 1SZNA 4MHHI 4OIIL 1RZ7L 3FO2B 2DLGA 3JQOB 3ZYIA 4WJ5A 1XB6A 1AXSA 2XBZA 2JTYA 4FDWA 3S2CA 3KCWA 5L9DH 3KNBA 4B41A 2F8OA 2ODHA 4JKMA 2AJSH 2IGTA 3DTUB 1X7TA 5CU9A 2PR4L 1FWXA 4WI5A 4U6XB 4I77H 4NCDA 5L4JA 3KL5A 4FTVA 2NW2B 4QRRD 2IPUK 2L7JA 5EOCH 5L6YH 1L3NA 1OLLA 2Z0BA 1MAML 1JYNA 2NSMA 3OQRA 3OXSA 3GB7A 1T21B 1J8KA 1D6VH 2F08A 2YGNA 4S0HA 2XA8H 2KPNA 3E80A 4HV8A 3MGTB 3VGFA 3BVNB 3HR6A 5CP3A 2A77H 2FQFA 4JDEA 4IJTA 5JXEA 4L29A 1NGYA 4OZ4A 3SDCA 4GP5B 4OJEH 5FA3A 1EXGA 3UMNA 3M45A 2ZXGA 5CUSL 3T0BA 1D6EA 3R0MA 4UNUA 1IGIH 2AJZA 4I18A 5HI3D 3SOTA 1BVNT 1U91A 1UQSB 4WZ9A 3NAAL 1JN6A 5B7FA 3RZCA 1Z0MA 2O6FA 3PWJA 3F64A 5AWNH 2UZXB 2JQAA 4K94C 1CQYA 4E68A 1QUNA 2F54A 3LH9A 3MREB 3FO9A 2IV8A 3CQFA 1YYCA 1TJGH 2VAAB 3OV6A 2VLJD 4OLZL 2F61A 5KN5A 1T5WA 1TPXB 1LEGB 3PV7A 4WKZB 1NDTA 2P8MB 4AVJA 2ADIB 4JRXD 5SX4H 1SOSA 4QXGH 4Y2DA 4HCFA 1WCBB 5DEJA 2GJ6E 3QJUB 1INDH 2EEAA 3PL6A 5HHXL 3T0EA 5LHDA 3NK4A 3ECBB 3LCYA 3EFOB 4HBCH 5F44A 7FABH 1QSFA 1R34A 1AMXA 3IF1B 1N3NA 3E2HC 4H40A 3C60B 2ZXEB 4RGNC 5FO7A 8FABA 1F86A 3RB5A 4KUCD 4XPFL 1JGVH 1LD9A 4X80L 4P5SA 5HDBF 3VMPA 1DO6A 4FABL 3II3A 4JJ5B 2W81C 1P7HL 3K4ZA 3CNKA 3D3VD 1MRFH 4QJ4B 4J8RA 2ZX7A 1KDJA 3MOQA 3ERXA 1GKOA 3MNZA 3GJFH 1CGTA 3WMQA 2CRZA 3HG5A 2XXMB 2V2TB 2PCYA 7CGTA 1NAMH 4QF1B 4JE0A 4RRPA 1OAYH 4JFTA 4KAQL 2EABA 4PB9H 5GRWA 2A38A 2ZWSA 4LVHC 1HHKA 4QRBA 4E9LA 4BZ2L 3EOAA 4NUGL 2NY6C 3G5ZA 1Q4NX 1KCWA 4XVTL 1H6EA 4I5BB 4NO2B 5I6KA 4HCIA 4WVRA 4P9ML 5HYJD 3TIEA 1V7ML 3LXCA 1EZLA 3FCTA 4ONFH 4XWOC 1JE6A 1ROCA 1YMHB 1M6OB 1F41A 1W72B 3MO1B 1R1CA 3DPDA 5CR8A 1Q0YH 4JHAL 4OIIH 1Z5YD 1RZ7H 4PJBA 4UV4L 4H8HA 4KXBA 3IU3B 4FYSA 4ZUWB 5F1OB 2AHIA 5IBLD 3DIFB 1UJ3C 3L81A 4F1ZA 1J0ZA 3O3AA 1FE8H 4RAUB 3CFEB 1G7MA 4RGND 3CZFB 4PN6A 2PR4H 4HZAA 1CK0L 4UCFA 3AABA 1NCHA 1A4KB 4E9QA 2FHCA 2AJ3B 2G60L 1RZKH 3BLKA 3DARA 3DETC 3E6HB 4FE9A 4TUKL 3SQOL 3EJTA 1DUYA 4QRUA 5GGVH 3IKKA 3ZRSA 3DX9B 4ELDA 5KYWA 1MAMH 3MNWB 1U41A 4Z0XB 3B5HA 3N5AA 1Z3RA 4FNUA 5EV7A 2EEDA 2DM3A 3GZOA 3MRHA 2GBUA 3FOMB 3JVGA 3QNYB 1SY6A 5E9DD 2FECL 3SDXB 3PGDA 4DIXA 3FHQA 3HS0A 2BSBA 4Q56A 2DYPA 3A24A 3ARPA 3WDIA 2DKUA 2FGWL 3O3BB 3PJLA 4X5QA 5DUML 2J2ZB 3FOLA 2DWYA 2ITDB 1JZJA 1BF8A 5CUSH 1FFPA 1P1VA 2W92A 3NAAH 3VRIA 3D05A 1A7RL 1R3HA 2BSED 2AJYL 4FNTA 4G8GB 4HOZA 3NSFA 1MJJB 4MHHG 3STZB 3ZYOA 3D08A 1EUTA 3QNZA 4H0LC 3BZ4B 3BZ5A 3L1FA 4L5FL 1CDUA 2GJZB 2NUPA 2J6EL 2PPEA 3P0YL 4YK4C 3KW7A 3QJHA 2WKGA 3FUKA 3F7LA 4TMPA 2ZOLA 2HUHA 2E6PA 4NQCE 3ZGIA 5ADPL 3H2PA 1U8LB 4G7VL 3CFQA 3O81A 5JW4N 2YXWA 2BNRE 2XRAL 3JWOC 1THAA 4L4TD 5SWZD 1JGIA 1XIWD 3VMNA 4ZMYA 4PJ8A 2KQNA 1AR1B 4GXUN 2J7LA 3KJ4B 3NFNB 1MVFA 3NVQA 4RWHA 2BY0A 5GIRB 5DFAA 4CC4A 1QTYT 5KVFE 4ELMA 3P3TA 1GZPA 5KBLA 1IEHA 4XPFH 2EDWA 4M9OA 1PZ3A 1ZS8A 4X80H 3T2QA 3TVMD 2B15A 4XP9H 3TT3H 1KUMA 1ZHLA 4M8QA 3LZQA 3N42F 1MJ7H 1TEFA 2WNXA 4PP1D 3QHZL 3C9NA 3EJRA 5BRZA 4AYEC 2EILB 4XMWA 4N22A 1NQBA 3EKCA 3B5GA 1NCNA 1Z9NA 1I85A 2AQ2A 2QADB 2GSGA 4HJGA 4KAQH 4LF3B 4MJIB 1GA2A 3SDYL 2R69A 3QXUA 1I8AA 3BVWA 3HZYB 4MMZA 1CD0A 4NUGH 1PD1A 3GO1L 5E2JA 4OF3A 2WGXA 4XVTH 2I85A 3TBYA 4EXKA 2IQAA 3OKEB 4ZTPL 4P9MH 2Q3XA 1IFGA 3LH2L 1MJ8L 1G0YR 4FQCL 5I5MA 3OC8A 2DEXX 2LR4A 4P48A 3UTOA 2R15A 5IW1A 1XDTT 2Y7MA 1KIQA 4LHQB 4JHAH 3K6DA 3RWHB 2ZOTA 5C08E 3MRFA 1R0AH 1KC5L 2O5XL 2V7HA 5CJBA 2QV2A 2Z0UA 1UASA 2PTTA 5F7KC 2QPUA 3SEPA 4HPOL 1RK1B 5BMFL 1DVYA 1CK0H 4W81A 3PDOB 4PJXF 3ZPDA 5LGJB 3MV7B 4HHWA 4PJ7A 3K5RA 3SQOH 2G60H 3OKOB 2DW5A 3PWPB 4TUKH 2DQCH 2VR4A 4JFEE 2G3NA 3BGFB 4HH9B 3UO1L 1QW8A 1PKQB 1HCFX 3Q05A 3VRJA 3P02A 1RZFL 2AMGA 1WZ1L 4XBEH 4CMMA 1XGTB 3VH8G 1K5NA 3ZE2B 3PXLA 5I66B 4PHXA 4EI6B 3VXSE 2QELA 4P04A 1BSIA 4HLZG 2FGWH 4EI5B 5DUMH 4XNAA 4Y4HB 4U1LB 4KWUA 1J1PL 4UT6A 4R6UA 1VAHA 1QSEE 5HHPA 2BWIA 2APTA 4WTQA 3BKYL 4AQ8C 1BBDL 4BYHA 5I1CL 1U42A 1A7RH 2KUTA 3A21A 2AJYH 1CF8L 1HL9A 1BAWA 1MJUL 1ZIAA 1FZMA 1TZIA 2C9VA 3PFUA 4JY6A 4OCRL 3ZSTA 5IQMA 1MFUA 1AANA 3DSFL 3ME0A 5ETUB 1CDBA 2GBVA 3HG0A 3LQZB 2J6EH 3P0YH 4O58L 5DC2A 2H6PA 1QBAA 4HULB 4MSWA 4HHGA 5AW6B 1PDKB 2VWEE 3FF8A 3BWAB 3BZDA 3GBDA 3STLB 2DWSA 4NQTA 5ADPH 4R90L 2XQBL 4X4XB 2P1YA 4YQXH 4ZX4A 1OSYA 4K8RC 1AO7B 1GZHC 2WBKA 2FD6L 2XRAH 3FL7A 2NT1A 4XE0A 5KVDE 1I3VA 2FB4L 3WKYA 3LSOB 2OTUA 3TJPA 4D0BA 1BQHB 1PPIA 3A6BL 3WS6A 5D71L 2NYKA 2WLIA 4KKAC 3CZGA 3NGBB 3WNOA 4WF7A 1SN5A 5TD4A 4KXZI 4KZ0A 3QJFB 4QT5B 3V0GA 1E8WA 4PS4L 1Z9MA 3EO1B 3QQDA 2H2SC 3HZKB 3G6AB 3TBSB 5MEND 5IQOA 3BEVA 5AAPA 5A16A 1ZHBB 3D25A 4M5SA 2VN7A 4GINA 2IV9A 1A9EB 3UGEA 2AZAA 4LOVA 1MFDL 3QHZH 4TNFA 1ZGLB 1SDYA 5ICYB 2TAAA 5JZ7C 1K8DB 5BQ7B 1UWGL 4E36A 3SDDC 1MFEL 5EN3A 1KB5B 4Z7QF 3BSGA 3H4HA 2YPKA 3WDHA 3SDYH 5F88A 5BS0D 4GP8B 2B9AA 3RY5A 5K59F 4MD4B 5C6PB 1QUPA 3GO1H 3DX8B 2GITB 3HS9A 2VXUL 4KV5F 3WXVL 2GTWA 4TF4A 3FN3A 3R7QA 1L0XA 3DJRA 4JBSA 2CIIA 1S7XB 3ZQ9A 5AB2A 4RNRA 4FQCH 3LH2H 1FNFA 3PWLB 2XZQL 3RIKA 5EEWA 5E7FA 1JWSA 3HG3A 4K8RD 1A4JA 2G5BB 5DVNA 1OE3A 2H2PC 1G5GA 2VDPH 1HWWA 1ANUA 4PRDA 3ZE0E 4KKBD 4R96B 4ZNEE 2O5XH 1W8OA 2CBQA 4KKAD 5SWSE 1OAZL 1AIZA 1EH9A 2DQTL 1UH3A 3UTTD 3WUWB 4HPOH 4A6YB 4HGMA 5BMFH 3FT3A 2F5BL 2BY2A 2CBOA 3U4EB 4AT6A 5I6OA 1K85A 1HFUA 1F1DA 1KBPA 4S1RL 3ZIYA 3G5VA 1G7QB 3HHMA 4P4RA 2CCVA 4LRIC 3UBXB 5EWIL 3KH3A 4P5TD 4OSUL 2GTZA 1N70A 5JZ7D 4P9HL 5DC4B 3O3DB 1GYUA 1AG6A 1C8PA 2EECA 1RZFH 3U79A 4G9FD 1BPLB 1ZHKB 5J57B 4MAYA 1W6LA 2OMWB 3GRGA 2O6CA 2X09A 2ZONA 5J12C 4CBZA 3IXTB 1F3RB 2ALWA 3QIWB 1INQB 4NWUL 4OLWH 1T20B 3EYUL 4YSRA 5CEXA 4POYA 3D5OF 4D94A 1S46A 4BWTA 1CE1L 4X6EB 3BKYH 1HDMB 2ETWA 4FZ8H 5C0JA 1SGKA 4OFQA 6PCYA 4M7KH 1P7QA 1MJUH 2Q3ZA 1GZQB 4IKNA 3IDUA 1KSRA 4N2OA 2CO1A 1JMXA 3QRFM 2PP8A 3DSFH 1U3ZA 3A22A 4QYOB 1TJIL 5ANME 4M00A 4XO3A 3W1ZA 4JGJA 4GRWB 2NX5A 4GSUA 4HJEA 1P5VB 4YDIH 2X3BA 3CDZB 3M7FB 1LK2A 4X7TB 2F74A 1RKRA 4R90H 4F8QA 2XQBH 4ZMWA 5GRZA 4ZTEA 2D9QB 4Y5YA 3VFSA 1K4DA 3PIQA 1CXIA 1B0IA 3LIZL 3KWWA 4W70A 5GRXG 3A6BH 5HGBA 1YA5A 5DVKA 1KJ2B 4HDIB 1QZ1A 2DMKA 3QJVB 4MX7B 2Z7ZA 3H54A 4U1NB 5F71A 4PS4H 2E6QA 4JGMA 4M5TA 1EJOH 4N0UA 4Y1AB 1E9QB 3P2DA 2H3KA 2VDMH 3RGVB 4W9IC 1GOGA 4PRNB 1NCWL 3RE0A 1CD8A 1N5YL 3K6NA 1DR9A 2Z31C 4ZOEA 4JQVA 5CN2A 4NUJB 3MU3A 1MFDH 3CIQA 4YGVA 1X9UA 3ULVE 1A9BB 3BVVA 1W91A 5CO1A 5EUOB 4JEGB 4UTAL 1UWGH 3MACL 3Q6FA 1JHTA 2WXOA 1KV3A 1WRFA 3V6ZA 1SHWA 4NQXA 5E08H 3K91A 5DJ6B 2WCGA 1JV2A 3GEWB 3L95B 2F54E 3HE7A 3FT2B 2WLJA 1ZK9A 2OZ4A 1CD9B 1JUFB 5JO5A 3KPRD 2EUVA 1KTCA 2CRYA 2AXHA 5ESQB 5CCHE 2XZQH 3CMOL 3KM2A 3RVUC 3BN9D 3RYMA 2QGCA 1BZ9A 1EZUA 1NFIB 2OMXA 3MJ8A 4P0DA 1I7TA 4NRZA 2AV1B 2AQ3A 2CPUA 3CD4A 3TS8A 5J11C 2OM5A 1FF5A 2IBZX 2WLMA 4M02A 1AXIB 3F84A 2K7QA 4XBPA 1DL7H 1ADQA 2EDFA 4P57B 1KGUA 1U8HB 4QRPD 2Q10A 1DANT 5DSCB 1AY1L 4L37A 1AOZA 1HKFA 4WDIB 1GS6X 5FYLE 2HP4A 1E5YA 4S1RH 3SJVA 5EO0A 1B4TA 1L6PA 5I1DA 3V6OC 1MWAB 1R5WA 4XGZA 1TMCB 4LFHG 1N10A 1Y0LA 2P7TA 5EWIH 5AVVB 4BK5C 4B96A 4IOIB 2PPAA 4KKLD 1MFCL 3KS0J 3D39D 4OSUH 3X14B 4EBQL 2B4CC 4YDNA 1LJMA 1ONQB 1CGUA 4DAGH 1WIPA 2KERA 3TYGL 4N1CA 1SYVA 2A4EA 2HRGA 1QKZL 2XWBA 5J5EA 1JV5A 4L8BB 2MNJB 4X6DA 4AYBA 3ZDYF 4IU3B 1HU8A 1XGQA 4CSSA 4KKRA 3ILPB 4QRQB 4Y4KB 4FQHA 3OF6D 4NWUH 3VXPA 4KJYA 2HFFA 3TBWA 2DYSB 1CE1H 3RVUD 2R1YB 3D85D 4FNPA 5DA0B 3OKMA 2D2CC 3GSUA 2DQEL 4IEFA 4MLSA 5C0AA 5IB4B 4WI0B 1B0GB 3FQ1A 1R5VB 1Q72H 2X42A 4TL4A 4OD1L 4YO0B 5IFJA 1TJIH 3L9YA 1CLOH 1VLXA 2BW5A 2NY0D 4FMKA 4LU5L 3VWKD 4JDVB 4OM0H 4PJFA 4N9GB 1NBVL 1UZ8B 3BPNC 5INCA 1M53A 4G8IA 5C86A 4GXVL 1YQVL 3V4PA 4FLRA 4GW1A 4JFHE 1Y1UA 1RURH 2NXZB 1YEHL 4XVUC 1CXFA 3R4DA 3BQUA 3K8MA 1OW0A 3LIZH 4Z7WA 4A7GA 4M4PA 1B0RB 1N7ML 5E6IB 1W80A 1ZHNB 3ZT7A 1URZA 2B14A 3LZPA 3FT4B 4N0FB 5IMKB 3FU0A 4JKWA 5DZAA 4YSSA 1FFOB 4XXDB 3AGWA 3W0WB 3HHSA 2ALAA 5E7BA 1QD0A 4PS8A 1NCWH 3HOGA 1N5YH 5IBTH 1GMIA 1HEJC 3Q7JA 4BD4A 3LN5B 1T1XA 3PWNB 2JKTM 5K1VA 3ZX1A 5CHNB 3WFCL 4UTAH 3IS1X 1A5FL 4QXTA 3TV3L 1JWUB 3W56A 1G84A 3CN4A 3MLUH 4WNSA 5AW1B 1A1OB 3CZLA 3BWSA 3QQ9C 4J4PC 4EDXA 4X5PA 1N18A 3N50A 1A02N 3MV8D 2VZTA 2F58H 2WLHA 4U6VH 4KRNA 4YHIA 5B4MC 3UOAB 1YC7A 5DRZB 5DHDA 4WY7H 3Q5YA 5E8OA 3FQTA 3WJMB 2D8KA 3NCYP 4LCCA 4NZUL 1NL0H 4OD2B 2OX5B 3GS0A 3MUHL 2XKNA 1NH6A 3L4VA 3V4VA 5DURD 3VFMB 2QQLH 3PJSB 5ABAA 3CMOH 3FAWA 4WJKB 4E5XG 1UGKA 1S9XB 1PU0A 1QNIA 1TSHA 3BAXA 5DD5H 5E6SB 5DS8A 3V0WL 4XXWA 3BDBA 1MCEA 2CG9X 2HUEA 1DQLL 1LO5B 1AMYA 1VESA 1AQKL 4O2EB 3ZXAC 4Y1TA 1ZT7B 4FHBD 4KJWD 5EBLA 1KTDA 5CWSA 4X5XA 2P5WB 1L9PA 2EDXA 1AZVA 4I0KA 1VZIA 1LE9A 1PAMA 1RUAL 4LKXA 3G5YA 4XZ4A 4OKVA 3BVTA 5IK3B 3L9RA 2HMID 2EO9A 5IHZB 1CGXA 1KNOB 1JZHA 3VI3F 1MFCH 1PG7H 2DWDB 3PABB 1FNHA 4EBQH 4HEPG 5DDHB 3ZSSA 1S9WB 5BRZE 3SD5A 3TYGH 5CU5A 4IBWA 1QKZH 3V5HA 1QR1A 3KYNB 2MRYA 4GQQA 4PB0L 3FQNA 5T3ZH 3IFPA 4PVNA 1EANA 2BOCB 5B4MD 5B3JE 4AMKL 3LKOB 3ZZ1A 3PU7A 1DJYA 5ECGA 2FWLB 3L13A 5EZOL 4Z6AT 5C0DB 1E4KC 5B8CA 1QO3A 3T2PA 4YX2L 3GGWB 1D9KB 5JTWA 3UGXA 1JXFA 4K23L 1ZEAL 4OQTA 4WV1C 3UFIA 5HYSG 4N8CH 2VLJA 4PM1A 4JHZA 2DQEH 1NIEA 2PYED 5D1QA 1MZZA 3EDEA 3H9HA 4JRXA 2I7SA 5HHNA 2P5PA 4Q6YA 3ZBMA 1J8HD 4W4NA 1MIEL 4KDWA 3UEQA 5IHWA 1AGDB 4Z23A 2COVD 3QP3A 3VUAA 1NBVH 2QVMA 3DX1A 2BS8A 1HSAB 1OARL 3RWIB 4GXVH 1QACA 3NG5A 3DV6A 1ZA3A 3RI5K 4HT1L 5CCKL 4PJ7E 5HHMD 3FTYA 2E8YA 3BHBA 5CXPA 1A1NB 1N7MH 3BP7B 3FUDA 3FYIB 2OJEA 3WKPA 3D3VA 4PG2C 3EYFB 4Z76B 2V6HA 3SOBL 1IBZA 5DJ8B 1JBJA 4E0RA 1Q94B 2G9HB 4U3SA 2PO6B 2BVYA 4ICXA 5IGXL 1V3JA 4JFZL 4KVNH 5DMIL 4MCMA 5DHVB 3TN0C 3MJ9L 4LBAA 5AW3B 2HPOA 2AKRA 5ESVA 4Y2OA 5FM4A 3WFCH 3T8XB 3TV3H 1H3WM 3P54A 3IKCB 4YN3A 3HLKA 2E47A 2YRLA 2QPEB 4HETA 1FH5L 2A4ZA 3REWB 3U2SA 5KBMA 1OQOA 5I8CA 2QVFB 3QQ4A 2L8AA 1FZJB 4BFOA 4NZUH 3ET9F 4NKOB 4Z18A 2R8SL 3A47A 4MTMA 4TLSA 1P4BL 3FPYA 4XPGL 3O4OB 1XBDA 3UADA 1HCVA 1MPAL 1T3FB 5IJDC 4GBXC 3OVUB 1DQLH 3UZEA 4G70B 1AQKH 4OLYL 3AUWB 1P2CA 5T1LD 1DCEA 3SE4A 2WWOA 5A2LH 1UM5L 1WFNA 4B97A 4YHYB 5HHOD 2EO7A 2L3BA 4ENED 4KO7A 1A0QL 1VKXA 3ZDZE 3JWNC 3IMVA 2WIIA 5I6XC 1RUAH 4Y89A 4MNGB 2XTJB 4H25A 4AZUA 1SRDA 3VFOA 5E9DA 3F7KA 4MJ2A 5AKSA 3V6FA 4NNXA 1IAMA 5FXCH 4HIIB 5AAWA 3OB0K 1F4HA 2FZ3B 4DTGH 3RWDA 4JM2C 5JMRA 2CHZA 4PJEB 1PD6A 1IILE 1T5XB 2IDTA 2YEZA 4Y16C 5AOJA 1J5IA 2D31B 4AMKH 3VG9C 3NFSL 4BA0A 4TTGA 2Y06L 3CQQA 4YX2H 3W57A 4K23H 5IF0B 1O7VA 2C4FU 2XZCL 1ZEAH 3B7RL 4NC1C 3RVWD 2RACA 2WQWA 1T4KB 4RAVA 5G5DA 1KMGA 5HJDA 5KAQG 2PPDA 4JVUA 4ADJA 4GBXD 4DK6A 1MDTA 1FJ1B 3MA9L 4NQSB 3OR6B 4G6FB 4FFVC 2DQMA 1XX9C 1UB5B 2BIOA 3H8NA 4H44C 3MBWB 1MAJA 4FNRA 6TAAA 1REIA 1S9VA 1F1GA 3SCMB 4RCAA 4G8EB 2R0KH 3EOBA 4OT1L 4L4TA 5SWZA 5D7IA 1BM7A 1XIWA 2CKNA 2JIXD 3BOVA 3DUSB 3US0A 5F1IA 1RUKH 3STBA 2H0PA 2VLLB 2CDFA 2E9WA 2WUCH 4GUPB 2ZUYA 5IR1B 2FUTA 5D7LD 1JHKL 4ISVB 1SDAB 4DCQA 1NDGA 3ZKQD 4N87A 1DSFL 4HT1H 4L4VA 4N2DA 2VABB 4WU7B 5CCKH 5DUBB 3KPQB 1KELL 1UXMA 4YXHL 4QRSA 4MQ7A 2NXYC 5F93C 1SXSA 3Q8EA 3TVMA 1QRNA 3VAEA 3A4EA 4I0PB 5EIIA 1IQDA 2YEQA 1G5AA 2VE6A 3SOBH 1FSKB 2CLRA 1IV8A 1U8QA 4W9DC 1QEWB 1PCXA 1G6RA 4P5MA 4QHPA 1CXLA 2RFXA 4G6JH 1N0XH 4JFZH 2DH3A 2V3EA 1JNLL 4AIEA 5TTRA 3SY0A 2GCYB 4NZRH 4LLYB 3MJ9H 5FC9A 2OYLA 2P8PB 4TNVK 1NCGA 4J23A 4CN6A 2GJPA 1DQVA 1ND0A 3RDTB 4WCYL 4WFED 2YJQA 3BH9B 4IDLA 1YCSA 4QLWA 2BVOB 3P9LA 4WNQA 1X5JA 4FFVD 4Z3EA 4LLDA 4IKIA 1SVZA 1FH5H 1D7CA 3G6JB 2W9LA 1YEDA 2DWEB 1IC5L 4JDZA 1HSBA 3GMMA 2YMTA 2IC2A 5ADOL 1A6VL 2N0MA 4IJ3C 4J6RL 2D7TH 2R8SH 1C16B 1NUNB 4EI0A 25C8L 1JDCA 1P4BH 4XPHL 4XPGH 3TBVB 2AJXL 2PYFB 4JG1L 5CGBA 4OF7A 1FL3B 4OAWA 1HL4A 2P5EB 5GSRA 3AACA 2VZSA 2Q2LA 2NXYD 2I26N 2P45B 2Y07L 3TF4A 1AR1C 1TQSA 1BOYA 1BEYH 4P46D 4DGVL 4OLYH 4NERA 1DVUA 4OZGB 4FNLH 4PY7A 4PJHA 4KJPC 1JXJA 1UM5H 2CLZB 2Z7UA 1UXSB 3WJJC 2XG5B 2AXWA 3WEOA 3Q2WA 1A0QH 5JXAL 4ZX6A 4ZO9A 3QDJB 4PY8I 3FW6A 4PU2A 1VCBC 3G3LA 4N0UE 3MLVL 1NMCB 3DIVA 2EINB 3VH8B 4N3UA 1KCBA 1TZ8A 3OPUA 2IGLA 2XNAA 4I3GA 1F6LL 3FQUB 2CKBA 3IN0A 3FU6A 5KS9A 3OMNB 4NJ9L 3TBTB 2DMHA 1M7UA 2XN9A 3MRIA 3CSFA 3U0PA 1OF2A 2KZ1B 1IAKB 1W72H 5KVDL 3GXTA 4L9DA 5AYQA 2VJXA 2KZBA 1H15A 4NEHB 2Y06H 4Y9BA 4E9SA 5DVPA 4AK2A 1MCSA 1J0IA 2HVJA 3L5WA 2ITCA 3H9SE 2CBMA 4KRPC 1M42A 1ZJBA 1T83A 3HPLA 5GZNC 4TLTA 4A2FA 1XCWA 4DGIL 4OZIB 1TOXA 3UIZA 3ABLB 3GHEL 3ES6A 4LCWE 4OLUL 1KBVA 3ULUE 4PJAB 4AM0B 2V3DA 4BA8A 3O6ML 2V33A 3ZKXC 3QUXB 5KSAB 4HHAB 1JK9A 1BZ7A 4KJPD 2ZCLL 5IVNA 3QUZB 1EDHA 3PG2A 4BSJA 1EFXA 4LVOC 4Z7OB 5DD1L 3QNFA 3T0VA 2VDNL 3BP4B 4RRPG 4PRHB 2I5YL 3WEXB 3D0VB 1JHKH 1TVBB 3FCSA 1AP2A 5F72S 3ZE2F 1VERA 3SJVE 5F1KC 4WUUD 1LWJA 1PIGA 2FX7L 1KELH 3H3PH 3BGFC 3NJNA 5DGQA 5MENA 4H8WL 3S36X 2ICEB 4N86A 1N64L 2X6AA 5K39A 3SYAA 3IDMB 4HWNA 1A65A 2ZWLT 5LGHH 3TO4D 1EDQA 1HWHB 3RP1A 4ENZA 5IOPB 5J13B 1CYXA 2BO0A 4LLWB 4TNVF 1N0LB 4WI9A 4X6DE 3F7VB 1NGZB 1JZDC 4JY4B 4OFDA 1JNLH 2CA4A 2EIEA 3AGVA 2WBJB 5SWQB 4EI5C 1KZQA 5BS0A 3IU4L 4Y4HC 4LBEA 4GKZA 4W9JC 3F85A 4KRPD 4ODWB 4RMVA 5IJVB 4ZUVB 1OK8A 4WCYH 2H1LM 4Z77A 2FEDC 3FB5B 2BVUA 3NMEA 5J6SA 1ZLWK 2WWKT 3TF7C 4RESB 4PRIB 5C0AE 3PQYE 4P2RB 4XMTA 2VXTL 1SOQA 5F89A 5FGRA 1L0PA 1M6UA 3VXUE 1IC5H 2BP0A 3O3EA 4G6AC 4N8UA 3WE6A 1SMAA 1A6VH 2EDLA 1OGAE 5AOIA 1XF2B 5C0BD 2R56L 4F7MB 4JG1H 2W80C 5LCVA 4YHMH 3UTTA 1X4YA 4LLVB 3EG9B 5ERWB 3SPIA 4LOUC 1UTDA 4DGVH 1I9IL 2D4DA 2ENSA 2FYVA 4Z7WE 2HX8A 5GGSB 4CN1A 5IBUG 4P5TA 1QYGL 4KX8A 3JTTA 3C5ZD 1UA6H 1D5ZB 3MRNA 3PJNA 3UTZA 2QKIA 5ICXA 4HGWB 1RUMH 5AVZB 4HS3B 4G9FA 3OB0H 1HS6A 3SGKA 4ZQTA 2EVHA 2Y24A 4MD5B 1FL6A 4MMXB 2AI0L 1JGEA 2W0KA 3O41B 4ZPTB 2K7PA 2X4RA 3WENA 3ARDC 3PWUB 4XX1G 2FEDD 3KPTA 2HLFC 4AZ8B 4NJ9H 4L3ED 5SX5K 3VXNB 4CA4A 5FOBB 3HA0A 5DXWA 3UJIH 4NS0A 1IGTA 1CFNA 4X2UA 5DJ0A 5EU3A 1QLRA 5HDOA 1F3DJ 2X88A 2X4OB 2V2XA 2AS5M 2XLLA 3MROA 3ZR6A 3OBAA 3U1SL 1U3HB 1JVKA 4H1LB 4O2CA 4Y4FB 4ZSOE 4YBQC 1TIUA 2IAMD 5IG7B 4DGIH 2M2DA 3OMIB 1ZTXL 3CVHB 3UIYA 3GHEH 4W9CC 4OLUH 1E4WL 5DO2C 1TSRA 3BIKB 4RIRB 1JPSL 3A6CL 1JFQL 1TQWA 4QRRE 5AVWB 5ILTL 4CVZB 3LDBC 4K5LA 2H3NA 3EFDL 1V7NH 3LD8C 5IVOA 5DD1H 4U0QB 4WWKB 3MRKA 5AW8B 1RZPA 5CD3A 3T0AA 4LIQE 1Q8MA 2I5YH 5F9OH 2OMNA 4BHUA 4BFBD 4CKQA 1IE5A 1CG9A 2A2QT 2BCKB 3DSNB 3FCBA 1AC0A 5AB9A 5JIDA 1UYWL 3ARDD 3IK2A 3VJ6A 3I2CL 1N64H 2HLFD 2VL4A 3RTLA 1L5GB 5T1MA 3O2VL 3IEAA 2VUOA 4MJ4A 3WNMA 4HEMA 4IOSA 2WN2A 4X0KB 5I1LB 3P4OA 1HZLA 2GJ6B 4B5ZA 4C56D 1XXDC 2Q2EB 4J27A 1S9YB 1TCRB 3ARQA 5IB3B 1OGTB 1NGXB 5FR3A 5AW7B 3RU8L 2Y25A 2JKSA 1NLDH 1WBXB 3AAZA 3GSOA 3ATAA 3KPRA 4GRWF 4BDVB 3ZMEA 1XF5A 3EDKA 5PCYA 4U05A 1I7RA 5D6CB 3MYZA 2RD0A 4TLKA 1XCTA 4JRXE 2FR4A 2Y7NA 1ETJA 4QO1B 4AXWA 2W9EL 2GSMB 4KQ3H 2QEJA 3T0XA 5IQ7L 1OSZA 5CLWA 2R56H 1E2ZA 1XGYL 5KSUB 2LW3A 3UX9B 4QRPA 1H9VA 1FFQA 4HS8L 1DVFC 1PD0A 1QFPA 2NY3B 4PJIA 1R24A 3SKNA 5L2KA 3ARBC 5ACMA 4UM8B 2CHXA 1CXKA 3I50L 4F2EA 1B0WA 1NBZA 3K2IA 4RGOL 1RJZA 3L2MA 3DC0A 2GTQA 3NZHH 2VSDA 3NJHA 1JP5A 3D3VE 5J1AB 5GSVB 3K71B 5EUOF 1I75A 4HUUB 2HRLA 3K8KA 1K4CA 4FAAB 5ESAB 4N2CA 1XR9A 2J8HA 4K5NA 2FAUA 2AI0H 1KFAL 5I76B 5DYOA 1BG9A 1UHVA 2AV7B 4MASA 1QLFA 2CIKA 4HJUA 4O4YH 3OF6A 5EBWB 2XV2A 4KK8D 1XTMA 2X4TB 4YDJA 4HF5L 5JOFA 1JNHA 5FM5O 1A6AA 1QBML 1DQIA 3D85A 5HYJE 1KCSL 1T7XA 1J5CA 4UNIA 2YUXA 3GEFA 3L1OL 4UAOC 1YMMD 1SXZA 3MZGB 5IB2A 1XFPA 2BH0A 1P84J 2F7OA 4MGXA 3LS4L 3WAJA 3TH4T 3U1SH 3U46A 4PCKA 1G7PB 4A6YH 3VWKA 1L9SA 2CK0H 1ZTXH 4RGNE 3DVGA 4FEIA 4GMSL 1E4WH 1TTRA 3OXRB 4DO5A 4HWZB 1MWAL 1LNUA 3HUJE 3L2NA 5A7EA 4YE4L 3A6CH 1JFQH 1RIHL 4JFPA 2DMBA 4N8VA 2X4UB 5ILTH 3QB7C 5E5MB 4Y9GA 2Q86B 5D55A 1BVKA 3LNEA 3LS5L 1VB9A 2XVLA 5AG9A 5TE7H 4IHOB 4WNJA 2LFGA 1IGYB 3PHQB 4ABWA 3CFMA 3KGSA 3VSVA 2V9QA 4KDTA 2E27L 5E9DE 1IEAB 4ANWA 5EOTB 4NQQA 3I2CH 1G43A 3I6KB 3P9MB 2O72A 4MS8C 7PCYA 2VB5A 1NBYB 2EC9U 2MCAA 1G1KA 3UABA 2X6BA 2CO7B 4OCSL 2QLYA 3GTTA 4HIJA 1E28B 2V9TA 4UT9H 1GXEA 1NC4D 3GMPA 3VGGA 1MZYA 3W81A 1SOXA 1WT5C 2CUHA 3BLPX 3C6LD 1FNEA 3CN0A 4MNQD 4NQCB 2XICA 3VXOB 5KVEL 1E6JL 4FFYH 1KYDA 4IBTA 4MZ3A 4YZFF 1ZLWH 2BNRB 3S5LB 3MV8A 2X5PA 1HHGB 2PLTA 4UBDD 3RU8H 4RA3A 3T6VA 4AH2B 5TGBA 4GRWH 1X5YA 4BKTC 4WHCA 1FZOB 3HIZA 3MLSL 4ZUTB 3DMMD 1VENA 1ET8A 2V5YA 4L1BA 4W68A 4XO9A 3UO8B 4AGQA 5HYQA 4TXVB 1PLAA 4HAFA 2WOYA 1CYGA 2O61B 2BSCA 1P7KB 1JPGB 2B0SL 3EYQC 3BFQG 4HC1H 2XA3A 2W9EH 3N85L 5D7IE 5SWZE 1R47A 1EZVX 4NENB 5IQ7H 2AXJA 4UQ2A 4HOMA 1O6VA 2R69L 1ED3B 2VLRB 2NXZC 2NY4C 2GEEA 4GW5B 3L5JA 4N6QA 4WW2A 4I89A 1UM6L 4IMKA 3LKPB 3I50H 2A1WL 2BHFA 1LO2L 3GJEA 3LB6D 3G5XA 4CN4A 3CV5A 2E7LC 1FNGA 4CGTA 3BP5A 3WFEL 1KGCD 1WG3A 1TQUA 1I1FA 2DI9A 2YPVA 2LFEA 2OI9C 4MA7L 5JHDA 3VFNA 2BY3A 5GS1A 2ZCKH 4WWNA 3X1EA 4K0OA 2P80D 4FULA 5D70H 1NIBA 2IAND 2LABA 5FK9A 5C08B 1IAOA 4F2FA 2OQJB 5FGBA 1CCZA 5CR1A 1RXLA 1MXDA 4ALAH 4F92B 3FU7B 1LEIA 1F11B 5A2FA 3QXDA 3RPIA 1QBMH 2AQRA 1W0WA 5MERA 3QUMB 3O6FD 1IC7H 1KCSH 4JN1H 1KBWA 4HFUH 1IX2A 2IALA 4D2NA 5BO0D 1MG2C 3ZT6A 5HHVL 2X6MA 2PYEA 3L1OH 3EYQD 5FHBL 1FFNA 3AY4C 4WTXA 1INEH 3LEXB 3LS4H 5EB9A 4N0CC 1J8HA 1DJGA 1FFRA 2CLVA 5GS0H 2BJML 4PH8A 3CXFA 1NZRA 3DXAB 4QWWD 5E6UB 3W5NA 4X42A 5KBKA 2FX9L 2MFNA 4F5CA 5F8RC 4OVVA 1MWAH 3WXWH 3IJEB 4YE4H 1RIHH 4JPIA 2ZCHH 3WKQA 4UT6L 3VXSB 4LEXL 1HH9A 1WWCA 4AQEA 4OVUA 5IESH 3BZFB 1KIRA 3LN4A 2AK4D 4UT7L 1QSEB 2ZZUT 3ISYA 2WTRA 1UCBL 2YFOA 1NOFA 1RZIB 3LNGA 4NXSA 5AUMB 3KXFD 4X6CA 2DDQH 2V2WB 3GBNL 4ZBJA 1C1EL 1TKWB 3AXIA 1VADB 4IM8A 4KNSA 4OH2A 2E27H 2X1XR 4XNZB 4F9PA 2R1WB 3FAXA 5HDRA 1VPOL 2DQGH 4NN5B 1CVSC 1KPVA 5KS9E 3CU7A 5D7JC 3X12A 1JK8A 4WHTA 1XMEB 4PWJA 1UD4A 2FSEA 3FRPA 4KTYA 4LPUA 3EFFB 2AANA 4OV5B 2H8PB 3IE9A 5B22A 1PQZA 3ZQXA 3TCXA 4GAJL 4JFQB 3NYKA 4GAGL 1D9KC 4F9LC 4U2ZA 4XPTL 2N7BA 3DVNA 5EC1B 5CBEB 5GGTA 4UQIM 3HFML 1OAQL 2W60A 5JPNC 1QLEL 1A14L 3OZLA 4JVPA 4ZTOL 2XT1B 4PGZA 3SGDI 5DD3H 3GSWA 3CFKA 4IS6A 3A0OA 4JB9L 2A83B 1KWKA 3BQVA 1EX0A 3VE0A 1F97A 2B0SH 2VXQA 5F1NB 3MUGB 1RZ8A 2Q7YB 3N85H 2V0AA 3TZVB 35C8L 5D2LE 5T1LA 1SF3A 2GQHA 3NQIA 3FU8A 4J5VA 2EH7L 3LPOA 2K78A 5HHOA 5C9JA 1BAFL 2XQYA 3N2JA 4MQSB 5I23A 2X0VA 2WD0A 5C0GB 1NFDE 2A1WH 2R2BA 2OSXA 3F62A 5IV2B 2D03L 4KXDA 1TU2B 1U8PB 2OSLB 3WFEH 2Z35A 1QEXA 4HIHA 1J9TA 3P77A 2ZUQB 1RULL 5GHWL 1Y6NR 4CILA 4PLKC 2EDEA 5E4OA 3F7YB 3W2DH 3OKDA 5IW3A 4UILH 4MKMA 5BS0E 4G72B 3VSUA 3ZE0B 2FQEA 3DBXA 4PRPB 1WS8A 2EVIA 3SO3B 1I8UA 2EXTA 5SWSB 3DHJA 2DLIA 1FVDA 4YSOA 1NANI 4ODTL 1XSJA 4XNYL 1H3PH 4F8NA 3WNPA 1EHLL 3NABL 4OI7A 4EQ3A 1F2QA 5FECB 3E8VA 5HGAB 1BYOA 5HHVH 3OJVC 2NY1D 2VITB 4O51B 2EUZA 4JHVA 1SEBB 1K3IA 1N59B 2NY5C 2XKUA 5FW6A 4AW7A 4RMWA 1SYSB 1AGCA 3ULSB 5A6MA 2G3ZA 5IHHA 4GKLA 4EVNB 2JIXA 1F4XL 1YN7A 3K2UL 2YD7A 3UTTE 2R4SL 2JJSA 2H32H 1IKNA 4BH8A 5D7LA 3OG4B 4FQXD 2BXZA 3T4AA 5FGCE 5DGRA 4F24A 5IT2L 2X4PB 4PJ5D 3RTQC 5ES4B 5I73B 4X9HA 1JGDA 3BUBA 3D33A 4UT7H 3RWFB 4MLIA 4NNPL 1OGPA 3AC0A 4PP2B 1UC6A 5F3HA 4L9LA 2XTJC 1C1EH 1PZDA 1MN4A 1TZHB 4G9FE 4OJFL 1A2YA 1E27B 3OKLB 1N8OE 4UOJA 4YSEA 2VLME 2BOBB 4L1LA 3ESNA 1ES0A 4A7QA 1RV6X 5D8JL 1LM8V 2VLKE 5HPMA 5K9JH 1VPOH 1YNTB 4HKXB 2M26A 3H0TA 5ANMB 1GGYA 3TESA 3B2UD 5EO9B 2DM4A 3U2JA 1IEBB 1ORSA 2FLBT 4BUQA 5E1IA 3NZ8B 4LSQL 3NOIA 4GAJH 1OIOA 2QLVB 1MHCA 2B7DT 4XPTH 1UWFA 4MAZA 5BQDA 2NNAA 3T8MA 1KCVH 3HFMH 4YBHA 4R2GC 1OAQH 2PNDA 1XQ4A 1A14H 1K2DB 3GB7B 4MA8L 5EO1A 4ZO8A 2FYYA 5JW4M 4ZTOH 2NY2D 1XF3A 3GSRB 5HJ3B 3BCDA 4PTTA 3WLWC 3UTQA 4GXUM 1EEUA 2RGSA 4DEUA 3U30C 3OHXC 1SQ2N 1MLCB 3E1F1 4FERA 4P46A 1TJMA 4L29B 1FORL 35C8H 5DJYA 3RTQD 1FA4A 4BM7A 5E8PB 1GVIA 3B1TA 1JGLL 2AEPL 4GY4A 4PRAA 1G7JA 1XH0A 1LYQA 1D6EB 2AJZB 4I18B 2F2HA 1U91B 2R0LH 1BAFH 3B83A 1JN6B 2OZ4L 2ZOKB 3RZCB 3PWJB 2QQKH 2Y7QB 2Y5EA 1E30A 2BS9A 2NNRA 5DHVH 2WLKA 2VIRA 2BMKB 1QUNB 3SGEH 1FV1B 2X87A 4N8PA 3ECVA 4JX0A 1OWWA 1BYNA 1I31A 2D03H 4YFLI 1GR7A 1IIIA 1OB0A 2BNUA 4P9HC 5KN5B 1T5WB 3NP4A 4UU9B 1RULH 3AREB 7TAAA 3W9EA 4O02B 4OV6F 4Y2DB 3Q9QA 1IT9H 5CZRA 4MB1A 2I7OA 1D7DA 5EC2B 2Y9RT 3T1FB 4Z0BL 1ADQL 2I9LB 2NCMA 4NQDD 3B5TA 3U36A 3UG5A 2QFRA 2A9MH 5H37A 3RDTC 5T5NG 5IEKB 3LNIA 1G6VK 4ZFZB 3O8XC 4PGEB 1ASPA 1AHWA 2AVFA 4TV3A 3KPRE 3CC5A 4MCYB 4ODTH 3UAJC 3IRPX 4XNYH 5FO7B 1WGOA 1SN2A 2APSA 1YYLL 1EHLH 2HG5B 1R3JB 1UOVA 3R7RA 5C92A 5AW2B 1E9OA 2FIRT 1T2QL 4NC2B 2WINB 3MLTA 1CGSH 4OZGF 4F20A 1CN4A 3GBEA 3H53A 5G55A 3V7MA 4F7CA 2DN7A 4F80A 3MUUA 5CJ5A 5ISZD 1F4XH 3FFDA 3ECWA 4QRPE 4DUVA 4YHPA 4PLNC 3WNLA 4GI8A 3CUPA 2WGNB 1QWNA 4AC4A 2DKMA 2Z8RA 3PLYA 3OSVA 3Q5TA 1NWOA 4UIMB 4JQIL 2BNQD 1C12B 4HJJL 2VSKB 4K3GA 3EF7A 3SSGA 4BKSC 5JHLL 3CPLB 3D39E 1OSPH 2EDHA 2OMTB 3N44B 5C0FB 4NNPH 1ZOXA 4FEMA 1WWAX 3SKUD 2ADYA 2J8OA 3TO4A 4XTRC 3CGTA 3L3GB 4KNQA 1NGPH 3QZNA 3KVDD 5T1KB 4ZMQA 4M03A 3TO2A 5DR5L 3BUYA 3KEDA 3RL1A 3O8XD 3FSAA 4W6WB 3C5JA 1KACB 2JB5H 4KHTL 5D7KD 3VTTA 3UAJD 1PJ9A 3CBJB 5F6IB 2VDOL 1G7MB 4PI2A 1QVOB 4L23A 4OZIF 5A3ID 2R2EB 5CGTA 1AZCA 4PJAF 3BT2H 3WSQL 5DFVC 1E6OL 4G83A 5MI0C 3T6WA 5H35A 1F42A 5CJ8A 1BVLA 5IEHB 1X7QB 4BGDA 3ZHKA 4JG9A 4ZNCD 1SVCP 5LG6A 3J8F7 4Z7OF 5KJRL 2WSKA 4PCYA 3AG3B 3O9WC 5C0BA 5J9PA 4AIOA 2VXSH 1PG7X 5KSAC 1T0PB 3E6FA 5DO8A 1RD6A 4JO5A 3PGDB 1C9SA 4H7VA 1Q9LA 5GXBB 1X5ZA 5I16A 1FORH 5JLZB 4Q6IC 1DBJL 3IDGA 1BD2D 5CZKA 4HKBB 2AEPH 4HKJB 2Z1KA 3ZE1E 5DMYA 4U4IA 4XCEB 1E9PA 3C5ZA 3WD5H 3CDGA 1R3HB 1E67A 2OTPA 1FDLL 1MXGA 1NIDA 3DROA 1CTMA 2HT2C 5D2NA 5D9SA 5FA4B 5IROC 1HTYA 1CBJA 2NUPB 4M61A 3LQMA 1IAIM 3JSSA 1QTSA 2WBJC 2NR6C 3EHBB 5C70A 4NWTL 2IVFC 5DTFA 2BX5A 2FSDA 4Z0BH 1ADQH 1O9ZA 4YAQB 2BSRB 3O45B 3T4YB 4G9DB 4KRLB 2V7NA 5DEGA 4BQBA 2X10A 2BPBA 1FN4B 1X9QA 2IBGA 3EZJB 4JFOB 1OANA 1QBBA 1C5DB 1YYLH 1GZPB 1X9RA 2GBAA 2IAMA 3E8UH 3IN2A 4L8SA 3ML9A 5C0CA 2VL5A 5JIPA 4Z1PA 4N1HB 3VX1A 4XNMB 1ZS8B 3CE1A 5CZXC 1T2QH 5FDWA 5BV7L 5AALA 5EIIG 2NCEA 1F6FB 2BRQA 1WVZA 3C9NB 2YD5A 2FH6A 1DTUA 1KXQA 2GIXA 4KZDL 4Q4IA 1DLHA 4GI9A 1MCJA 4RETB 3KLAA 2QDVA 4FI6A 4PBWD 2JKLA 3QJXA 2GSGB 3QH3A 4X7EC 4OUUA 5DI8A 2UXTA 4MMZB 4OQTL 4X4MA 4KK9D 5E1AA 4FNQA 4JQIH 4JN2B 1ET7A 2QVIA 4HJJH 4MQTB 4YDVB 3K0YA 5JHLH 2CM5A 4PJDB 5DVLA 3MRBB 4FQLL 1FAKT 4GUQA 3D9AL 2IQAB 3S8GB 2AMUA 2H7WA 2NR6D 3H6AA 1DVSA 2H26A 3CK0H 2E9GA 4MMXC 5T3ZD 4M43H 1KYUA 3N0PB 4QHNA 3LOWA 3ZHLA 5DR5H 4KKZA 3MA7B 3MRFB 4CVWA 4Y5XA 1EJ6A 1KBBA 1T1WA 3OB8A 4KHTH 4XC3L 1I7UA 4IOFD 5FFGA 4C56A 4C83A 4EMZA 3RVTC 4JNXA 4BQ9A 2VDOH 2PTTB 2JK5B 1R19A 3QYNA 5T3XL 3CVHL 5A2JH 4IRSC 4PSRA 2P26A 3RJDA 2ZUSA 3TIDB 1ZGLM 1DN0B 2IFFL 1WH0A 1D2OA 2ENQA 4B9FA 1K5WA 4TSAL 2I07A 1U4FA 2BDNL 4K3DH 4HUCA 4WHDA 2BZDA 3CFBA 1J8HE 3HRZA 5KJRH 4BHUI 4P2CG 3M8OL 3U9PL 4HMCA 2O6PA 5FOJA 4HXBL 2HN7B 4F5CE 5C0RL 4IGBC 3RA7L 5HY9A 1UWXK 3CVIL 2ZOOA 4MA1B 1I1AC 4NT6A 4P4KA 3CDFA 3QO1B 4MCZA 1D5BB 3M86A 5AL0A 5HBBA 4AVKA 2Y3NA 2JSFA 2R0ZL 1MG3C 5F0MB 4YHLH 4A7SA 3OZ9L 3NFPB 5JW5A 1E5ZA 2ZXDA 4JZJB 5DMKB 4X6CE 5INDB 1IL1A 3GJFA 4AKQA 4XBGA 2EDNA 5CFHA 4UDUB 1GRWA 1W15A 2WKLA 1NAMA 1VHPA 3HE6A 1KCUL 4JANA 1GGIL 3T0WA 1DBML 3T2OA 2OV0A 1YEKH 2B1OA 4ZXBB 2NQDA 3VGEA 3MV9B 3QYCA 4G3YH 1GY2A 3S4SA 5E9AA 4JFFA 2X7LA 4WU5B 3WY1A 2CCWA 3AITA 1Z0NA 1KJMA 1P4IL 4AOFA 5E2TL 5FFLA 4XP1H 1XGRB 5LNEA 2VRKA 1YMMA 3IDXL 3BPCB 4D0BB 3CLFH 4APQD 3K1DA 4G7QB 3QQ3B 4GRLA 2BVPB 3QJQB 5C09D 3ZDZB 4Z8FL 3MBXL 3QORD 3D69B 4Z7VB 1BQRA 1N4XL 1UT2A 5D1XC 5E1GA 5K93A 1I1AD 1ZE3H 3D25B 3G08A 5AW9B 5AYUL 5B1JC 1IM9A 1RMFL 5JNYA 4YNYB 2C7UA 4FNSA 3H3KA 2ADJB 3DRTA 5AZEL 3CSGA 2XI9A 3MOAL 1RHFA 3QULA 4LVNC 1A7BA 5HHOE 3QWNA 3GTVA 2C1PA 2VZ3A 2WTPA 1JYWA 3EJZD 2XACC 3FFCE 3KYOB 4OQTH 4P2YA 1EEZA 5TFSL 4V33A 1GJUA 2D2OA 1OTSD 4Y8AA 1F4YH 1ZSDB 3KEHA 1EXUB 1LWRA 3D9AH 2VAJA 4WEBL 4R0LC 5JIIA 1AVAA 2UY7A 2VC2B 3TFKD 4FHJA 3GQFA 1JWSB 5TDOB 3IDJB 1N6UA 2JNZA 3PP4L 4U6HB 3VCLA 2R1XA 4B9JA 3PUCA 3C6LA 2WAQA 4MNQA 4UOQA 4IRJC 4PRDB 5FCSH 1EK3A 1I9JL 4RDQG 3VFUB 3WFBL 2VQ4A 4XC3H 1AIFA 3WN5C 3EBHA 3TPKA 3AT9A 4H1LH 4CMHC 5FPIA 1N2RB 3RIFK 3RX7A 5T3XH 2A9CA 3CVHH 4PV8A 1GOFA 2H45A 3S97C 2AEIT 1HYSD 5LXGL 3DMMA 1UXWA 2IFFH 3VG0L 4M7JL 1U21A 3PUUA 1HZHL 4TSAH 5DQJB 4HUWA 2BDNH 5LLIC 2R23B 5D7SL 4GEJA 3P4MB 3P69A 2RCSL 4Z7UB 2JWYA 3T3MB 4B9YA 1T1YA 2AZUA 2J1WA 3LPWA 1LEKB 5FKPA 3W39A 3JWNE 2BRRL 2E59A 1MY7A 4HXBH 2F1BA 3FU9A 5C0RH 2E7CA 3F2LA 4QD2E 5CJOH 4XN1A 3CVIH 4W1TA 4A2HA 4PCTA 2Z92B 5G2NA 2VDQB 4DVRL 3IWVA 1XMWA 4ICWA 5F8QC 4B9ZA 3OZ9H 4YH6A 4XZUA 4Q74A 1KPUB 4M6OH 1G9EA 3T08A 1LXMA 3VFRB 4ABVA 3DJZA 4IRJD 1BLNA 3U6XS 1S78D 4JQXA 1KCUH 3KWTA 1GGIH 4L1DA 1DBMH 1NOLA 4EUPB 4L8CA 2P80A 2HTKD 5DK2A 2IANA 4P2OB 5I17A 5J6HB 3V5KB 2Z7WA 5LDSA 2CALA 5B3NA 5CEZL 3K72B 3ARFB 3AWEA 2NW3A 1UACL 4WFEE 3GM0A 3FU3A 2F74B 2YSSB 5C07A 4MBRA 4O2FB 3O6FA 3MCLL 4IYKA 3B4NA 2MHAB 5I74B 4KZCA 4AC2A 4DP6X 4GG6A 3UZQA 1B9ZA 1HILB 4MJHA 3QJOA 2WLNA 4JREB 5E5RB 4A55A 4DSYA 4ZW8A 3UYPA 2R0WL 5F9JB 3C60D 4RFNB 1XT5A 4NPYA 4Z8FH 4NN7B 4P23C 3MBXH 3CU1A 4NIKB 5JR1H 1N4XH 3MKKA 4N0UB 5ABDE 5AVYB 3SODB 2A6JB 4V1DD 1HOEA 3CIAA 1U92B 1T5KA 3DURA 4XX5A 3VI4B 6PAZA 3W9DA 1HIML 5AYUH 4UM9B 2W95A 5LGKA 2BVTA 1XBRA 1KXTB 2Z34A 2YUWA 3AXLB 2CO6A 3ZIMA 5I30L 2PCFA 3O6KL 4KROB 4KVCL 3TNNB 1JNNL 2ATKB 4ZFQA 2G2PA 2AK4A 3VQMA 15C8L 4GJTB 2ZKXA 3TCLA 2BXYA 3V6ZB 3GBML 3KXFA 1FP5A 5E8DL 2IH9A 3WMSA 1U3JA 1HKLL 1CLCA 1RAMA 3D12B 4L0PB