3LZFH

Crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
224
structure length
216
Chain Sequence
VQLVESGPALVKPTQTLTLTCSFSGFSLSTSGMSVSWIRQPPGKALEWLALIDWDDDTYYITYSSSLKTRLTISKDTSKSQVVLTMTNMDPVDTATYYCARTLRVSGDYVRDFDLWGRGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin, HA1 Subunit
publication title Structural basis of preexisting immunity to the 2009 H1N1 pandemic influenza virus.
pubmed doi rcsb
source organism Influenza a virus
total genus 38
structure length 216
sequence length 224
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lzfH01
3HI6L 2GTWB 1QRNB 3KYMB 4UILL 4R90L 5I1AA 1LK2B 5FHAH 2DLEA 1EH9A 5HDQH 2HRLA 2E3VA 1T89A 3MGOB 2PR4H 2VAJA 4RIRA 3WSQH 3BRFA 2VXTL 4F9LC 2X4PA 4QYOA 3B9KD 3MLXH 2HMID 3I6GA 3MLVH 4LVOC 3MODH 4HD9A 4YHMH 5MEQA 2I07B 5IM7A 4DK3A 4G43A 5BMFH 5EULV 1EIBA 1CFTA 1PLGL 2Z31D 4Z77A 5IOPB 3QUMB 3Q1SH 1WCQA 2EECA 5C0CE 4BK4A 4QF1A 3QA3B 4FFVD 3GJFB 1C5CH 2LQRA 1S7TA 4ZFOA 5KVDH 4OM1H 5BRZB 3QXUA 5GRUH 4DZ8B 3RVVC 1K5NB 1KIPA 4F7CB 3ULVL 1YYMH 1ZA6A 4H1LG 1MPAH 2QJDA 1N3NB 4DKEL 5SWQA 2VLJD 4PJ5D 1UXWB 1FJ1A 1FFQA 3IDGB 4UV7L 4F58H 5F72S 1UKSA 1FRGL 2DQUH 1XR8A 1BQLH 1ZGLA 2DAVA 5I15H 4NO5B 2QSQA 4DVRL 5HHPB 1KV3A 1YNKH 2CDEA 3B2UD 4N0FA 1R3LA 1PY9A 2J7LA 4Z7UB 5HYJE 4GRLD 4OLXL 4EN3A 4XVTL 2HWZL 2B1HH 1JNLL 5DMGD 3MUZ1 4L8SA 1QO3A 3L3JB 1CGSL 2G75B 1A6TB 1NBVH 2PTTB 4H0IA 5JW4R 1CDUA 5MEPB 5IQ7L 3G5YB 4UTBH 1KBGL 2VXSH 4EI6B 1OF2A 4Y5VC 3LEVL 3X17A 1ZEAL 1YY9C 3GSQB 4OF8A 1KGCD 1YN7B 5DUBA 4Z95L 4I48B 3QDJA 1Q72H 1MFBH 4YXHL 4UT9H 4JHBA 3OKDA 1WEJH 1KCVL 3WS3B 4ZDHA 4U0QB 1KCSH 2YUWA 5HTSA 1K9TA 4P4KD 1K2DB 1UKTA 4MQXD 3CFKB 2LAGB 3O4OB 3G04A 2ZPKH 4I18C 2Y1VA 1DQLL 4K7PH 4KUCF 1CZ8H 5F9OH 3UO1L 1KYOK 3FO2A 4K71C 1WITA 3IAQA 3FAWA 4PJ7E 3BRGC 3BGAA 5I19H 1NAMB 5FHBH 5C08D 1L9MA 2CGRL 5C0GA 2NY4B 4ZNEE 3B9VA 4XI5D 1IGCH 2WWMD 3F8UB 3G9AB 5DJXB 4WWID 4WRLA 4GW5A 3AMKA 3PL6A 2PW1A 3MO1A 4KRNA 1MAML 1YEDB 1EEYB 2ADJA 4JFOB 1FL3B 4Y4FA 3T77B 1WTLA 3OKMB 3X11A 5KSAB 2DM4A 3K0WA 5CP3H 3O6KH 3BGFC 4ZXBB 4M5ZL 3MRBB 1NAKH 3DUUB 3U0PA 5CZXC 3NZHL 4NUJA 3U83A 3GSOA 4GQPH 3BZEA 15C8H 4NWUL 4RMWA 2P48B 5I9QC 1NEUA 2G9HB 5HPMA 1YJDL 3ZDZF 3UTZB 1JPSH 1RUAL 3WXWL 3G08B 5C0RL 2XFXA 3QXWA 4AH2A 5EIIA 3N9GL 4DW2H 3GUTA 4XPTH 1KJVA 3U9PL 4MWFA 3KPRE 3SGKA 2Q86A 1OSPH 3REVA 2C3VB 4Q9BA 1OGAD 1TJIL 2QQNH 2WUCH 4YFDB 5IB1A 3MA7A 5GGVL 1OQOA 4LKCA 4BZYA 5FYLD 4HUWA 5F7UA 5E8NA 4JB9H 4MGXA 2YRZA 5JPNB 4EUPH 1RJZA 2EEBA 3W5MA 1PAMA 4OBSA 4P46B 2GFBB 4D3CL 5H8DA 5TQ0H 4F9LA 2AABH 4ZUWA 4WHTA 5F7DA 5ENWA 3OJDB 5DYOB 4F7TB 4WI9A 1KIUA 4NO0D 3LB6C 5JORB 3NH7H 3RWIA 2W9DH 4AL8H 1Z5LB 5IEHB 3JUZA 1UQSA 3P3YA 1Q9WA 5D2NB 3V9FA 3KLHC 3LPWA 2X09A 4XCYB 2VXVL 4TTDD 4KZEH 1FFNA 2NY6D 1NFDB 3UTSD 4KJQC 4KC3B 3VI3F 5I1HH 3DBXB 1V7ML 35C8H 2J88L 1UCBH 1HZHL 1KN4H 3VFTA 3VWJD 3Q3GB 5IK3B 3KPSD 2NX5E 3T04D 3VXRE 1U3HC 3V6ZA 2LAAA 4XX1G 1OAYL 3CZJA 2XZAL 4POUB 2OJEA 4KQ3L 4WFFE 5HHMD 3VXMA 5DO2D 4JFFA 5ICZB 5E6IB 1I8IA 2EDLA 3EYOB 5DVOA 3W0WA 4FQJL 3HB3D 1OOAA 1QBML 5TE6H 3MRMB 5GZND 1IC7H 3NIFE 1E4WH 2GIYA 4WEMB 4L1HA 1XAUA 4PJCA 4EDXB 2BOCA 4GKNB 5EN2B 3MV7D 4LSRL 3SJVE 1CK0H 1PYWB 3QIUB 1OAUL 1UWEL 3HFMH 3G6AA 1BZQK 1J8HE 2XN9A 1AE6H 4FQ2L 2JJSA 2XZCL 1ZLWH 1GOHA 2ZWLT 4M93C 4Y1AE 4NM4L 2HJFB 4OLYH 5ID1A 1I1YB 5KSBA 3GKWH 1DL7L 4Y5VA 4AEIH 4JZNA 3M45A 4YDIL 1XGTA 1AGEA 3VWKB 2FJHA 2DQCL 4MXVE 4NNPL 5EBLB 1N5YL 4FNLL 2K3TA 4XP9H 3VI4F 1MCOH 3VXUE 1ZK9A 5F1SA 4TVPD 1IGFH 4S1SL 2X41A 3MRLB 1NCAH 3HC3H 3T09A 1EGJH 2VDPL 3RIAF 4Q97A 4HWEL 2WK2A 4JFXB 4KTEL 4AEEA 3PHOB 3QQ4B 1PSKL 1AXTH 2P43B 2AI0L 2JF1A 4LOUC 4MXQC 2CKBH 2BK8A 1X4XA 4MCZA 1HEZB 4I18A 1MCPL 4NGHL 2H26B 4L8BB 1CLCA 2HFTA 3TV3H 2CIKB 3WE6A 3HI6H 4KI5E 3U4AA 1KNOB 4UILH 4R90H 4Y4KC 3MCKA 4Z7VF 4CU8A 4HIJA 4KKCC 4FXKB 3UTOA 1XIWC 2C5DC 2VXTH 2UUDH 3C8KA 3RRQA 2BY0A 1T04B 4OB5L 4J3UA 1JHLL 1I7RA 2YPLB 2PYFA 43CAA 5EC2B 1PLGH 4KMQA 4KH2A 5FO7B 1RZGA 2VZ3A 2NY5L 7FABL 2BC4B 1RIVL 4GW1B 4NRXB 3OKEA 1MRCL 2X4UB 4RBPH 1DQQA 3S36L 1OD7A 5DJYB 5HYSA 3FQUA 3ULVH 4M48L 1HYSD 3SDDB 5MEND 2VH5L 2VITA 4AT6B 1B90A 5L8LB 4U31A 4Q6IC 4I0PD 1H5BC 2DM2A 2APVA 4DKEH 5DF0A 1HXMA 1FGVL 2DKUA 5BW7C 1SMOA 5J3HC 4POZC 2HTLD 4HG4J 3MLSL 2A77L 2ENYA 4UV7H 3MYZA 1AGDA 3M8OL 4PJXF 5DS8A 1FRGH 3IDNB 5CD3B 1KULA 2F9BT 1XF2B 4PJHF 1CDYA 4C58B 1JZ8A 1S7QA 4DVRH 2X89A 1TZGL 4X8JB 1U3ZA 1FL6A 4LVHB 3DRQB 4PRIB 1C16A 4HCRA 1UZ8B 1RIUL 4JKWA 4JQXC 4OLXH 4XVTH 2HWZH 2C7UA 4K7FB 2DJ4A 4JFEA 5C0BB 4HMCA 4IRZL 1JNLH 2EXYD 4I4WA 5AWNL 3STLB 2C4FT 3VE0B 3VXTB 3ZKXB 1NGYB 4OUUB 5IQ7H 5CZKA 1KBGH 4IRSA 3F5WB 4BH8B 5IHZB 4ODXA 4M00A 5EO0B 3RWFA 5I16A 3ARDB 3LEVH 3LKOB 5EG6C 1VERA 1ZEAH 5EBWA 3O9WD 1H0DB 1ZSDB 5LGJA 3O6FC 5AZ2L 4PR5B 1RJYB 3G5VA 2QQKL 4EI5B 2V2WB 4Z95H 3QWRA 1X44A 4IOFD 4YXHH 1CDJA 4KROD 1Z2KA 5KSUA 5DA0B 2OR7A 3HE7D 5T3ZL 1KCVH 4JPWL 3ARGD 3ARFD 3ZT5A 1G7HA 2WBWB 1JWUB 3V6BR 2NY2D 3VJ6A 2AK4D 3UYOD 1U3YA 1DQLH 2GQHA 4NZTL 3UO1H 4CNIA 1AH1A 3EFFA 2OL3A 5E7BA 3D0LA 1KJ3L 4LLYB 5K9KA 3RIAK 4P48A 3UX9B 5HHQA 5ALBL 1OWRM 1M7IA 2R2BA 5I1DA 2CGRH 4NN6B 2XA8L 4GUPB 1U3HA 3E2HC 4L8DA 3CX5J 3SQOL 1F58L 4LVNB 3TBTA 5LAXB 3WHXB 4Q0XL 1PGRB 2I24N 5C0CA 2IAMB 4G9FB 5DZOA 2FSEB 1PKQE 1U8NA 2Q7YA 2V17L 4NQEA 4WFHD 2YOCA 5DXWA 1GZPA 4LEXL 4XH2B 1MAMH 1JUFA 1EUTA 3UAJD 3P2TA 4DFIA 2G2RB 3U30C 4N8VA 4YEFA 1JPTL 4GRWH 4X9IA 2YRLA 2NPLX 4M5ZH 1SQ2N 5I8OL 3NZHH 2EXWD 4LP5A 5CD5D 2VLRD 3RY5A 3W2DL 4G6FB 4ERSL 1U8HA 3QDMB 3O11A 2R1WB 2F5BL 2GKIA 4XVUC 5ERWB 1YC7A 1T1ZA 1NUGA 4EXPX 3IDIA 3SKNB 1YJDH 3HI1A 1QP1A 1RUAH 3F58L 3VXOB 4PGCA 3WXWH 3QDAA 5C0RH 1CD8A 3N9GH 1IM3B 4NYLB 5E8OB 3U9PH 4ZUUA 3OJ2C 4HBQA 4QHMB 5JXED 1QFPA 1MCQA 4D8PA 1OP3H 4P2RB 3IKKA 5IW1A 1TJIH 3HC4L 2F15A 4PGBB 5GGVH 1QNZL 3BGMA 2A6KA 5FYJU 5FYKD 5DJDA 4HSQA 5FKAA 1HOCB 5JHDD 3OKNB 4DVBA 3DXAE 1BQHG 4NT6A 3PDGA 1T2XA 3SDXE 3DETC 4QRPB 1E4XI 2EE2A 1VFBB 1MWAB 4JHAL 1UWXH 1WZMA 3RDTD 1XIWA 4UNUA 4D3CH 2E6QA 4G80A 3RTQD 4NKOA 3L3IA 5CJXC 1WIOA 2C1PB 3HMXL 3IS1X 4I3GA 1X6LA 3EO0A 3RKDD 4BSVA 4WU7A 3PABA 1ZA3A 2YXMA 3D3VE 1N8ZA 2GK2A 4JVWA 4XXCC 4KI5C 1FNEB 1I7TB 4PJ7A 3X14B 5J6GA 5HVGB 5IT2L 1Y0LB 2VXVH 4L4VE 3ZE0F 1AGBB 4JM4L 3VA2C 1IZJA 4HKXA 4L8CB 4ZNEA 2H2PC 4LAJH 1U58A 3UPCA 1V7MH 2X7LB 4LPUA 5EC1A 3T65B 3RI5K 3O2DL 2ZUTA 5HHOB 2J88H 1HZHH 3L3HA 4Q6IA 1ERNA 1EUUA 1H5BA 5IJVB 3V95A 2VLKD 4JLRA 1OAYH 1K85A 4CN4A 2XZAH 5I8CB 4KQ3H 3L6FB 1A6WL 1NANH 1S7UA 2EYRA 3PUCA 1S9YA 4P59L 2MMXA 2ZSWB 3PJSB 5DEGB 4NQXB 1A6ZA 3KPMA 1ZHBA 3U9UA 4FQJH 4IBLT 1QBMH 1CGWA 4KGJA 5ILTL 4K94L 3ES6A 1TFHA 2P1YA 2EE9A 4ODBD 1OAUH 1U8LB 1UWEH 4MAYA 4K3HA 4NKIL 4ZOCA 4RFOL 4FQ2H 5J89A 4RGMC 1JIBA 2XZCH 4NP4L 1VEOA 4Y4HA 3P4NA 4NM4H 2Z93B 4WO4A 1IGYA 1RUKL 5ISZA 1NMAL 3NFPA 2OX5A 5F71A 3UYPA 4NWTL 1DL7H 4S1DD 4BH7A 4CU7A 3ULUE 2E9WA 1NGPL 4YDIH 2UZIL 1KLUB 3O6FA 2DQCH 4NNPH 5TDPB 1FN4B 1N5YH 4IRJC 3TZVC 4FNLH 1NDMB 1F02I 1R5IB 4WFED 2NXZC 4S1SH 4N0CC 3W9DA 1HHHA 2XT1B 4NQDA 2VDPH 4HWEH 2LV4A 3QUYD 4KTEH 2P5ED 1PSKH 4ZG1A 5K9OB 2AI0H 1F4AA 4X9FA 4P4RB 3LH2L 2F5AL 1MCPH 2LTQC 5C09B 4NGHH 3D25B 5IB4B 1IBGL 3OKLA 3QJHA 5TF0A 1E4JA 4N90D 5FA3A 3V4UL 1UZ6E 1EEZA 1CD1B 2X9YA 1FAKT 3S37X 4HJ0C 3I75A 1P4IH 1G7MB 5J12C 1JZ7A 5SWSD 1YEHL 2OTWB 2J6EA 2YD6A 5F21B 3VFOB 3WDJA 5GGSY 4I0CC 1P84J 2P5WD 4PFEA 4KDWA 5D6CB 4OB5H 1FZKB 1JHLH 3KLSA 1S5HB 1DDHA 1IAKB 1WC7A 1K4CA 4U1HA 4Y2OA 2Z4QB 4EUPA 3QO1B 4Z7NE 1EFQA 4TULL 1UG9A 5J1AB 2NY5H 2VISB 3MJ8A 7FABH 4OKVB 1RIVH 4MXWL 1MOEA 2X70B 4YBLB 1MRCH 3S36H 3VGHA 3VXRA 1QBAA 4M48H 4HZLA 4KJQD 3I3BA 3QR2A 2VH5H 3MV9D 1JPFB 4U6VL 2NZ9C 1YDPB 3I84A 2C3WA 1FGVH 4XB7A 3OR6A 3MLSH 2Y7QA 1KXTB 2A77H 5CEZL 1YPZE 5D6DC 1JWSB 1C5DB 3QDGD 1AQDB 4G8FA 5EU4B 4AM0B 1TZGH 3G6JB 5ETUB 3N1PC 3KJ6L 1RIUH 3FQRB 4IRZH 5DJ0A 3T8XB 2VZUA 3LQZB 3QSKB 5AWNH 2ICWB 4Z7QF 4O2EA 1FBIL 5F9JB 2EDRA 1AKJA 1WSST 4P23D 2BVQB 5C0JB 5CGMA 3EDEA 3RBGA 5HYEA 4HULB 2A74A 3MFGB 4XNUL 2AXFA 2AJZA 1FFRA 5CJXA 2Y5TB 3FB6B 5AZ2H 2RIKA 3LIZL 4QRRB 3VRJB 2QQKH 2D9QB 5HYJD 1CXLA 5DK0A 1YZZA 4QGTA 4PJBF 5HYQA 1LD9A 4M7LL 5CJQL 5T3ZH 3A6BL 4XXCA 4JPWH 4I5BB 1QBBA 1FNGB 5H37H 1YJDC 1SY6L 3CFCL 5KSVA 3ZYZA 3D9AL 3VD4A 1DBJL 4MSWA 4N0UA 3DVGA 4NZTH 5HGHA 3MXVL 4TUJB 1JJUA 1KJ3H 1L6XA 4TSCL 4R0LB 3BAEH 5ALBH 4Y4KD 5I1IL 3DROB 2XA8H 4GG6F 4P2QB 4RAUB 2UWEE 2VDOL 3SQOH 1F58H 1RUPL 4H88L 4OZIF 4WTZA 4Q0XH 4BQ6A 3PP4L 2CO7B 2OTPA 5FO9B 4JFDD 4PY8I 2V17H 1I4FA 5KVEL 4WUUD 3CDGB 4LEXH 4MCYB 4XCNA 4YK4C 1J11A 4JM2D 3SCMB 2PYED 1W72L 5KS9F 2NMSA 4UOJA 1T5XB 1UVQB 5I8OH 1CFBA 3W2DH 4ERSH 5HHXL 1X5JA 5D70L 1OTTD 3LV3B 1I3VA 3CSBA 5FK9B 1RZKL 2M2DA 5IVXE 2F5BH 2H2SD 1TETL 1I1AC 1IILE 4Z7OF 3OXRB 3RQ3A 1DANU 1P53A 5DT1L 3F58H 4ZS6D 1KPVB 5D1ZC 4HKBB 4E5XA 2XXMB 4HJGA 2Q8BL 4IRJA 3TZVA 2FWOA 4NN7B 3B9AA 3T3MF 2P49B 3U0TB 2EYTA 2ADIA 4H5SB 3HC4H 2VSCA 4LGPB 3WLBB 1K3IA 2Y4SA 3G6DL 2GAZB 1QNZH 3M17A 2X4OA 3PWPE 3MRIA 4J4PC 4ZUTB 4RMVA 4HQQL 3C2AL 4PRHB 3ULUC 3QDMD 2EZ0D 1XF3B 1C12A 1CXEA 4JRXB 1UJ3C 3KYNA 4X6DE 3SGDI 5GRVL 1NL0H 4TRPL 3QFDB 1A4JA 3O8XC 2V2XB 4JHAH 5A16B 2KQNA 2WBKA 1IRAY 2E7BA 3IETA 4HMEA 4WV1B 4XHQA 4YDVB 3LMJL 3PXJA 4XXDA 1P2CB 3HMXH 3H9ZA 3CC5B 3WD5L 2EICA 4KPHL 3C5ZC 4XCFL 5D2LE 5SX5H 5IHUL 1PVHA 4RNRA 2G5BB 4G6KL 4R4BB 5IT2H 2IALB 1JNNL 4JM4H 2OTUA 4MZ2A 2RR3A 1XCTB 4XNQA 3KDMA 1YY8B 5E2TL 4Z7WE 2H3NB 5D1QB 2JCCE 4CRPA 1IC4L 3O2DH 3RVTC 5IESL 5I1AB 3TIEA 4BKLA 3BPLC 1HI6A 4XPFL 4Z7UF 4JANA 4N0YL 1CR9L 1AO7E 5EOTA 4RIRB 3GZKA 3L9RA 4AK1A 5D6DA 2X4PB 4QYOB 1A6WH 3N0PB 2YKLL 3I6GB 4IJ3B 3GM0A 2QQLL 4P59H 2AEQL 5MEQB 4G6AC 5IM7B 1MCEA 4G43B 5DJAA 5JDJA 4FZEL 4P57A 1CFTB 4UB0L 4Z77B 5ILTH 4K94H 4LK4A 4K9EL 3ISWA 4QF1B 3W11D 4G8GE 1JMXA 1S7TB 4ZFOB 2NX5D 4NKIH 1Z9OA 4OIBA 3TESA 4O58L 1KIPB 1X5AA 4FFWC 1G6RL 5A2IH 4RFOH 3GHBL 4NP4H 3PGDA 3W82A 2BY2A 5BOZG 1ZA6B 3RVWD 4LDEB 1RUKH 1JYNA 2ZUQC 1NMAH 1QLFA 4NWTH 3VDBA 1CGYA 1FNAA 1H15A 1NGPH 1IAOA 5SWQB 4FQHA 2UZIH 1FJ1B 3C08L 2DQDH 1A7NL 2G60L 3SO3B 1NUDA 3ZHDA 1KIRA 1L0YA 2W0PA 1XR8B 1ZGLB 1TTGA 2D0HA 3SJVD 3BPOC 2EDBA 3S35L 2DLFL 3V0AC 1QQDA 3DXAA 1T80A 4OZGE 1J8HD 2CDEB 3SDXA 2R2CA 4N0FB 4QRTA 1R3LB 1Q94A 4W4OC 1MRDL 1IGIL 1VADA 2APWA 1R3JA 3D2UA 4EN3B 1OHQA 3LH2H 4L8SB 4YC2B 1QO3B 1IBGH 2O5YL 3V4UH 3DETD 1DQDL 4CVZA 1FC2D 5A40E 5BS0D 3B5GA 1YEHH 1OF2B 3D3VA 3SOBL 4WHYH 5IVZA 4ESKA 4LFHD 4Y88A 4RRPA 3MJ9L 3NA4A 4PPTA 2PCPA 4L4VA 1WAAE 3QDJB 4LPYA 2VXQL 1UADC 3V7AE 4XMPL 3GJFK 5AUMA 5I30L 2CPCA 4ZDHB 3S98A 3T4YA 5EU6A 1RV6X 3HRPA 3S4SA 2I9LA 3QAZC 4MXWH 4PJAE 4PJEF 1X5ZA 3BPCA 3G04B 2C3GA 1X5XA 5TE7L 3FO2B 2H2PD 4GKZA 1N7MH 4CADA 3TVMD 3FL7A 3T08A 4U6VH 3V5HA 3N50A 5DK2A 1I1AA 5DMKA 4X6EA 4X7TA 3HS0A 3L7FA 3IFNL 4OCXL 5C0GB 3OAZH 3V6OE 4Z78A 1IEAA 2ZNXA 5D1ZA 5CEZH 1MQKH 4GW5B 1TQBC 3PL6B 4ZO7A 2PW1B 4NQCB 5CKGA 3EGSA 5F1NA 1IQDA 3MO1B 3BEVA 4BELD 2K7PA 2YEZA 3GK8L 2ADJB 3S96A 4URTB 4Y4FB 3X11B 3KJ6H 5ELIA 1EK3A 5J4MA 4DGVL 3CDCA 4J4PA 3MCG1 2DM7A 3WNKA 2BVEA 4RGOL 4GFTB 1F6AA 3U0PB 4NUJB 1A1OA 1GCFA 3GSOB 4KV5E 1PD6A 3BZEB 2XICA 3GIZL 3H8NA 1UJ3A 4KKAD 3ZLQC 4KKBD 3O8XA 5HPMB 4JHZA 2F54E 4KKNA 3MNVA 2MFNA 5C0DA 4XNUH 3QISA 1NFDF 3KXFE 5TDOA 1XF5A 3LIZH 2XFXB 4NHCL 4BQCA 2BY1A 4PTUA 4AH2B 5EIIB 4N9GA 3GUTB 4MB4A 3RAJL 1KJVB 3C8HA 4MWFB 4H8WL 4JO3L 3DHMA 3J8F7 3GSVA 2Q86B 3ULVD 4M7LH 5CJQH 3A6BH 4PJ8C 3C5ZA 5GJSL 3REVB 1WIPA 3B9DA 1L7TL 2XY1A 4PJFA 2MTPA 5IB1B 4N1EA 5L7XL 4LKCB 1SY6H 1FORL 3CFCH 3QRFM 1NPUA 1MJ7L 3TBVA 5IUSA 3D9AH 1ZLVH 1DBJH 4FQCL 2H6PA 4U0RB 3R06A 4HUWB 3IJSA 3MXVH 5E8NB 1Y18A 2HFGL 4TSCH 4JG1L 5KN5A 1RJZB 3TC9A 3WFHA 1HIML 2Y6SD 1D9KC 5I1IH 3KLDA 4X6FA 5IMKA 4WEUD 2VDOH 2AJVL 5CP7A 4H88H 4OGAC 1HNGA 4YPGA 4WHTB 4ZUWB 2EDJA 3DECA 5F7DB 5ENWB 4HIHA 4LVOB 3WN5C 5KVEH 3MACL 5GZOC 3C8DA 4OUOA 2X5PA 3UPRA 3RWIB 3QFJD 3DOSA 4MA3A 3TPKA 1W72H 2H8PA 3LPGA 4JN2B 1UQSB 1Q9WB 5CBAA 1N4XL 1I7ZA 5BZWA 5FB8A 1GGCL 3BKCL 4JQIL 5E8DL 4DEPC 1R3HA 1FFNB 1LO4L 4Z6AT 3BP5A 5HHXH 4LDOB 5D70H 1RZKH 3VFTB 1TETH 3ABZA 1WK0A 2HN7A 4JPKL 5F7YC 5DT1H 4YXKL 3V6ZB 1WFNA 1DN0A 2FEDD 5JNYA 2OJEB 5TFSL 3VXMB 4ZYKA 2Q8BH 4JFFB 5D93C 1I8IB 3BH8A 2FHFA 3CFEA 1RPQA 4U6XA 3FQTA 4N9OB 5I6XC 3W0WB 4HW6A 4MS8D 2C1OA 1BM3L 3T4AA 2J12B 2BNRE 1M7XA 4W4OA 1G7LA 4PJCB 4HAFA 3G6DH 4AEFA 5B4MD 2BOCB 1AP2A 3QDHA 3G6AB 4HQQH 3C2AH 2XN9B 2VQ1A 4Y19D 2AJ3A 4CVWA 4TRPH 5IMLA 1A2YA 5ID1B 5KSBB 4Y5VB 1U8IA 4JZNB 3WO4C 1XGTB 1AGEB 2FJHB 3LMJH 2X4NA 2L7UA 1P7KA 3GI9L 2IBZY 2ADFL 3KPNA 2VRAA 3WD5H 4CJ0A 4KPHH 5HVHB 4XCFH 3QXDA 5IHUH 1EMTL 4U1MA 4G6KH 3U0WL 1JNNH 1R3KA 2UY6A 4Q9RL 1Y6KR 2FBJL 4MCZB 3DURA 4I18B 4M9PA 3JWOL 5E2TH 3BJ91 3S6CA 4K71B 3WE6B 4KDTA 2IQAA 5DZLA 4E0RA 3CUPA 4RSVA 3MCKB 4YO0A 5IESH 4XPFH 4HIJB 1BZ7A 4J3WA 4N0YH 3RGVA 1CR9H 3MV8A 4YEEA 4LFHG 4NM8L 5K59E 1S7XA 5E2UL 3AROA 3C8KB 5DTFA 3FOMA 4K8RC 3WNMA 3VRLE 1M71A 4CVXA 1A3RL 1DQTA 2VDLL 1CD9B 2QQLH 3BDBA 3Q2CA 2AEQH 1I7RB 3UEZA 3PP3H 1HH6A 4Z9KB 2PYFB 4LCCC 43CAB 4V1DA 3RVXC 4KHXL 4UB0H 2NQCA 1RZGB 2YK1L 3NVQA 3KHOA 4TSAL 3DGGA 4K9EH 5IVXA 3UTPE 3BGFB 2VZ1A 3RL1A 1WIUA 3RJDA 1DQQB 5LJYH 1I3UA 1MI5E 4HFUL 1FCGA 5I76A 4O58H 5HYSB 3FQUB 1G6RH 4Y8DC 4F33A 5AAWA 2LVCA 4JY6A 1N5AA 2VITB 3JWDC 5I9QB 5I0DA 1RURL 4D2NA 2DJSA 4YBQD 4QOKD 3MOAL 1KB9K 1HXMB 3DMMD 3GIVA 3C08H 1FYTA 1WZKA 4MJ6A 3VGGA 1A7NH 2G60H 5DS8B 1AGDB 4XMLL 4YUEL 1INQA 4NC0B 1EA9C 1S7QB 3S35H 1CXKA 2DLFH 1FL6B 3U7YL 3JSSA 4NO2A 4I2XE 4X6DA 1C16B 3OAUL 1MRDH 1IGIH 5HGDA 8FABA 2C7UB 4JFEB 3WFDL 2DB8A 3GBMH 4I4WB 3EJZC 3H9SE 3GBNL 1UEMA 3RZCC 2O5YH 4OIAA 4LQFH 2QQQA 3X3GL 3ARQA 2ZCKL 1AHWC 1D9KA 4HT1L 4IRSB 1SEQL 3C5SA 1BFOA 4ODXB 5DC9B 1NUFA 3RWFB 1J10A 2IANE 5I16B 3SOBH 5EBWB 5EOQL 2IPKA 5LGJB 3E6FA 2FIKA 3MJ9H 2A73A 4FQXC 4A6YA 1QA9A 3N85L 3TYGL 5KSUB 4Z7WA 4XMPH 2JCCA 2AJXL 3V4PL 4HUMB 5I30H 5FV2A 2QL1A 4PJ9D 4OFKA 1DLHA 2BSTA 3NOIA 3WHE1 3AS3A 3LKPA 4KJPD 4DUVA 3VJ6B 5E8EA 1AC6A 1AO7A 1OT2A 3ZE2F 5TE7H 4CNIB 2Y9RT 1BJ1H 3EFFB 2OL3B 4PLKC 3D0LB 1N6UA 3IKCA 1CD0A 1FE8L 1B4RA 5K9KB 4NZJA 5HHQB 3RP1A 1M7IB 2R2BB 2XNAA 2EC8A 3WNLA 4PV9A 5I1DB 3IFNH 4OCXH 5DQDL 1U3HB 5LGHL 4L8DB 3TBTB 3NAAL 4NZUL 3ZKSD 4HKZA 3ROOA 5C0CB 2GJ6E 3MCLL 3HUJE 1KFAL 4NQEB 1U8NB 2Q7YB 1J88A 4G8GA 1GZPB 4G6AD 5GRYA 5D7KE 1JUFB 4M6ML 1T6WA 3LRGA 3GK8H 4Q9QL 2B8OT 4PJDE 4N8VB 1UXSA 2DQFA 3SGEH 4F8QA 3K2UL 1KXVC 4RGOH 2J3SA 4HH9A 3PGFL 3GIZH 4FFWD 1U8HB 2ZG2A 3O11B 1HHJA 3SPVA 4BUGA 4M93B 5JOFA 5FM4A 1T1ZB 5EA0L 3IDIB 2Y36L 1DZBA 3HI1B 5GGTL 4OZGA 4PGCB 4TUOA 3PL6D 4NHCH 1WBXA 3RAJH 4ZUUB 4H8WH 3KPOA 4JO3H 4HXAL 2OBGA 1ZHLA 1CIUA 5GJSH 4D8PB 5DGRA 4GSDL 1RZKC 4ODHL 2R9HC 4LCWA 4U2ZA 5IW1B 1L7TH 1BZ9A 5DURD 1RVFL 3RWGA 5L7XH 2ZNWA 3O0RL 3BGMB 1FORH 1ND0A 2A6KB 1MJ7H 5E03A 5DJDB 5FKAB 4FQCH 2HTKD 4DVBB 2IMNA 3LAFA 4NT6B 2HFGH 4YH6A 2GHWB 4YGAB 4JG1H 4F9PC 5JQHC 1HIMH 3K1DA 3HHRB 2I26N 5C07E 3BZFA 5DK3A 1WAAA 3NIGF 4MJIE 3TT3H 1XIWB 4G80B 5DVNA 2AJVH 2DD8L 4NKOB 3L3IB 1JN6A 3SY0A 4RMUA 3EO0B 4S0SD 3V0VA 3MACH 4WENB 2NXYC 4LCCA 4BSVB 1MFCL 4WU7B 3PABB 1ZA3B 1N8ZB 1NLDL 4PJ7B 5J6GB 4EKXA 2H32H 3PF2A 1N4XH 3AAZA 4J6RL 1GGCH 3BKCH 4JQIH 5E8DH 3CVHA 5GGUA 1LO4H 4HKXB 3ME0A 4L4TE 1U58B 1F45A 3UTTD 5EC1B 3T2OA 1BD2E 3L3HB 4Q6IB 5FCUL 1H5BB 2V7NA 4JPKH 5KZCB 3C6LA 3MBEC 5T3ZD 4YXKH 3I3DA 5KAQG 2DL9A 2MKWA 4JLRB 5TFSH 2EYRB 1S7UB 1S9YB 2G5RA 5JA9A 1RZJC 1MCRA 4R4FL 4X4XA 3EHBC 1A6ZB 3KPMB 4U6YA 1ZHBB 3U9UB 5CGYC 3WFCL 1BM3H 4QRQA 5MI0C 1H9VA 1BX2A 2OXHA 3OG4B 3ES6B 1H3XA 4ETYA 2F54A 4MAYB 1RUML 2LU4A 4LPXA 4WWKD 4PBVC 4W68A 1H3PL 1LNUA 4HGWA 3Q5YA 2VR4A 4JDVA 4F7EA 4Y4HB 3P4NB 4ELKA 4WO4B 1IGYB 4PY8J 5ISZB 5C0AE 3NFPB 4WDIA 2R2EA 4HKJA 4E9LA 4KJYA 4BH7B 3BWUC 2CK2A 4K9EC 3O6FB 5FEBA 4FQXA 3GI9H 5DR5L 1ZXQA 1A7QL 3PWPD 3QJFA 2ADFH 4U1NA 1JGDB 3MMEA 4NKDA 3W9DB 1S7SA 3MUJA 1HHHB 4C56D 4NQDB 2NNAA 1EMTH 3MSPA 5F44A 3FB5A 3SDAD 3U0WH 1LO2H 2EIBA 4Q9RH 2FBJH 3JWOH 3OKLB 3G6JF 3QJHB 4NJ9L 5FA3B 4R2GD 1EEZB 4OI7A 4AZ8A 3I75B 2HLFD 2ZP0T 2VE6A 4M8VA 2DLIA 2XZZA 4GW4A 3E2HB 4EBQL 5E9DA 2JTDA 4NM8H 1N64L 1E0OB 4OM0L 4I3SL 3QNXA 3D69A 5HD8C 2VDLH 2A83B 4PRNA 3TWCL 1DDHB 5T1KA 1WC7B 4KHXH 1K4CB 4U1HB 4EUPB 3U30B 5CZVL 5T33L 2YK1H 1R3IL 2ATKA 3MJ8B 4TSAH 3JXAA 2X9WA 4X7EC 1Z9MA 4XWOC 2JIXD 2PUQT 3VXRB 4HFUH 4PY7A 5F7KC 5D7JC 2E8ZA 5GS1C 2XRAL 4HZLB 4QNPF 1G9NC 2EDYA 3FN0L 3C09C 1CGUA 1RURH 2JJTC 4BK5A 1QSZA 5FM5O 1KG0A 3WS6C 3MOAH 1NGWA 3ZDZE 2YPVL 5F89A 1JPGA 3OR6B 2Y7QB 2BNRA 2X1OA 2HKFL 4ZQKA 1P4BL 2XZQL 1ZWIA 5CJOL 4XMLH 4OV6F 1OVZA 1J0YA 4G8FB 1YMHA 4FTVA 4YUEH 4JKKA 2FR4A 3DI3B 4PGEA 3U7YH 1UA6L 2AP2A 3UC0L 1P1ZA 3OAUH 2VDRL 3TJHD 4BM7A 2YD3A 2HT3C 2KL6A 1WICA 3P4OA 3NABL 3WFDH 5DJ0B 5HDBF 3GBNH 4O2EB 4Y5YC 1AKJB 3X3GH 1E4KC 2ZCKH 1JCKA 3B3IA 3GM8A 4HT1H 5FA4A 1SEQH 3FQXA 3OX8A 1HHGA 3OL2A 4JREC 5HJ3A 5BVJA 1LO5A 2A74B 2AXFB 2AJZB 2KQMA 4LNVA 5EOQH 5FGCE 3STZA 4CN6A 3JV0A 3C60D 5DK0B 3FRPG 3PQYA 3VGDA 1TITA 2X1XR 5HYQB 4OZFA 1LD9B 3N85H 3JZ7A 1DN2A 3V4PH 2AJXH 1AR1C 3ARBA 3DO3A 1U6AL 4H1LH 2MCPL 3EAKA 5KSVB 2C26A 2HG5A 3PWNA 3QEQD 1DUYA 3NFNA 4WI4A 1GGIL 4MSWB 3NA9L 4N0UB 3DVGB 1UM6L 2EEAA 5F9AC 3MLTA 5C0EA 1T7WA 3D87B 4FQIL 5HGHB 2XXCB 4WUKL 4LSSL 1FE8H 3RKPA 4MHHI 4H8WC 3BO8A 2AV7A 5ITFA 2B2XH 3VXSE 3O4LA 1U41A 5DQDH 2OXGA 3QPQD 5LGHH 3HAEA 2AJYL 3NAAH 4NZUH 4OLUL 3GMOA 3VCLB 5FAAA 1JZ4A 1BECA 3MCLH 1KFAH 3QEUA 1I4FB 1H8NA 5EB9A 5EWIL 4XCNB 3O3DA 4ZFZA 4M6MH 2CR3A 4Q9QH 4F3FA 3QPXH 5JW4N 4JO1L 2BVOA 2YSSA 5KAQF 3A6OA 1VACA 3SDCA 3K2UH 1DUZA 3KPPA 4JPIA 5ICYA 2CUIA 3NCJL 3PGFH 3NN8A 4G3YL 4N5ED 3R0MA 5EA0H 4AYFA 4WW1A 2F58L 5GGTH 5DWUL 4E5XB 3U1SL 4XPGL 2PETA 4HJGB 3T0DA 3B8SA 1QZ1A 4IRJB 3TZVB 2FWOB 1BVLA 3VI4E 3IGAA 2NXZB 4HXAH 3AUVA 3H9SA 4X98A 4KMTL 2EYTB 2ADIB 4GSDH 4ODHH 4GBXC 3RX5A 1IKFL 1RVFH 3GEWB 1GVIA 3M17B 2X4OB 3O0RH 3V79C 3MRIB 5JHLL 3QWOA 1INDL 2LTQB 2IANA 2E9JA 5DVLA 5CEZD 2GW5A 4TNVF 1C12B 3RZCD 1S9KC 3O3BA 3KYNB 3KXFD 3MRQA 1CQYA 1QFHA 1A4JB 1X5LA 5J12B 4ZNCD 1NJ9A 3IJHA 5I74C 3IETB 2M26A 3OF6A 2VC2L 2VL5A 5I0ZA 4XXDB 3BDYL 3KLAA 1CXFA 4UUJA 2M1KA 5DC0A 3ZKNC 3K8KA 1MFCH 4DUXA 2A6IA 4YXLL 1MHHA 1NLDH 4P9ML 1BF8A 1A02N 1REIA 4WCYL 4RNRB 1NCNA 3DX9A 3OG6B 4J6RH 2OTUB 2AXGA 1YYLL 2VTFA 4MQSB 4XNQB 1YMME 3KDMB 5D7JA 3TM6A 5GS1A 2ED7A 3MJ9A 4JRYE 1BQUA 4PLKD 3WIFA 1ES0A 2YD4A 5L8KB 2GJ6A 2JJTA 3HUJA 2NY1D 5EZOL 5FCUH 3KPLA 3O45A 3TIEB 4BKLB 1HI6B 4JANB 1I8LA 4JE4B 3BVNA 4MNHA 1MCLA 5EOTB 4P5TD 5JIIA 3L9RB 1NMBL 4PJDA 5SWZE 2YMXL 4PJXE 1FO0A 1KTDA 3DHJA 5K9QI 4PD4K 4R4FH 1I85C 2I60L 5F1IA 3QNZA 1ULVA 2VZOA 5DJAB 4P57B 1FG9C 3WFCH 2MQ0A 3CK0H 4RZCA 3AS0A 4HPOL 4LEOA 5I17A 2XTJC 4JR9L 3WNPA 5IFAH 1CLZL 1W8OA 1RUMH 5GSRB 1H3PH 3IXTA 5E70A 1E4KA 5C3LD 1AXSA 1CGVA 3PGDB 5DJCA 1BVKA 3OMZA 3SGJC 2IJ0C 5JR1L 5HI5C 1QLFB 3DTXA 1H15B 1IAOB 4FQHB 1MFAH 1OP9A 1CT8A 4C4KO 1KIRB 4HWBL 5DR5H 3SHSA 1A7QH 8CGTA 4LARL 3JWNC 1MCWM 4QHKJ 1QQDB 3DXAB 4PJEA 4TUKL 3SDXB 4QRTB 1Q94B 3QUXC 1VADB 4KAQL 1R3JB 3D2UB 2PXYC 1BJ1J 1T2JA 4Q74A 4MJIA 4EXKA 2P44B 1A5FL 2F53E 4NJ9H 2OZ4L 3CU7A 5DRZA 4CVZB 3U2SA 5F7EL 3P30L 2NY0D 4EBQH 2WM0A 1NSNL 5EBMA 1FP5A 1N64H 3D3VB 3BMWA 4OM0H 5IVZB 1NCTA 5JXAL 3BESR 3P77A 1U36A 2PCPB 3TWCH 1KYOJ 4L4VB 1X4ZA 3EYVA 2D0GA 4NQDD 4YK4B 4GMSH 1EV2E 4L4TA 1ROWA 5AUMB 5CZVH 5T33H 1R3IH 3T4YB 3NGBC 5EU6B 3S4SB 1BD2A 2I9LB 5I1CL 2JJWA 4N68A 2AEPL 4XX1E 4OZHE 5ACZA 3BPCB 4B7LA 5C2UB 5I1KL 4C57C 2D7PA 4XAWL 2XRAH 4GKZB 3FN0H 4CADB 2DQIL 3V5HB 5DK2B 4FZ8L 1I1AB 1OGTA 4X6EB 2FNBA 3R1GL 3QUML 3HS0B 4X7TB 5DJ2A 3TLRA 3VFGL 4NBXB 3NPSC 3MGAA 2YD7A 4Z78B 1IEAB 5D1ZB 2HKFH 3QI9D 1P4BH 2XZQH 1DVFC 5CJOH 3X12A 4CMHC 4QY8A 2VO5A 1N6QL 3UTPD 1T1WA 4CU6A 3FHAA 3EGSB 5F1NB 1IQDB 3BEVB 3QUZC 1LQSR 1MI5D 2YEZB 3E1F1 1UA6H 4GBXA 3S96B 1F6LL 1WV7T 3UC0H 2CSPA 1J1XL 2VDRH 2VLJE 3KGRA 3NABH 4NC2B 5CAYB 1F6AB 1A1OB 1UJ3B 3I6KA 4JG0L 3TH2T 2X4TA 3QUKA 1I7UA 5ADOL 3O8XB 1HKFA 3CZFA 5CEXA 3BPNC 1KXQE 5FYKU 3MNVB 3Q5OA 5C0DB 3UZQA 5TDOB 4KRPC 1XF5B 5DDHA 3U7WL 3MLYL 4PTUB 4N9GB 4GXUN 4O2FA 3NBNA 2W9LA 4OCWL 3CMGA 3QZWA 4N8VG 4PLJC 3GSVB 3VFMA 3C5ZB 4M61A 4W70A 5FDWA 4PJFB 4FOMA 1U6AH 3T2PA 4PGZA 2MCPH 4NCC2 2Y07L 3QIWC 1KGCE 5B21A 3TBVB 3LZFL 3ZE0E 3IXAA 3Q6GL 1GGIH 3P11L 3NA9H 2H6PB 3R06B 1UM6H 1D5MA 3IJSB 1QBLL 1Y18B 4FQIH 4WUKH 4LSSH 1P9MC 5KN5B 4J3TA 3WFHB 4PJCF 2GJZA 1G6VK 3BPLB 4X6FB 5IMKB 1JYXA 2CDGA 4L5FL 5HDOA 5I73C 2AJYH 3T0WA 4OLUH 1E28A 1KB5L 4YPGB 4BZ1L 2R2HA 1QTYT 5F7HA 1EBAA 4HIHB 5EWIH 3RWEA 1I85A 4X4ME 2YWYA 3D5OF 5C08E 1GSMA 3UPRB 2VXUL 4XNXL 5KSBF 1QFWM 4MA3B 5IGXL 3U36A 4JO1H 2H8PB 5CBAB 1VSCA 2AQ2A 1NBYA 2A9ML 5L2KD 1UWGL 3AVEA 1I7ZB 3CD4A 5BZWB 1F11A 5FB8B 1R3HB 1R5WA 3LEYL 2MJWA 3NCJH 5GJTL 2APBA 4NRXA 3BP5B 1L0XA 2W9EL 3O41A 4G7YL 5EPMA 1UKQA 4EQ2A 4G3YH 2ZUYA 3B6SA 3QG6A 2HN7B 3S3JA 3DVNA 3SGJA 1VFOA 3QH3A 1OL0A 4AQOA 4HIIA 2F58H 2ESVD 3ZHLA 5D7KD 1O7VA 5DWUH 1DN0B 4U1GC 3HG1A 4Y2DC 5JNYB 3U1SH 4APQD 2DM3A 4XPGH 5FYKL 1WWAX 3TNNA 4H20L 4ZYKB 2XTLA 1F4XL 1KIQA 3BH8B 3CFEB 4RGND 4U6XB 3BPOB 3FQTB 1B9ZA 4KMTH 4ZS7L 2C1OB 2DQHL 3T4AB 1QG3A 3GMLA 1IKFH 5HDLA 1G7LB 3QUXA 3LRSA 4ZUSA 4Y7MA 4B0MM 3MROA 5FOBA 2PXYA 5JHLH 1AP2B 1VHPA 1TJHL 5F8QC 1INDH 4Q2ZA 1QRKA 2VQ1B 3C9NA 5CUSL 1QR1A 3D39D 2AJ3B 5JOEA 4HEPG 2R0KL 3HZKA 3H0TA 1A2YB 1J87A 1DTUA 3CU1A 4OQTA 4OUUA 4P5KA 3P40A 1U8IB 2VC2H 4K3DL 3WBDA 1JGLL 4BSWA 5E2JA 2CH8A 2X4NB 3BDYH 4F8TA 1P7KB 3AREC 1CCZA 4J8RA 3KPNB 1OTUC 2PTUA 4YX2H 4YXLH 4P9MH 1K8IA 3QXDB 4GAFB 3W39A 4D9LL 5D5ME 3KR3L 1FL5A 3KG5A 5IMOA 3QAZB 4U1MB 4WCYH 1P69B 1CICC 3QQ9C 1FQ9C 1EERB 1R3KB 5C07D 5BV7C 2P4AB 2F8OA 1YYLH 3DURB 2BSRA 2AGJL 3C5JA 5TQ2L 3H3BC 3WFEL 4E0RB 2IQAB 4L3ED 3CUPB 1WISA 4YO0B 3BW9A 4MNGA 1BZ7B 5BVPL 1JI1A 3RGVB 3MV8B 5B3JF 1HQRA 5I71C 4TOYL 5IBLD 1Q0YL 3ZYOA 1S7XB 1ZANH 3H9HA 1NMBH 4I77L 1DVFA 2YMXH 5HYIA 5DTFB 3FOMB 3EDKA 2NY3D 1TQBB 1PG7X 1M71B 1S7VA 2I60H 3BI9X 3WIHL 2FGWL 1FZMA 3B9KC 3QUZA 1IAIM 2HMIC 1HH6B 4V1DB 3KPSE 3HZVA 3G5ZA 4HPOH 4M7ZB 4JR9H 3DGGB 2ITDA 5IVXB 2F74A 3NIDE 3TN0D 5DMKB 1A7BA 2GT9A 1CLZH 2Z31C 4KK5D 3LDBC 3RL1B 5HHME 5I76B 4LF3A 1LMKA 4FFVC 3CFJA 1PW3A 1F4YL 4F33B 1CLOL 4JY6B 5D7IA 4BQ8A 3GB7A 4FQ1L 5JR1H 4LHUA 4DFHA 5C92A 3GIVB 3MV7E 4MJ6B 1FYTB 4NOFA 1CL7L 4FXLA 5E1HB 4ZSOE 3REWA 4HWBH 4XP6L 4NC1E 1FLTX 2VUYA 3ULSA 4EUPG 1INQB 4LARH 2A9NL 3KNBA 4PJBE 4NFCA 4TUKH 3P0GB 4BZ2L 4Z0BL 4NO2B 3IAGC 1I1RA 4BJLA 2ICES 4X6DB 4XHJD 3PWVA 4NZDA 3ARUA 4KAQH 5HGDB 3V5DA 1NEZA 3B2UC 8FABB 3QIWA 4MNQE 3QIBD 5C0AD 1J0HA 4GRLC 3PDOA 1A5FH 3SKJL 5DMGC 4TVPE 4ALAL 2OZ4H 4LAQL 3BISA 4JVPA 1D9KB 1S5IL 3C5SB 2ZUWA 1BFOB 5F7EH 3P30H 3VDCA 4GG6E 4PTTA 5J06A 5E00A 2FHCA 1NSNH 4OZIE 4D0BA 1F3DH 2IPKB 4OTXL 2HJKA 3PGCA 5JXAH 3E6FB 2FIKB 2A73B 4JHWH 1B0GA 2Z8WC 5BJTA 4A6YB 1QA9B 5FGSA 3IDMA 4WI6A 4Z7WB 2JCCB 4KUCD 5FUCE 4JRYA 4CUCA 1DLHB 2BSTB 3NACL 5I1CH 2P24A 1X5IA 3LKPB 2AEPH 1CG9A 5E8EB 1J1PL 4DEPB 5I1KH 4X9HA 4DJMA 1AO7B 4P4KC 3ZSSA 4ZTPL 1XF1A 2OK0L 4MQXC 4YLQT 4JRWA 3IKCB 2PO6D 3MOQA 2DQIH 2XNAB 4FZ8H 3R1GH 4PV9B 3QUMH 3VFGH 4Z7OE 3T0ED 3MX0A 4Y0GA 4YHLL 4LPTA 3FTGA 2VWEC 2AAVA 3GJFH 4Y2DA 4HKZB 4HK0A 3R4DA 4LHJB 3MJ7A 4OAWA 3ROOB 5DD5L 4IEFB 4ONFL 1FH5L 1R5VA 5D93B 4OT1L 1N6QH 4XI5C 2WWMC 4G8GB 5MENE 5LXGL 5I6XB 3DRTA 3T3ME 3WJJC 5EU6D 3MLVL 4E41D 1J1XH 1UXSB 3LKRA 2DQFB 3UTQA 5J7CC 4ONGL 2OJZL 3CX5K 2HFEA 4ZPTA 4LSQL 3AGVA 2AV1A 5IV2A 4HH9B 2AKRA 2H45A 3DWTA 3VMNA 1EFXA 4DGIL 2QHLA 4JG0H 1G7QA 3SPVB 1HHJB 5ADOH 1VB9A 4PJ7F 5JOFB 4PUBL 4WTZG 3A6CL 5HI5D 3HZMA 2APXA 5I1JL 3FB8A 3WO4B 4OZGB 2N7BA 2ZKHL 4TUOB 4MA1C 4AG4L 4RWHA 2UYLA 1XGPA 5GGRY 3T2NH 2WZPD 3U7WH 3MLYH 1WBXB 1SJVA 2B20A 5E4EC 3AREA 4PJIA 4OCWH 3KPOB 4XMKL 2MPAL 1ZHLB 4KMLB 3VU2A 5ITBH 2D7OA 5TDPA 4RX4A 5DI8A 2DQUL 1BQLL 5B39G 5BO1H 2F53A 5CINL 1BZ9B 2D7MA 3RWGB 1J18A 1CICA 1ND0B 1XF4A 2Y07H 3D0VA 3LZFH 1AD0A 3Q6GH 1T7XA 3P11H 1IMHC 1LO0L 1X5KA 2OMBA 5L9DL 1QBLH 3HA0A 1EVUA 1QPPA 4FQQA 1QSED 1ZVHA 5DMYA 1DBAL 1RHHA 1LO3L 4JFQA 1SJEA 4R3SA 3BZFB 1RULL 5JIPA 1U8OA 4L5FH 4V2BA 4UOW1 3SE9L 2GEEA 4GAGL 4CDGC 1KB5H 3B43A 4GKSA 4BZ1H 2AK4E 1JN6B 2QV2A 2EDDA 3SY0B 5F6HI 1JGUL 1D5XA 5CMAA 1XGUA 4OZHA 3B9KA 3V0VB 3CSYA 4LCCB 4X4ZA 2VXUH 4XNXH 5JW5A 5IGXH 3DV6A 3FFCD 5FKPA 4TNWF 4XC3L 2Z31A 4UT9L 2A9MH 1UWGH 3AAZB 3P0VL 3LEYH 3CVHB 5GGUB 4WFHE 5GJTH 1ADQA 3I50L 2W9EH 4G7YH 4TTDC 2VERN 2NY6C 1XGQA 5TJWK 1V3LA 4KK9C 4K3GA 3C6LB 1OQXA 2AQ1A 2I25N 4MD0A 1FSKC 4H20H 4GS7B 2VLRE 1F4XH 2VLJA 4I9WE 4PJ5A 4U1IA 1TNNA 4X4XB 1ACZA 4U6YB 4R6UA 4R96A 5DO2C 5MEOA 1SVZA 4ZS7H 2DQHH 4QRQB 1U93A 3GRWL 1BX2B 5T1DL 2WAHA 3HB3C 5GZNC 4BSJA 1ZOXA 1RD6A 1TJHH 4JJ5A 3BP7A 1U8MA 2F54B 4ONOA 4GRLA 1NUNB 2WLZA 1PFCA 5CUSH 1LNUB 4HGWB 1W8NA 4JDVB 4F7EB 5CGTA 2R0KH 4ELKB 5F9JA 1N26A 4WDIB 2R2EB 4WNQA 4HKJB 4KJYB 1V05A 5FYKE 4K3DH 1JGLH 3VFPA 4QHNA 4RA0C 4KRPD 5JHDE 5C0ND 5I1GL 4FQXB 3I02A 2L7JA 3LOWA 2L0DA 1WLHA 3V4VL 3QJFB 3HN3A 4U1NB 5HHNA 3MMEB 4NKDB 1ZGLP 5E94A 1S7SB 4UQ2A 1QVOA 1WGOA 1LP9E 4D9LH 1MWAL 2QSTA 3KR3H 3NIFF 1WTGT 3FB5B 4JDTL 4UNVA 2EKJA 4MQTB 1T7ZA 1KJMA 2RCSL 4P4KA 5CLTA 1QSFD 2MHAA 1AI1H 4H0GA 5TQ2H 2WUBL 3WFEH 1KUMA 2VE6B 1MAJA 4XPBL 1AC0A 4X4MA 4GW4B 5BVPH 5C08A 2BMKA 5E9DB 4DKFL 3VGBA 1IE5A 4TOYH 2WBJD 5F96L 4I77H 4HDIA 3QNXB 2DLGA 1MELA 3D69B 4TSBL 2J8UE 3HLAA 4PRNB 4R8WL 4YDLC 3WIHH 2FGWH 5KBNC 2J8HA 3K7UA 3CVIL 3WJJA 5T1KB 1YMMD 2CRYA 2ATKB 2N1KA 1CTNA 4I3RL 4X9GA 1U42A 4XTRD 5D7LD 1E6OL 1HCVA 4PY7B 2DBLL 2CD0A 4WU5A 3LD8C 1F4YH 3VD3A 1CLOH 1NLBL 5SWZD 4L29A 4KI5F 2KZWA 2MQ3A 4FQ1H 1KG0B 1HYSC 3FT2A 1NGWB 1YA5A 4TNWK 4Z5RA 3MOBL 3TA3D 4RRPG 2A1WL 5F89B 1JPGB 4I0PC 2BNRB 2Z0BA 1CL7H 4HH8A 4KDVA 4DOHE 4ZQKB 1ZWIB 4XP6H 2HTLC 1YMHB 4FTVB 5EU5A 1OTSD 2YUZA 1MQ8A 2FR4B 4PGEB 4BZ2H 2Q87A 3CDYA 5JO5A 1P1ZB 3F7PC 4ZAKD 3MFFA 3P4OB 1OGAA 5IKCA 1IJ9A 1NC2A 2FECI 3VMPA 1EZVY 4PRPD 5GGRA 2YN5A 3SKJH 4WFEE 2EXYC 4ALAH 2ADGA 4LAQH 5DQJA 1JTPA 3B3IB 5FA4B 1S5IH 4D9RD 3FQXB 3OX8B 1T0PB 1HHGB 5HJ3B 5BVJB 1Z0NA 2P5EE 4LQ1A 1LO5B 1FVEA 1T0MA 1IFHL 1J0KA 1ZKAA 1S8DA 1FNFA 4NDMA 5D5MA 4OTXH 3S7GA 3STZB 3O9WC 3PQYB 2HP4A 2NXYB 5IW6A 4OZFB 1N0XL 4N5UA 1NCDL 4IOFC 4NO0A 3ARBB 3NACH 4KROC 3HE7C 1GGYA 2VQUA 1J1PH 5F7NC 5EIVA 2HG5B 3ARGC 3ARFC 3PWNB 1DUYB 2P5WE 3D18A 3NFNB 4YWGL 2W38A 4ZTPH 2OK0H 1GIGL 2NY2C 3MLTB 5C0EB 5CHNA 1MHEA 3BO8B 3ARVA 3UTSA 2AV7B 5ITFB 3O4LB 2NTSP 3IVKA 4YHLH 2P7TA 3VWJA 5IF0A 3ESVF 3HAEB 3LN9A 3GMOB 5CEYA 2W1NA 5DD5H 4YHZL 3IDYC 4ONFH 3RL2A 1FH5H 1J7VR 4OT1H 4PP2A 2JB6A 3QEUB 3W9EA 3FOLA 4YR6A 2FEEI 5LXGH 3MV9E 3U4BH 3O3DB 4ZFZB 4F3FB 5MI0B 1BBDH 1NC4D 2Q8AL 4G7VL 3UAJC 1B88A 2BVOB 2YSSB 3LCYA 4ONGH 1U8QA 2OJZH 3K2MC 1VACB 3MGTA 4O5LL 3SDCB 5ICYB 1DUZB 3KPPB 4JPIB 4LSQH 1INEL 1WT5C 3O6ML 3QDGE 5D1XD 3TJEL 3MV7A 3QCTL 3NN8B 4DGIH 4ZSOA 5JQ6L 5FDYA 2EXWC 5CD5C 1T2QL 4PUBH 1XZ0A 3MRJA 3A6CH 3CFBA 4WW1B 5I1JH 5FUOL 4Z8FH 2IH3A 2ZKHH 4AG4H 5AG9A 1P7QD 2JKXA 1BVLB 4XMKH 2MPAH 3IGAB 4K07A 5CJ5A 3H9SB 4X98B 5GISL 4W6YB 3GDBA 4KJWC 4U6HA 5CINH 3GGWA 5JXEC 2VQTA 2QADD 3G5XA 5L6YL 1XGYL 3QWOB 4ZXBC 3IFOA 2IANB 4ODSL 1JMZA 1LO0H 4GT7A 5L9DH 3VRIA 5GS0D 2O61A 3O3BB 2YHGA 1DBAH 3VH8A 3MRQB 3HC0A 1LO3H 1RULH 3WUZA 1NJ9B 1ZVYA 3IJHB 3QP3A 3SE9H 4JZJC 1MY5A 3B2VL 3K4ZA 4EOWL 2EIZA 4GAGH 4OF6A 1MF2L 2VL5B 4U2YA 2AJSL 1W0YT 3RDTC 4FG6C 1JGUH 2EE6A 3KLAB 5IROC 4UUJB 3RTQC 1EAJA 1MVUA 4RCAA 4LCWD 2A6IB 3CNKA 1MHHB 1FFPA 3RKDC 5DHVA 2DRUA 4XC3H 3WV0A 3ILPA 3BE1L 1BAFL 1SBBA 3DX9B 3NCMA 3P0VH 1JZ2A 2AXGB 4JFDE 2IBBA 3I50H 4Q7DA 3MNWA 5D7JB 5GS1B 4WUUE 3C09B 3WIFB 1S9WA 2AQ3A 5T3XL 1ES0B 3SDXF 2GJ6B 3HUJB 4JCLA 3KPLB 3O45B 2PYEE 5MENA 4ONHA 1PG7W 1FLRL 1OY3B 3BVNB 1I75A 4MNHB 4I0PA 2MKLC 3GMQA 1ACYL 4PJDB 1DEEA 5KVGL 1FO0B 1KTDB 4YBHA 4XAKD 4EIGB 2IH1A 5F1IB 3QNZB 4RMSA 1V7NL 3HNSL 5DGQA 1DBKL 3FB7A 1IM9D 3JV5A 4RZCB 3GRWH 4ZODA 4NQCA 2ZOLA 4LEOB 5I17B 5T1DH 4GQ9L 3LS5L 1URLA 3FO9A 4F15C 2V9QA 5LGKA 1G1YA 2CUMA 3T3PE 1ZAGA 3IXTB 1WZ1L 4RWYH 1AXSB 5DJCB 1JVKA 1CN4A 3AFLA 1BVKB 3ILQD 5CJBA 2R1XA 2BERA 1F3DJ 2Y5EA 1KTKE 3DTXB 4BA8A 5B38A 3BQUD 1KSRA 4P2OD 5D9SA 4PV8A 1CT8B 2IBGA 4CJ1A 4S1DC 5H2BA 5I1GH 4DGYL 2H1PL 3QDME 3O9WA 3V4VH 3EJJX 1R6VA 2ICWI 4PJEB 4I1NB 3WJLC 5GIRA 3OXSA 1MWAH 2EDNA 3D85D 5C3TA 1OT1A 2X40A 4JDTH 3DIFA 4C83A 3HE7A 1FDLL 1CDIA 1NFKA 3QUYC 3ARGA 3ARFA 5I75C 4MJIB 1IEHA 2RCSH 4S11A 5D7SL 3F65A 4UT6L 1G7PA 3FHQA 4OD1L 2WUBH 1NH6A 2AK4A 4LLQA 3CFDA 5DRZB 1V5JA 1GRWA 4AIOA 3U2SB 4YZFE 3ARWA 3TO4D 4XPBH 1PEZA 1EHXA 1TVBA 4QKXB 1LHZA 1I8MA 4DKFH 3QXVA 5EBMB 3L95A 2IPTL 4K23L 2B1AL 5F96H 3ULUF 4M1CD 4TSBH 4MDJA 3P77B 3S88L 1NCBL 4R8WH 5A43C 5I18L 3EYVB 2BX5A 3HPLA 1XT5A 3CVIH 4L4TB 4XP5L 1SBSL 5HBBA 4I3RH 5LVEA 1MCSA 1BD2B 4FMFA 3BXNA 4PREA 5ACZB 1E6OH 2DKSA 1WT5A 1KB5A 1LILA 2DBLH 4JN2A 3BYYA 4YNYA 2X6MA 4XBGA 3T1FA 3HE6D 1NLBH 3MZGB 5GS2H 2VLRA 1UZ6F 2BNQD 4PJFF 1OGTB 2XPGA 5DJ2B 3SBWC 5E9DD 4KK9D 3UJJL 4FABL 3RNQA 4PJGA 3MOBH 1IC5L 2APTA 2A1WH 5EU3A 2VNCA 5DHYA 5K9JL 4NRYA 1Q38A 4ZFOL 4TQEL 1PEWA 3X12B 1LDSA 4QY8B 4MHHG 3TH4T 3MC0A 1T1WB 1DCLA 2AEIT 1H3GA 2BJML 2YZ1A 2HT4C 4YGVA 4YQXL 1P7HL 4GBXB 1C7SA 4WW2C 1CE1L 5JXEA 4HHAA 3LRHA 2XQBL 4QRSA 3OPZL 1E27A 1IGML 2NY7L 4R7NA 3I6KB 3OQ3B 5JHDA 2X4TB 3QUKB 1I7UB 1T4KA 2ARJQ 5CEXB 3CZFB 1TCMA 1JNJA 1G1CA 4P23C 1VFAA 2BVPA 5I74B 4JZJA 1IFHH 5E24E 1LP9A 4WFGD 4OCYL 3FT3A 3RX7A 3RDTA 5DDHB 2DWEA 5IROA 5KVFL 3RTQA 4KY1L 4O2FB 2CLRA 2VMFA 4KHTH 3QZWB 4KZDL 2DMKA 4MNQD 3DPBA 3VFMB 1N0XH 4M61B 5CIPA 1NCDH 5BS0E 1WFOA 5FDWB 1IGTA 1QFOA 3GFUA 4N8PA 4ZOBA 1P5UA 2N4IA 4NHUA 4YWGH 3IXAB 1SJXA 4XBPA 4W6XB 3LN5A 2GK0A 1D5MB 1GIGH 4O51A 4RFEA 1O7SA 2V9TA 4WVRA 5E6YA 4OBRA 3QO0A 2J8UA 4ELMA 1RQ5A 2GJZB 4KU1A 2R15A 2ZCLL 3H2WA 5DD6B 2CDGB 1P4IL 4M9OA 1E28B 2R2HB 4YHZH 3MJGX 2VLKA 4LLWA 3T1WA 4NOBA 5DEFA 4Y16D 1OP5K 1KLFA 3RWEB 1X5FA 3UYRL 1HHKA 4WJ5A 5EO1A 3U36B 2W60A 5D4QA 3FFDA 2Q8AH 2XTJB 4G7VH 1TPXC 3BKJL 4JM2C 4L9LC 1NBYB 4JFZL 5T1MA 4O5LH 4GMTL 4HIXL 1F11B 4AEHH 4YFLF 5TH2A 1INEH 3O6MH 1R5WB 3TJEH 3O41B 3QCTH 1YQ2A 5EPMB 5JQ6H 3QEGL 4UV4L 4WI3A 2IC2A 4HC1A 4WHCA 1T2QH 3B6SB 4K7PY 1G7JA 5INDA 3QG6B 1QRND 3DVNB 1DEDA 4L3CA 3QH3B 1OTTC 2E6PA 3FQWA 1GGTA 4HIIB 1NCCL 5FUOH 5E8PA 2H2SC 3HG1B 4LVNC 5F1KC 3TNNB 4XB8A 1KIQB 4P3CL 4ZS6C 4OGYL 2BY3A 5DRXA 4LLVA 4X6CE 3VGFA 5GISH 4OGXL 3WJLA 1J86A 1SHMA 4F7PA 3GMLB 2H9GA 3PNWA 3MRCA 3QUXB 3LRSB 4ZUSB 1FIEA 1RU9L 2PXYB 3MROB 5FOBB 1XGYH 5L6YH 3QUYA 5K9QG 3DLQR 2P5EA 4ODSH 4Q2ZB 1A7OL 1BLNA 1FCCA 1QSVA 3C9NB 3DI2B 3G6JE 1QR1B 4KXZI 5FGCB 5BRZD 3ULVE 3MBXL 1E4XL 3UBXA 3AB0B 2GITA 3HZKB 1IGJA 3H0TB 2EZ0C 5IVXF 3MRNA 4HLZH 2R0LL 3B2VH 4P5KB 3NCYP 4EOWH 1MF2H 5SWSA 4BSWB 2AJSH 2EH8L 5MHSD 3IS0X 3CIQA 1A3LH 4J8RB 1S3KL 1UH4A 4UBDD 3IU3A 2P5WA 3X3FL 3KS0H 5DD3L 1KPUA 3OWEA 1K8IB 3W39B 5ACMA 1ITCA 3HMWL 1FL5B 3NGBB 5IMOB 5DRNA 3BE1H 1BAFH 1QFUL 4ZD3L 5C6TL 5FM8A 4XRCA 5BZDA 5JUEL 5J1SC 3Q0HA 2BSRB 2HFFA 3C5JB 4QNPE 5T3XH 3HRZA 1VESA 3QFJE 4X6DF 4B53A 3SBWA 3BW9B 4GH7B 1FLRH 4MNGB 5DFWH 3NPSB 1AY1L 3BAEL 1T1YA 3F7VA 4LLMA 1HQRB 2Z35A 1ACYH 3H9HB 1HXYA 1DVFB 5KVGH 1DFBL 3CXDL 1ZE3C 4CMHB 5GXBB 3P9WB 4AY0A 3TFKD 1S7VB 1FZMB 4KTYA 3QUZB 1V7NH 3QDGA 3HNSH 4P2QE 1DBKH 3BHBA 3HZVB 3G5ZB 2EDOA 2ICCA 1KB9J 4GQ9H 4WW2A 3LS5H 2ITDB 2F74B 2GT9B 4MAUL 3OB8A 3MUGA 5T3XE 4LF3B 3CFJB 1QUNA 1WZ1H 3W11C 3L1OL 3LS4H 2J1KA 2JCCF 2EIEA 4LP4A 4Z7WF 5D7IB 2AK1L 2GSIA 1KT2A 3U6RA 3GB7B 3BPNB 4I9WD 1KC5L 3SEPA 5M7QA 3QHZL 4P23A 3BH9A 3RVWC 4LHUB 4NNXA 4OFIA 3ZL4L 3EIFA 2AVGA 2ILLA 2EDFA 2FD6L 2NY4D 3P4MA 5IBTL 3REWB 4DGYH 1J5OL 2H1PH 3ULSB 4Y19E 3KNBB 3Q6FA 1NQBA 5HYJA 1EO7A 3GBLA 4KJWD 4KI1A 2DYPA 1QFWI 5KTEL 3RUGE 3MRGA 2WSKA 5HYFA 3CH1B 3PWVB 5EZLA 3KWWA 1FDLH 4U7SA 3RNKA 5KSAD 1NEZB 4ZO6A 3V5DB 3MUY1 3QIWB 4GRWE 1DQJA 2E7CA 4J7RA 5D7SH 4ZXBD 5LQBL 4UT6H 4UT7L 4JKLA 3PDOB 1W0WA 4OD1H 2XWJA 1DP0A 1KELL 2O5ZL 3ETBF 4LIQL 1YNTA 4PTTB 1AGCA 2Y06L 5E00B 5I73B 4Y4KA 1NL0L 4K23H 2IPTH 3SQBA 2B1AH 4D0BB 3A67L 2HJKB 4JFHE 3PGCB 3LKQA 2V6HA 2ERJC 4FG6D 1JE6A 3S88H 1NCBH 1B0GB 4LHQB 5I18H 1JFQL 5C0FA 4JFDA 5BJTB 4MX7A 4NUGL 1ZVSA 3IDMB 2A38A 4WUUA 2BOBA 4XP5H 4JRYB 4X0KA 1SBSH 1F00I 4OZGF 4LMQI 4JM2A 4L9LA 2P24B 1CG9B 3BUYA 2MSPA 4J12A 5I1EL 4GRMA 5B22A 4WEBL 4Z18A 2P42B 2A2QT 3EOBA 1HWGB 5JDSA 3UJJH 4JGUA 4FABH 4IHOA 1VA9A 1DBBL 3PG2A 3TVMC 4JAMA 1IC5H 1UYWL 2ORBL 3FTGB 4U05A 4U1GB 3UJTL 4P46D 2FO1A 4Y2DB 5K9JH 4HK0B 4OAWB 4PG9A 3MJ7B 4TQEH 2C3XA 5BW7A 4OZFG 1R5VB 4KQ4L 3FO1A 3L5XL 2Q3ZA 1BPVA 4ODVL 3DRTB 5GRJL 2BJMH 1WAAF 4YQXH 4QOKE 5DUPL 2V7HA 1CE1H 3LKRB 4FP8L 3UTQB 1J1OL 3MR9A 2HFEB 2XQBH 3OPZH 1YEGL 4QWWD 4ZPTB 4PJAF 2V9RA 2AV1B 5IV2B 4JQXA 2AKRB 5IP4A 1IGMH 1EFXB 4YAQA 2NY7H 1G7QB 3ZYJA 3BIAX 1F5WA 3HAEG 3ALXA 4MA7L 4KKAC 1X9QA 1WVZA 4KKBC 1CDCA 3HZMB 5C0IA 4OFYD 3FB8B 1RMFL 4OCYH 2EO1A 2UYLB 1XGPB 3KPRA 4S1RL 4FRWA 5KVFH 3MREA 4KY1H 1HE7A 3AREB 4PJIB 3G9VA 4P49A 5CP3A 4KZDH 2DQDL 5E6ID 1BJMA 5DI8B 4S2SA 1IAII 1A22B 2F53B 1J9CT 4HS8L 1JGDA 3ULVC 1CICB 1XF4B 5BV7B 3D0VB 5DZNA 1AD0B 4LCYA 3P9MA 3WDHA 3BZDA 3QIUD 2R0WL 1QD0A 1AGFA 1TVDA 3L3DA 4FQQB 4FFZL 4KV5F 1II4E 4UDUA 1RHHB 1CVSC 3ZDYE 4JFQB 2ZCLH 1SJEB 4R3SB 1YN6A 3AM8C 1U8OB 5I71B 2Y6SC 3K8LA 3N06B 4GKSB 4RAVA 5CMAB 1D5XB 3VWKD 2P47B 2ICEA 1AIFA 5I8EA 3UYRH 2OL3L 4Z76A 1XGUB 4OZHB 3B9KB 4BFEA 2R1YA 1J8KA 2W0FA 3CSYB 4ZPVA 1JF5A 3WEXA 3JTSA 5DJ6A 2A83A 5JW5B 3DV6B 2XKNA 5FKPB 3BKJH 3VFSA 2Z31B 4JFZH 3HR5A 3LDBB 5KOMC 4GMTH 1F3JA 4HIXH 3T0VA 1OAKL 1LEKA 3ARYA 5B3NA 3RY4A 1QHPA 4XNMA 3QEGH 2NX5A 4UV4H 4HBCL 1MNUL 1XGQB 1CS6A 1TDQA 3U82B 3ZE1E 3DX6A 1N7ML 4F57L 1NCCH 5CILL 1KLGB 4K7PX 2V2TA 2R8SH 3VFRA 4MD0B 2W59A 1Z3GL 3WKML 3ARXA 2VLJB 4P3CH 4PJ5B 4U1IB 4MA8L 4OGYH 2FEDC 2ZJSL 4R96B 4QXTA 4OGXH 5MEOB 1MQKL 2HT4D 2VKWA 3BN9C 4YHYC 1U93B 1FIGL 3MV11 2KH2B 2YPLD 3SJVA 1TJGL 1JNHA 1J8HA 4MS8C 1RU9H 4NFDA 2A0LD 4JJ5B 3BP7B 1U8MB 2DIAA 1A7OH 2ZG3A 4GRLB 4AQ1B 5B4MC 1MJ8H 4Y1AA 2JE8A 3HI5L 4JZOA 2Q1EA 3MBXH 2E6JA 1E4XH 4YHIA 3M07A 1JGVL 3SDDD 5CBEA 2WNGA 1JGEA 3PIQA 2R0LH 4WNQB 4MYWB 3VGEA 3OGCA 3O3UN 4OGZA 5BS0A 2EH8H 3VFPB 3VXUA 4OIIL 3FT4A 4QHNB 1GPOL 3I02B 4XWGL 1S3KH 1LWRA 3UBXI 5HHNB 3X3FH 5E94B 4UQ2B 5D72L 5DD3H 1QVOB 3BD3A 3MLZL 3WUWA 3HMWH 2WMPA 4GLRI 4UAOC 1Q9OA 1QFUH 4UIKL 4PRID 3PHQA 5C6TH 4ZD3H 2DI8A 4P3WA 5JUEH 1KJMB 1F2XK 2GY5A 4P4KB 1OAZL 5GGVY 5C0BD 3S37L 2MHAB 1KCUH 3QHTC 5E2WL 3VG0L 1U8JA 1FZJA 3TVMA 5F9WC 4NJAL 1AY1H 5C08B 2BMKB 5DMIL 5DC4B 3WNNA 1H3TA 3ARDD 1S9VA 5C7XH 4HDIB 1A4KA 1EGJA 1DFBH 2A6DA 3CXDH 4LSVL 1V8HA 3HLAB 5IFJA 1SYSA 3UTTE 1I3RA 4AIZA 3ZDXE 4Y5XC 3VCLA 4EI5D 1ZS8A 2CKBA 3TYFA 3VW3L 4NKMA 1MLBA 5HVFB 5C9KA 5T3ZE 2YZ8A 3GSRB 3LN4A 4DZBA 4MAUH 2WWKO 4OI8A 3FQNA 2R4SL 4JQVC 4WU5B 3L1OH 2AK1H 4L29B 5FV1L 4UU9A 1KC5H 3FT2B 4Z5RB 3QHZH 1XMWA 4X6CA 3ZL4H 4X99A 4YBQC 4MA1B 2QR0A 2FD6H 5IBTH 3DMMC 1J5OH 4OD2A 5TDNA 5KOVC 4JY5L 2IAMD 5EU5B 4G9FD 3VRLF 3IDUA 4IJ3C 4KWUA 4CN1A 4F2MA 1X5YA 3FONA 5KTEH 5JO5B 2D31A 2A6JB 4XT1C 3MFFB 1OGAB 5IKCB 1WF5A 2IPUG 1NC2B 5LQBH 4UT7H 5GGRB 3N1GC 2DBJA 4NBYB 4R26L 1T6VN 2ADGB 5F7FA 5DQJB 1KELH 3B83A 4G6FD 1AD9A 4C56E 2O5ZH 3M1BA 3CCHA 1JF1A 1CFQA 1P4LA 3AM8A 4LIQH 4KKLC 2Y06H 1FVEB 5GHWL 5E5RB 1T0MB 4WIQA 3RZWA 1S8DB 1OARL 5GS3A 3SE4C 3A67H 4NDMB 5D5MB 4D9QD 4QRUA 1CF8L 2VDKL 1JFQH 2VZTA 5IW6B 2YA2A 4NUGH 4JN1L 4KRMB 4M4RA 4NO0B 1VFMA 4NZRL 4P2RD 3QFJA 1LEGA 1BOYA 2J6EL 5DHXB 3JVGC 4PJ9C 2EKSA 2YS4A 3D18B 1OM3L 1YECL 1KOAA 5I1EH 4KJPC 4WEBH 2NTFA 5CHNB 2NY6B 3SO5A 1MHEB 3NCCB 3UTSB 4QRPD 5GGSA 3GMMA 5GQBA 1DBBH 3IVKB 1UYWH 2P7TB 2X2YA 2ORBH 3VWJB 5IF0B 2NR6D 1PKQA 3UJTH 4EJ1C 5CEYB 1M4KA 4QT5A 3QZWG 1JHKL 1FSKB 5EUOE 1XGRA 3RL2B 4KQ4H 3DX7A 2JB6B 4PP2B 3W9EB 3FOLB 1IEBA 4YR6B 5HVWA 3L5XH 5HHMB 4ODVH 5GRJH 1G9ML 1ETZA 5MP6L 4OF3A 2HH0L 2FCBA 5DUPH 2FH8A 3HNVL 4FP8H 1J1OH 1U8QB 3EYQD 3MGTB 4Y89A 1AJ7L 1YEGH 3RU8L 1BOGA 3MV7B 1MY7A 1NDGA 1VGKA 3GHEL 3MRHA 4C55A 2X1QA 3TEUA 4X6BA 4ZSOB 2DICA 5GSRA 5DD0L 5DMJB 4TYUA 1XZ0B 4Y19A 3MRJB 4MA7H 4MQ7A 5HHOD 3CFBB 2QKIA 3ECBA 1ZTXL 1A7RL 1RMFH 2IH3B 2I27N 3VXNA 3RUGA 2WWKT 4S1RH 3KS0J 2NY5C 3L3KA 5GRVK 3HUJF 1L7IL 3PL6C 5BOPA 1MJUL 4GLRH 2BVUA 2P46B 3F7RA 4J3SA 1R24A 4U6HB 2XYCA 4HS8H 5GS2D 3WCYA 3GGWB 1QYGL 1UFUA 4RMRA 4PJDF 2MOVA 3G5XB 2GCYA 2QSVA 1FNSL 2C4XA 4JGJA 3IFOB 1WWCA 1XCQA 2XWBA 5DUML 2R0WH 3AXLA 3VRIB 4FFZH 2O61B 2FHBA 3VH8B 3GBML 3HC0B 2HTKC 1GH7A 3V52L 3WYRA 3OJVC 4LQFL 5EO9A 4JFEE 4XCEA 2EIZB 3EJYD 4U3HA 1ZLUK 1CYGA 3QEQE 5SV4A 3D48R 2NYYD 3IAPA 4QTIL 3CXHK 3MYJA 4NQSA 2OL3H 4YDLB 4Y5XA 3H7LA 1MVUB 2YUXA 1A7PL 3VG9B 2KZ1B 1OW0C 3EUUA 5FOJA 1FFPB 5DHVB 3ILPB 2AERT 4JFPA 3S5LA 1OAKH 3KAAA 4R7DA 1CTOA 3MNWB 4PD4J 4JQVA 3LD8B 2Q76A 5C09D 1S9WB 3MQIA 4WHDA 4HBCH 1MNUH 4YHKL 2H41A 4KFZC 4QHLA 2D3VA 5EFIA 2XG4A 4S10A 5MENB 4ONHB 1FFOA 4F57H 5CILH 2R29L 1A1MA 3HNTL 4I0PB 2OCFD 4QOKA 3GMQB 3DMMA 1DEEB 4CDHA 3OV6A 1Z3GH 3WKMH 4X7SL 1BFVL 4I0KA 4MA8H 2I5YL 2IH1B 5KVMC 2ZJSH 2YXFA 3B8YA 2FLRT 1NGQL 4LU5L 3TO2A 3FB7B 4MDIA 1FAIL 1FIGH 2ZOLB 1TJGH 1WCBA 5DFVD 4ODWA 3FO9B 25C8L 4NQEE 4X5XA 4A2LA 2YD9A 4NQVA 2DN7A 3HI5H 1CFNA 1BP3B 1HHIA 5TGBA 2HVJA 3PWUA 1U95A 4WWKC 1JGVH 3SGDH 2BNUA 2R1XB 1T5WA 3ARRA 5IBUB 1CXIA 5B38B 4JY4A 2IADA 3SE4A 4QHUA 2LE9A 5D9SB 4PV8B 3EYUL 4OIIH 4WTXA 5H2BB 5CEZE 1GPOH 2XWTA 4AIXA 4XWGH 3O9WB 4BFBD 3WLWD 4IMLA 5D72H 4JCMA 1KJ2L 3MLZH 5GIRB 3OXSB 1MFDL 4KROB 3DIFB 4C83B 4H26A 3HE7B 4UIKH 2W65A 2CIIA 1S9XA 2RBLA 1U3JA 2XOTA 3JVGA 4PJ9A 4RFNC 3ARGB 3ARFB 4XVSL 1H8SA 1OAZH 3SDAC 3S37H 1G7PB 2NY2B 2NLJA 2QTEA 2AK4B 3EFDL 5E2WH 4LLQB 1RJCA 1B4JL 3VG0H 3CFDB 4MMZC 2JJSC 4LHUG 3K8MA 5KJRL 2QHRL 1TVBB 4NJAH 3ELAT 4R2GC 1I8MB 1MHPL 2AXJA 5DMIH 4HUKB 2HLFC 3L95B 2FJFA 2IEPA 3BWAA 1BBJA 3IDYB 4L9DA 4LSVH 4MDJB 3TT3L 1OB1A 4QRRD 2B5IC 3HPLB 1D6EA 2VAAA 3VW3H 4X5WA 1NEZG 5HVHC 1AQKL 4F37F 2LVEA 4MB5A 5JZ7D 3BXNB 2MNUA 1EEQA 5EOCL 4PREB 4ORZC 1M05B 3FN3A 4GAJL 1KB5B 4YNYB 2R4SH 5FUZL 1I9RL 2DDQL 1VPOL 3GSWA 4XBGB 4UINL 1KTRL 3T1FB 4WY7L 1YEJL 3VXPA 2VLRB 4EQ3A 2AXHA 2XPGB 3PV7A 2GJJA 3RNQB 4PJGB 1YPZA 2B7DT 2C3HA 4L1DA 1KTLB 5EU3B 2IQ9L 4P2QD 5DHYB 1MFEL 5CSZA 4NRYB 2BP3A 4PRAA 4JY5H 4HFWA 3RVUD 4OLEA 2QLVB 3UJIL 3I9GL 4YGVB 3FRUA 5T3XD 1C7TA 1GC1L 1UB5A 3BN9D 1M1SA 3FRPA 2EDHA 3SCMD 43C9A 4HHAB 1BIIA 1VDGA 4ZFGL 4QRSB 3TJHC 4KTDL 1KENL 1SVCP 1HDMA 1E27B 2Y23A 4R26H 4R7NB 5D96C 5JHDB 1T4KB 4O00A 3OKOA 1VFAB 3CJJA 2BVPB 5GHWH 4JZJB 3PE9A 1OARH 1LP9B 3FT3B 3RDTB 5ID0A 2DWEB 3FO0L 4K94C 3RTQB 2CLRB 1CF8H 2VDKH 4YHNA 5ISZE 3KYAA 3FZUD 3QWQB 4JN1H 3C60C 1OW0A 5CIPB 3IFLL 1IGTB 4U1KA 4NZRH 3P0YL 5CCKL 2J6EH 1NBZA 1NC2D 4NHUB 1IC1A 2IPUK 4XBPB 1OM3H 3LN5B 1YECH 2GK0B 4O51B 1LO2L 1AXIB 1NFIA 4RFEB 4NQDE 2BHZA 3DVIA 4PRHD 5DSCA 3QO0B 2UWEA 2J8UB 4ELMB 4JFHD 4CGTA 4JRXD 3UTTA 1EJOL 3T0BA 1RZIA 4IRSC 1YEEL 3WKNA 1MAKA 2X4RA 4NIKB 3IDJB 1CQKA 1JHKH 1HSAA 4G8IA 4HUVA 3ARPA 3QPQC 5IJKC 2VLKB 4LLWB 5DEFB 4JPVL 2DTSA 2QBWA 4PG2C 5JMRA 1S7WA 1HHKB 4WJ5B 2MCG1 1G9MH 2MWCA 5MP6H 1CI5A 3TP4A 4GO6B 5EO1B 1T66D 2HH0H 2W60B 5DFTA 3FFDB 3HNVH 4U1SA 2HAZA 3MNZA 5T1MB 4F15B 2RHEA 1AJ7H 1TENA 3RU8H 5TH2B 3MPCA 2UV3A 3GHEH 4DOHB 1RJLA 3BOVA 4WWKA 5D1QD 3V6OC 5DD0H 5INDB 1G7JB 5HSFA 1I1FA 4F37K 4L3CB 4P2CG 4N5EC 3S36X 3FQWB 1ZTXH 1A7RH 5E8PB 3EYFA 3HZYB 3GO1L 1I9IL 1MEXL 2XV6B 1MCIA 3ULUL 5D8JL 1B2WL 3BRDA 3RY6C 5DRXB 1L7IH 4LLVB 2B0SL 1MJUH 1GOGA 3PWPA 5KG9A 3N1MC 1KF9B 5C1MB 4F7PB 3PNWB 1PKOA 2H9GB 1QYGH 3MRCB 4C56A 2J5LC 2VOTA 4PJ8A 3ZT6A 3ET9F 1FNSH 1Z0MA 3QUYB 5I75B 2P5EB 4FQPA 3MJ6A 3SDAA 4OKDA 5DUMH 2RFXA 1BLNB 4P99A 2CRMA 1C5BL 4MZ3A 1LK3L 3KPTA 3UBXB 2GITB 1IGJB 3V52H 3MRNB 4IOSD 5A3ID 3O81A 2VB5A 4KKLD 3EDDA 2D7QA 5SWSB 5IEKB 4KUZL 4AJ0A 4QTIH 5D7IF 4WTWA 5T5FL 5D2LA 4WI5A 3IU3B 2P5WB 3VFVA 1X5HA 1A7PH 1OCWL 3WL9A 5ANME 1KPUB 3WN5A 2E7MA 5DRNB 1W0VA 1A1NA 1NGZA 1UM5L 4XRCB 5BZDB 5F3BA 4EN3D 2HFFB 4R97C 5IB3A 5HGAA 2CDFA 2JIXA 2N56A 3HRZB 5EUOA 1EHAA 4YHKH 1CIDA 2DJUA 3HMXA 4B50A 3MV9B 3FAXA 5AYQA 5BQ7A 2NY1C 1T1YB 2R29H 3F7VB 3HNTH 4LLMB 2Z35B 5L2KE 5I2IA 2B2XL 4N0UE 1HXYB 4P5TC 4X7SH 1BFVH 2ZUSA 5F6IC 5KANG 2I5YH 4OZ4A 5J0BA 4RISL 3QDGB 4D0CA 1NGQH 4LU5H 3U48A 3BHBB 1FAIH 1VCAA 3QDJD 1LE5A 3TBSA 4WW2B 4BUHA 5IIEA 2ESVE 3K74B 3O2DA 3TCLA 25C8H 3MUGB 2BZDA 3QPXL 5EBGA 5EU7E 1L4IA 2X10A 4RGNE 2IFGA 4MJ5A 1N59A 2GSIB 1KT2B 3QEHA 3DARA 3U6RB 3CSGA 4KK8D 4P23B 2X4QA 1RUQL 3BH9B 3E3QE 1ZHKA 4G6JL 4RQQA 4NNXB 4KK6D 2NZIA 3P4MB 5CFHA 3EYUH 1RK1A 1U2HA 3D39E 3SE3C 3Q6FB 2XY2A 1NANI 3C60A 4NQCD 1KJ2H 1CDGA 4LPCA 5HYJB 5J56B 4PRBA 5J8OA 4MVBD 2FL5A 2DYPB 1MFDH 4MLIA 3MRGB 2VKXA 1PBYA 5EZLB 3KWWB 5ACLA 4Y4FD 3RNKB 4QTHA 4XVSH 5LKNA 3S34L 1A47A 1DQJB 4FN0A 2GUOA 1FZOA 4PP1D 4MAYC 6FABL 1W0WB 3QEQA 1CGSH 2XWJB 3EFDH 1B4JH 4JKPL