3H9ZA

Crystal structure of the ige-fc3-4 domains
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig epsilon chain C region
total genus 39
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA02
5IEHB 3S88H 5T1KB 5DJDB 5IM7A 1CG9A 3G5YA 2FGZA 4Y4FA 1S7SA 5J56B 3ALXA 3NAAH 4Z7UE 4X80H 1FNFA 4JRXD 4HKJB 3GBLA 4HK0B 4KXZI 4DUVA 1EAJA 4ZTPL 3U9PH 2P46B 4LAJH 1KPVB 1S9VB 1D6VH 3O6LH 5C07A 4CW1B 5C08A 3MBEB 4K2UH 1Z5LA 4ZOAA 5A2LH 2H1PH 2J6EL 1IL1B 4U33A 1WBXB 3A6BH 5CD3A 3WHXA 3EYSL 5ANME 4TUKL 2HLAB 2W38A 3V4PH 4F37F 1LK2B 3WNPA 4FQHB 3NA4A 5F7DB 5BV7L 3VFOA 1QFWH 4KQ4H 5JO5B 4NQSA 4WUUE 4ONHA 2NW3B 2R0WL 1EJOH 3GBNH 4PRBB 5SWSE 3ULVF 4Y88A 3ARFD 3QJFA 4Y4KD 1IC4L 4O5LL 2KQMA 2WWMC 1MCRA 5DS8A 1NL0L 3MREA 3VW3L 4LBEA 5B22A 1KB5A 3IYLW 1ZVYA 2V2XB 1X5XA 3WV0A 5SWSD 1AR1D 4UQ3A 1YQVH 1MAJA 3PWUB 1Y6MR 1SJEB 9CGTA 3F7YA 3QQ9C 1RUKH 4NC1C 1BBDH 1FCGA 2VYRE 2CLRB 5KTEL 2ICWJ 2IPKA 3RWIA 5CZVH 4WEBH 4QCIA 1U8OA 1WISA 1DBMH 3LEYH 2FBJH 5HVGB 4YHPA 1RFDL 4N0CC 4NIKB 4OKVB 4MXQC 4YIQB 3O11B 2X4OB 4CVUA 2AK4E 1KIRA 5ACZB 5D1QA 4PJBF 3MGOA 4YE4H 3IFNL 4AIXA 4LCCA 1IEAA 4PRDB 1X5KA 4KH2A 1LEGB 1T4KA 3WLWC 5L88L 5DEGB 4Y4FB 2LFGA 3ARDD 1L7IL 1I8MA 4ODWA 2BVQA 3DPBA 4ZS7H 5SWSB 1QNZH 3ROLB 2BNQE 2ESVE 4KZEL 4M61A 3HI1A 3ARFB 5C0JB 4OCRH 4J8RB 2FATL 2ADIA 5L7XH 3B3IB 2IANB 2D4FA 2P1YA 3FOLA 1KF9B 4NWUH 5EIIA 4X7FC 4RNRA 1J1XL 1T66C 4KDWA 1MFDH 4NM8H 1C7SA 4PY8I 4I2XA 3ISWA 3ZL4H 3DUUA 4IDLA 1MCDA 3HB3C 2EC9U 4U6TA 1HINH 4HDIA 1Z9LA 1ROWA 3MV9B 3BFOA 4QHLB 4ELKA 2J7LA 1N0XH 1ACYH 3T4YB 3NTCH 2XZQH 5IEKB 4FNLL 4Z77A 1VA9A 4RGMC 3H9SD 3L95B 3VXNB 2J6EA 1NCWH 2CLVA 4PS4L 4ZTPH 1MRCH 5DS8B 3BHBB 3OKLA 1H8NA 4QXGH 1MCJA 4PREB 1UJ3C 3M17B 2PYFA 3LD8C 5DQ9A 3W39B 1OOAA 3PUCA 2C7UB 2JCCF 1I1AB 1OWWA 3VXSA 4Q7DA 5C7XL 1ZGLA 3QFJE 2F5BL 2VDLH 4JKMA 5GRXG 3WL9A 2X9XA 3U0PB 1MIML 1JWSA 5BV7B 5K9JH 2V2TA 5E03A 4XP1H 1FNGB 4P9HL 1QVOA 3QAZC 2G2RB 2RGSA 4ONGL 5DRNB 4S11A 5KS9A 5D7LA 3QIWA 4S1QL 4CJ1A 4Z18A 5IG7A 3KHQA 1HQ4A 3QP3A 3R0MA 1IMHC 4O5LH 3MYJB 2IADA 5IK3B 1UB5A 5E5MA 4XC1H 1LE9A 4J12A 3E2HB 2LU7A 2FO1A 2G60H 1A6UL 1EUTA 5IMLB 2DQDH 5C0BA 2OTUB 4YHZL 2CRZA 4J8RA 4JM2F 2EDHA 5LGJA 1CL7I 4E5XA 3RBGA 4E0RA 4EDXA 1ADQH 4JFQB 4GJTB 1VFAB 2X44D 3QUMB 1Q9LA 5I16B 1SM3H 3FZUC 4L8SB 3T0EA 3CFKA 2GCYA 1XF5A 2DLGA 3H3BC 4P0DA 4RAVA 5EBMB 5D93B 2O61B 1CICA 3P4OA 4QO1A 4LHUD 3HI5H 5I76A 3TJHC 3TBWB 4XNYH 4NO5A 1U8QB 3ORJA 1G9NC 3VMPA 4LCWA 4PJFB 4WU7A 4RWHA 2OXHA 3T0VA 2HKHL 3OG6B 4LPXA 4G8EA 1FZOB 4U0RC 1GPOH 5JR1H 5GGVL 4G5ZL 4L3ED 1PEWA 2DLEA 1CFNB 5F9JA 2X10A 3ALPA 2E8ZA 3TO2B 5I1DB 5KVEH 2DMKA 2DYPB 1RIHL 3RX5A 5FDWA 3F7PC 2B1HL 2VL5A 4L4TA 1NMCC 2E9WA 5B4MD 1YMHA 2HAZA 2WUBL 3PDGA 4BSVB 4HXBH 2H6PA 4RDQF 2VZSA 2EC9T 3WNNA 2ZUTA 2LV4A 3JV4A 5E99L 2Z35A 3MJGX 1DN2A 4HS3B 2CH8A 2X4NA 3LKQA 4MQXC 1HHJB 2A9ML 1MCBA 1U95A 1II4E 3I2CL 2YUWA 3B9KB 1LNUB 1TZIB 4FG6D 3JVGC 4MA7H 3SE9L 3UCRA 1QKZH 4DKFH 2QV2A 1M4KA 5E5MB 2CJUH 4E41A 1N64H 5EZLA 4X6EB 2I9TB 3VDBA 3PF2A 5E94B 2APXA 3MBEC 5D1ZA 2P5WA 3MO1B 1U8LB 4GLRI 4R2GD 5D8JL 1AGFA 3IKKA 4K7PY 1HHKB 1S9WB 2X4UA 4MCYB 1IKNC 5T5FH 4MS8C 1S7TB 3PWLB 4M93B 4JFQA 1S9YB 1ZA6A 4WO4B 1G7QA 1JWMA 2Y5TA 4UTBL 2FEDC 5FYLH 3O3DB 1G7JA 1TVBB 4KC3B 3RJQB 3ME0A 5J89A 1RULH 1CD1A 3UTTA 5SX5K 3EOTL 3CZFB 4D9LH 3V4UH 4LLQB 4P4KD 4Y5YB 3RL2A 3IJYA 4OZ4B 1QBLH 2AQ3A 4QRQB 4MJ4A 5CIPH 4DEPB 3FT3A 3HR5B 4C83A 3MLPA 5CGYC 2GTWB 3OJMB 2NY2C 4PRAB 2APVA 4GKSA 2EDKA 4PGDB 1OAZH 1G1YA 1T7XA 4H0HB 2Z4QB 5E2UH 2R4SH 4I77L 1EO8L 3KAAA 1I3GH 2WINA 1IT9L 4ODVH 1W0VB 3OAYH 4KK5C 5IT2H 3HN3A 2QBWA 5B8CB 3QEGH 3DMMA 1YEHH 1NANH 3IVKA 1ZGLM 2DTSA 1XF4B 2G5BB 3QIBD 1GPOL 5HDOA 1Q94A 2BERA 3CC5B 3HPJA 5LCVL 2YD7A 3KJ4B 2DL2A 1PG7X 4BELD 2AEWA 4APQC 3KPQA 3X14B 3UAJC 3QIUC 4LEXH 4G43B 1KSRA 4KKBD 3TBYB 1FBIH 1G0DA 1PKQE 1RIHH 1FNHA 4Z8FL 4MNQE 1CQKA 4JPWH 2I5YH 2D9QB 1I7UA 1HI6A 2HJKA 4JJHA 3TN0B 1PFCA 4GKNA 3H9SB 4P2OD 4S1RH 3T77B 3BI9X 1U3HA 3LKRA 5HI4D 2DJUA 5ACMA 1VACA 2FZ3B 4KV5E 3BW9A 5DTFA 4UUJB 1MRFL 2AJXL 1FLRH 5ISZD 4X7DC 4ALAL 1P1ZA 1A4KB 2A9MH 4LLMA 1AD9B 4JAMB 3DX9B 5CGYD 5DJYB 3GI9L 3GB7B 2CDGA 4PJGA 4JZJC 4QRRD 2FBOJ 3UTSA 2BXZA 3NBNA 2PR4L 1GOHA 4JPKH 4OM0L 3S97C 1ND0B 1FVDA 2IGFL 3IU4L 4JDTL 4AM0B 3FB7B 5F7UA 2H2SD 3GSNH 4FFYH 3ESVF 5F1SA 5F7KC 4X99A 1MI5B 4P5TB 4L5FH 3EHBC 5IIEB 1K4CA 4PJXA 5EO9B 3CFBB 4D94A 3IDGB 1RZ7H 4QXTB 1I9IL 4R0LB 4U3XA 1AQKH 1P5VA 4R7DA 3UAJD 4OZIA 3C2AH 1A6TB 1N26A 1JNHA 1AO7A 1MHCB 2XYCA 5GJTH 2HLFD 3MODH 5E6IC 1KTKE 2HRLA 1AHWC 3F58H 3FQNA 4XMKL 5BMFH 1EX0A 1JF1B 1T0NA 4LNVA 4PJ7F 5DXWA 2B5IC 5HHVH 5B38A 2UVFA 3O8XD 5DURB 5FCSH 5J8OA 4MA3B 1X5AA 4QXUL 5I18H 3C5JB 2BJML 5EBLA 4OZHE 4S1DD 4WI7A 4X6CB 5EO0B 3UJIL 3WFZA 3CFJA 1OCWL 4JN1H 3O45A 3ZDZE 1JF6A 1JJUA 5I75B 1A14L 1RVFL 2IAMB 4K9EH 3V6OA 1J86A 3KYKH 4PJ5E 4F7PA 4IHOB 3G6DL 4NKIH 1T21B 1M1SA 2BC4B 4IIQB 3IT8D 4NPYB 3P9LB 4HUVA 3QFDA 5CEYA 1NUGA 1JYWA 2ITCA 5KSAB 3RTQB 1P4IL 3BEVA 3CNKA 1KCRH 4NN5C 3VFSB 3P4MB 1P1ZB 3L6FA 1GHFL 4PRIE 2DM7A 5AZ2H 3V7MA 12E8H 5AZEH 3O8XC 4M1CC 2EO1A 1BVLA 2UYLB 3D6GA 2X89D 1UCBH 2DKUA 3Q5YA 4JVPA 2YD6A 4OCLC 1G7PB 1FPTH 1TNNA 1ZSDA 3P11L 1J8HB 1FVDB 3BKMH 3PGCB 3QJHB 4AM0A 1CGSH 4G8FA 5ESQA 2YD1A 1IFHL 2FX8L 2G5RA 2VAAA 4PGBB 5C7XH 1AKJB 2YKLH 5CJQH 2AXFA 2K9UA 5F71A 4HIJA 3DVNA 5FKAB 3H9HA 4HXAL 2EXWC 4NKMA 5MI0C 1NMAL 3O9WA 1Z0MA 3BP7B 5IOPA 3BGFB 2UZYB 3VXOA 4K94H 3OSKA 4X83A 5HYQA 2DQJL 1KB9K 4EJ1C 1RJYA 1RZ7L 4MNGB 1E6JH 4K3JL 1LP9B 4J1UA 4ENEC 2ENSA 4WHYG 4XVSL 1MJJA 3RI5F 5KS9E 4RMWA 1KPUB 3MLTA 2Z91A 1QLRB 3B8YA 1OGAD 2A38A 5HHVL 4Z78A 1DEEB 2V5SA 2NLJB 4EVNA 3LQAC 1A7BA 3G5YB 4FFZL 4MD5A 5TDOB 2YD4A 3KWWB 2GIYA 5IR1B 2X70B 2BVPB 3BH9B 4LHUG 5CJXA 3NCEB 5MEPA 2YR3A 4HFWA 4C54A 4Z7QE 4CW1A 3LKPA 3FO9B 1UXSB 4ZFZB 3TT3L 4NZTH 4PJDB 3KYMB 3O41B 4ZPVB 4DTGH 2IBBA 2AEQL 3MA7B 4CU8A 3SQOH 5I1CL 1B0WA 2IFFL 1BLNB 2JIXD 2EXWD 3W2DL 1RURL 4M43H 1UA6L 4YC2B 4URTB 5F44A 1QA9B 5DI8A 4ZSOA 1IJ9A 3O4OC 5MERA 3UYPA 1MLBA 3GSUB 4XCEB 1Q9WB 2OQJB 5GS3A 3MBXH 5ESQB 3TV3L 1R5VB 4FS0A 3L3GA 3MLYH 1X7QB 8FABA 1IGCH 5CHNB 3FFCB 1D5MA 4BFGA 5I30H 4XCYB 2MCG1 3UBXB 1JGLL 1UACH 4I9WE 5GSRA 1MFEH 3SY0A 1QYGH 2YPVL 3GMNB 4JRXB 2NY3C 2W0FB 3EFFB 1KCRL 3BVNA 5D1QD 4U2ZA 2Y9RT 3EOYG 4YFDB 2IG2H 1PJ9A 1T1WA 1SJEA 3MRRA 3O4LA 1NLDL 2DQCH 5FECB 4BUGA 5EOQL 3VXUB 2AKRB 4ELKB 4YHNB 3ZYOA 1HYSC 4PV8B 3DVGA 1E27A 4OUUB 1UCBL 2BMKB 3PWPB 3ZMRA 4J4PC 2MJWA 2GYSA 5IEHA 3VWKB 4EUPB 4MCZA 2W0PA 4Q74A 4OKVA 5F96H 1U36A 4L8BB 5JIKA 4LSTL 2JF1A 4CN6A 3MOAL 4XHJC 4PJ9B 2I60L 4HK0A 1PSKH 5AUMB 4JHBA 2ZSWA 4Z7WB 5J7CC 1CDCA 1RK1B 3MJ8A 4X7CC 1F4XL 3KWWA 1DE4A 2AJZA 3F8UB 3SDCB 1RULL 2HKFH 1AE6H 5JHLH 2V7NA 5FCUH 3ARFA 2VDML 2E7LC 4N0FA 3RIFF 4EQ3A 5KJRH 3QSKB 1NCAH 2EZ0D 4JQIL 4HIEB 4TUJA 4NDMB 4E42B 3QDMB 1T22B 5TE7H 2WIMA 2WBJB 2C1OB 4AEHH 1NANI 2EYSB 2GT9B 5ID0B 1BM3L 4WI5A 1F11A 4KJPC 5E2UL 5HYJD 5TE6L 3P9WB 1NMAH 2DRUA 5C3LD 1U8NA 4X4YB 3W5NA 4GG6B 2YC1B 1FE8L 43CAA 3FRUA 1NFDA 3SKUD 2Q20A 4MA7L 4PPTA 2W9LA 3QFJD 1HYSD 5ANMA 2A6KA 1NAKH 4M3JA 3RVWC 3SDAD 5EOCL 1JZ8A 3FQUA 2GITB 3CGTA 5EU3B 3MZGB 5C8JA 5CHNA 5T1DL 1YMMA 4I4WA 1YYMH 2GK0B 4JFDB 4O2CB 2GY5A 1MF2L 4GRWH 3M17A 1OAYH 4KQ3H 5F9WC 2VO5A 3QDGA 3QNYB 3K1KC 4LMQI 3D39B 4KROB 3G9VA 25C8L 2QQKH 3G04A 3TBWA 3P4NA 4Z7UA 4UZGA 3MMEA 2W65B 1KUMA 1WAAF 3EJZD 3JV0A 1U6AH 4JDZB 5IFJB 4XBGB 4P5TC 1ZLVH 4GAYA 2VUOA 5FDYA 3HCVB 2YD3A 4YHNA 4YIQA 4UOW1 3BP4B 1U8MB 3W81A 1RU9L 3CXDL 5K9QI 1HXYB 5JLZA 2AQ1A 3H0TA 1PKQA 4TSCL 3Q6FA 1YDPB 4AMKL 4MZ2A 4U6VH 5IG7B 5D2LA 4HJGB 1SJVA 2R69H 1CGTA 1MRCL 1TCRB 1WBZA 2NY1C 2GTZB 5L9DL 3MZTA 5JHDE 5GGTA 4P23B 3T8XA 1KCUL 3QPXH 4LHUB 4FXGB 4EDWH 1KPRB 2L7UA 5IBTL 5B21A 3VFUB 3WUZA 1EEYA 4KUZH 5F1OB 2QADB 3R1GL 5AD0A 3QPQC 1VFAA 4NUGH 3F7VB 2ZOLA 1INQA 1NSNH 2ED7A 1M7XA 3KNBB 5D7JD 1T2XA 5FYKE 3P4OB 3B9AA 1A3QA 2PKDA 5GGUB 4P5MA 3MRDB 2VLKD 3L95A 4M48L 3WDIA 5FF6A 3N9GL 3VFTB 3MQIA 5E94A 3VFPA 4Y5VA 3OB0H 4NQDB 1J05B 3PWVA 4XXDA 1KTLA 5C2BL 4PREA 2VDLL 4N0CD 1P9MC 4HIIB 2VJXA 3BGFC 4P4KA 3HNVH 1EEQA 2VRAA 1CZ8L 3EAKA 3RI5K 1OP5H 3REWA 4WFFE 2B0SH 5C1MB 1QD0A 4OCMC 2BNQD 2ESVD 5D9SB 3WN5C 4MVBD 3NACH 3NABH 3ZDYE 4XI5C 2PR4H 4JPKL 2VDQH 1GZPA 3C6SA 3MGAA 1KIPB 2KUTA 4XBGA 1H0DA 2J8UE 1WSST 3MUGB 2HG5A 2P5WD 4KQ4L 4PRHD 1MUJB 4LCCC 1JE6A 4BFEA 2NY6C 3RVUC 3Q6FB 2W1NA 2PW2B 3B2UD 3WKNA 4M93C 2QADC 4Q6IA 3SCMD 4GG6E 5TE7L 3EJYC 4HXBL 4YUEL 2APTA 5EUOE 3E3QC 5GJSH 5C0CE 4KV5F 4W4OC 2XPGB 5ITFA 3I9GL 4DZ8B 3T4AB 5IB5A 1A6WH 4LP4A 1ZLWH 1HN1A 2RFXB 2Z31B 3KGRA 3QEHA 2LTQC 3CC5A 4EDXB 4RFOL 3PL6C 1LEKB 4HC1H 4U6VL 1ULVA 2DF3A 1G7HA 1AGFB 3LKNB 3PABA 5J6GA 1P7KB 2NY1B 5EU6D 3DBXA 1LWRA 4NSKA 4IMKA 3OR6B 2R1XA 3JBG7 1KYOK 2XN9B 2ZOLB 3AVEA 3TN0A 2VDRH 5EIVA 2VLJE 5GQBA 3IDNB 2EDYA 2A1WH 3QIWC 5DUBB 4LLWB 3TH4T 4WU7B 5L2KB 1RUQH 1VACB 2VLLB 5EU6A 1S7WA 2OCFD 1XF1A 1PDKA 2JK5B 4I3RL 3VE0A 2QADD 1CR9H 4GKSB 4OFDA 1J0JA 5D2NA 1A5FL 2AJSL 5IW6A 4KZEH 1DVFC 4FHBD 4EDWL 1FFPA 2E6QA 4R8WH 3FFDB 1FRGH 5E99H 5HI5D 4RZCA 2DIBA 2FJHB 4H88H 3IU3A 2J6EH 5DWUH 3BAEH 1CGUA 2EH8L 4ZYKA 2R2BB 4HKBB 3ESUF 4WW1B 4Y4HA 3WS3B 1NGPL 5J9PB 5AZEL 4TYUA 2I9LA 4G9FB 4PRHA 2CD0A 5A2IH 3ULVC 4OD1H 2D7NA 4P2QE 5FGCB 1NAMB 5CSZA 2P24B 3ARBC 1P7HL 5ISZB 1X9QA 1JV5A 2ADGB 2WMPA 2VITB 3HAEG 3RNKB 2DICA 2CR3A 4F3FB 2BNQA 2ESVA 4NJ9L 1AO7B 1MHCA 4ZO8A 3RUGB 3TJEL 2FEDD 5DK3A 4OGXH 1Q0YL 2FLBT 2BOBA 3MRFB 1UB5B 3PJSB 3WFHA 3WE6B 3ULUF 3QFJA 1ZT7A 1T03L 1U8LA 5D7LD 3NCYP 1VPOH 1DQML 1KEGH 4JGMA 1SBSL 3C9NB 3U9UA 3MJ7A 2B0SL 5HYJA 1XGYL 3MACH 3MV7D 2OK0L 1F90L 1G7JB 1TVBA 2WW8A 4ODHL 5CZVL 4HGMA 4JRYA 3RU8L 4UB0L 3QG6B 4KDVA 1IQDB 4PJCB 4LOUD 3C6LC 4WWKD 4DGYL 3VRIB 3DYOA 3V79C 2Z92B 1OAZL 5KSBB 5IMMB 1HHIB 3THMH 3HG1B 1CICB 3UBXI 3ARBD 2NXZD 5JPMA 4BH8A 5EN2B 3L3DB 4JRXE 2QEJA 2J3SA 4LCWB 4PJFA 1NFDF 4WGVB 1ONQB 3BJ91 1A7OL 1TQCB 3GJFB 4P57A 3UTQB 5GGQH 5EWIH 4QXWA 2BY0A 3MV8E 2VDOL 3QI9D 2O5ZH 3RRQA 2H45A 3HRPA 4MD4B 3OX8B 1R24B 4IMKC 3LN9A 3LVEA 1C1EL 2DI9A 4QRPA 2ID5A 5K9QG 3TO2A 1TZHA 1SBBA 2DWDA 2P5EE 3FO1B 1D5ZA 3VFOB 2NY2B 2VL5B 5F9DC 3W0WD 5DT1L 3TA3D 1A5FH 2AJSH 2HH0H 3CCHA 4Y4HB 3UTSE 3WS3A 2VZUA 4QXGL 5KSAC 2WBKA 1K8DB 3WIHH 4IOIB 1E4XI 3L5WA 2MCPL 1BGXH 1FZKB 1I9JH 3ZKSD 4PGZA 5FB8A 1F3JB 1H3UA 2APFA 3VWKD 2ADGA 3BIBX 5CKGA 1OB1B 4Z0XA 4F8QA 2J88H 1UM4H 2XA8L 3DWTA 4AG4H 2XG5A 3MFFB 2HMID 4PS4H 4X6FB 3ABZA 4NQDD 3BP7A 1S7QB 4MD0B 4F15C 5IOPB 4GAFB 5CZXC 4D9QE 1CT8A 3FCTB 4Q58C 1AXTL 3U0TA 1A9BA 4KRPD 3WFDL 3VGGA 3QEQD 1NCBL 5HGBB 4AQ1B 4DGIH 4MNQA 3AREB 3F12A 5D1ZB 3S4SA 3V9FA 1DQQB 4ZUWB 4NQVA 1U8KA 3E3QE 5CCKL 3ZYJA 4NKIL 1JFQH 4JVUA 5AAWA 1X4XA 4HV8B 1Q0YH 1W0WB 3MGTB 4G8GA 3RIFK 4I48A 3VRJB 1IEAB 2NXYC 1EEZB 1ZHLA 1EPFA 3LKOB 5FGRA 4PJHE 1DCLA 3P0YH 4MD5B 1HHIA 3QIUD 2QSVA 5SWSA 1CK0L 5DJZA 2EDXA 4QRQA 4DW2L 4GW4A 4XMPL 3ARWA 1TITA 1HILB 3KR3H 1MCCA 1T7VA 2EE9A 4H8WC 2DLIA 4L8CB 3K2MC 4ZXBD 2EE6A 1AHWA 1LO0L 2RB8A 3P0VL 4Z7OF 1DBJL 1T03H 1MEXL 2ZJSH 4JKWA 5E4EC 2OZ4A 3QNZB 3D0VB 1GZQB 2HP4A 2WINB 3IJSB 4G3YL 3S96B 5HY9B 3SJVB 4DFIA 4C56B 3WFCH 4H5SA 5FYJU 1KN4L 2YWYA 5BS0B 3C8DA 3DV6B 3IVKB 2LU4A 3BYTA 5FUZL 1BZQK 2E9JA 4LGRB 1MJ7H 1RZ8A 2DM4A 2IALB 2Z31C 3V5KB 1X4YA 3GSUA 3V8OA 4XCEA 1NGWA 3ROOB 1RZJL 3BPNB 5B39A 3FOMB 3VD9A 4U2YA 1NFIB 4PY7A 4R4NC 2JJUA 3FRPA 3L5WB 3TO4B 5GISL 2YBRA 4PFEA 3PWPE 1K3ZA 3TN0C 1A3LL 3O4LD 1I8IA 3WIIL 5L2KE 2IQAA 2W9DL 4Z0XB 2VXTH 3KYNB 1F58H 4HWEH 3ARGB 1IGTA 5KVFL 1TNMA 1I75A 1HYRC 1S9VA 1KXQE 3QIUB 1U3HB 2ADFH 3V4PL 4Y2OA 3L9RB 5FM8A 3Q6GL 3BH9A 1E4KA 5MEPB 2LABA 3MJ6A 1IL1A 1JPFB 1B2WL 3S8WA 5FOJA 2H2PC 4U1MA 5L8LB 1IFHH 2MNUA 35C8H 4NKOA 4B50A 4B5EA 4PB9H 1G9NH 4PJCF 3SE3C 4OZGE 1RIVL 2Z8WC 5I1HL 4OF6A 3IXAA 2XQYK 4NQCD 5JO5A 5KSBF 3E8UH 4MQSB 2VIRB 1I3VA 2OMNA 3V8CA 1A0QL 1ZSDB 4HWNA 1QEWB 4JZNB 5F7YC 2A6DA 1T89C 2JIXA 4G9DA 1JGVH 1NDGA 1JGEA 3KPSB 1BIIB 4Z8FH 2P8LA 4R7NB 5MERB 4DEPC 3T3PF 2J4WH 3SDCA 3U7WH 1NGZB 2R2EA 5D1XD 4M7JL 5D7JC 2JB6B 3CFBA 4ENED 5K9OA 4DFHA 2VMFA 4LASH 4YHYB 3R0NA 5IV2B 4MJ5A 3PWUA 2HRPL 1MI5E 2VABB 4DOHE 3V6FB 3BDYL 5HXMA 5HYQB 3O9WC 4QNPF 4DZBA 3FQNB 1ETZB 2IPKB 3RWIB 4KHTH 4A6YL 1JF1A 4QCIB 4KVNH 3QUZC 3RGVD 2NR6C 2OP4L 3T0EE 2Y6SD 1MPAH 4Y5VC 1BFVL 2AQ2A 4KHXL 3ZYZA 2AKRA 2CSPA 4WW2A 2VZOA 1I1FB 1O7SA 1T04A 3WFDH 3BH8B 3BE1H 3HUJE 1DEEA 4LLDB 4JHZA 4YC2C 4XMPH 5EU3A 3WHE0 1IRAY 2ZNXA 3AS0A 5C2BH 3EYQD 1M7IB 4NQXB 3NFNA 3GBMH 3X3GH 1E6OH 5B39G 3NH7H 3WMSA 5GGTH 5SWQA 1UC6A 2HT4D 5GS2H 2F54B 2J8HA 1AFVH 4WWKB 4M9PA 3EZJB 4J3SA 2D7MA 1I85A 1LILA 1TPXC 2APWA 3CXHK 3RVVC 3OPZL 4P3CL 2CQVA 3KYMA 1FQ9C 3MV7E 5CD3B 4Y4FC 1WFNA 3MLYL 2GI7A 3ARDC 4NKOB 4M3KB 5HDQH 1CE1L 5C0AA 4HJGA 4LVHB 3ZHDA 5D71L 4XNZC 1FRGL 1FAKT 5FUOH 4K7PL 3HE6C 4OCYH 35C8L 1SM3L 2P8MA 1BFOA 4WENB 3AMLA 3QZWG 3EBAA 1QLFB 3BHBA 4H20L 3MUZ1 4NNYA 4IM8A 1VADA 3VA6A 5DD5H 3W39A 1DSFH 3FQUB 4OLYH 2HFFA 1WIPA 2ZCHL 1LE5A 1SMAA 1DQJB 3U82B 3AUVA 4M1DH 3I75B 2VQTA 3CFIC 4M7JH 4N0YL 2OR9L 1ETZA 3VXME 4F7MA 5CJXC 1DQLH 3HB3D 3MRDA 1WCBA 2V17L 2XTJE 3P4NB 2V9RA 1FCCA 3QDJA 2YRLA 4L8BA 3PWNA 4F7TB 1A6UH 3DNKA 3VFPB 3ILQC 1PY9A 2B39A 4YWGL 5AWNL 2XWBA 5HHOD 2DJSA 4GRLA 5TGBA 4Z78B 3PV7A 3MJ8B 4RMUA 4K94C 2J1KA 43C9B 1AQKL 4EI6A 1P69B 4FTVE 3REWB 3VG9C 1QBAA 3D18A 5LQBL 4YZFE 2XI9A 4LK4A 4C4KO 2E7BA 4NDMA 4H88L 5ICZB 4YGAB 1T22A 3LQZA 32C2A 4HH9B 2ED9A 1KIPA 4WY7L 3A6CL 1U3JA 4XPTL 3DSFH 5E00B 1MIEL 5FHBL 3S3PA 4BZ2H 3SDAC 3HKFA 3TBVB 1RSFA 3LD8B 3O41A 1D7FA 3OKKB 5FV1L 2QKIB 4TQEL 2Y72A 4PJHA 2VDNL 2HTKC 3C6LA 1EFXA 1U8NB 2BJMH 3MTRA 2Q8AL 4MA1C 1C1EH 2CMRH 2YHGA 1REIA 3MV9A 4QHLA 3P30H 3VFVA 1XEDA 5IW1A 3F6IA 2ZUUA 5I66B 2VB5A 1WZKA 2H3NB 3H9YA 4NHCL 3VFTA 5ALCL 3MJ9A 1QLFA 3DURA 2R2CA 4JPIA 1V3JA 2BNRD 3OJDB 1U3HD 3QDGB 2R9HC 3LZFL 4PLKD 4NC2B 1LK3H 1EHAA 1E4WH 4PJ9D 2X7LA 5EZOH 2RCSL 4HXAH 1I3GL 3DETD 5DJ6B 3LHPL 3NA9L 4LVOC 1WCBB 3SE4A 2VN7A 3CLFL 4GRLD 3UTZA 5J13C 1GVIA 4F58L 2HTKD 3P0YL 3OR7A 2H41A 4F9LA 2RBLA 3LS5L 1BBDL 4AEEA 1J88A 4P5KA 5C08E 4YHOH 1HQ4B 2GTZA 3QG7L 3S37X 3TNNB 1QG3A 4GMTL 2HTLD 1EO5A 3FFDA 3UPCA 1PZ5A 5CP7B 1WFOA 2BHUA 4KI5E 1C5BL 3WHE1 5H35A 1C08B 2YPVH 5J9PA 3IF1B 3MXVH 3I85A 1CFTB 5KAQG 5T1LB 2ARJB 1CFSB 2YUVA 2P45B 3V5DA 4WUUD 5EZJA 4KTDL 5FYJL 2QL1A 4XWGL 1R3IH 3O45B 5D70L 2VITA 5F7NC 3CFKB 5I1EH 1YA5A 2BNQB 2ESVB 2H32B 5EU5A 1HHHB 1PEZA 1PVHA 1RJZA 2BCKA 3EO1B 4UIKH 5DD1L 2XN9D 5ITBH 1A64A 2VXUL 5C0CD 2FH8A 4G3YH 4P59L 2VLKE 4PRNB 4Y5VB 4G7YL 4HUVB 1ZT7B 5CEYB 1MIEH 4BZ2L 4NP4L 1JTOA 5GJSL 1QNZL 3R8BB 1CLZH 4TQEH 4HIIA 2FSEB 1KIQA 1ZLVK 1U3ZA 1ZHKA 4WHDA 3ZE1F 2WBWB 2Y07H 5T1LD 3RWJA 1HH6B 4LQFL 1H5BB 3MRNB 4YZFF 3QIWD 1WIUA 3RY5A 4M7LL 1BVLB 3P0GB 4GO6B 3OKNB 1A6AB 2VQUA 3ZSTA 2R2BA 3A0OA 5F1NB 3FB6B 3MRKA 4OI9A 1OWRM 1CF8H 1QYGL 4NN7C 4ODSL 3ILPA 1BHGA 4PJBA 2AXFB 4YFEA 2WM0A 3GJFA 1IGMH 4OFPA 5FV2A 2IAMC 2X4QB 2O5YL 2Z8SA 1EUUA 4LSUH 3ULUD 1KB5L 2UWEE 4N0UB 4WV1C 2K3TA 2EO9A 2CIIA 1WC7B 5I1HH 1CLYH 4FQIL 1PZ5B 2WUCH 4PJEE 4AT6A 5EZLB 1AD0A 1OW0A 1EGJL 1KNOB 4A2MA 2CDGB 4HHAB 1JRHL 4WV1A 3P30L 1FNSL 4IOIA 1LVEA 4OGXL 5EU6E 3JZ7A 2XIDA 2B4CC 4WO4A 3IDNA 1DQMH 1Q38A 1TTUA 1KEGL 4F58H 4YHZH 1OGTB 4F9LC 4U1JA 3QUXC 4ZFOL 1XH3B 4WHTA 3ZO0A 1PD6A 1AY1H 1IBGH 2G75A 4EBQL 4AMKH 3O3AB 1XIWC 5BMFL 4UINL 5E2WL 1IGIH 3W11C 5HVWA 1GGIH 3AREA 5IW6B 5D1XB 4JO2L 3LKPB 4TTDD 4OZHF 4OCXL 1N59B 3QDME 5GZNC 5CJOL 3AM8A 2VH5L 3BPOC 5D7IE 1MJ8H 5HGGS 5TJWK 4ZYKB 3RWJB 4JDVB 3UJIH 3O2VH 1ADQL 3HNSL 1LEIA 2HKHH 3DXAB 3DRQA 5I71C 4LSPL 4RGNE 1DLHB 4HKZA 3ARQA 4YNYB 5INCA 2OL3L 2NY0B 1QSVA 2G5BA 4GMTH 1Q94B 1H8SA 4OFVA 3QI9C 2DLHA 3AGVA 2V2WA 4HUWA 5I17B 1GZPB 3QHZH 1BREA 4OJFH 2IAMA 1FO0L 4G7YH 3T0EC 2FH6A 4HKXA 3PDOA 5IF0A 5MEOA 2NX5D 3QNZA 4P2RB 3AC0A 4U1GB 2J5LC 4NN6C 3QNXB 5FO9A 3HC4H 2P5ED 1WWBX 2PW1A 4GFTB 1QR4A 4Y4KA 5IFHL 1R5WB 4X7TB 4FXKA 3VD3A 3LKSA 4NRZB 3Q48A 1A4KA 4NWTH 3ZT7A 3RAJH 3NIDE 3ARVA 5B39B 1U8HB 2AV1B 1EH9A 2EXYD 4ZXBA 5KVMC 4NOFA 1F3DJ 3BOVA 4HWBH 3VWJD 4ZQKB 3D3VE 5BW7A 3DO3A 2D0FA 2NZ9C 4LNRB 1ZAGA 3QIUA 4O51A 3R1GH 5GZOC 1K4CB 4NZRL 4PJXB 3TA3C 3GFUA 3HS0B 2JK5A 3OXSB 4R90H 4E42A 4MZ3A 2HH0L 4DKDC 1QSFB 3B83A 3G08B 4HFUH 2FBJL 4XVUC 3OJVC 3V4UL 3FO2A 3WUWG 2MTPA 1TJGH 2AV7B 3TGXA 1TZHB 2DWDB 2C1OA 4KJYA 1KIUA 5HHQB 5JDSB 3B4NA 1MHPH 4HULB 3S5LB 4KRLB 5DD6A 5J1AA 3SJVE 2UWEB 2I25N 5EC1A 4Q6YA 4PV9B 1KGCD 3DXAA 1K8DA 2X9WA 3KPSA 4YNYA 5INCB 2HJLA 4GAGL 3I6GA 1M05A 4XP4L 1YEEL 4NKQB 5JHDD 5T5NF 1A7PH 3GUTA 5E6ID 4KK8C 5I17A 5J3HC 2NLJA 4EVNB 1JWUA 4D9RD 1E4XL 3QZWA 4PY7B 1QRNA 5TDNB 5BVJB 5JOFA 3PGDA 5FUZH 4MNGE 4N8VG 3CVHH 5CUSL 1VSCA 1T21A 4LFHG 4IRSC 3M1BA 4RMRA 1UA6H 3D0LA 4LVNC 4OCSL 3D39A 1JK8B 1MFCH 4EIGB 1XR8B 7FABL 3HZVA 1YEHL 3KJ6H 2WP3O 4NC1E 3MJ7B 2X1OA 1U92A 2YPLB 3BP4A 5TQ2L 1FH5L 1U8MA 1J0IA 1NEUA 2VLKB 1A22B 3GSQA 1GCFA 1IQDA 5KSAD 2DDQH 2GAZA 4XBPA 4PRPE 3RWGB 3SBWA 1RIUH 4NC0B 3AY4A 2L4OA 3G6JA 3T09A 1KT2A 2GUOB 4OFYA 4CL7A 4G8FB 3BKYH 3WIIH 5JPMB 5KG9A 2XY1A 3BQUD 1FFOB 1ZE3C 4WWKA 1UEMA 3GSOA 3REVB 4OI7A 4NHUA 4YK4C 1WT5A 2VLMD 5DJ0B 1MIMH 1BX2A 3N50A 2Y4SA 3BVNB 1HKLL 3OX8A 5IFHH 4IS6A 4EI5A 3HFML 1YJDH 3N1QC 4N5ED 1INQB 3UO1L 4PTUB 1DVFA 4KJYB 5D72L 1FO0H 5F72S 3U30B 1OTUC 4HQQL 1FZMA 2I60H 4PV8A 5DD6B 5J1AB 1D5ZB 1YPZA 2R29H 3NIFE 4PJ5B 3TPUB 3SDCC 1JPGB 4MAYA 1GXEA 4DGYH 3NVQA 4M6AA 2A1WL 3HE7D 3DTXB 3I6GB 4LF3A 2G9HA 2Z0BA 1MCLA 4JFED 4FQJH 1KTLB 3VFNA 1OHQA 3NTCL 4P46D 2CDEB 4FNLH 4XNUL 2QSTA 3EHBD 3O4LE 5EORH 4K71B 3BRFA 4NP4H 1OAQL 1NC2D 1A7OH 2ATKB 2EC8A 3QIBB 4Q9CA 3WNKA 1YEDB 3S5LG 5DMGC 2DIAA 1XGQA 3D85B 4N1CA 1F8TL 3QXAB 4NO3B 5DEFA 1ZVHA 4X8XA 4LCIL 4QRRB 4KGJA 3FO0H 3NAAL 4D0DB 4WI6A 1BZ9B 3QCUH 1J10A 2BZDA 5HHMD 4HG4J 4ZPVA 3MOBH 1UB6B 2NY6B 2I24N 4OD1L 5F9OH 3FZUD 4X9IA 3RWEA 5INDA 1QHPA 4E41E 1YEIH 2AVGA 2UZIL 2WQ8A 4OQTL 2Y1VA 1RVFH 1MHPL 2X5PA 4XC3L 3FQTB 4S1SL 2JB6A 2V5MA 3QUZD 4TUKH 3RGVC 4KKCC 4ZNEA 4OZGA 1AGBB 4WRLA 4NJAL 4UIMB 4UDUA 2CLZA 3TZVA 1AXTH 5F7LB 4KUCD 4NKDA 1IGFH 5SWZB 1IC1A 4N90D 4FP8H 4OTXL 1M7DA 4L4TE 2PO6D 2O26U 4OZFH 2IWGA 3I02B 2W65A 4K7FA 4U49A 3O4LB 2NQCA 3U7AA 5D6DA 2R69L 4GQPH 4CVZA 1JPST 4I8DA 4FMFA 3TO4D 3RPKA 3KPPB 5CZXD 3TPUA 1CLYL 5ID1A 3PWPA 4N90E 3SBWC 2UUDH 2R0LH 4U7SA 5D7KE 2I07B 4GG8B 3TWCH 1F6AB 1A21A 4JPIB 3RVWD 3GMMB 3BZFA 4JY4A 4KRNA 2OI9B 3L3OA 3RL1B 4Y19A 2JLLA 4XP9H 2FYYA 4JZJA 3SCMB 3DRTA 5D1XC 1DDHA 1FNAA 5H94B 2FX9H 1DSFL 1KJ2A 1BJMA 4OLYL 1P53A 4LQFH 3EOAB 2V7NB 3VFUA 4M5ZL 4IRSB 2MPAH 5D72H 1YY9C 1ZWIA 3SE8H 5FUOL 2WSKA 5DD3L 2FX8H 2G2RA 3L1OH 4U3HA 4M6ML 5DC0A 4PJ8D 4D0DA 2NY1D 1ZMYA 3T04D 1N8ZB 1F11B 2R4SL 1BGXL 4I77H 3TM6A 3QBTB 4UOJA 1W8OA 5IROA 1IZJA 1IGML 1PQZA 2HLFC 1IM9B 3QUZA 1NH6A 1FYTD 4FFZH 4JFDE 2VLRB 3NCYS 5BXFA 1QR1A 3MOBL 5DMYA 2GSIA 3LAFA 5DJ2B 3HZYA 1X5FA 3DGGA 2HFFB 4KJQD 4PG9B 1P7QD 4F15B 4UIMA 2Y36H 2IH3B 2Q7NA 3BZEA 4GT7A 3IDYB 4XVSH 1CXLA 5I73C 3U7YL 5EBMA 2O61A 2QQLL 5HDLA 3IFNH 1SJHA 1RJZB 2F58H 3PNWA 3S36X 5GZND 1CR9L 2IFFH 3W2DH 4YBQC 5DFWH 5E1AB 3AY4C 3Q1SH 2IMMA 2XWJA 2ICWB 5ALBL 1QRND 5MENA 4P57B 1JGVL 3QEQE 5IJVA 3HZKB 3IS0X 2F54D 2FSEA 4K23L 4DW2H 1OM3H 4B7IA 5FYLD 4M62H 1CE6B 1HE7A 4P5KB 5EZOL 1FORH 4HT1H 3BPCB 5HYSB 1N5AB 4WVRA 5HDBF 4MXVF 4KJPD 4Y19B 4ELMB 3HE7A 1JGLH 3IFOB 2Z31A 5HI4C 1R5IB 5SX5H 1XGTA 1MJ8L 4OZIE 1XZ0A 2MKWA 5JORA 5DDHB 3FQRA 2F5AH 3TT1L 3ZDZF 4AK1A 3IF1A 2AXJA 1RUQL 1CFVL 3QDJE 1LK3L 4YO0A 2ICES 3AFLA 3QXDB 3JWOC 3RDTA 4Z7QF 5JQ6L 2CUIA 3C6LB 3NCBB 3B9KC 1BQLH 3FTGB 4LKXB 3LRSB 1HDMA 3AU1B 3D3VB 1JGDB 2Y25A 3GHBH 1YEEH 1HNGA 4OSUH 5E8DL 1PKOA 4R8WL 4JFYA 3LS5H 3C5SA 4HS8H 3MOAH 1V3LA 3FN0L 5HD8C 1WC7A 4K3GA 3V7AE 1KELL 3PHQB 3OB8A 5HTSA 2EKJA 1MQKH 4PBWD 4Y0GA 4XP9L 5D2NB 2W9EL 1MCWW 1BD2E 3HUJF 4M7ZC 2NX5B 1YN6A 4WI2A 3UPAA 3NFPA 3R4DA 2WWKT 3MREB 3MCKA 5I15H 1Z6JT 2VSDA 2WP3T 5LBSH 4KGLA 1FL3A 2NY7H 4TVSa 4HKBA 4GUPA 4G8GB 1OCWH 2CUMA 4WW1A 5F88A 5CBEB 5IFAH 1OAUH 2BSTB 5SV3A 4X5XA 1HNFA 4YDJA 3I75A 3TJEH 4MMXC 1ZTXL 2HRPH 3FT3B 3MXWH 4C83B 1BOGA 2H32H 4YHPB 4JFEE 1B3JA 5A3IC 3OTTA 4LIQH 4QRRE 3SDXB 3NZHH 4LLAA 1HK6A 4PGDA 2YEZA 5MENB 2ZG3A 4EZMA 5J12C 1CGYA 2BOBB 1GAFL 3D0VA 4OF8A 2R23B 4L4JA 4JDVA 4W81A 5B8CA 4ODWB 3OGCB 1CS6A 2NY5L 2E7LA 2EH7H 1I9JL 5HI5C 1UT9A 1YYML 1NDMB 2CKBB 1DLHA 4HKZB 4WU5B 2NYYD 1CU4L 2IALA 4KQ3L 3E6HA 4CADB 3V5KA 3TFKC 2GJ6A 3GIVA 4TVPE 4HBCL 3LQZB 3ELAT 4FQ1H 1ZT1B 3ARTA 5CJQL 5KVGH 4LLVA 3S36L 2PF6A 6FABH 1S7XB 2YN5A 3ARED 1DP0A 5HYSG 4MAUL 1FG2B 3PDOB 1BF2A 3UTTE 1BBJB 3DX6A 1VFMA 3WEXB 5ENWB 4YHKL 1T1ZA 5T3ZD 1MFBL 3SGDI 5D6DC 1JFQL 1K3IA 1N3NA 4L9LA 4HSQA 1HEZB 5I66A 1D5IL 4NYLA 1SY6A 3NPZB 5IESH 1MHHB 3MRCB 1OSZB 1JPFA 1HWGB 3VWJA 4D0CB 3O3BB 3OKLB 4HIHB 4F8TA 2NY3B 4N8VA 1RJLA 2N7BA 5E9DE 1RZIB 1XGUA 2C3WA 3AAZB 5BS0E 4PLJD 2ARWA 4PJ7B 2GJZA 2P4AB 5CP3A 2XA8H 2JCCA 5FM5M 1XIWD 5EORL 2JIXB 4G9DB 4D0BA 3VMOA 3SE4C 4RRPG 2JJTA 4QRUA 1E4JA 1WZ1H 3STLB 2V2TB 5JXAH 3MRQB 4LDOB 1QBLL 4UQ2B 4F7CA 1IAOB 4W4NA 1WEJL 4L29B 1MCQA 4JY6B 2UZIH 1O5DT 1FGNL 1WAAE 2PXYD 4KMTL 4MB5A 4NO0A 4S0TD 1CFVH 1FNSH 4I0PD 2W0LA 1FO0B 3QO1B 2DQGL 1N0LA 1WZLA 5DVKA 3VFWA 5JDSA 4F80A 4P2RA 4QRSA 4FQXA 5HGBA 4X6DF 4OGYH 1FAIL 2LU3A 3QNXA 1BQLL 5LG1A 2ARJQ 4HBQA 5F9OL 4OSUL 2ITDB 3MRHB 1C08A 3C9NA 3U9UB 2CRYA 3E6HB 3D9AH 4CADA 4F57H 3GIVB 2E9BA 2IEPA 3OZ9L 4OGAC 4C58B 1VB9A 3CDGA 1GGIL 5A2KH 1IGCL 5IKCB 2ERJC 1UM5L 4PJCA 4GKZB 2Y5EA 2HN7B 1JBJA 2R2HA 2J8OA 4H0IA 4KK6C 2EIZA 1NAML 1DTUA 4MDIB 1LGVA 1AI1H 1NUNB 3MLRL 4FQ1L 4JLRB 5FHBH 2NY0C 4YUEH 2AJUL 1N59A 3H7BB 2BDNH 2JELL 2NY4D 2AJXH 3ARPA 3QDMD 2PXYB 4MD4A 5LQBH 3LN4A 1JI2A 3BDBA 4HUXA 2VDKH 3VGAC 4O2EB 3TZVC 3CX5K 2NXZC 1KG0A 2P5EB 1KBGH 1NGXA 4G6AD 2I5YL 3BWUC 4RFEA 1G7PA 3V95A 2N56A 2W9DH 5AYUH 3PGCA 3D1MC 5T3XL 1E0OB 5HHOB 3TIDA 4MA1B 5JDJA 4UBDC 1QUNA 4UTAH 4OLZH 3U9PL 4HKXB 5K33A 5FB8B 4HEPG 4RFOH 1CD8A 1KB5B 1FIEA 1T7ZA 3BXNB 3VGEA 3QXUA 3JWNC 2E9IA 4Z0BL 2DBJA 5IHZA 5DHXB 5DJAA 1AKJD 2H1PL 3L9RA 1G9NL 2HFEA 2R4RL 4JFDD 4DK3A 4CDGC 3IJHB 2C3VA 4MYWB 4L3EB 4DQOL 3TIEA 1Q8MA 4Z7OE 1XF2B 1FHGA 2ZKHH 3W11D 3QDJB 3H7LA 5ESVA 1MCEA 2FJFB 3DUSB 2YPKB 1GL4B 1QLRA 4IOFD 1JNNL 3MGOB 4XNXL 3RKDD 2A6DB 4LCCB 1UZ6E 3CLFH 4WI9A 4K2UL 3T3ME 3SDDD 1U0QA 5C0DB 1BQSA 4N1HB 3P9MA 5H2BB 4Y2DD 3BDYH 4ZUTA 1J0YA 1A1NB 3HI1B 2FWOA 1INEL 1KT2B 1CVRA 2ATPB 2GUOA 2G75B 3HS0A 4HFWB 5IB2B 1K2DB 4JLRA 4XWGH 1F6LL 3MV8A 3I84A 4GRWF 1FAIH 4GBXD 4U1GC 1P4IH 1JHLL 4U1IB 4PJDA 5DVLA 3BN3B 2XY2A 4YBHA 4WGWB 3K74B 2VERN 4TSBL 5E6YA 3L7FA 5HYIA 3WJLC 5IJKC 3SJVA 4ZSOB 3PWJA 3QQ4A 3L1OL 4WFGD 5C0EA 5IWLA 1NC4D 3CSGA 5M95B 5MENE 4PBVC 3C60C 2HVJA 5LWYH 4YFLF 4YHML 3B5HA 1KJVB 1RUPH 5HHOA 4L3CA 1QRNB 3IDXH 1MFAL 1PW3A 5HPMB 4NFDA 1MFCL 4OCNC 2BK8A 2IPUK 1UYWH 1VGEL 1CIDA 4HJ0C 1UVQA 4K7PX 3DOSA 3W0WE 4AIZA 3OJ2C 2JELH 2EDRA 5FYKH 1BOYA 1J0KA 4YBLC 3EDDA 2BNRE 3LPWA 1VFBB 4NRYB 4N0UE 2F8OA 3MRRB 4ODSH 2JE8A 2EDTA 4JM2A 4NQEB 5F6IC 3IJHA 3WL9B 4I18C 1E27B 4LPWA 1BD2B 2XRAL 1UJTA 1PYWA 3EYUL 2XKUA 3O4OB 3PHOB 4P2QA 5DJYA 2Q76A 1QPPA 4ZS7L 1DR9A 4PRHE 1DFBL 4XNMB 4X9HA 5FA3B 1BZ9A 4FQLH 3DX7A 3JTSA 4JN2A 4R97B 1BZ7B 4WDIB 5C0CB 4KAQH 4U1KA 1QSFD 1XMWA 4P9MH 4O4YL 2P8MB 5ADPH 4DCQB 1QRKA 3PP4H 3REVA 2IQ9H 1S7VA 2JB5L 4PJXF 4QY8A 4FA8A 3WS6A 1JNNH 4XNXH 1DN0B 3KPRE 5D1ZD 1JN6B 5DT1H 5F9WB 4JQXC 4YLQT 1R3HA 4UDUB 5B8CC 1JMZA 4R4ND 2GY7B 2OS7A 1EHNA 1D5XB 4Y2DA 4LGSB 1FFNB 5JHDB 4Y19E 2VLJA 1WWAX 4F7MB 1HHHA 5CEZE 1T0NB 1SJXA 3HE6D 3JWDH 2VXSL 3T2PA 1JZ3A 2PO6A 5ETUB 5JQ6H 1NUFA 3PWJB 3O3EB 1H15A 1IM9A 4HS6A 4IJ3C 3ULSB 1CDYA 5J0BA 5I1LA 1I1FA 2VL4A 2YSSB 1MREH 4RSVA 1QR1B 2CDEA 4FFWD 5DJDA 3LN5A 4GRLB 1KIQB 5FKPA 4YHIB 1A8JH 4LLDA 1ORSB 4JFPA 5E2WH 1YMMB 4AL8H 2X4TA 3PGFL 2GK0A 2RHEA 4JFDA 5T3ZH 4EI6B 5D5MA 4LRIC 3GMMA 4F7PB 5MHSE 3F7YB 4FRWA 2V7HA 1AR1C 6FABL 4Y8AA 3O0RL 3D85A 4NQXA 5AYQA 1TQCC 2OX5A 4C56D 3ZHLA 4ONGH 1T1YB 2IH1A 3IDXL 3MA9L 5GRUH 4BSWA 3LY6A 1KCKA 4L4VD 5JA8B 4JDZA 5IFJA 3KPRB 3IFLL 4DK6A 5I8OL 3OKEA 3WHXB 3MCLL 4QKXB 3QR2A 2DQFB 4IRSA 3P4MA 5C0FB 1PYWB 4OLVH 4UNUA 1B90A 2X4QA 3CU1A 4OT1H 2BSSB 4UMGA 4XP4H 3Q6GH 5CGTA 2BX5A 2MPAL 5FOBA 4NWTL 5B3JF 2H3NA 3QXVA 1YN7A 3WJJC 4OV5A 4LHUA 1R5IA 4KTDH 3D2UB 1QOKA 3DURB 4GRWB 3G9AB 4RMTA 3JV5A 3MV01 3I9GH 5TE4L 2QR0A 3N0PB 3EIFA 2BRRL 1OTTC 1CDGA 4NKMB 4LRNH 2N4IA 1G7LA 3BPOB 2VZVA 1M7DB 1CDUA 5E8PB 5GISH 5C0BD 3IDIB 2BNUA 1KTDA 2X7LB 3U7WL 1CD1B 4M5YH 1JI1A 2MQ3A 4I0CC 5CJ5A 5D6CB 4W68A 1FH5H 1DEDA 5IBLC 3GGWB 3I2CH 3C5SB 4OIAA 1RD6A 2OM5A 4HFUL 2ZUQC 3QUXA 4LU5H 4C57C 1RY7B 5I1GL 4HAFA 1BEYL 5IB3B 3QUYD 4OZHA 3SKJH 2Q7YB 4EN3B 5JA9A 5HI3D 4KI5C 2XFXB 3L3OB 3MCKB 3SO3C 1N7ML 4J6RL 5B3JE 2RQ8A 2FYYB 3WSQH 2PYFB 4OF0A 3B9VA 4X4MA 5C3TA 3BP5A 1E4KC 5LAXA 1CFTA 3VXSD 3T65A 2YD9A 3ARFC 2D31A 2EDFA 2IH1B 1A2YA 1YC8A 3VG0H 3D3VD 4PBXA 1EHLH 1UXSA 4ZFZA 1AGDB 5HGHB 1S5HB 2YD2A 1H0DB 3CLEH 2DQFA 2OMBA 4NT6B 1CLCA 5GGTL 4PYGA 3RJDA 3IS1X 5D1QC 5KZCD 3W82A 4Z9KB 2QLVB 4OZFB 4PRNA 1LE9B 1EO8H 1T7YA 3OGCA 1J1PL 2ORBL 4NUGL 3FB8B 4LQ1A 2OQJA 3WN5A 3VXPA 4XNQA 2VXSH 2GJ6E 4ZDHB 2IH3A 2YPLD 1T0PB 1MPAL 1D6VL 3MRNA 3UBXA 1VPOL 3IAPA 4YEEA 3TFKD 3Q0HA 5IBTH 3OKNA 2R1XB 4OCYL 5CD5D 1IGIL 4DKEH 4KUZL 3TNMB 1I1AA 2GJ6D 3C8HA 2FJGA 4EXPX 4KY1H 4X5XB 4CVZB 5DRZA 1G7MB 1XGRA 2CJUL 4MA8L 1T2QH 1NMBL 4OLEA 3DYMA 1JRHI 1YY9D 3UO1H 2W92A 3BKCL 1ES0B 3SGEI 1TJHH 1D9KB 1T66D 5IFAL 2I07A 1FFPB 2OR9H 4A2LA 3EKCA 3DHMA 4U6YA 3MV9E 3FB5B 1FL5A 3GNMH 1IILE 4YK4B 4OFKA 4JM2C 3DRTB 3QWOB 1KNOA 4ZD3L 1BEYH 4MQ7A 4ODTL 4KTYA 1NLBL 2HJLB 3PP3K 3BGMA 4CUCA 1NAMA 3RDTB 2J5LB 1GGUA 2ARJA 1FFQA 4XP6L 3C2SA 3HC4L 2IANE 3STZB 2W9EH 3QZWB 3CVHA 3T0EB 3MYZA 2LVCA 1WF5A 1W72H 4ALAH 3U6RA 3D39E 2FHBA 1MH5B 3BUTA 5DYOB 1SYVA 3MUJA 3ARBA 2QSCL 3FO0L 1U8QA 3O2VL 2A6JA 4YDIL 3AXLA 1C7TA 3IFPB 4NQCB 3MODL 1NFDB 3EFDL 4XP5L 2AK4B 2EE3A 4QGTA 2C4FT 1IGYB 2ITDA 2OL3H 3WXWL 1S9WA 2X4UB 4JRYD 4M9OA 1CFNA 3VXPB 5KSVB 2CKNA 3GSNL 4R2GC 5IVXE 2JJSA 1FDLH 3T2NL 4YHKH 4J3UA 2FLRT 4LEXL 4L4VB 4L5FL 1DUYA 4XVTH 1F02I 3NCJL 5CBEA 4ZO7A 1RAMA 1UYWL 2R2HB 3HG1A 4OF3A 4FN0A 1NC4B 3BGAA 5GS0D 5F1NA 2NPLX 4NZUL 4LDLB 4BH8B 1HSAA 1R3LA 2Z31D 2Z35B 1UWEH 5I8CA 3E1F1 1EGJA 2EH8H 4PJBB 4L3AA 3MLXH 5MEOB 4LSQL 3PQYD 1ZHBB 2NY2D 3HZKA 5MEQB 1P84K 4P2OB 1CVSC 4BA8A 1A7NL 1FL6A 4GAGH 4Y4KB 4M6OL 4JCMA 3HA0A 4FXKB 4ONOA 1G9MH 4L4VE 2VDRL 1KPRA 4YXLL 3VDAA 1T1XA 4UV4H 3EO9L 3TCLA 4WV1B 1A9EA 4PLKC 1CIUA 4ODBD 5FEBA 3VFNB 5IESL 3N1FC 2C1PB 5HVFB 2VC2L 3F7VA 4HUKB 3FMGL 4OZ4A 1Y6NR 4JFOB 5ILTL 3VD4A 5TDOA 5DK2B 3GRWH 4U1JB 3SPVA 1D6EB 1UH3A 4QHKI 4JANB 4PRID 1CXHA 4MDIA 1DZBA 2FEEI 2GTWA 4XBEL 1NCDL 5LGHH 4GRWE 4AIOA 1J1OH 3BO8B 4U6HA 2J8UF 3N85L 4ZD3H 2Z8RA 4UIKL 5DD1H 1RZIA 1XGUB 3AAZA 5ESVB 3VFMB 3DMMB 4B53A 1AI1L 1WVZA 3MGTA 1OTSD 3UDWA 5L8KB 5C0BE 1B2WH 2JCCB 1MCSA 4NO2B 3ZDXF 5ICXA 3C8KB 3AB0B 1CFQA 1NGXB 5DC9B 3UYRH 1MI5A 3KVQA 3KPQB 1KB9J 5DO2C 1V5JA 3R06A 1C5CL 1LO4H 5J4MA 4M03A 1NKRA 3FQTA 1R5VA 2ZP0T 3GHBL 2V2WB 4HUWB 1EXUA 4LLUB 5CBAA 3OKOB 4LHQB 3MOQA 3ZKXB 1I9EA 2MSPA 5CLTA 3LH2L 1Z3GH 4R96A 3MLUL 2FCBA 1OT2A 3LPGA 4U1IA 1RHHB 3K8KA 3H8NA 2BDNL 3OZ9H 2FECI 3PL6A 5IHLB 2UY7A 3V6OE 5B38B 4DTGL 3BKJH 4UUJA 4YX2H 4KKNA 5FO8B 3MRHA 5C0EB 4KKBC 3GMPB 4Y4HD 3KLAA 4YPGA 3ZE0E 1P7QB 2BMKA 4HT1L 2GJ6B 4P2OC 4ZNEE 3DBXB 2KH2B 2VWEE 3UTSB 1U8HA 2AGJH 3WXWH 3QCVH 1UWEL 5BZDA 3DYPA 4CU7A 5ERWA 3B2VL 4K9EC 3G6JB 3KLHD 1BJ1J 5DUBA 1AO7E 4UV4L 5L2KA 3VH8G 3A67H 3H7BA 5C08B 1MCPH 1U8IA 1BQHB 4LLYA 2F8XC 1K2DA 1E6JL 1VEPA 3SEPA 4UV7L 1A1OB 4JO1H 4X5LA 3NPSB 3K4DA 4P2QB 3VWJC 2EYTB 1CF8L 3G08A 3GMLA 1AGEB 2FRGP 3HAEA 1GGBH 3JTSB 4JN2B 4JKKA 5F7DA 2FO4A 4I1NB 1QBBA 5F89A 1LO0H 1L7IH 3PE9A 3SGDH 5GS2D 3KPMA 2I9LB 1K5NA 4HIXL 4D9QD 3GI8L 3UP1A 4F9PC 1ZT4A 5GPRA 3QPQD 2BOCA 5IM7B 4JGJA 4DQOH 4R4FH 3PG2A 4JY6A 1BWWA 2DQCL 1JRHH 4LSVL 4H20H 2FIKB 4NPYA 5C07B 2C4FU 3VXQB 2I27N 3IETB 4M8VA 1S7RA 3PL6B 3QHZL 2NY4C 4L8DB 3RVTD 2H9GA 3AMKA 3QDGD 3SKNA 5FYKU 2XWTB 1U8OB 5J3HD 2IMNA 4V2CB 1B0GB 4OQTH 3ZYIA 3I3DA 4J3VA 1PAMA 5FGCE 4G7VH 5D96B 3O2DL 5ACZA 3OXRA 2EIEA 1C5CH 5DZLA 3JVGA 3QWQB 3MXWL 4JRWA 3CH1A 4MA8H 5I8EA 5HHPA 5KSBA 3RZCD 3OKDA 1U41A 5E6ZA 4Q0XH 2D03H 1AKJA 4YXKL 1I85C 4CRPA 5E70A 4DKEL 2DMCA 3DVNB 5FKAA 5DDHA 3GKWL 5EOQH 1MSPA 3LQAL 3IDUA 1RUAL 3DX8B 1MRFH 3KPRA 2J8UB 4JR9H 1A0QH 2EH7L 4NKDB 5L0QC 1N4XL 1A1OA 3JTTB 3ARUA 5I75C 3VXOB 3GMOA 1X4ZA 3X12A 2BVYA 4LSTH 5C07E 3LRSA 1QA9A 5DI8B 5C0AB 5J13B 2VLJB 5EFIA 4DAGL 1RHFA 4MNGA 3ZLQC 5DVMA 1A4JB 4F7EA 1F97A 1LP9A 3H42L 3MJ9H 5FOBB 2XQYG 4AEFA 3K46A 5CFHA 4YR6B 3VXNA 2ADFL 3VD5A 3NFSL 4X9FA 2CLVB 3DI3B 1SEQH 1N0XL 4AYFA 5HGDB 3GHEH 4NNYB 1YN6B 3DIFB 4UT6L 2HWZH 4PLNC 4PJFE 3A67L 3GSNA 3JWDL 3OAZH 4Y2DC 2Y06H 4PJ5D 3EFFA 1JZ5A 5H94A 1ED3B 5ALCH 1S8DA 3MSPA 1L9MA 2Y6SC 1F6FB 3IDIA 3WBDA 3DGCR 5HGAB 5ELIA 3QCVL 5FIEA 5C2UB 4XVUD 4FQPA 1N6UA 5C0AD 5F21B 4K23H 3DVFA 5EIIB 5D4QA 2XZAH 5IQ9A 1T3FA 3BQUC 5HYJE 5HHOE 1U8KB 3DUUB 3GBML 1CGXA 4I0PB 3LS4L 4UU9B 3LCYA 2YZ8A 2XZCH 3G5ZB 3S35X 2X4SB 5C0AE 2VAJA 4UV7H 1I1AD 4BUHA 3KPLB 3HZMA 1S7UA 4HMEA 4QT5A 4POZC 5TFSH 1BAFH 4I18B 3U7YH 5T1MB 2VLRA 3PXJA 3HAEH 3VI3E 4P3WA 4XCFL 4DN3L 4O58L 2WANA 1HQRA 1YEGL 4OCWL 2RJMA 5K9KA 4E5XB 4HIEA 2EYRA 3LKNA 1A3RH 4XHQA 3VFGH 3DX8A 2DQIL 1FGVH 4NUJA 2X40A 4QF1B 4BKLB 5CEXB 1IM3B 3IKCB 4YXLH 4YHYC 5SWZA 1HOCB 4XX1E 1A47A 3K4AA 3RGVA 3VXUA 5B38G 1H3XA 3DX6B 4UB0H 3LOWA 1FV1B 2X41A 4M6NH 4MJ6B 3C60A 5B3NA 4WJ5A 5EU7C 5KS9B 1KCUH 3LN5B 3WN5B 3QA3B 3MRJB 5E8NB 1F00I 5J1SC 4MCZB 2D03L 4WFFD 5DUML 4M5YL 3NCFB 2VR9A 5TQ0L 4TTGA 1TZGH 2Q7YA 3VXMB 4GG8A 3CAFA 4Z5RA 2IAMD 4FZ8H 2R1WA 1I8KA 3IFOA 3RL1A 3ARGA 3CSPA 3QUKA 1T1YA 2B2XL 2DQUL 4NGHL 1J1OL 1OW0C 1ED3A 4LCYA 1AP2B 1EBPA 3FMGH 1JHLH 4MXQD 3OKEB 3QUYA 4GW5B 5D71H 3GMRB 1JTPA 2Z8VC 4N8CH 4QGYA 5EBWB 3STLA 1S78D 2UVEA 3QCTH 4UINH 5IQ9B 4HUNB 3FTGA 3S6CA 3VFRB 4POUB 5GGSA 5GS0L 3NMEA 2HT2C 2ZUYA 1IAKA 2DB8A 3TO4C 4NO5B 5EA0L 2DM2A 4K8RL 3RUGA 2UZXB 4BH7A 1EDQA 1F4YL 43CAB 5I1AA 1QEWA 4JZNA 3MRFA 1N6QL 4F9PA 4GG6A 2PO6C 1PQZB 1EMTH 5L88H 4TULH 4XT1C 5GIRB 2AABH 3AROA 1MVFA 5F8QC 5TF1L 5I71B 4JY5L 1HHKA 2XZCL 5F9JB 1HQRB 2MWCA 3F6LA 4ZDHA 2Q8AH 5K9OB 1JMXA 5DHVA 1KLUA 1ZLUK 3TCXA 4I4WB 4L3EE 2DQHL 3RWCA 3ULUH 3EYOA 1KTDB 2CKBL 1JNJA 1BMGA 4XC3H 3KNBA 4YFLI 3VRIA 2BSTA 1CFBA 4M7ZB 3G04B 3MUHL 4JFHE 2HWZL 1FJ1A 5L2JB 4Z7VB 2VOTA 1QACA 4HK3N 4JKPL 3HC3H 5DYOA 1XIWB 2FJGB 5EN2A 5D7IF 3HR5A 4NJ9H 5ICYA 2VZ3A 4PJBE 4PJAE 1NMCB 3H0TB 1T04B 2YEZB 1Y0LB 1CK0H 4ODXA 3EYFB 3UYOD 2ZCLH 1DQDH 5C0IA 5IBUB 2KZWA 3VG0L 1TQBC 3ZE2F 4LCIH 1G9EA 1LD9A 1ORSA 4JFPB 4XPTH 1G7IB 4O2EA 4OM1H 1TCRA 5BZWB 5HYSA 1KG0B 4DOHB 2V7HB 3PP3H 2Y7QA 3RU8H 1YNLH 2IGFH 2B7DT 1OARL 3BN9C 2PYEB 4DWHA 2HYMA 4OTXH 1NCCH 2XV6B 1TZGL 1TXKA 5IVOA 3X14A 3GMRA 5I1JL 4QYOA 2Y5TB 5IVNA 1S7XA 3ILPB 3LB6C 4I3RH 3T3PE 4EQ2A 1QFHA 3DV4B 4V2BA 1I9IH 4YHMH 2WBJC 4JFZH 5D5ME 5DK0A 3VFRA 4X4XA 3TH3T 1IAIL 3X13A 4G8GE 5GJTL 2JKXA 1LMKA 1FGVL 5FF6B 4N8CL 4NCDA 1Y18A 2CIIB 3SO5A 5D2LE 1G6RL 1I1YB 1MHHA 4RBPH 4ZUUB 1KCLA 4LLMB 2GSGB 3UZEA 3OV6A 4UOW0 5EA0H 3DMMC 1MQ8A 3WFEL 5JPNB 1WT5C 1D9KC 3OR6A 4WUUA 3BJLA 2XN9A 3PHSA 3NGBC 2MCPH 4ZMAT 2DKSA 2V5YA 4RISL 5DK2A 4QRUB 5DJCB 1XT5A 1KGCE 2AGJL 3LRGA 5EU6B 3IU4H 2ATPA 4X98B 1JZ6A 1QFWI 1PX4A 4ZPTA 4K3DH 2WLYA 4HAGA 3WUWB 5ADPL 3TESA 4R7DB 1Y0LA 4OZIB 4NBXB 1KCSH 4S1DC 5JXED 4WO4C 1FO0A 4MX7A 1EHXA 1T0MA 4YH6A 2XTLA 1Q9KA 5EDXA 3VFMA 4OIIH 5DJ8A 3B9KD 4DVBB 1MHEB 3KHOA 3VH8B 1E28A 3PIQB 5I74B 3QHFL 5KSBE 3RA7L 5EG6C 1OTSC 3GSXA 1I1RA 2QHRL 1HZHL 4CN4A 4PJGF 3LEXB 3ZE0F 1NGWB 2A2QT 3ROOA 2YPLE 5LXGL 5CSZB 1FORL 1G7HB 3RVUD 4FG6C 5E00A 4WTXA 4ZFFA 2ZG1A 1I7RB 3RVTC 3OAZK 5IF0B 2PCPB 3OKYA 1SYVB 4XAKE 4P5TA 2VLLA 1KOAA 3AXLB 4IIQA 4JG0L 5F70A 5CZKA 1LDSA 4Y19D 2DI7A 4NFBA 3ZE2E 1KBGL 3RTQA 5F1KC 4QXTA 4L1HA 4OD3L 5HHXL 4P48A 3I3BA 4OGAD 3KLAB 1BD2A 4KKAC 4P2YA 3MA9H 2W60B 5GRUL 1J8KA 3FT4A 2VTFA 3O3BA 4Q6IC 3V52L 1YY8A 2DLTA 3SOBH 3D87B 3H3PH 4R0LC 4UT6H 5BZDB 1WJ3A 4G7VL 4JREB 1NGYA 1KB5H 2E6JA 2BFVL 4HW6A 3L3DA 3F5WB 5EBLB 3WKMH 4O51B 3D69B 5CAYB 5IB4A 4FOMA 1QFWL 4NNXA 4PJAA 3R06B 3KLHC 1UH4A 1BQHA 4X98A 1H3WM 5EULV 2OTWB 5MEQA 5TFSL 3TZVD 4L29A 1VERA 2EDDA 5TH2A 1R24A 5IV2A 1ZA3A 2VKXA 1TVHA 3TBSA 2R0ZH 1C12B 4WNQB 5E4IA 1X6NA 4JGUA 4RMQA 2OR8A 1Q9KB 4WEUD 5JUEL 1ZS8A 5I1KL 4CVXA 3PJSA 4FQXB 1NJ9A 4W6WB 1JPTH 2CIKA 1OY3B 3O3EA 5HYJB 1A7RH 1V7NH 3OL2A 2VLME 4LSPH 4HWEL 4ODUB 3GK8H 1UXWA 2A77H 1DBML 1OP3H 4HUUA 5B4MC 3RY6A 4J4PA 3VWKC 4HWBA 3MFFA 1EEUA 4X6FA 5A40E 1PX3A 4LIQL 5EUOF 5F7MC 5DSCA 5GGVH 3OMZA 5HJ3B 1N2RA 4U6XA 3B8SA 3U0WL 4U4BA 4XPHL 1IARB 1HH9B 2CGRH 1U3YA 4RX4D 3D2UD 2VR5A 4PB0H 5SWQB 4HIJB 4X6BA 5GS0C 1JK8A 1OAUL 1ONQA 4P46A 4PTTB 1F4AA 1VFOA 5BOPA 2GHWB 1RMFL 1A6WL 1XGPA 3TBTA 1IKFH 3AM8C 4RMSA 3VGFA 4K3EL 2QHRH 4KK9C 4M02A 5T3ZE 3FO1A 1J5OH 4GRLC 5D7SH 2VR4A 4QRPB 2P49B 1RZFH 4YDVB 1CFQB 3LDBB 4NM4L 5F7EL 4IJ3B 1S5IH 3SDYL 1QSEE 3EZ8A 5DJZB 5FYKL 2EEBA 4ZG1A 3EOBA 1YN7B 1DANU 3QO0A 4GXVH 1F3JA 2AI0H 1HSAB 5GSVB 4Y5YC 3U4EB 4EKXA 4D2NA 3V0AC 4NQTA 4HPOL 1D5MB 5DZNA 3RQ3A 3BPLB 4YXHL 2E7MA 3RY4A 3ARDB 1NCWL 3GMNA 2ED8A 5I0ZA 4N9GA 4KHXH 1PG7H 4NRYA 1LE5B 4D3CL 4JO1L 2I26N 4H5SB 2BNUB 4ZAKD 1NMBH 2VQ1B 3MV11 2EDJA 3IAGC 1WFUA 1RZ8B 3DVGB 1AD0B 1TJHL 4ISVA 2OJEA 1LO3L 5DD0L 1YC7A 4HF5H 4O4YH 4R3SA 1MFBH 3MPCA 4Y5XC 1T1XB 4WHYH 3Q5TA 4XGZA 3MNVA 5HGDA 2P47B 4ODUA 3KYOA 3DUSA 2DWEB 2R0KH 5TGBB 1P4BL 5DO2D 1JIBA 4XMLL 5C0GB 3S35H 5HBBA 2DM3A 1FNEB 2BVOB 3QI9B 43C9A 1I8LC 1KXTB 3OKDB 3L3GB 3V6BR 4QY8B 4G6FD 5A43C 2BHZA 5FO7B 5I1IL 3T65B 5F3HA 4M8QA 4MXWH 3JSSA 4OD2B 3KYAA 5D1XA 5C6TL 3GMLB 3MRGB 4IBLT 1NBYB 2J8UA 2NXYD 5JHDA 4GW1A 1SBSH 5FGBA 3MBED 3T0ED 3O2WH 3WYRA 3IJSA 5HY9A 1L9NA 1EFXB 3G5ZA 5TQ2H 4MQXD 3X12B 2M26A 1HCFX 1K5NB 2A73A 5D70H 1WLHA 3CVHL 5CUSH 4ZNCD 1FDLL 3LPFA 4K3EH 1NFIA 4BM7A 4OGYL 5A16A 3DUHA 2EDWA 1T6WA 2X6MA 3Q5OA 5BRZD 1TETL 2DOCA 3JWOL 5GSVA 4JFFE 3QH3A 4LMQE 4DAGH 3W9EB 5L7XL 3EFDH 1XF3A 4GAJH 1DQLL 1UVQB 4F57L 3V6FA 1BVKB 2XKNA 4OFIA 3BWAA 4L8DA 4HD9A 1B0RB 5TPWL 3CXHJ 2H2SC 5CJ8A 1CXEA 3RGVB 1OGAB 2YD5A 5GGRA 2A9NL 5DR5H 4N1EA 3N1MC 2VQ1A 4NQEA 1AJ7L 2QJDA 3HCVA 4G80A 1XGRB 5H37H 4YXKH 4LSSL 2YRPA 3QA3A 2ENYA 4U05A 2BY3A 5KN5B 3RP1A 2EIBA 1LQSR 4RWYL 2DD8H 3G6JF 3ZTJH 1WBZB 1JF5A 2V9QA 3GHEL 4UBDD 2DWEA 3BPNC 5D5MF 3KS0J 1UQSB 3HNVL 4OV5B 1J18A 1WK0A 2BXYA 1MWAA 1KJ2B 1EZVX 2P48B 1CD9B 4MQ7B 5IMKB 4OIIL 1Z5LB 1WFTA 1P4BH 1G7LB 1NCBH 3ZKMC 1ACZA 4APQD 2F5AL 3NFSH 3FO2B 2P7TA 4GRMA 4XB8A 2NTFA 4HZLA 3QUML 3DO7B 3ULVH 1H3PL 4HPOH 3BIKB 4DN3H 2AEPL 2AEQH 3QDGE 5E2TH 5I1AB 5TF0A 5CWSB 4M43L 1MY7A 1UG9A 4MAYC 5I9QC 1I4FB 3HTLX 1FV1A 3RKDC 2R4RH 3ULSA 4R97C 1T89A 2NXYB 4FP8L 3B6SA 4I5BB 2A6IA 2DQEH 1RV6X 4ZO9A 4NQEE 4M00A 2PTTB 4UT9H 4D9RE 4P4KC 1F2QA 3NFNB 5DVOA 2NY6D 2FNBA 3KG5A 5C09A 1F4WH 1MNUL 3L3JB 4ONFH 4Q2ZB 3EJYD 3S3SA 1JNLL 3MBEA 5D1ZC 3MRMA 1TFHA 1YPZF 1R3IL 1AP2A 2VN4A 4F37K 2F54A 2XG4A 1QRNE 3L5IA 4TNVK 1AGDA 1Z3GL 1KENL 5DMJB 4O00A 5GRWA 3GSRA 4JG1L 3O81A 3CSYB 3GSWA 4JPVL 4QRPD 5DGRA 1K4DA 2X4SA 1J8HD 1LO4L 3ZKXC 1ZHBA 4ZSOE 3HRZA 3CPLB 1S7UB 1T7WA 1LD9B 1SVCP 4KZDL 3ALWA 3V52H 4BH7B 4ELMA 3BAEL 2Y07L 2W07A 3CFCL 2CXKA 5KG9B 3GJFK 2A83A 4M1GL 3GIZH 3M45A 2B1AL 3KPTA 4KXZH 4CU6A 5GGSY 4M7KH 1WZ1L 4FFWC 1DBKL 1A9EB 1K6QH 2VXUH 1OP3K 4JQIH 5JMOC 4TULL 4PJHF 5HHME 4H26A 3OAUL 3GMOB 4Z7WE 4GOSA 3QCTL 3BYYA 5E8PA 5HVHC 1JGDA 1GH7A 4JFOA 1TMCB 5EC2A 2V5RA 2XZZA 4OLUH 2IPTH 1RZKH 5C08D 3MRJA 3BEWA 4YR6A 1F4YH 3RHWK 3NCJH 1I1AC 2YWZA 2BSRA 4KRPB 4ZUUA 2ZZUT 3CMOL 3DTXA 4CGTA 1LEGA 1T4KB 1EJOL 1UWGH 3VRLE 3O2DA 2L7JA 1BQHG 5C9KA 4LSSH 3MLWH 4WUUB 2GJJA 1M71A 5T1DH 4NBYB 1TJGL 4NN5B 4WEMB 3L5XH 1F45A 3GKZA 1JZ2A 4DN4H 1RURH 4OV6F 3GO1L 1H3PH 3X3FH 4P9ML 4DKAA 1W72B 3BISA 1XCQA 3U79A 4R26H 1BJ8A 1S5HA 1BFVH 1VHPA 5CBAB 5D96C 1AIFB 4FQIH 5BS0D 4XB7A 3E0GA 3S98A 5DK0B 3VFVB 1Z9OA 4J4PD 4JN1L 4CKVX 4XPAL 3IXTA 4UNTA 3X13B 4LVOB 1S7WB 3PIQA 5AG8A 2C9AA 5CILL 2M2DA 1A1MA 1U2CA 1L7TL 1OSPH 3O2DH 5L9DH 3QEGL 4TNWF 1FIGH 2KL6A 4OUOA 3JXAA 5IUSA 2CLZB 3TZVB 2AJVH 4L4VA 4J3XA 1ZVSB 3HLAA 4AH2A 3QUMA 2XXMB 5JW5B 3BUYA 3CDCA 3TT1H 3D85D 5DLML 3D9AL 4QF1A 4QWWD 4FZEL 2PCPA 3VXSE 5F96L 3ET9F 1HXMB 1NC2B 2WQRA 4JR9L 2X4PB 4LNRA 1QVOB 5DJCA 1N3NB 3DSNA 2OSLB 4L9LB 4JJ5B 5DJ6A 4G8EB 1FYTE 3QDAA 3UTZB 5ID1B 3MYJA 5AEAA 1YECL 5C9JB 5E7BA 3VWJB 3BZDA 3MCLH 3BSZH 2ZUSA 5L0QB 2H2PD 1H5BA 1CDBA 3SGEH 3TNNA 3BZFB 4QNPE 1YY8B 1OLZA 4MXWL 2VLJD 1FL5B 3X17A 4X6DB 1SMOA 5D2NC 3S5LA 5C71A 3SCMA 5C0BB 1I7ZB 2UWEA 1YQVL 3NCMA 3W9DB 2R0KL 3TPKA 3NZHL 3QWOA 5ILTH 4I2XE 1NGYB 1D5BB 4QOKB 3VG9B 3E2HC 3KPMB 3MRKB 4G42B 4WW2F 5C92A 1O0VA 3HC0A 3QYCA 1INEH 2NY5C 3ZSSA 2HTLC 1FZJB 5EZJB 4LFHD 2H32A 1R3KB 4TOYL 1X5IA 3ZKNC 1BD2D 5FGSA 4J3WA 2Q3ZA 3PGDB 2DYPD 5H8DA 5SV4A 1HZHH 2F9BT 1N8ZA 4XPBL 5FYLE 4JANA 4MD0A 4N0UA 5LBSL 5DF0A 5I9QB 2CDFB 1LDPL 4XNUH 4U1NB 4XAWL 4JE4B 3T0DA 1I7TB 4H1LG 1PLGH 4CVXB 4HJJL 1J7VR 3S36H 4MNQB 4OI8A 1B4RA 3CD4A 4G6MH 4HWBL 3LS4H 2IBZY 4NCC2 1MI5D 4NCC1 3L7EA 1YPZE 2HFGH 2WUBH 1QFOA 2ZPKH 1ZVSA 3HLAB 5GRVK 2W60A 3ZDYF 2VLKA 3OXRB 5I19H 4YJZL 4ORZC 4OJFL 2ZKHL 1BIHA 4ELME 3A6CH 3UTTB 1A3LH 4MXVE 5DMIL 5D7JA 1UWGL 3UTPD 3IJYB 1H8OA 2VDPH 1NUDA 4U7MA 5D7IB 1OD7A 3G6AA 2NY5H 3G6DH 4AENA 3OKOA 4WFHD 1FFOA 2XT1B 4RWYH 2ICWA 1U95B 3GSOB 3FAXA 1AHWB 3DROA 1HHGA 1T0MB 3D39D 3FFCD 4KROD 2IBGA 3NZ8A 4TNVF 4PRPA 4Z7VE 1ZV5A 2WAHA 4MNHB 4GS7C 3BPCA 2I9TA 1DL7L 4PTUA 4H1LB 3NIGF 1V8HA 3RVXD 1TPXB 2CPCA 3E8UL 3DRQB 4W6YB 3UTTD 1ORQB 2HT2D 1FGNH 3ULUL 3TYFB 4OBRA 3WFCL 4H25B 3PWLA 1D5BA 4QOKA 2PYEA 4NN6B 4QTHB 4J23A 3TIDB 4PJGE 3KPNA 4LF3B 2IQ9L 1T5WA 2JB5H 5AAMA 4NZRH 1NFDE 2AXGB 3DXAD 5EU7E 1I9RH 1YMMD 4Y1AE 3TVMA 1D9KD 1YEKH 4ODTH 4PP1C 3R8QA 2R0LL 1A7RL 1V7NL 4S0SD 1EIBA 5KBNC 3UJTL 5EO1B 1U8IB 5FAAA 4UILL 3CVIL 3VMNA 1YJDL 1XGQB 1A6ZA 1MCKA 1T5XA 1YEFH 4KROC 5F9AC 4DGVH 3FKUS 3SCMC 4NO3A 3GB7A 1T3FB 4M1DL 1N64L 1XGPB 3TBTB 1Q0XH 1AGEA 1GIGL 1QLEL 4RFNC 5IMOB 3BKYL 5F7WC 4BQ9A 4WIQA 5EOCJ 4JZOA 4J3TA 2CK0L 5IQ7H 1EO7A 1JGEB 4BQ8A 1BIIA 5IVXF 4ZUTB 3I6KA 1OAQH 2NCMA 1NBVL 5ITBL 3QO0B 3G5XA 2D4DA 1Z2KA 3MV8B 3T2OA 4EUPG 2EYRB 4OZIF 4Y16C 3KJ6L 3RWHA 1JNHB 3MRGA 3ULUE 2YA0A 3SDYH 5BJTB 1MCIA 3CIQA 2VE6B 2N7AA 2E27H 4JPVH 1QFPA 2DBLH 2PW1B 3IKCA 4Y8DC 4MNHA 1MHEA 3EUUA 4H1LA 1CGVA 1QBMH 2DS4A 5C6WH 3O6FB 4MA3A 4PJCE 4XVTL 4XRCB 1RIUL 1IVLA 2CKBA 3GSXB 4LRIA 4WW2B 4GS7B 3C87A 5IT2L 3U0WH 5DHYB 4WJ5B 2AV1A 4TTDC 4OB5H 1S7SB 4XP5H 4RA3A 4HH8A 3QQ9D 3EGSB 5T1KA 3V0VA 1L0QA 5ALBH 4PIRF 4TNWK 3VXMA 3WNMA 1FG2A 1F13A 4TRPH 4WW2C 4NJAH 4X4ZA 4XCCL 5ACLA 3BP6B 1YNTB 4CNIB 2XZAL 1G9MC 2XKNB 4LSQH 5ENWA 4Y4HC 1OQOA 4AJ0A 3D0LB 3VXRE 4K8RD 2SEBB 1KACB 4JM2B 5DWUL 4Y4KC 3HZVB 4GW5A 4NYLB 1J9CT 1I9RL 4G6FB 1NEZB 1S9XA 2PTUA 4XI5D 2YA1A 4XWOC 1H5BC 4BZYA 4P49A 4HK3J 4J2XA 1VESA 1RJLB 2QQQA 4XCFH 1WTGT 3L3KA 3RWGA 1UGNA 2GJZB 3GRWA 3GI9H 5FYLL 4WO4D 4ZFOA 3CX2A 3CH8A 3E6FB 2A0LC 1B88A 3MLZH 1MWAB 3ARGD 3MRLA 5GRVL 3S35L 1CICC 5IB4B 4TSBH 4RFNB 1F8TH 5A16B 2XACC 3K3QA 4MB4A 4FFVC 3DGGB 2OTWA 1LO3H 4CAGA 4Z95H 3J7HA 2FGWH 1L7TH 4IMLA 3VXUD 1DANT 3M1BB 2BRQA 2Z93A 5HGAA 2ZNWA 3C60D 4GH7B 1UZ6F 4U1HA 2KBGA 3AREC 4F33A 5L2JA 4LCUA 4XWOD 1F3RB 1OGAA 2E7HA 1XR8A 4XRCA 2XWTA 4LVHC 2CO7B 5ICYB 3HI5L 4G6JH 3NABL 3NACL 3UPRB 2EZ0C 2AJ3B 2X4OA 1DBBL 4IRZH 4LARH 3RY6C 3B6SB 1T80A 5C0GA 3KPLA 4MNQD 5FM5O 1LHZA 4MJID 4M61B 1I8MB 4C56E 4XBPB 2DQIH 5HHPB 4RGND 5I8EB 4PGEA 5SWZE 5C09B 5IB1B 3HE7B 4XX1G 4OB5L 4PLJC 4KJWC 2Q1EA 4NHUB 1WUNT 2YOCA 1Z0NA 4LVEA 2V2XA 2PUQT 3UZVB 3O6MH 5F1IB 2DQJH 4PJIF 4UQ3B 5IBUG 3S37H 2FEEL 4YO0B 4QYOB 4OZFG 3P40A 3LRHA 1GC1H 4EN3C 3LN4B 3VJ6A 3TA3A 2NTFB 4HZLB 3W0WA 1HDMB 4YHOL 3PXHA 4R26L 4PJ5A 2IFGA 1OAKH 3BIKA 3FQWA 3A6BL 1FZMB 4PUBL 3NCCB 4D8PB 2EDBA 5IVXB 5IEKA 4QHMA 3DHJA 3PHQA 3NN8A 1YJDC 1A02N 2AS5M 3D2UA 3KXFA 2XWBB 3FFCA 5DQ9B 4PRDA 4RGNC 1DBAH 3VGDA 1CTNA 3OGOE 1ZGLB 4WTZA 4NZTL 4M6MH 5C0JA 1YEDA 2N1KA 2WIIB 3D18B 4H26B 3WO4C 3TEUA 4FQLL 5IHUL 4BFIA 1IKFL 3QUYB 3RTQC 4LPTA 5BVPH 4U1HB 4ZTOL 4YDJB 3GGWA 3FQXB 1J5OL 4F33B 1QSFE 2R39A 1PGRB 3Q3GB 5D7LB 4LKCB 3EOTH 4D9LL 1MOEA 1XF2A 3MC0A 5CKAA 1RJCA 4GQ9H 1B4JL