3H9ZA

Crystal structure of the ige-fc3-4 domains
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig epsilon chain C region
total genus 39
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA02
4DKEH 4YAQA 5IM7A 1FP5A 3SHSA 4L4TB 4UQ2B 3LH2H 2IPUK 4JFXB 4ZS6C 3C5ZA 4KMQA 2VC2L 4PV9B 3ECBA 3FN0H 2G75B 4ZFOA 3ZTJH 4CJ0A 4H20H 2HT3C 1G7IA 2JCCB 4LIQE 3UROR 4FMFA 4HXAH 2OM5A 5JOEA 1GIGL 4ZFOB 4UIMB 3Q0HA 3VE0A 3ARBB 4HT1L 1NSNL 5ITBH 2D7TH 4PJAF 2ADJA 1NFKA 1Y0LB 5JOFB 2Y23A 5DJ8B 1NBQA 5C9JB 3C6LB 1RJYA 4MDIA 4JM4H 4PTUB 2DKUA 3I3EA 3QWOA 4I4WA 1CFVL 4MA7H 4R3SA 5D72H 3VFWA 1JWMA 4TRPH 3U1SH 4PRNB 3WO3B 3CPLA 1C08A 3O2WH 4LEXL 1I8IA 1OM3L 4PGCB 1KCSH 3FQNA 1FL6B 2P5WA 1MQKH 5F1NB 4UBDC 3BOVA 1G9NH 1TQCC 5DVMA 3SKOA 4I0PA 4U0RB 3BPNC 1Y18A 5CJOL 5DO2D 2Z31D 5ANMA 4Z7VA 1OP3K 1JYVA 5DJAA 4XP5L 4PLKD 3C5SA 4XP4H 4TOYL 1VCAA 1Z0MA 4RIRB 4DCQB 2BY3A 1BVKB 2VDQL 5JO5B 3N50A 4HKJB 4ODWA 1RIUH 4JQXC 4ZYKA 4KMLB 3DPBA 2VC2H 1G7LB 3K0WA 3BP6B 1TQBB 1Z5LB 3MR9A 1I9RH 2YD6A 5HYJD 3QA3B 3PIQA 1H9VA 3MRBB 5GGRA 3EZ8A 4TQEL 3VH8A 1ZHNA 2IBBA 4WO4B 4YFEA 5MEQB 2J5LC 2UZIH 3EYVA 4KTDH 3N1MC 3OPZL 3U30C 1U8KA 2ATKB 2XTJC 5T5FH 1WICA 1WIPA 3HNSL 4NKMB 5KS9A 4P9HC 1FNSL 1QA9B 4JKKA 4ACPA 4E5XA 4PRDA 4YWGH 3PNWA 5BZWA 2DQIH 2C3HA 3W5MA 4LSVL 5IJVB 2GK0A 1HHHB 3J7HA 1CTNA 3ARFB 3QUZB 5EUOE 4V1DD 4XVUC 4YXHH 2VZVA 5K9KB 1DVFA 4X7SH 3L5HA 4ZUTB 3WSQH 2XN9B 4YHML 3INUH 4Q6YA 3SY0B 3SO3C 5HVGB 1TITA 1U93A 4OGYL 1RY7B 5E08H 5I6XB 4IRJC 1A6AA 3DMMC 1JHTB 3GFUA 1I8IB 1U8PB 1AD9B 4HWBH 2Q6WA 3C2AH 4GAYA 3FOLA 3THMH 5DJ0A 4NWUH 4F7PB 3TV3L 1P7QD 4F9PA 2F8OA 2HLFD 3SDCD 4P3DB 3NA4A 3QUXC 4DGVL 2LU3A 4HEPG 2R2EB 2CLZB 3JV4A 3PP4H 1ED3A 3FONA 3LKQA 3CXHJ 1PYWA 5FO7A 3KGRA 2D7OA 5F9OH 3RVUC 4J1UA 3H0TA 2BVPB 2YBRA 3QPQD 4YQXL 1UWXK 2BSTB 1MJUL 1IGMH 3CDYA 4TNVF 4C56A 5GS2H 4JVPA 4AK1A 5K33A 1P7HL 3FB7A 1B6DA 3QDJA 4MA1B 4N90E 3AGVA 3A6OA 4O5LH 1U8LA 5I76A 4P49A 3DMMD 3DBXB 3ARYA 4LCWA 3WUZA 3GI9H 1DBAH 1RZFL 1JFQL 1EUUA 3CFEB 2FJHA 2CUHA 5FYJE 1SY6H 1S9YB 5DUML 1N0XL 1OP9A 3MJGX 1RJYB 2B7DT 1NCWH 3FQRA 4YHNB 4WTZG 5C0CE 5DJ8A 3QEQA 4CVXA 2CDFA 1LDSA 2CIKA 3PP4L 1J7VR 4FQQB 4GAFB 4DN3L 3MA9L 2GFBA 3S3PA 1CWVA 1Z0NA 5ESVA 1MCIA 2PW2B 1ODAA 2BOCB 5LCVH 4I2XB 5TF0A 4G42A 4OKDA 4L8BA 4X7EC 4UNVA 2FGWH 3CLEH 5F8QC 3JV6A 3OG6B 2ZZUT 4Z7QE 5JZ7C 4ZS6D 3BH9B 1FO0B 4NM4H 1FC2D 1J0HA 3LPFA 3OWEA 1GAFH 4G6MH 2M2DA 3MLYH 2DQHH 3Q3GB 3WFCH 4WHCA 4N9GB 1WSST 4ONGL 5CGMA 5C3TA 1WVZA 3FB6B 3L5WB 5BVPL 3NCMA 1IL1B 3RNKB 1YY9C 1UH2A 4BKLA 5C0IB 4TVPE 1VPOL 5LAXB 5JW5A 5F8RC 5EBGA 5IKCB 1OF2B 1HXMB 3TEUA 1K6QH 2JF1A 3VI3E 3V6BR 5GS1B 5GJSL 1MFAL 2Y36L 3NCJH 1I4FB 1T4KB 4OF7A 4D3CL 2FL5A 4NPYA 3ELAT 4HX1A 3QNYB 3RUGA 1FZJB 3LQAH 2ICWB 2R1WB 2OSLB 4P5TC 4OCSL 3QCVL 4CMHB 1QVOA 1KPVB 2AI0H 2R0WH 3BFOA 5E8PB 5D7SH 3N9GH 1PJ9A 2JJUA 4KI1A 5J3HD 1Z9SA 4FQXA 3REWA 5DA4A 1EFXD 2ZNXA 2WP3T 5I15H 3QIUB 3LKRB 3D2UA 5IFJA 3RL1B 1FORL 1LE5A 4ZS7H 4P2QD 3B9EA 2DQUL 2G5BA 3L3KA 2PYED 2VXUL 3MV9B 3NFSL 2VJXA 4OBSA 4OT1H 4HXAL 3RVUD 3W39A 5ISZA 2DLHA 2HLAB 3WNMA 2VISA 4Z9KB 1BQSA 4GW5B 1PLGH 5EIQA 5BOPA 1U95B 3DRQB 3MO1A 2J8UE 1UWGL 3S4SB 1JYWA 4LKXA 1KN4L 2R29H 2VXTL 1EGJH 1EHNA 1NFDB 1KJ2B 4L3EE 3U4EB 5GGTL 2BSSB 4OCSH 4PJDE 3GJEB 3D39A 1U6AL 3U4EA 4HAGA 2CR6A 1JGEA 4NIKB 4GAGL 1F3RB 5F21B 1AO7A 2GYSA 4OTXL 4XMKL 4OGXL 4TOYH 1ZHKB 1WWWX 5EN2B 3EOYG 3KYNA 2ED9A 5C07E 1FZMB 4G8GA 1VACA 3K4DA 1YEJL 3JV6B 3R8QA 4HIHA 4DGIL 2PXYB 5BVJA 3RY4A 2DQUH 4KU1A 5INCA 1JWSA 1A14H 1ZEAL 3O6FD 4W6YB 1XIWD 4ZTPL 1R3LA 3CMGA 3OF6D 4N0UB 1S7RB 3QG7L 4GUPA 5F1IB 4MWFB 2XOTA 1HQ4A 3CCHA 2VUYA 3VFTA 5J9PB 4OD3H 3J8F7 3LD8C 4YIQA 3ZE2F 4HIJB 1PKQB 1UXSB 1RUKL 5L8JB 3VXOB 3K1KC 4JRYD 5FGCE 4KI5F 3UTTA 5C0RL 1HHJA 1AC6A 3BVNA 2W65A 3F12B 2I26N 5D2LA 4YC2C 5IW6B 3E0GA 5TE6H 4O00A 1TNMA 1P5VA 1S78C 4LCWB 3BX7C 3RJQB 3I3DA 2Q20A 2EDYA 3L3IB 4NT6A 4FQCH 5M94B 1WISA 5B8CA 1IARB 4R4NC 2G2RA 4DTGH 1UB5B 3CD4A 3ZE1E 1HSAB 5KSAB 4XX1G 3GSOA 3WNPA 3F5WA 3WUWB 4GW4A 4F7CA 5CIPH 4Z7VE 5DEFB 5F6HI 1F4WL 4PD4K 1NBZA 4GRWB 2CJUL 5FF6B 4TN9A 4HF5H 4P4KD 5D8JH 5DQDH 2P5WE 4JO1L 1UVQB 1YEFH 2BY0A 2OL3H 3IDYC 4OZFB 4WGWB 4UT6L 3FRPG 2VZ3A 4JHAH 2OTWB 1I8KB 4F33B 2XTJD 4UU9A 3TN0A 1OGAA 3WKNA 2GY5A 4D9RD 1BX2A 5KANI 4X5XA 4YQXH 1H15B 2GJ6B 2IEPA 4JZNB 4OLXH 5DDHA 2PUQT 3T0EB 5K93A 1S8DB 5KSUA 4EN3A 4OM0H 1K8DA 4Y5VB 1B0GA 2C4XA 3DX9B 4NJ9H 4XMPL 5L2KE 1Q72L 4PJGB 3UJJH 1YC7A 4GW4B 4F7CB 4TUKL 4UINH 1N59B 3IGAA 4ZMAT 1VDGA 1ZE3C 1HN1A 4Y5YC 5AZ2L 1IC5L 2BCKA 1XT5A 1CD1A 2QHRH 4YO0A 3L5IA 5DO2C 1QLFB 5CZVH 4ZOCA 1MF2L 2I07B 4GG8B 4TVSa 5BW7A 4B41A 1FGNH 4S1SH 3SDDA 3U6RB 3MCKB 2ORBL 1MIEL 1T2XA 4KC3B 1KLUA 3QG6B 3VXSB 2YOCA 4M1GH 3RVTC 1DDHB 4KKNA 2ATPA 5CS7A 2VL5B 4LLVB 3V6FA 2LAGB 3N0PB 5KBNC 5D7IB 1B4JL 1RUQH 5BMFH 2IH3A 2NLJB 1TJIL 5GSRB 3WEXA 2CKNA 5LGHH 5B3JF 3BE1L 3RNQA 5AZEH 1VFOA 4M6AA 1A4JA 1B0RB 1ZHNB 5J9PA 4OM1L 1ACZA 5C07B 1HK6A 2VDNL 4E42A 5HHOD 5FA3B 4D2NA 4RMVA 4PRBA 1YEGL 4NQVA 4LASH 3RDTD 2X7LB 4OLVH 3ULUF 1HH9A 1FG2A 3PE9A 4KAQH 4NQEE 5DMYA 4HGMA 4OB5H 1OQXA 5IEHA 1MF2H 3RVWC 3U2SB 3VD4A 3WFBL 5FYJL 4P23C 5KVGH 3BGMA 1A2YA 4HDIB 5D96B 4U6VH 4OUUB 1CGUA 1R3JA 5GGVL 1EUTA 2OTUA 4DK6A 1F58L 4FQPA 3GBMH 1U8NB 1KJ2A 5EPMB 1F97A 4JRXE 3VXSD 3L7EA 1T1YA 1HHKB 2FH8A 2ADFH 1B4JH 3MRQA 5C8JB 1EJOL 1GZPB 2O5ZH 5E4EC 3GSNA 3GSUB 2GTWA 4TULH 4Y1AB 3HC3H 2X70A 3OSKA 5EC1B 1KSRA 1OTTD 4KKLC 3V0VB 3U7WH 1F6AB 3B2VH 4HJJL 4U05A 4TTDD 5D7SL 1FIGL 2HFEB 4YHLH 2JK5B 3LQZA 5D5MB 2LU4A 4QXUH 3Q48A 1MCKA 1IM9A 1MHCA 1VFMA 5IB5A 3IVKA 3LRSA 5KAQF 3T08A 4XNUL 4ZFGH 3GMNA 5SX4H 5ESQA 2X5PA 1ZT4A 1YEGH 4LIQL 1IT9L 1MFDH 3EDEA 3KJ4C 1W8OA 1C8PA 3MLSL 3T0VA 2VH5L 1KXVC 3TIEA 4HMCA 1BD2A 5KS9F 3HNVL 1BLNB 3MRHB 3STZB 4ALAH 2NY4C 4JY4B 2ZUWA 4LF3B 3S97C 2O93L 3ILPA 1OGTB 3C2SA 1MPAL 3MV8B 1MY5A 2QSQA 1NLDH 3MGTB 3MA7A 2ZNWA 1S7UB 3WDIA 5CBAB 4BFBD 2VQ1B 3G6JA 2A6JB 2IMNA 4FQ2L 5I1KL 2AQ1A 1ZT1B 3RY5A 3T8XA 4S1QH 1KFAL 2A9ML 1Y6NR 3KPRD 5DDHB 4WCYL 4JFDB 4Y88A 5IWLA 3EJJX 1A5FH 1A7PL 2AP2A 5I1HL 5C0AB 4XHJD 1LDPL 1KYOK 1NC4B 3QULB 4HUUB 5TH2A 3R06B 1OTUD 1QPXA 2DM3A 1GL4B 3QFJA 4NBYB 4XRCA 3MV8E 3UYPA 2D7TL 4DVBB 4G8IA 4LLMA 3H7BB 5GZOD 4K2UH 2ERJC 1FE8L 1UJ3A 4QYOB 5DD6B 3PF2A 2HFEA 3FTGB 3ZSTA 1FLRL 1WFOA 2NY1D 4PJAA 1NFDE 4OZHB 4HXBL 2X4TB 3PQYE 3G6DH 2FSEA 4Y8AA 5C0EA 4F58H 2HTLD 3S37L 4R2GB 4WV1C 5KSAA 2D03H 4YDJA 3SBWA 4Z78A 32C2B 3MBED 1I85C 2A1WH 4LSUL 4KJPD 4X5WA 4PJIF 4PB9L 4XHJC 5MEOA 5TE6L 1AO7D 1KB9J 4K8RC 1HQRA 5TE4H 5DHXB 3VXRB 4FS0A 2OMNA 5F93C 5TF1H 4YHZL 5C0DB 1BREA 1KGCD 4LHQB 4WTZA 4OF8A 2CSPA 5FYKE 4PP1C 3TF7C 3OKEA 4PJHE 4NCC1 2KQNA 4TQEH 5CZXC 1KLGB 4HBQA 2C3VB 3WHXA 1HH9B 2J3SA 1I8LA 2X1XR 3LEVL 4JRXB 4ODSH 4XP9L 3ZHKA 2AAVA 3WLWC 5SWZD 4LOUC 1C5CL 4GUPB 3MRIB 5HGBA 4TVPD 3OZ9H 4WY7L 4LGPB 4H25A 3JWDL 1DE4A 1PZ5A 5E2VH 3O4OC 4GRLD 1NANI 4MD0B 1QLEL 1U92A 3RA7L 5DZOA 4ZOEA 4NC2B 2IALB 4P9HH 4Y5YB 3HZKB 2NXZB 1XF4A 4RDQG 2FR4B 4XB8A 5HHMD 4M8QA 1GZQA 2EDHA 3ESUF 3ILQD 1LGVA 3RPKA 3SGDI 4GAYB 5JQ6L 4HS3A 2W60B 3CMOH 4U1KB 1FJ1A 3WCYA 5HHVL 4JJ5B 2XKSA 3F8UB 5GISL 1J0JA 3U4AA 3T8XB 3T04D 3HMXL 4FFWD 1NH6A 3RFZC 4JKMA 5E2UL 3MRNB 4P23D 3STBA 3MRPA 2Y06H 4HW6A 2NY0B 2CK0L 3IDUA 5I1CH 2XI9A 3EFDH 3WXWH 5D2NA 1RIUL 5FHBL 3PHOA 4YHPA 4RAUB 2FLRT 4QOKD 1BOYA 4JKLA 5IB4B 4L8SB 1OAKL 1I1FA 1SY6A 5DVKA 1N2RB 1ACYH 4RAVB 1BLNA 3MRHA 5E2VL 4F7EB 3GI8H 4D0BB 2X1PA 1KIPA 4GG6A 3V5KA 5D9SB 1T5WB 2IANE 1P9MC 5TDNB 2DQTH 1ROWA 2AV7B 1Q0YL 4KJWC 3ZDXE 3QPQC 2VLMD 3DX7B 4KQ4H 2VKXA 1QBLH 4MQXD 5FYKH 1MH5B 1AFVH 4U6YB 1ZT7B 4PS4L 4NKOA 3O6LL 3OR7A 4W6XB 4E41A 5JLZA 3T3PF 5A3IC 2CLVA 2IPKB 2FZ3B 4U1HB 4J3OC 5EH1A 2VDMH 1FAIH 3U4BH 5EZLB 1ZLVK 3X13A 3I50L 3IDNB 3MV9E 5ANMB 1VA9A 1FRGL 4NZTL 4GRWE 3H7LA 4IJ3B 4IRJA 4GS7B 1A9BA 4R7DB 3D69A 3C2AL 1N8ZB 2DQGH 1DBMH 4ELMB 1S7SA 5BZDB 3O8XA 5E2JA 1JWUA 1RK0A 3GBNH 3RWDB 5L8LB 1PKOA 5DD3L 2W9LA 2ZG2A 2ZUVA 1JZ3A 5K9OB 5KTEL 4F3FA 2E7HA 1RHHB 4DZBA 4E0RB 4PRHE 1JGDB 5HI4C 3TZVC 5ISZD 1FYTE 1JRHI 1DBJH 4KMTL 1LO3L 3AB0C 4GRLC 1NCAL 1OARL 1T80A 4YUEL 2WWKO 5CEYB 4TSCH 4LLYB 2AW2A 4AG4L 1T21B 4HEME 1G7QA 2VO5A 5GZOC 2IAND 3PL6D 2HKFH 2FRGP 5DUPH 1FAIL 1QG3A 4M48L 3WHXB 1FO0L 3FT4B 4QY8B 4Q97A 1NBVH 5EBMA 4MQTB 4QTIL 1SYVB 4PRPB 4QHUB 2DIBA 3R06A 5CIPB 2ESVD 2IPTL 2A0LC 1XIWA 2NZ9D 4U1SB 6FABH 3GSWB 3O0RL 2DYPB 3GBLA 2NNAA 4Z7OE 3BXNA 5E2TL 3DECA 1TVHB 5FKAA 4R4FL 2MCPL 3S35H 2CGRL 3T2QA 3QDJB 4OCMC 1BJ1H 4YC2B 2PN5A 5T5NG 5IVXA 1R24A 1LD9A 4LRNL 4JN1H 2QSTA 3RUGF 1EHXA 1ZSDB 3CK0H 1KIQA 3ZKXB 3AREC 5FYLH 1DQQB 5ICYA 1D5XA 5HHQA 1AGBB 1CICA 2DBLL 1X6NA 3GIZH 5J1AA 3LKQB 1U8JA 4LBEB 1NDGA 3I6LE 5CINL 4IM8A 4Y4FA 1AGDB 3QEGL 4OJFH 4IMLB 4NQDA 1MLBB 3LN9A 1FE8H 1M7DB 3F7VA 3EKCA 4H20L 4RMWA 5C0FA 3NFPA 5J1TC 4ONGH 1UVQA 1I1AC 5GGSB 1E4KC 3FRPA 4IRZH 4Z5RB 5J13C 4X6EA 3BEVB 2JK5A 5D70L 5DMIL 4PJ8C 2VN7A 2EE2A 2X9WA 5E2TH 4PJDF 3DURA 4JPVL 1NC4D 2JCCF 4P57B 3TNMA 3ZYZA 4MJ6A 4MD5B 3DUHA 3LN5B 2Z31C 3MYJA 5AG8A 1FH5L 2JTDA 5ALBH 1MRFH 5D72L 1BMGA 4PJ7A 4KRMB 5CP7A 3U1SL 2FDBP 1KJ3L 1MCNA 2HA1A 3ZDZE 3QDME 2ICES 1U8NA 5TDOB 1ULVA 2R0WL 4NHUB 4LSTL 4NZUH 1F11B 1RQ5A 2CDGA 2B5IC 1GZQB 2FECL 4PRAA 5IESL 1VGEH 2DRUA 4C58B 4BM7A 3U83A 2XIDA 3UTTB 5IK3A 2OXHA 4QRQB 3RBSA 5I15L 5JIHA 1RPQA 5JQHC 3ARZA 3W9EA 4KI5C 5B3NA 3BWUC 4H5SA 1OW0A 4FFZH 2C4FU 1TLKA 4OD2B 4KI5E 3C6LD 5TQ0L 3CFBB 4IRSA 1YMMA 3MR9B 3T0ED 1UACL 1JUFA 4C4KO 1S5HA 3RPIA 4PGBB 1T04A 1AE6H 4YDVA 2NY4B 5FA4A 5I18L 4EI5B 5F7HA 5F1OB 3MLTB 1ORSA 2JB5L 1KN4H 3A6CH 1HHKA 5D7LE 5F44A 3UDWC 4KHTL 1DQLH 4I2XE 5E2WH 5IVOA 4DTGL 1KEML 1CF8L 3EFFB 1XGTB 3LS5L 1DR9A 4YBHA 4Q58C 4Y2OA 1PQZB 3U82B 1MLCB 3MMEA 1RZJH 2VNCA 3U6RA 1Q9WB 3TVMD 4G6JL 5C0AE 4YR6B 1CDIA 3VXQB 3AXLB 4WI5A 2CH8A 1QSFD 1RMFH 2RGSA 5C9JA 4DKFH 5H37H 4JLRA 4GW1B 3P11L 2IQAB 4LMQE 4PJGA 3PGDB 3QXVA 3PGFL 3ZDYE 3S3JA 5T33H 1J1OH 4S1DD 2J8UF 2DL9A 1A22B 4JDZA 4NQSA 4X98B 2HWZL 1M7DA 3ETBF 3CZFA 4JFXA 3IRZA 1BF2A 4UU9B 3QDMA 1W2KT 1Q72H 2E7MA 3QJHA 1L0XA 2J12B 3QO1B 1KG0B 3DYPA 3O2VH 1W0WA 4K3DH 3BDYH 3TZVA 4YDKH 2XKNB 4UAOC 3B9DA 1HHIB 3SE9L 2NW2B 1VENA 4I9WD 2R23B 1ZWIB 2VERN 4PYHA 4XGZB 2AJUH 5FIEA 2GJ6E 1FBIL 5K9JL 1F3DH 4XP1H 3D0VA 2XN9A 3RKPA 4L3CA 1T0PB 1I9JL 1ORQB 3O8XD 3HA0A 1DEEA 4KVNH 1FGVH 3RIAF 1LWRA 1D9KA 4R97B 3GMRB 3SGEI 2NR6C 2WINA 4O4YH 2WBWB 1OAQH 4U0QB 5SX5H 2IAMC 5DR5L 4GT7A 3UTOA 4U6HB 4MCYB 5T3ZE 4Z7UB 4OM1H 2FB4H 5EIIA 3VXPB 1N4XL 3V7AE 1S7TB 2HWZH 1FZKA 1CDHA 3SGEH 1W0VA 4YHOH 1XCTB 5IMMB 1HH6A 1K4DA 5FECB 5DQJA 1QSFE 1V7NH 5ESAB 2WW8A 2ED7A 5JHDB 3EYVB 1UXSA 3BPLB 5MEQA 4JG0L 1YYMH 2LFGA 2RCSL 2VIRB 3QNZB 4FG6C 1N2RA 2AXGB 5INDA 4L9LA 5ESVB 1MUJA 3FO9A 1ES0A 3TVMA 1W72L 4D9QD 5C1MB 3DSFH 4JFQA 4Y4FC 2NYYC 4RFOH 3EOTL 1CE6A 3TH4T 1Q1JH 3R1GL 1UG9A 3QJFA 5DJ2A 2QHRL 2I25N 3RRQA 2NXZC 1ZLWH 4IMKA 1DBKH 4NQUA 4P57A 1HHGA 5FUOH 3GRWA 4LU5L 1HKLH 5F96L 3V5DA 2UVEA 1A2YB 3ZL4H 4XTRD 5IFAH 5F89B 1MI5A 4HUKB 1M05A 3D39B 1II4E 5C0BD 3GSVA 1JPSL 2EDFA 4XBEH 3OKLB 1FPTH 2YUVA 3EHBC 4WFEE 2YD8A 3B4NA 1FYTB 3OKOA 4U31A 3U7YL 4MA8H 5HHME 3BEWB 4KV5E 3HAEA 4F15C 4NZDA 3GNMH 2FR4A 3EUUA 4KPHL 1JV5A 4KUCF 5FCUH 4HH9A 2GJJA 4FP8H 3ULSA 5T1LA 4NKIL 2DBLH 5GGUB 2AKRA 2ARJB 4NNPH 1QSVA 1YNTB 4QTHB 2Z8SA 1R3LB 2YHGA 4J2XA 3HRPA 2DM4A 4X80L 5C0CD 1D5XB 1PY9A 4KI5D 5DK3A 3HC0B 5I1DA 1ED3B 1M71B 2DQDL 3FONB 5ANME 4RFOL 2Z93B 1GOGA 5B39A 3IXAB 5IVXE 4HS6A 5D4QA 4RISH 4OV5B 3SGJA 3WFBH 1AIFA 1D3CA 5EO0A 2WIIA 3BXNB 5LBSL 4P3CL 4NUJB 4G43A 1QR4A 1L6ZA 2NY1B 3BT2H 4GG8A 5IIEB 1A6TB 3VFNA 5ALBL 4FTVB 4WU7B 5I1EH 3UPAA 5IQ9B 3QQ4A 3OPZH 5HYSB 3MOQA 5EBLA 3UPRA 1U91B 5BV7L 3O8XC 2B0SH 4YDIL 3HNSH 5GGTH 4XBGB 5KW9H 3S34L 2EDJA 1LE9A 3RX7A 2F5BL 2X4TA 4YWGL 3ROLB 1IAOA 1KIRB 2ZCLL 4PJBB 1Q9OB 4W4OC 3HKFA 4HD9A 1I7ZA 5DD0L 3WJJC 4F9LA 3LZFL 4H8WL 1H8OA 3FN0L 3SDXE 3QPXH 1IL1A 2VZSA 4H1LA 3RNKA 2M1KA 1JTOA 1T66C 3ZSSA 2YKLL 4NUGH 2ZOLB 5IOPA 1CXHA 4U49A 1CICD 5IOPB 5IHUH 1FL3B 3MV9D 3DUUA 3C87A 1I1YB 2YD3A 1BGXH 3BKMH 5HHPB 4UILH 2C1OA 3BP5B 3B83A 2P5ED 3KYKL 4ALAL 2ICWA 2R1WA 5JW4M 3O2WL 2YMXH 5AG9A 4OZGA 5D1XD 3MV7D 3U9UB 3UZQA 5CAYB 5C0GB 2QTEA 1G0DA 4XC1L 2BSED 4QRPD 1Z6JT 2ZPKL 3KJ4B 4QOKB 5CEXB 1JNNH 2QEJA 4U2YA 1GGIH 3RTQD 1F4HA 3TJHC 1F5WA 2MQCA 2P8PA 5KVFH 4G6JH 4CN6A 2W65B 5CJQL 4K9EH 1N6QH 3OZ9L 1FL3A 1YZZA 4MXVE 5DRZB 3FRUB 2J6EH 1CU4L 5J6GB 4O5LL 5HJ3B 3DXAA 4MWFA 1ND0B 1KB5A 2BC4A 4J4PD 3HFMH 4HF5L 4AIXA 3O11B 4I5BB 3FMGL 1FFQA 3MGAA 3GHEH 4JB9L 4H1LB 1EAJA 5KVEL 1I9EA 1EO5A 1JPTL 4LSVH 3RWIA 4AEHL 2YXFA 4LSRH 5T5NF 5H94A 3S37H 3LMJL 3HAEB 3LKPA 1ZHKA 3TNNA 3W2DL 4UTBL 2JB6B 3RU8L 3HG1A 2GITB 1D5MA 1YNKL 5HGAA 4P48A 4F2MB 2FO1A 4JFOA 5D6CA 3PWPD 5IIEA 2WUCL 4WWKB 3MJ8B 3BESR 4FFWC 4LCYB 4JJ5A 5EO9A 1DLFL 2V2WA 2R1XA 1VGKB 4RRPG 3GKZA 3BKYH 3VI4E 1CFTB 2WM0A 3DO7B 2G60L 1BJ1J 1YJDH 3FQUB 1VHPA 3IXAA 3JV0A 2DQFA 1YDPB 4HWNA 1CU4H 5MEND 5E5UB 4IOFC 1NFIB 4NRYA 5IFHL 4LLQA 4E9LA 1V3MA 4FXLA 2XRAH 1JE6A 2Z31B 5EZJB 4M02A 4GKZB 3MBEB 3OTTA 3RZCA 4W68A 4ZDHA 4F37K 4XNQB 4QXTA 3HG1E 3D1MC 3FQWB 5C9KA 1QRKA 1FDLL 2BNUA 3LKSB 4L9LB 4YZFE 1IM3B 4HKZB 4RA3A 1WIOA 2Y07L 1N3NB 5MP6H 3F7YB 1DSFL 4G8FA 1VPOH 4P4KC 2ARJA 1FNLA 1WIUA 1YUHB 5FECA 1NCCL 1ZLSH 3ALXA 3LDBC 1H3WM 3RIAK 2CPCA 1XF2B 2X4SA 2DLGA 2R9HC 1BFVL 1MEXH 2EDRA 1ONQB 5I66B 1H3PH 4X6FA 3WNLA 2R2BB 5F71A 5GS0H 3TLRA 3DVNA 5D1QC 4HUXA 3WD5L 4X6DE 4RMTA 2O5YL 3NN8B 4BH7A 1L7IH 1T1ZA 5D7JA 3MRCB 3ZT7A 5MEOB 3HMXH 5L0QB 1HSBA 1IFHH 4DZ8B 1UKTA 2I07A 1BFTA 5KSVB 3GSNB 4I18B 2VLRB 1JI1A 5TQ2H 1T4KA 4U7KA 4NO5B 4TNWF 3T1FA 5EU6E 3CFCL 3M1BA 2R2CA 2FWOB 2ITDB 2JJVA 5E4IA 2EH7L 1I3RB 4I0PB 1A7NH 3PQYA 3EYFB 1JHKL 2QV2A 1GJIA 1JIBA 3ARFA 3QUZA 2C9AA 3MV8D 2VDLH 1UZ8B 2P7TA 1U3HC 4P4KB 3IFPB 1IZKA 2Y5TB 4I77L 2P24B 4WUUA 5SV3A 5J8OA 2ID5A 4NQDB 3CLEL 4Y1AE 1AGDA 4IOIA 3U0TA 2GY7B 3QR2A 1QBLL 3MROA 1DP0A 4JPIB 4ZUSB 5A2JH 2DQJH 2R0KH 2W59A 4IMLA 4D94A 4R26L 5GGSY 3H8NA 2GIYA 1SJXA 2X4RA 5SWZA 3L6FB 1NEZG 3FO0H 4LPTA 4WI2A 2QADC 1A6ZB 2W0FB 2VB5A 2X1WL 3OJDB 4L29B 4XWOD 4MXWH 1UGNA 4GAGH 3FT2B 1ZSDA 3FAXA 4GBXD 5CGYC 3DI2B 5AYUH 2R15A 1YN6B 3C5SB 3H3KA 5E8OA 4QRRB 3QUMH 4IHOB 1A7QH 3OR6B 2BHZA 4XGZA 1LO0H 3FO1A 3PDGA 5FYKD 3GHBL 3NTCH 4U1SA 1NDMA 4KK5D 4NC1C 2D31B 2XFXA 3SGJC 5I1IL 4X6DF 5GS0D 1RIVH 1C08B 5J11B 5I71B 1F3DJ 3QG7H 2XV6B 3T09A 4X5WB 5SWZE 2VZOA 1FV1B 1TZIB 3WBDA 4LAJH 4G5ZH 2VAJA 5KTEH 3QUYD 3DBXA 5DJ6B 2ADIB 1P53A 4UT9H 5D7LA 4LLYA 3ZHDA 4WCYH 4YBQC 1MHPL 3LRSB 4CRPA 1G7QB 5F3HA 3FO0L 1YMMD 4JFFB 2EC9U 3CH1B 3SDXB 3LQZB 5D5MA 4N0UA 5JTWA 3VJ6A 4LARH 3EGSA 3VXSE 3HMXA 1KIUA 3VXRD 4JFFA 4OD2A 3D3VB 2FIKB 3CX2A 2GJ6D 3JWOL 5EORH 3OKNB 2A6IB 4L8CB 3MRDB 3JTTB 1B90A 2CIIA 1ADQA 2J88H 3RGVA 3RHWF 3MLXH 1NGPH 4HKBB 3QIUC 4JR9L 2YRPA 5EZOH 2Q6WB 1FV1A 1CK0L 2F54B 1OQOA 1OW0C 1JHTA 1KJMB 3WIHA 3HC4H 1T89C 1I3RA 1E28B 5J06A 4XVTH 4KDVA 1R3HB 5E4EB 3WJLA 5JORB 3KJ6H 4JO1H 4QXWA 1XGYL 5F1KC 1NFDA 4OGZA 4UT6H 4LSUH 5CP7B 1OAZH 1S7UA 5CKGA 1LEGB 2BNQD 5F7EL 1T04B 3KLAA 1AGCA 2IG2H 4P2RA 1EFXB 2F74B 3NABH 5GXBB 1Q9LA 4D9QE 1WFNA 1GIGH 3BVNB 5HYQB 3WHE1 1UWEL 1BAFL 1GGBL 2HT2D 3K8LA 4J3XA 3MROB 3VGEA 3DUUB 3QEHB 4EJ1C 1RZKH 2EDTA 1VB9A 2F54E 4HQQL 4OI8A 1YY8A 3RWHB 3ULVD 3V0WL 4LCUA 3F7RA 2XTJB 5FUZL 1BECA 2AV1B 3CFJB 4L4VE 4Z7UA 3HI5H 1CK0H 4M62H 1EAPA 2R69H 4HIEA 5E8PA 3MNVB 4MAUH 3H9SB 1UZ8A 1T1XA 4HJGB 3QDAA 3L7FB 5FYLE 1AGFA 5F88B 4WNQB 3P30H 4NRYB 1EFXA 3IT8D 4X7DC 4XNQA 1GZPA 5CJOH 4UAOB 2GSGA 3UJTL 5D2NB 1AXIB 4I18A 2R1YB 3VRIA 1E4KA 4K07A 2YWYA 1DLFH 1PKQE 4QNPF 5CP3H 5IKCA 5L2KA 3EOAA 2X4OA 1A6TA 3VFNB 1RZIA 3NFNB 4XTRC 1E28A 1GOFA 3TN0C 1INQB 5JXAH 1H15A 2GJ6A 1A7RL 5B8CC 4MMZC 2D9CA 5T1DH 1FZOB 4J23A 1DN2A 4HQQH 4MDIB 1C1EL 2IQ9L 4LAQH 4WFFE 3C6LC 5LVEA 2A6IA 1D7FA 4D0DB 2RR3A 2XY2A 1P6FA 1DSFH 4J4PC 1U92B 2O5XH 4J6RH 1M6OB 3IFLL 1MAMH 3JWOC 2BRRH 4XNYH 3PDDA 2ADIA 2KPNA 5CBEA 4PIRF 1I9IH 12E8L 1NCUA 1NMBL 1EMTH 1CVSC 4GRLA 5GPRA 1EJOH 5J6GA 4OFVA 5SWSA 3LS4L 4FZEH 1QBML 2PTVA 5F70A 3NIDE 5GZNC 3OAUL 3UBXB 4ZXBA 3C5JA 3HE6A 4QCIA 2LTQC 5FHAH 3WDHA 3MCLH 4ELMA 3VGFA 1M05B 1IEBA 4N5UA 4JZOA 4YHLL 1BWMA 3VRLE 1I3GH 4OD1H 5JXAL 2XFXB 4YX2H 1QSEA 3MGOB 1RI8A 32C2A 5CIPA 5CEXA 4M1GL 4P46A 3UTTE 3NIDF 1N59A 1A6WL 2PXYC 2EXWD 1SBBA 4YHOL 4P2OB 2I9TA 4MS8D 4M1CC 3SBWC 1SYSA 2HYMA 1T2JA 4WW2C 3B5GA 4N0CD 2QSVA 4G7YL 4ODVL 3O3AA 3FFCA 3G6JF 1TJGH 1INDH 4NO2B 3BWAB 1MPAH 2EZ0C 2ITCB 3SKMA 4LSDA 2VYRE 1H8NA 5CSGA 1K4DB 4QXGL 1S9XA 4AM0B 4UOW1 3CSBA 4X9BA 3PWUB 4OFDA 3D18B 4Z8FL 4YDKL 5L2JB 1FQ9C 3QNXA 3GDBA 2WBJC 4NGHL 3P4OA 1IEAB 3IDNA 3MJ7B 5CCKL 5M95B 3MA7B 3WKMH 4H0GA 4OZHE 5CBAA 5DD5L 3M07A 3P4NA 1TVDA 3SCMD 4JANB 3DURB 2J8UA 3U36A 1Q94A 3ARPA 3TIDA 4ZXBD 3MACL 4KY1L 2GCYA 4HLZG 1MHHA 1MH5A 2MQ3A 3NVQA 3GM8A 3IKKA 1P9MA 1ZT7A 2G5BB 3L3KB 3MV9A 4Y8DC 1MCLA 3ARGC 1MCCA 4U7SA 5E6ID 3DETD 4WUKL 3LEXB 4FQIH 3AREB 5E5MA 4NQCE 3QDHA 3TP4A 4CDGC 1TZHB 2MKWA 3HNTL 3V5KB 2HT2C 3F7YA 1F6AA 5AEAA 4S1RH 2EEBA 3JWOH 2DIAA 5IB3A 5J6HA 5KSBE 5FO7B 1U58B 3CFDB 2PO6B 3OX8A 4QLRA 4ZAKB 1DEDA 3KNBB 3U36B 1AGCB 4P2RB 2RQ8A 1J0ZA 1E4XH 4BK4A 3BISA 3LHPL 2VLKA 4ZXBC 4R4ND 3CXDL 4QKXB 2A74A 4G9DB 4EDXB 1N0LA 4GG6E 5JW5B 1JGEB 3L7EB 1K5NB 1XGPA 2FECI 4Q0XH 3O4LD 2D9QB 5F1NA 4MB5A 1RK1B 2AI0L 4KTEH 4Q6IB 1FPTL 5GJTL 1KJMA 1RFDH 1EZVX 4CGTA 5GRUH 3CUPA 2NY3C 3PWJA 5I1HH 3IDYB 4P9HL 4K7PL 3TYFA 3S4SA 2I9LB 1T21A 4MNGB 4P4RB 3S36L 2YD5A 3E3QC 2VXUH 3NFSH 1T66D 5C0JB 1GCFA 3D3VA 3H2WA 5DJZB 1JUFB 1WZMA 3VCLA 2F53B 4K2UL 1MCPH 3T0EC 2BVUA 3TPUA 4X80H 1EXUB 4LVNB 3V95A 1U8IB 2HT4C 3NIGF 3RAJL 3IJHA 4LCIH 5I16B 1FLRH 1YEDA 4G8IB 4LLMB 2CIKB 4QRRD 4O02L 4UQ2A 1Q9KB 4RSVA 5D6DA 3RWHA 1A7OL 5FUZH 3KR3H 4PJDA 1U8KB 2ATKA 2D7NA 1IQDA 3EFDL 3IB4A 1J5OL 1KACB 5D96C 3E6HB 3S5LA 1OD7A 1P4BL 1QVOB 3IDJB 2WUBL 1DTUA 3FQXB 5EUOB 4YZFF 4PG9A 3IU4H 1R3IL 4HJ0D 1T7VA 1RZKC 2BXZA 5FGBC 4KKAD 3TVMC 4HKJA 1UM4H 4C83A 1LEGA 2MJWA 4P2QB 1NBYB 2E9WA 2ENYA 4RGNC 4JO4L 3WN5C 5ACZA 2BCKB 2DBJA 2NQCA 1D9KC 4XPGL 4F57L 5KS9E 5EU5A 3VG0H 2LU7A 3SPVB 3NCYS 4EI6B 1HEZA 4HIIA 3TO2B 4A2LA 4BSWB 1U8HA 3WUWG 1AD0A 3AMLA 1R0AH 2W92A 2NY6D 2GK2A 4ZG1A 5EOQL 1JL8A 2C1OB 3BP5A 5ID1A 1UJ3B 4OCYH 4QYOA 4JZNA 4RMRA 4MJ5A 2NY0D 1FO0A 3QDGA 5FOJA 1K3ZA 1X5JA 2Y7QA 5CLWA 1KCKA 3MODL 3WFDH 2H8PA 1CDCA 4NO2A 3OKNA 3VXPA 1NGXA 1WCBB 1GOHA 1FRGH 4NZTH 3B3IA 3ISWA 3TO4D 2GAZA 3LSOA 1HYRC 1BZQK 1RZFH 1AQKH 2OQJA 3QB7C 3P9MA 5AWNH 3PP3H 1S7XB 4JGMA 1U93B 2VXVH 4GMTH 3SPVA 1XCQB 4MDJA 4XNXH 4F7MA 1NKRA 2G60H 5IMLB 3MV8A 3MRKB 4QT5B 5KSVA 3SE9H 4FQLL 2EKSA 1MFCL 4U6XB 1IGFL 4PLJD 1T7WA 4GLRI 5EUOA 1IEBB 1R3JB 3H9SA 5FXCH 3QQNA 5CJQH 5KZCD 4LKCB 1XIWB 3C5JB 4QCIB 3Q2CA 3OXRB 4L9DA 5DQDL 3QFDB 3CH8A 5JW3L 1CE1L 4EUPA 4OV5A 1XIWC 3N85L 2R8SH 2YD9A 4L1HA 4I13B 3ZDXF 2EICA 3FFDA 1JZ8A 2A6KA 3FMGH 5BQ7B 3JTSB 2E6QA 1IAKA 2ILLA 1MFNA 2EO1A 3QDGD 3FT3B 3V0VA 1ZGLP 3PWPB 4M7LT 3BRGC 2BNQB 4YNYA 2R2EA 3B8YA 5TJWK 4EEEA 4J12A 1YA5A 1ZA6A 5CJXC 1X4ZA 4OF3A 4G6KH 3O6MH 5EOTB 1KPUA 5LXGH 4JG0H 1BM3H 2WUCH 3QFDA 3RI5K 1J86A 2IBGA 3MX0A 1FGNL 2AJXH 1ITBB 1WWAX 5H37G 1MCSA 3EYSL 1KXTB 1XGPB 4PGZA 5CCKH 4XWGL 1YJDL 5JIKA 3N9GL 5JUEH 5FGCB 4Y4KB 5MI0B 4NBXB 3BDXA 1U9KA 4JFYB 2IADB 3MRKA 1FFPB 1FSKB 1IC7L 5ENWB 4JFQB 3TNMB 1O7VA 4PRBB 3MRJA 3P73B 2VDRL 3PWPA 3CFDA 1J87A 4JPKH 4DN4H 2WNGA 1JPSH 4XBEL 4MHHI 2XZAH 4JFFD 1YMMB 3PXJA 1A0QH 3VFMA 2F8XC 1K8IA 1WZLA 4HS8H 5F3HB 4I5BA 1C5BL 5IT2H 1FL5A 5GSRA 4KFZC 3X3FH 3PG2A 1FNGA 3GNML 2P46B 5IFJB 3RNQB 1TCRA 2R0ZH 3ARXA 3BZ4B 3CVHH 4FP8L 4PRIB 1A8JH 4I3RL 1CBVH 4JFEB 1F3JA 4PV8B 1UEMA 2MPAL 3LEXA 1G0XA 3LKNA 3W5NA 2W9DH 2YZ1A 4HCRH 2AABH 3O6FB 2FNBA 3GHBH 4P9ML 1E4XL 3L9RA 5D7JC 4FXGA 5C09B 3N1FC 1KNOA 4L1DA 3OR6A 1Q94B 1A1MA 2G2RB 2NYYD 4XMLH 3P2TA 1WWBX 1L7TH 2CGRH 4XCFH 5BRZA 4DGIH 4JN1L 3GSWA 5KJRL 3BIKB 5CJXA 3T4YB 3SCMC 5E9DB 4NN6C 4UT9L 4HT1H 4NQCB 1R6VA 4XPFH 5C08E 1R5VB 1JWMB 3P4OB 2VQTA 5LKNA 1UADC 1C12B 2OZ4L 4YHKL 4PV8A 1WITA 5DK2B 4HKBA 4XCCH 4BQ9A 4OUOA 1FYHB 3OAYH 3CZFB 3VXMB 5CINH 1A9EB 1NAMB 4HGWA 1H3TA 4BH8B 2OTWA 2ZCLH 5ILTL 3FZUD 4I3RH 3KG5A 4M61A 3RWFA 1KGCE 4NC0B 4CN4A 4ZNEE 2HFFB 4O2FB 4WUUB 3VE0B 2ITCA 3SKMB 1LO4L 1HINL 2UUDK 3FFCB 3PGDA 4EVNB 5E94A 1AGBA 3Q5TA 5JIIA 3QYCA 3ZKMD 3VW3H 3UO1L 4FQCL 5IHUL 2VDQH 3VFGL 1G7HA 5ACMA 2X40A 5C8JA 4FQQA 5MENA 1HNFA 1G1CA 3LB6C 2CXGA 3DTXB 3QUMA 5GHWH 5FB8A 2H9GA 1PG7W 3SKNA 1WZKA 5IW6A 1MCBA 4Y7MA 3NOIA 2OR9H 1AR1D 1I1AB 5HDLA 2OI9B 1CS6A 5I2IA 4OQTL 4FHBD 5T3XH 1IAIH 3HE6B 1KPUB 3QZWG 4NKDB 1NLBH 5E8OB 5CSZA 1GGIL 4RWHA 1BFOB 1KTRL 4PJCB 3BAEL 2HMID 3EYUL 1UA6H 3VWJC 4GKSB 3OJ2C 1G7PA 5DHYA 2BOBA 4FQJH 1IAKB 3W39B 1U8QB 5IF0B 5E6IB 4MJ2A 2ZSVA 4N0FA 2DIJA 4OCWL 5GGUA 3WSQL 1VACB 1QO3A 1VFUA 4JPWH 5BVJB 4BH8A 3IU3B 4P2RE 1TJHL 2CLZA 3MLXL 2DI9A 3GHEL 1YPZF 1YQVH 5DJDB 2JB5H 3G6JE 5KVEH 4KKCD 4PB9H 5BZDA 1DQLL 2ZG3A 5E2WL 3GSVB 1AGEB 3OV6A 5TE4L 1XF5A 5C6TH 3LV3A 5CEZD 5E9DA 2GEEA 2YPLA 4LNVA 1AY1H 2BSSA 3CX5J 3P4MA 1X4XA 5IMLA 4XP4L 35C8L 4EI5C 5JOPE 5L6YH 2UWEB 1CE6B 2DM2A 3RGHA 4DGYL 5IQ9A 3K3QA 2VABB 4YHIA 5AZEL 2BNRD 4CW1B 3S7GA 5I73B 4MNQA 3SKJH 2KZ1B 1Z9LA 1EAPB 5CJBA 2XA8H 4LPCA 4BFEA 4OCWH 1W72H 1ND0A 2W9EL 3TYGL 3HAEH 5ACLA 4LVNC 3ULUE 1XF2A 5I1GH 2YA0A 1JPGB 1XGQB 3DETC 3Q6GH 4M7KL 3VFVA 1QRNA 4MA1C 3V0AC 2J1KA 5D2NC 1L9NA 2QQNL 2IALA 3PJSA 2V17H 3B9KD 3DLQR 5FF6A 2BOCA 3ZL4L 5TFSL 1T83A 5D2NE 3CFIC 2X89A 4KGLA 3PHQB 5DRNA 1Q0XL 3BRDA 1KENL 2YXMA 1LEKB 2JJWA 4DJMA 1T3FB 4OD1L 4MA8L 4WEBH 3WXVL 4OZGF 2CLRB 4WWID 4P2RD 4G8EB 2PTTB 3PDOB 5C0GA 2E8ZA 3K1DA 4HK0B 4QRTA 1TETH 2A73A 3QXWA 1FGVL 4PG9B 5A1AA 1A6WH 4AEFA 4WRLA 4QXUL 1BZ7B 1ACYL 1SYVA 4PRPA 3ZDZF 4N9GA 1EBPA 1CLOH 1HQRB 3FB6A 3CPLB 2H3NA 5DJCA 3ZKQD 2J8OA 5MENB 4G6ML 5JW4Q 1MFDL 1NGZA 4P23A 3LKPB 2UWEE 1RSFA 4DN4L 5E9DE 1JHLL 5CEYA 4KUCD 1U3JA 3RWJB 4XCEA 4LSSL 3O6KH 1CXLA 4I2XA 4RWYH 4LHUG 5DJYB 4UIMA 4TVPH 1G7JA 4OLYH 4R0LB 5IBTL 5FM8A 2YK1H 3I85A 1G7JB 1HYSD 5GS2D 1RD6A 3VD3A 2AK1L 3IFLH 5JR1H 1UQSB 1KCRL 5T1LD 2RCSH 3I75A 1LE9B 2KKQA 3PWNB 5B4MC 5I9QB 2NLJA 4ZNCD 5EFIB 1JYXA 3MRMA 3QRGL 2AABL 4JFEE 2H3NB 4GRWF 4S1QL 1QFWH 3U48A 3L1OH 4YEFA 1C12A 3RVTD 1DBAL 5DEGA 3DHMA 1A6AB 2FO4B 1K5NA 4KVCH 2DJ4A 1CGSL 3AS1A 2EKSB 2HTKD 1U8LB 3F58H 1NL0L 3L5JA 4QT5A 2FJGB 3ARGB 1EDQA 4LNRB 2KL6A 5JPMB 3DMMA 1UJ3C 3RX8A 3MGTA 4TNVK 1M71A 1S9WA 4R0LC 5DS8A 2J5LB 1X5HA 3L7FA 4ZPTA 1TQCB 4J1UB 5D7KD 3O3DB 1RURL 1AC0A 4G7YH 3ALWA 3JWDC 3KDMB 4WW1B 1CFBA 4NZJA 3DVIA 4GKNA 4LPUA 5SWZB 2HMIC 2NW3B 5D1ZC 4HWBA 3BEWA 4NJAH 1MCEA 3TJEL 1FYTD 3MLYL 1LO4H 4QRQA 3BJLA 1YEEH 4X98A 2M26A 3MLUL 1INQA 3QRGH 4U6TA 3GMOB 4YGVB 2D0GA 5IB5B 5BVPH 4JE4B 1IM9B 2BHYA 3W81A 1KCUL 5DMGD 3BPLC 3ZHLA 2CR3A 1CGSH 1UCBH 3V5DB 5JPNA 3BT2L 1DVFC 3F5WB 2EH8H 3A6BL 4K3JH 4KTEL 2Y36H 4I3SH 4K8RH 5JXEC 3BSZH 4ODBD 2ZJSH 1BVZA 1OF2A 3HUJF 3P4MB 1MFBL 3NPSC 3S98A 4GQ9L 4LMQI 2XQYK 5CUSH 1CZ8H 4PGCA 2IAMB 4LCCC 2X9XA 4OQTH 1LHZA 2Y1VA 3HE7D 1PY4A 1HHHA 1OAZL 5D7LD 2Q3ZA 1JNHB 5IMKA 5JHDD 3E8UH 3IU3A 4LCUB 1IQDB 1VFBA 1VEMA 4CVZB 1G9EA 5DGRA 1I7TB 5ERWA 3VFRB 1NEZA 4V1DE 3AC0A 5D1QD 4X4YA 3UEZA 4HC1L 2EDBA 1UYWL 1FSKC 1RJZB 5J0BA 1S5HB 3RPIB 3MRBA 2XPGA 3VDBA 3EGSB 1Z9OA 4ETQA 5JIPA 5GISH 4H26A 3FJTA 3GIVA 4HV8B 5DURD 4GKZA 4YH6A 3VWJB 1UWGH 5EU7C 3FFDB 1HDMB 2GTWB 3SO3B 2IFFL 3MLZH 3D39E 1CVRA 3SOBL 2CK0H 5I1CL 2X4QB 4PJ9C 1ZTXH 1C16B 4ODUA 4XVJL 1B9ZA 4XPTL 2V2WB 5C3LD 1U6AH 2HVJB 1KCLA 4PG2C 2IWGA 4FQ1H 1UH3A 4YDJB 3RTQC 4ODHH 4KKBD 1RZ7H 4TPRL 3EDFA 3IGAB 3GKWL 4HMDA 1S5IL 3OKKA 1F4XL 4GOSA 3I84A 1RVFH 4NKQB 2AJVH 1IC4L 2VITB 1JF1B 3QI9D 5JW4R 5AD0A 2XT1B 2OQJB 4WIQA 5DD1H 2YUZA 4N9OB 3OJDA 4RFNC 4PS4H 1A1OA 2DLTA 2W9EH 2Z92B 3BN3B 4NNXA 4ZOAA 2RAMA 4R0LA 5D7LB 4EN3C 3QH3A 3QEUA 4Z7QF 5H2BB 1KB5B 2BC4B 2BDNL 3RWFB 1OVZA 1N5AA 3MLZL 3DX6B 4Y4KD 1FZKB 3DXAB 1F6FB 3REWB 1QUNA 4GFTB 1WZ1L 3LS5H 2WUBH 3VFSB 3E2HB 3MYZA 4HMEA 2D31A 3KWWA 3DGGA 3BIKA 1R3IH 2I60H 2ZOKA 3V6ZA 3QXDA 4RGOL 3HE6D 3GMRA 1UM4L 3KPMA 5IG7A 5FGSA 4YBQD 4XBPB 4LLWB 4NC1E 3RJDA 1IGML 3KYMB 1KPRA 4HCRA 5TDPA 2LTQB 4B50A 1KJ2H 3D3VD 3OBAA 2GHWB 3FQXA 3IDJA 1QBBA 2J4WL 4F8TA 1JZ2A 5ICXB 1WAAA 3T0EA 5ADPL 4NO0B 4X0KA 5MHSD 2ERJB 5C09E 5I9QC 1H8SA 2EDQA 3N1GC 1URLA 4MNQD 1NGYA 1SY6L 2O61B 3KPRE 4PRIA 2DLEA 1NBVL 1DANU 3IJHB 5HDQL 5I16A 1A6VH 1BHGA 5IK3B 1MHEB 1AXSB 1NCCH 2BVEA 1Q9KA 2JKXA 4JDZB 2SEBA 4QRUA 3N1PC 1DQDH 3MRGA 2XZCL 1CXFA 2VAAB 1X5LA 4MXQD 3MUY1 4QOKE 2NY5C 2VZUA 3QCTH 2MCPH 4I0PC 2NXZD 1BFSA 4DKEL 2ZSWB 2A83A 5FDYA 3WYRA 3TCLA 5T1KD 4XNMA 3X14B 3HZVA 3RWDA 1T1ZB 4XPBL 5C2BL 1A4KB 1YPZA 4I9WE 2V6HA 3CFCH 2RIKA 1MIEH 1L0YA 2R2BA 3NH7L 4N8CH 2YPKB 3ARTA 2R0LL 3WFHA 4G43B 1RZ8B 4K71B 3QEGH 5F9WC 3MLSH 3N85H 2R8SL 3WIIH 1T0NB 5I76B 4G9FB 4X4XB 3PL6C 3WS6C 4IS6A 1HI6B 1NCBL 3NACL 2B8OT 3LKOA 4W70A 2OJZH 3C08H 3PUCA 2AJZB 1CD9B 3B9VA 4K94C 3FOMB 3CDFA 3VJ6B 1QOKA 1U58A 2R4SL 4QGTA 5HHQB 3MV11 2ZUUA 4XVTL 1G9ML 1CGYA 4HFWA 4JPVH 1L4IA 3LKRA 4PJ5B 4WDIA 2FX8L 3ULVE 1Q1JL 5CLTA 1K9TA 2Y4SA 1MY7A 2APTA 3O2DH 5FAAA 2A9MH 5D9SA 3KPOB 5DF0A 2IG2L 4F7EA 4W6WB 3VRLF 3MJ8A 2FYYB 2EH8L 3G5XA 2OR8A 2QQKH 4QRPB 4AT6B 1D5MB 5HGAB 5HGHA 2Z8RA 4ONHB 5JDSA 3TIDB 1LMKA 3CGTA 4QF1B 2V2XB 3HZYA 4RGNE 3EYQD 4Y4HC 1YN6A 3HC3L 4Q0XL 3ES6A 4Z7WF 1T2QH 1DVFB 3TH3T 1BQLL 3C6SB 2AGJH 4M4PA 1FIGH 3PV6B 1R3KA 3NA9L 5DQ9B 1NFDF 2JCCE 3DGGB 1MUJB 3FO9B 1XR9B 2ZP0T 2HT4D 2NY3B 4RAHA 3SN6N 5IT2L 1QFUL 2UYLB 1TIUA 3DUSB 3GSXB 1G6RA 1K4CA 1BIHA 1OGAB 5CJ8A 1CICC 1QA9A 1UYWH 1LILA 3FRUA 4F33A 4TRPL 4OI7A 3QDGB 3V79C 3X11B 2DTSA 4PY7B 4XP6L 5IP4A 1HH6B 4FQXD 3BWAA 4U6HA 2NTFA 1UFUA 3TA3D 4IIQA 5D1QB 4NQXB 1MJJB 4LSPH 5DVLA 4PLJC 1IAOB 3QA3A 3S88L 4NO0A 4NQCA 4PJBF 3CC5A 2NR6D 5LQBH 4OZIF 3S5LG 1NGWA 3FAWA 2V7NA 4MB3A 2AJ3B 2IAMD 4X6CB 4DKFL 4UQ3B 4PJ8B 4JREC 1I8LC 3ILPB 3EO1B 2C7UA 5C09A 2FYYA 2HVJA 2GT9B 5F7WC 4HUVA 2O5XL 3F62A 3EJZC 4LFHG 4CU7A 1MJUH 1IQWL 1QFUH 5HHNB 2BRRL 4XNYL 5E7BA 4KRPB 3BW9B 4JO2L 4XPGH 4F57H 2VDPH 4U1LB 4HIJA 3QO0B 1BQHA 3CIQA 4MX7B 3QIWD 5E70A 1TCMA 4O58L 4GXUN 3VD9A 4MNQE 3GIVB 3HI5L 4YXKL 1DZBA 4NNXB 3WLBA 3FQWA 2AKRB 4GKOA 2NY7L 5E2UH 3UO1H 2WBKA 4XCEB 3UPCA 1A6UL 1E6OL 1RJCA 1JV5B 1EEZB 1TTGA 4P3DA 1HI6A 5C0BB 2E6JA 4NQTA 4G8GB 1W0YT 3P30L 1NEZB 3U30B 1OLZA 5DVNA 1KC5L 2PCPB 1VSCA 3C5ZD 1NUDA 4V1DA 1JWUB 5GRVK 5HHOB 1U8MA 3THML 4UT7L 2P5EB 3AS0A 1J05A 3ARGD 4JFDA 4IDJH 4FNLH 1LNUA 5HBBA 2P5EA 5EO0B 4AMKL 4G9DA 4EDXA 4NFBA 5HHMB 3BD5A 3GJFB 4GG6F 4NJ9L 1MELA 1OGTA 5JZ7D 4NQDE 3O6LH 5IB3B 3HR5A 3CDGA 4PJEE 5CZKA 4L29A 1BF8A 2YR3A 1HWGB 1H5BA 1UWXH 5J11C 1DFBH 1QKZH 2VWEE 4XB7A 5DFVC 4KQ3H 4F9PC 3CSYB 2XY1A 4ZQKA 3DSFL 4AEHH 4NDMA 3DX7A 4J6RL 4NOBA 5T3XD 2XQBH 1OWRM 4MJIB 1U2HA 1MAML 1PEZA 2EDEA 4M8VA 2F53D 4UTBH 5EU6B 5IMMA 1U8OA 2X09A 1FNGB 1T1WB 1CGTA 3EYOA 5E99H 3MACH 5HYQA 3KPRA 3V4VL 4CW1A 3KPPA 5I17A 2C4FT 5JHDE 3P0VH 4PYGA 1NMCC 3QJFB 2FWOA 3P73A 4Q7DA 4RFEA 4NPYB 2B39A 2FBJH 3LN5A 5EB9A 3HPJA 5JXED 1IGJB 2DD8L 4JFED 4IBLT 1F13A 5HDBE 2HRLA 4DFIA 5KSUB 2BNRE 1BZ9A 43CAA 2HKFL 3ARQA 1QQDA 3GMMB 5GGVH 3T0AA 3NCBB 4N8VA 4HSQA 1Z2KA 2XQBL 3JTTA 1KELL 3RDTC 3MFGB 2UUDH 5D2LE 5IW3A 4U1NB 1XF4B 2X7LA 2CUMA 4M7JH 1DQJB 2AEWA 3QRFM 4UIKH 5IB2B 3WLBB 3SE8L 4LCCA 3FCTB 3O0RH 3EO9H 3VGAB 1MREL 4JFDD 1SMAA 2DS4A 1LQSR 1OTUC 1WFUA 2F19L 2P5EE 3MRIA 3VGAC 5GJTH 3UJIL 3JZ7A 1WUNT 4D9LL 4OTXH 4J3VA 1CBVL 1CDYA 4XMKH 2B4CL 1C7SA 2IH3B 5L88H 4LLQB 4A6YA 1YECL 1KJVB 5KSBB 5E7FA 3RIFF 3SJVB 1JK8B 4HIXH 2DYPA 4AYFA 1D5BB 1C7TA 1BP3B 4ZTPH 2DQGL 1IVLA 3TT3L 4NRXB 3ARSA 4JAMA 1ZGLB 2HTLC 3PP3K 2AXHA 4ZUUA 4HHAB 1PD6A 5IGXH 2V5MA 4HK3J 3T0WA 4AL8H 2PCPA 5E8DH 2QQLH 3T3PE 2YSSB 4LHUD 3ULVF 3HC0A 1Y0LA 5I1DB 2LAAA 2E8YA 3PWNA 3RI5F 3IF1B 3DROB 4EDWH 4PY8I 3BDBA 2AK1H 3I6LD 4G7VL 5JR1L 4R6UA 3OGCA 3ARFC 3QUZC 4AIOA 5GRYA 3X12B 4AG4H 5EC1A 4DZBB 3TWCL 3W9EB 3IKCA 4BFGA 2H2PC 3G08A 3OHXA 1V8HA 1MWAB 1IKFH 4X6BA 4PREB 3EJYD 3CAFA 3NFNA 4YPGB 3S88H 4NM8H 1F4WH 2HTKC 3DX8A 2P7TB 4OGXH 4QRTB 1A9BB 4R7DA 4HZAA 1AXTL 1IGJA 4UZGA 4ZUTA 4JQIH 4MNHA 5DA0B 3BQUC 4AEEA 4YDVB 3SQOH 1NGWB 4JY5H 4JY4A 3NN8A 4BH7B 1PG7H 4K7FB 3PHQA 2P8MA 3KPRB 2FZ3A 2DJSA 4PRHB 4G3YH 1GVIA 5I17B 2HG5A 5F7KC 2VISB 1IAIL 3LKNB 1IAIM 4G8GD 4RRPA 3K8MA 5AWNL 1X5IA 4HUWA 4DVRH 2VDPL 4XAKD 1IGYA 3UJJL 4ZUVB 4EOWL 1UA6L 4NSKA 3MJ9L 3WMSA 4ODTL 4HFWB 4JR9H 1OCWH 3VH8B 4FQJL 4MJIA 3FZUC 4G9FD 1I1FB 3W11C 3C60D 5D70H 1I9RL 4N1EA 2ZKHH 4M43H 4OIIL 4JRWA 3OJVC 3JWDH 5DT1L 1TJHH 5K9QG 4RQQA 1SEBB 5B38A 1QLFA 5IB4A 2YA2A 3RP1A 1CD1B 1QYGL 4PP2B 2CKBL 1QRNE 1FFPA 1A3RL 5ENWA 3MXVL 4EI5D 1U0QA 2JIXA 3EAKA 3HS0B 3UDWA 3QQ4B 2CJUH 5E1HB 5C6TL 4KKAC 5EOCJ 5JDSB 1DUZB 2R1XB 2YA1A 5FKPA 2HAZA 4AMKH 2IBZY 4CADB 4QRPA 3PGCA 1CFTA 3DO7A 2X4NB 3DNKA 5HHOA 5DSCB 3DRTA 1WAAF 4DVRL 3IAGC 4XPHL 4JREB 4L5FL 5MEPA 3FO2A 3GMQB 4LASL 3ET9F 3CVHB 2PW1A 3RWCB 4FABL 3G6AB 2IJ0C 3P9WB 3LVEA 2UZYB 4LCWE 2V5YA 1TTFA 3I02A 1NUFA 2Z92A 3ECBB 1YC8A 2O5YH 1U8QA 1WZ1H 1G7IB 3GBML 4QWWD 1SYSB 3BPOB 5DJYA 3AAZA 2AJZA 5HGBB 1KEGH 2CO6B 2ED8A 1QYGH 3BW9A 5C6PB 1UM6H 3V4UL 3QO0A 3LD8B 5BW7C 4O4YL 1BFOA 1IAII 3QCUL 1FNEB 1WFTA 2Q7YA 3T77A 1OHQA 3U7WL 4RX4D 3ZKND 1QSZA 3CU1A 2RBLA 1R5VA 1NDMB 3O45B 4KKBC 3B43A 4L4VB 5IROC 3H3PL 1MSPA 5CZXD 4Z7OF 4PJ8A 2OZ4A 2FX9H 3HG1D 3EFFA 1C5BH 1D5BA 5I74B 5FB8B 5ADPH 2XXCB 2DD8H 1RVFL 5EUKA 1I4FA 3I2CL 3RKDC 1CFNA 4HPOH 1MJ7L 4PJBE 4N0YL 1MFEL 2VDML 2RFXB 2GI7A 2EIZA 3VI4F 4CL7A 4QWWC 2PR4H 4QRRE 4L3EA 4RMUA 3BPNB 3IJYA 4NQXA 3MUHL 2NXYB 1WCBA 3V7MA 1PYWB 5B39G 3RZCD 1JFQH 4D0DA 4ERSH 2J8HA 5JHDA 3MFFA 4HKXA 1QRNB 1CD0A 4XRCB 1QZ1A 4RWYL 3QUML 1S3KH 3KYNB 4HGWB 5D2LF 4PRAB 5FV1L 4OZIA 4N8VG 2E27L 4G42B 3VG9B 3BPCB 3DUSA 3GSXA 2E9BA 3FOLB 2LVCA 3GMLB 4RAVA 3UTZA 3L3GA 4OCLC 4MQ7B 1E4WL 2YPVL 1D5ZA 2N7AA 4JZJC 3FB8A 2ESVA 3HPJB 2AEQL 5C7XH 3HZYB 4PJ7B 2FBOJ 2QADB 2VQ1A 4HPOL 4AENB 2WANA 1SVCP 1NAKH 4PJGF 2IPUG 2QQQA 3B9AA 5JPNB 1AHWC 2VN4A 1U2CA 3TO4A 1T83C 3DVNB 4IIQC 3L5XH 2DQHL 5A2FA 4OGAD 3LPGA 5CD3A 3L3JB 1M4KA 2EE3A 4IRSD 5ISZB 3STZA 3NFPB 3ALPA 2PYFB 3IKCB 5DFVD 5BOZG 3W9DA 4GRLB 4M6NH 1FVDB 1YY8B 4JFDE 4XT1C 1A64A 1T5WA 4U2ZA 3CVHL 4BQ6A 2JIXD 3QEUB 4Y19E 3NCJL 1ADQL 4YNYB 4PGJA 3MJ6A 1YNLL 1KOAA 5ESQB 1YYML 2YBRB 2XPGB 4KWUA 1G6VK 2OR9L 1RUPL 2ZUYA 1KTKE 3LQAL 4XXDA 3NCYP 2GSIB 1MIMH 5TF1L 3MBEA 4PB0L 4YHZH 5IR1B 5ABDE 4WI4A 1J8KA 1J8HA 2FCBA 4MAYD 4IMKC 4L8DB 2PW1B 3RWCA 4NRZA 1AHWB 5EC2B 3GJFA 4Y4KA 4NM8L 1HXMA 3GEWB 5D1XA 3QUXA 3ARBD 4H8WH 5FOBA 5I1JL 1FORH 3ZZ1A 1ZLWK 3FN9A 4Q6IC 2XWTB 5DEGB 4N8CL 4WWKA 1ZOXA 2QL1A 1BVLA 1UB6B 3A6BH 2PXYD 4K3JL 8CGTA 5EO9B 1TPXB 1J8HE 2UZIL 1DUZA 4K8RL 5T3ZD 1KBGL 3BGMB 4HDIA 1R5IA 4ZPVA 4WUKH 2OZ4H 4YHKH 1MFBH 4LKXB 2ZSWA 4GQ9H 4CVWA 3C9NA 3V52H 2EDWA 1FH5H 1AGFB 5LWYH 3U0PB 1MQ8A 4M3KB 4LRIA 1M7XA 4XWOC 5C70A 1JPFA 1NPUA 5MENE 4DAGH 4U1JA 2VDOH 2DKSA 3QWRA 2G5RA 4W4OA 3IDXH 2YS4A 1JNNL 1G84A 4M61B 4F80A 3MJ9H 5BQ7A 2X9YA 4LSTH 1P7QB 4C56E 5F9AC 1X6LA 2NX5B 3HR6A 1QSEE 5F7YC 4MJ5B 2OI9C 1NAMH 5DRZA 4C55A 4LKCA 1NC4A 1JI2A 3QULA 5TH2B 2Q8AH 4ENEC 4P3CH 3T2NL 3ZMRA 3D6GA 3ZE1F 2IC2A 5DT1H 3UYOD 2FD6L 3QHZL 43C9A 5I1EL 2IFFH 3ZYJA 3KLAB 3EDDA 1ORQA 5DI8B 4L3CB 2ZUXA 4KV5F 1ZTXL 4YBLB 1D9KB 5GGVY 1X5YA 3SDDD 1C1EH 5DI8A 4ZD3L 3P0GB 4MDJB 1ZHLA 4PJFB 3BRFA 4YO0B 1T3FA 3N1QC 3BUTA 1CGWA 3EHBD 2Z9TA 5DTFB 4GXVH 3SKOB 2FO4A 4XBPA 5E03A 2AGJL 1QLEH 3NCCB 1D5ZB 2E5EA 4X6EB 4JEGB 4APQA 1CF8H 1KCSL 1MQKL 3QO1A 1JTTA 4Z7WA 1NGXB 3L3HB 4OFIA 2VLJB 4Y0GA 3DX6A 1NC2D 1LO5A 5IV2A 3VWJD 2HH0L 5E1AA 3C6LA 4WEBL 3VXTA 3MBXH 1S7QA 5BXFA 1UXWB 5IV2B 1TCRB 4NDMB 5DK0B 1LK3H 1N6VA 5C0NC 4GKNB 2Z91A 1MCRA 4RGMC 4ZO7A 3SDYH 4KRPD 3GI9L 1CTOA 3KYKH 2W0PA 2ZG1A 4U7MA 4JG1L 1U8HB 2I9TB 3U46B 4TNWK 1CLOL 2HFTA 3FKUS 4L4TA 5HYSA 2VDKL 1WTLA 2OL3L 4YR6A 4F7TB 2XZQL 3V4PL 1FNSH 2V5RA 3WS6A 2LVEA 4QF1A 5ETUB 3SCMB 2XQYG 4OLYL 4RZCA 4BFIB 2ZCKL 4C83B 3BP4B 3A67L 4L4VA 4Z7UE 1DBJL 1TQBC 1SMOA 4K3DL 2H1PL 4AQ1B 2NY1C 1X7QA 4X6FB 1X9QA 4TSCL 1MJ7H 2XA8L 3KS0J 1ORSB 5IVNA 3BYYA 4KQ3L 1AHWA 3MOAL 1HHJB 1D6EA 2AJUL 5EZIL 1LEKA 3RVXC 3NZHL 2DTMH 3WD5H 2X4PB 5GZND 1CL7L 4QTHA 2E7LC 1XGUB 3VGHA 4JZJA 3UBXG 3ARVA 5HYJB 4WW2F 1KB5L 5F1IA 1MJ8H 4MYWB 4OSUH 4TSAH 3FCTA 4MCZB 2BY1A 3S8WA 3H9HB 2O26U 2DN7A 4WV1B 4HK3N 1RJZA 2YN3A 3DYOA 4PLKC 3KPNA 2D7MA 3RUGE 2ZCHL 2H26B 5FGBA 2VXQH 5D7IF 2EDKA 1B4RA 1RIHL 3OKOB 3MZGB 3W0WE 2VUOA 1F2XK 1U8PA 3WFHB 5JNYA 3D5OF 4RGND 3PABA 1FVEB 1WBZB 4XPAL 1RZGA 3VXUA 3BKYL 3SDDB 5I8EA 2C7UB 5I1LB 5SWSD 5F9JA 2FATL 4GO6B 1CL7I 3TJHD 4Q2ZB 3B2UD 4AIZB 1VERA 4L4JA 3KXFE 3QDMD 5JOFA 1DUYB 4AQOA 5BO1H 5IR1A 4MD5A 1P4LB 4JKWA 4K94H 3KYOB 3LV3B 2GSIA 2FHCA 2KZWA 1SBSH 3GM0A 5E94B 1A7BA 3O6KL 5LG1A 4NQDD 4HUXB 4LFHD 2Y07H 5FUOL 4FOMA 5KVGL 3B5HA 4CDHA 2C3XA 3AMKA 1CFSA 4GS7C 3VXUE 1N26A 5IVZB 3AREA 5E5MB 3UZEA 2JJSA 1FVDA 1CCZA 1HYSC 4ODXB 3QEHA 4QO1A 4JQXA 1BM3L 1KTDA 2UYLA 1T7YA 2ZJSL 3BGAA 4MCYA 2QSCL 5E6IA 3QEQE 4HUWB 3MA9H 1QLRB 1RIVL 1KJ3H 5EIIB 1KLUB 2AEIT 3O3AB 1IE5A 1G6RL 5HYFA 5J1AB 2OSLA 4G5ZL 5DS8B 2V9RA 2FEDD 1IFHL 2J8UB 2GCYB 3O4LA 3LIZL 5JMOC 4NHCH 5SX5K 3D39D 3IS0X 3PWVA 4ZO9A 2CXKA 2XA3A 4ENED 2B2XL 3ARDB 5DGQA 4GQPH 1F2QA 2CRYA 1AP2A 1N7ML 3EO0A 4KHXL 5BO1L 4KK6D 5DRWB 3FQNB 4DOHB 2C5DC 3KPMB 4DW2H 4M03A 1FNAA 4FZ8H 3GMLA 1EEYB 2AQ3A 2XNAB 5F3BB 3CSGA 1HZHL 2OR7A 4K23L 4OKVB 1MNUL 3MRLB 5KOMC 4PG2A 1OSZB 2Q7NA 1MWAA 3SJVE 4OD3L 3WV0A 1F6LL 3FT4A 2AEPL 5GRVL 3RVVD 1N5AB 4ELME 5SWSB 3WIFA 4WI7A 1UENA 1XH3A 3BKJH 2YEZB 3S96A 1ZT4B 3MRFA 4WUUD 3I75B 3E2HC 2DQJL 2R0KL 4PLOB 2VE6A 3EO9L 3JUZA 1CDBA 1EHAA 4MAYA 4L4TE 4X8XA 2QR0A 3BN9C 1RV6X 4DUXA 1G7PB 5DHYB 3IDMB 5DJZA 3VCLB 4XNZB 4Y89A 4Y2DD 5DD0H 4GSDH 2CDFB 1EFQA 3QPXL 4W4NA 3GSUA 2AK4D 1W72A 1P4IH 3WLWD 4BUGA 3O9WB 2BFVH 2A38A 4Y16C 4Z0XB 5IW1B 1BJMA 4Q2ZA 2JJSC 4AIZA 3V6OE 4WHTA 1JNLH 1HXYB 3OKMA 3QFJE 3I9GH 1DVFD 1QHOA 4UV7L 4DW2L 2Q76A 1AR1C 3PGFH 1QP1A 1VGEL 3O8XB 5KN5B 4FQHB 5CUSL 2IANB 3PL6B 3NGBC 3HZVB 3MLWL 1EV2E 5BRZB 1V05A 3RWEB 1TDQA 1AIFB 4HK0A 4XCCL 4XI5D 2BJMH 4JCLA 2H26A 4OZHF 4MZ3A 4JDVA 3IRPX 2DQIL 5JXEA 2R4RL 3BN9D 2JE8A 4UNTA 1SEBA 4LLAA 4EUPG 5B38B 5E56A 5ICZB 4G7VH 5F7DB 1CLYH 1B6UA 3I02B 2I60L 4M6MH 4H5SB 1QSED 3UX9B 2IBZX 2J6EA 4GSDL 3A6CL 5HPMA 1EJ6A 4PY7A 3RZCC 1A02N 3LKOB 4PRPE 4X5LA 2PF6A 5IJKA 3GO1L 5FM4A 3V5HB 1BIIA 2DYPD 5EZOL 1JPGA 1XGQA 3BZFA 2Y5TA 1K8IB 5IMOA 2P43B 1BZ9B 3GJEA 3E3QE 4HUUA 4QHMB 5E00A 3BIBX 3BMWA 3PV6A 3ARBC 3MLVL 4EIZC 3UZVB 3OXSB 4NFDA 3O41A 1YMHB 4M9OA 1TVBA 2P8MB 2HKHH 3ZT6A 3O2DA 4BZ2L 3T1FB 4M7ZC 4YDLC 1X5FA 2IADA 1H0DA 3SQOL 4LSRL 1PSKL 4OZFG 3DRQA 3MO1B 1C5DB 5T33L 4FNLL 4KH2A 2AJVL 3FB8B 4KZDL 4JKPL 4AT6A 2NY2C 2HRPL 3L9RB 1KXQE 1O0VA 2WV3A 5ID0B 2J2ZA 2L7JA 3SO5A 4JJHA 2HVKB 2V9TA 2NY4D 4DK3A 3D18A 3V7AG 1G9NC 3QHFH 1ZMYA 3D2UB 5IMOB 3LS4H 1RZKL 4XVSH 3V6OC 3KVQA 2B1AL 5ESAA 2VXSL 3UTQB 3D0LB 3JVGA 1T22B 5FHAL 4L8CA 3GO1H 4NKMA 5KS9B 2HJKB 3KDMA 1F02I 4S10A 1CI5A 1MRDL 4OI9A 3HZKA 4M62L 1KB9K 1IBGH 5ADOL 4P2QE 5DUMH 1DQQA 2Y5EA 5B3JE 3NH7H 3EYQC 4Y4HD 5IHZA 3QNYA 1QR1A 3SGKC 5AAMA 4Z76B 1YEFL 2YPLE 4RNRB 5DHVH 3VU2A 5BRZE 3FFCE 4TUOA 3GI8L 4LQFL 4PJXE 3QEQB 4DN3H 4FXKA 4I48A 1YDPA 4Y19A 3RWEA 2LE9A 5L6YL 3QIWA 3TT1H 5C0IA 1T0MB 2BNQE 3RDTA 4KZDH 4D0CA 1AR2A 3ARDD 5DMJB 3ZLQC 2YPKA 3KPQB 5CEZE 4PRNA 4HC1A 2RHEA 3VXRA 3ZT5A 4PLNC 5GS0L 4F2MA 3G08B 3OHXB 2F53E 4XVUD 1JZ5A 5C0BA 1IC5H 3OAZK 4M1DL 3TBVB 1KYOJ 4K94L 4G6AD 1EEZA 3NIFF 4ZFOL 3GSNL 1IRAY 1YEIH 4P5MB 3TC9A 3P77B 4UTAL 1S7RA 3FQTA 3RVVC 2Q86A 3HI1B 3H0TB 3WJJA 1DQDL 1I1CA 1XR8A 2QQKL 3NMEA 2QR0B 3WKML 4P23B 4ELMF 4PP1D 4IOIB 4N8VB 3E6FB 1OGAE 4P5KA 4Y5XC 2CRZA 5C7XL 1OL0A 1NGZB 5AYQA 4UUJB 1AO7B 3VWKB 3S34H 5LGHL 4ONFH 2AK4E 1BQLH 2D7QA 3MCLL 1NQBA 3GMPA 1BVLB 3I3BA 3QG6A 3VXSA 4LPVA 2BY2A 4R26H 4XPBH 4OLZH 2X4OB 5BJTA 5I75C 4YX2L 1MRCH 4Y16D 2E3VA 4G8EA 4WFED 3WL9A 1RU9H 1ZT1A 3AY4A 3KHQA 2I5YL 4KPHH 4RFEB 2NZIA 3Q6FB 4YUEH 4QRRA 4WU5A 1F4YH 4LVEA 2WZPD 4KHXH 3TN0D 2XXMB 1MFEH 4CVUA 2CDEA 1S7WB 4KAQL 2FGZA 5AYUL 3H3BC 3CFKB 4ZTOL 1FHGA 3DX9A 2BVOB 3HPLB 5CWSB 4HV8A 2DJUA 5IROA 4M00A 5SV4A 2OJZL 3AM8C 3C08L 5KSBF 4WI6A 3U0WL 1YEKL 2DQDH 2QADD 1GPOL 4R4BB 1VADA 4JFEA 1J11A 5DXWA 4JRXD 4E5XB 2FEEI 1PGRB 4K3EH 3QJHB 2NX5A 4WO4D 1EGJL 5C0AD 5CEZH 3T65B 3IXTA 3A0OA 4HPYL 2VSDA 1YUHA 1MHCB 1H5BB 3S37X 4Q74A 4UV4L 4NQEB 3EW3B 4IRJD 1FL5B 5GGRB 2GJZA 3MZTA 1RJLB 2ZUSA 2B4CC 3MNWA 4S2SA 1KIRA 2B1HL 3IFPA 3PHOB 4YHPB 5HI4D 4H1LG 3ZTNH 5ID0A 1NBZB 1Z5LA 3TWCH 1GC1H 3U0PA 4L8SA 2F74A 4NO3A 4FFVD 2W0LA 3SDXF 1G7MB 3JVGC 4N0RA 3F58L 2VITA 5HGDB 5C92A 2IGFH 4Y1AA 5DD5H 3IDGB 4DKAA 4JN2B 4FTVA 4WU7A 4JHWL 3BUYA 1UB6A 3KPLB 5EU4B 4APQD 4WFHE 1JVKA 1RURH 2G9HA 5D7IE 5J4MA 4QHLB 1ZLVH 1JPTH 3MOBH 5F7MC 5DMIH 3M45A 4J8RA 5EU6A 3L95A 5GRZA 3V5HA 1FG9C 1PG7L 5T1KA 1KC5H 5FA4B 1EO8L 3LB6D 1YNKH 5JHLH 3X12A 4PTTA 3HNTH 4GRMA 1KFAH 1RAMA 1GGUA 4HKZA 2AK4B 3C09B 3VRJA 3BJ91 5HHVH 3CDGB 2G75A 1N3NA 1AY1L 3IETB 3ULSB 4Z7VF 4H0IA 4P99A 2X4PA 2FD6H 2WWMD 1SVZA 1LO2H 2XN9D 4OBRA 4LDLB 2X42A 2HFGH 3R4DA 5I6XC 2C3VA 3WS3A 2XRAL 5I2IB 1S9YA 1ZVHA 3V6FB 5KVFL 5GS0C 1P2CB 2EIDA 2C1PA 3JXAA 4TTDC 2N4IA 4JZOB 1LNUB 1WC7A 4OF6A 4D0CB 4CUCA 3RDTB 3QHTC 3BP4A 3ZYIA 4POUB 3X14A 3RGVC 3M17A 3WNOA 4JHAL 2DQTL 3K81A 3SKNB 4M7KH 3BQUA 3LN4A 1YN7B 1GRWA 3IS1X 4JB9H 1XCQA 4F7MB 5JHLL 3V8OA 1FN4A 5JA9A 1P69B 2JCCA 5BV7B 1SJVA 4GW5A 4LEXH 2A2QT 4P5TB 4DQOH 3MLRH 4UDUB 1JZ7A 4CJ1A 4EN3B 1TPXC 3QP3A 4EVNA 5EULV 5KOVC 4NQEA 3VFOA 3RL2B 5HTSA 5GGQL 3P0VL 1S7QB 3O11A 4LLDA 5BXFB 4AZ8A 3WNKA 4XP5H 3KR3L 3MFFB 4KRPC 1H3GA 3GMQA 1IGFH 5T1DL 4ESKA 5JDJA 1JBJA 5I30H 5I1AA 3WE6B 3QFJB 5K59E 3H42H 1R3KB 5DQ9A 1T7ZA 4WW1A 1JRHL 3B6SA 1T20B 5K9QI 1JCKA 5DRWA 3TBTA 4H88H 4UT7H 3EOAB 1AD0B 3I6KA 5ICYB 3R8BB 3EO1A 4OGAC 4KTDL 5BMFL 3RUGB 1KIQB 1RZ7L 2YD7A 4XBGA 3TPKA 1QD0A 4ONHA 4J3WA 2YD2A 4NCDA 2ARJQ 2EDOA 1A1MB 2VOTA 2WQRA 3HI6H 1GGTA 3ULUD 4P2QA 3H3PH 1ZWIA 3UAJD 1LEIB 4KJQD 1PX3A 1XF5B 3KPSD 3BO8B 1LP9F 4JM2C 4QHMA 1OTSD 2MTPA 2R2HB 4O9HL 5CMAA 3M8OH 4HG4J 1HIML 3PJSB 1AH1A 5T1MA 1BD2B 4G6KL 1BPVA 3VWKA 3TFKD 3LQAC 4M1DH 1KB5H 4LSQH 1MJ8L 4PJHB 4TSAL 5FO8B 3EIFA 3G5YA 3INUL 5CBEB 1FO0H 5FYJH 5HI5D 3L3OB 1VEOA 2P45B 4GBXC 5CGYD 3WO4C 5I30L 4AEIL 1P7QA 3H42L 4POYA 2EXYD 4G8FB 1OPGL 2PO6C 4ZAKC 3CSYA 4L8BB 3T2PA 3NTCL 3LPWA 1UQSA 2KH2B 3FOMA 3DV6A 3QXAA 4MA3B 1TNNA 5INCB 6FABL 3HN3A 3ROLA 1WBXA 3DVGB 4P4RA 1G7LA 4P5MA 1JPST 4NQED 5TQ2L 3ARRA 3SEPA 4GW1A 3KYOA 4L3AA 4X7CC 4LCWD 2QKIB 5EZJA 5F9DC 2EYTA 1BBDL 2ZUQC 1A7NL 2XZQH 3V4PH 3MSPA 3UAJC 1QFOA 1GC1C 3VI3F 5DC0A 2WP3O 3NIFE 1XAUA 2Q8BL 1AFVL 4EDWL 2XWTA 3QXTA 5HDBF 5F9JB 1K85A 3GIZL 2R39A 5EU4A 4JVWA 4HS3B 4PJCE 2OYPA 1JGVL 5DJXA 1T6VN 5E8EA 5EWIL 1QNZL 3QIBB 3U4BL 2CQVA 2VLKB 3KPNB 2ADGA 5IQ7H 3HZMA 5FK9A 4HJGA 4LHJB 1IC1A 4NO3B 1KT2A 4MD0A 2VR4A 4B0MM 2K9UA 1HKLL 2RB8A 3D25B 5F96H 1DE4B 1PZ5B 5TGBA 1N0XH 3GBNL 3MV7A 5E6YA 4XMLL 2Z35B 2OJEB 3VWKD 1V7MH 2F19H 4UOW0 1MRFL 1NAMA 1ADQH 3O6ML 4LLUA 1XMWA 5D1ZA 3W0WB 3NIGE 1RUPH 1JN6B 4MSWA 4LLVA 2AJYH 3ZE0F 4D0BA 1KPVA 4RGMB 2DI8A 1DDHA 2CD0A 4G3YL 1OARH 4ZNEA 1MHHB 2VLJD 1WCQA 2IGFL 4P2OC 5D7KE 5KSBA 5SWSE 2OS7A 1PLGL 2NPLX 1GAFL 5IG7B 4JHWH 2VDRH 5I75B 4LLWA 1HINH 4QTIH 2YZ8A 3BEVA 2R29L 1WGOA 3B6SB 2VAAA 1PX4A 3VW3L 1IEAA 3F6LA 5IJVA 3QIUD 2XYCA 2W60A 3MNZA 4HZLA 4MQ7A 4PREA 4YGVA 2YPLD 5DD6A 3CX5K 5DJDA 4XNZC 1AKJB 3X11A 4R4FH 3S35L 4PJIB 3HMWH 4ETYA 3SDAB 5C07D 1FCCA 1FVCB 4PJ9A 1W0VB 5HI5C 2ZWLT 3EZJB 4WO4C 4RFNB 1CFSB 3PQYD 4U3XA 3TA3C 5F97E 2XTLA 3DV4B 3QCVH 1JP5A 1SHMA 5A40E 2NX5D 4WO4A 1XR8B 2BOBB 4HCRL 3IF1A 1JNLL 4H0HB 3WUWA 1ZVSA 4MJID 4C54A 1MCPL 2K1MA 1DEEB 1ZHLB 4PJFA 1BJ8A 4NO5A 2HFGL 3UTSE 5KSAC 3NABL 2FJGA 1REIA 1K2DA 4JFYA 3V9FA 4R96A 4Z7VB 1A3LL 3HE7A 4D8PA 1KULA 3REVB 1J1XL 3OB8A 5BJTB 3K80A 4FQHA 1BGXL 3BKML 4ODUB 4UILL 5KN5A 2DWDB 1MCJA 4MQSB 3JSSA 4LEOB 4CMMB 3S6CA 4JFFE 2BXYA 3FO1B 2C1PB 4C56D 3UC0L 3ZE0E 3MC0A 5FO9A 1BOGB 4GXVL 1KEGL 4H1LH 1YEDB 1EMTL 4XX1E 3MLTA 3ORJA 1NUNB 5CILL 4QEGA 2MWCA 4DQOL 3AS3A 1A6ZA 5GIRB 5HY9B 3MXWH 4U1JB 3FTGA 5GGQH 1OAXL 2PXYA 5FYJU 3JBG7 4AH2A 1IZJA 4O2FA 5TE7H 1PBYA 2ZKHL 3K2MC 5ERWB 5H35A 3OAYK 3AUVA