5AG8A

Crystal structure of a mutant (665i6h) of the c-terminal domain of rgpb
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
164
structure length
149
Chain Sequence
VPTKMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVEGKPYTVAVSGKTITVESPAAGLTIFDMNGRRVATAKNRMVFEAQNGVYAVRIATEGKTYTEKVIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Outer-Membrane Export Signal of Porphyromonas Gingivalis Type Ix Secretion System (T9Ss) is a Conserved C-Terminal Beta-Sandwich Domain.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords GINGIPAIN R2
total genus 29
structure length 149
sequence length 164
chains with identical sequence B
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
A PF18630 Peptidase_M60_C Peptidase M60 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ag8A01
3PGCB 3HHRB 4XNZB 1IC5H 1MHCA 1R3LA 2NY5C 4NWUL 4U1HA 3STZA 4YXLL 4KVNL 5I1LB 2VQ1A 3L3OA 4P2CG 4FFWD 3BGMA 2NY5H 5ISZD 2DWDB 4XNXL 3WDJA 1DQQB 5J1TC 3TJEH 3QPXH 3MSPA 3P11L 4BM7A 4V2CB 1X7QA 2BVTA 1X5GA 3O6LH 2J8UB 1HHJB 1IAOA 1CGYA 2P48B 1LK3L 1EXUA 2FJGB 1MFDL 4WUKH 3SDDC 5I75B 2ZP0T 1S7TB 2NLJB 4KJQD 4C56A 4YZFF 4S1DD 2VOTA 3V7MA 4M7JL 3DLQR 3ARDB 3P9MB 1FAKT 2XZCL 4TVPH 1MRDL 1IGIL 1AQKL 1DJSA 5J12C 3SJVB 3AM8C 2FD6L 4OIIH 5GRZA 1BBJB 1DBJH 1WZ1H 2AVGA 1P4IH 3MLWH 3REVB 3C5SA 3DNKA 5B3JF 4TSCL 3HG1B 2ZNXA 4WNQA 2ADIA 1G9EA 2IALB 4JM2C 4BZ2H 5D8JH 3BP7A 1GIGL 3Q3GB 1FGNL 4JAMB 3EZJB 2VXUH 1JV5B 2XRAL 3I3BA 4UI2A 4YFLI 3OJ2C 1CG9B 3MGOA 2P49B 2E9WA 4LHQB 3HR6A 1LWRA 4GFTB 4MMXC 5DHVA 3QUYC 4NQCB 1FLRL 1LEGA 1LD9B 1YNLH 4I0PB 5HVFB 5BV7H 5I66A 2ITCA 2O5YH 4Q9BA 1DCLA 4L9DA 1QZ1A 1J8HE 5SWQA 1IAII 2FHFA 3DX9A 3C2AH 4JDVA 2VQUA 1EJ6A 5JLZB 1NC2D 1NBZA 3U79A 2OTWB 3PNWA 4S1RH 4OV5A 4J3SA 3LQMA 3QEUB 4PP2A 5L2KB 1BFOB 3RVXC 1PG7L 4P9HH 3DMMC 3RWCB 4U6TA 1JVKA 3KWWB 4K3JH 2AI0L 5LQBL 2EDTA 1BFVH 5CZVH 2IBZX 3T0XA 3QI9C 1K2DA 3CSPA 1NEZA 1BZ7B 3UTSA 2NY1D 1NC2A 3CXHK 4K94L 5DEFA 5DWUL 5DJCA 4RMRA 3TFKC 2NY6D 5KS9E 1HHJA 4PRIE 5M94B 4ZFOA 1HYRC 5HDLA 3O6FB 4MNQD 4WV1B 2IFGA 1KPUA 5L2KE 1QKZL 4D2NA 5IMLB 3SKOA 1T04B 3VCLA 4HAGA 2B1HH 3FB6B 3WLWC 4KKCD 5HHOE 4Z78B 4G80B 4WY7H 4JY5H 5DUPH 3LQAC 1RK1A 3GMOA 1CD1B 3LRSB 1RJLA 3P9WB 4G6FD 4AT6B 1CLYH 2V2WA 3L7EB 4AQOA 4MAYC 3H2WA 5F88B 5HVHB 3EO9H 4LPYA 2D7MA 1QFWI 5GRJH 2C7UA 3MV8A 1I1FB 4X4YA 3G5XA 1OARH 3ARQA 1UENA 4XPAL 1UZ8A 4ZFFB 5FM4A 5CCKL 3O45B 3QEHA 3MLXH 5AG9A 3F7VA 3B4NA 1F2XK 3RDTA 1F4WL 4YDIH 5CD5C 1F90H 4NT6A 2XIDA 4QHNB 2GY5A 4KTDL 4PJ9D 3VH8A 5I1AB 5DK0A 1FV1B 2HKFH 5E6IC 5IW6A 1A14L 3KLAB 4KMTL 3O6MH 1GAFH 1NJ9B 4KQ3L 4P57B 4RIRA 3FTGB 5IESL 3IFPB 1ZTXH 1A2YB 3NABL 4LLUB 3UAJD 3FQTA 4OZFB 1MWAH 3LQZB 3BH9B 4M7KL 2W65B 2CXKA 3EGSA 5L2JA 4HIIA 3L3JB 3KR3H 4J12A 2J8HA 4XP5H 1VFMA 1XCTA 5T3ZH 3O2WH 3QP3A 2NY0D 3WFCH 2I9LA 4U1IA 4G9FA 4OUOA 2YOCA 3WXVL 2AV7A 4HFUH 3QA3A 3S88L 1J5OH 4JG0H 2MWCA 1CFBA 3MRBB 4PTUB 5E9DB 2NY1C 3S35X 2CXGA 4J7RA 1T5XB 4R97B 1J1XH 4P23A 3V5KB 5C0FA 3ULSB 3VWKC 2FZ3A 1WFTA 5J9PB 5CBAA 2HG5B 4N8PA 2XNAB 1IEAA 5D4QA 4NBYB 1LP9A 3F65A 4OQTL 1KLFA 1U93B 2NX5E 1NCNA 4X6DA 2EDYA 3QCVL 2DYPB 4HV8B 3WJLC 4J1UB 1D9KD 1RULL 1G7JA 1S5HB 1YMME 3WFDL 5CIPA 4P59H 2FIKB 1OGTB 5K9QG 1V3KA 1F4YL 1RIHH 1B6DA 5E1HB 5CBEB 2MKLC 4XC1L 5GGUA 1YEFH 5F7YC 3ZDZE 1H3UA 1DL7H 1Z9OA 4QWWD 2Z93A 3L95A 1SBSL 1A6PA 3FO9B 3ILPB 4WI5A 5BJTB 4R2GB 2J4WL 5CWSA 4M4RA 1ZA6A 3HNTH 4LLYA 2FX8H 4Q9QH 1OQOA 4N1EA 1X9QA 2P5WD 4ETQA 1LEKB 2PN5A 4YHYC 4XPFH 1CLZL 12E8H 4KY1L 5I2IA 2X9XA 5JW4Q 3T04D 5J4MA 1CDUA 2VDNH 4LDEB 5JIHA 1KIRB 4JANB 2V2TA 1KB5A 4HC1H 4MD4B 3TPUB 1RUPH 4FP8H 2IAND 3NZ8A 4LCWE 3UO1H 4RGNB 3ZHKA 4BQ8A 2FATL 1ZHBB 1Q72L 4KTEL 4X7TA 5HBBA 5INCA 4TSAL 3H42L 3FQWB 4GRLD 5DRWB 4E41A 1QLEH 3P77A 3TN0B 3HPLB 3G6AB 1JPTH 4TN9A 5LAXB 1K5NB 3PWLA 2DIAA 3IDXL 1KPRA 1X5HA 1DDHA 2BSSA 3HAEG 5IG7A 3OG6B 4OZIA 2GJZB 1RK0A 2WQ8A 1PLGL 4GG8B 3EYVA 1HE7A 3MJ9H 4WJ5B 3QDGB 4ZFZA 4C54A 4PJ7F 3T0VA 4JKMA 3GJEA 5I1KL 1XF5B 3QUMH 1Q38A 1WAAE 1XEDA 1LP9B 4X6CA 4NN6B 3G04A 1FFPB 1MOEA 4PJFE 3SKNB 1FGVH 4YE4L 1DLHB 1N64L 2FDBP 3GSVA 4NQXB 3MA7B 4NWTH 4ZUTB 4GSDL 5FYKH 5TJWK 4FQXB 1WIUA 4Y0GA 4RNRB 3O2DA 1KJ3H 4PJAB 4XMKL 2PXYD 4ONOA 3K2MC 1HXYB 1L7TH 1CGVA 1S5HA 2GSIB 4LL9A 4IIQC 4OLZH 5DXWA 1PKQA 1MIMH 2DQEL 3MFFA 4RFOH 4TTDD 4BSJA 5TE7H 4GKSA 3ARBA 2VLKE 2V5YA 1MPAL 4OF5A 1F6AB 4G42B 3BUYB 3QYCA 2IGFL 5DD3L 3GSWB 3T4AA 1T4KB 3NH7H 2OLDA 5KVMC 4V1DB 4K2UH 4CBPA 1HHHA 3D85A 3WIFA 3SKMB 5EU6D 2V5SA 4A6YH 4U7KA 1LO0H 4ZUSB 2ZUTA 1FDLH 3V52L 1INEH 3O6FD 1FL3B 1QBMH 1RZGA 4D9LL 1AGBA 4XP4L 4D8PB 5J13C 1IVLA 3CD4A 1PYWA 1TQCC 3LZFH 4P2QE 3TO4A 5JPNB 2EDKA 1NBYB 3AFLA 43C9A 5EZOL 1HNGA 1Z9SA 2NPLX 1YPZE 2V2TB 1CTNA 4CKVX 2YA1A 1ADQA 2P5EA 2YUVA 3UZVB 3D0VB 1ZANL 2XOTA 5JOFB 3UXFA 4XTRC 2NY0B 3N1PC 1V05A 4M1DH 4UINH 4GBXB 3C60C 4M62H 1A4KA 3UTQA 3H3KA 3Q0HA 4HS6A 3VI4E 2WUCL 3HLAB 3RWGB 3MUZ1 4QRQB 2ESVE 4M6AA 4L9LC 5ERWB 3GMOB 3BP4A 4N1CA 4U1JA 4OZIB 3UPAA 1NUFA 3ZE2F 1WC7B 2CUMA 5C0CE 4JPKH 4AIZB 2IPTL 4EI5A 1MI5A 4X0KB 1MH5A 5EB9A 3WO4B 2R29L 4GW4B 5IVXA 5CEYB 1RJYA 3RKPA 1ZGLA 4F2MB 1ZGLP 2KL6A 5IK3B 5IB1A 3TZVC 4JO1H 5DK2B 3U36A 3DHJA 4F37F 1YN6A 3TBSA 2FSEA 1U8IA 4X9IA 5HDOA 1JWMB 2A83A 3PP3H 3G6JB 2CDEA 1IQWL 4EXKA 2DLHA 1F02I 4PJBE 5DMGD 1JV5A 2WIIB 2FJFB 3U4EB 4JN1H 1P4BH 3QISA 1C5DA 3NA9L 5D96C 1U3HA 3BSZL 4YK4B 2ESVD 2Y7QB 5F1KC 3SDXB 3IRPX 4TVSa 3P0VL 3KXFB 1QFUH 5EZLB 4NQDD 2YMXL 3CMOL 5SWQB 1IAKA 3GO1L 2F54D 1PSKH 2E9BA 1SJEA 3VWKD 3FFCE 5MEQA 1E6JH 2P7TB 1KXQE 1MIEL 5J6GB 1AD9B 1T22B 1EFXA 5T5NF 2E7LC 4XPTH 4ALAL 1FZJB 4TNVK 3VWKA 2VQ1B 3L3OB 5E2VH 4GRWB 3CAFA 1FSKC 5DT1H 4NQTA 4ZNEA 1HH9B 4A2MA 5ID1B 5HHQB 4NQVA 4PV9A 3LKRB 2V7NB 3IETA 3PWVB 1T0NB 5B4MC 4EIZC 1MCRA 1NFDE 4BH8B 2BVQB 2BY2A 3U46B 4NQSA 3BIBX 1YEHL 3DVNB 4PJ8B 5FO7A 5ETUA 3OHXB 2D7TL 1XCQB 3QT2A 5DD5L 4ELME 4QXGH 1N0LA 1ZV5A 2E3VA 1BZ9B 5HY9B 2I27N 3VXSA 2AV1A 1XGTA 1WC7A 4NSKA 1UM5H 2OL3H 5FYKE 2C3VB 4CJ0A 3MC0A 4G9DA 4HX1B 2AXJA 5EFIB 2XACC 2W1NA 4QRRE 1OAQH 1OSZA 3MCG1 5K9KA 2NXYC 1P2CA 5J0BA 4O4YH 7CGTA 4Y5YC 4QRSB 3SQOH 1RHFA 3HZVA 1OAXH 4Y4HB 3FQXB 1YYLL 4TRPH 5FV1L 4N0UB 1YEKH 4OZHB 4W6YB 4X98A 1HINH 3RKDD 4NN7B 3O45A 2AJVH 1TITA 1ACYH 1B4JL 3SE4A 4ZS7L 3BP7B 3ALPA 2ATPA 4O2CA 2DTMH 4PJBB 3BKYL 4YDKH 2AP2A 4OM0L 5ESVA 4ISVA 5HHME 1F6LL 3F7PC 5CKGA 1R3JB 4PJAF 5ANMA 3F62A 1VGEH 3CZFA 4XWOD 2CPCA 4YXKH 1F58H 2R15A 4FQ1L 4OCSL 3S8WA 1A4JA 1CXFA 4KROC 5EZLA 4APQC 1BVKB 1XAUA 2OTUA 4CN4A 2BJML 4PY8J 5CJ5A 4BKLA 3DGGA 1HNFA 3GSOA 4YHZL 5DMJB 4UMGA 1AR2A 4WW2C 1KGCE 3DVFA 1F5WA 5GPRA 3QEUA 4MB3A 4PP2B 4DN3L 5IVXF 3QG6B 2FECI 4MHHG 2QJDA 3CK0H 3FT2B 4LSVH 2G60H 1C7TA 3GMNB 3ROLB 3M45A 5HGDB 2R2EB 3GJFK 2I9LB 4U1IB 5CS7A 1LDPL 1RAMA 1KLUA 5ISZB 4NOFA 5FF6B 3RVWD 3SE8L 4YDVB 2GFBA 3HE6C 4KU1A 1DFBH 3L3HA 1Z9LA 2FR4B 3KJ6L 3PHOA 5DC9B 1TVDA 2A6IA 5E08H 4O58L 1ZVYA 3V5KA 2HFFA 1MCOH 4NCC1 2CJUH 4IEFB 5EU4A 1KIPA 3TC9A 2C4FT 1S7VA 3RIFK 3VFNA 4M7LT 2NTFB 4E41B 2LTQC 5FOBB 1CL7I 3L3GB 4IRSD 5E6ZA 5BS0A 3HE7D 1S9XA 5J13B 3I6KA 4XP9L 4F58L 2ZCLH 2CD0A 3G5YA 1TENA 3PJSB 1LO4L 5DD6B 1G7IB 3HUJE 4JFFB 3GIVA 3MNWB 4PRIA 2HFEA 1A1NA 3IDYB 4TULH 5GRWA 1ZA3A 5CMAB 2F53A 1DBAL 3AS1A 4WHYH 2CLZA 5DHVH 4IRSA 2EXYC 5T3XE 1CXEA 3KPQB 5ICXA 1M7IB 2R0ZH 1VADB 3BKJL 4UNTA 3WJJA 2AEIT 3TZVB 1A1OB 5JDSB 2GAZA 1II4E 1EJOL 1A6VH 1AGBB 1AXSB 3MOAH 4PRID 5BZWB 2VR5A 4LPXA 2ADFH 4JJ5A 3TCLA 3VRJA 2E7HA 2VH5L 2VLJB 3VXMD 3N1GC 4X7SL 2XICA 1DUYB 5D1QA 5CINH 4E5XB 3QEGL 4I48A 4K8RL 4YHPB 3WN5B 2P8MA 1BVKA 1QA9A 1UCBH 2DQFA 1G7MB 1JGEB 5CD3B 4LSRH 1MVUB 1UT9A 5DVOA 4MJ2A 4OZGB 5T5NG 1B4RA 2EH8H 4PRPA 5DGRA 5DQ9B 3QXDA 3SDDA 2P5WE 4KUCF 4NN5B 3HC3H 3E1F1 1GOGA 4KI5D 4U1GB 1EH9A 3QPQD 4XGZB 4AG4L 1T2QL 3HMXL 3M8OH 2AGJL 4MDJB 5JPMB 3PWPB 4ZDHB 4BUGA 1X4YA 1JP5A 2DQDH 3OKKA 3JBG7 2VZ1A 3ARTA 2B4CC 5GSVB 2YD9A 4OGXH 3MV9B 4PJXA 4MJIB 2VLMD 1TCRA 3LEYL 1QSFB 2B2XH 4RDQG 5LGJA 5L8LB 3BP5B 4FXKB 3WUWG 2FYYA 1IMHC 1AXTL 5IB5A 3ZYJA 4G9FE 5DC4B 1TPXC 1JGLL 3ARGB 3QQNA 2LV4A 3H9ZA 4FFZL 5EULV 5D2NE 3VE0A 1G9MH 2VITA 4HJGB 1UZ6F 2P8LB 3LOWA 4J8RB 1JF1B 1YMMB 1QFPA 4JFFE 5C6WH 1AGEB 1JPFA 1LO3L 5D2LA 5FGCB 5B38B 5I17B 1EK3A 1OTTD 2L7JA 4G6JL 4U4BA 3WUWB 5CLTA 3M07A 4KVCL 4M7ZB 3KJ4C 1NFIB 2RB8A 4JZOA 4ONHA 1CFQA 4EUPB 1D7FA 2OXHA 5DHYA 3RWHA 2NX5A 4Z5RA 3TA3D 1CCZA 3RWIB 3ZSTA 3IF1A 5EPMB 1E28B 4WRLA 2JJWA 4XNYH 1A7OL 1L7IL 3INUH 2E6JA 4ZOAA 5TDOB 5DJ6B 5EORH 1NAMA 2UYLA 1FC1A 4UNUA 4GT7A 1VKXA 3H9YA 3IU4L 4JCMA 3PWJA 4PJIB 2GJ6E 1SHMA 5IB4A 1KG0B 1S9VA 3H7LA 4LSUL 1QSVA 1R3IL 3DSFL 2ENYA 3LS4H 4Y4HC 1IC1A 1KCLA 5KS9A 2YPKB 4HMDA 3JWDC 2H3NB 3FL7A 2D7OA 4DK6A 1NMCB 1ORSB 3VG0H 5IMKB 4C56E 5JOFA 3I2CL 4BUHA 1OAUH 4PJCF 4X7CC 4E9LA 3DX8B 3V4VH 2MCPH 3VGAC 4Z76A 3A67H 1DEDA 2X4RA 5JPMA 1KPRB 3HC4H 4HWZB 4Y19A 1JGDA 3TBYB 1NCCL 1UA6H 4LKCB 1AC0A 3IFOB 5I76A 1RZKC 4UZGA 3CVIL 4EQ2A 2DQGH 3RWFB 2XPGB 1RU9L 1K8DA 4JRYA 2WBKA 3DXAD 3CSYA 2Z9TA 3MZGB 3K4DA 4HBQA 3QDMB 5D1ZB 1OGAD 2OQJB 2F9BT 4KRPD 4X0KA 2ZCKL 4MJ6B 4PJ9C 5MEND 2ATPB 1NCWL 5CGTA 5ADOL 5E8DL 4PJHF 2C3HA 5ADPH 1BM3H 3CXHJ 4D0BA 4NUGH 5D93C 1CXKA 3W0WE 5AZ2L 1PQZA 1NGWA 3ULVC 1NGQL 4C57C 4PGEB 3MZTA 1WWAX 4PGZA 3LKOB 1U3YA 1D5ZB 1J8HA 2QR0A 1GGIH 4OF6A 5GISH 5JHDE 5I1JL 3DPBA 3F12B 1Q0XL 5DMKB 1P9MA 4CN6A 4MVBC 4XCFH 5KVEL 5DVNA 5CP7A 3SDXA 4RQQA 3FQXA 5DJDB 2VXSH 3PDOA 3NA4A 2XN9E 1HEZA 1FN4B 1N5AB 3AAZB 5BQ7A 4JQIH 3O41A 4JLRA 5B21A 2W0FA 1FNEB 3I50L 4KJPC 5B22A 1Q1JH 4TUOB 1F4XH 3BD4A 5CEXB 3T0EA 3KPTA 4NM8H 2JB5H 5T33H 4OI9A 2AJUL 2Y06H 3L9RB 3E0GA 2FX9L 1AD0B 2NY1B 2VABA 5F7DB 5I0ZA 2B1AL 1R3KA 2NZ9D 2IANB 2E7LA 3MXVL 1J0YA 4FFYH 3QDMD 2J7LA 2I9TA 2RJMA 4JDTH 1D9KC 1NSNL 4BH8A 5E8OB 5I15H 2D0FA 3QUXB 1Q9KA 3MLZL 3WXWH 5HVWA 2EIZA 1N3NB 3ULUF 1J9CT 2NW3B 3PQYE 3CFBA 1YUHA 2WUBL 3LPWA 2D4FA 3MNZB 5HY9A 3K1DA 5MP6H 2Z35B 3IDUA 4NQDE 3MLYL 3SY0A 5E00A 2NY3D 4XAWH 3EJZD 4P9ML 4RMVA 2AXHA 4QOKB 3STBA 4FA8A 1W0VA 3ESUF 1NLDH 1GGYA 4NRZB 1B0GA 3UP1A 4G6MH 1CFVL 4ZUWB 4FQXD 4U1GC 1UM6H 4AIOA 4FG6C 4Y16C 3GSNA 5ITFA 1E4JA 1QTYT 4UDTB 3RVUD 1OLLA 1KJ2A 3WSQL 1OGTA 1MCWW 3E2HB 5GGVL 1I7ZB 4FQCH 3QEQD 3AS0A 1QLRB 1C12B 3MACH 3QJFB 5HDQL 5GGTH 3EFFB 3I02B 4ZPVA 4N0FA 5T1MA 3X13B 1Q94B 2XFXB 3U1SH 3ZZ1A 2A77H 4OZGA 3REVA 1DBKL 4IS6B 1FIGH 2KZ1B 3IVKA 3MRJA 3VFMB 5E24E 4C55A 1MRCH 4ZAKD 4PJEE 2GJJA 1FN4A 1KIQB 1QNZH 4PGJA 1BD2B 5EU3A 3W9DA 4WTZA 1F13A 3EAKA 2ZUXA 4LLVA 5FYLL 3FKUS 3QQ3A 3UPCA 4ODXA 5I9QC 4JFPA 3U7YH 4M4PA 4G3YL 4OZIE 3QUYB 4U1LA 1KEGL 1WQVT 4ODVL 5DD0H 4PTTB 1WICA 2DKUA 3GSNH 5T1DL 5HGHA 3V7AE 4MNGE 4WI8A 4YO0B 3T2PA 4WI2A 4YHOL 4G80A 1A7QL 2R39A 3ELAT 4F37K 4PJIF 2ATKA 4UT9L 1KELH 2XTJD 3DUHA 4ODHH 2VZUA 5C2BH 2CIIA 3DETC 4B53A 1SEBB 1IBGH 3L5XL 5F88A 4NNPH 1BD2E 1FBIH 3CCHA 3ESVF 4ODTL 4XCYA 3LKNA 4GKNA 4LPVA 4O02L 3HFML 4IIQA 2YSSA 2XXCB 2MQ3A 2APWA 3BT2H 2EYTB 5I8EA 4F7TA 1IGJA 1UVQB 3PGFH 2D7NA 4OZHE 1UXWA 3BVNB 5HGAA 1U8LA 5H35A 3CJJA 1NAMB 2BNRA 2UYLB 4MNGB 4OBRA 5FECB 2W9DL 2WK2A 3I84A 4DUVA 2EZ0C 3LIZL 3QFJD 3MRLB 3L7FA 2I25N 4TNVF 2KBGA 4OD3L 1JPSL 3I9GH 2ICCA 3QQ4B 1HSBB 1W72A 2HVKB 3IDGA 2NW2A 3LQAH 4LIQL 3X3FH 3PQYD 4I0PA 2F5BH 1C1EL 3NPZB 4P46D 4LHJB 1FL6A 3OAZH 3DUUB 2A9NH 3K1KC 4I48B 1RUKH 4B50A 1RZIB 2NY0C 4DVBB 5C92A 2PTTA 4PJ7A 5E2WH 1F8TH 2YBRB 3N1MC 4NIKB 1KB5H 1B6UA 5DEZA 3W82A 4KKAC 2E7MA 1KCUH 2VDMH 1CE6B 1OB1A 1PYWB 2OR8A 4BJLA 1J87A 3QJHA 5IW6B 4JVWA 2D9CA 1A3QA 4LVHC 1AP2B 1QSFD 1NGYB 1ZOXA 5JW4R 1QVOA 5CSGA 4WU7A 4OKVA 4HT1H 3MRIB 1WZKA 4GBXA 5ILTH 4AEHH 2APFA 3RUGB 4NRYA 1KEGH 4ESKA 5GZOD 2G9HA 3S98A 4RZCB 2HH0H 1DN0A 2ICWI 4LOUD 2L4OA 1UH2A 1M7DA 4G6AC 2YN3A 4R90L 1J05A 1OSPH 4XBPB 2VLKA 1DBKH 1RZFH 4LDOB 3KPLA 4NQEA 5GGUB 2P8LA 3DTXB 4HHAB 3WDIA 1T6WA 2HLAA 2PW2A 1RVFL 1XF4B 2EE6A 4PJ5A 4P2OA 5TH2B 5FDYA 3TFKD 4HWEL 4JGMA 5I1IH 1H3VA 1BQLL 3LN5B 4G7YH 4LCWB 4H26A 3AROA 4PRNA 4XWOC 1CIDA 2OQJA 3GRWL 4R4BA 3HPJB 4LQFH 4AJ0A 3BEVA 4JZOB 4ONHB 1C16B 4KKBD 1ZLWH 4XCEB 1WZLA 1I1CA 1CICD 1FZMB 4ZSOE 4P46B 4OZ4A 4L5FL 2W0FB 3P40A 3C6LA 2WQRA 3B9VA 4MNQA 1CDBA 1FL5B 1UM6L 5FAAA 1H15B 1MHHA 2XTLA 4HUXB 3SCMA 3D39A 5FB8B 2NCMA 5IF0A 1IT9L 1H5BC 2H9GA 4Q0XH 5BW7A 3WFBL 2WLZA 2FEDD 4M43H 4QNPE 3LD8B 2EO1A 3TT1H 3WYRA 1FG2A 5C0RL 2X41A 2WBJA 3TT3L 4M5ZH 3IXTB 5I8KL 4WI9A 1FYHB 3BDXA 3JV5A 3S9DB 5TF1H 4AEIL 4FQQB 4HDIB 5IG7B 3KLHD 4JG1H 4KUZH 4MA7H 1RK0B 2X4PA 3MLZH 1JNLH 3PF2A 3KWWA 4GKZA 3JVGC 3ZHDA 3DX8A 4ZUSA 3MGAA 3OXRA 3BEWA 2VQTA 4MLSA 5IJKC 4ETQB 2V9RA 1TQBC 4YHYB 3R1GL 1P6FA 2DQUH 3K46A 1AGDA 4QRRA 2VWEE 4HK3J 1N59A 1V7NL 4X99A 1OD7A 3TVMA 1R3HB 5DJAA 1UXSA 1HKLL 3RWDA 2G2RB 4KI1A 1XGTB 3FRPA 3KPSE 4JHWL 3SGKC 2D3VA 2B0SL 2CH8A 3MRDB 4YWGL 2J8UF 4N1HB 1XFPA 1G7JB 4XCFL 1YMHB 3G6DH 1KT2A 3HR5A 4P5MA 1HIML 1FO0B 1ZE3C 2NXYB 2WW8A 1I9EA 4Y5YB 4FQJH 4D0CB 4Z7QE 5JW3L 5C7XL 25C8L 2B4CL 4XCCH 1C16A 4LNVA 3RDTB 3AB0B 4GRWH 3T0DA 5HYFA 1NDMB 5ADPL 2EIEA 1YZZA 4NHUA 4DUWA 5E8DH 4S2SB 1JI1A 4MLIA 3MBEB 3STLB 5TDOA 3UDWC 1HI6A 5JXAL 2ZUYA 1H9VA 2EO9A 2VKXA 2ZCKH 4HUUB 3SKUD 1CBVH 4U0RC 5B8CA 3Q6GL 4LASH 3F58H 2Z31D 2CO6B 3OR6A 2H6PA 5TGBA 2HRPL 3QIUA 2V7HB 3QXUA 1IKFL 3E6HA 4NFDA 5C08A 4IHOB 3QUZA 1JWSA 3V6OE 4GLRH 1JF6A 4JB9L 4L8SC 4R4ND 5LBSL 2BNUB 1NLBL 4OLXH 1U9KA 1DBBH 3CC5A 3T3PF 4KHTL 1R3KB 1CICA 2BHYA 5I9QB 5SWSA 3HRZB 4OUUA 3LKPA 4U1HB 3QIWA 15C8H 3A67L 3GI8H 4N9GA 3VXSE 3P77B 1GZPA 5D2NC 2VDRH 1AQDB 4XCYB 2ZNWA 4D8PA 4U6YA 4BELD 3KG5A 2XQBL 5GIRA 3WKML 4H20H 3QUYA 1MQKH 3S35H 1R3IH 1I7RA 5IB3B 1QG3A 2KKQA 1P1ZB 2Y1VA 4AENA 1PDKA 3G9VA 1JGVH 3NAAH 3S3JA 3ULUC 1CBVL 5L6YH 1YY8A 2OXGA 2NXZB 3U82B 1NBVH 3W0WD 5LGKA 3QFDA 4XHQA 4X6CB 3IJSB 2H2SD 5F7EH 3UJIH 1L7IH 3INUL 4XTRD 4B7LA 5ERWA 1EHLH 5D7JD 2WP3T 4RSVA 5GS1A 4HUKB 4D0BB 3ZTJG 5C7XH 2PYEB 4E41D 4LEXH 5F9AC 5H94A 3REWA 4TUKH 5GS2D 1A7BA 1BBJA 5F9JA 3VXSB 1ADQL 4HC1A 4UUJB 3NFPA 1YDPB 4F33A 2EYRB 1ERNA 1A6TA 5H37H 1F45A 2MJWA 4N0YH 5HYJE 1VCAA 4YWGH 3WHE0 1DQTA 4LPUA 1CFNB 1UVQA 1QQDB 3F7YB 4O2EA 1G9ML 3KYNB 3DECA 4S1SL 4HLZH 3TBWB 5JOPD 4FFZH 2W92A 3D25B 1S78C 5DHVB 1QFWH 1MLCA 1NBVL 2VISA 3L5WA 3BKCH 1IM9A 1LE5A 1S7UB 4ODXB 2B2XL 1RZ7L 5IVZA 5D7JC 2E27H 2EIDA 1NAKL 4ZXBA 5L7XH 1MQKL 3SDXE 4PJXE 1C5BH 1MNUH 1CS6A 1XZ0B 1Z9MA 3PNWB 1IAIH 4HGWB 3RPIB 1OAZH 3HI1A 3D0VA 5DMYA 2XZAH 3GM8A 3QO1B 3AY4A 3QXDB 1JNLL 4KUZL 4MA7L 4OGZA 1GRWA 5C07E 4DUXA 4I9WE 5I8KH 1K4DB 4HUMB 2JTDA 4LVHB 4KHTH 5F72S 4RX4D 5HSFA 3VFPA 5LBSH 1L4IA 1MCWM 3HI5L 3MNZA 1X5JA 3QIUD 4KI5E 2P4AB 1UCBL 3WIHA 1RHHB 3PE9A 2VDKH 5LG1A 4GXVH 1HYSC 5CINL 2Q6WA 4OKVB 3DRTA 1LEIB 2OCFD 1CN4A 3BO8A 3HG1A 4KRLB 1ZLUH 1NFDA 5JXAH 2A6KA 3DRQA 2DM3A 2WBJC 4TTDC 2AXGB 4RISL 3MMEA 3DSNA 3DVGA 4HXAH 1CG9A 3MGOB 2YRLA 5EOQH 3FRUB 1FFNB 4G8GE 4J3VA 3BKJH 3B9DA 3D39B 3VFVB 3GRWH 5JORB 1I7ZA 3K74B 1BQLH 1QYGL 3ARED 3ARDA 3CMGA 2UWEE 4KGLA 3ROOA 1MRFL 2ICWB 2X7LA 3I6KB 1FNGB 2GJ6A 4Z7WE 2CKBA 4TULL 3RWHB 1ZGLM 1FFQA 4E42B 5T3XD 1GPOH 4F57H 4F3FB 4GBXD 5F70A 1QPXA 2Q76A 2XZZA 3GJFB 3RA7L 4DEPB 4PY7A 43CAA 3OXRB 2BZDA 4JFQA 1CLCA 4PD4J 4OD2A 1U8QA 1JYXA 5C0GA 1NCBH 3TO4C 5IOPA 2QV2A 3QHFL 5E08L 5BVPH 3NVQA 5ANME 2YPKA 4WO4B 1R3HA 3FT3A 1CTOA 5DJAB 3QO1A 4PV9B 5BMFH 5A16B 5IM7B 4LF3B 3ZMRA 3ARYA 1BVLB 3GSOB 4FQIL 2VDML 4HULB 4YGVA 2WINB 1MREL 3O3AB 1F8TL 1IGCH 3QHZH 2R9HC 1HHKA 5EBMB 1ZWIB 3VI3F 2VC2H 4JFFA 2VLJE 1RJLB 5JIKA 1F3JA 3KAAA 3X3FL 1XR9A 3UAJC 4Q0XL 5T3XL 1BPVA 5HHPB 1F58L 3D39D 4FQ1H 3KPRA 1X7QB 3NPSB 5CEYA 1VGEL 5K33A 4X5XA 4Z7VB 3GEWB 2E9IA 3HAEH 3LIZH 3NIFF 5C09B 4MJIA 1OT2A 3TVMD 4NM4H 2NZIA 3CXDL 3KYKH 4PGCB 2F58H 1WWCA 4L5FH 5FO8B 3SGJA 3JTTA 2LE9A 2VZOA 4QLRA 5GZNC 1ACYL 3VFOA 4NO2B 4MX7B 5D1QD 1YEKL 2R1XA 2A0LD 4P23D 1LVEA 2HA1A 3B5HA 4JHAL 4G7YL 5JO5A 4G6KH 2XXMB 1D3CA 4FQHA 4GLRI 2EDFA 4M1CC 3KXFA 4GBXC 4X8JB 2BERA 1FL6B 5SWZD 1A5FL 3G5XB 4IBLT 3OJDB 5JA8B 3GDBA 2BC4A 2D2OA 2R56L 3C2SA 1KELL 3VXRE 1Q9OA 3U9UA 4X80H 1NGXA 3PWPA 4K3DL 5F1NB 1ED3A 4U1KB 2FLBT 2FX7H 4MJ4A 3H0TB 5FYKD 4Q9RH 3VFWB 5C0IA 2DBLH 1YNTA 4G8EB 5FGCE 2EICA 4P5TD 3NGBB 1HI6B 2DLIA 5DJ6A 1X44A 1J8HD 4FHBD 4QRPB 5IJVA 4CMMB 4HT1L 2DKMA 5J9PA 1NANH 1DQQA 5GQBA 3JWNC 1I4FB 5GJTL 2DBLL 5CGYD 1BJ8A 3BH9A 2NTSP 2FX7L 2MPAH 1OW0C 4WEBH 4X6DB 5KS9B 5D2NB 1KGCD 3IDNA 1QNZL 1KCUL 2P46B 2R56H 4OI8A 3LRSA 3P4MA 3GKWH 2FGZA 1FRGH 1NAML 1A5FH 4L3AA 3MRNA 3WD5L 1ONQA 4K9EC 1PJ9A 5BOPA 1PSKL 2UY6A 5CHNB 3ZHLA 5DRNA 3CMOH 4EJ1C 3MRDA 3SE4C 5HI5C 2CO7B 3TA3C 4LIQH 4JHAH 4H8WC 2IBGA 3PGDA 2JB6A 2LFGA 5IW3A 4RRPG 3L95B 3MRGA 4FQCL 4Z6AT 4ZUWA 4L4VB 3TJHD 4OZGE 5GRYA 3KYNA 5CKAA 2DD8H 3BEVB 2VR4A 2FRGP 2W9DH 4LNRB 3V4PL 4BZ1H 4UV4H 4DGIH 1VACA 3KYKL 4WDIA 1PKQB 2K3TA 5E7FA 3RIFF 1R6VA 5I6XC 1VKXB 2VE6A 1JMXA 1IQDB 3S5LG 3FZUD 2VRAA 1JF1A 1WCBA 4KJWC 3TYGH 3V8OA 3RL1A 5FA3B 2HMID 3MLYH 1PZ5B 5HHOD 4WWKA 3NZ8B 3OG4B 2IPTH 1IM3B 3IVKB 4MWFB 3EOBA 2NX5B 4Z5RB 1IBGL 3L5XH 4F15C 3O9WC 3T0ED 3UTTE 3SDAC 4MNQE 5HDBE 4JM2B 4XNZC 3PQYA 2MFNA 4XT1C 3MRRA 4FTVA 3T4YB 5GGRB 3OAUH 4NZDA 3MRQA 4OUUB 3RWCA 1ZA6B 3B9KC 4X9FA 3OKDB 4RIRB 4QRPE 5CSBA 4DCQA 4MDJA 3V6OC 1MJJA 3MO1B 4HIHB 4UINL 1BAFL 1KPVB 3GMRA 2BDNH 1UJ3C 3BESR 3UYPA 1E0OB 3CPLB 4JVUA 1FJ1B 2A2QT 1ND0B 4Z7UF 3I50H 5L2JB 1YEDB 4UTBL 3TVMB 4HGWA 3TBVB 3QRFM 2W91A 4J4PD 1ACZA 1X5AA 4R9HA 1NANI 3AU1A 3RA7H 4UU9B 5C9JB 2VLRA 3HTLX 2Y5TB 4PRDA 3V52H 2VXSL 4Z76B 1NC4B 2WSKA 1FIGL 2EEDA 3MJ6A 4Y19D 3J7HA 1YUHB 1PVHA 3UZQA 1Q0XH 3KHQA 4KKNA 4G5ZL 4PLKC 4GRLB 2HFGL 1H3PL 3PDGA 4RFNB 3SGDH 4ZFOL 1EFXD 5HDQH 2XNAA 5C0CD 3KPQA 1G7QA 5HGAB 3MODH 3RX8A 3X12A 2DQEH 4RFOL 1MCEA 2BOCB 3TO2B 3FQNA 3T77A 3C09B 3GSRA 4PJ8D 4WFGE 3UTZA 2VL4A 1HN1A 5HGGS 5I1HH 1ZLVH 5JIIA 3TCLB 3JSSA 4GXVL 2F8VA 4J6RH 3MCKA 2WP3O 3TH2T 3O4LD 4X7DC 1ITBB 4XAWL 3ROOB 5HYIA 5I1KH 4JO4H 4YNYA 1IARB 1HHGB 2RHEA 3QUZD 1A4KB 3UTQB 3G6AA 1IEBA 5EIIA 5CP7B 5I1GL 2GTWA 1B0RB 4EZMA 2IMMA 3DIFB 2MCPL 5T1LB 1TETL 1SY6H 3RZWA 4PYGA 4FXLA 5FEBA 5FDWB 2AQ3A 3QDHA 5J11B 4ZOBA 5E6IB 1BREA 3VG0L 1DUZB 1QBBA 2FATH 5ID1A 2M1KA 1T1WB 2BSTB 2E27L 3S34H 1BOGB 1A6AA 3BZEA 4F8TA 1JRHI 1W0VB 1FO0L 4JKPL 1A1MB 4WV1C 3GBML 4ZO9A 4OFDA 4F2MA 1XGRB 4LKXB 3CDYA 2A1WL 1J88A 4UT7H 1OM3L 1DVFD 5EORL 4C56B 1I9JL 3CLEL 1M05B 3WBDA 4U1MA 5F1SA 3K8MA 1M4KA 2FX8L 2P8PA 1EHXA 1A47A 4ZSOA 5D71H 3D0LA 3TBTA 2VLKB 2OSLA 4WEUD 3IDMA 4MGXA 4NC2B 4N0YL 3NN8B 1DR9A 2N56A 3I02A 4I0CC 4X6DF 3OTTA 1OTUC 2BY3A 2FIKA 1R24B 3KPRD 4BQBA 3QFJE 4CU7A 5KSVA 4GAYB 4PR5A 1N6UA 4X9BA 1FFPA 4P5TB 3AS2A 5AZ2H 1EHLL 5JQHC 3IF1B 2X89A 4FFWC 3OMZA 1B0GB 4GG6F 1BHGA 2ZZUT 1RQ5A 4PD4K 4HGKC 1RULH 3IAGC 3OKMB 5CJXC 2J6EA 2YZ1A 1TFHA 4CDGC 2R8SH 5D7LB 2AS5M 3O3EA 1HEZB 5J1SC 4NO2A 1T2JA 1S7UA 1JMZA 1U8JA 3S35L 4LHUD 2XQBH 3WKMH 3C5ZB 4OF0A 3MRFA 3T0BA 2AJ3B 4P2RB 1J1XL 5AYUH 2VWEC 4HWNA 4P4KC 3KPSD 5DJYA 3M8OL 4FRWA 2GHWB 2IBZY 1IKNA 3ZKMD 3TNMB 4PS4L 4CADA 5EZJB 5C0JB 1DBBL 3K8KA 4N5UA 3C8DA 1W0YT 3I2CH 2MQ0A 4LKCA 4FQLL 3W5MA 1O7VA 1PY9A 5IJKA 2IBBA 3QUMB 3DSFH 2HRPH 4JRWA 4M7KH 3GSXB 4LPWA 2C1OB 3JV0A 1UB6B 4WW2F 4WTZG 3FN0L 4X7SH 4D9QD 2NLJA 3TP4A 3IFNL 1EO8L 1T0NA 4QHLA 4JKLA 2VDOH 3ARFD 4HK0B 3RP1A 4LLWB 4GOSA 3C5JA 4NQED 4WFEE 3CUPB 3O4LA 1D6VH 1AGCB 1AO7A 3V6ZB 4IDLA 5SX4I 4XNYL 1JN6A 4OI7A 1JNHB 3RY4A 4R4FH 4F8QA 4YDIL 4DOHE 3ZO0A 3WIHL 5F97E 3I75A 3HG1E 2UZIL 1GZQB 1LO4H 2KZWA 1KLGB 1X5IA 4QT5A 3DHMA 3ZLQC 1P2CB 4JHWH 4WFFE 4R7DB 4MQ7B 4FG6D 2W9EH 3QQ9D 4GMSH 4WTXA 4JRXA 5SWSE 3B8YA 3NOIA 1TJIL 5D7LE 1FCGA 4PJGF 2X6MA 3GNMH 4LLVB 1RZGB 3C6LB 5FA4A 1VEPA 3B2UC 1YNTB 4QGTA 3VFUB 1JZ8A 3Q5TA 4Z7VF 3ULVE 1TZGL 2R4RL 5C2UB 2J8UA 2NY3B 2XWJB 2QQKL 3QRGL 4HIIB 4LVEA 5TE4H 4WWKB 3U7WL 4RGMC 5IVNA 3O3BA 1P7QD 5C9JA 4JG1L 2HLFD 1BFVL 5CZVL 5DR5H 4HS3B 1ZHLA 1CR9H 4IOSD 3HMXH 5TF1L 4I8DA 3MROA 8CGTA 3TT3H 3BXNA 4LRNH 3P9MA 3SQBA 3UTSB 5INDB 2WWMC 1H3GA 1OSZB 5GIRB 1ZK9A 3BHBB 4XH2B 5FYJE 1IT9H 1D6EA 4OCSH 1XR9B 4HS8H 1L0YA 1A64A 2A6JB 3RDTC 5DJ0A 1GL4B 2CLZB 3B2UD 3RUGE 4ZTPL 1J11A 4YLQT 5JA9A 4LLWA 3FO0H 4B0MM 2ADFL 2DTML 3ARGA 1OAYH 4PFEA 1IGJB 3MOAL 4B5EA 1B4JH 2BY0A 4LARH 3QUKA 2QADB 3SHSA 1T1XA 2VXUL 2WLYA 3B83A 1KIUA 1S9YB 3ULUD 4IM8A 3VU2A 3QUXC 5EUKB 2R0ZL 1YYLH 2CDEB 1HHIB 4MX7A 3P73A 4F7CB 3L3GA 5L2KD 3GMPB 1K6QL 4ZS6C 1RZJC 1A8JH 1WZ1L 3DXAB 1YA5A 3RGVD 5D7SL 5FGBC 2FLRT 1W0WA 4JM2D 2ZUWA 2ZCLL 4R7DA 1ZA3B 2XV6B 2IG2L 2XZCH 4NPYB 2R23B 1JGUL 1VFUA 4HIXL 4GS7B 4IDJH 2HH0L 3QI9A 3TIDB 3VFTB 3T2OA 4WUKL 5BXFB 1FZKA 2CJUL 2IQ9L 4JZNA 4AEHL 1S8DA 1OB1B 4QOKD 3DXAE 1JFQH 4OLUH 4UQ3A 1HILA 1BGXL 1U8MA 4YZFE 5IBTL 2W38A 1A1MA 2YPLE 2V2XA 3D39E 4PGDB 4I5BA 4ZFOB 1U92A 1KJVA 4WV1A 1XGUB 4PV8A 1EEUA 5F9OH 4IOIA 4XCNA 1LDPH 3VXRA 1HHGA 3RVXD 2BMKB 2G60L 1FJ1A 1KUMA 3RBSA 2D31A 2NY4B 5E2WL 3EYOB 4HG4K 1RK1B 4OD1L 3GO1H 2OI9C 4Z77B 3T0WA 1SEBA 5CGYC 5AZEL 2F5BL 3P0VH 4GRWE 2AV1B 4YIQB 2EE2A 5DYOB 3WLBA 3LQAL 4LBEB 3WMSA 5KVDL 1DQJA 1KFAH 1EEZA 4UOW1 5L88L 3NA9H 4U49A 2H32B 4S1QL 1AE6H 5I16B 4YXKL 2YS4A 1UZ8B 4ZFFA 1P4BL 3VMOA 5D7LD 5EH1A 3U30C 3G6JF 4M93B 5DEGA 5IB3A 4HQQL 1J0HA 4QRSA 3O8XB 3UTPE 4KXZH 1S3KL 3RTQB 2EDJA 1T7XA 4YDKL 5C3LD 5BRZE 3OKNA 4YFEA 3HPJA 4MCYB 4TVPE 1JWUA 1MLBA 5GSRB 5C0BE 3QFDB 3U2SB 5KZCD 4G6AD 4ETYA 4NDMA 5KVFH 4I3GA 4M03A 1IGML 4X6EB 5E1AB 3KDMB 2NQCA 3FOMB 2OZ4L 2EH7L 3R06A 2AQ2A 3BMVA 3R4DA 2LU3A 3SQOL 1WZMA 3OKEB 4PJFB 4IHOA 1XGQB 1HQ4A 1LMKA 2X70A 2XKNB 4TQEL 1T3FA 2I5YL 4HF5H 2FEEL 1NBZB 1X5ZA 4JM4L 4IJ3C 3L3JA 4Y16A 1MF2H 3O11A 4JE4B 5C2BL 4NN6C 4YQXL 3QIWB 5F7FA 4ODHL 3F7VB 2HVJA 4X83A 1BOYA 4BK4A 4PJDE 5F21B 2YRZA 3OKKB 3MXWL 1U8QB 3KGRA 1YEHH 3NCYP 1CFTA 3CGTA 5CJOL 3SGKA 4U2YA 3VXUD 1V3LA 3MRQB 4KQ4H 4PTUA 3NFSH 2VLJA 5A2KH 2GUOA 3OXSB 5J12B 3CSYB 1RZJL 4FQPA 2R2EA 1NUDA 2JCCA 3MR9B 4L4JA 3QIBC 4UDUA 2F53D 3GMRB 3GHEL 3ES6A 3U7YL 3I6GA 1GH7A 2DICA 4D9LH 2PR4H 3UTTA 1N59B 3TO4D 3V6OA 4DVRL 1XGRA 4LKXA 4H25A 1FDLL 4RRPA 1AGCA 3PP4L 4Z7NF 5IHUL 3R0MA 5GRUL 3FOLB 1IEHA 5SX5H 1YYMH 1G0DA 1T1YA 4ZAKB 2YRPA 1YMMA 3KLHC 4L1DA 5JNYB 4IRJB 5KVGH 4KROD 1QR1A 4JY4B 3VXUE 4MNHB 2DJSA 4RWHA 2ZUQB 4G9FB 1O7SA 3I75B 3QDJA 1Q0YH 5DD3H 3K2UL 1KNOA 2LVCA 2E9JA 4JO2L 1I1YA 4Y5XC 3MACL 3CFKB 5E2UH 3H9SD 3DUSA 3DWTA 3LRHA 4WWKC 4QHNA 4JEGB 5B39G 1FYTE 2P43B 3EOTL 3BQUD 1P7KA 4B41A 1MIML 5TDPB 3BZDA 3HRPA 5JUEH 4P4RA 1P84K 4P5KB 4ODSH 5DVKA 1KJ3L 3RZCA 4W6WB 1NJ9A 1C7SA 1JTTA 1EBAA 5FYKL 3QXAB 1OGAB 1N64H 5IROA 1FE8L 4CRPA 1FL5A 5IB4B 5GS1B 2CK0H 2F5AL 3H9HB 5DRXB 2H41A 2V2WB 4MXVE 5EA0H 4OLVH 4XHJD 1P5UA 3QUML 4M6MH 1TZHA 5DA4A 3UBXI 3GGWB 4I77H 1S7RB 2MHAB 4HLZG 4HJJH 2IEPA 4WHDA 1QSFE 3HI1B 1EDQA 3HE7C 3H3PL 3QI9D 4OIBA 2BC4B 2P8MB 2AJSH 3LEVH 1A7RL 3MRCA 1K4DA 1I3GL 4CNIB 2J88L 4K23L 1QEWA 3H42H 4P2QB 1G9NH 1BFSA 2F15A 1NMAL 1PZUB 3T1FB 4FFYL 2Q7YA 4MZ3A 5CP3A 3VRLF 5IT2L 1E4XL 4JFEB 3WFZA 2NXZD 3OXSA 2DIJA 2B1AH 4WEMB 2YXMA 1GZPB 3MLSL 3O41B 5JXEA 4HC1L 3VH8G 3W81A 2FX9H 1QBLL 1BWWA 5GZOC 2XA8L 1IEAB 1CD0A 5IQ9A 2JB5L 3Q5YA 1TJGH 5EBLA 5EOCL 3V0WH 1G7PA 1DEEB 3HA0A 4PPTA 5ESAA 5F7DA 4ZUTA 4OM1L 5ACMA 2GI7A 2QHRL 4RMTA 4U7MA 1T0MA 4NGHH 2FGWL 1FAIH 2X4NA 3VG9B 3D87B 3EW3B 3C6SA 4PRHA 5KVEH 1PEZA 1J12A 3RAJH 1DDHB 2MTPA 3SDCA 4V2BA 2NY6B 1AGEA 3QSKB 1JPFB 2BHZA 5D2LB 5I17A 1Q9WB 2DL9A 2ITDB 2YUXA 4JFEE 5DJ8B 4PJHB 2N7AA 3QXVA 2C1PA 3BPLC 1MCIA 3D85B 4GH7B 3HZVB 4NUGL 1X5FA 5D2LF 5EU5A 1T5WB 3ZDXE 5EU6A 4LNRA 4M7LH 2ORBH 4HLJA 1RFDL 4QT5B 1L7TL 3FONA 4MJ5A 5A2FA 2P45B 3T8XB 1T21A 1OGAE 3C6LD 1P69B 2FCBA 4H88L 4RGOH 1I7TA 3SN6N 3WUZA 4ISVB 5JORA 1EAPB 3IDIA 5IEHB 1G7HA 2O5ZL 3B9KB 3LKOA 3VXOB 4Q97A 1A7PH 2ED7A 2VLME 4ZOCA 1ZHBA 4KHXH 4LF3A 4J2XA 4JG0L 1U3ZA 5I1DA 5J6GA 4DZBA 1Q94A 4MYWB 5DZOA 2IH3B 4OGAC 1U36A 1ZWIA 3W9EA 1OP3K 5T3ZL 5H2BB 4KKCC 1JPTL 5MERA 5F71A 5CJBA 4G8GB 1QLEL 2IAMC 5KG9B 4J3TA 2A6DB 4LLDA 4DCQB 1Q72H 4PJFF 4NJAL 1NGYA 1MI5E 1SJHB 1N6QL 4X6BB 1DQLH 1ZLSL 5IQ9B 3T3ME 4Y5VC 4QXTA 1A6UH 3TO4B 5JPNA 4L8CA 4NZUH 3C60D 4JRYB 1LO5B 4Z7OF 1BQSA 12E8L 1N8ZB 3BZ4A 1ZVSA 4AEFA 3OGCB 2YPLD 2HG5A 2HKFL 3U36B 3AB0C 2I9TB 3QR2A 2C9AA 1I4FA 4S0TD 5EUOF 4AH2B 3B2VL 3EOAA 5IWLC 3RNQA 4FNLL 4NKMA 3FOMA 1F6AA 1TNNA 2CR3A 3MLXL 3CVHA 4NZRL 1XH3B 3TWCH 5DD6A 5EOTB 3VDAA 1DL7L 4KVCH 5I1CH 1WGOA 1NGWB 5GRJL 3O0RL 1ZSDB 1RIUL 1XT5A 1DANT 5TQ2L 3EYUL 1AKJA 1JNNL 3BKMH 1EMTL 4MCZA 2AAVA 5E94A 4L8SB 3SGDI 1FIEA 1ORQB 1CK0L 4P59L 2JJSA 3ARXA 1ZGLB 4KTYA 2CUIA 5C86A 3C09C 4OKDA 1YNKH 4JFPB 4IRJC 1CVRA 3PWPD 4XX1G 1UWEL 1YEGL 4EUPG 3ZTNH 4BQ6A 4I18B 4OQTH 3RQ3A 2GY7B 3LV3B 3PL6A 3BOVA 3MV9D 3LPFA 5ITBH 3VXNA 5D7IF 3VFRA 2WBWB 3MOBL 1BX2B 3WNNA 5IIEB 4I1NB 4QOKE 1CGUA 1MVFA 3G9AB 4UQ2A 1CGSL 3RU8H 4PB0L 4WCYH 2NY4D 2OTWA 1I8MB 2AGJH 2BNQD 1KJVB 1T2QH 1KEMH 2UUDK 2JJUA 5DUML 3V4UL 5E70A 3DUUA 3TF7C 5J1AB 4Y2DA 3HC3L 5IM7A 1F3RB 4Q2ZA 2JCCF 4XP5L 5J57B 4LCUB 4M02A 3KR3L 4L1HA 3HNSH 2ESVB 2DLFL 5E8PB 4Q6IA 3NIDE 2O5YL 2YA2A 4ZUVB 1D9KA 1IL1A 2FWOB 4XVTH 5DK2A 3SY0B 2A74B 1FVEB 1VGKB 3BUTA 2P5EE 1ZTXL 3NABH 2BFVL 3C08L 4WGVB 4L4TB 2HJFB 1JTPA 3CFCH 1GAFL 1KCVL 4WDIB 3DRQB 4MHHI 3UTTB 1BQHG 1EJOH 2GJ6D 2FH6A 1OF2B 4KTDH 2C4XA 1JK8A 2Y6SD 3B43A 2ADJA 1DLFL 1CXIA 4S0SD 5HYJD 1DBAH 5C0BD 3P3YA 5EIVA 2BOBA 4DWHA 1CL7H 2ADGB 4PYHA 5DURB 2ICWA 2HKHL 4C58B 3MLVH 1N2RB 4L4TE 4DK3A 1MFCH 2NY2C 3AS3A 3G08A 3LEXB 2IH1B 1IGIH 1AD9A 4XNQA 3KPNB 4NC1C 4F7TB 1M71B 5I1EL 4JM2A 1E28A 4Y16B 4N8CL 5EBWA 4Q7DA 4R4BB 4YDLC 5FKPA 5GS1C 4QXUH 1EHAA 4NO0B 3DMMA 2PYFB 1YC7A 4K7PL 3BGMB 4PJBA 5FYLE 2DN7A 3U4EA 1HDMB 2OP4H 3WS3B 5D1ZD 1MQ8A 4R3SA 5B39A 1FC2D 5ID0B 1O0VA 1OCWH 1TCMA 4PJ9A 4K94H 4PLNC 3BYTA 4LP4A 3BI9X 5FO7B 4K71B 4UT6H 3HC0A 3WS6A 3AU1B 3OPZL 1CU4H 5IMKA 3N1FC 4JREB 2Y07H 2BMKA 4DN3H 3SJVD 2NTFA 5CUSH 2Q8BL 4YHKL 1S5IL 3KXFD 3HAEB 3TIEA 4P3WA 1BZ7A 3ZYZA 4LLQA 4L3CA 1N0XL 3LB6D 1CDJA 5DJ2B 3ZL4H 4QXWA 4OTXL 1QSEA 1NCUA 1ONQB 3CFIC 2ERJC 3HZKA 2R2HB 4HUNB 4X98B 2ED9A 3BP6B 5IFJA 1CWVA 3OJMB 1I8IA 3QCTL 3BWUC 3S7GA 1RUQL 4ONFL 4XP6L 1YC8A 2E7BA 2YSSB 4HK0A 4UIMB 4P46A 5GZND 1IAOB 3FONB 4MJ5B 2EKSA 4WI6A 4PJAE 5IB1B 4ZG1A 4KKAD 2AK4A 5FCSH 1K4CA 3UPRB 4FQXC 1HINL 3P9LA 4Y88A 2VLRE 4TRPL 5FHAL 2MMXA 2NY6C 5HGBA 4NSKB 5IEHA 3KDMA 4JVPA 4OJFH 5TGBB 4LGSB 2O26U 1NUNB 3G5YB 3IFLL 4N8VB 4Y2DD 3D6GA 3CFJB 4CUCA 5HHMB 4EDWL 3MJ7B 4H8WH 3WLWD 4K8RC 4TVPL 4DN4L 4NZJA 3EYQD 1Z5LA 3OJDA 1I85C 1BFOA 4IRSB 1N5YH 5DJZA 5E5RB 4LSTH 1NDGA 2EEBA 1RZIA 1AGFB 1J1OL 2D7QA 3V0VB 5F3HB 2Y4SA 1B90A 2PW1B 5E56A 1S9KC 2VLLA 1OTSD 2COQA 2ZSWA 4KDWA 1FZJA 4CAGA 4TUOA 1HOCB 1XIWC 4L3EE 4OB5H 3VXTB 1UKQA 4U6XB 3BD3A 1KXTB 3VRIA 1LD9A 4ZMAT 1T7YA 3QPXL 3FAXA 4W4OC 4DW2H 5E2VL 4M6NL 2VDQH 1S7VB 3VFNB 4M8VA 3FB8B 1A9BA 3CFEA 3RUGA 4KVNH 1JGEA 5CD3A 2W60B 3ORJA 5JLZA 2N4IA 1IC5L 5GRVL 1AO7E 1MIEH 2IH3A 3CC5B 4FQQA 3MOQA 4HJGA 3ZT7A 3PIQA 3EYQC 2ZOLA 5GS0L 5CJXA 3L7EA 2OP4L 2Q7NA 4OFYA 4I2XA 1JUFB 1QFUL 4GG8A 1UEYA 5D1ZA 4Z8FL 2X4NB 1KLUB 5ISZA 1ZSDA 5D1XA 4XBPA 3WUWA 3QDJB 1T1WA 1TDQA 3BSZH 4PJGA 1MCFA 2B8OT 5CSZA 4D0DA 5F89A 5IHZA 5IVOA 4POYA 5E9DE 3EYSH 4YFLF 2HFFB 5I1EH 5K59E 4FQXA 5D1XD 4HIEB 3KS0J 3OAZK 4RNRA 9CGTA 5IV2B 3SBWC 3UJTL 5BS0D 1G7QB 2PO6C 1MFCL 2P42B 4LEOA 3JTSB 3L3DA 2HKHH 3OJVC 3ZE0E 4NKOB 2FBJH 3NACL 3PV7A 3PWNB 4PJIA 1F4AA 5MENE 4MJID 5ESVB 2DQFB 3FO2A 1YMHA 4HUXA 2R0KL 3SCMB 3VFSA 5FM8A 5EC2A 1EAPA 1ITCA 3IDIB 4JPKL 4XI5C 1D5MA 3RWEB 1VFBA 2GSGB 4JPVL 4KGJA 4J3WA 3QFJA 2X89D 5AAMA 3DYPA 3MLTB 4OCYH 4CMHB 3GJFA 4LSSH 1RZ8A 2ARJA 5HHNA 2ZCHH 5B38G 5EZJA 3RVVD 1FZOB 3VA2C 2AV7B 5J3HD 5CD5D 1D5IH 4KC3B 5MENB 5EO9B 2JE8A 4XZUB 5IOPB 2MOVA 4KZDL 3OKDA 3NZHL 1BECA 4F7EB 5D1QB 2DQIL 1U8JB 3PL6D 3C8KA 3OGOE 3Q1SL 2XG5A 5DUMH 5FHBL 4MJ6A 3C5JB 1QBML 2BNUA 1INEL 4WCYL 4HXBH 1BEYH 4UTAL 3VGDA 3PXJA 5IROC 4EI6A 3OGCA 4FXGA 2OM5A 3K0WA 3RZCC 3V7AG 3SO3C 4RCAA 1WTLA 3V79C 2G75A 2YPVH 5E00B 1DQJB 2Z31C 2Y36H 1DQDL 2R0LL 1GGTA 5F89B 4MB4A 3VXPB 1EO7A 1MPAH 3MQIA 3FB5A 5TE7L 4I0PC 4APQA 5M95B 3F7QA 3P4OB 3GIZH 3BP5A 1CK0H 4P2YA 1SEQH 5EBWB 2HWZL 4YXHH 4BZYA 4LEOB 5KANI 1MFEL 5T1LD 1RIUH 3W2DH 2IADA 4QY8A 3O0RH 4NN7C 3AGVA 1RUAH 2UZXB 1N7MH 3FJTA 3BJ91 3PWJB 4YE4H 4CJ1A 3EDJA 3H9SA 2NXYD 1VPOL 1OP5H 1XF2A 5F1OB 5DD1L 3ULUH 4JFDB 1QR4A 5F9JB 1AY1H 4OZFH 1PQZB 1FVCB 1YPZB 4EXPX 4JDZA 4LLMA 3MJ9L 4WO4A 3B2VH 3GMPA 5EZIH 5F7UA 1JZ3A 1PLGH 3D3VA 4UAOB 3EYFB 2VXQL 4EQ3A 1XR8B 1CXLA 5HYQA 4OGYL 2P1YA 1BF8A 2W59A 2DDQL 4DZBB 3U9UB 2FO1A 2PTTB 4PJ7B 5TF0A 3IDXH 4OFKA 4BQ9A 4E0RB 4QF1A 3FMGL 3RVVC 5BO1H 4RQQB 5IFAH 5A2IH 5JR1H 4ODWB 1PX3A 4JFXB 4TSAH 2EDXA 1SM3L 5MERB 1MAML 4DGVL 4ELMA 2HT2C 4NQDA 3UO1L 5EO0A 3MV11 3BDYH 3MPCA 1IM9B 1LE5B 4NKIH 3NMEA 5BO1L 3BP6A 1P84J 3WIIH 5J7CC 1CLZH 5DUBB 4WW1A 4BFIA 2X4TA 2GITB 4ZUUB 4ZXBD 3S4SA 3LDBB 2BVQA 4Q9CA 4HH8A 2GTZA 1KPUB 3KLDA 5DFVC 3UPRA 2VZTA 1ZVHA 3ZSSA 2WIMA 2YK1H 5EN2B 5EG6C 4P2QD 5TDNB 3QWOB 4R26L 2HTLC 4K3GA 4ONGL 4NFBA 2HP4A 4KKLC 4AT6A 3RGHA 3W2DL 5BZDA 1MCNA 4KZEH 1MELA 1F4YH 3S96A 1B2WL 3OX8A 4Y1AB 3PDOB 1ZHNB 1SEQL 3DX7A 5IB2B 1WBZB 1DP0A 3BIKA 2F74B 3QEHB 3MLRL 1FH5L 2CDFB 3BRDA 3QCVH 5D72H 3HZMA 1VEMA 3MA7A 3VFGL 1JIBA 4LK4A 2R0LH 1E4WH 3V6FB 2NNAB 2Y36L 5C0AA 2YD5A 1S8DB 4KV5F 1KN4H 2YPVL 1G0YR 5KSAD 2HYMA 1HSBA 1W72B 5HYSB 5ANMB 4F7CA 3CZFB 4NBZB 1J8KA 2RQ8A 3PL6B 1NCDL 2N1KA 4X9HA 3QJFA 2W9LA 1Z0NA 4FQ2H 4ZODA 4PP1D 4RAVB 5F7KC 1CT8B 1MJ8H 1UWXH 4ZNCD 2QHRH 3WXVH 2WBJD 4K07A 4P9HC 2O61B 3MRRB 3T4YA 4XMLL 2Q76B 4Q74A 3O3BB 2DQIH 4UB0L 5F96L 5LXGL 2Q7YB 2D9QB 1K3ZA 2X4SA 5GS2H 1W2KT 5KN5B 4NKIL 2DS4A 3AVEA 5D1XB 3NCJL 3BISA 4L9LA 1KPVA 3IFOA 5IT2H 4NQCD 5ESQA 5FO9B 5LGHL 1SM3H 1CI5A 1MH5B 4CVWA 3QUYD 1GC1C 1GSMA 4Z95H 3HUJA 2VAAB 3VGBA 5JR1L 5DJ2A 4ODBD 5IESH 1FYTA 2FWOA 4UV7H 5IJVB 5JIPA 1JPGB 4OCYL 4MZ2A 1KSRA 1KTDB 3CFDA 2V5TA 4UDTA 1V5JA 3KNBB 2BXYA 2X1OA 3H3PH 1MLBB 3LRGA 3TH3T 2FSEB 5EU6E 2PXYC 2R0KH 3QUXA 4TNWK 3L3DB 1X3DA 2HTKC 3QO0A 4LCYB 3W39B 1F90L 4PLJD 1BLNB 1DTUA 5DD1H 4GW5B 1Y0LA 1XGQA 4I0KA 1TVBB 4P2RD 4PJ5B 2R2BA 4X4MA 3VFVA 4ZD3L 4YIQA 5DYOA 1RUAL 2CMRL 3UJTH 3HE7B 4HEME 3U4AA 1B9ZA 2WMPA 3X14B 1N2RA 5CSZB 1B0WA 5I0DA 3OQ3B 4ODSL 3EO1A 2ARJQ 4KDVA 4WNQB 1OWRM 3JV4B 5SWZA 3EYSL 1CIUA 1U95A 1JYNA 3WNMA 4WY7L 3RTQC 2EYTA 3EOTH 3L6FA 5IK3A 3TNNB 4JO2H 5FO8A 3SDAB 4LCCB 2R23A 2QQLL 4HPYL 4KK6C 1AGFA 3GHBH 3O4OC 4K8RD 5HI4D 4HUVA 1F3DH 1QLRA 4OSUH 1EVTC 3KPMA 5C0NC 4QGYA 5DWUH 2V9TA 1U2CA 3I6GB 1YYML 2XZQL 4QHUA 5GRUH 1NPUA 3E8UH 3SGEH 5DSCA 1GC1L 1IFHL 4UTAH 1BEYL 5I74C 2XWBA 2VDQL 3SPVA 5LQBH 5DI8A 3MYZA 4UBDD 1KOAA 4NJ9L 4P9HL 3Q1SH 4WU5A 5DGQA 3VXRB 3EOBB 2WWMD 4MMZC 2ILLA 5J6HA 4DEPC 1BZQK 4HJ0C 1MCCA 2QQNL 5FYJU 2UUDH 3K3QA 4AMKL 3CZJA 2JIXB 2Z92B 5EBGA 3KPLB 4NQEB 3FFCD 1WIPA 4HHAA 1R5VB 3MXWH 4JFEA 5FGSA 3RPKA 1MY7A 4ZFZB 3RFZC 3P4OA 2AKRA 4Y4HA 2MQCA 2ZCHL 3UC0H 4UNVA 3BAEL 4G43A 4H0HB 4H8WL 4U1MB 4E41E 4G8FA 4MNGA 5I19L 2P8PB 4MDIA 1A0QH 3LVEA 4JPVH 2XRAH 2R2CA 5IQ7L 5F1IB 4HIEA 3TN0C 1K4CB 3GFUA 1FFOA 4PLJC 4IOFC 3MRPB 1PAMA 1WCBB 4KAQH 3KHOA 2BVPA 32C2A 2OMNA 2FBJL 1IZKA 5SX5K 1DBJL 3ARBB 4GKNB 5KVFL 2FD6H 3O3DA 2R1XB 3UCRA 3EO1B 4PJFA 2MNUA 1VADA 4U6VL 3ZDYE 2P24A 3MLPA 5IMOA 4XP6H 3VMPA 3MREB 2E8ZA 2GTWB 4OT1L 2DQCL 2E6PA 1DSFL 4JZJC 4K9EH 4P5KA 4OZHA 2EZ0D 1ZT1A 4LCCA 4POZD 4UOW0 1KTKE 4ZQKA 4Z0XA 1KFAL 1HQRB 5BVJA 5KVDH 1MCBA 3KLAA 1P7QB 4TPRL 3KPOB 1WFOA 2APVA 3QIUB 4WUUE 1XGYL 1KF9B 3QQ4A 3TJEL 4L3EB 5LJYH 2AJ3A 4P2RA 4DKEL 1I1AB 4MXWL 2IFFL 5ESAB 4NQCE 1U92B 4JDZB 4LLMB 3WL9A 5AUMB 5IW1B 4LGRB 3M17A 4JPIB 3L3KB 3C9NB 1VA9A 4HKZA 4LPTA 2BVYA 1I85A 3TNMA 2H2PC 3VD3A 4S11A 4BKLB 4DKFH 5A2JH 1EO5A 2KH2B 4E0RA 3SE9L 3PQYB 2DWEB 4HJ0D 1XGYH 2CRIA 4J4PC 5HJ3A 3X11B 3QA3B 4TPRH 5IBTH 1DBML 4GRLA 2IQ9H 4PJXB 1XGPB 3A6BL 3U83A 4QTHB 4P49A 1G9NC 1MJJB 3MO1A 5IBUG 1KCRL 5EOCJ 4N8CH 5MEPA 1JGUH 2X4UA 4OT1H 4LSTL 3IB4A 5C70A 5EC1B 3P4NB 4GW4A 4L29B 4DN4H 5IVXB 4YK4C 4GO6B 4XNMA 4PLKD 1CDHA 1XF3B 2AJYH 4P5TC 1OY3B 3TBVA 2Z8WC 3BYYA 2DYPD 5TDPA 5JQ6H 1KB9K 1HKFA 4MCYA 1T0MB 3WEXB 4U3HA 1M7DB 3LKSB 3MGTA 3B9AA 3BWAA 4NUJA 3ETBF 5DFWH 4OJFL 5C0CA 3GUTA 4BSVA 2YKLL 1DLFH 3EJZC 5HHOB 1V8HA 3O3DB 5E0QA 3OKEA 1OL0A 5IVXE 4N0CD 1XIWD 1JTOA 2BXZA 4JFDA 3MREA 2FIRT 3WO4C 3JWDL 3OX8B 3FT4B 2BFVH 1J0IA 4JFED 2DRUA 3LD8C 4PY8I 1NGPH 2ADIB 2HVJB 2HFTA 4LHUA 1IAMA 2XT1B 4EBQL 3R0NA 1WBYA 1U41A 3OF6A 1HXMA 2P5ED 4OTXH 2EC9U 1R0AL 4AMKH 2XG4A 1FNLA 5HI3D 4Z7WB 5KJRL 3NGBC 2K9UA 3GMLB 3BJLA 3LQZA 1RJCA 4OCNC 5FYJL 4ZXBB 5GSVA 3HE6D 1TQBB 1J86A 4NQDB 4R97C 3ZE1E 1QSEE 2Q8BH 2J8OA 4NJ9H 4FN0A 3VGGA 2V9QA 2Y07L 5DR5L 3F5WA 3D2UA 3QNZB 4PB0H 1CU4L 3CDCA 5K9JL 5KZCB 1Y18B 2XTJE 5DVMA 1KULA 4OV6F 4M00A 2QQKH 4Z78A 4NN5C 3LN4B 4GS7C 1GGBL 5ITBL 3EJYD 4OSUL 3O2VL 2AK4E 3MNVA 3B3IA 5DRZB 5FCUL 3HR5B 1L0QA 4HPYH 4P23B 5C0FB 3EFDL 4RGND 4Y2DC 4ZO6A 3ZTNL 3HZYA 1UWEH 5KSVB 1CE1H 5I73B 1BMGA 3DROA 4BFBD 4BA8A 5ESQB 5FO9A 4B7IA 3UYOD 2W9EL 4GMSL 1M1SA 4MVBD 4FZ8L 5EPMA 1N4XH 3TGXA 4XC3H 5E5MB 5TQ2H 3LMJH 1KTLA 4G8IA 4O2EB 4H0IA 4JKKA 3C5SB 4ZTOH 2CMRH 5FM5M 4GQ9H 5IMLA 3JTTB 3U0WL 1OTSC 3MLVL 4NYLA 3P0YH 3O4LB 2UWEB 3I3DA 1LK2B 3V5HB 1H5BB 1C12A 1CVSC 4J8RA 4PREA 1OOAA 2YR3A 3DV6A 1TZHB 3WNPA 4ORZC 2MKWA 4N0CC 3U30B 5H94B 3REWB 4K71C 1D6VL 2DMKA 3EIFA 3VD5A 1H8NA 3FO9A 4PGBA 2G5BB 1UEMA 3QEQB 3HS0B 4PJHE 2KUTA 5HYEA 4GRMB 1KB9J 3GBNH 1WT5A 1CFQB 4EUPA 5KSAC 3CFCL 3OR7B 3B5TA 2Z8SA 3BMWA 3C08H 1S78D 3DGGB 4PY7B 4Z95L 43CAB 4XVTL 3MROB 1I75A 5KS9F 5GGTA 5F3HA 1B0RA 5F3BA 1ZLSH 1R5WA 3QULB 3QUXD 2JKXA 1I1AD 3NCJH 3SDAA 2DLFH 1UG9A 3HNSL 1JJUA 3U6RB 1I7RB 1PW3A 4JQXC 2H45A 2ZUSA 1D6EB 1IL1B 5F96H 3VRIB 5LXGH 3JWOH 2H6PB 2AKRB 2Q6WB 4BFEA 3SDYL 3IGAA 3KVQA 5C08E 5BW7C 5ID0A 4NHCH 4XVSH 4DQOH 3MRHA 2I60L 1YEEL 1AH1A 5F1IA 4K3HA 4PRAA 4KJPD 1JN6B 1A7PL 5E6ID 3MMEB 1QD0A 1UXSB 5GS3A 3B3IB 3MBEC 2I24N 3ARFC 4AL8L 1GHFL 2DB8A 4AIZA 4H88H 1J0KA 5E99L 3MUGB 2YA0A 5IHBA 3U0TA 1YEGH 3RWFA 5D72L 4W68A 4YPGA 1R5VA 2RGSA 4KK9C 1FO0A 1C08A 1FH5H 2ZSVB 4DOHB 3MUJA 4F80A 3BKML 3HKFA 3OB0H 2CDFA 1OPGH 2AK1L 4YAQA 4PJ7E 5DLML 2Z4QA 2EKSB 2HN7B 2FEEI 2LTQB 4QRUA 4JFYA 4L3EA 3RI5K 1FV1A 2FGWH 1U3HB 5M7QA 4Y5XB 4FNLH 1IE5A 1AC6A 3VD4A 1D5MB 1YECH 1EBPA 3GKZA 4MQXD 1MJ7L 4NNYA 2R69H 3KPMB 2OR9L 5JZ7C 1I3RA 3RVUC 4HGMA 5C07D 5HHVL 5DRWA 1OM3H 5IMOB 5CIPH 3TN0A 4NQUA 2IAMD 5EOCH 3V0WL 5C0IB 3PDDA 4N0RA 1FO0H 4JKPH 2XA8H 5GGQL 3QPQC 2DQTL 3QAZC 4O51B 3X11A 5INDA 5C09D 5DFVD 43C9B 1A6UL 3BDYL 1E4XH 4PTTA 5E8NB 3LKQB 1HH9A 4XXCA 4X4ZA 2R2HA 3ABZA 2J88H 2VLLB 4L8CB 3C60A 1SY6L 1QO3B 4L29A 1HILB 1U8MB 4OLYL 5MI0B 5I1GH 4Y1AE 1CXHA 1RY7B 1S9YA 4FXKA 4OZIF 4KHXL 1OT1A 4JFZH 1J10A 3LKSA 1E6OL 4M48H 3IJSA 3ZDZF 4UILL 4AYFA 2Y23A 1MCPL 2C3GA 2CK0L 2F5AH 4GKSB 5EA0L 5HHXH 2DLGA 3MYJA 4Y4FA 1YN7B 3FB7A 3HMWL 1FE8H 4RA3A 5GHWH 4PG9A 1N7ML 4RGOL 1W72L 5DMIL 2FECL 4ERSH 5IR1A 3HE7A 2ADGA 4F9LC 3L1OH 2I26N 5JUEL 4BSWA 5JMOC 3E3QC 3IU3B 5E4IA 4M7LL 4DFIA 4NO0D 2XTJC 5I74B 4W70A 3SKJH 3G04B 4D0DB 1NCTA 3H7BB 2KQNA 4NRZA 4NO5B 4C4KO 3QXAA 3TLRA 2Z4QB 3RTQA 4J23A 1DQDH 4P99A 2HFGH 3GSUA 2X05A 5IV2A 5C8JA 2PO6A 4G7VH 4I3RL 1ZT1B 2VKWA 5GGRY 7FABH 5J8OA 2H8PB 5KVGL 3GZKA 5D9SB 2IPUG 3FQRA 2VISB 3L5WB 5JXEC 2YHGA 3BPLB 3WS3A 1ZAGA 4NGHL 5I8OH 4BYHA 3T65A 1SY6A 2PR4L 5DSCB 5I8CB 5FHBH 1T3FB 4OM1H 5BRZB 2WBJB 1CE6A 4YHLH 3Q6FA 4O51A 5T1LA 1TJGL 3TZVD 2H2SC 1NMBL 1EEQA 1RMFL 3D18B 4M5YH 4CW1B 1RZJH 4TNWF 4ELMB 1BAFH 2XKUA 4WHYG 3ZKQD 1NBQA 1TJHH 3MLSH 4LBEA 4IMLA 4LAQH 1HZHL 5F8RC 2BSTA 1NMAH 4UQ3B 3S5LB 1ETZA 2RFXA 1U6AH 3OAUL 5ICZA 2WWKO 1D9KB 4K23H 4W4OA 2EDLA 2CLRB 4LSSL 1IM9D 1KTRL 2CKBH 5D5MF 2FJGA 4Y4KA 1S7WB 3L3IB 2VDPH 4ORGB 1KIPB 1OP3H 1FHGA 4XWGL 5EN2A 4LAJH 3RWDB 1XF3A 3O3AA 2AQ1A 4I77L 2AXGA 4H25B 2X4OB 4M6ML 3TYGL 4HKXA 1NFDF 2FNBA 2Z91B 3OKYA 5LVEA 4OLVL 2PW2B 4JFFD 1IGMH 5KSBB 4JR9H 4ZFGL 2VXVH 4QHKJ 5ALCH 1MHPL 3IDGB 1RIVL 3QCUH 1JHLL 2XWTA 1U91B 3P0GB 3S96B 5FA3A 1EERB 2BNQB 4ENED 2GW5A 2GCYA 1RUMH 1MFAL 2FHCA 4ELMF 4W6XB 4AQ1B 5HXMA 4ELKB 5A2LH 4HQQH 3FQUB 3T0AA 4IRJD 3FQNB 1ZT4A 3FAWA 1YPZF 4L4VD 1AE6L 5DJDA 4Y7MA 1HHHB 5FGRA 5KTEL 4XZUA 2PO6B 1Z5LB 4N0UE 3R8QA 4DJMA 5E4EC 3QDAA 1Q0YL 3RDTD 1U8KB 4QRPA 5GS0H 1EGJH 5L9DL 3GMMA 1A22B 3BQUB 5AG8A 1JL8A 2RCSL 2OMBA 4H1LH 3EJJX 5KAQF 4DAGH 3ECBB 4M3JA 2F19L 1V3JA 2R9HD 1C5DB 1S7XA 3VXTA 1DEEA 4RX4A 2ZUVA 2JK5B 4YHNA 2ICEA 4WEBL 4QCIA 3KLSA 2MPAL 4XRCA 4HCRH 3M17B 5IBLD 2IANA 2GK0B 2PTUA 1TVHA 1T1YB 3QDGD 5A3ID 5LKNA 1D5XA 5C0BB 3LPGA 4M9OA 3O2DH 3TPKA 1X4XA 3VDBA 4TOYL 5D5MB 3MBXL 1ZHKA 4JO3L 3VWJC 1JFQL 5D7KE 4QF1B 2ZJSH 4CNIA 4MAYB 1MEXL 3T0EE 3NFSL 3UTTD 3A6CL 1AGDB 1I9IL 1IGYB 4IDJL 3LH2H 4KDTC 1J1OH 4LCIH 5JTWA 5ICZB 4OLWL 1X5XA 2ITDA 2DQJH 3MA9L 3MJ9A 1SMAA 5CAYB 2YWYA 1VENA 4HUWB 4KJYB 2Y25A 1FORL 1G6RB 2AW2A 4Z7VA 4OGAD 3S4SB 1MCLA 3W39A 3ZKNC 1BLNA 1QFHA 1JBJA 4EI6B 5CEZL 2XY1A 1K6QH 5C6PB 2EH7H 1OWWA 3SOBL 5LWYL 4RWYL 3CDGA 4OCMC 4U7SA 4UUJA 1KENL 3QIBD 4LARL 4MA1C 4OFPA 4P0DA 1H3WM 4M8QB 4OFIA 5FGBA 5E94B 2DQHL 2HLAB 1G7LA 3SDCB 3S3SA 1C08B 3DOSA 4U33A 5F9WB 3FHAA 3OKLA 3HUJF 1ZEAL 3FT2A 1INQA 1IAKB 4S1QH 1Q9OB 1FP5A 1HSAA 5AZEH 3NFNB 4X6BA 3V0AC 3H9SE 4MA3A 3SE3A 5BOZG 3L3HB 2FR4A 2VC2L 1CYGA 2CR6A 4HPOH 5CUSL 1QO3A 3UBXA 2FO4B 4YR6A 2GIYA 3QUZC 3QDME 5J89A 3KYOB 1S7SA 1E27A 3LAFA 1MFBH 4KK6D 1FNAA 3DGCR 1S7TA 1BD2D 3U7WH 1T03H 5IKCA 3D3VE 3EDKA 2OTPA 3F7RA 4QKXB 4YO0A 1Y6MR 5DA0B 3JXAA 4N9GB 1OCWL 3HN3A 1FG2B 1U8OA 3RWJA 4M6OL 1WIOA 1TMCB 4ODWA 4PLOB 1CFSA 3QHFH 4OLUL 5DRZA 3QUMA 3U4BH 5HHMD 5C0EA 3V8CA 1KN2L 5I1LA 1T5XA 5I30H 4LIQE 1Z6JT 3EHBC 2IMNA 1FPTH 5E6YA 4GAJL 4GW1B 3DX7B 5D6DA 5FK9B 1A02N 2X1QA 4V1DD 3LY6A 1KNOB 3FFCB 1UJTA 4CVXB 2IG2H 3DARA 3P30L 2BRRL 4I4WB 2UZIH 3V6FA 1JRHH 3N9GL 2BVOA 4G9FD 5IGXH 2NYYD 3GM0A 4QNPF 4K7FA 1A9EB 4WIQA 4NYLB 3HG1D 3EOAB 4KRPB 3DURB 4U1NA 4WHTA 4YNYB 2ERJB 2LQRA 3E6HB 3VXNB 1YMMD 1PEWA 5F7LB 4RISH 1KCVH 3GGWA 4W4NA 1TZIB 2VDOL 3RL1B 4YBHA 2VAJA 2C1PB 3AREB 3FO0L 1EO8H 5D6CB 1MCQA 3IFNH 4PRPB 4H1LA 5DQ9A 4PUBL 2LAGB 4U6HB 1OQXA 4PB9L 2APBA 2D03H 3WCYA 4EOWH 2F54B 3LKPB 4P5TA 5MHSD 2APTA 2BOCA 3TO2A 4DVBA 1M7IA 2CLVB 3JVGA 4CADB 3DMMB 1NDMA 1AIFB 2BX5A 1EFXB 3I6LE 4APQD 4FZEH 1HSAB 2CIKA 3GSUB 1PX4A 5DQDH 2ZPKH 3CVHL 3RX5A 4YHML 4LRNL 5HGDA 1OAKH 3S37H 3V4UH 5B8CB 1S7SB 4NC1E 3CFDB 4Y4KD 1F6FB 3LV3A 6FABL 5AWNL 1CR9L 5C1MB 1VFOA 3SKOB 3SCMC 1T04A 3VCLB 2Y5EA 5TE4L 2ZKHL 2G9HB 3QRGH 1EZVX 1C5CH 1RV6X 1P6AB 2UV3A 3CLFL 4P3DB 5LCVH 1EZVY 1JNJA 5B3JE 2FB4H 4WU5B 4PJXF 2JLLA 1MJUH 3GNML 3BFOA 2R8SL 2OL3A 1KJMA 4HZLA 4NC0B 2X44D 1NEZB 4GG6E 3BE1L 4HX1A 4AZ8A 1YNKL 4IRSC 3RRQA 3P4NA 3VXME 2YD6A 1A7NH 4NKDB 4MB5A 4XPHL 1Q9WA 1EMTH 1H0DB 3B5GA 2AJXL 3D9AH 1SMOA 1U8NA 5I71B 1EVUA 3VDCA 1KC5H 2YD7A 3OBAA 3L3IA 4MD0A 2M8XA 4JRXB 1JZ7A 5D7LA 4MSWB 2JELL 1I9RL 3QO0B 4P57A 4R8WL 4GMTL 1ADQH 1SYVA 4LRIA 4D9RD 1I8KA 5TPWH 4U1NB 4OCWH 4WHTB 2X7LB 4HKXB 1WJ3A 4NQEE 4WFED 2CDGA 1CD1A 3T3PE 3DMMD 5GRVK 5D71L 5EDXA 3MRPA 2B5IC 1CGWA 1YPZA 4X4ME 1DUYA 2VLKD 3CLEH 4QCIB 2SEBA 5GGSB 2VZSA 3WIFB 2A1WH 5T1KD 3SDCC 3TYFB 4G6FB 2BCKB 3OKOA 1GOFA 2OR7A 4U1SA 1IKNC 5DJZB 3GBMH 5BQ7B 5F7HA 1LO2L 1NGXB 1JGVL 1WVZA 3NAAL 3IXTA 3S34L 3GI9H 3OKMA 3AY4C 4Z7WF 2X9WA 4RAUA 3UYRL 1T20B 3NCFB 2XPGA 3SJVE 1DVFC 3QH3A 4FQLH 4AK1A 2DI7A 4ZXBC 2DWDA 2BHUA 4LPCA 4MS8C 4PS4H 5KOMC 5T5FH 5A16A 5I18H 3BZEB 3ARVA 4KK5D 1S7XB 1INDL 3D69B 4PJDB 4UIMA 1X6NA 1NLBH 2NW3A 3O3UN 4YBLC 2IWGA 3VWJB 4JB9H 1ZT7B 3CFBB 5AYUL 3EYOA 2O5ZH 3IDNB 4KK8D 1GGCH 4LDLB 1X6LA 2ZOLB 4ZAKA 1U58B 1WEJH 2VL5B 5GJSL 3QWOA 3F58L 3Q6GH 3HZYB 1VEOA 5T3ZD 3E2HC 4QTIH 4JY6A 4XB8A 2XA3A 1A3LL 3A0OA 3RI5F 2IH1A 1AI1L 4HWUA 5DMKA 3BDBA 1Z3GH 3GIVB 2XQYG 35C8H 4IIQB 1RFDH 4ZUVA 2B7DT 1PD6A 4PRIB 3ULUE 2CRZA 4Y1AA 3MODL 4Y5YA 2LAAA 4M7ZC 4ZYKB 2BNQA 3LHPH 3OKNB 5BJTA 3HZKB 3RVTD 3NIGE 4CVZB 3N50A 4GAFB 1H3PH 4KK5C 5JW3H 1HQRA 3QB7C 4KRNA 1SJXA 1CD8A 4JJHA 1WAAF 4PBXA 1LK2A 3RAJL 2PW1A 3G6DL 1BF2A 1K3IA 3HB3D 5DO2C 2WAHA 2R0WH 4PJCE 4X4XB 1T66D 1S7RA 2MHAA 1TTFA 2G5BA 4GRMA 4BH7B 1VERA 1I9JH 3T65B 4XP1L 4U1SB 3RGVB 5DFTA 5MEQB 1SJVA 1G6RL 4PJ8C 1FZOA 3MBED 3QIWC 1KYOK 3O6KL 1JHKL 4I9WD 1HHKB 5GGRA 4KKBC 1CZ8H 2DQUL 1ES0A 4Y2DB 3OZ9L 3RVTC 4XBEL 1NDGB 1K8IA 3CDFA 3BPCA 3BD5A 1G9NL 1AP2A 1QLFB 1UWGL 3QIUC 1QSED 4PJEF 2PNDA 4Q6IC 1I3GH 4P48A 1TETH 1A7RH 4I3SH 1N6VA 3QIBA 2AJSL 4M5ZL 4Y2OA 1E27B 4POUB 1RURH 4BQCA 2IAMB 2HTLD 1XCQA 4M43L 4O2FB 2VLRB 3IRZA 4JO4L 4YJZL 4PRDB 1A9EA 1WWBX 2VL5A 4MA8H 4KRMB 4OCRH 3CUPA 1CF8L 4DFHA 1D5BB 2AEPL 2D31B 4LLQB 2VB5A 4LVNB 3U0TB 4DGYL 4X6CF 4WUUB 4YHIB 1KBGL 1WV7T 5KSBE 3S4SG 3CFKA 3QHTC 2PYEA 4P2OD 1G1CA 3VI4F 4HKJB 3PL6C 4DGIL 1X5YA 1AXIB 1IC7H 3OAYH 4APQB 3LN5A 2YD1A 4KUCD 1VFBB 2GSGA 3Q2CA 3DROB 2J1KA 2EYRA 2WNGA 1H3XA 2F54A 1FVDB 1IAIM 4XPBL 4LQFL 3ZE2E 1QRNA 2NXZC 3FCTB 5I71C 2R1YA 1DQML 2DMBA 2VE6B 3VFTA 5L8JB 3K2UH 4D3CH 3GSNB 3SO5A 4G5ZH 1MWAA 2EYSB 4NNXA 1U8KA 1RZFL 1QRND 5EUOA 1NAMH 3NCMA 4PJCB 4PG2A 3MCKB 1PZ5A 2PF6A 4TSBL 3B9KA