3LZFH

Crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
224
structure length
216
Chain Sequence
b'VQLVESGPALVKPTQTLTLTCSFSGFSLSTSGMSVSWIRQPPGKALEWLALIDWDDDTYYITYSSSLKTRLTISKDTSKSQVVLTMTNMDPVDTATYYCARTLRVSGDYVRDFDLWGRGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin, HA1 Subunit
publication title Structural basis of preexisting immunity to the 2009 H1N1 pandemic influenza virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 38
structure length 216
sequence length 224
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfH01
1R24B 4K55A 3UPRB 2VABB 1P69B 1A1MA 4TOYH 4QCIB 4ZOEA 1T2JA 2BNQB 2XNAA 4OFPA 4GRWF 1NDGA 2E9IA 4CN4A 5GRYA 5I73B 3TF7C 5LQBL 5D7LD 3UROR 2EO9A 5C08E 5ESQB 2D3VA 3MLYH 5I1DA 3ZL4H 1S5HB 5ESAA 3DHMA 1CDIA 4P2QB 3RUGA 3P30L 2P45B 3FT4B 1NMAH 3L7FA 3BVNB 5GISH 2IG2H 4O2CA 2X7LB 3G6AB 3MOBH 4Z78B 3L95B 1MLBB 4H8WL 2UV3A 4HH9A 4YHNB 4AM0A 4Z7UF 5F1NB 2GFBA 4EOWH 1R5IB 4FQJH 3SJVB 3NCJH 4OZGA 4HHAA 4ONGH 4NN5B 4NPYA 3VFMA 1K4CA 2J8UB 4KV5F 5J06A 1VACA 3WE6A 2FB4H 1D9KB 3B9KC 3VW3L 5T1DH 4P2RE 4WU7A 5F8QC 5JW5A 3MNWA 4IOIA 1F58H 4WDIB 5E7FA 2HRPL 1AD0A 4WUKH 4KAQH 2J12B 3B2VH 4F9LC 4HK3J 25C8L 1RZKC 1DE4A 5HHNB 2RFXB 3V6FB 1ORQA 1N5YH 2AQ2A 4LPVA 2EE2A 1QFWH 1RURL 4U6VH 3BIKB 3WS6C 5DJ6A 1QHPA 4S2SB 4B0MM 4POUB 1HEZB 2JE8A 1JHTA 2VXVL 3GHEH 4DTGH 3F65A 2CH8A 4ELKB 5C0DB 4ZFZB 5BQ7A 3D3VE 1G9MH 2CD0A 4FFVD 4Q9QL 1Q0XL 3OR6A 3I02B 3U0WL 4MA3A 3RPIA 4U49A 4Z7NE 4OT1L 2LAGB 5F88B 5K59E 4AH2A 3WL9A 1YQVH 3GMRA 4UTBH 3WFHB 2IWGA 5KVEL 4Q9RH 1UG9A 4HMEA 4EN3D 1T5XA 2XWBB 3UPCA 2OP4H 4MA1B 3TESA 1MFAL 2W0PA 3TO4A 1RZFL 3RWDA 3HAEH 5CJXA 4XP6L 1MCBA 4U1KA 1H5BA 1XF3B 5EZIH 1GGBL 4MD0B 2C26A 5DR5H 1J7VR 2AJ3A 3T0WA 1F42A 4M5ZL 2J7LA 2V17L 2NCMA 4FNLH 4M48H 5DGQA 5C08A 3RVUC 5J12B 3EYUL 1TXKA 5C0JB 2BNQD 5I1DB 2UUDK 3WN5A 4GAGL 3IT8D 3GSQA 4OF3A 4EUPG 4XP9H 4OIAA 1TVHA 3VGAB 1U8JB 4O2CB 4P9HL 2NX5E 3QJHB 1KJ2H 3RKPA 5KOMC 3H8NA 4MXWH 4JLRB 2FJGB 5J7CC 5TE6L 2HTKC 4NBXB 5ETUA 4P2QD 1M7IA 2HMID 3WD5L 2VSCA 3W11C 3VDCA 2ZCLL 4TNWF 2ZNXA 1GC1L 1X5GA 5T3ZH 2I07B 2CLVA 3VFMB 1CE6A 4S1DD 4JKWA 5LWYH 2EZ0D 4HWBA 4LBEB 3M17A 1F4WL 1WCBA 3MLUL 4HBCL 4JQVC 3MYJA 3DX6A 5TFSH 5TJWK 3UTTE 2F8XC 2VUYA 3DECA 4ZFOB 3FOMA 1MEXL 2ERJC 1FFPB 1ZHNB 5D9SA 3WHXB 4YK4C 1UCBL 2B0SL 3DXAB 2O5XL 4DGIH 2YEZB 4PR5A 5KANG 5IROA 1D9KD 1TLKA 1ORQB 4PP1C 4MWFA 2XZAL 5F96H 4HUVA 1JRHI 3BUYB 2I60L 5C07B 3KR3L 2LU3A 3HRZB 4UINH 4M7LH 5I8OL 3TFKD 3EFFB 1KXQE 2NZ9D 1ZLVH 2NXZB 2QQKL 5T1KA 1XH3B 3PWPB 3VU2A 3FL7A 1S5IL 2VL5A 1K3ZA 2R15A 5IESL 3WJJA 5DJZA 3VD7A 4IIQB 2BJML 3D69B 4UIMA 3ARZA 1MJUL 4UDTA 3N06B 4PJFA 4UILL 2O5ZH 4Y5VC 5D7SL 5FHAH 4NHCH 3RPIB 1H8SA 2AJXH 3K1DA 3SPVB 2ED7A 4L8BB 3B9KA 2P8MA 4AH2B 1NGQH 1UA6H 3GMRB 4HZAA 5FGBC 4G9FE 1T5XB 3MRFA 4M00A 3EYOB 5CFHA 1EHNA 4F9LA 5IIEA 5BVPL 3L5IA 1E4XL 3RWDB 1CXLA 3VDAA 1NJ9A 3WXVL 3C8HA 2ILLA 2H32A 2YC1A 4S0SD 3ZE0F 2HFFB 5JW4N 3WS6A 2ZCHL 5C08B 1PLGL 4Z7VA 4JG0H 4PTTA 3SDDC 3WN5B 3VXRE 4O4YH 3GSQB 3GJFH 3DLQR 2NX5A 3GSXA 3MLSL 4LIQH 3MLXH 1MAMH 2VZTA 4KXZI 4B7IA 2C1OB 1YMHA 3O41B 3QUXC 1NLDL 4ZS7L 5ETUB 4X6DE 3MOQA 3HRPA 3RP1A 2LTQC 3QCTH 1YYMH 5JORA 2VQUA 3L5WB 4BH7A 2CLVB 1JTTA 2J1KA 4E41A 4FOMA 1FNGA 4A2MA 4ZDHA 5I18L 1NGWA 3D85B 3L3GB 3DX8A 1DBKL 4P2RB 4P4RB 3UTTA 1IEHA 5ALCH 3QUML 4KJYA 2R1XA 3FOMB 2G9HA 4R0LB 4AL8H 1A7RH 1FGVH 4GMSH 4QRUA 1IAIM 4OLYL 2GK0A 4AEHL 3G5YA 1RZGA 2R8SH 4PR5B 1AXTH 2H9GA 1LGVA 4NKIH 4AEEA 3QXVA 1UQSA 3RVWC 4Y89A 4CDGC 1A1OA 2YMXH 3O2DL 1FCCA 4LSVL 3VMNA 1U8KA 2P44B 3VFVB 4KZEH 4G7VH 2WK2A 3CLFL 1MCSA 2H2SC 5HGDA 3DXAD 2DIBA 5T1KB 3KPPA 1KCKA 4HPYH 2VL5B 4WI3A 4ALAH 2BOCA 3D3VB 1NL0H 3F6IA 3LRSB 4J3OC 1AD9B 1RIHL 5C07D 5GRUL 1DVFA 3OAZK 3IDIA 1NUNB 2NXZD 3PWPD 4HC1A 2P8MB 3ARGA 3E2HC 3MV01 4PV9A 4DJMA 4JQVA 3V0AC 4ODHH 4KGJA 2BMKA 2IPTH 4NN6C 1T7ZA 4JPKH 4MAUH 1NJ9B 2D7OA 4G5ZH 2IAMB 2FRGP 5D6DC 3GRWH 3WIHL 3ZE2F 4JFPB 5CGYC 3DIFA 3TC9A 4KROC 1U9KA 4EUPB 4NBYB 3QDAA 3G5ZB 3T2NL 4EDXB 2DQIL 3FB8A 1OF2B 5F7EL 5JW4R 4QXUH 4QXTA 1NCBH 3LS5H 1AQDB 3MNZA 3HI1B 4LLYA 2I9LA 4KTDL 2HJKB 3LN5A 2HFEA 4Y5VA 1A6TA 2NX5B 1INEL 3H9SA 1BWWA 5C08D 1S7UA 2EE9A 5IW3A 4JO3L 5FGBA 1Q1JL 1OGAA 4ZUTB 4GFTB 1D6VH 3LRHA 5DEGB 2BCKA 4XPFL 4W6XB 4PJDA 4QRSB 5GRVL 4EJ1C 5JDJA 4BH7B 4HJGA 2P49B 5DJDB 4HIXH 4PRHA 3S35L 1JZ5A 1JYWA 3BN9C 4ZUSB 5DVMA 3FMGH 1Q94B 2PYFA 4NO2A 3RWEA 3UTTB 1H3VA 1BVZA 5C0GB 3QNZA 4QRUB 2NY6C 5J11B 5C3TA 3ZTJG 4L4JA 3G5YB 3D85D 2QQQA 4HLZG 2B4CH 2H9GB 2C3WA 2GQHA 4GRWE 1AQKH 1ZKAA 4P2RD 4AEIL 3E1F1 2FL5A 4MD5A 5IK3A 5KVMC 1A1OB 4QRPE 1JZ3A 4JO2H 5INDA 1U8OA 3QCVH 3UO1H 3CSPA 3INUL 4GW4A 4F7TA 5J13B 2R23A 5GGSA 3BQUC 4HK0A 1EUUA 1GPOH 3TBVB 1H3WM 3LKRA 1U58A 2Q7YB 3S34H 4YJZL 5DQJB 4FXKB 4MYWB 3O6ML 3B43A 3ARGB 2X4RA 4PJ8C 4M1GL 4Z7UE 3UEZA 4DFHA 3MV9E 12E8L 3D3VD 4EVNA 4G9FB 3CC5A 4FMFA 5E4IA 4MZ2A 3BSZL 5ESVB 3MXWL 2BMKB 5IMMA 2CKBL 5SWZE 4KV5E 3MLTB 1FORH 4JFQA 2XG4A 3IVKB 1UM6L 5FYLL 1OB1A 4Z7WA 1A6PA 5DD0H 1JFQL 1E6OH 5I2IB 4YR6B 43CAB 4XPGL 4LF3A 1FH5L 2R1WB 3GKWH 2FO4B 4XNXH 2ICES 2HG5B 1MCRA 4HWEH 5IHZA 3VXRB 4QXTB 2IAMD 1OTTC 2YRLA 1BJ1J 4DW2L 3BN3B 2ZOLA 4YNYA 1N3NA 1G0DA 1C8PA 4XVUD 2NY4C 4X6DB 2GJ6E 3PHOA 4KJPD 5A2FA 4NO0A 4LCYA 3V6OC 3NTCH 1Y6KR 2NX5D 3FO0H 3SCMB 4RRPA 4WVRA 4Z95L 5HDLA 1VFMA 3B5GA 4C56E 2IH3A 3HN3A 1LVEA 4MJ6B 2J6EA 4XNUH 2EC9T 5D6DA 4M1CC 1N59A 1CFQB 4X5XA 1C12B 2PYFB 4NO2B 1LO3L 3I2CH 1RULL 3BXNA 3KPRE 2YD4A 4QTIL 5TPWH 5B39B 2BY1A 4KVCH 4XVSH 1WTLA 4P2YA 5C0IB 4YHYC 3VGHA 2VSDA 3LKSA 5B3JF 2VLJE 5C7XH 3FTGA 2QQNH 3MA9H 4OZFH 2R0LH 4TULL 5GGRA 3RFZC 1VKXA 5CP3H 4JHAL 1OLLA 3BJLA 3UTTD 4MD5B 1KIPA 4M3KB 3MRNB 1EVTC 3X12A 4OM1L 2EDQA 3K2UH 1GGTA 3VI4E 4PUBL 1NC2B 1MCFA 3L3KA 4BFGA 1FN4B 2R1YA 5TGBB 1KCUH 3LQAC 4XWOD 1CFTA 1CL7L 1ZXQA 1RJZA 1PX3A 3CVHL 1KTDA 5ERWA 3PV7A 4PJEA 4KKAD 3JWDC 1FFOB 5CEZH 5F8RC 2A1WH 3IDXH 4TVPE 2NPLX 3BDXA 5FHBL 3CSYA 1BMGA 1C7TA 3CD4A 2X4OB 4OLUL 4U1MA 2CSPA 2WQ8A 1PEWA 4KKNA 3VA2C 4ZTPL 2J88L 2R29H 3CC5B 4I18C 2QHLA 5CP7A 4EIGB 4NP4H 2F74B 5TDPB 4N0YL 5SWZA 1IC5L 4LPUA 1BPVA 1F8TL 4M6AA 3RL1A 1UH4A 1MUJA 4G9FD 1QHOA 3G5VA 1NCCH 4YE4H 1P6AB 3JV4A 5HHVL 4YXKL 4WJ5A 3D48R 5J9PA 1AXIB 5CD5C 3BQUA 4EKXA 3IGAB 5DK0B 3DO3A 1U92B 1HYSD 3FFDA 3WS3B 3WFDL 1VFBA 1AFVH 3PP3H 2GJ6A 3VXRD 4O02L 1YQ2A 3PHOB 1CBVH 4G43A 1DBML 2XA3A 1UENA 2AEPH 5FYKE 3MOAH 1WWCA 3IKCA 1BGXL 1NLBH 2GHWB 5HHXH 4UBDC 4P3CH 2FECI 5LAXA 1IGTA 3S88H 1J5OH 3KPRA 4WEMB 3BXNB 2KZ1B 5FECB 1N8ZA 1YEIH 3SCMD 1WT5C 1NCWH 2APXA 1RFDH 3FTGB 3RWCA 5D4QA 4GRWB 4K94H 5JHDE 3JWOH 1VKXB 3ZE0E 1VCAA 4H26B 5C0AE 2MFNA 3RIAF 2MCPH 4QRPB 1KNOB 1MCWW 1J0JA 3P4OA 3U79A 1MI5E 4N8VG 3IFNL 1NUGA 5FV2A 4XCCH 3O6KL 4K7PL 4DEPC 4LCWE 4TSAL 3WUZA 3U82B 5I1AA 2NY5L 5HDBF 3OKYA 3V8CA 4GKZB 4PRBA 4NZTH 4LSUL 5D1XB 1MFDH 1NC2D 4LSSH 3O45B 1VB9A 2VKWA 4XGZB 1TZGL 4Z7UB 1KN4H 3EOBB 1U95A 2V5RA 3B3IA 3MV9B 1WJ3A 3P4NA 1VSCA 4U1MB 3VGBA 3LIZH 3WFEL 5IWLC 2VO5A 4DKEL 5CP7B 5C0BA 3THMH 4F37F 3PNWB 5SWZB 4WFHE 2YWYA 4KJWD 4A6YL 3TNNB 1MUJB 3VGGA 2JF1A 4G6JH 3QHZH 2AXFA 3C6LC 2DS4A 3JV4B 3BRDA 1A5FH 1NGXB 1OARL 5EZOL 5T1LB 1J8KA 3DOSA 4I3SL 3MLWH 3U4BL 5J9PB 1JV5A 1MQKL 1N0XH 3DURA 5ELIA 4FQHB 1S9XB 3O3DB 5ID0B 2J8OA 4QT5A 3QR2A 5F9JB 2VIRA 2B2XH 4URTB 1F02I 5CIPA 4MQ7A 1ACYH 4WTXA 4X7TB 3MODH 1G7LB 4LSQL 1VHPA 1X3DA 4GJTB 1CU4H 1QOKA 2GJ6B 4Y16C 1P5VA 1PSKL 5BV7L 5IB3A 5HJ3A 4G43B 1A6WH 1S7RB 3WFCL 3PWUA 1FRGH 5HHQB 4C56B 3VXNA 1E4KC 1OQXA 5FGCE 2FX7H 2GI7A 2VYRE 3HI6H 4ZYKB 4QXGL 3Q5OA 1IGTB 4PLJC 5D96B 5E5MA 4BZ2H 5C2BH 4OV6F 2W65A 3OKMA 3KPRB 4UV4H 2Y07H 2FWOB 1AGCA 4FA8A 5KJRH 4YHOL 5GS0D 1J1OH 4O5LH 3UMTA 2VLJB 3RWCB 3IJSA 1I8KA 4X4ZA 5JHDA 1L7IH 5C86A 5FM4A 4LQFL 3NFPA 3ZE2E 5EC1B 3JV6A 1TCRB 4GLRH 3V0VA 5I74C 3P4OB 2AI0H 5EZJA 4RISL 2LU7A 2RR3A 1NFIB 4GRLC 2AABH 2VQ1A 2OI9B 5FUCE 1TJGL 2R56H 2AQ3A 2DM4A 4OUUA 4QRPD 4JY4A 5ICZB 2QJDA 1U95B 5EB9A 4D2NA 3B3IB 3P4NB 5I76B 4R26L 1EZVY 4PJ9B 1NMCC 4K7PY 4KVNL 5KS9F 1WT5A 2NY3B 5C0CA 5D1XD 2DLGA 5HI5D 3MV9D 1C5BL 5GHWH 5C2UB 2P42B 2A6KB 2VZSA 1XF5A 1LO0L 4NKOB 4ZPVB 4K8RH 4RMTA 2VDNH 4W4NA 4P99A 1I8MA 3B9EA 5SWZD 2K7PA 4PRNA 4HCRA 1FNFA 3EIFA 2OCFD 5D6CA 3VRJA 2M26A 4QT5B 4G7YH 1DQMH 2CPCA 5D70H 4BSVB 2M1KA 5EIQA 5T1LD 1QSVA 2ADIB 2VUOA 1BZ9A 2YD5A 5KZCB 4JPWL 3QCUL 4HT1H 4YHML 5IWLA 5IB3B 3TPKA 4LP4A 1HSAA 1GRWA 4BKLA 3S9DB 4DK6A 2G60L 5IVOA 5L8JB 4JVUA 4ZFFA 2VMFA 3CMOL 5CSZB 4L9LC 4U0RB 4H5SB 5JR1H 3OJDB 5TQ0H 3P77A 4BUGA 4U7KA 4OJFH 2GJ6D 1IQWL 3LN9A 2XRAH 4CRPA 3TIEB 4TSBL 4HF5L 1JPST 5HI4C 4IOFC 1X5AA 2UZYB 1FGNH 3BPCA 4AT6B 4C56D 2HJLA 1KENH 4WW2F 3LAFA 4IDJH 2GYSA 1I8KB 5DK2B 5JHDB 1QRKA 4N8VB 2EEBA 4AMKL 5C0AB 3KPRD 1T20A 4OFIA 3HE7C 1XGTB 2Q86A 4JM2A 5FOBA 2P8PB 4PJGA 4APQC 1NANI 1MI5B 4S1QH 3VFWB 5HVWA 4OGZA 5IG7A 5IOPB 2VLJD 4JO1L 5L9DL 1QLFA 4MX7B 3VFSA 2Y6SD 1FO0H 2P48B 3VXMA 2B1HH 4LCWB 3BE1L 3FB5A 1VEPA 2OTWA 4MXQC 3TH3T 1E4KA 1VGKB 4RGMC 1KELH 3TVMC 2EDBA 5GGSY 3SKNA 2APVA 1OCWL 4NNXB 3SE9L 3U4EB 4M6NL 3F7VA 2J4WH 4HJ0D 1WGOA 2OX5A 1MAKA 5C92A 1JZ6A 2AEQH 1RK0A 3QXTA 5HYSA 3C2AL 4RMUA 2BX5A 5GGTA 4KC3B 1F11B 1I7ZA 2H26B 3ULUC 1U8HA 3MFGB 4PJ9D 3V4UH 4DKFL 1XF5B 4PJBF 1F6AA 4UV7H 1T2XA 4MA8L 4WV1C 2NY3D 4XVJH 4BFEA 1NEZG 1ZGLM 4DCQB 5B3JE 1E27B 1IAMA 4P59H 1IEBA 2HJFA 5IW6A 1ETZA 1MJJB 5D6CB 3R0MA 3CUPA 3BAEL 4GRMB 5H35A 1SVCP 1S7SB 1ZT4B 4GKSA 4KDTC 5I17A 2VN7A 1BZ9B 4WY7L 4LSDA 1F13A 2ZG1A 1IAOA 1QBMH 1RUKH 5KTEL 3WNPA 3CH1B 3QYCA 1LEIA 5SV4A 5EA0L 3T0EE 3UBXI 3MPCA 3V9FA 1HSAB 2HFGL 5KVFH 3RWGB 1AI1H 3A67L 3WNOA 1RJCA 4PV8A 3ET9F 3KPLA 4LQ1A 2RJMA 4AIOA 5KZCD 5FGCB 4GKOA 3FT3A 3S8WA 1HXYB 3R8QA 1CD0A 5FYKD 3UTQB 3SGEH 1ZLVK 2D9QB 2RCSH 3SO5A 3KS0H 3MX0A 1TJHL 1YN6B 3LRGA 1UACH 3J8F7 3PL6C 2VQTA 4P9ML 4D9LH 4J6RH 2DQJH 4O9HH 3D39E 4ONHA 5GGRY 1QBLL 4KPHH 3EYSL 1Q9LA 5JHDD 4XZUA 1FLRL 5C0AD 3IAQA 1X5ZA 2EXWC 5FA3A 2BHUA 1LK3L 1U8NB 1A21A 1MI5D 2VDRL 2XZZA 3QPQD 4K7FA 4RFOH 5C8JB 1I7RB 4UAOB 3DBXB 2FGWL 3H42L 1HINL 3F7VB 2OZ4H 4LCWD 3C60B 5DYOB 4JFDE 5CZVL 1RK0B 1EHAA 4LPYA 4RWHA 35C8L 3ARFB 1XGUB 1NEZA 5EOCL 1WVZA 4OCWH 5AYQA 3GJFK 1JNLL 4WUUE 3HE7A 4LCIH 4QRQA 1MHCB 2R4SL 4P2OA 3MV8E 4NCC2 2ORBL 4YLQT 3MGOA 3GSWB 4ZS6D 4WFHD 3TBSA 2DLFH 3IDNB 1RZIA 4M4PA 5IHBA 1QFHA 5IW6B 4DN3H 4MXVF 2AJVH 1N4XL 3CUPB 1G6RB 2AXJA 2Y23A 2NY2B 3T08A 1KB5B 4X6FA 3OG6B 2NXZC 3TVMA 4GKSB 2FX9L 3V4VL 4JY5H 3D9AH 5D1QC 1EAJA 3BHBA 3ZTNL 5ITBH 3TZVB 5D7IE 5HDBE 3WKNA 1ZEAH 3FQRB 1MWAB 1QZ1A 3MFFB 4PV8B 5F9OL 1AKJD 4KQ4L 1SEQL 3NPZB 5DWUH 1V7ML 2FYYA 2N1KA 4R96B 3NA4A 1IGFH 4NJ9L 5AZ2H 4YDKH 2MMXA 1EXUA 1C1EL 3RVXC 3JTTB 3HNSH 3UX9B 1R3LB 2MPAH 3EFDL 5DVKA 3L1OL 1RUML 1U8IB 1GL4B 4HG4K 1JGLH 1FG9C 2XT1B 5JXEA 4OQTL 4KDTA 1GIGL 4EDWH 4I0PA 3EO9H 3GI8H 1AC0A 5CS7A 3BZEA 1ADQH 3NA9L 3QDMA 1XCTA 2R2HB 4XZUB 2DI8A 4NNPH 4DVRH 5BJTA 2FIKA 1YEEL 2HP4A 4LOUC 3VCLB 2VXTH 3W2DL 1FL6B 4R7NB 1T21B 5GS2D 4ZQKA 3OAUL 5C09A 3HNVL 1FNEB 2YD1A 3VMOA 2QHRH 1MRDL 4MJ2A 1NEZB 3FAXA 4HLJA 4NQDE 2BXYA 1CXHA 3IYLW 2E6QA 4Y0GA 2VDLL 2V9RA 5BS0E 2KKQA 2P1YA 4NQTA 4X9GA 4YO0A 1KIRB 3C60D 4P2OB 3MV8A 1WUNT 4WEBL 5H94A 2EO1A 3ARFD 3TBSB 3TWCH 4NZUH 5EFIB 2CR3A 2N56A 1CD9B 1MRCL 4LSPL 4JN2A 2QSCL 4RNRA 3TNMB 1TNNA 4XAKE 5FUOH 2WP3O 1Z2KA 2QR0B 3UXFA 5FYJL 1SMAA 2QQLH 1MFBH 4IMKC 1MJ8L 4Y4HA 1RK1A 4LKXB 3T0EB 1AE6H 2EECA 1INQA 5FA4A 3DVGA 2NY2D 5D7IA 4GG6A 3H6JA 2E7BA 5CGTA 1FZKA 3TT3L 1CD1A 2DB8A 1NAML 5FCUL 3QUZC 3AS2A 4JDTL 3U6RB 1S7VB 1TENA 1G7JA 4L5FL 2IFFL 4FQLL 4FFZL 4ELMA 5GJSL 5DHVA 4HZLA 5KS9E 3TZVD 4KHTL 3LN4A 2OMBA 4LLWB 1EXUB 1TTFA 1JZ8A 4LLDB 1OHQA 4KTEL 5C0RL 5LQBH 4FN0A 1IE5A 2RGSA 3RZCB 5E2VL 2YPLE 3CIQA 3OWEA 2PUQT 4X4MA 5D2LE 1LP9F 3P30H 5CEYB 4J4PC 5ICXB 4K3DL 2Q6WB 3D39B 5FEBA 5D1QA 4DUVA 3PDGA 3TO2A 5DLMH 4LLQA 4HUUB 4H8WH 1PVHA 4H0GA 3KPTA 2BC4A 4HS3B 5EOTB 5C6WH 4PJHF 1DDHB 3FRUA 4MJIA 1TQBC 4K3JH 5BJTB 3WJLA 1AJ7H 2FIKB 4RGNC 4YEFA 2FLBT 2XWTB 4RDQF 3L3IA 1B0GA 2DKMA 1N5AA 5SWSE 4L29A 5A1AA 4RAUA 4WTZG 1RHHB 3BEVA 4ZQKB 4JFDB 4R2GB 3VW3H 1RZ8B 4Z0BL 1U42A 1WAAF 3QNYA 2HRPH 5CD3B 1I1AC 5HI3C 3TLRA 3MRIA 3O4OC 1XGRA 3A6OA 2IPKB 3MRQB 3MR9A 5DS8B 4WUUB 5BS0A 25C8H 3ULVF 3CFCL 3MV8B 4LCUB 5H2BA 3IFLL 4I5BA 2X09A 1RURH 1UB6A 3K81A 1D5IL 2EYSA 5MENE 4BK5A 1G9MC 5JQ6L 4C58B 4XI5C 1T6WA 3MLPA 4UMGA 2VZ1A 1OTUD 2VXVH 3PWVB 4NOFA 5IBLC 3GMQA 4LL9A 4MQXD 4P2OD 1OT1A 3FO2A 4GKNA 5I1LB 1EPFA 3HG1E 2N7BA 4Q9QH 1Q0XH 3GSVB 4Y4HB 1G7QA 3ZZ1A 4MS8D 3U0WH 3MV7B 1U3HB 4OT1H 5FA4B 4IRSC 5D7IB 2XZCL 3E6FA 3QFJE 1BZ7A 4X5WA 5KVEH 5EWIL 4P57A 3BT2L 4M9OA 1HHKA 1G7JB 1JWSA 3T0ED 1RZFH 1AGEB 1S9YB 3NCYS 4IM8A 4XP6H 1JP5A 2CKNA 3RRQA 2ICEA 1GGBH 1OPGL 4KMQA 1R5WA 4P4KC 5J89A 2XA8L 1Q9OA 5I1GL 2A6IA 4M5ZH 4UTAL 2V17H 5J8OA 3EYUH 3MREB 5E2TL 32C2A 4PJBE 5F6IC 2G75A 2BVQB 5D2LA 2ESVA 1W0VB 3MC0A 2WIIA 4GAGH 1YA5A 4IMKA 3G6JA 4P9HH 4I2XE 3BPLB 4OCLC 1RD6A 3AFLA 4KK6C 4UOW1 5J56B 1FVDB 3VRLE 3RZCD 5TE6H 3FRUB 5JXED 4L8CA 3SY0A 3QUZA 4WTZA 4HS6B 3WD5H 3D39D 2HT3C 2ZCLH 5DFVC 2BXZA 1GC1H 5JOEA 1B0GB 1T1ZA 5EBMA 2Q7NA 1N5AB 3AROA 4JKLA 4PB9L 4N68A 1DQJB 3BEVB 5J1AA 3BRGC 3MLUH 4HBCH 3VJ6B 4FMKA 3C09B 1K85A 1ZE3C 3L3JB 1MEXH 1LDSA 4NQDB 3V8OA 1XGRB 2CMRL 5BS0B 1UCBH 2B0SH 3MLZL 2O5XH 3REVB 4MGXA 4WGVB 1K2DA 4JFDD 2GT9A 4R2GD 4I5BB 2XZAH 3PP3K 5I1EL 2NNAB 2I60H 3KR3H 5I8OH 4O58L 4WUUD 4PJAF 4HXAH 3MV8D 2X4UA 4HV8B 4U1HB 1WBZA 3TYGL 2BJMH 4LEOA 1MJUH 2ZPKL 5DUML 1P84J 3UTZB 1H15A 1FC1A 4UILH 3FQTA 5D7SH 2X1WL 4GS7C 1UZ8A 3S98A 4OSUL 1BIIA 3ULUL 2HTLD 4LGRB 5JO5B 1BZ7B 2KZWA 3LOWA 2O61B 1I1AA 3FT2A 4ZD3L 2LU4A 4POZC 4U6HA 4Y4HD 5BVPH 3MV7D 4JPIB 1E4XH 1U3HD 2ATPA 5KS9B 4GH7B 5DK3A 2HT4D 2F9BT 4BM7A 1QA9A 5IMOB 3EHBC 3RGHA 1HQ4A 2ZCHH 2A6IB 2WWMC 1WLHA 3GMLB 2P4AB 3NH7L 5HDOA 2IMNA 2YPLB 3PQYE 1IILE 4LCCB 3GBML 5D2LB 5E1HB 1KPUA 3PWNA 4D0DA 4D0BA 2CRZA 15C8L 1WEJH 2CXKA 5F3BB 4FFWD 2Z4QA 2D31A 1TZHA 3CFBA 3MLSH 4IRSA 3P11L 4J8RA 1B88A 2B20A 2A6JA 2HAZA 1BFVH 1NLDH 3HAEA 3BDYL 4MAYA 1YEHL 4Y2DC 1A7NL 4JAMA 3BO8B 4WO4A 1T1ZB 4G8IB 1F4XL 5SWSB 5KSVA 4GBXB 1M7DB 1NDMA 3GHBL 4JDZA 5I18H 3B2UD 1F5WA 4DN4L 4P4KA 5J1AB 5D7JC 1DBKH 4FABL 1AGDB 4KTYA 4U31A 2D7TL 1KJ2A 4AEHH 4XRCA 4LIQE 4NO3A 3LB6D 2V2WA 3KJ6L 2DQCL 5IQ7L 1X5XA 4ZXBC 4WW2B 3O2DH 4LSVH 4JFFE 3U0TA 4BQ8A 5EH1A 1A3RL 5MENB 4NQDD 1IC1A 2LV4A 5EORL 3QXDA 5BS0D 3CLFH 2MKWA 2A77L 3TBWB 2P43B 2DQDL 1J1XL 1NMBH 1FQ9C 1I8LA 5IQ9A 2DICA 2JIXA 1BQLL 4BELD 3HG1B 2JJSC 1KBGL 1KYOJ 1RIHH 4MSWB 3G9AB 3BP5A 5GRUH 4XAKD 4NQEA 4X6CF 1ZAGA 2DJUA 3W5MA 3QFJB 1F6FB 2XQYK 1VERA 4JFHE 1IGJA 2F58L 4U33A 1JTPA 4ZFOL 4OZIF 1NGZB 3FT2B 5EO9A 4DZBA 3CVIL 4JGJA 4U6YA 3O9WA 5CKAA 4M93B 1AR2A 3CK0L 5AZEH 3LZFL 1G6VK 2IBBA 2LAAA 3T0VA 4U4BA 3OX8A 1GGIL 3JWNC 1QA9B 3O3UN 4DGVL 4ZTOL 1DLHB 3WIHH 2VDPL 3QDJB 4HIJA 2OR9L 4H1LH 3HZKA 3M1BB 2FCBA 3QFDA 1BREA 3T2NH 2V7NB 3QT2A 4PJBB 2DQIH 3PQYA 4MD4A 5F7EH 5DMYA 4OTXL 4G80A 4PG9B 3ZKMD 4D0BB 1LO4L 1OAYL 4KTDH 4NGHL 2ARWA 4WCYH 1F3DJ 3VD5A 4NQCA 1INEH 4I2XB 2D31B 4OLVL 4M7KL 3VH8A 3CFBB 5E4EB 3UTPE 4J8RB 5DJAA 2QADC 5J6GB 4JO3H 2YPLD 2E8ZA 1AC6A 1DP0A 1RIVL 4MAYB 4PY7A 1Q1JH 4X98B 3SKMA 2EKSA 4XPFH 4EBQL 3H3KA 4HKBA 3U9UB 3OGCA 4WO4B 3ELAT 4D0CA 3S35H 2QKIA 3O0RL 1FVCA 2B1AL 5JMOC 3TYFA 5HXMA 2B4CC 5I16B 5E8PB 3LHPL 3GJFA 5SWSD 4GBXD 3LKNA 3HC3L 1PW3A 5K9JL 3C9NA 4JJ5B 3RWJA 2ICWA 4AEIH 4DAGL 4CADA 4DQOH 1I7UB 2R2EB 4D9RE 3IRZA 3OKOA 3QXDB 5EC2A 1T83C 3ZKXC 2XTJE 2ID5A 4Y2DA 1ZHLA 4QHUA 1CQYA 3I6KB 3WYRA 3H7LA 3SGKC 3QHFL 1CG9B 2F5AL 4JGUA 5MEND 5ADPL 1PG7X 1T0NB 4XHJD 2Z92B 2G5RA 4QKXB 1MLCB 1HHHA 3O6MH 4PJHE 5HYJE 4M1GH 2WUBL 3TV3L 4RFEA 12E8H 3HG1D 3BGMA 3PDOA 3MRRB 1A1NA 3BSZH 3MXWH 4U6YB 2BRQA 3O9WB 1FL3A 2CKBH 3CAFA 2NY3C 3OX8B 3QFJD 4ZXBA 1UM6H 1JGVL 2R39A 5FYLH 5T1MA 4YZFF 1WAAE 2XFXB 1TITA 4Z5RA 1Z6JT 2E7LC 3HZKB 3C5ZC 3OKNB 4XPGH 4YPGA 3PQYB 3R06A 3ULVE 4WI7A 3MRBA 2JJSA 2UWEF 3KLSA 1QR1A 3HMXA 3QDJD 2VC2L 3KG5A 4DW2H 3RY6C 1V05A 1XR8B 3IXAB 4Q2ZA 2BHYA 1TVDA 2PYEB 5I75C 3SKMB 2FEDC 5KAQF 1ZGLA 4Z0XB 3RGVC 2XN9E 3QG6A 3GRWA 2W9DL 1JE6A 1JUFA 1C5CL 3J7HA 4Q7DA 2XACC 4Z95H 3VFRA 5JIIA 1EO5A 2GY5A 2QKIB 1O0VA 5DI8B 1FVCB 3NCYP 4MAYD 1XCQA 4DVBB 3LSOA 5K9OA 3BD3A 3T09A 4R4NC 4Z6AT 4WEUD 1LO3H 1RULH 2EXYC 4QTIH 4N5EC 3VFGL 1Q9WB 5DT1L 3H9ZA 4EOWL 4O2EA 3LKPB 4R9HA 2FR4A 4K07A 3QQ9D 5DC4B 4TULH 3C9NB 2Z93B 4JHAH 5E8EA 1QR4A 4JFFB 3UYOD 4OM1H 3SKOB 2R2BB 3AREC 4JE4B 1JL8A 3ARBC 3QSKB 4PUBH 5EC2B 4NKMA 5FXCH 1JGUL 1P4LB 1CL7H 2PO6C 4BQCA 1RZJC 3LEVL 3OKDA 1DR9A 5T5NG 1DTUA 1B3JA 1W0WB 5I6XC 2ITCA 1N5YL 4J12A 2ADJA 1HWGB 4UQ2B 5FHBH 2YHGA 2XY1A 4NRYA 4X83A 4OLUH 3PDOB 2FH6A 2J88H 2AK1L 4R4FL 1A1NB 4I4WA 5A2KH 1QSFA 3ULSA 1OL0A 1VA9A 1CFNA 3L7EB 2YUXA 4N0YH 1IC5H 4HFUL 2VB5A 2VLRE 3HLAA 1F8TH 4PRPA 1FYTA 4IHOB 3OKEA 3SE4C 5DA4A 3B6SB 4M62L 2X4PA 3EDDA 4JN1H 3MTRA 1LHZA 4AENB 3UBXG 4WNQB 1T83A 2ZOKA 3O9WD 5HHVH 4YXKH 5LVEA 3BH8A 4LGSB 1DN0A 3SGKA 4LSRL 1T03L 2F53E 3AXLB 5EU4A 5IM7A 1I1YB 4OLZH 2K9UA 5DJ8A 2VNCA 4PJAE 3PQYD 3NGBB 3IXTA 5CUSL 1CDCA 4O02H 3EO1B 1DBMH 3QG6B 1JUFB 3VFRB 1BGXH 2M8XA 1MNUL 4PLKC 2ZSVA 5IFAL 4LP5A 1MCJA 1BOGA 2PYED 1FDLL 1P5UA 5HY9A 5I8KL 3T4AA 3LSOB 4HKXB 4Y5YC 3RIFK 1CFBA 5K9OB 4N5UA 3QWRD 2E7LA 3W82A 3C5ZA 3TN0B 5IUSA 2J8HA 3FAWA 3W0WE 5F7NC 2DQHL 3GMPA 3EDKA 3OKLA 3ZLQC 4ZNCD 5DZOA 4HK3N 5CJBA 4RMWA 1EEYA 1NSNL 5IEHB 3QUYC 5KN5A 3IFNH 5HGAA 2XTJB 1LP9B 3EJJX 3O6KH 3RGVA 3DMMC 3OHXB 4LRNL 1DCLA 4K7PH 1D5XB 3Q2CA 3Q6FB 4JFFD 4PJXE 1WIPA 2NY5H 2RAMA 3DVNA 5EU6E 3BKML 4LSUH 4X4XB 3GSNB 5J3HD 2ITCB 3CPLA 1OGTA 4PJHB 2BDNL 5HYJB 3RVVC 4MNGE 2I24N 4JZOA 2YD7A 4OZFA 2NW2B 4Q74A 2YKLL 3WFEH 4N0UE 5CP3A 4DKEH 3VFPA 2C5DC 5DDHA 2DQUL 1Y18A 3RI5K 4BSWB 1CFNB 4W6YB 1HHIA 4LHQB 2HVKA 3HLAB 4A6YH 3LKOA 4I48B 4PPTA 4JGMA 4JFHD 3OKEB 1T4KB 1S9WA 3BEWA 1NCAL 4NHCL 3AS3A 3WUWA 3AREA 3C8KA 4QNPE 3QPXL 3KPOB 1OARH 5EZOH 5INCB 2BOBA 1KPVA 1Z9MA 3O3AB 3U4BH 1NGYB 1MQKH 1DN0B 2MQ3A 2F53A 4HPOL 2PXYB 5EU4B 3KJ4C 3MUY1 1KTRL 3NCBB 4JCLA 1HQRA 1Q0YL 1E0OB 2DQFA 1MAJA 3VXQB 4Z8FL 1QLRA 3SDAC 1PSKH 5BV7H 2UY6A 5DMGC 2W38A 2XN9B 4P3DA 3RVTC 3SGJC 2H6PB 4J3XA 5E00A 4P46C 3WFCH 3PHQA 3UTPD 1C5DA 1P7KB 5GS1C 4KRPC 2FJFB 1QFOA 4NRZA 5JIPA 3REWB 3SE4A 4HGWA 3HI5L 4M43L 4QXGH 5C6TL 4X7FC 4OZIE 1RV6X 1HIMH 5BW7C 3SDXF 3ALPA 4FQ2L 3OXRA 4KQ3L 3EO0A 2BNRE 4KK9D 1CZ8L 1CVRA 3LV3B 3VXOA 1A6UH 3W0WA 4RX4D 3WFZA 1BZQK 4LQFH 3GMPB 5KVDL 3D0LB 3VE0B 5MERB 3L9RA 4NC1C 3TN0D 1J8HE 4RISH 3P9MA 1M05B 3S96A 3O2VL 5ALCL 1JI2A 1EUTA 1TJGH 4PJXA 3DVNB 4D9RD 2CIIB 4YC2B 5CBEB 5GS0L 5EU6A 4LVEA 1AXTL 3SE3C 4NM4L 1GOHA 3CPLB 4MNGA 2FLRT 2XTJD 4XCYA 3KLDA 1EFXA 3LPFA 2KUTA 3MO1B 4R26H 5BRZA 4N0UA 1ES0B 4KVNH 5MHSE 1UWXH 2OL3B 4BA8A 4K8RC 4N90D 5LGKA 4ZOCA 2VLRB 3UBXB 2ZG3A 4ALAL 3GNML 5HYJD 1IGYA 1KG0B 2LE9A 3MACH 1C5BH 3ZSTA 5FGRA 3BEWB 1LO0H 3PWLB 4M7LT 4E9LA 3C8KB 3GMNA 3G04B 2Z8RA 1JGEB 1CT8B 4J3UA 4CMHC 4PJ7E 3K4AA 1WITA 3DMMA 3D2UA 1K6QL 3HR5B 3FB6A 2I27N 2F53B 3CDFA 1S9VA 5BVJB 5BXFA 5DQ9B 4KI5E 1KPRA 5ABDE 1RU9L 1U8QA 3PGDA 4MAUL 1NKOA 4G5ZL 2C1PA 2EYRA 4PJAB 2GSIB 2WMPA 1QLRB 1SJHA 3ULVD 3QCUH 1U6AL 4HJJL 3NIGE 4YHMH 4Y1AE 4DOHE 4M7JL 2PXYD 4Y4FA 3C2SA 1ERNA 1NBQA 1TZIA 2G60H 1WZLA 3MJ7A 5GSRA 3CMOH 4G6AD 5HGBA 1C5DB 5TDNB 4GW1B 2BY0A 3DV6A 1CGXA 1GZQA 2Q3AA 1GAFH 4QXUL 1HXMA 4L8SA 5L2JA 1Q9KA 3BPOB 3B83A 5DTFB 4OCNC 4HGWB 1IQWH 5DHYB 1DJSA 4XTRD 4XMPH 1QSEA 2XN9D 5I8EA 2MSPA 4TSBH 4HF5H 5B8CB 4F7CB 2DYPA 3OB0H 1KIUA 3GM0A 3KPMA 1ED3B 4X6EA 3VXUE 3W0WB 1FZOA 4AMKH 2JJTC 3TBTA 4YZFE 4PD4K 4NQVA 5DGRA 5K9KA 3SDAA 1J8HA 3L5HA 3SGDH 4JO1H 5L9DH 2N7AA 5EUOF 1CXEA 3SGJA 2UWEE 3HCVA 4P46A 2A83B 4PJXB 2YA1A 3K8KA 4OGAD 3FRPG 5GS1A 4KMTL 5EU6B 1FV1A 5GSVB 1HSBB 3HZYB 4MNGB 1N6VA 1OCWH 3SE9H 1NC4A 1BLNB 4M6NH 4JFXB 4N0UB 2AEWA 1QLEL 1E4JA 2HKHL 1D5BA 2L4OA 4DZ8A 1ZANL 4NHUB 3C2AH 1NUDA 5KAQG 5IB5A 4R2GC 1BD2E 5DJYB 1YC7A 1HNFA 3UP1A 4DKFH 3DNKA 4MA8H 5F7LB 3GMNB 1KN2L 3KYNA 4CU7A 2VLRD 4XCEB 4PJ7A 3DRQA 4PB0H 3T8XA 1ITCA 3FB6B 3G9VA 1S9VB 3BAEH 2FJHB 5F70A 2VL4A 2E9JA 1D5ZA 3PGDB 2CLZB 3ZDZF 1PD6A 2EYRB 3X14A 4Q6IB 1LWRA 6CGTA 4WY7H 5KTEH 1D6EA 2C4XA 1JTOA 5EA0H 4YDLB 3EYFA 3S5LA 4Y4FB 4G6MH 2HFGH 3A67H 1OSZB 3WHE0 2XZQL 8FABA 3DV6B 4MDIB 5F1SA 1GZQB 2HLFC 1F45A 4ZOBA 4PS4L 4L8SB 5L2JB 1R6VA 2DWEA 4RAVB 2Z31A 4PJIE 4OZIB 1CGUA 5JW4Q 1SJEA 3LS4L 5A16B 1JGDA 3T65A 3G08A 5DRNB 2DYPB 3MRMB 2VISB 3CFEA 2BNRB 4GSDL 1TJHH 3KPMB 4KK8D 4X4YA 2OSLA 2ZKHH 1ZT7A 4FFWC 4WW1A 4QF1B 4U3CA 2QSVA 4PBWD 3QUKB 5AWNL 3SKUD 3RBGA 3STZA 5K9KB 1WIOA 1F97A 4PFEA 1MFEH 4JFYA 3ETBF 1QBLH 2X5PA 3EYSH 5D93C 3W0WD 4KY1H 4RMRA 3HZVA 1FLRH 3I6GA 3CFJA 1CDBA 1LK3H 4JDVB 1S7XA 3HB3D 1F00I 3CFKA 3RX5A 2VDRH 1NBZB 4JANB 3QI9B 4LLUA 3T0DA 1NFDA 2FGWH 3DX9A 4LLVB 3H42H 1EMTL 2FEEI 1HINH 4IRJC 2Z9TA 1HCFX 1D5BB 4DZ8B 4E5XA 5EU6D 5CZVH 1U93A 2IADA 35C8H 5I1JL 1BD2A 1WBXA 5I0ZA 1GZPA 5EOCH 2IANE 4IEFB 3PGFL 2E27L 3SDCC 1OTSC 3W5NA 1JNLH 1T0MA 3L5JA 3ILPB 1FO0A 3AB0C 4JEGB 5KANI 2R4SH 3LMJL 2WIMA 2ORBH 2OJEA 3ZT7A 1RZJL 4L3CB 4PJ7B 3DRQB 2WBJC 2Q8AL 5LBSL 3V5KA 3BGFC 1N4XH 4JHWL 4QHLB 1J05B 3AVEA 5EN2B 5EZLA 2J5LC 2FX9H 1ZLWH 3V4VH 3N0PB 2BSRB 1P1ZA 5DMJB 4JRXE 4Y1AB 3WEXA 3ZTNH 4DOHB 2F19H 4DUWA 1HOCA 4K71B 3WIIH 2X4TA 5AUMA 5F9OH 4KQ4H 1KTKE 1SEQH 2K3TA 1V7MH 4YWGL 3MUGA 4CVUA 3MCKB 4PJIA 1G9EA 1HHGB 1S7TA 5CEXA 5B38G 3PWJA 4Y4FD 4NJ9H 4RFNC 1FFNB 3I9GL 3T65B 2O5YL 4U1NA 1PQZB 1C1EH 3G08B 3UJJL 3GSRA 4LGPB 2J8UF 3EFDH 3VXUB 3L1OH 4J1UB 1RUMH 2OSLB 1G9NC 1CFVL 2CDGB 4JKKA 3U2SB 4UQ3B 5HHXL 4OQTH 3O3BA 1GIGH 3STZB 2DYPD 4P3CL 4YHKL 2BNRD 2XXCB 4JFYB 4CW1B 2AJZA 3NA9H 4X8XA 1J5OL 2X2YA 4L9DA 2UWEB 8CGTA 3U9PL 4YDJA 4WWID 3FQWB 2K7QA 2ZUXA 1BFTA 4U1GB 3W2DH 1VFOA 3C5JA 1W8OA 1BJMA 4GBXC 1J86A 4JQXA 2JELL 2ICCA 3OAUH 3OQ3B 1AXSB 5C0NC 4HWUA 1MRDH 3QI9D 2NXYB 1BD2B 3IDMA 1N6UA 4HW6A 4XH2B 1Z5LB 4Q9CA 2P24A 5MHSD 4GG8B 4WEBH 4AY0A 5CBAB 4ZFGH 2ARJA 2OR8A 3L3HA 4ODSL 1MRCH 4NKDA 4WW2C 4LSPH 3V5KB 2QSCH 5GRVK 2CO7B 2F15A 5F1OB 3I3BA 1F2XK 2OZ4A 3Q6GL 3V5DA 3ZDYF 4JCMA 4NQXA 5EZLB 5FYJH 2FZ3A 4PP2A 1MJ8H 5LGJB 4FQ1L 4IRJA 1JPFA 1MH5A 3RUGF 2VR4A 2FBJL 3CCHA 4KI5D 1EGJL 5E8NA 3TT3H 3VXSE 1NAMH 1RVFL 1WQVT 4R3SB 5FCUH 1BX2A 4WGWB 4JDTH 1EBAA 1YPZA 3LD8B 1SY6H 4Y1AD 3UJIL 2IFFH 4FQLH 4NN7B 2B2XL 4FFZH 4PJIB 5GJSH 5CEXB 3FOLA 5K9QI 3KXFB 1L0QA 2R0ZL 1D5MA 2UYLA 3QIWC 3KLHD 1BVKA 4OZGF 5DMKA 2WBJA 2X42A 1LE5A 1FL5B 3MRDA 4M7ZC 4N0FB 5C0RH 3G5XB 4Z77A 4UZGA 1KB5L 4EZMA 1UVQA 2C3HA 5E2VH 2O26U 2ITDA 3GI9L 3LQMA 3O3BB 2KQNA 3WDJA 5F1IA 1I4FA 4NUGH 4K3DH 5MEPA 4ZAKC 2G2RB 3FQNB 5DJCB 3P9WB 2PW1A 2EIZA 3VXUD 1R3HA 4FZEH 4QTHB 1LK2A 4PJ5E 3U46B 4YDJB 1MWAL 3SKJL 3L3DA 5KJRL 4B7LA 1EHLL 1UFUA 1XEDA 4PG2C 1T6VN 1KC5L 1YMMA 2P7TB 4LVNB 1CS6A 4NYLB 3PHSA 3EJYD 2F54E 3EOAB 4ISVA 1B0WA 5CZKA 4OLEA 5ACMA 4JJHA 4Z0BH 5FK9A 3RU8L 3PP4L 3MYZA 2IANB 1ADQA 3GK8L 3FZUC 3H2WA 3DYMA 2JJVA 3CFCH 3IFLH 5DURB 1WFOA 2V7HA 1ND0A 1E6JL 1D5IH 1BD2D 2NXYD 4YPJA 3L3HB 4X7SL 5EO1A 5JQ6H 4ODXA 1IAKA 1OVZA 2JB6B 2NY7L 4NUJB 3IU3A 4HUKB 4WI2A 4PP2B 4JRXB 1QTYT 1P4BL 3NACL 5EUOE 1MH5B 4LLAA 4UOW0 2VLKA 3CDCA 2XZCH 1KCSL 5B38B 4F57L 5E8NB 5SV3A 5HD8D 4JY6A 5EWIH 3IDJB 3BT2H 2HT2C 3NFSL 3F7YB 3BP6A 1NCDL 2DAVA 1FJ1B 2QEJA 2X89A 3K80A 4RA0C 3I6LE 2UYLB 1D5MB 1OPGH 2ZG2A 5C9JB 5C70A 5HYIA 1B0RA 3MRDB 5I1GH 4UTAH 4P5MA 1SYSA 1P7QB 2X4SA 5ACZA 4Z77B 1NCNA 1TJIL 1H3TA 5GZOD 2D7QA 2YA0A 1UVQB 5E2TH 5FO9B 3KXFD 5CZXD 5DQDL 4QLRA 5TH2A 1G7IB 3BKJL 4TUKL 1I4FB 3NBNA 2ED8A 4OJFL 2JLLA 2WANA 1AHWA 1TVBA 3DO7A 2D0FA 5E6IB 1GC1C 1CDHA 1XGPA 3L3DB 3QZWG 4FRWA 5T3XE 3VWKD 3FKUS 3ZDZE 1R3JA 4V2CB 3BP4A 2RBLA 1BFOA 1BF8A 3QIWA 2F54A 4WU5A 4XP4L 5DEFA 3ZMRA 4PB9H 3V7MA 2X4NA 3RL2A 3DSNA 3UAJD 1KT2A 2VZUA 4X7CC 3F5WA 2BSSB 4PJFF 1R3IL 3KPNA 4U1SB 2EIEA 3BZDA 5JPMB 1MFCL 2CMRH 5FUZH 5B4MC 1QVOB 3MLZH 1UJ3B 3OR7A 2X9YA 1EFQA 2DLTA 4FQIL 1KLGB 4X0KB 5I1EH 2IBZX 2IAND 3ZKND 1HHJB 2OR7A 3WCYA 3U0PA 4O58H 4TSCL 4E0RA 5E8OA 1JRHL 5IVNA 3S3JA 4PREB 5IB2B 1WC7A 4Y5XC 2YSSA 5KBNC 5DURD 2V5MA 2GSGB 3TYGH 1LEGA 3IU3B 5GGQL 2ZPKH 4V2BA 5DUMH 1WZKA 4XNZC 4JKMA 3D25A 4Z7VF 2EYTA 1XF1A 1AY1L 4OSUH 4TUJB 4EI6B 5D5ME 5LCVL 5DVOA 3VXSB 5MEQA 3GFUA 2CUHA 1T66C 3DETC 4ZD3H 1ZMYA 1L0YA 3FN9A 4BSJA 4JRXD 3UC0L 1CTNA 1Z0NA 1A7OL 1JNHA 4M8QA 3DGGB 4NQSA 3UTSE 1UXWA 1S3KL 1WBYB 3EYQC 2LABA 4XBGB 2Y5TB 2D9CA 4F7EA 2HFTA 3FQXA 4ODVL 1B0RB 4PRAA 1DQTA 4MCYA 2X4SB 3NH7H 1I1FA 5F6HJ 4D8PA 5A2LH 4DKAA 3GBMH 5TH2B 3V6ZA 3QZWA 3EJZC 5GIRA 1OD7A 15C8H 2X70B 3IS1X 4X8JB 1AHWB 3M45A 2AV1A 3DO7B 1P7QD 4XPBL 3F58L 4OCXH 2Z8WC 3P11H 1NBVL 3L3OA 4PJ5B 4CKVX 5DC0A 3BDYH 2L7UA 1CICB 1YEHH 2VJXA 1NFKA 3NGBC 2AP2A 2XKUA 1A7NH 4TTDD 3BP4B 3NAAL 5ACLA 1BFOB 5E6ID 1F4XH 3Q3GB 2F54B 1CR9L 3GHBH 4OGXL 1K4DB 5CGMA 4MZ3A 3VFTB 1A8JH 4DN4H 2HH0L 2X4NB 4J6RL 4FABH 5CAYB 2D7TH 5E24E 4FS0A 4NQUA 3KJ6H 2DQCH 5IQ7H 1A9EA 1MIML 4XNQA 1EAPA 3MBEC 4G42A 3STLA 1A3RH 3LPWA 3IJHB 1VADB 2CRMA 4YUEL 3QIUA 3AU1A 4OD1L 5EORH 3DTXA 2YOCA 2A77H 5E8OB 4GW5B 2DQDH 1J1XH 3VGEA 1FZMB 1BQLH 2IFGA 5KSAB 3MRHA 3EYVB 1KBGH 2HN7B 4G3YL 4BQ6A 4ODWA 5EUOB 4RZCA 4U1LB 3QEQE 5D5MA 1IM9B 5EIIA 3FB7A 5D2NE 2F58H 4BJLA 1IVLA 1OM3L 3HZMA 2AJVL 4WENB 4MJ5A 5IR1A 3CVIH 2EDFA 2YZ1A 1JNHB 1A9BA 3CK0H 4NQSB 3LZFH 4HIHA 1N2RB 3BOVA 4L4VE 3VXSD 4PJDF 4XP1L 4U3XA 4ZTOH 4DGVH 4F7EB 2VDPH 1LNUB 2OR9H 2E7MA 5FKAA 5IW1A 4Y5XA 4K3EL 1KF9B 1YC8A 3IJYA 1DEDA 4E42A 4OTXH 5DWUL 1DQDL 1HDMA 3V6ZB 5MI0C 3ES6A 4JG1L 1LO4H 1OAYH 4NGHH 3WLWC 1N7ML 3GMOB 2YD2A 4M9PA 4OLVH 5IMLA 4M7KH 3F6LA 2ENYA 3RKDC 1UWXK 3GKZA 4YQXH 1IQDB 1IARB 1RIVH 2ZUQB 2YPKA 5EBWB 1FG2A 1J0KA 5AD0A 4MB4A 4EBQH 3JBG7 5IMKB 4U6TA 4OD2B 5IT2H 1ZLSL 4PJ5D 1C7SA 5I71C 3RUGE 3O0RH 5L7XH 4MCZA 1CICD 1EZVX 3SOBL 2B1AH 3WKML 1G9NL 1TETH 3LEXA 4H1LG 2KBGA 3D18B 3LHPH 4KKCD 4XC1H 5L0QB 4GXVL 2F54D 2EDJA 3HC3H 5EU7E 1JHLL 1AIFB 5K9JH 1BBDH 1A9EB 1F6LL 1MSPA 3KYOB 1EAPB 4OZGE 4XNQB 3MLVL 4DAGH 4FQQA 3IB4A 5HYQA 1UWGH 1J1PH 3TIDB 1M71A 1ZWIA 2QL1A 3QHFH 2F5AH 5ICYA 1T5WA 3N1PC 4HWBH 3PF2A 2IF7A 5SWQA 3CDGB 5D5MB 4Y19E 3OB0K 1FNAA 2WUBH 5EU5A 3TV3H 5FYJU 1AO7A 2WBWB 5KSAD 3E0GA 1PKQE 1FAKT 3HZMB 1KXTB 4BH8A 5DD3L 3RY5A 5IR1B 1MFNA 2C3VB 2XPGA 3O2DA 3HS0A 3UTSB 1A9BB 4JRWA 1IM9D 4L4VA 2BVPB 2GTWB 2NY1B 3MBEA 3OKKB 1JGVH 1X7QA 2DRUA 3A6BL 3H9YA 1FSKB 2VXSL 5F9AC 2MCG1 5IW1B 1CCZA 3I6LD 4WHCA 4MNQE 2Y72A 1FPTL 1B6DA 3ES6B 3RDTB 7FABL 3DX7A 1T3FA 2Z35A 2VC2H 3E8UL 2OQJB 3MRCA 3UTOA 1ZHBA 4ENEC 1QACA 4LHUG 2D03L 3R8BB 1FG2B 5J0BA 2V5SA 1CWVA 4HIIA 5IEKA 4CVZA 3WIHA 2W9DH 1Y6NR 1C5CH 1KLFA 4V1DA 5DMIL 2H41A 4H1LA 3BWAA 2I9TB 3QULB 3H0TA 1UKQA 2Z8VC 4MCZB 2VITA 4NT6A 5T3XD 2C7UA 3NMEA 3HHRB 1BEYH 5DLML 1CDJA 4EUPH 5FO7B 1KCRL 4PJEF 3QWQB 3ARVA 3VFGH 1Q72L 5DT1H 2YXFA 1Y0LA 1KULA 1QSZA 2DI7A 4K3JL 3RY4A 4P5TB 1AR1D 1H3XA 2CLRB 1AJ7L 2GCYA 3ABZA 4XAWL 4Z76B 5IKCA 3C6SA 1XT5A 1KIQB 5BOPA 5DD5L 3KYMB 1H8OA 2DLHA 2W07A 1M71B 4Y4KC 5HGGS 3V79C 1ZWIB 1C08B 1JGUH 2WQRA 3LEVH 1JK8B 1OAKL 3QUMB 2GAZA 3V2AR 2H2PC 2FGZA 5I15L 3WO4C 3QEQB 5SWQB 4Y19A 2RIKA 1UWEL 1TDQA 5D2NB 5E9DE 5EU5B 4F7PA 1PKQA 1UM5L 3U48A 3HTLX 2AK1H 4R4FH 1JVKA 4ZUWA 1J88A 1BOYA 5DVNA 2IJ0C 4LNVA 1ORSA 1MHEA 4HFUH 1L4IA 2VN4A 4QOKE 1BQSA 1X7QB 4M62H 4PJFE 4K9EL 2BSTB 2AJYL 2EDEA 5CLWA 4FQXC 3T3ME 1T1WA 4LRIA 3AMLA 3UTSD 4MNQA 1G7HA 4WWKB 3TA3B 3GGWA 4PY8I 2NY1D 4LHUA 4LSRH 1T03H 5T33L 4JZJA 3S6CA 1A1MB 1RSFA 2Z35B 2XNAB 3N85L 5JOFA 2ZUSA 1NDGB 2AJUL 2CKBA 4P2CG 5M94B 5CUSH 2OLDA 5BCAA 1XR9A 1RMFL 1IAII 3ALXA 3RDTD 3RHWK 5IEKB 1MOEA 4HKZA 2EDDA 3VI4F 2PCPA 1F4YL 3BJ91 1S78D 4LSTL 1MNUH 4H1LB 4Z7VE 5ESAB 3RUGB 4H20L 5E8DL 5IFAH 3OSKA 4N0CD 5I8KH 1FDLH 3L7FB 5JHLL 2VITB 4NT6B 4YBQD 2YBRA 3DUSA 4XWGL 4HH9B 2H8PA 4AM0B 2GFBB 4XBPA 1CDYA 2IQAA 3QDGA 4P5KA 1ZLWK 1GH7A 4ODUA 2GUOA 3F8UB 1T1YA 5F44A 5K33A 4OZGB 4HHAB 1TQCB 2DQHH 4NPYB 4LDLB 1BVLA 1K4CB 4E41E 4ZUVA 1DUZA 1EBPA 1NSNH 1VACB 3WE6B 2NY5C 3VG9B 1H0DA 4P5TD 2DF3A 4WU7B 5JW5B 3MNWB 4IOIB 3SJVD 4I1NB 4LRNH 3RNQA 1QPXA 1AD0B 3LH2L 3VXPA 3RTQC 2Q76A 3VWJC 3BKMH 1DE4B 1I7TA 5IVXA 5TDOA 4B50A 2BDNH 4IJ3B 4P23C 5E9DA 5JUEH 4OAWA 1LO2H 5CJQL 3FQUA 2JK5A 2YKLH 1PKQB 3TJHC 5DJ6B 3BZFA 2DQUH 1JHTB 4ZUWB 4HXAL 4UT7L 4KJQD 3QEQD 2YK1L 5BQ7B 3GIVA 4QOKA 1EDQA 3OR6B 2OTUA 4JFZL 1NCAH 4MA3B 4CVXA 3QPXH 3CVHA 3T1WA 4DGYL 4FZ8L 3WL9B 1F2QA 2JJWA 4Z9KB 3RA7L 4I3GA 4LHUB 3SBWC 4HPOH 1P7HL 2NW3A 5BV7C 3TO4B 3MROA 5E03A 1Q0YH 4U1KB 1H5BB 5L88L 4Z8FH 5L2KA 4WWKD 3TA3D 1YUHA 4R7DA 1XR9B 2AJ3B 1A6VL 4UT6L 4KKBD 4G8GE 1RUPL 4TQEL 3F7QA 1X44A 3G6DL 3CZFA 3JV0A 4JB9L 2X4QA 5I0DA 4LARL 3HI5H 4M43H 3TP4A 5C6TH 1WEJL 1TVHB 4MHHI 3CNKA 4OKDA 3H9SE 5E08L 3SO3C 5F7YC 1LEKA 4FQXA 2HWZH 4FQ2H 1BFVL 4KQ3H 1YY8A 4B41A 2YZ8A 4HD9A 3DVIA 4PY8J 1M7IB 1OGAE 1CZ8H 1SBSH 4XBPB 2IQAB 4P5KB 3DV4A 1RI8A 4ODUB 2BVEA 3U30C 1I75A 4PJDE 1T1YB 1V7NL 1IM3A 1BVLB 5KVDH 1CE6B 4PRHE 5HDQL 3P0YL 4OFYA 5I1CL 4KK5C 3JUZA 1FBIL 3KPQA 3M17B 4Y2OA 1WCBB 3IDGA 3K46A 3VFUA 3MYJB 3DX6B 3O2VH 3EGSA 1CFSA 3MRJA 2BZDA 3SN6N 4F8QA 5D9SB 4U6XA 4NFBA 5GS0H 3VA6A 2KPNA 3S37X 2J6EH 3MJ6A 3ZTJH 4NM4H 5CHNA 4MWFB 3ROOA 5E9DB 4HLZH 2C3XA 5H37G 4CJ0A 4HUVB 1XIWC 3FQUB 2JK5B 1K9TA 4R4BA 1TTUA 1R3KA 3OJVC 1FP5A 2HKFL 1NMBL 1MCOL 4LVHC 1ZA6A 5F1KC 4GRWH 5HSFA 3GNMH 2IPUK 1WWAX 3PUCA 5DJZB 1ZVHA 1DL7L 4QOKB 4UIMB 1F90L 4UDTB 4PJFB 1MHHA 3CVHB 1UCTA 5B3NA 3B9KB 3C87A 1I8IA 1A47A 3D0VA 3KVQA 4ZSOE 1I1CA 1K6QH 3PJSA 3B9AA 1DQLL 3MRFB 3RTQA 1EERB 2NW3B 2ENSA 4JREC 1O5DT 4UU9A 3VWJA 5IIEB 1RU9H 3GSNL 5AZEL 5K9QG 4LKCA 4MVBD 3WIFA 4P23A 1ZS8A 2VDQL 2H32B 1U6AH 2YC1B 4HJJH 1YUHB 4A6YA 3QEUA 3U7YL 3FO9A 4LHUD 3WLBA 4G8GA 1U41A 4M7JH 1CLZL 4JM2F 4Z7WE 1GHFH 4PJGF 3TO4D 3BPNC 3R4DA 4Z7VB 5C71A 4PTTB 2X1PA 3MNVA 1RJLA 1A6ZA 2X4QB 1WK0A 4WCYL 3GSXB 5CILL 4M61A 1A2YA 1YMHB 2SEBA 3ULVL 1YY8B 2D2OA 2YD3A 1MCDA 2YXMA 3ILQC 5JORB 4E41B 3IDYC 1FNGB 4ZDHB 5DRXA 1NGWB 3DX8B 4NOBA 3QO0A 3VWKC 3QQNA 1YEDA 5DSCA 3HPJA 4RRPG 3EGSB 4IRZL 4KJYB 2R1XB 5E2WL 2G9HB 3ZYIA 3CX5K 1JJUA 4PGBA 5E2UL 3T04D 2GK0B 4KMTH 1FVEA 1RZGB 4YBLC 3SDDA 5D72L 5LXGL 4UNUA 2KH2B 3U4AA 3NZ8A 5CHNB 3T1FA 1UQSB 4ONFL 4DQOL 1KXVC 1U8KB 4CN1A 1QLEH 2HKHH 4R4BB 3RX7A 3QUXA 1ZANH 5HGDB 4ORGA 4X5LA 1Y6MR 3KPPB 4GUPA 4YH6A 1BFSA 2BOCB 5E9DD 3ARDC 5FM5O 4QRRA 1WV7T 3QH3A 4FTVA 4MA7L 3S3PA 4XMLL 5D1ZC 1M6OA 4PJEE 4F33A 2A6DA 1DVFB 1MHHB 3E3QC 5IF0A 2BY2A 3IDIB 5HYFA 1KN2H 2P8LA 2FBOJ 3MJ9L 5T1KD 3S4SG 4PV9B 3MSPA 4ZSOA 4L8DA 5T5FL 4QOKD 4YGVA 5FIEA 1F3RB 3PJSB 4LVOB 5JNYA 4YK4B 5JQHC 1MCHA 4WHYG 4PTUA 5IJVA 3B9KD 5HYEA 4LKCB 2I26N 3WIFB 1ZS8B 4GAJL 1XF4A 1XIWA 1PYWA 3DIFB 4G8GB 5HHOA 2V5YA 1KEML 2OL3L 5FDWA 2EICA 4WHTA 2XZQH 3FB8B 4UI2A 2C3GA 2VXQL 3TM6A 1S7WA 4RQQA 4PS4H 3MNZB 1UKSA 4LLYB 2I9LB 3LN5B 2HFEB 4Y5VB 1A6TB 3BESR 2IMMA 5D8JL 1TNMA 3H9SB 3LS4H 1S7UB 1QFWI 3KDMA 4AIZA 2AV7A 4YIQA 4GSDH 1OGAB 5HHPA 3O4LA 4OIBA 4OCSL 2BCKB 2P5EA 4HUNB 4PJDB 2GJJA 4QHKI 3HE6C 2Z91A 4HJGB 3BKYL 5GZNC 5AWNH 1CXIA 4TN9A 4PRHB 5ISZA 3GSOA 1CGSL 3QO0B 2WNGA 4K3GA 4RGOH 5F97E 4YHZL 3T4YA 5DSCB 4TTDC 3RWEB 5FYKH 2CK0L 2DQGL 3IFOA 3QNZB 4E41D 1UJTA 3QIBC 1CXFA 3CFIC 1N6QL 1FVEB 4OFYD 3SDDB 4C59B 4CJ1A 3JXAA 1YNTA 3L6FA 3ZDXE 2WWKO 4OLXL 3MJ8A 3NZ8B 3T1FB 2W0KA 3CLEL 3MA7A 4PRIA 2FL5B 5IK3B 1EMTH 3RVUD 1J87A 3MUHL 3QUXB 2HVJA 2NLJA 3BD4A 1YYLL 5INDB 1U8OB 3D5OF 4GW4B 4F7TB 3V6OE 3ESUF 2NY0C 2LTQB 3TBYA 3S4SA 3W9EA 2R23B 5I1JH 5GGSB 4HK0B 3PGFH 2E27H 4ZNEE 3LKRB 1U58B 1M1SA 1M6OB 2HTKD 3N1MC 3LMJH 4XPAL 3ROLA 1U2CA 4LNRA 4AJ0A 2X4RB 5ENWA 3W11D 5DHXB 1RZJH 4ZSOB 4HH8A 1D7FA 4EVNB 4L8DB 2Q8AH 2ADGA 5KVGL 2LQRA 5LBSH 4XNYL 3MRPA 5JZ7C 2BVOA 2I5YL 1KJVA 4JHWH 1DVFD 5SX4H 5C0BE 4A2LA 4HXBL 4PTUB 5IMMB 1KCVL 3QAZC 3ARGD 4JFQB 5F3HA 4OV5A 1OB1B 2EE6A 4JN1L 4Z7WB 2RB8A 3NPSC 4ERSL 4LF3B 4EI5C 3B5TA 4PP1D 4EQ2A 5IHZB 1S7WB 3ARDA 4YWGH 5JTWA 1JWUA 4OCYL 1I3RA 3WSQL 1PZUB 1VGEL 5D1ZA 4G8GD 1GOGA 1RZ7L 5A40E 3LKQA 2E6PA 2ZOLB 4OLZL 3I9GH 2O5YH 4YNYB 5J6HA 3KNBA 2ZP0T 4BUHA 3E2HB 4PJ8A 4U1JA 4AIZB 1N3NB 1XGQA 5FAAA 1WICA 3UJJH 5HHPB 4YHPA 4NO0B 4LCYB 2JCCE 3GZKA 1CYGA 1CFVH 1UC6A 3H9SD 4HIEA 4NN6B 4GMTL 1WSST 4X9FA 2IH3B 3X11A 2NMSA 5GJTL 4YHKH 1OGAD 1N59B 4FXGA 4JO4H 4X5XB 4KROB 1VFAA 3JUYA 2IALA 3U9PH 1GSMA 1PG7L 4R8WL 4PRHD 4J2XA 3LKSB 4F58L 1JYNA 2BVUA 1YNTB 1BF2A 5GGRB 1V8HA 4PJCE 2VWEC 1TPXC 1KIPB 2P5WA 3X12B 3K1KC 2JELH 3L3KB 1YECL 3SDDD 4XC3L 1YZZA 2R1YB 3V6OA 4F3FA 4QHKJ 1CFTB 5ADOL 1J10A 3HE6A 1RJZB 3LDBC 1KTDB 5D7IF 4ZNEA 5ERWB 1CIDA 5F7MC 5A3ID 4PJEB 4GG6F 3QUXD 2HA1A 3NOIA 3VXTA 1PFCA 3OG4B 3CSYB 2NYYC 5EPMA 4FHBD 1J9CT 4ODSH 5GGVL 4AG4L 3QIBA 2ICWI 1KJVB 2NY6B 4BYHA 1I9RL 3B4NA 3Q6GH 5C0CE 2EDXA 1O7VA 5I9QC 3STBA 3RL1B 4L3EA 3ZYOA 3MRGA 4HDIA 4OV5B 4FQ1H 3FFCE 4G8FA 3G5VB 5HVHC 2IQ9L 3HC0A 5L8KB 3O8XC 2GITA 3O6FC 4YFLI 2FBJH 4PRDA 4WJ5B 3P4LA 1EGJH 5A43C 4L4TA 1RVFH 3RVWD 3BQUB 4NNYA 1YY9C 1I3RB 2FNBA 3CJJA 3V4PL 3UJIH 1LQSR 3FFDB 2H2SD 2R0ZH 5TE4L 2DLIA 1VFBB 4U1JB 2H1PL 1XGQB 5DUBA 4JVPA 1AGFA 3O3EA 4I18A 2JCCA 1G6RH 3S36X 3NCCB 2XYCA 5KW9L 1KB5H 3IKCB 3GI9H 5C0FA 3EUUA 1A7QL 5E1AA 3W81A 5KSBE 2X1QA 5LAXB 1T2QL 5EU3A 4I9WE 4PLOB 4NO0D 2B5IC 4U7MA 1HIML 4BFBD 4PGEA 1N8ZB 2K1MA 1MWAH 3SKJH 4EI5A 3N1FC 4YBHA 1EHLH 1A6UL 1ZT1A 4PJCA 1KC5H 5CGYD 4KROD 3UZVB 1GGCL 1MVUA 3KPSE 4PJGE 1G1CA 2R0WH 4OQTA 4QYOA 2NY4B 1AR1C 5I8CA 3RU8H 1NBYA 3ESVF 3FONA 3PP4H 1N64L 3VXME 2V5TA 3GK8H 1OP9A 3MBXL 5I1AB 4PRBB 3GO1H 5L0QC 1VEMA 2IPUG 4RIRA 3VG0L 5K93A 3L5XL 5CMAA 3H3PL 1E6JH 5EPMB 3C08L 1DANT 4IBLT 5D7LE 4X7SH 4YHYB 1JPTL 3MZGB 5C0BB 5GPRA 2AJSL 3BN9D 1BQHA 2NY7H 2EIDA 4EEEA 3MACL 1HN1A 1KTLA 5IFJA 1SEBA 3FFCA 1P4BH 3NACH 5HYSG 4JFOA 5GGVY 2WWKT 2AXFB 1I9JL 3BW9A 2NY6D 5D2LF 1HI6A 1HKFA 5TF0A 1KCSH 5DJ0A 4F57H 3G6JF 1JV5B 4JKPH 3NCEB 2YUWA 2A73A 3CU7A 3DURB 3QJFA 4FFVC 3BMWA 3U36A 4ETQA 3NFSH 1PZ5A 2ZSWA 2VIRB 4K3HA 1OP5H 5CIPB 1T7YA 2VR9A 4MQ7B 1NCDH 4GXUN 1IT9L 1REIA 1AGFB 5C1MB 3BQUD 2NY1C 4HX1A 4OBRA 4EN3C 4PGDA 5HJ3B 2JCCB 2ICWJ 1LE9A 1TJIH 3HUJE 1EJOL 3A0OA 3VI3F 2E6JA 3PWUB 5DQDH 3VXNB 1GAFL 5KSBA 3BKJH 4ZO7A 4TUKH 4OFVA 4TPRL 1NAMA 2DL9A 2FHCA 5E5MB 4QHNA 3P4MA 3O8XA 4XMPL 2W65B 3C6LA 3O6FA 3OKMB 4G8EA 2W0LA 5DVLA 1U91A 3RWIA 4ZG1A 1AGCB 1T04A 1WF5A 2AW2A 2GK2A 1T1XA 3IJSB 1NKRA 4PJCB 1UH3A 3T3PF 2BVYA 3C5SA 5I73C 3HPLA 3ARTA 3NFPB 3QQ3A 3JV6B 3BX7C 1A7BA 4XP4H 3V0VB 3KPSA 2A2QT 3BP7A 5EZJB 4QYOB 4HEPG 2HMIC 4Y16A 3BMVA 5I8CB 1W72L 1R3IH 1OTTD 2VQ1B 3MGAA 1MFCH 3OJ2C 4OUUB 4S1DC 5JIHA 4QGYA 4JY4B 2H3NA 4HG4J 2EZ0C 4RIRB 4RCAA 4W6WB 4FQIH 4P5TC 2NY4D 1F3JA 3OXSA 5TE7L 5D7LA 3CFDA 4NN5C 5HGHA 3NZHL 4OI9A 3F7RA 3P73A 2NTFA 4TSCH 1JRHH 5C0CB 3V6BR 4TVPD 1CLOH 1D9KC 4M1CD 3UZEA 5E94A 4ODBD 5GGQH 1HILA 1N26A 3ME0A 5I19L 3FFCB 1CK0L 5MP6L 4CN6A 3K4ZA 4JFOB 1X4ZA 2Y06L 3GEWB 3TFKC 2X40A 2NZ9C 4F2MA 1AY1H 2EEDA 5C0BD 5LCVH 4J3TA 1I8MB 4PRNB 4PB0L 4GRLA 2DTSA 1UEYA 3M07A 5FFLA 3U36B 4DEPB 5IVZA 3VRJB 3UC0H 1PZ5B 3VRLF 4HUWA 4JR9L 1A7OH 5LJYH 1I3GL 2XKNA 1S3KH 2EDHA 2GEEA 4HUXA 5H8DA 5IB1A 3IDUA 3KYKH 4KFZC 4ODVH 1EH9A 1KB9K 3QISA 4G6ML 3HUJA 4BKLB 1DQQA 4ZFFB 3BUTA 2DWDA 1R5VA 5KSBB 3ULUE 3P77B 4N9GA 2E7HA 5DC9B 4XPBH 4MA1C 3X13A 3F58H 1AH1A 1NBVH 3C8DA 1I9IH 5AG9A 3BPCB 2KDGA 1OAQL 2HJLB 2HYMA 4KXZH 3U83A 4HSQA 3NAAH 2ZKHL 5D71L 4O2FA 5E5UB 3HPLB 4JHBA 1MCNA 3QXAA 1T20B 2ATKA 1J12A 5J12C 4JM2B 1CR9H 2Q86B 3KPSB 4OGXH 5FOBB 4PJGB 1A4JA 3OGOE 3WBDA 2HH0H 5BMFL 3NIDF 5I1IL 5IG7B 1MFEL 5CD5D 3OBAA 4Y16B 4EN3A 1QLFB 4L1DA 5DJ2A 3VFSB 3QDME 3PGCA 4KY1L 3VGAC 3VXMB 3FB5B 2OTWB 5BOZG 5BZDA 4L9LA 2Q20A 2YWZA 1QEWA 4IMLA 3QEHA 3KWWA 3TT1L 1F3JB 1MIMH 2YN3A 1R24A 3SKNB 5D7LB 3CFDB 4QCIA 3MJGX 4RBPH 4YUEH 2BNQA 4OD1H 4BQ9A 5F71A 3QG7L 2IGFL 2EEAA 4UBDD 5C09E 5HYSB 1OT2A 1WZMA 1I7ZB 4G3YH 1U8HB 4CBPA 2DD8L 5ESQA 1F6AB 1S5HA 5I74B 4APQA 2GJZA 4X9IA 5C0CD 1TTGA 2APFA 3BVNA 4GRLB 1BJ1H 1IEBB 2HJFB 3G6AA 3MRKA 1OM3H 1DSFL 2APBA 1MLBA 1ETZB 3FFCD 4WI6A 2X41A 6FABL 4HUWB 4MMXC 5H35B 2JJUA 1BAFL 4AIXA 4YHNA 5F1NA 4B53A 1YDPA 5I17B 4YEEA 1R5IA 5IB1B 4XP1H 1IAOB 4IIQC 1RY7B 2ZWLT 1LEIB 1VEOA 2F19L 1FYHB 2J8UA 4YFEA 4QRTA 3HUJB 5DRZA 3WIIL 4GG6E 1YNLL 4K3EH 1D9KA 4KKLD 3KPLB 1R5VB 1T7VA 4MVBC 1UH2A 4NZRL 1DQDH 4JG1H 2HRLA 1PY9A 4X7EC 4N9GB 3FT3B 4LPTA 3U7WL 1N7MH 4ELME 4MHHG 3X13B 4WV1A 3WFBL 1K8DA 5HHNA 2RFXA 1OW0C 3V6FA 4OZHE 4H25A 3UYRL 4I9WD 4S2SA 2L7JA 1ZLSH 2ATKB 1A14L 1JI1A 5C0DA 1RUQL 4X4ME 5DFWH 4ZFZA 1A4JB 4YFLF 3WN5C 3SOBH 4ONHB 3WKMH 1G9NH 3QRFM 1NH6A 4M6ML 1UKTA 3FHAA 5DJ2B 3I02A 1LDPL 1Q9LB 4TNVF 4GXVH 2DBJA 5FA3B 5BZDB 3D1MC 4JM2D 4L9LB 3KPSD 5F88A 4MJIE 4XCFL 3I85A 4IMLB 1JHLH 3QEHB 4K7FB 3WFHA 2CUIA 4QHMA 4OBSA 4KZDL 4ONOA 4ZUUA 4Y16D 2XWBA 4ZMAT 3MLVH 5IBUG 3VXMD 2E9WA 5GRJH 1XF3A 4YAQA 2OYPA 4MD0A 1X4YA 4OI7A 4PLJD 4XPTL 2MTPA 3HE7B 4R0LC 5I30L 3PL6A 4QRQB 5C0JA 1OD9A 3DSFH 4APQB 1QUNA 2GJZB 3DRTA 3MGOB 5IROC 3BWUC 4ZFGL 4XT1C 4JPVL 1RZIB 1U8JA 2WSKA 3MRKB 3LPGA 3QJHA 5DD3H 5F7FA 4MB3A 4JLRA 2FJGA 2R4RL 3SHSA 2W91A 1SQ2N 5JXAL 4X6FB 3DJ9A 4RGMB 3TVMB 1YDPB 1CD8A 4GRLD 3WJJC 4GLRI 3A6BH 3BHBB 3EDJA 2I07A 2XKSA 2VXSH 4QRTB 1EX0A 5DRZB 4DWHA 1X5IA 1OAUL 4LBEA 1FPTH 2DJSA 2FYYB 1SY6L 1CGWA 7FABH 4I3RL 4ZFOA 1FFPA 2W0FA 1ZHNA 3E8UH 3WHXA 1UYWL 3DXAA 4WV1B 1K8DB 2YEZA 3WXWL 3WV0A 2D03H 3CXHK 4OZHA 4HQQL 1LD9A 2VR5A 2IAMC 4H25B 2RHEA 3BUYA 1BBJA 1VPOL 5C07A 3HRZA 3EFFA 1YEKH 1QG3A 5DMIH 1PJ9A 1J0HA 1XH3A 3PWPA 3DROA 1WZ1L 4I0PB 4NUGL 2ESVE 5F72S 3N50A 4TUOA 4IIQA 3BD5A 4XVUC 3D69A 3G6JE 4KJPC 3BZEB 3QDMB 1KCRH 1XCTB 3QBTB 4FZEL 1Q72H 4XCNA 3SPVA 4L8BA 2VRAA 3SEPA 4QHMB 1JPGA 2UY7A 3NFNA 1L9MA 4XAWH 4ZUUB 4CVWA 3EYOA 4TNWK 1ZGLP 1Z9OA 1OW0A 3VI3E 5DD5H 5T3XL 4YAQB 3NABL 5C09B 1FZJA 2MJWA 4G6FB 1ZSDA 2HFFA 4H0IA 4LEXL 1OAKH 3Q5YA 3PL6B 3K74B 1YEGH 2MHAA 4IOFD 4YO0B 2Q8BL 2D7MA 5HI4D 3TGXA 4AYFA 5J11C 1U8PA 5I15H 5H94B 3DRTB 1UWEH 1L7TL 4XWOC 4JHZA 1UM5H 4JN2B 4QWWD 4RNRB 3T3PE 3HE7D 1DBJH 4KKAC 2C1OA 3O41A 4APQD 2VE6A 4O51A 4RGNE 1FNLA 5J13C 1RK1B 5F21B 2CIKA 3AY4C 3L5WA 3MUJA 4K9EH 2Q87A 1INQB 1EV2E 2AJYH 4XNMA 5CJ8A 3RWHA 3DVGB 4MXQD 1DVFC 3B9DA 4GG6B 2NR6D 3D85A 3L3GA 4U7SA 1FZKB 1CD1B 4M4RA 3TVMD 3ARGC 4P2RA 3OTTA 3OPZH 4P4RA 1SVZA 5T33H 4R0LA 1V5JA 4ELMB 2W0FB 1U8MA 4LVOC 5DHVB 4HZLB 2PNDA 1BWMA 4OFDA 3LN4B 3N85H 4OLWL 2AJUH 4OD3L 3PABA 4OZHB 1LD9B 3VGFA 3ULUD 1RMFH 1WIUA 3AS0A 2O93L 1BBJB 3MGTA 3VFVA 1F4YH 1HYSC 4LSTH 4KU1A 5T5NF 3DROB 1ZV5A 3PE9A 4H20H 5E8DH 3AGVA 5J1TC 5JHLH 3D3VA 4TUOB 5D1QB 3LRSA 5J4MA 1AD9A 3TO2B 2VAAA 4LLQB 1GOFA 4ODTL 2BC4B 4W81A 4XWGH 1NUFA 5IBUB 4XCNB 3H7BA 1KJMA 4MJIB 3A6CL 4I0PD 5GQBA 1JPGB 2Q1EA 3NFNB 1CE1L 4OCMC 1T7WA 1JNJA 3QDMD 3L3IB 5ANME 3HAEG 1JHKL 1M7XA 2BHZA 4L29B 3CXDH 4RAUB 4U0QB 3SCMC 4JVWA 2UZXB 4FFYL 1FZJB 2IAMA 1ZSDB 3QNYB 4JFPA 3MRIB 3LH2H 4EUPA 3MR9B 5FUZL 3G5ZA 4EDXA 4TRPL 2MHAB 1ZLUH 4J4PA 4C54A 1OF2A 1U8PB 5H2BB 5C09D 3HMWL 1AQDA 4G6FD 3HI1A 1UB6B 5CJQH 4C57C 2HJKA 2EYSB 4LDEB 3SGEI 4K2UL 5T3ZE 5A3IC 3GMQB 3PL6D 2BNUA 4UT7H 3EOYG 2VE6B 4O51B 3FO2B 4GKNB 2YK1H 4HS8L 2VH5L 5DD6A 4ZUTA 3NIDE 4OF5A 5JW3L 1WFNA 2DOCA 5DEGA 1PY4A 4QRSA 5IHLB 4JFZH 2AK4E 1G7QB 2CIKB 4Q97A 5DJDA 4Q58C 2EXWD 4XNMB 4NQEE 3RWHB 1P4IL 1MELA 3E6FB 4DGYH 4FZ8H 1VDGA 4X5WB 2MOVA 4KJWC 3BRFA 4LK4A 3RA7H 1YJDL 4ZUSA 3WDHA 4P57B 2Y5EA 1Q94A 1HHKB 1MIEL 1JWSB 2EH8L 5E0QA 5C0GA 1U8MB 5C3LD 5L88H 2ICEB 1R5WB 2DMCA 3PABB 4OM0H 4UT6H 1A6VH 5B39G 4YDIL 3UDWC 1TIUA 4Y7MA 1Q9OB 2YN5A 1RUPH 3MGTB 4TQEH 4JM4L 32C2B 2G75B 3G6DH 2AERT 2ESVB 2YR3A 4JB9H 4AK1A 2WIIB 4LARH 4YX2L 3G6JB 3AY4A 4PJXF 3TBVA 2OM5A 4NQCE 2VAAB 5E08H 4OCXL 2Q7YA 1IMHC 1H3PL 4FXKA 5DQJA 1INDL 2GY7B 3H7BB 1KJMB 5C0EA 4L8CB 3SY0B 3QUZB 1LO5A 4G9FA 5D1QD 3VH8G 1V7NH 3HMXH 4IDLA 1CQKA 4S1RL 5I1KL 5ANMA 5ESVA 2APWA 5EBMB 2PTUA 2DKUA 3X17A 1CGVA 4HMCA 2BY3A 5HDQH 2FX8L 3P0YH 5I1CH 4MJID 5GS0C 1FBIH 2F8VA 3MLTA 1KV3A 4LMQI 3QHTC 3IVKA 3EOTL 3DGCR 4QNPF 1Z0MA 5SX5H 3T77A 5I2IA 4YR6A 43CAA 2R1WA 2JTDA 1JF5A 1K2DB 2ADFL 2FO4A 3RVXD 2GT9B 2HG5A 2XTLA 3VXRA 5DD1L 1X5FA 2WZPD 2A9NL 5CJOL 2EKJA 3UZQA 1QQDA 2BNUB 1TQBB 2HKFH 4NWUL 1MCOH 2V6HA 5ID1A 2X4UB 3CSGA 2VLME 4RGNB 1WBZB 4X6DA 5DD6B 1DL7H 2EIBA 3D87B 4LEOB 3QEGL 1F90H 4YDVA 2AK4A 1H15B 5A2JH 3FQTB 3SCMA 1UZ8B 1OAXL 2OJZL 3KGRA 4MLIA 1BIIB 5D1XC 4MJ6A 1R0AH 5HI5C 4YHLL 4LOUD 2VDMH 1I1AB 1CFQA 4YGAB 1C12A 1DQLH 1X6NA 3O4OB 1E4WL 4EXPX 4U6HB 1FFQA 5B39A 1U3JA 4ZO8A 2J3SA 3RNKA 3GSNH 5C0IA 2ATPB 5DJXA 4LU5L 4D9QE 2N4IA 3VD3A 2VDQH 1ZTXL 3U7YH 3MRNA 1CLZH 1HQ4B 3KS0J 2BSED 4NBZB 1NC2A 1FN4A 4XHQA 4FP8L 3BZ4A 4Z7OF 1KPUB 3PWNB 5TGBA 4D0DB 3ZYJA 2Z4QB 1W0YT 3AMKA 1TZHB 4XBEL 5CILH 4IRSB 1FFOA 2A6JB 4YQXL 3ULVH 3HAEB