3LZFH

Crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
224
structure length
216
Chain Sequence
VQLVESGPALVKPTQTLTLTCSFSGFSLSTSGMSVSWIRQPPGKALEWLALIDWDDDTYYITYSSSLKTRLTISKDTSKSQVVLTMTNMDPVDTATYYCARTLRVSGDYVRDFDLWGRGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin, HA1 Subunit
publication title Structural basis of preexisting immunity to the 2009 H1N1 pandemic influenza virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 38
structure length 216
sequence length 224
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfH01
3CVHB 1KENH 4X5XB 2A9NH 4W81A 4FQXD 4KUCD 1RUKL 3QUMB 1UWEL 4Z9KB 1EA9C 3C87A 3WHXA 2DLIA 2G9HB 1A64A 1HDMA 3IKCB 3TVMB 4GXUN 2DYPA 4M61A 5KSAC 1UH4A 1EK3A 2HRPL 5B8CC 5ITBL 4Y4HB 4HIIB 5INDA 3ARUA 5C0JB 5KSUB 3G6AA 5IROC 2HLFD 4KGLA 4JJHA 5FM5O 4L4VE 3OF6D 2W0FB 2OCFD 5TE6H 3VXMA 4PP2B 1TFHA 2EC9U 4NO0D 3RWFB 1OAYL 4XCYA 1UKSA 4F3FB 3TA3B 4PJ7B 4HUUA 2CDGA 1R5IA 3WMSA 1AKJD 2DI9A 4GKOA 3WLWD 1X6LA 1OAZH 5CBEA 3UC0L 1CFBA 4PJ5E 5CILH 4X7EC 4JZNA 1J18A 4BFBD 2QSCH 2FGWL 3H42H 1F90L 2DMCA 4M6ML 1NEZB 1FDLL 2NY6C 5HHXH 4PRID 4MJIE 5D5MB 1U92B 1Q38A 5CJXA 2VLRA 1YPZA 3N9GL 1WWCA 3QG6A 1L0QA 2B2XH 5EIIA 4PBWD 3W82A 3RDTC 2GJJA 4JM2D 1CFTB 5DFVD 4UILL 2NZ9D 1KNOB 4M1CC 4KY1L 4DAGH 3SE9L 2NY0C 4UNUA 4XBGB 4LGRB 4IHOB 1BEYH 3FT3A 4JZOA 4ELKB 4HIEB 4YC2B 5SWZB 1Q0YH 5I73C 4YHNB 1S7UA 3IFNL 5F6HJ 5CUSH 5HD8C 1RULL 3C5JA 4LOUD 1PY4A 3PL6C 5HI4D 5CHNA 4HUXB 3JWOC 4OCYH 4I1NB 3DV4A 4JFPA 1J1PL 4LIQH 4Y2DC 4Y8DC 1NGXB 5AYQA 2OK0L 5GS0D 1P9MC 1MCLA 4XX1E 4P23C 1G0YR 2H2PC 4ZFFB 1YNTB 2C3HA 2NY5C 2L0DA 4GBXB 3OKDA 4X7CC 5DJDB 5DA0B 4JKWA 3AY4A 1TNNA 2VXSL 4M1DH 1ADQA 4LNVA 4ZQKA 3U30B 3FQXB 4GUPA 5FYLH 2D3VA 1A6WH 3N1QC 4NCC2 5IWLC 2IC2A 3P0GB 2W9DH 2GQHA 1JTTA 1NGZB 5HHVL 4OQTA 1MNUL 3CD4A 4X7TA 2NX5B 3U0PA 3CK0H 3TZVC 3MNVA 4GAGL 1EO8L 1FO0L 1M7IA 3D25A 3DMMD 2LVCA 5DS8B 4PREA 2W9LA 4UBDC 3MBEC 4P4KA 3NCCB 2JB6B 1A7PL 1TQCC 5F7HA 5C6WH 1QZ1A 4OF0A 4BSWB 1JMZA 4DGVL 5DZOA 1WQVT 2VZUA 1IEAA 5B4MD 3CFDA 4YBQD 2V2TA 5BV7L 1ZT1A 3QIBB 4JHWH 2YWZA 1UA6H 2R2BB 1A0QH 3TBVA 4D9LL 5L2JA 2E6PA 1EXUA 2CLRA 1AXSB 5IT2L 3H9ZA 3STBA 3CIQA 2OZ4L 5GJTL 1NCCL 2VLLB 4RZCA 3VH8A 3D39A 3B9KC 4PJBA 5JOPD 3IDNB 3V5HB 3STLA 2XPGB 3F7YA 4ZUUA 3BDBA 1A7BA 5ESVA 1BGXH 1P5UA 3N1PC 5KVGL 2VZVA 1NCAH 3OKLA 4KHXL 1KYOJ 1XEDA 3T0EE 5HJ3A 3MCKA 2CSPA 3O4LD 2ZSWA 4JDVA 4TYUA 3VI4E 3IDJB 4KHTH 4K94H 3QPXL 4XNUL 3C5SA 4LVNB 5EOCJ 4I2XE 4LCUA 5ETUA 4DGYL 5C0AE 2UY6A 4R4BA 3DGGA 1NDGB 2HN7A 4PJ9B 1IBGH 1I8MB 1T6WA 1MRFL 4Q0XH 1F11B 1U3HA 3NTCL 4XPBH 4XT1C 4M7KH 1M71A 1XGYL 3QEQA 2Z31C 5FHAL 4J3WA 5GSVB 4B5EA 3W9DA 2OQJB 3UTQA 4KRPB 4HLZG 1DUZB 4R3SA 3ARQA 5C70A 1FH5H 2IG2H 1U8MA 3HUJF 1LWRA 4IIQB 5JW3L 4KVNL 4WVRA 1EJ6A 4DKAA 4YWGH 4NKQB 2RB8A 1AIFB 1CE6A 2D7TL 2DN7A 3QEGL 3UO1L 1S7VB 1WK0A 4OGYH 3E6HB 4ZXBD 4L8CB 4HWBA 4LQ1A 5LGHH 3U46A 1KTDA 3SKMB 5D2LE 4DCQA 4PJEB 5FK9A 4JGUA 2DMBA 5GGUB 4GAFB 4P46B 1E4XL 1FN4B 1LO2L 5LGKA 3MRKB 1OSZB 4YDKL 3QUZC 1T4KB 1BOGA 3QDMD 4QRPB 2GEEA 3MV9B 1HQRB 1JWMB 4JFFB 3BP5A 3BN9C 2AABH 3C5ZA 2QHLA 4RISL 3LS5H 3VCLA 2BOBA 3GK8H 2BNQE 4Y19A 2CLZA 4LLDB 2PO6B 5EU6A 2EH7H 2QADD 4JEGB 4Y0GA 1HINL 4Z18A 1UEMA 3DO3A 3GSOB 1YN6B 5D9SB 3X3FH 4ZPTB 4R97B 5L0QB 1UACH 2BVPB 1V05A 5BS0E 1D5BB 2ZOKA 1JCKA 1DEEA 1ZHKA 5J4MA 3WEXA 5DLML 4FFVD 4CNIB 2D9QB 2A1WL 4AJ0A 2AV1A 2P46B 3S7GA 3QXDB 2HT2C 2X70A 3VMNA 5JHDD 4YHZL 2QSQA 1EGJH 4R0LA 4U1MB 1RSFA 3ORJA 1GC1C 4L8BA 1O5DT 4NQCE 4P3CL 4HCRL 1GGBH 4O9HL 1S7SB 5ENWA 3U9UB 4A6YH 4XC3H 2H8PB 5MERB 3EDDA 3EOAB 3VXUE 2HT4C 3SDYH 2QTEA 3QRFM 5HYEA 4PGBB 3DX6B 4GJTB 4YFLI 1YEHL 4PRHA 5C09A 1YQVH 1SVZA 4AT6A 3RGHA 1MCJA 4IJ3B 3FO1B 3WXVH 4QT5B 5DRNA 4L9DA 4U1SB 3AROA 2O93L 2LQRA 3RWJA 3VD3A 3FZUC 3ZSSA 4U1LB 4XVJL 3TO4C 2XRAL 1FL3A 1T20B 5BVPH 2K3TA 5EUKB 3BAEH 3S5LA 5I66A 3QZWG 1SYSB 3ARDC 2PETA 2O5XL 3VFPB 3OR7A 4J3SA 2DQJH 1EEUA 4RAVB 1XGRA 1TNMA 1IAIH 5FYJD 4M62L 3ARTA 5DT1L 3RVVC 3OMZA 3C09C 2X9YA 4NCC1 2GAZB 1VFBA 2GJ6D 2ZKHL 5E6YA 4XNYL 5J9PA 2FATH 4LLYA 4PJGF 3HMXL 5EZLA 4KKCD 4EQ2A 4NZUH 3F6IA 4FXGB 4KK5C 4X6CA 4YDIH 4OLEA 3V6OE 1SJHA 4NIKB 4ZUVA 3MRJB 1JGLH 4MA7H 4Y2OA 1UYWL 4XNXL 4ZUTA 1HHHB 3OWEA 5SWQA 4P2OC 4ERSL 4HDIA 3MXWL 1OHQA 4XRCB 5F7EL 2VAAB 5F1NB 3MGTB 2QHRL 1EUUA 5IBLC 3SJVE 1ZA3B 5HI5D 3MLXH 4N8VB 1YNLH 4O2CA 1JNNL 1L7TH 4FABL 5EU3B 5D1QD 1F2QA 3NCFB 2P5EE 3T08A 2CDFA 3MR9A 4ONOA 5EA0H 3KNBB 3REVA 4Z7QF 4PTUB 3FQTA 1XH3A 1YY8B 3DBXB 4Z0BH 5F70A 3OJDB 5JXEA 2AJXH 3MUY1 4WUKL 1ORSB 2WLYA 1L6XA 2VDKH 3M17A 3SPVA 4MSWA 3G9AB 1T7XA 4AEHL 2CRMA 4CJ0A 4GLRH 3SCMC 2EDDA 3KYAA 2XFXB 4YEEA 1B9ZA 2BRRH 3ARGB 1X3DA 1ZK9A 4P2RA 2A6DB 3EGSB 4LPVA 4IRJC 1N4XL 4ZPVA 3UJIH 1KTKE 3BW9B 4J4PD 2V7HB 1TLKA 3VFUA 1EVUA 1ZSDB 2JIXA 5CSZA 3FTGA 1QG3A 4IMLB 1NSNL 1IGJB 4GXVL 1I1AA 1NBYA 1UJ3B 2DQUL 1MPAH 2P8PB 2VIRA 3LCYA 4K8RD 4M7LT 4P59H 4HKBA 4OD3L 2NXZB 1LP9B 1J10A 4E41D 4NFBA 2E9BA 4ETQA 2Q8AL 1QBAA 2ADIB 5KBNC 3QNXA 4YXKL 4Z7WB 4OLXL 1HOCB 4L5FL 3O6KL 2ITCB 2R1YB 2ZJSH 3SKJH 3BGMB 5E03A 1L9NA 2AEQL 1FO0A 4HIHB 5DVKA 1XCQA 1T1XA 5T1LB 1AD0A 4K2UH 4HBQA 4OCMC 4H20L 1DBKH 1RIHL 1MFBL 1KACB 4Q9RL 3ARBC 2BERA 3OQ3B 5TDNA 3D2UB 1TZIB 1N59B 5DD6A 5AG9A 2D7QA 3IU4H 3L6FA 3BPOB 3SN6N 3NACL 5ADOH 4X4XB 1NL0H 5C6TH 3ES6A 4JQVC 1R3KB 1VKXA 2Y5TB 4GRLD 2QSTA 5F8RC 1I75A 3S96A 5IBTL 4PJ5A 2VITB 5D2NC 1OGAA 4HX1B 4O02H 3RNQB 2GT9A 3T3ME 4DUWA 2OZ4A 4Y16D 5GISH 2DQDL 5MENA 4BZ2L 4KRMB 3TVMC 1NJ9B 2CK0L 2WMPA 4CW1B 2ZOLB 2ZCHH 4JREB 5JLZA 4K07A 1QLFB 1HHIB 3CH8A 5DR5L 1UM4L 5JORA 1HH6A 4U6XB 3P30L 3DETD 2ED8A 2JB5H 3RUGE 3FB8B 4BELD 4RAUB 3IDGA 3DUSA 3QCVL 5DA4A 5ICZB 4WJ5A 4FFYH 3KJ4B 4RMTA 4BQBA 2GTZB 1NGYA 1CTOA 4AEFA 2AJUL 4XAKE 4LPWA 3U2SB 4GQPH 4G8GD 4HIXH 5F88B 1WFUA 3S37L 4NQSA 3VWJC 1NEZG 2CDEB 4K94C 4U0RB 1HQ4B 4BYHA 5HHOB 4NRYB 4XXDB 4OAWB 4WUUE 3QDJB 1DBAL 1AD9A 1MCKA 5A2IH 4RX4A 5F7DB 1RPQA 3S4SB 5T3ZE 2G75A 2F5BL 4UV4H 4TSBL 2HFFA 2XXCB 1KJMA 4D0BA 1WVZA 1MVUB 4HHAA 1FORL 1LK2A 2PW1A 4LEOA 1XIWA 3C9NA 3G04B 5D6CA 1YNKH 1U8IA 4WNQA 4OI7A 3B2UD 3MJ8A 2V5RA 2NYYD 4ZFGH 3C60B 2NY2C 4XMPL 4OUUB 4XP1H 4JY5H 4PJ8C 1J0HA 1Y6MR 2VR9A 4WFHD 4AENB 3O4OC 3OXSA 1DBJL 2YPLD 1QSEB 3ULVE 2L7UA 3ZE1F 1OAXH 3EOBB 3V7AG 1JZ4A 3ARED 3FT2A 4ODUB 2X4RB 3LH2H 4JO4L 4JHAH 3B5HA 4TNWF 1JNLH 1QFPA 1QSFD 5IB1B 5J6GA 1MJ8L 4FQJH 4S10A 4F9LA 1D5MB 1G6RB 4QOKE 5AYUH 1U8OA 4GSDH 3RGVC 3VW3H 4GBXC 4Z0XA 2P43B 3N06B 5F7KC 1KPRA 1NC2D 5FYKL 3PNWB 5LJYH 4LSUL 2D7NA 2LU3A 4PJCE 3VFRA 1ED3B 4RFEB 5DJ0B 3OHXA 3P0YH 3BESR 4YIQA 2YUWA 3B4NA 2MNUA 5DJAA 4R90L 2X4OA 3D85B 2I9LB 4TQEH 4YHOL 1FVCB 1LEKA 1J8HA 1IGYB 2X1QA 4ELMF 4OB5H 4FP8L 3BRGC 1JNHA 5C08B 1KIUA 4YXLL 1E6JH 2RAMA 2E27H 5EZIL 1NAMH 1D9KD 4C54A 1Z0NA 1WCQA 5E8OB 4QRRA 1I4FB 1CS6A 1KLUA 2VXQL 3M8OH 4EUPB 5CP7B 3T0EA 4HIJB 3MODH 4X7SL 3UDWA 4TVSa 1EHNA 4HCRA 1JFQL 4I9WD 4G3YL 1WCBB 4WI4A 4ODWA 3EO0B 3RTQA 5CD3B 3ROOA 1B0RB 3L3JA 3NIFE 4KV5F 1LDSA 5A2JH 5E9DD 3EYVA 5EZOH 4HJGA 3SO3C 3T2NH 4UT7H 3ZLQC 1CLOH 4X4ZA 3HNSL 1RAMA 2YD9A 3P3YA 2IAMD 4JB9H 1CXKA 4DWHA 4MNGE 1H3PH 1ZVYA 1X5IA 3JVGA 2HAZA 1ZWIA 1TJHH 1KEML 1CICD 2AJVL 4K55A 4WY7L 2PW2B 2PYFA 2XV6B 1PBYA 1WZKA 1UVQB 3RL1A 3Q6FA 5GRUH 2P7TB 5DXWA 4DGIL 5D7IE 4OD1L 2XICA 3EYSH 4X8JA 4HUMB 1Y0LB 1I3RA 2EYTA 2X1PA 4JKLA 5KZCB 1NGQL 2CRZA 4P5KA 1P84J 4U1NA 5HYSB 3GMNB 5BRZD 1KEGL 3PUCA 1T5XA 2BVEA 3HMXA 4RMRA 4M5YH 1MQKL 3C6LC 5J6HA 3ARFA 5GRVK 3VXTA 5DJCB 1YYML 3WO4B 2F5AL 2OTUA 4YAQB 4KDTC 4NT6A 5E70A 1W72A 4KI5D 5A16A 2V5SA 4FG6D 4P5TA 4RMVA 3PWPA 4LCWD 3BWUC 2JJSC 1FJ1A 3RWIA 2BNRE 2BNQA 1J0YA 1FG2A 2V5YA 5SWSB 3BPLB 1J12A 1I7ZA 1CE1L 3HZVA 1T04B 2GK0B 3V6ZB 3GHBL 3HZYA 1XGQA 1A5FH 1Q0XH 4JO3H 3THML 3BVNB 4PBXA 3QZWA 5IMOA 3QYCA 1C7SA 3NCMA 5E6IA 1GIGH 1HHJA 1WBZA 1KTLA 5IF0A 3OBAA 1LDPL 3TH2T 4RRPG 1G6RH 4P46C 5FCUL 4WHYH 1LO5A 5DHYB 2H2SD 4Y4KB 4OZIA 4K3JH 3BMWA 1OQXA 3GI9H 5H37G 1IE5A 3AM8A 3FFCE 5C3TA 4KAQH 1LHZA 5GS1C 4FQCH 5MP6H 2Q6WA 3O6FD 4I48B 2ZUQC 3JWDL 3SO5A 4NQCA 4MCZA 2DBJA 4G9FA 5IFHL 2GJZB 4WO4C 1G7IB 3G08A 5GGRB 2F54E 2BVOA 2ADGA 2X1OA 1RUML 5GJSH 5FM5M 2RGSA 2J4WL 4NC2B 2E8ZA 2EKSB 2XOTA 3G5XA 3ILPB 4YQXH 5GGTH 3UJJL 3VXRB 2FX7L 2PYEB 3SDDC 1ETZA 3WJJC 4BFEA 3DUUA 1NFDE 1MSPA 2IQAA 4LK4A 4R97C 2H6PA 2F58H 1AY1H 3D9AL 3O9WD 3OPZL 1JGVL 4MA3B 2I5YL 4FQ2H 1CLZL 3NCJH 1FVEB 4H25B 2VQ1A 1ZLUK 4J8RB 4R7NA 1T0MB 4P2QA 5DTFB 2SEBB 1FPTL 1EAPB 5DI8B 3VGEA 3MREA 4JANB 1L9MA 1MJJB 3HLAA 3MLTA 1KFAL 4U6HA 1KG0A 3BXNB 3BT2H 3LKSB 2J8UA 3LRGA 5C0EB 3I6GA 5KG9B 2AW2A 3E2HC 3C8HA 1ERNA 4NZRL 1AGDA 4E0RA 1OAUH 3MRQB 3W0WE 1FSKB 3SQOL 2X09A 4NRZB 1ZLUH 3LPGA 3KPSB 1MRCL 5FUZL 4MCYA 4JPIB 1M05A 3JV4A 3RVXD 3CSPA 2FWOA 2ESVA 3HG1B 3B2VL 4EN3B 5CEZD 4EKXA 5I8CA 5JPMA 5ACZB 4S1RH 1QBLH 2HJKB 4U7KA 1G7LA 5C07B 2AXFB 5C9JB 2HH0H 3PWNB 4NRXA 4PJHE 3EYOB 2NW3A 2AV7B 2WSKA 2DAVA 3IFLH 4JN2B 3L7EB 4OGAC 4OFPA 1AR2A 2FJGB 4UTAL 3VXMD 3BUYA 1W2KT 5HGBA 1F3DJ 4R8WH 2HLAB 5D1XC 2DD8L 3KJ6L 3NFSL 5L88H 1INEL 3PGCB 4IMKA 1G0XA 2J2ZA 2X1XR 3NFPA 4KDWA 2F53A 3SGJC 3GO1L 1DFBH 4Z6AT 1T7YA 4X4YA 3EYFA 3WYRA 2VLMD 4NNYA 4MQ7A 5CAYB 4KROB 4GS7B 1FGVL 4WI2A 4L3CB 4RMQA 2Y1VA 1YPZF 4LKXB 3VFTA 4DVBB 3A6BH 3QIUB 3C08H 2P42B 1T1ZB 1KCSL 5DJYA 2R0KL 3LD8B 1W0VA 3H8NA 5D72H 2FZ3A 5FM8A 2QQQA 1ULVA 3OZ9L 3PABA 2EC9T 2ATKA 3WV0A 2VYRE 4NPYB 4D8PA 3C8DA 4Z77A 1DQML 4LP5A 1I1YA 2GSGB 3LQAH 5JDSB 2BOCB 4LBEA 4MGXA 4NHCL 2FR4B 1NLBH 4WV1A 1QR1B 4QRTB 2V7NB 3I3DA 3TT3H 1IGFL 1DLHA 4X6FA 3RA7H 4Z8FH 1PSKL 1S7RA 1LILA 5DDHA 5C0CE 1R0AL 1HH9A 2ZWLT 4XXCA 5CEXB 3HR5A 1IL1A 1CK0L 2OSLB 4BH8A 3K7UA 5FB8A 4B41A 2FO4B 5E8NB 4OCNC 1F6FB 1BJ8A 4LSRL 3BDYH 3PXJA 1EMTL 1MCPH 1UQSB 3CUPB 4OV5A 1MY5A 2XN9A 5GRXG 3SBWC 2ORBL 2DDQL 4NO0B 2FSEB 5IHZB 4JLRA 2NXYD 2F74B 4IRSC 1H8NA 5FIEA 4BQ6A 1AKJB 3P73A 5DUMH 2NXZC 3QUXD 3CDGA 1A1MA 3O6MH 5IVXE 4UT9L 5LGJB 3OKNB 2H3NA 2EH8L 4ODTL 4JG1H 2Q8BL 4JRYE 4OJFH 4XNZB 2VMFA 2I24N 1KC5L 1KGCD 2EDRA 3OAUH 4UTBH 5JUEL 4DFHA 2RR3A 4PJXE 3SDXE 4M03A 2Z92A 4OM0H 4P4KD 3HS0B 4PRIB 4LSVL 1BLNA 2APTA 4XI5C 1EPFA 3V2AR 4RCAA 3TV3L 4U1HA 4CL7A 2LTQB 4LSSH 4HF5H 1KTRL 4TRPH 4LASH 3MRRA 5CD5D 3BPOC 2PN5A 3LAFA 2MPAL 1R5WB 2VDPL 4L3EE 4JM2B 3D3VA 4U6YB 2OL3B 4Q6IC 3VXQA 3OX8A 5I8KH 5JIKA 2QJDA 2YD6A 4JY4A 5DJ2A 4PJBF 4JN1H 4AMKL 1RMFH 4I8DA 5IR1A 3JTTB 4G5ZH 3D18B 3D39D 3DNKA 3KDMA 4ORZC 3QO1A 2YRPA 2BNUA 1RZ7L 3IDXH 2CIKB 3HI1B 1IGIL 4KXZI 2LVEA 2M1KA 3DRTB 2J5LC 4NFCA 4E9LA 3IAQA 4ALAH 3O2WH 4NZJA 1YEEH 1WWAX 4MS8D 4OUOA 1DR9A 3B9EA 1ORQB 1I9JH 2FJHB 3PQYD 3EZ8A 2XTJD 1S3KL 5EPMB 4PGJA 2R9HC 3U7WL 2XTLA 1OY3B 4KJWD 4RNRA 1JRHI 2AAVA 1FNEB 2FCBA 1YC8A 1HHKA 3OKOB 3GMRA 5BW7C 1U3HD 1T21A 1BZQK 1DQDL 5C86A 4XPGH 2VRAA 3QI9A 4G6JL 4AYFA 3QEQD 4N0RA 3IAGC 2EECA 2AJSH 1MI5E 3DMMB 2D7OA 2UY7A 4M43L 3VA2C 4C59B 2P5WE 4CU8A 1ES0A 4JR9H 5EO1A 3DGCR 4Z78A 4WFGD 3GGWB 1JTPA 1UFUA 3ARXA 4MNHA 3O41A 1MLCB 2JK5B 2R15A 2CR6A 4Y5XA 3L1OL 4BSJA 5JW4R 2VOTA 1BVLA 3FQWA 2Y23A 4BH7B 2VDLH 3ZTJH 2K9UA 3MO1A 5GSRB 5ANME 5EOCL 1OTTC 3SDCA 3V6FA 2OP4H 1WAAE 4NC0B 1JHTB 4ZS6D 3HB3D 3EDEA 4XPAH 4XMKH 3T0BA 4RGOL 1J1XL 3GEWB 3WBDA 1NANI 1DQQB 4HV8A 1IC5H 4HXBH 4HD9A 5F3BA 4QXGH 5I30L 3OAYK 2J88H 3C5ZD 3LDBC 4GG8A 3P11H 4N90E 4QHKJ 4I13B 3HC3H 2DKMA 3IDIB 5EU6D 3O4LB 4XWOC 2YHGA 3TM6A 1ZANH 5J13C 4PY8I 1U91A 3DXAE 3RPIA 5IOPB 1CGSL 5JO5B 3HR6A 2P8LB 5IKCA 1FZOA 4JZJB 4JY6A 4ONFL 4WWKB 4FQIH 5FO9A 3LKQB 3UTSE 3E8UL 3KYMB 1VFMA 1HHGA 3LZFH 5I1AA 5I9QB 4UQ2B 5ESAB 3OAYH 2VR4A 3MV7A 2XZAH 4EUPG 1OP3K 4UB0L 2ZCKL 2FEEL 2Q1EA 4P3DA 4CUCA 4F8TA 4ODXA 4NN7B 2D31B 2R2HB 3QCUH 1BWWA 3WFDL 3F65A 5D7IA 5IESL 2XZQL 4OIBA 5DRXA 4OD2A 4TUOA 1RZFH 2OTWA 1OOAA 3UTTE 2DBLH 2HT3C 1DLFL 2R0ZL 5HY9A 1BD2D 2GI7A 5EULV 4WI7A 1A1NA 1K8IB 4PRHD 2AQ1A 4ZXBB 5C09D 4TTGA 3D0LA 3HE6D 1OP3H 3CVIL 4S2SB 5TQ0L 4K7FA 2EEAA 3KLHC 2P24B 2V5MA 3H9SA 5DEFB 2WINB 1MIML 2WV3A 3V4VH 4XWGH 3NAAL 5I1JH 1PLGH 3AS3A 4Y4FB 4O5LH 1S5IH 4HEME 1N8ZB 3L3HA 3L9RA 4LCCC 3D0VA 1LEIB 3JWOL 5T3XH 1HYSD 1UXSB 1FE8H 2BNRA 1MHEA 4G8IB 1QNZH 5D1ZA 3MYJA 4MVBD 4DFIA 1T03H 5L9DH 4DUXA 5J06A 3VI3F 2HKFH 5GZOC 3Q48A 2QADB 5I71C 1XF3B 3HKFA 1B2WL 3BGFC 4X6CF 2VERN 4CN1A 5BZDA 1JPSH 4WI6A 4R6UA 1IVLA 4ZSOB 4R4FH 2YA0A 3V4UH 4OI8A 1MCOH 3MLRH 1BQUA 1P4IH 5C0FA 3CFCH 3JZ7A 1B0WA 4NM8H 4X80H 1SEBB 2VL5A 5HGGS 5EC2B 4IOFD 4G80A 4N8CH 1J05A 5JHDB 5F89A 2H32H 3WS6A 4D9QD 2D0FA 3NFNA 4PGZA 2FO1A 4ODHL 3SKOA 3CXHK 2EXWC 3M07A 4F7PB 4PJDA 1T7WA 5FGCB 5IJKA 3HNTH 5FEBA 2CMRL 4Q9QL 3ARRA 4HFUH 4K9EH 5LG1A 2VXUL 3AC0A 1B0GB 1FP5A 1GHFL 3GSXB 2ID5A 3TWCH 4U3HA 1QPXA 3I6LD 2I60L 4PJIE 3I3EA 5EH1A 1XF5B 3RKDC 5JXED 1D5ZB 1KB5H 4KKBC 3QEUB 3CMGA 1SMOA 4XB7A 3FO9A 4FQQB 3T8XA 1AQKH 5BOZG 3U36B 5KVFL 3DRQB 3W2DL 4D9RD 3LQAC 4NOBA 3MYZA 2X4TB 4D0CB 5EBLA 3T0AA 1X7QA 1EX0A 4P2RD 1UZ8B 2MTPA 4GMSL 5D7KE 2B4CH 1FNSH 3FQUA 2VDRH 3FN9A 3T77B 4G6ML 3GRWL 2MWCA 3T1FA 3O0RH 4F37F 3W0WA 1VADA 1H9VA 4YDLC 5E56A 2GJ6B 2C3WA 1OSPL 1DDHA 5JDJA 1I1AD 4W6WB 1T0NA 4J7RA 4NQDA 6CGTA 2APFA 4PJFA 5CSBA 4IOIA 4PIRF 5E5MA 5IW1B 3TJHD 2CRYA 4KTEH 4YLQT 1TZHA 2OR7A 4NYLA 4PJGB 1NBVH 1SY6H 1D6EB 2WZPD 1YY9C 4OCXL 3MUHL 5A3IC 2PXYA 1B3JA 4HWEL 1U42A 3UYPA 2IBGA 3QJHB 3GB7A 4PGEA 3EAKA 5K9JH 4KK6D 3ZHLA 2FX8L 1YECH 3MCLH 4EVNA 4JG0H 5BQ7A 4FFWD 3KPOA 5CJBA 1R3HA 4POUB 3U4BL 1NMCB 2ERJB 3WFCL 1ZHLA 3MV8E 5I1HL 5D1QB 2DM7A 4J3OC 5IW3A 4XCNA 4U1JA 1FSKC 1C5BH 4JJ5A 1F58H 1A6TB 4MAYB 5FO8B 4AEIH 3HHRB 1OGAD 4JDZA 2YEZA 5EN2A 1CD9B 1Z5LB 3MRLB 3TBSA 3UMTA 1CGTA 5MEND 4P5MB 4EN3C 4XCEA 4XH2B 1WIOA 1I9RL 1PG7W 4NJAL 3IU3A 1AFVH 2YKLH 3X11B 1ZS8B 5F9OL 4AG4L 4OLUL 2FIRT 4M1GL 1OD9A 1IQWH 4OTXH 2AQ3A 3CMOH 1PQZB 3I2CH 2AJZA 3QIWC 4K23H 4FS0A 3QUKB 1K8DB 1CF8L 1MAJA 4LF3A 1ZVHA 4QKXB 2XWTA 3KHQA 3O45A 3Q5TA 5FOBA 2BSED 1R24A 3MRDB 5GGSY 3R1GH 3TP4A 3LEYL 1FC2D 2N7BA 1RZIB 2EDNA 4Y1AE 3EOYG 4E41B 3O3AB 5I1EL 3JWNC 4Z7VE 3AFLA 3HFMH 5CMAB 4GS7C 5AZEL 3VFNA 2FH8A 4N0FB 3GMQB 4YUEL 5EORL 1Z9SA 5ALBL 1GC1L 4RX4D 8CGTA 4YHLL 1MFCH 3QRGH 4DOHE 4NQUA 3IJSA 4HT1H 4XBPB 1QFWL 4RSVA 3IB4A 4U1IA 3BD5A 2XWJA 4RGNC 3ZKNC 5DRZA 4PP1C 4LKCB 5HYQB 1A1OA 1I1FB 3CFKA 5E8EA 2Z0BA 4GRLB 5A40E 1T0PB 3QJFA 5H35A 4WGWB 2YD2A 1ZT7A 4V1DE 4FQXC 5A2KH 1C8PA 1JN6A 1ZMYA 5GGSA 4Y16B 3L7FA 3VFWB 1FZMB 1O7SA 3ARSA 1YMME 1KENL 1T5WB 5KSAA 1X9QA 5HYFA 2A9NL 5B8CA 5DJ6B 4KK9D 2BC4A 3ETBF 5IROA 3VD4A 5EU7C 2APBA 4WU7A 3HRPA 4J2XA 3FT4B 4KZDH 2A6IB 1GZQB 4XPFH 3NABH 3LHPL 3MOQA 3LRSB 5DHVB 1EV2E 3WLWC 4GRWF 2R1WB 2C26A 1J8HD 5FUCC 2IQ9H 4M7JH 1OTUC 1JF6A 4JDTH 1S9YA 3EOTH 5E8DL 1Q72H 4G8GB 2X4NA 1XGUB 1C08B 1I3VA 3UEZA 1TZGL 3IXTA 5FUOH 4QRRD 1ZHBB 4U33A 1ZGLA 1B88A 1U58B 2FD6L 1T1YB 3QPQC 3QWOA 4FHBD 4QXTB 2A73A 1EO7A 3GMMA 5CILL 2LTQC 2A6KA 3AMKA 3BKYL 4X99A 1U8JA 3C2AL 3L3KB 2QSCL 1TPXB 3H42L 5DD0H 2IANA 4PRAA 2IPUK 5E1AB 3WSQH 2VZ1A 3HMWL 2YC1B 3RDTA 4JM2C 3P9MA 5DFVC 5FA3A 5HHXL 3TNNA 3RTQD 2NZ9C 4JPWL 5FYJU 1UB6B 2XYCA 3C6SA 1RHHB 4PJ7E 3IRPX 5IB2A 3G5ZA 2BY0A 4PB9L 5B38B 2CUHA 2B2XL 4GOSA 4LLUB 2ATPA 2W65B 1HKLL 1FL6B 1N0XH 5ICXB 1R3LB 1KLGB 2YPLB 2CRIA 5LCVH 5CEYA 1T2JA 2FHFA 4DAGL 3QG7L 5KW9L 2YPKA 5IFJB 3RAJH 3AREB 1BEYL 2P5WA 4I18C 4Y2DA 5E94B 1QSFB 1YQ2A 1Q0YL 4S11A 5A43C 2YZ1A 1I8IB 3F7QA 1P9MA 4P23A 3BIKB 5D5ME 2R1XA 4U6VH 2RIKA 1ZEAH 4OLWH 1N5AA 5F96L 4RMWA 3MNWA 4NBZB 4DZ8B 1NC2B 4OCYL 3P4NA 3ZYIA 2FX9L 4JVWA 4RWYL 4LIQL 4XCFH 1I7RB 1CR9H 5KTEH 3RJQB 4JFOA 1DBBH 4GMTH 2DLEA 5IWLA 1MWAB 1CDJA 3T3PE 1CZ8H 4N8PA 1H3UA 3ARFD 4HUKB 1C12B 4M1DL 2VZ3A 5SWZE 1U3JA 4MQSB 5DQ9A 2A74B 5FYLL 1EHLH 4U31A 3TZVA 1I3GL 3Q1SL 3UPAA 4P5TD 3PWPD 3UPRA 1T66C 4GG6A 1IGTA 2W9DL 5CFHA 1XR8A 2XKNA 1CFQB 3MBEA 3ZT5A 1GGCL 1GOFA 1FL5B 1FZJB 1H3WM 3VD7A 4IOSD 4KJPC 5CIPH 3CK0L 3MRNA 4OF5A 5B4MC 3VRLE 3DXAA 3ZDXF 1QACA 1KSRA 4H26B 5K9OB 3DYPA 4PR5A 2Z8WC 4ZOBA 5E6ID 1PZUB 3L3IB 3CFEB 3UTSA 4QHMB 5HHPA 4XC1H 4OZIF 5D6DC 4GKZB 5E9DB 1CXFA 4HLJA 4I3GA 3RHWK 1RK0A 1I9IH 1I7UA 1KIQB 3FO0L 1LD9B 3IETB 2IAMB 2WK2A 1FCGA 4JHWL 4PLJD 2A9MH 3J7HA 1P4LB 4K9EC 1UA6L 3B9KA 1YUHA 1A0QL 2MOVA 2NX5E 3I75B 5DVOA 1CICB 3ECBB 1VFAB 5JZ7D 1T80A 4AIOA 1VPOL 4G9FD 4TUJA 1A3RH 4NC1C 3DHMA 1S7XB 3CX2A 5IM7B 4EZMA 3GJFB 3VFMB 3LV3A 4EI6B 4F2MB 5I6XC 3KWWB 4NGHH 4PTTB 1Y6KR 2W60B 3U1SH 3TJEL 3Q2CA 5F7FA 4QTIL 1BGXL 1UB5B 4ZFOL 4MJ4A 4UDUB 4XNMB 1Q9KB 3GRWA 3PDGA 1NCAL 1VGKB 1I85C 4JZJC 4X7DC 3RZCC 5I8EB 1C5CL 1QVOB 5BRZB 1QEWA 3T0DA 4XGZB 3SY0A 1VEPA 2GY7B 3R0NA 2B4CC 2XY1A 3LKRB 4K94L 4NCDA 5E2TL 2XZCL 4HFWB 3VDCA 5JNYA 3OGCB 2HFGH 5J12B 3MLSH 4ZUWA 2W1NA 5MI0B 2IH3A 4WU5B 4HJJH 2Z31A 5IB5B 3O3EA 3U9PH 4QXWA 4TTDC 1IBGL 4LCWB 4YDVB 4P2QD 8FABB 4OI9A 3ZHDA 3GNMH 2J8UF 3BOVA 4XPBL 4NQTA 3VE0B 4M7KL 1CXLA 2V2XA 3IDYB 3QNYB 5EC1B 1MRDH 1FCCA 4RFNC 4NO2B 4ZXBC 3EDKA 4UNVA 1GYAA 1G7QB 2HMIC 1FGNH 2IG2L 3WJLC 1A21A 1JZ7A 4YWGL 3LN4B 5HHNA 1G9NH 1IAKA 3CPLB 3PWLA 2ZG3A 1BQHB 4YE4L 3U6RB 4OGYL 1INQB 3TO2A 5LGHL 4YHPB 3NIDE 5I1CH 2ESVD 1WBYB 4XNQB 4LEXH 3O6FB 2B5IC 3ZHKA 3T04D 5F6IB 2ENYA 3S3PA 7FABH 1JK8A 3H9HB 3MFFB 1R5VA 4QTHB 5JIHA 4YHML 5I1DB 2IEPA 1FAIH 3EYUH 4WTXA 3DROA 1N7MH 5ITFA 2QADC 3BPCA 3MROB 2AABL 1U2CA 2I26N 4F7MB 5I17A 1BM3H 5JR1H 2YBRA 3LS5L 12E8H 4HWZA 4QYOA 2DIJA 4PJEE 4EQ3A 5D7LA 1P7KA 2Z8RA 3T0WA 3KYNB 3O9WB 5BO1H 4B50A 3PXHA 1S7WA 2EH7L 1H8SA 2F53D 5GQBA 2R2EA 4OFIA 4A2MA 3X3FL 4ORGA 2C1PA 3RWEA 1ND0A 4QRPE 1UACL 5IVNA 1XT5A 3SQBA 3UPCA 3MV9E 4JFFE 4WFEE 1YC7A 3BHBB 1BHGA 1EIBA 2ITDA 1KJ2B 4Y4HD 3J8F7 3UTZB 3BP6A 3WNPA 2J8OA 4NO5B 3OG4B 1T7VA 2CGRL 2EZ0D 2W9EH 1G7MA 1CG9A 1EGJL 4UV7H 1A6ZA 5AUMA 2YPVH 1GGBL 1TCRB 4CVXB 4A6YL 4XC3L 5ESQB 4Z7NE 4LARL 3WLBA 3S9DB 1A7QH 4U7MA 3SDYL 5FGBC 4PG9B 3KPRA 2YSSB 6FABH 1G7PA 4PBVC 2B8OT 5E4EB 3TO4A 4E5XA 1BVZA 2BJMH 1YQVL 3BZEA 2PNDA 3WHXB 3WXVL 2VDML 5KS9A 3HE7A 3DYMA 2ZPKH 1HDMB 1FYHB 2DYPB 1A4KA 3INUH 1FLRH 4M61B 3ARDA 1U8HA 1AGFA 1QYGH 4HK0A 1RURH 5INDB 3I50L 3G6AB 5LAXA 1CDYA 1EEYA 3MV8A 4YHIA 3BAEL 3MA7A 2B1HH 2R39A 2FYYA 5FYKD 2XN9D 3IF1A 3VXMB 1CFSA 4BK5A 4XCYB 1VA9A 1VSCA 3WKMH 3ULUE 1IAIL 4HUUB 2CDGB 1BQLH 1R5IB 1TTUA 4KKCC 3KVQA 5J11C 1S5HA 3PV6A 5IHUL 4ZOCA 1QD0A 2WBJC 5CBEB 3OTTA 5E2WH 4LAQH 3CCHA 4HMCA 2FATL 4JZNB 4J1UA 3BZFA 4OBSA 4MQXD 4P2OA 4YDIL 1MCEA 1NAKH 2I07A 3BQUC 1H15A 1A8JH 1JGLL 2WANA 4MA7L 5ACLA 2KQNA 5HI5C 1WBXA 3I3BA 3H2WA 5L2KA 1F4WH 2VLRB 1YPZB 2ERJC 5GGVH 2NY3D 4MJ6A 4BFGA 5EOTA 1UXWA 3QG6B 3NCYP 2R69L 5EIIB 5E5UB 3D3VD 5J89A 1A9BA 2XQYK 4L1DA 1EAJA 3MLXL 4YR6B 1CIUA 2VLKE 3FT3B 4JZOB 1BFOA 4NM4L 3SEPA 2D4DA 3DVNA 1S7UB 4P48A 5EA0L 4LU5H 3VXNA 1U36A 2WUBH 3C5JB 2ZP0T 5C0GA 3SCMA 3ZL4H 2JCCE 3S37X 1JNJA 5CHNB 1CQYA 4HG4K 3MOBL 2AJXL 5H8DA 3DV4B 4JFPB 4QXUL 1PKQA 2VDKL 4QGYA 1CTNA 4HXAL 4IRJA 2C9AA 2BY2A 4MWFA 4NZTH 3VFOA 3OKDB 5B3JE 4K3DH 1FYTE 3F6LA 3NPZB 2EIZA 4ZQKB 3VFSA 4GUPB 4UI2A 5LXGH 1GGYA 2XQBH 3UJIL 2NXYB 3HRZA 1OTSD 1G9MH 4HGWA 1F8TH 5CINH 2DTMH 5T3ZH 1HSBA 1E4JA 2CXGA 4ODVL 1OLLA 2YXMA 4UIMA 4X7TB 3RU8H 3U0PB 3MTRA 2Q76A 3MNVB 3PWVA 4P59L 1HNGA 3D5OF 3V79C 1M7IB 1KIRB 3JV5A 4G7YH 5E08H 4DKDC 4HUWA 2HWZL 2R0WH 4P57A 5I19L 4P4KB 3DUHA 1B4RA 1RUQH 5E2VH 3MJ7A 1N5YL 2ZJSL 3ARBA 3G6JE 1IEAB 3O2DH 4F15B 3CFDB 2A0LC 4XVUC 4XAWH 3ALPA 2DM4A 3L5XL 3ULVH 2V2TB 1ZT1B 5DO2C 4K2UL 4JQVA 5CEZH 5HI3D 4WW2C 3T2PA 5C1MB 4POZC 3SDCD 3ALXA 3TBVB 1YZZA 4XTRD 5L2JB 5D2NA 1EXUB 2CLRB 4FXKA 1LP9E 3LKPA 5I0DA 4D3CH 1YDPB 1E0OB 4LMQI 5ADOL 2G9HA 5IP4A 1NL0L 4RZCB 5C6TL 4FQHA 3VH8B 3D39B 4Z7WE 2KH2B 4PJBB 4APQA 4LCYA 1A14H 3STLB 3F7YB 4ZUUB 4HIIA 5ESVB 2D2OA 3MRPA 1J0IA 3DVGB 3KPQA 4ETYA 5GISL 4WFFE 3IXAA 3OKLB 3QXVA 5JOEA 5HJ3B 4NDMA 5A2FA 3MCKB 4O51A 4N1HB 2ZSWB 4JDVB 2DM2A 4IM8A 4AK1A 4ZFOA 5EOQH 1WEJH 2XTJB 2E9WA 2JB5L 4LCUB 5ETUB 3N1MC 4R4BB 3DGGB 4WI3A 2HN7B 3AB0C 5DC9B 3VWJA 1N6QH 1U3HB 2DIAA 3MV7D 2OYPA 5D7IF 5H94B 2ZG2A 3KPMA 1M71B 3QEQB 4TVPE 5DVNA 3W9DB 4KJQC 4HIXL 1NUFA 3UTQB 1ZA6A 3GKZA 2PCPA 4R3SB 1B6UA 2OM5A 4JFZH 2F8VA 1U8MB 43C9B 2F19L 4QY8A 1G7HB 3A67L 1CE6B 1TJIH 4FQ1L 1S7TA 5FA4A 4YPJA 4UV4L 2RFXA 2NYYC 1KTDB 5D93B 2V6HA 3U46B 2PR4H 4DCQB 5D8JH 5FK9B 2NY1C 3H9SD 3TT1H 1IGCH 2L4OA 4PJ8A 4RMSA 1HXMA 1YNKL 4OCSH 1JHLH 4FQLH 5EB9A 4ZFGL 5J1AB 2AXJA 5HHOE 4JM4H 4XP1L 4JY5L 5J0BA 2QBWA 3MX0A 3QDJE 3BP5B 1G9NC 3KXFA 3RQ3A 1KBGH 3RKPA 3C5ZB 5D1ZD 5EZJA 3RGVA 3VCLB 4GBXA 2BOBB 1Q1JL 2UWEA 4UDTA 4Y19B 2CLZB 5FDWA 1JNLL 5EU6B 5IMLA 5L6YH 4U1GB 4FQJL 3QDGA 2DJ4A 43CAB 5AYUL 4GSDL 3VW3L 2WBKA 4OF3A 4BKLA 4EDWL 1OGTA 3VXOA 5JMRA 5JIPA 5JXAH 4HK3N 2EDWA 2QEJA 3V6OC 1DEEB 1ZHKB 2DI7A 3KPPA 5F21B 2ZUYA 4JRXA 1QSEE 1D9KC 4TUKL 4TQEL 4UT6L 4NWTH 2AV1B 5F7LB 3UJTL 4MNQA 2CKNA 4OB5L 2X70B 1UM5L 4PJDF 4CKVX 3H6JA 4L8BB 3MRBA 5MHSE 1YN7A 1E6JL 1NAML 2VDQH 4PRPD 5ENWB 1GSMA 4RQQA 1NMAL 3M8OL 4O2EA 3Q3GA 1BD2B 3MODL 4PRHB 1EGJA 4KPHH 2WWKO 5C09B 2R2BA 3QWQB 4AT6B 5ILTH 3HE6B 3RVWD 3KR3H 4BQ8A 5DRNB 4A6YA 4QF1A 4KTYA 3BIAX 4TN9A 1I1CA 2FBJH 1ZLVK 5D7SH 3WUWG 3RWJB 3SE4C 1JUFA 4XPTH 3RIFF 3HPJA 1FL3B 5C08E 3TYGH 2ED9A 4YHKH 1GXEA 2NCMA 1CBVH 3LQZA 5EZOL 5DK0A 3T2NL 4UT7L 5T1DL 3S5LB 4PLNC 5I18H 5I66B 4JB9L 4U3CA 3OR7B 5ECJE 4FN0A 1H3PL 2KPNA 1XGRB 2IPTH 1TJHL 3NIGF 1T89C 4I0PC 4X6EA 3O8XA 1ZLVH 3U4EA 5GRUL 4M6OH 4PJFF 3E3QE 3VGAB 2C3GA 1VFBB 3EYSL 1LEGA 5J9PB 3AGVA 4LLYB 2F15A 4JCLA 2EDBA 3GMPA 2DQTH 3C6LA 4N0YL 2OXHA 3QHFH 2HKHH 4X6CB 1A9EA 4LSPH 5J12C 1PW3A 4BQCA 1SJHB 4LVHC 5CJOH 4WHYG 2XI9A 4KDTA 4ZUVB 4KI5C 4Y5YC 4BA8A 4XVSL 2PKDA 2PXYD 4ZUTB 3VG9C 3PF2A 1UADC 3HC0A 3K1KC 4M7LH 1EHAA 2JJSA 4R26H 4UIKH 5SWQB 4HDIB 4Z7OE 2NY4D 3ARWA 3LVEA 5TDPA 2WP3O 5L7XH 3ROLA 2CUIA 4O2CB 1JPST 1OAKL 3T2QA 5JOFA 1JTOA 3V8OA 2CDFB 3GI8H 4JKPH 3MR9B 1U6AH 3REVB 2EEBA 4JO3L 1A5FL 1Q0XL 1XH3B 3FQTB 4P46A 1RY7B 3WNNA 3TIEA 1KN4H 2FEDC 2G5BA 4DEPB 4FMKA 4M4RA 4G43A 4DN4H 1A7OH 3M17B 5HDOA 4ZUSA 3SPVB 3MUGA 4MSWB 5GS1A 1AHWC 1GGUA 3O6FC 5F6IC 5I2IA 4MJ5A 4HS3A 4WO4A 4K3JL 4P2RB 4I77H 5T1LD 3EDFA 1QBBA 3E1F1 4KAQL 4LLDA 5SWSE 4ZPVB 5MP6L 5GS2H 4L9LC 3HPLA 3VRJA 4O2FA 3VFUB 4MXWH 4H8WH 5CSZB 1O7VA 3SDDA 3WJJA 1KJVB 3G6DH 3FTGB 1F4AA 1RJYB 4MXQD 5GJSL 1I1AB 1NBYB 2VIRB 4YQXL 4PY7A 5EUOA 4MA1C 3UYRH 4ETQB 1M6OA 3QNXB 3QAZC 5FV2A 3DOSA 5CP3H 1H8OA 5J1TC 1G9MC 4WIQA 1FO0B 3UBXA 4FQ2L 1XCQB 5CSGA 1T1XB 3BP7A 1AD0B 4X6DA 3WCYA 5D70H 4QHNA 3TBYA 5TDNB 5DD6B 1RUKH 3L6FB 4GW1B 2CPCA 1G1YA 2PYEE 5BV7B 3REWA 3ES6B 1RZGA 1DP0A 4AY0A 3BT2L 3KPLA 4HSQA 3S96B 1BFVL 4G6AD 4JFHE 1OGAB 4TSAL 5ITBH 1CT8A 3P77B 4ZAKD 5DGQA 3ULVC 5MENB 5CWSA 3PE9A 2NZIA 4KRLB 5KSAD 3L3DA 1NKRA 1S9KC 3VFPA 4S1SH 5JLZB 3LKNA 1MJ7L 4PRDA 5JORB 1PY9A 1HH6B 3RY4A 3KYOA 4KVCL 3UTOA 3DX9A 3IFPA 3FN3A 3IDGB 1CGUA 3DUSB 4C55A 4S1RL 5C0RH 5EWIH 4WJ5B 3VGFA 3EUUA 2Z4QA 4HAFA 1NGYB 2HH0L 1VB9A 5D1XA 2VLKA 4OGXH 2JELH 5ALCL 4MLSA 4X6BA 3H3PH 3SGJA 3FCTA 4R8WL 3K2MC 2EC8A 2JCCA 3VMPA 3N9GH 3NGBC 3S35L 1ZXQA 3K4ZA 3QBTB 3VWKC 1AD9B 2FB4H 3MLZH 5F1NA 4X7FC 2G5RA 1GZPA 3UXFA 4KY1H 5CJXC 5C07E 3SE9H 2HFFB 5KANI 1KJMB 4D0BB 1FYTA 1S9VA 4HHAB 2YD1A 2IAND 4PY8J 3ZZ1A 3VG0L 1LK2B 2PW1B 4LEOB 1XIWB 5C8JB 4GT7A 4ONHA 1MFNA 5F9WC 3C9NB 3RDTD 3C8KA 3A6BL 4BQ9A 3GM0A 4WCYH 1A6AA 3KNBA 5D6CB 1F97A 1U8IB 3C08L 4PLOB 4WNQB 4CGTA 4WW1A 2ZUWA 3L3OA 3QHZL 2NY0D 1JPGA 3MJ8B 3FAWA 1AR1C 1XCTA 5TGBA 1I8LC 5D72L 1IAII 1X5FA 2OK0H 1M7DA 2IADA 3V4PL 3CFJA 3OXSB 4LLWA 1EFXA 5HD8D 2FGZA 4TOYL 3BSZH 4ZFZA 1J5OL 2MCPH 3LQAL 3FT2B 1KCRH 2VDOL 2WQ8A 2X9XA 1W8NA 3P4OB 4Y2DD 1HZHH 1U3ZA 3O2VH 3TT3L 1JGEA 2A6DA 3RA7L 4JFDA 4Z8FL 1DANU 4P23D 2H2PD 1U8OB 3BW9A 3G6JA 1BF2A 3BJ91 1QA9A 3RBSA 3RIAK 3M1BA 4IRZL 2W92A 3GUTA 3DI2B 3SBWA 4KUZH 2Y36L 4RGNE 5HHVH 3OHXB 1MNUH 5DJAB 4YIQB 1N2RA 2CH8A 2NXYC 4IRSA 4GAGH 2X4OB 3BDYL 5HPMA 3CH1A 1EO8H 3AS1A 3QUXC 1MCPL 1LEKB 1J8HB 3NN8B 5I1LA 4F80A 4NQEA 1G84A 3HC4L 4GRWB 4Z7WA 1A7PH 2AK4A 2IBZX 4GG6F 1JNHB 3QQNA 5GRYA 1HWGB 3TZVD 5DUML 3F5WA 4QRRB 2YD3A 1KLUB 2CIIA 5BV7H 4UBDD 4JFED 3MBED 3OKKA 4P4KC 2H1PH 4YBLC 2LU4A 3H3BC 4YNYA 1IZJA 1NAMA 1PAMA 3WXWH 3OAUL 4UTBL 5EU7E 3EO9H 4GLRI 5GJTH 4ODWB 4OM0L 2M2DA 1RZ8A 3H7LA 1ADQL 3RTQB 4DJMA 1NUGA 2FL5A 4Q6IA 3K2UH 3ROOB 4F7TA 3L3JB 1DQJA 4RA0C 2DJSA 2J7LA 4HF5L 4RGMC 4W6XB 3EYVB 4LASL 4HJGB 1BAFH 3VH8G 3LEVH 5FUCE 4LAJH 3ARZA 4Z7UA 5K9QG 2AJYH 4OIIL 1HEZA 3B9KD 4XP4L 4DQOH 1GAFL 1F6LL 5D7JA 1HHIA 1ZAGA 1RD6A 5FECA 2L7JA 2PYFB 4XNUH 4XPHH 1H3XA 4G5ZL 3RL1B 3Q6FB 4PRIE 2VWEE 3UBXI 3ZT6A 4DGYH 1NCWH 1DZBA 3IDXL 3SE3C 4X8JB 1AO7A 2EDLA 1I3RB 2EYTB 2OR8A 3DYOA 1U8NA 4P5KB 1P7QA 3U2SA 1JL8A 4OZGA 5IB3A 3O2WL 1YEEL 5FHAH 3WS3A 4Y7MA 1EEQA 1T5XB 4KJWC 4L29A 3PWUA 5HHMD 5FKPA 1G7JA 5J6HB 3ARFB 3VXTB 1U3HC 5DD3L 5BW7A 4LP4A 2OTUB 4L8SC 4NT6B 1W72B 4JFXA 4NRYA 4ZD3H 5A16B 2Z31D 4P5TB 5F7DA 3PWPB 1BMGA 3WUWA 1E27A 2XA3A 3RVUC 1FJ1B 3RWIB 3IJHA 4U05A 1G6VK 3ZYOA 1FG2B 2VE6A 1OT1A 1I7ZB 2CKBL 4EDXA 1MHPH 2KZ1B 3HZYB 1XGQB 3QZWB 2E9JA 1E4XH 3N85H 1WZLA 4JR9L 5E6IB 3VXRD 1HHJB 1WBZB 4YDKH 1IQDA 1KTLB 5IF0B 3UZVB 4X5LA 4OUUA 3BEWA 1JGDB 2APVA 3W39A 1PVHA 2HVJA 2R0LH 3MRIA 2VISB 1LO5B 1QSEA 1RHFA 4LLAA 2VDLL 4OZIB 3EOBA 3OSKA 1NGPL 2BVQA 4ISVB 4J6RH 2OP4L 3MJ6A 2NMSA 1K6QH 2Q6WB 5F7NC 1HINH 4MCZB 1U0QA 4G9FB 4XPAL 3G08B 5DQDL 2BVOB 3PNWA 2ADGB 1K85A 2Z91A 1IC5L 4HXBL 4I5BA 4RFEA 5DJ0A 3G5XB 4QXGL 1YA5A 1F6AA 4GKNA 2J88L 3P11L 2I9LA 3BGAA 1ETZB 1U8QB 2X7LA 5DZNA 3N1FC 4HWBL 3DUUB 3HC3L 1NCBH 5I1KH 2IQAB 3RWCA 2H6PB 5D7LD 4HZLA 1XGTA 1FLTX 4QHLA 5CJ8A 1ZANL 5GGTA 1HN1A 1FV1B 1SBBA 3KPSD 4HCRH 1RJLA 4H8WC 1I4FA 4PJAA 3NA9L 3V5KA 5DMYA 3KPTA 4AH2A 1U8PB 1HIML 1MCIA 2DQFA 2HT2D 3F7VA 3HG1D 3LZFL 3RL2A 5JOPE 4TNVK 2HTLC 1JZ6A 1OWRM 4R7NB 1YEHH 4P2QB 2ZUXA 3MGOA 1CFNA 3WDHA 3EJYD 1MJUH 3MREB 2JJTC 3HLAB 3MLTB 1F3RB 1P2CA 2HT4D 4U6HB 1KG0B 4CU6A 2J8UB 3O4LE 3I6GB 3S97C 2XRAH 3HE6C 4MMZC 2R23A 3CGTA 4U7SA 2DBLL 3R4DA 4E0RB 3V95A 2BRQA 4MYWB 3KPRD 1PDKA 5KS9F 1BVKA 2WM0A 1HSAA 3FZUD 4MCYB 1M05B 3P9LA 3JV4B 1I8KB 4LCCA 4M62H 3EFFA 2PW2A 3HE7D 1DE4A 3B43A 4U6TA 2ESVB 2ZUUA 1NC4A 4O4YH 1HYSC 4UQ3A 5I8CB 5JPMB 5I1JL 3V4VL 4XWGL 1AI1L 1PLGL 3ARDD 1MEXL 2X5PA 4O5LL 4R2GD 5HGAA 1S5IL 1WICA 1NPUA 1JYVA 1G7LB 3BKJH 2VLJD 2DTSA 2Z93A 3MRGA 4NRXB 4GAJL 1FFPA 2NW2A 3RVVD 5T3XL 1FE8L 1A7NH 5T5NF 3PIQB 3S36L 3BUYB 4F33A 1D5IH 5HGBB 4XNXH 3VFVA 3RWGA 2OI9C 5DRWA 5T33H 1T03L 1SYVA 5L9DL 3QWRD 4QGTA 3ABZA 2BFVL 4ERSH 2EYSA 1CDBA 2HKFL 1XF2A 3MXWH 3BH9A 1UM6H 2YD7A 3NFPB 2F53B 5GGRY 2QLVB 1L7IL 4UAOC 4DVRH 3EYFB 4X4YB 2R4SL 4V2CB 1JPSL 3L3GA 4NNYB 4R7DA 4MQ7B 1BREA 3QDME 1JWUB 4FABH 2VZOA 3GMOA 1F4XH 4P2OD 3V4UL 3VFTB 1MCOL 3MLRL 1P4IL 3MUZ1 3OXRA 4NM8L 2GK0A 4X80L 3V6ZA 5IBLD 4M93C 3BE1H 5L2KD 1NKOA 5HGDA 2PTTB 5DJYB 2VDNH 1TVHA 3EYQD 2Y7QA 1W0VB 4N8CL 2FZ3B 3O3UN 2OR9H 4QHUA 4LSTL 3PABB 4CADA 2ATKB 1X5GA 4LLVA 1AGEA 1WC7A 4LRIC 4S1QH 4Z77B 5ID1A 4I3RH 4R4ND 3BWAA 5EG6C 3KYKL 1I1YB 4KKLC 5JXEC 1N64H 4NWUH 3BIBX 1ZTXH 4WV1B 4HFUL 4K9EL 5F9JA 1DLHB 4X6FB 3TN0C 1W8OA 1S7RB 4WHCA 1HH9B 4WHDA 2XACC 4I3SL 4GQ9H 2OJEA 1H5BA 3HR5B 2ZUSA 1IL1B 4BH8B 5GGRA 5JHDE 5FB8B 4PPTA 1KB5L 4KDVA 3QFJA 2Y9RT 1YEFH 4IRJD 3CLFL 3WFZA 4BK4A 4OLVL 4OV5B 5FGCE 4LL9A 2XN9B 3EHBD 1KB9J 1TMCB 4WRLA 2F9BT 3F58H 3IJYA 3O6KH 4JLRB 2B4CL 2JKXA 3P73B 4JQXC 1OQOA 2V5TA 3CDGB 1A1MB 4OF8A 3RX8A 2H3NB 3O0RL 4EI5A 4OM1L 5FYLD 4NBXB 1MFBH 1D3CA 3WNOA 2APWA 4KK6C 4X9HA 4GRMA 3NH7H 5B3NA 4IEFB 3K1DA 3NACH 2DQIH 4JVUA 4F7CA 1MY7A 1JIBA 1SY6L 5DEZA 1BLNB 4FFWC 5C0BD 4QWWC 1JZ3A 5FYJE 5DC4B 3PP4H 5IBTH 4HGMA 2NY3B 5K9JL 3MRRB 1YECL 1YMHB 3GSNH 3MCLL 4FZ8L 5BV7C 1P7HL 3D3VB 4LHJB 4JG0L 3VXQB 4BZ2H 3OX8B 4M6AA 3PGFH 2GJ6E 4NQVA 1BQSA 5DUPL 2VQUA 4JY4B 2PTVA 4IDLA 4YHYC 5DJ2B 5IV2A 2C4XA 1UM4H 4AIXA 2RQ8A 1BJMA 5DYOA 2OMBA 4LHUG 5IR1B 4PJGE 1AP2A 4NHUA 1C5BL 3KDMB 1F58L 3QO1B 4JFYA 4APQD 3QCVH 2BNUB 3ZKMD 1RFDH 2B0SH 3QISA 5KVEL 4X9IA 3P0VL 3PWNA 2E7MA 4NKDB 4XVTH 5T1MA 3CVHH 3QIWA 5GIRA 1AFVL 3S37H 2DWEB 5LBSH 2YKLL 4PD4J 3QUMH 3HCVB 3V6BR 3A0OA 4OTXL 4N5UA 1G1CA 3QH3A 4MD0A 5DVMA 3UYOD 3I2CL 5ICYA 4KH2A 5F7UA 3W11C 4RNRB 4NJ9H 3VWJD 1HHKB 3GMRB 3RP1A 4Z7QE 4XX1G 2DQCL 3SDAC 1T7ZA 1FORH 3QI9B 2HG5A 3MRHA 4RIRB 1ES0B 4WWID 4WI8A 1F4YH 5EO1B 2Z8SA 4Z78B 2BY1A 5ISZA 3HFML 4XMPH 3IS1X 4L1HA 2CKBA 4MNHB 3O41B 2I25N 4Y5XB 2HVKA 5DMIH 1BVLB 5C0ND 1MREH 3FQWB 1VACA 2Q7YA 3MO1B 4HT1L 4F58H 2BX5A 3VRIA 1MCCA 1AJ7L 2BOCA 3SDCB 3V6FB 2NY2D 3KS0J 4JO4H 4WWKD 4NBYB 2W38A 4PJ8D 3D1MC 4FQXA 4E41E 5F1IA 4FTVA 4NNXA 3U48A 5CEXA 1CL7H 1CGVA 1R3IH 4LSUH 1F13A 1MFAH 3CU1A 4HV8B 4PS4L 2RJMA 2UWEF 1TQBB 1JF1B 4KK9C 4BSVB 5F3BB 3KXFD 5HVHB 4GG8B 3RGVD 2Q3ZA 1AXIB 1IGMH 2X89A 4OZHA 1B6DA 1I3UA 1B4JL 4NN6B 1TVBA 2BHZA 1NCUA 3BN3B 4HPYH 2OJZH 4YH6A 3QDGD 3RPIB 4U49A 5EZIH 2VUOA 5IKCB 1LO4L 1FZOB 3KAAA 4JY6B 1BWMA 5IJVA 4JO2L 3L95A 3R8BB 2VXQH 5FO9B 4KZDL 2EEDA 1HHGB 4X7SH 3OKEA 3NABL 1FIEA 5DUBA 4Y4FD 3MV7B 5KVMC 4JRXD 1JFQH 4JO1H 4P3DB 4G3YH 4ODXB 4M7JL 1RZJH 2ICES 3EOTL 4JDTL 4MNQD 3TNMB 1JMXA 1Q72L 3QQ3A 3VXSD 5EFIB 1C16A 5TFSH 5DRXB 4OD2B 4TUOB 2OTWB 3B9AA 5FUOL 3HI6L 2CD0A 1PYWA 3DX8A 1Z9MA 4MX7A 1X4YA 5HY9B 3KLSA 3HNSH 2YD8A 4JM2A 1IAOA 1UZ6F 5CJQL 3RTQC 1A1NB 1PX4A 3D0LB 4WGVB 3WIHH 1E6OH 4K7FB 1GGTA 4WY7H 1CQKA 1VCAA 5DD0L 5FYKU 4CRPA 2HFEA 4M8QB 5TQ2L 3H9SB 3AVEA 3W5NA 2LU7A 4G8GE 3EO1A 1KXVC 3IGAA 3TFKC 4DGIH 4OD1H 4MMXC 3L3HB 4KMTH 5CGYC 3L9RB 3D0VB 1UH3A 2XZZA 4I18A 5C0DA 2LAAA 1YEIH 2BNRB 4L4TA 1HNFA 1MHEB 1N0XL 1OM3L 1EDQA 2O5YL 4Q2ZA 5D1ZB 5LCVL 3MYJB 1KEGH 4DKEH 3RAJL 2X42A 1QRNA 3O8XD 1MELA 1NUNB 1DQLL 3BKCL 1RI8A 4EXPX 1SMAA 3NIDF 4U6VL 4OLWL 5BZDB 3C6LD 4J23A 3OKOA 4XCFL 4HQQH 1CR9L 5C0FB 5KTEL 1V3MA 4WFHE 2OTPA 1CE1H 1DBBL 4GMTL 2YPLE 2VL5B 3GHBH 3IT8D 1RIUH 3CDFA 3CFIC 3MZGB 5DJXA 4ACPA 4G80B 2Y07H 1J05B 2X4QA 1QSFE 5F89B 2MKLC 3WFBL 5JHLH 3NFNB 4Z95L 1LDPH 3STZA 4PRPB 3SKOB 1U2HA 4PJDB 3GIZH 4ZMAT 3O81A 5E6IC 3GSQA 2H32A 1QR4A 5JQ6L 3EW3B 1FFRA 3CC5A 4NUGH 2BXYA 4PV9B 5D6DA 4C56A 4M7ZB 1BOYA 4HWUA 4ZYKA 4RMUA 4KI1A 5IFHH 3QDAA 5E00A 3QXUA 1YEDA 5B39A 5HYJA 4BUHA 1RUMH 1MCDA 4F9PC 4XC1L 3FO9B 1W72L 2X4PB 1PX3A 4OFDA 2EE2A 3MRCA 3B83A 5E7FA 3TPKA 1I9IL 2X4SA 5KSBA 4JCMA 1YYLL 4EIGB 4NUJB 2GYSA 4WO4D 5EBLB 2UUDK 1X7QB 3AU1A 2A9ML 1KB5A 4X9GA 3VDBA 2ADJA 3A6CL 3CFBA 4L4JA 3D9AH 3O4LA 2N4IA 5K59F 4I9WE 3FQUB 1I9EA 2VJXA 5J1SC 1A3RL 1JWSB 3SDDD 3RZCA 1I85A 3T1FB 5EUOF 3W0WB 3E0GA 5BXFB 1DDHB 1U93A 4NGHL 1HI6A 1T0NB 2IGFH 3P40A 3U1SL 5E9DE 4NQDB 4PJFB 5H37H 4MAYD 4IOIB 5E5MB 4K71C 2UUDH 4KV5E 1TZHB 4KJYA 4NYLB 4M48H 2D31A 4RFOH 2PXYB 3GB7B 4PGEB 2E7CA 1DVFC 2DKUA 4X6DF 4ZNEE 5D96C 2C3VA 2HFGL 4LVOC 3M45A 5C92A 3MLSL 1ZT4B 2NY4B 1SY6A 5BQ7B 3SQOH 3PG2A 3KPOB 1CLYH 1R3HB 1J87A 1AQDA 2BK8A 2B7DT 4P2YA 4ZDHA 1ZHLB 4ZXBA 3MXVL 1QFOA 2M26A 4UINH 1PJ9A 5F1OB 4NP4H 4NN5C 3WN5C 5IEHA 1WZMA 2IALA 4XCNB 5I75B 1SM3H 4I0KA 1WF5A 3WJLA 4U1JB 4JJ5B 5BRZE 5C71A 4M9PA 3FQRA 1WITA 4JDZB 2YEZB 5EN2B 3VGGA 4FZEH 3TBSB 1FGNL 5F8QC 1LO3H 3NZ8A 3QDMA 4XCEB 3DTXA 3PHQA 3BJLA 4KI5E 4ZS7L 1J11A 4UTAH 3IU3B 4MAUH 3QCTH 4LCWE 3RNKA 4X83A 3ULUH 4MQTB 3NFSH 5I1CL 1INEH 4L4VA 5E5RB 2MQ3A 4OGAD 3TGXA 4LEXL 1KCUL 2AJZB 4LRNH 4FQPA 1UKTA 2KKQA 4LF3B 5D1XD 1FAIL 5C2BH 3BP4A 3P4LA 3O45B 1N6UA 2XWTB 3G5YB 5FOBB 3K4DA 1R24B 1FFOA 4ZNCD 3GMLA 2JCCF 1JRHL 2NNAA 5GS3A 1N7ML 2DLTA 5I76B 2AEIT 1U41A 3B3IA 3GSVA 1BM3L 5JR1L 12E8L 1IEHA 2YMXH 4LGSB 1IM9A 2R0KH 3T2OA 3U0WH 3VFNB 2DRUA 3FOLA 1LNUA 3P4MA 3SKNA 3TEUA 1CI5A 4LHUA 2CLVA 4MJIA 3DSFH 4OCRH 4K7PX 3SE8H 4Y4HC 2GTWA 1SEQH 3IJSB 3R8QA 2V9RA 2COQA 4U1IB 3DO7A 5A1AA 2XWJB 3TH3T 4WI5A 1U8LA 1TETL 1B0GA 5E8EB 2XA8H 3TA3C 3G5VA 3MV01 3FJTA 2X40A 5FGBA 5J57B 4PGCB 4NOFA 4FXLA 2W9EL 4WV1C 3QJFB 5H35B 1ZT7B 1L6ZA 3DURB 3QEUA 2YPVL 1JN6B 2FIKA 1EFXD 1RZKH 4ZAKB 3U36A 5GGSB 1EMTH 4OSUL 1A7QL 3OAZK 1ZE3C 3G6JF 5KSAB 1BX2A 2ENSA 3NCBB 2AS5M 3QULA 5B8CB 2BJML 4AQOA 2BC4B 4JFDD 4QRSA 3EJJX 3BKMH 1D5XA 2ZPKL 5ACMA 4WU7B 3IVKA 5TJWK 2EH8H 4ODTH 1OPGL 4Q58C 1A4JA 4IRSD 1KC5H 1XZ0A 4EOWH 5JUEH 1Q9OA 1QFUL 4CJ1A 3OAZH 4MHHG 3H7BA 2WBJA 2CO7B 1S9YB 4NQED 2RCSL 4YC2C 2AK4D 2X4NB 3WKML 3CSBA 4PRNA 1BQLL 3IXTB 4MQXC 3QXWA 3WIFA 2AK1H 2NQCA 4NNPL 5CEZE 1A3LH 1ZGLB 5BZWA 3BQUA 3BFOA 2IJ0C 3RBGA 3WDIA 3QWOB 1JZ2A 4OFKA 2A73B 4XI5D 3GMMB 2A6KB 2Z9TA 4YO0A 2EIDA 1OW0C 4X99B 1U8JB 2XQYG 3MLUH 2VXVL 2IANB 4PRAB 3RPKA 4AMKH 1RZJC 1NAKL 3RDTB 4ZTOH 5FA3B 3TNNB 3VXME 1X5YA 3U30C 3ZE2F 3BYTA 5BVJA 3SOBH 3KLAA 4Z7UF 2V2WA 3C6SB 2NY0B 5IB2B 4DN3L 2VL4A 1T22A 1EH9A 4HBCH 2ATPB 3GZKA 5I73B 1ZV5A 4UUJA 5CEYB 2VLME 2YPKB 4M9OA 1DUYB 5D7JD 1ZLSH 3WO3B 1QLEL 4Y8AA 4Y2DB 1A6VL 1ZGLM 4P23B 4NKOA 4LU5L 2R1XB 1OAQL 2WUBL 3ZL4L 1N5AB 1WISA 1YPZE 3MNWB 1TXKA 1AO7D 3P4NB 4OZGF 3K4AA 3I6KA 2E6QA 1VFUA 5AG8A 4CMMA 1MF2H 1MIEH 3QIBC 2OMNA 1P7QD 4JFOB 2R9HD 4TVPH 2BP3A 1S8DB 1T2QL 4I2XA 1RZIA 4E41A 3O3AA 5C0AA 2DIBA 2EIEA 3F7PC 4K3DL 2IWGA 2MQCA 5HDBF 1GPOL 4LHQB 4KMQA 5DQ9B 2IF7A 3TBWA 3GBNH 2XKSA 2XQBL 2J3SA 3TZVB 2KUTA 1F8TL 3UPRB 2DTML 5T3ZL 2VAJA 1IGTB 4GG6B 1MCWW 2XIDA 1XR8B 2XKNB 3RJDA 4JFEB 3MBEB 2V17H 1F3JA 1KIPA 5C2UB 2E7LC 4HKXA 1TQCB 3ZE0F 3BRDA 3T4AB 4OLYL 2DQEH 2E7BA 2ICWA 5E08L 1RVFH 2EIBA 5HYQA 2R0WL 4PR5B 4WW2A 5D2LA 4LVNC 1OTTD 5CIPA 5HHPB 1DL7H 4U1KA 2MQ0A 4XMLH 3O2DL 3QXTA 3BPNB 4KMLB 5I30H 1RK0B 1I7UB 1PEWA 4PJ9C 3LB6C 3ULVL 5SX5K 2XNAA 1VGEH 3B9KB 1YUHB 4AIZA 3GSUA 1KGCE 5EO9A 2VNCA 3QO0A 5HVHC 3MRFA 3U4AA 4KRPC 4D3CL 4TUJB 3L5WA 4ONFH 2XY2A 3IS0X 1EZVX 5E1HB 5ID0A 4NN6C 3O11A 3MRMA 4IIQC 3E8UH 2A6IA 3OR6A 2VUYA 3W81A 4XWOD 3VD5A 5I8OH 3FONB 2BHUA 2YR3A 2VQTA 5SX5H 2ICCA 4UB0H 1QEWB 3AMLA 4G8GA 3SY0B 4PJAF 3VXPB 5HHMB 5BS0A 5KJRL 1QFHA 4HJ0D 4M4PA 5JNYB 4R9HA 4ZUWB 3D39E 3SKUD 2IH3B 2Z31B 3O3EB 4PJBE 3KHOA 3HAEG 1N6QL 3MLPA 4NSKA 1TTGA 5F44A 4C58B 3VXUA 2V2XB 1JZ5A 1HYRC 2YWYA 2PO6C 4PFEA 2FDBP 1GOHA 2BSRA 3PQYE 3UTPD 4JFZL 1MFEH 2AXGA 3JV6B 5KAQG 2XTJE 3SGKC 2GSIA 5DSCA 5HHNB 5L0QC 1IAKB 4EUPH 5J3HC 1DEDA 2JJWA 4N0UE 1AE6H 3TO2B 3ZDZF 3JTSA 5D8JL 3U7AA 1NC4D 1S9WA 2C7UA 3TT1L 1IGCL 1Z9OA 3QEQE 4LDOB 2ZNWA 5GGQH 2E3VA 3F62A 3VDAA 1JHLL 2UYLA 1JK8B 1R5VB 4FQLL 3W9EB 4HMEA 2IFFH 4WFGE 5IG7A 4TSCL 1K5NA 5GZOD 3DROB 5ITFB 1I7RA 3BPCB 2C4FU 4OFYA 1KBGL 2QR0A 5I17B 5C0IA 2XT1B 2YBRB 4HWZB 1JPFA 3ULUC 4CMHB 5J56B 5K9QI 4IJ3C 2ADFL 1NDMA 5JPNA 1MHHA 5D7LB 1P7KB 3DIFA 5L6YL 3V6OA 1S7WB 1N26A 2X1WL 3K74B 5DJZA 2EKJA 5IW6A 1D9KA 2R2EB 4OKVA 3OKMA 2KL6A 4YX2H 3GSRA 3RWEB 5KN5A 1ND0B 3T4YA 1NBZA 5JXAL 3MMEA 3WS6C 1FL5A 2DYPD 2OX5A 4P4RA 1BIIA 4KQ4L 4PG2C 4LLMA 3SJVA 2ITDB 1GHFH 2EXWD 3MSPA 4NWTL 2LE9A 2D0HA 3BP6B 2WLZA 5GPRA 5EU6E 4ZG1A 2P5EA 5FF6A 1G7MB 1CG9B 4CVWA 5H2BA 1A6ZB 5AUMB 2NTSP 2VDQL 5DMKA 1MCFA 3RVWC 4M7ZC 4GKZA 5E8PA 2VC2H 4D0DA 1JGUH 3KPRB 3RKDD 5JMOC 4Q9CA 1G7PB 3SE4A 1QBMH 4KKBD 4KPHL 25C8H 4E5XB 3BZEB 1UGNA 5ILTL 5KS9B 1T1WA 1VFAA 3KR3L 3HE7B 5M94B 2FBJL 1A4KB 4DKFH 3ARDB 4R2GB 5HDQH 5IVZA 1U8HB 1AGFB 3QFJD 4HK0B 1K4DA 2GKIA 4YHKL 2VLJB 5LAXB 1GRWA 1RZKC 1Q9WA 1EEYB 5F9AC 1LO0H 3MA7B 1T89A 2FYYB 2VLRD 4I0PA 1X4XA 3C09B 3IF1B 1QFWM 1CFSB 5GGVY 1BD2E 1V3LA 2ICWI 5BRZA 3GSWA 4OCXH 3QA3B 4PRHE 2Z35A 5C09E 4QRQA 1FRGH 1S5HB 3PV6B 1S78D 1MUJA 3NZHH 2KBGA 3R06A 4NKIL 3PP3K 3RX5A 3CCHB 4M6OL 4EI5D 2N1KA 4Y5YA 4LGPB 1MVFA 4J1UB 3LMJH 3WFCH 3BZFB 5GXBB 4JGJA 1ZKAA 5AEAA 1KLFA 3QHFL 2HKHL 1TJGL 4P2OB 4LSPL 5GHWH 2I07B 1BBJA 4KKAC 1H15B 3VE0A 2Y25A 3ARGC 1PG7X 1WBXB 4YFLF 4NO3A 5L2KB 1CDIA 5CBAB 4JKKA 4MJ6B 4M7LL 5EOTB 1UXWB 4UIKL 1PKOA 1FIGL 3WNLA 3PP3H 5C7XL 1KCLA 2KZWA 3BZDA 3WFEL 2DOCA 1JV5A 3VFGH 1YEKH 4NJAH 3VI3E 1UJ3C 5MEPA 3P2TA 4X6CE 5F9OH 1L0YA 2BSTA 2VB5A 3GI8L 4M1GH 2QQNL 3DVNB 3GM8A 4JKPL 3S88H 1U6AL 1AHWA 1CU4H 4XNQA 4NZDA 5DFTA 3O6FA 5C0GB 4RWHA 1WGOA 2X2YA 4WTZG 1BZ7A 4I4WA 2CR3A 4QTHA 5M95B 3S35X 4IBLT 1PKQB 4DN4L 4D9QE 2AEWA 1XF1A 4IRJB 1E4WH 2QQKL 2NPLX 3RUGA 4MWFB 2AXHA 3GIVA 4L9LA 3VFOB 3QIWD 4LSDA 2BDNL 2RHEA 1QO3A 3VFSB 2EIZB 1U3YA 4YZFF 3PGDA 3MLWH 3AAZA 1ONQA 4I77L 4MXQC 5ELIA 3S98A 5AAWA 1EEZA 3HRZB 3DV6B 1VDGA 4HGWB 3JXAA 3I6LE 1S9XA 2JF1A 1HSBB 1IT9H 1KULA 4PYGA 1ZGLP 1KN2L 1QFWH 4UIMB 5EU5A 1PFCA 3S6CA 4X98A 5J7CC 15C8L 3PWVB 2Q76B 4WUUA 3LSOA 4G9DB 3UYRL 4D9RE 4JREC 4TULH 4P57B 2D4FA 3GBLA 4P2RE 1PZ5A 3CAFA 5ISZD 1V7MH 1XAUA 3MJ7B 3P9WB 5C0BB 3ARBB 1XR9A 3ZKND 4N5EC 4PP1D 2R4RH 2EO1A 2G2RA 1AC0A 3GKWH 2VABA 3KJ4C 2BHYA 4WEUD 3MUJA 3WNKA 5D70L 5EBMA 4U2ZA 5IGXH 3LIZH 1AC6A 4UU9A 4G6AC 5D2NB 2AJ3A 3O2DA 4FXKB 2W07A 4X0KA 5TE4L 3LKPB 4FTVD 4ZAKC 3V5DA 3WL9A 1KELL 4FQHB 4U0RC 4GKSB 3L5IA 4HW6A 3U7YH 2FJFA 4APQB 1JJUA 1YEGH 1Y18A 2R29H 4LCYB 4OZHF 3HZKA 3WFHA 3LHPH 2EXYD 3MRPB 1JYXA 1IC4H 4QOKA 3KPQB 3IXAB 2FRGP 4K3EH 1JYNA 2X89D 4NDMB 1LQSR 5E8DH 4O51B 1U8KA 4KK8C 4PJCA 4DUVA 5LWYH 4S1SL 1A6PA 3ZSTA 3PHOA 4M3KB 3ESVF 2P8MA 4CBPA 1TZGH 5ERWA 4ZFOB 2IFGA 1EERB 3FAXA 5DQJA 4OLZL 1V5JA 3C60C 1EBAA 1OTUD 1UCTA 1MOEA 4J3TA 2FD6H 1HXYA 5C0RL 5EWIL 1OGAE 2XWBA 3VWJB 3BKYH 5DHXB 2V9QA 3C2AH 3TYFA 4OGXL 2JELL 5MENE 4JFQA 3KPMB 3FB7B 1F00I 3HMWH 3VWKA 3T0VA 5GZND 3H3PL 2O5ZH 1ZA6B 3QPQD 4JPWH 2PCPB 3RRQA 2DL2A 3KPNA 1MCWM 5IB4A 1KPUA 4JM2F 4HEPG 4U0QB 3OB0K 2MHAA 4PB9H 3LKOA 1S7QA 4QY8B 1IFHH 4MA8H 2GFBA 2FB4L 3MLZL 4Y19D 1HKLH 3D48R 2ZCLH 1S7TB 3HI5H 3D6GA 5FA4B 3TPUA 1SJVA 1L0XA 3E6FA 3QG7H 3B8SA 5KW9H 4YR6A 2RFXB 2NY2B 1I8LA 4PJ8B 1HXMB 2D03H 3N0PB 3O4OB 4WCYL 5GRJH 4MNGA 4IDJL 3V9FA 3OB0H 5F96H 1X5HA 1BBDL 4YPGA 2FX9H 4RWYH 1CDHA 2G60H 4L4TD 3ZYZA 3KXFB 2OL3H 1C1EH 5KVDH 5EZJB 3EJZC 3RGVB 7CGTA 5BCAA 3BSZL 1UH2A 2MCPL 2UWEB 3HZMA 5T5FL 1KCRL 4FFZL 4UDTB 4Y5VA 5FDWB 5T3XD 1QRND 4MDIB 1HZHL 1MCSA 3O2VL 3HAEA 1CWVA 5IMLB 5CGTA 3LRHA 3QDGB 1ITBB 1P84K 3E3QC 2Y5EA 1I3GH 3Q1SH 3HUJB 4MLIA 1BIHA 4PLKC 5SX4H 3QUXA 5DWUH 2GUOA 2JTDA 4BKLB 1OGTB 3VXOB 4N1EA 4KUZL 1GGCH 5EO0A 5LVEA 5GS0H 3KPPB 3ZDYF 4MB4A 1NCNA 1RUPL 4JRXB 3QHTC 3UAJC 1KIRA 4PRBA 1T66D 1K2DA 1LK3H 4WDIA 4MHHI 3TBTA 2A2QT 3U0TA 1ACZA 4MNQB 3H9YA 3VXSB 1OLZA 4GAYA 4KJPD 3DX7A 3MRBB 1YN7B 3FN0L 3QNZA 3MA9H 3BMVA 2NY5L 4RQQB 5DK2A 2LFGA 3Q6GL 5AZ2H 4O2EB 3Q3GB 3FO0H 4H5SB 1AGBA 5AWNH 2H1PL 2HTKC 4WHTA 4C56D 3WXWL 4HH9A 3BPNC 3SO3B 4A6YB 4CVUA 3EO9L 1J8HE 4QF1B 4YBHA 1VPOH 1YDPA 3CXDH 3GBML 3IFOA 1IZKA 1MLBA 1JUFB 3K2UL 1QP1A 4GRWE 5KSBF 3HPJB 3WO4C 1J1OH 1XFPA 3SGDH 5HYJD 3FFCA 2VTFA 3LQZB 3TJEH 4KFZC 5DK0B 1BAFL 4QRRE 1QHOA 4QTIH 5FOJA 3LEVL 3DVGA 1CDGA 1VEMA 2AJYL 1C5CH 4MXVF 2F54A 4R96A 5F1KC 1A6UL 4DQOL 3BPLC 1IKFL 3SE3A 3ZTNL 2DQHL 1FVDA 5LQBH 5E2TH 3HNVH 4GW5A 2XZCH 4X6EB 3O8XB 3PQYA 4XPHL 5CLTA 3U4EB 1QQDA 3RZCD 5K9KA 1NFDA 1UCBH 4PUBH 1NCWL 1LEGB 3UP1A 2WWKT 1OB1A 2AGJL 2NR6D 3GMPB 3C6LB 5CCKH 4OCWH 1II4E 4N0UA 4LSQL 2QKIA 2Q87A 1A9EB 5H94A 2WUCH 4L8SA 3MNZA 4Y4KC 4G42A 5F97E 2AKRA 4LDLB 1WT5C 1IM3A 3HC0B 4TTDD 1XMWA 1LE9A 3MPCA 3S3JA 2C1OA 2EO9A 3V0VB 43C9A 3ILQC 4LPXA 4ZD3L 5TDPB 1G7HA 3ROLB 4YE4H 4J3UA 3UZEA 1CDCA 2APXA 5JOFB 1ACYH 2HMID 2JIXD 4H88H 2DLFL 1NMBH 3S36X 1MHPL 5IBUG 4NKMA 3T65A 4GW4A 2NTFA 3N85L 3MJ9L 1IAIM 3FOMA 3TIEB 2G5BB 3VGHA 4YHMH 4G43B 5J1AA 2YN3A 4ZUSB 3MUGB 5CLWA 5GS1B 4O58H 2W0PA 2ZUQB 3PWPE 2R0LL 1J0ZA 1P69B 5I2IB 4MJ5B 4HS3B 5IMMA 4WO4B 2Q20A 3IDUA 3K80A 5AAMA 4PJHA 5DEGA 1P6AB 4OZFG 4J6RL 4L4VD 5IUSA 1K6QL 1RU9L 3D69A 3HPLB 3ZT7A 3VRJB 2WP3T 4O2FB 43CAA 2Q7NA 3SDDB 3RY5A 4CMHC 1KPVA 3EDJA 1VESA 2Y4SA 2GY5A 1QSZA 4GH7B 2VKWA 3ZDXE 4PY7B 5EUOB 4JPVL 4PJ5D 3VD9A 5E99L 5SV3A 3QEHA 1M6OB 4CVZA 4OZIE 3FRPA 1NCBL 1IM9D 5I1KL 5JIIA 4OT1L 2CGRH 4JQIH 2EDQA 4HPOL 4C83A 4XCCH 1W0WB 2KQMA 3CZFA 4LHUD 2C5DC 3EJYC 4MJID 3UBXB 2O61A 2UV3A 4G9FE 2VN7A 1F3DH 4DZBA 3BP7B 2JJTA 1RJZB 4LARH 4X6DB 1WLHA 5CP3A 4QHNB 3BISA 1SQ2N 4WTZA 3TBYB 1BD2A 3X12B 1SJEA 3QUYA 1P5VA 3E2HB 3HE6A 1RK1A 4QCIA 1MJUL 2VDMH 4PGDA 4L8DA 3WDJA 3REWB 1H3GA 1RZGB 5KSVA 1J0JA 3TF7C 3KPLB 3NOIA 4H1LG 1CT8B 1OWWA 1P1ZB 3I50H 2Y6SD 1CD1B 5FKAB 5C0CA 3HE7C 3OGOE 5CWSB 3KGRA 1FZKA 3SGEH 4KROC 3RWDA 3L3DB 4R2GC 1PD6A 3BEVA 4JAMA 4P2QE 3LKNB 2BSSA 1X5ZA 3QIUC 4DW2H 3LS4H 4PRDB 2DWDA 3KYOB 5IHUH 4O4YL 5MEOA 4HKJA 3DX9B 1U95A 3IFPB 3LD8C 5T5NG 4BZYA 2J8UE 5FHBH 1XIWD 4JVPA 2Z4QB 3BKJL 4G6KH 3K8KA 5D1XB 2VLKB 3DECA 2Y06L 1WZ1L 4M00A 1P4BH 3BZ4A 2XG5A 1A7NL 1WUNT 2WBJD 3LEXA 4X6BB 5IVXA 2I9TB 5I1GL 2HJFA 2J6EH 5DD1H 1IAMA 1D5IL 3FCTB 3S34H 3FQNA 4JRYA 5IQ9A 2JCCB 5T33L 5FYJH 1W0YT 1NCDH 2ESVE 4K3HA 2NLJA 3I9GH 5D71H 2R69H 4PJXA 5EDXA 2PUQT 3SDXA 3BQUD 1UM6L 1GZPB 3O3DA 1VHPA 1Q94A 1JE6A 4OZ4A 4DVRL 3EYQC 3K0WA 2HLFC 3I02A 1FYTB 1N3NA 1S9VB 4CN4A 1F4XL 2GCYB 2WWMD 3OV6A 4NM4H 4ONHB 5F93C 4L3EA 3C8KB 5CZXD 1A6AB 1DN0A 4LRIA 4R4NC 4XP9H 2ZSVA 3BE1L 4K7PH 4WW1B 3L3OB 3BD4A 1JPGB 2VDNL 1CCZA 4ODSH 1XCTB 3IRZA 5TGBB 3MOBH 4QXUH 5HBBA 2OR9L 1UEYA