3H9ZA

Crystal structure of the ige-fc3-4 domains
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
b'VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig epsilon chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
total genus 39
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA02
1KCSH 3GSUA 1N6VA 3F7VB 5TDNB 3BDXA 4KK5C 4I77H 5EIIA 1A6WL 4BZYA 4JG0L 4LHUA 4WFED 4YWGH 3RX8A 5IFJB 1R3IL 3T2NH 3MUZ1 4GRWB 1NLBH 3OGOE 1FBIL 2EXYC 4XCEA 1PX3A 4X7DC 1OP9A 3QT2A 4EI6B 2ATKA 2UZXB 3VWKC 3KPPB 2VC2H 1DBJL 4YAQA 4G7VH 1ETZA 5D4QA 4CN4A 4LCWB 3E6HB 4JHAH 1W72B 4X6BB 4KQ4H 4PRPA 3MMEA 4YHNB 4UT9L 3ARQA 5E6IA 1Y0LB 1H3PL 4GMSH 5IQ9B 2DM2A 2HJFB 1J1XL 1NGYB 3W0WB 1IZKA 2HFFB 1YEIH 1UH2A 4P2OC 2FNBA 5JR1H 5IT2L 1FH5H 3QIBA 3AREB 1R5VA 5DJDA 2FBOJ 4NFCA 5EUOF 1MFBH 5HHXH 4FFVC 4U6VL 3MBEA 3CC5B 3ARFC 3OAZH 4CVUA 1FBIH 1GPOL 3STZA 1HOCA 4O2FA 1JPGB 5AWNH 1U6AH 1HHKA 1RVFL 3IAQA 3V4UH 1B4JL 1A6WH 3IJSB 1BP3B 5FGCE 2A38A 5GGTL 1IGIL 2JIXD 5EDXA 4TOYH 5M94B 4EQ2A 4Y1AB 1XEDA 4P57B 1W72A 4G8FA 2C26A 4ERSH 1D9KD 2VDMH 4PGDB 3SE3C 3MRNB 1U8IA 1FFOB 4JZNB 4PBXA 3LQAC 1MWAB 2Y72A 4OIIH 4OT1L 3N06B 2DYPB 3HCVB 1FL6A 5EZOH 1A7RH 2PETA 3FCTA 4ZPTB 3WN5A 1BMGA 3PWJA 2X70A 3KR3L 4PS4H 1WSST 2CDEA 4JY4B 1U3YA 1FIGL 5FHAL 1W72H 2J8UE 5KN5A 4F7CA 2HMIC 3V52L 4TNVK 1A14H 5IFHL 2A6DA 4QRRA 2F8XC 3WYRA 1MCPH 2R56L 5GGSB 4LVNB 4PJIF 5IVXE 1MSPA 4KK9D 5F1IB 1RU9H 2H9GA 4G6AC 4L8SC 1DANT 1YNTA 1J10A 3U0PB 4YH6A 1JWSA 1G6RL 3S35X 3VWJD 4LCWE 3VW3H 2O5XH 4HIJA 5HYJA 4PJGB 4MJ5B 5HHVL 3QULB 3DVNA 4GRLC 3L3DB 1JK8A 2ZNWA 3PWUB 5D7JC 4ZO9A 4OD1H 3OXRB 1U91B 4N0YL 5I6XC 1T2JA 1PYWB 1ZLWK 3DGGB 1NFDF 3R1GL 1IMHC 4AEFA 3O3BB 2ZUXA 2YN3A 3MJ6A 1BHGA 5TGBA 5TE7H 5CWSA 1UT9A 4YXLH 3I9GH 3KXFA 5DHXB 1OLZA 3MBEC 1UEYA 3PQYA 4R90H 1EPFA 3O6KL 1NPUA 1UWXK 3TBVB 3W2DH 4V1DD 5GGUA 4WEUD 2XRAL 2K3TA 2VZVA 2HFEB 4ELKB 5KSUA 3WJLA 2F5AL 4HD9A 4NGHL 3QFJD 3JWOH 4MCZA 4OZGA 4OI8A 5I73B 3DRQB 5J9PB 2IANE 1B6DA 5MEOA 1MQKL 4X6DA 2P5WB 4HUKB 4DUXA 1Q9LB 2FJGB 4NQDD 1U92B 3PWNA 3UMTA 4AEHL 4DOHB 4K8RL 4X5XA 1JNJA 4QNPF 1PZ5B 5C0CB 4Z7UA 1JN6A 1P5VA 1SY6L 5D2NA 2AEPH 5JPMA 3FQTA 1A3QA 5D93C 5J0BA 3QHFL 5KSUB 5KJRH 1IM9D 1KJ2H 5HDQH 3GHBL 2DQTH 2NY2B 4Z0BH 1NC4B 4Y4KC 1MCBA 3TNMB 2D7NA 5H37H 1NQBA 1S7WA 3I2CL 4PJHB 5HYIA 3VXSA 1A6TB 2PR4L 3QG6B 4CMMA 3QXTA 5DQJB 3CC5A 5JOEA 3VG0H 2GAZB 3PQYD 3C5SB 3D0VB 3R8BB 5GSRB 1YUHA 1N2RB 1EEQA 3UO1H 5CP3H 1V5JA 4OLVH 3VG9C 1BWWA 3FZUC 5DQ9B 3TBWB 1Q0XL 4XPBH 2YEZA 1TCRB 2JCCF 3CLFH 3EOBB 2CLZB 1A1NB 3G5XB 5E00B 4OJFH 5EOQH 1HE7A 5FB8A 2GFBA 4R96A 3MRKA 4XI5C 1KTKE 4U1JA 1FVDB 5BRZA 4M48H 1I8IB 1NAMB 4OF8A 5FIEA 5IEKB 2Q6WA 1C5CL 2J8HA 5IVZA 5F71A 1FL6B 5DR5L 3QJFA 3OWEA 3RPKA 3S3SA 5DEGA 5E08H 2XFXB 3HE7D 4YDJA 2YUXA 3LDBB 5CEZH 3HMWH 5DGQA 1CLCA 2BHZA 1RZFH 3TESA 1XR8B 3P3YA 1S7XA 1RJLA 3RVUD 4DK3A 2R0ZL 4GSDH 3FFDA 1R3HB 1INEH 4OCXL 3TPUB 4WTZG 3QEHA 1ETZB 5DDHA 4ONFL 4YHPB 1RZ7L 2GT9A 1G7HA 3QDMA 1GZPA 1T0MB 4KDWA 4PRID 5ENWA 2HTKC 5GS0D 1FVEA 1H3XA 1WQVT 3WJLC 4XHJD 5C8JA 1OB1B 4OGYL 4KI5E 5KG9A 2XZQL 1MWAL 1QBLL 4X8JA 5C71A 2WZPD 4D2NA 4O4YL 4G8IB 1NAMA 1MIMH 4JLRA 4MA8H 4P4RA 1HINH 4NZRL 2B1AL 5EZIH 4LGPB 3EJJX 4YX2L 2FJHA 2VDLH 4JGMA 3VFRA 3BPCA 5D6DA 2IPUK 1MJ7L 2XFXA 4P4KB 3T08A 4KZEL 3VD4A 4V1DE 1N5AA 1JPGA 1OM3L 5DZNA 1CL7I 5KG9B 3ZTJG 5I71C 4XT1C 1IKFL 1SYVB 3O3DB 3ULSB 2XRAH 2V2XA 4YAQB 1UGNA 1KTDB 2C3WA 3EYFB 1OPGL 5F7KC 2XWJA 4E0RB 5JW5A 4U3CA 3LPFA 1XCTB 4H8WL 1G7MA 4OQ1A 2YUVA 5MP6H 1E6JL 4E5XB 3NPSC 4CBPA 1EUUA 4G9FB 1JZ5A 5K9JH 2IH3A 4BJLA 3MRMB 3B9KA 3E1F1 4HKBA 2W59A 5I30L 2FB4H 3SBWA 1WBZB 5A2KH 5HYJE 4I0KA 3UTSE 4B7IA 5T3XE 1BVLB 4X5XB 1BZ9B 1MJ8L 2BFVL 3I3EA 3B9AA 3QXUA 4UNVA 3FT4B 4RMVA 1IVLA 3GNMH 1U8NB 4P46C 5IMOA 4C58B 3O3AA 2R4RL 3NZHH 3H9SE 3MV8B 2I60H 4ZS6D 5TFSL 2UUDK 3HAEA 4RDQF 3ALXA 3T0XA 1Y6KR 3X13A 5J7CC 4A6YH 2GAZA 3SE3A 3DMMA 4TYUA 2P44B 4L9LC 3SDYL 4BUGA 2APTA 2HN7B 2C3XA 3DWTA 4HKJA 5C0IB 4GRWF 5DUBA 1NBZB 3KWWA 4MDIA 4XPAL 4HKZA 1YNKH 1B90A 4OQTL 3SDDC 2WLZA 3ZHDA 3LN4A 3UCRA 4KKCD 2HRPH 4HFWA 1A3LL 1QSZA 2IAMD 5B3JE 4CUCA 5EU3B 1KTLA 2C4FU 2ZJSH 4O2CA 1TZGH 1H9VA 1KOAA 4U2ZA 1WBYA 2HT4C 2YD1A 2X42A 1QSED 4QWWD 5F9OL 35C8H 2IGFL 1P5UA 4X83A 1LNUB 5T1DH 1FYTB 1JV5B 5T1LA 1QACA 4ORZC 4XNUL 4ESKA 3DGCR 2H2SC 1SYSB 3T1FB 4LCIH 5J6HB 3DMMB 3HLAB 4L3CB 5JHDB 2ERJC 1F58H 3QNZA 4XRCB 4RMWA 3BGFB 3L5JA 4P46B 3U1SL 4KRPB 1RJYA 4PJDF 1TPXC 3DTXA 5F3HB 3CU7A 1FLRH 1IC7H 1AE6H 2VLLA 1RK0B 4EI5B 1QSEA 4P9ML 3KYOB 5E8OA 1VADA 2R2EA 1XIWA 4LK4A 5I19L 3MGTA 5D72L 5ISZA 4L4VD 1BECA 3JVGA 5FDWB 1C5DA 5EC1B 3TNMA 5E2UL 3ZTNL 3GZKA 3EDJA 1D9KC 4PP2A 2I25N 3EYVB 4XXDA 5JPNA 5EPMB 2A77H 4ZOCA 3HRZB 5DC9B 3IKCB 3P9LA 5D2NB 3H6JA 3MRFA 1MHCB 4L3AA 3NIDE 3VG9B 2D7TH 1MCLA 4NWUL 3ARFD 1D6VH 3ZKNC 3PWNB 3QCVL 1LEIA 1QSFE 4J6RH 1OGTB 4DEPC 4OCRL 4E41A 4XNYL 1CE6B 4LOUD 1KIRB 1RY7B 4U2YA 2AK1L 1ZLVH 4U4BA 4P2QE 4WCYL 4DCQA 2OL3B 4DJMA 5T3XL 1A7PL 2C7UA 4OFYA 5D72H 3MXWH 4W68A 1D5MA 4YE4H 2XKSA 3U0TA 3UJJH 5F88A 4G8GB 4KRPC 2GQHA 4PRIA 5DEGB 1E4XL 3AREC 3VI3F 1P2CA 3MJ9A 1KNOA 4X5LA 2WUCH 3HC0B 3D5OF 1TJHL 5DHVH 4HS8L 1Q8MA 1U8OB 3TN0A 4RGNB 4D0CB 3GMMA 5DEZA 2GT9B 1RQ5A 4R2GC 5I30H 5D1XD 4X9GA 4M61B 1ZLUK 4ZFOL 2IH1A 1ZHLB 1N5YH 4RIRA 3WFEL 2XWTA 1HXYA 3HI1A 4JFHE 3W9DA 3E0GA 5GS2H 2A9MH 4FQPA 5LCVH 3STZB 2XV6B 1VGEL 4U6HA 1G9EA 2PYED 4FQLL 1DUZB 4JVWA 4X4YB 2FLBT 1OGAB 5C1MB 4MDJB 1TJIL 1CXFA 1WV7T 3WFCL 1BIIA 4JKKA 3JXAA 1XGUB 2ZSVA 4C57C 4OGXH 2AV7A 4Y89A 5E1AB 2IADB 2WNGA 2V5RA 4NM8L 1JF5A 5DUPH 4Y0GA 4I4WA 1U8OA 3RAJL 2E8ZA 3AY4C 1UFUA 5EBWB 1D9KA 1BQHB 1MFAL 1BD2E 4LMQI 4NZDA 2HP4A 3MACH 4P9HL 3BZFA 3CCHB 4YZFF 3WSQL 3ZDYF 4PJ8A 2DQGH 2GJ6E 3L5XH 5FK9A 4CAGA 4NSKB 4P2QA 4BZ2H 4IHOA 4Q2ZA 2BY3A 1AD9B 4F7PB 3E8UL 4ZO6A 5EU6D 2AJZB 3FO9A 4NJ9L 4ODUA 4WVRA 3GBNL 4ODXB 2HVJB 5GZNC 4GRMB 3BW9B 3S4SA 5JDSA 3I6LD 5EORL 1J0ZA 3EO0A 3QQ3B 5CJXC 1ONQB 4RAUB 4JO4L 3RVVC 3KPMB 3NZ8A 5E2JA 1JHKL 1MCPL 3P77B 1FZOB 5C09E 3DMMC 2NTFA 3MZTA 4JPVH 2ZSWB 5J6GA 3ZKMC 5DYOB 4EUPG 4Z7VF 3QIBB 5HDBE 2BNUA 3BOVA 3NFPB 3K8KA 4GKNB 2KBGA 1MRFL 4YR6B 1ZHNB 1YQ2A 4HUMB 3L5XL 2CMRL 1IBGL 1MFCL 5C09A 5DJ8A 3UTZB 5EO1B 2WK2A 5K9QI 1JK8B 4IRSA 2IWGA 2V17H 2YUWA 3WNOA 3HNVL 3L5IA 1BOGB 1KACB 1I3VA 2ARJB 3X3FL 1BZQK 2A6JB 1JBJA 5I76B 1CBVL 3BPNB 3IU4H 1TNNA 5F6IC 3RWGB 4QHLA 5GGVL 3WIFA 3O6ML 4QOKE 4X98A 3GBLA 4GRLB 4QF1A 2C3GA 3CVIH 4ZAKA 2EKSB 3V79C 1ZT7B 2QADB 3M45A 2MHAB 1ZVYA 3IAGC 4JKPH 5IROA 3ESVF 4IRSD 4HCRL 4UNTA 3VJ6B 3IFNL 4FNLL 3D85D 2ICES 4N0UA 1FN4A 3V0VA 4JZJC 2X89A 1EERB 5J3HD 2PYFA 1WFTA 4NQED 2BXZA 5E8NB 4H88H 5JA9A 5C0ND 1GGBH 3OAYH 4BSVA 2PYEE 4PTUA 5C0BB 3G08A 4JY5L 5F8RC 1EHAA 1U93A 5FYLH 3RNKB 2P47B 4M6AA 2WANA 1P4LB 2YA2A 2O5YL 4Z95H 2AEIT 1QBAA 2YOCA 4I13B 3REVA 5A43C 1OAKH 4C56E 4TULH 4WO4A 3RNQB 3QDJE 1A0QH 4S1SH 3UPAA 4GAGL 1H5BA 4OKVA 4QT5B 2XQBH 5DF0A 3T04D 5JHLH 1T03L 3GHBH 2VZSA 3GMNA 1J1OL 4P46D 5LAXA 3WDJA 3OR7A 5D70H 4JR9L 4PRPE 3VI4F 4DVBA 3HB3D 1QUNA 3MLRL 1HHJA 4Y4FB 1AQKH 2CK2A 2GSGB 3O2DA 4IRZH 4WI6A 5HGHA 1DQQB 4EUPH 1PG7L 3P73B 4S1RH 2Z8SA 5JA8B 3BKJL 3WNKA 5B3NA 1P53A 3MBED 5MI0C 2R4SH 2QQQA 3VXUA 4ZFZA 2YWYA 1QO3A 2AJ3B 4Y5XA 1CFVL 1Q72H 2BXYA 5DHYB 3HI6L 2UZIL 3HPLA 4TN9A 3X3GH 4JRYD 4Y7MA 12E8L 4HK3J 3ZT7A 1UA6L 3EFFB 1F90H 2IQ9H 2V5YA 2DJUA 2FHCA 5F44A 1KBGH 2NY4B 4R26H 1WWCA 2CIKA 4HXAL 5F7EH 2Z31C 1F4AA 5EU3A 4QRSB 2R4RH 1HEZA 4H0GA 3CUPA 1N26A 3FOMB 3QNYA 1T0NA 3ZYJA 2NTFB 3LDBC 3MV9B 1QR1B 1J0IA 3MRIB 3MV8D 4K3DL 2FGWH 1F42A 3OKOA 1IAIL 4Z7QE 1PG7H 5F7MC 5SX4I 2VZTA 5K59F 5DT1L 2I5YH 3OZ9L 3CX2A 4U6HB 3IU4L 1T1YB 4P4RB 4WV1C 5D2LA 1U8LA 4DW2L 4PJ5A 1OAYL 3L5HA 4ALAH 2A6IA 1LO5B 3WNNA 4PTTA 1QBMH 3BEVA 5IB1B 1ZOXA 3QUZC 2R69H 1ZHKB 3HE7C 5IR1B 1HKLH 3DXAB 5F70A 5D6CA 5EO0A 3OXSA 1LE5B 1T0NB 4H8WH 1WTLA 3A6CL 1YYLL 2ICWI 2R2CA 1I9RH 5DK0B 4TSCL 5E9DA 4ODVL 5I75B 1KEMH 2BOBA 2HG5A 4PG2A 1I9IL 5MHSD 1XCTA 3PL6D 1ROWA 1HOCB 4FFYL 5L2KB 1XGRA 5GS1C 3B9KD 1OQOA 1UA6H 3MGOA 4MXQC 4DKEL 3A6BH 4NQSB 1OF2B 2ADIA 1HH6A 3MSPA 5FA3A 4HGMA 3BVNB 4J3SA 1FL5B 4O2EA 3NZHL 4FFWC 4OLWH 2EYTB 3PP4L 1FJ1A 1DJSA 4OZIF 4HUWB 2Q7YB 1J5OH 5E6IC 5J8OA 3ZE2E 3TA3C 8CGTA 3K1KC 4I48A 3O4LD 3HS0B 1M7DA 1Y0LA 3EYSL 2IAND 4XC1H 4HFUL 2ZPKL 2FB4L 1EZVX 1K4DB 4MQTB 4PV9A 3EFDL 1F3JA 1HIMH 1F02I 4WFHD 2PCPA 5EULV 5KOMC 4LPUA 4JDVA 4K94H 4HIXH 2XZAH 4R3SB 2NLJB 5DVKA 3S88L 4LEOA 4FFZL 1NAKH 5HHMB 3C60D 4OLUH 5CEXA 3U4BH 2AJUL 3LZFL 2H6PA 5TQ2H 2H32B 2E7BA 4JM2B 3VE0B 3FMGL 3FFDB 2YC1B 2MKLC 2CLRB 5CD5C 3AGVA 1YYML 3BWUC 1RIUH 4Z7OE 2FX8L 2F53B 1UWEH 4XVUD 5I1CH 1DLFH 4OZHA 3OAZK 3BFOA 1EHLL 1FYTE 2EYSB 2FJFB 5EWIL 1PY4A 5D8JL 4QXTB 3ZTJH 4YDKL 3WKMH 1T83C 2R9HC 4BK5A 4Y5VB 2MKWA 1AO7A 4LNRB 1O7SA 3CFDA 4KRNA 5ACZA 2B2XL 3ESUF 1JGEA 3H7LA 1KULA 3QEGH 1P7KA 2ZKHL 4U1HA 5IKCA 5ISZB 1FAIH 3T0EB 4G7YH 1ZK9A 1NJ9B 4EZMA 3N1GC 2FL5B 5CGTA 3WLWD 1DFBL 3UTSD 2Z91A 1P6AB 4C59B 1BQHG 4GJTB 3QHZL 4MB3A 6CGTA 1X7QB 4HS3B 3KJ6L 3KPTA 4P5TC 3HPJA 3FRUA 1FV1B 4L8CB 5JMOC 4NRZA 1XZ0B 1FORL 4GQPH 1NCDL 2WQRA 4B50A 3SE4A 4KK9C 3VWKA 5BOPA 4F37K 4X6FA 5IHUH 5A2FA 5IP4A 4ZFFA 1MFDL 4Y5VA 2BVOA 43C9A 1MCJA 4Z7UB 3TH3T 4UQ2B 1MVUB 1QKZH 4CGTA 4I5BA 2CXGA 1J87A 4GUPB 1SEBA 3SDXB 1R3LB 4PGEB 5DD3H 4K3EL 3IKKA 1LDPH 1F4WH 1I3RA 1DDHA 3IAPA 4TUJA 2MTPA 5IVNA 1VFMA 5E2TL 1S9YA 2R0KL 4X6EB 3PXHA 4NO0D 4Y16A 1JHTA 4BH7A 4JB9L 1I75A 5JXAH 3NN8A 1M71B 3GMMB 3NACH 3QEQA 5ICXB 3ES6B 1FL5A 1F6AA 3QWRA 1BZ7A 4NKDB 1S7QB 2P43B 2DD8L 3NABL 5T33H 2FCBA 5D1XC 1RK0A 2P24A 1ZA6A 1M7IB 1ND0B 2J2ZA 2BY0A 3TVMD 1NFDA 1RSFA 1FPTL 2FO4B 4W4OA 4ZSOB 3LZFH 3OMZA 3SKOA 3OF6D 1FZJA 4IOSD 2VAAA 5EZOL 5JW4M 4RNRB 1TJHH 4X99A 1NFDE 2FX8H 1XF3B 4YDIH 2I24N 2VL4A 2VR5A 3D69A 3SGJA 2A6IB 1MHHB 4QKXB 1CK0L 2GCYA 2PXYC 3WFEH 1QA9B 5DJXB 3AM8A 5BW7A 4JRXD 3Q48A 5I19H 1U3HC 1MCFA 2HWZH 4PJBE 3I50L 3K4DA 2X1QA 3TYGH 1FL3A 4KKNA 2DBLL 4NSKA 2FR4A 4X6DF 1NKOA 4FQJH 4HLZG 4QRPE 5DSCB 4HKJB 4KMTL 1U2CA 3BKYH 2Q8BH 5F7NC 1T0MA 4CN1A 3RWDA 3MUGA 3GSVB 1BFOA 1L0QA 4OZFH 1SY6A 4OZGB 4NPYA 1J1XH 2WMPA 3HC3H 1F13A 5CUSH 4CVZA 3PDOA 4JGUA 4IJ3C 4J3VA 4YK4B 1FCGA 4MNGB 2PXYA 2ADJA 4ISVB 1S7UA 4M7ZC 2NY1C 1CFTA 4WI7A 4YFDB 3TN0D 3EBAA 4ZAKD 3B9KB 4PJ9D 3O3EA 5CBEA 2OZ4H 4FQQA 5AD0A 4Y4HA 1EEYB 1I1AB 3QDHA 5JUEH 2DI7A 3KDMA 1CICB 4FQJL 2H1PL 4E0RA 1KCKA 2AKRA 1HYSD 4Z6AT 2W9EH 5E8OB 4B0MM 5GGVH 1I8MB 2DMCA 1E27B 2M26A 5GGTH 2IANB 5KVMC 4PB0H 2XACC 1RZJC 4NKMA 1BFVL 4PY7B 4KKCC 1BJMA 3RGHA 1NDMB 3RA7H 1HIML 2YZ8A 5HTSA 3NAAL 3VFVA 1D7FA 1A7QL 3F8UB 1X5JA 1JHTB 4WFFE 4BH7B 4LVHC 5D96B 2BFVH 3ARZA 4AG4L 4HUXA 2V7NA 3FOLB 4XTRC 5EBGA 3ZT5A 4WWKC 4BQ9A 1WC7B 1F4WL 2ITCB 4QRQB 1YMME 5T1MA 3NIDF 2DLHA 2X1PA 2ZG1A 3GJFK 4M8QA 1EFQA 3SOBL 1JTTA 4HLZH 3S37L 2J6EH 1RU9L 3TPUA 5HYSG 1I3GH 2V7NB 5IB3B 2CGRH 4Q9QH 1C16B 2ADFH 2YRLA 4M1CC 1J0JA 2B0SH 3LN4B 3PE9A 1UM6L 1A6VL 2PXYD 3EJYC 5C09B 4H1LA 3MA9H 4M9OA 3BESR 5FK9B 4HIEB 2CKNA 5IIEA 5K9KB 1AC0A 4Y1AD 3MXWL 1MY7A 2QEJA 4YHZH 2WBJC 5HHOB 1DBKL 4YQXL 2X4NA 4HEPG 1YNTB 4ZXBD 4PJXE 3JUYA 1LO3L 2YRPA 1GIGL 4UUJA 3C6SB 4ZQKA 3GO1L 5FGRA 3UDWA 4HLJA 5F72S 4G6FD 3IJYA 2EDYA 3MLYH 5ACZB 4HWBH 2FRGP 4WHDA 3S4SG 1C08B 1JHLH 3KPLB 1ADQA 2RR3A 3KGRA 4N90D 4BKLA 3V7AG 4CADB 1MVFA 2XQBL 1T03H 2WBKA 1DSFL 3LN9A 1U6AL 1PVHA 4LF3A 3ULUE 1X5GA 2ZCHL 4I9WE 2NTSP 5CSGA 1SJVA 4DFIA 1MOEA 3T0BA 4HXAH 3JSSA 4KMQA 1IAKB 3QHFH 3QWOB 4H1LB 1DQDH 3VXNB 5D1XA 3ZDYE 1PFCA 4Y5YC 1MJ7H 3QH3B 1QLEH 1LWRA 4M00A 4MAYC 5HYSA 3FO0H 5JIIA 4JPKH 3HZMB 5E4EC 3QA3B 3HTLX 1P4IL 1NUGA 2ADJB 3SGEI 3L3OB 3W81A 3GSNH 3ULVD 4MSWA 4O2FB 2LTQC 1KPUA 2RHEA 5CS7A 5IVXF 3VFUA 5IVZB 4PJ5B 3VRJA 5C0RL 5ILTL 3ZYIA 4M8VA 1KJVA 3GI8H 3E3QC 1XH3A 1XT5A 4ONGL 1JHLL 2X4UB 3WEXB 1AJ7H 4Y16B 5BS0B 3BD5A 2E9WA 4PUBH 5C6TH 3QB7C 3LH2L 3V5KA 1JWMB 5CEZL 4WUUB 1HHKB 2E27L 3AMLA 3SY0B 5HGGS 4OSUH 4L9LB 1LO3H 4RMQA 1BAFH 1GAFL 5IW3A 2VZOA 4LARH 1HXMA 1OP3H 1FHGA 5LXGH 4LSUL 4XVTL 1OAKL 2B2XH 2FD6H 1K8DB 1LGVA 3PP3H 2XICA 1T5XA 4Y4HD 2Q1EA 4ETYA 4RFEA 5E7FA 1DVFD 2XQYK 1OAQL 4S1QH 4RSVA 2R15A 4L8SB 3WKML 4YDKH 4N9GA 1P84J 2E7LC 5J13C 5TDPA 2NY7L 3QAZB 4BSJA 3LKNB 4PGBA 3HR5A 2VE6A 3P4OB 4KK8C 5INDA 5E08L 3LSOA 2VMFA 5DD6B 4LCUA 1TETL 3QIBD 3OJMB 1IGJA 4UBDD 5FHBL 1XCQB 1RZ8A 4Z7UE 4LAQL 5EOTA 3O9WA 2N56A 4KVNL 3I02A 1Z9LA 3BZDA 2IF7A 2NY3D 5D1QD 5I1KH 2BCKA 2Z31B 1W0WB 2PKDA 1QFUH 4JFED 4XP6L 5I8KL 3C8HA 2QV2A 3VCLA 2KH2B 4PUBL 5F3HA 3CH8A 2ED9A 3GK8L 3GIZL 2LV4A 1CBVH 3QQNA 2L4OA 2OR8A 4Y5YA 1BFOB 2AJVL 4AIZB 1Q1JL 1T1ZA 5ILTH 4O02H 3GO1H 4K3EH 3L3HA 4WIQA 4PR5B 3LMJH 3IFOB 3KPPA 3T8XA 4QCIA 4NKQB 4LHJB 5D1QC 3RAJH 3CSBA 1AJ7L 3LQZA 1QNZH 2KKQA 3VFGH 1IT9H 3FZUD 1QYGL 2DM3A 3GMPA 4FTVD 4POZD 5E2VL 4U6XB 3O3BA 4AEIH 3IKCA 1WBXB 3L3IB 3ZKXB 3ALWA 2OR9H 3KYNA 1GHFH 1W2KT 2NW3B 3ULVF 4OF3A 5T1KD 3TNNB 1ZT4B 3TBYA 4XNMA 2OM5A 3QDGE 4Y8DC 4Y2DC 2B4CC 2Z35A 4RISL 2WLYA 4YXKL 4YO0A 1ZLSL 5E6ID 3RKDD 5TFSH 3QUXD 3ARXA 2YMXL 4HX1B 1UACH 4X99B 2IPKA 5FKAB 2DLFH 2EDNA 3IYLW 4MCZB 1I3UA 3DHJA 1YEEL 4XMPH 2DQIL 3IDUA 4ACPA 2W65A 3DUSB 1FG2B 1IC1A 2EZ0C 1XF2B 3JUZA 2VDPH 2OXGA 4ZFOA 3SE9H 4MMXC 4FHBD 5T3XH 3BXNA 3FQUA 1DBML 4YJZL 3QUYA 4NQVB 3KYNB 4JJ5B 1KG0B 4OCRH 2KUTA 3TLRA 1T66D 4H5SB 2BNRD 4OBRA 2DQCH 1ZVSB 4FQIH 2W65B 3DUSA 1I85C 4YBQD 2VLME 3OR6A 5DI8B 3U79A 1S9VB 1ZLSH 2EIBA 3HE6C 1VPOH 1KGCD 4KDTC 4RWYH 2NY0B 4R0LA 1PLGH 1TVHB 4N8CL 2H32H 2EKJA 5DJ8B 3BE1L 2WIIB 2AXFB 3MOAL 4OV5A 5E03A 3AAZB 3U9PL 5SWSE 1IAOA 3UTZA 4QRPD 4UIMA 3BIKB 1R6VA 2H32A 4JM2A 1H3UA 3QFDA 5I8CB 4BM7A 3V6ZB 4DN3H 1R24B 3C60B 5HBBA 3H9HA 4ZYKB 3AB0C 4U1NA 4TQEL 3U0PA 3MV7A 1KTDA 4KJWD 2DLFL 4WFHE 4QRRD 5F7EL 5F9JB 2EDHA 4NQCB 3N85L 1AXTL 2OTPA 2YKLL 4K8RD 4WJ5A 3KPSA 2A9ML 3VXPA 2OMBA 2YD5A 2H41A 3O41B 3PHQA 4HKBB 1J05A 1U8LB 1I1FA 1ORQB 3JV6B 4FFVD 2HVJA 4MAYA 4LHUG 3MV9D 1J9CT 3U0WH 5I8KH 3LKRB 3T4YB 3O2WH 3MMEB 4YHNA 4YGVB 4ZMAT 1A7RL 1RUAL 2Y36L 2UV3A 1IAII 4X8JB 1N6QL 1R3IH 5EU5B 3T2NL 3VDBA 2Y6SC 2ITDA 5B8CA 3CH1A 3BQUB 4LHUD 5CBAB 4W6XB 3ARPA 4RZCB 4YGAB 5L2KD 2GHWB 3FHQA 2E9IA 1D3CA 4F7MA 2X9WA 1R5WA 3D39B 3AXLA 2IG2H 3DO7A 3T2PA 3G5YA 4TQEH 1A3RL 1T4KA 2B39A 3HN3A 4M1CD 1I9RL 5GISH 4WDIA 1EH9A 3BVNA 1KXTB 1QPXA 2KPNA 1WT5C 2H26A 3MCLL 4WU7A 3QEUB 3O6FB 3QO1B 5FOJA 2PW1B 3MOBH 4F3FA 2DLEA 3B5GA 2Y7QB 3FAWA 1KCRL 5GRZA 2VXTL 1NSNH 3L3OA 3T3ME 1QFHA 3GI9L 3STLB 1T4KB 5E94B 2BVTA 3HUJE 2K7QA 2GTZA 3V9FA 5F7FA 3WDHA 4WHYG 1FZKA 2GW5A 3U48A 1BJ1H 3KPRA 1EUTA 3JV0A 3H3PL 3QXWA 3GSWA 3DUUA 3I84A 5DRNA 2BRRL 3IFLL 2VE6B 1MRDL 2EIZA 3O4LA 3BQUC 4BZ1L 5FAAA 4TVPD 4LLDB 5FYKH 4AENA 5K9OA 2FYYA 4J12A 3WFBL 2YMXH 3MJ9H 5CZXD 4PRDB 4PY8I 4JFEE 2C7UB 4MB4A 1GGIH 4IIQB 1AGFA 2UWEB 3DV4A 3MRIA 1KB5L 1PSKL 4HH8A 1E6JH 1AD0A 3C6LC 2IAMB 5J11C 5IHZA 3GI9H 4LMQE 1QBML 5DRWA 5E8PB 1CDBA 1OTSC 2EYRA 3R8QA 3IF1A 1XR8A 15C8H 2DQUH 1CIUA 1T04A 3MLXL 1YJDC 4UIMB 3NCCB 4OM1H 5BOZG 1HHGA 1CR9H 3MRGB 2NY1B 2D3VA 5H94A 5E9DB 4UQ3A 2DIAA 2SEBB 4LGRB 4RQQB 3HNTL 2DF3A 3CFBB 3EJZD 1D5XA 4LCYB 2HH0H 2YBRB 5LWYL 4BQ8A 3LVEA 3HG1E 4JFQA 3GMRA 3BUYA 3VRIA 1NGPL 1V3MA 3LAFA 4WO4C 3ZE0F 2NMSA 4FRWA 4HEME 5JQ6H 2AJSL 2RCSL 4RA0C 3JV6A 3VH8B 4RGNC 5EZLB 1A64A 3ARTA 2G2RB 3QUZD 5J6HA 5I1EH 5ALCH 1JN6B 2HTLD 5GHWH 5EB9A 4MJ6A 3Q5OA 4M62H 1NC2B 3G6JF 1U8MA 2BP3A 2PNDA 2RFXA 4LKCB 4URTB 5DJAA 8FABA 1WIPA 2EEDA 2XXMB 3B2VH 4NQUA 1H3GA 1LEKB 2GTWA 1JWSB 2ESVB 1ES0A 1N4XH 4HG4K 1MHEB 4UV7H 4Y19E 4IRJC 5B22A 2DQDL 3SDCD 3VXTA 3PV6B 4FQCL 2DTSA 5DZOA 3QQ4A 4MNHA 5CMAB 3ZSSA 4X6DE 1NMCB 1D5ZA 5DD1L 1P6FA 4JANA 5HI5D 5EC1A 5HHOA 1B88A 1FIGH 3GEWB 4MD0A 5EUOB 1GOGA 2B5IC 3PWVB 4JFDA 5CCKH 4MXVF 1N3NA 1RZKC 2X1WL 2R2HB 3ARGD 2WINB 4XAKE 4NZRH 1H8OA 3ARDB 2DKMA 4XPBL 2CQVA 3RKDC 2NY6B 4S2SA 1CGUA 1I8LA 1UM4L 1NAML 4PRHD 3EFDH 4PJ7F 3MUJA 1D9KB 4I18B 2J8UB 4JY6B 3ARRA 4Y5VC 2PW2A 2EEBA 4WRLA 1ZHNA 4KQ3L 1QLFA 4NBZB 5IV2B 5HHVH 4IRJA 3VXMB 4ZXBB 2A73B 4HPOL 5F1NA 2QQKL 3MBXH 1Z0MA 4UDUA 2QKIB 3QEGL 4NO2B 1B6UA 1BOGA 2YPVH 5JMRA 3PWLA 2XN9A 1OARH 2D7OA 2BVQA 4HZAA 4MD0B 4ENED 2YD7A 3ARED 5AZEH 5B39G 3FL7A 5BZWA 5IT2H 4ZUWA 4Z8FH 4GG6B 4KC3B 3GMLA 1HXYB 3HI1B 5TE6L 4J6RL 3GMQB 4H88L 5KAQF 4W4NA 3P4NB 1MIEL 3OKMB 4PGZA 3OKDA 2AS5M 4JFZH 4EIZC 3EDEA 4ODTL 5CJ5A 3BKJH 3WIHH 4CMHC 5GPRA 1ZT1B 1U8KB 2VDNH 2W1NA 4P5TD 5I16B 2E7HA 1BLNB 3OG6B 1S7RB 5HY9B 5I1IH 1J1PH 4YGVA 3WLWC 4JO1L 1QHPA 5GS1A 2BNQE 5I71B 1DUZA 1QZ1A 2XTJC 1UYWH 3DYOA 1J1OH 4Y4KB 4XNUH 1OSPL 1ZLVK 1I1YB 3ET9F 1BBJA 2Q8AL 2X4RB 2X4UA 4QO1A 3GI8L 1ZWIB 3VA6A 2ZUWA 1IILE 3MLRH 2OBGA 3HHRB 5B4MD 2AV7B 5E1AA 2YD8A 5HDQL 4QY8B 4LSVL 4G8GE 3U1SH 3EYSH 3HZYA 4WEBL 2XYCA 1INDL 4PRPD 4Y1AA 3FTGA 3NTCH 1XF4A 1MI5B 5HGDA 2DQIH 4L29B 2EXWD 1CFVH 2LABA 3ALPA 3AAZA 3DO7B 3SCMD 1CDYA 4PS4L 4GBXB 5D7LB 3MOQA 3BRFA 3RY6C 1A7NL 3NIFF 2FD6L 4P3DA 2X9YA 4DZBB 3IETA 5DD1H 5IMMA 5IQ7H 4MAUL 4X9FA 1FZJB 4Z7WE 3V5DA 3GKWL 3F5WA 4XH2A 3NA9L 3QIUA 4JKPL 1BD2A 4PJCA 4N8PA 2Q8AH 5CKGA 1F00I 4P3CH 3UBXA 4G9DA 2XTJB 3FO2B 2D31B 2IAMC 3KS0J 1NAMH 1RVFH 4U1LA 3D3VB 4Q9RL 3FT3A 4U6YA 5MEQB 4Y2DD 2K9UA 4L1HA 3C6LD 3RX5A 4PJIE 3GSWB 1DQTA 3DETC 4N0YH 1CCZA 2P5EE 3EOTL 5DMIL 4WY7H 2QSCL 2D7TL 5ESAB 6FABL 2P7TA 2W9LA 4P2RD 4FFWD 5IBUB 5SV4A 1NCCH 1W8OA 4QTHB 1IEAB 5D7JA 1JE6A 4GAGH 5L2JA 4MAUH 3CFJB 4RAVB 1NCBL 4KROD 1IJ9A 4LP5A 4YIQA 4ZAKC 5ADPL 4PJXF 1A6PA 2YS4A 2GYSA 1UZ8B 4ZFGL 4GUPA 3V7MA 2X4SB 4P2RB 4NRZB 4EIGB 1PKOA 3G04B 1ZAGA 4P2CG 2P7TB 5CUSL 3ES6A 1UKTA 1CR9L 4MD4B 5DK3A 1XMWA 2APWA 1T6VN 1KJ2B 4PRAA 2DIJA 3DIFB 3PQYE 4PJAF 4FS0A 2F8VA 1JNHB 1WZKA 3UBXG 1A2YB 1DLHA 1KYOK 5D1ZA 1KG0A 3VFNA 4KVCH 3MOAH 1J18A 5DUMH 2CLRA 2X5PA 3OKNB 1JWUB 4NKIH 1MAJA 1EJOL 2CKBA 1CDJA 4J8RA 2WWMC 1H3TA 4LIQE 5C07E 2I07B 4LVOB 3UTPD 1KTRL 1BVKA 4JFQB 5E99L 4HWBL 3UTTE 1WVZA 1CGYA 3KNBA 5DJ6B 1KIQB 4R2GD 4BFBD 1I8MA 3QFDB 4WW2B 3L6FB 5SWQA 1MFAH 2GK2A 4RMTA 4AMKH 1UXSB 5IHLB 3WXWH 1FRGL 5FGBC 1U8JB 2RAMA 5CEZE 1TVHA 4MA7L 4NQDB 2CUIA 4KDVA 2IQAA 3QCVH 4NN5B 1MI5D 4OCNC 1M05A 1T89C 5FA4A 3MRCA 3U4BL 3VGAB 3MV7D 2A83A 3CNKA 1S7TA 3HZYB 1JV5A 4JFFD 5T1LB 3PIQB 2C4FT 3CMOL 1LNUA 1DQLH 5TE4L 1FNSL 1H3PH 3K3QA 4R97B 1B0RB 2X6MA 1T6WA 5C0EB 3FONB 4Z7WA 4JO4H 5IW1B 1YEIL 3HR6A 2FX9H 5KAQG 4G7VL 4YXHH 2A6DB 4QRRB 2Y07H 1WZMA 4YHOH 4AMKL 4FG6D 4HMCA 5JW4Q 4ZDHA 4AEIL 5FM8A 2IJ0C 4K2UL 2DQEL 1GGTA 4LVEA 2GIYA 4G8EB 1I1AD 4X7EC 4QYOB 4L4TE 4NNYA 2AK1H 1CF8H 1GGYA 2JCCE 3WXWL 4LLQB 4NKIL 4Z7NE 4EEEA 3HA0A 2VIRA 3NCYS 4CU8A 4MZ2A 4KKBD 3CFEA 1AGEB 3OXRA 4KJQD 4N0FA 2AI0L 2C1PB 2C1OA 3KPRE 1L4IA 4ZUVB 4KZDL 3AS2A 4NIKB 1BZ9A 5D1QB 2FBJH 3GKWH 5DJCB 1X5ZA 5EC2A 1QRND 2GUOA 5EU4B 3S5LB 1FC2D 1MFCH 3LN5B 3BO8B 4R6UA 5HPOA 1R5VB 1DEEA 4APQB 1FVEB 3OBAA 2VABA 4UV4H 3SKJH 3FFCE 2R1XB 2IG2L 3QDAA 3WHXB 4OCSL 3IDIA 3FB8A 1DQLL 3O6FD 1PZUB 5JORA 4P48A 4ODSH 3E2HB 3M17A 5EIVA 3SHSA 4PRHB 3PJSA 1SJHB 4ZPTA 2FJHB 2V2XB 4HKZB 4XPHH 4MQXD 3SJVA 3INUL 1RZIB 2AEWA 4ELMA 1I8KA 5I0ZA 2I9LB 1PGRB 4G3YH 2I60L 1NCBH 3H8NA 3HC0A 3V8CA 2ERJB 1AP2A 1YDPA 4GS7B 1TZHA 2H1PH 2DBJA 5F1OB 4QXWA 4YXLL 5LG1A 3S97C 1EXUB 1V8HA 4MZ3A 4UV4L 4P9HH 3N85H 1XH3B 2DAVA 3SDCB 5CEZD 3V5DB 4GT7A 4XCNB 1MLBA 2HKHL 1YQVH 3TH2T 3V6FB 5C08E 3PHSA 1OT1A 5IGXH 1BM3L 4ZODA 3B9VA 4GQ9H 4X4YA 4M4PA 3T77A 1DN0B 3C9NB 3DJ9A 4PGCA 3QZWB 4Z76B 4N9OB 1FH5L 4H8WC 4YPGB 3EOBA 1FLTX 5CP7B 1TCRA 4K7PY 1MNUH 3LB6C 1RULL 4N90E 5I0DA 1R5IB 1UM5L 2PO6A 1NLDH 2CGRL 4GG8B 5ESVB 1QFWI 1C5DB 1V3JA 3U9UB 3A67H 4XB8A 3QDGD 4ZTPH 4ZUTB 1V3KA 5J89A 4QHKI 4XC1L 2N7AA 5HI4C 4O51A 3GSXB 5KVEH 3B2VL 2BSSB 3WE6B 3I6GA 1EFXD 3QIBC 3SGDI 4YPJA 2DJ4A 2Y6SD 1I1RA 3VJ6A 1IEBA 5A3ID 3C08L 4POYA 4CADA 1T2QL 3P73A 2P8LA 4LAQH 2NY1D 1ZS8B 3L3KB 1KIPA 1RV6X 3QWRD 4OT1H 2WUCL 4JRXE 2BNRB 1RHHA 3GKZA 4NN5C 5GGQH 2VYRE 1S3KH 1KPVB 5GZOD 5IBTH 3D2UA 3C6SA 3U4AA 2ICEB 3WNMA 4E41B 1DBKH 3MA7B 4Y4HC 4YQXH 1NLDL 2ZUQB 2GITA 1NGPH 5JZ7D 4TUKL 1H0DB 3WS3B 3I75B 4H26B 1S78D 3BUTA 4JGJA 3VD5A 5CWSB 4ODTH 3VWJA 5F7LB 2XG5A 3HZMA 5BXFA 2C1OB 3I3BA 3VXSE 4FMKA 3EGSB 2IPTH 4RDQG 3DI2B 5C0CA 5FKPA 5E2VH 2G5BB 3VXNA 1QEWB 4OCLC 5E2UH 3TIEA 2VWEC 4OM0L 1OAYH 1DE4B 1EO8L 4UT7H 4Z5RB 2FJGA 2XN9E 5CILH 3WFBH 3GJEB 3SDDA 5TQ0L 2DWDA 1WC7A 4YHIA 4WFEE 1NCNA 3LQZB 1RJZA 5I18L 4GMSL 3QPQD 5FUCC 4NT6A 2VLKE 4QGYA 4UINL 1EJOH 1GGIL 1VEOA 1QBLH 3EGSA 2WP3T 1S7VA 4XMKH 5GGQL 4G3YL 4X98B 1DFBH 3O9WD 5IB3A 3N1QC 3L3DA 4PGJA 2PTVA 2J8UA 4I18A 5DQDL 2VDLL 1OP3K 1U91A 2OJEB 1RK1A 4U7KA 5HGBA 4OLEA 3QDGA 1U3HA 4HIHA 2DQHL 2PTTA 2UUDH 1UZ6F 3RL2B 4IMKC 3PWPE 3TVMC 1ITCA 1E4XI 1KIUA 3FT2A 4PJCF 3UYRL 4MQSB 5KJRL 5HHQA 3OJDA 2OR7A 5F9OH 5I1IL 3GB7B 3P4OA 5INDB 2E6QA 4FFYH 1FNFA 2F8OA 4UQ3B 2HT2C 1BGXL 5J1AA 1MCRA 3VXTB 4BH8B 1CTOA 5AUMB 5MI0B 3SDAB 2P45B 3NGBB 3GMRB 1PQZA 4ETQA 5C0BD 1MCWM 4FQHA 4NC1E 4Q6YA 3U46A 1J12A 4FZEH 5I1LA 3CK0H 3P0VH 4U49A 3B2UC 1CFNB 4NBXB 5ICYA 1U0QA 3NCBB 5FYLE 4WNQA 5DEFB 3VXRA 3SKNA 3S4SB 1QSFD 4ALAL 2BERA 2ZPKH 3RBGA 1SMAA 1U8IB 2VDRH 4CMHB 2AQ3A 3IDYC 5IG7B 3SJVE 2DQCL 3VXQA 3WLBA 2J7LA 3FB7A 4M61A 3IXAB 2Q7YA 3VMNA 1S9XA 3AS3A 4Q6IA 3S34H 4K3DH 3V6OC 5LBSH 1YEGH 2BC4B 4WWKB 3V4VL 1FFOA 5BS0D 2DKUA 3GSNA 3CDFA 4OD1L 3HMWL 1I7ZA 4PJCE 2VKXA 4DKFL 1G6RB 1PQZB 1UWXH 1IM9A 3J8F7 5IM7A 4JPKL 4PJ7B 4NQEB 3MJGX 4ZFFB 1FCCA 3QHTC 4UU9A 1UB5A 5C07D 2PN5A 4JRXB 4P3CL 1R3KB 2Q20A 3CX5J 4X4XB 1R5WB 3N9GL 3RY5A 5C9JB 5JIHA 5CHNA 1ACYL 4NDMB 2NX5D 1FNHA 2GUOB 3SN6N 1JPST 5D7JD 3RY4A 1CICC 2Q6WB 3PJSB 5IK3A 3WMSA 2LTQB 1HYSC 3TIDB 5DRXA 2GJ6B 2AEQH 3UJJL 1NEZG 5GSVB 1S8DB 1IQWH 1GL4B 1BD2B 5B38G 1T0PB 3H42H 5SWZA 1NCDH 3LKOA 4M6NL 4IHOB 4Q2ZB 4ZS6C 1SQ2N 32C2A 2X4NB 4BQCA 4F37F 5ID0B 4I8DA 5JQHC 4L8BA 4UIKL 2DM7A 4C54A 1TETH 3MFFA 2XA8L 4MSWB 1LP9F 3D3VD 3F12B 4H1LH 4U1MB 4K94C 1U8QB 3RUGE 1FGVL 3BEWA 4U1GC 5DHVB 2X05A 4PG9A 1K8IB 5CILL 3CGTA 5DFWH 3UEZA 3BWAA 1N8ZB 3K4ZA 4CDGC 1CD1A 3MR9B 5FHBH 1YN6A 3MRHB 4KRLB 5BVJA 1XFPA 2OS7A 3ELAT 3F7QA 3DMMD 1TDQA 3FQXB 1KB9J 5JHDA 2BY1A 3FRUB 5ADPH 4NUJA 4PD4J 1XGPA 2V7HA 3N1FC 2YD2A 2WBJB 5TQ2L 1N7ML 1D6EA 3ARBD 4XBGB 1EEUA 1D5IH 5GZND 2CKBH 4XPGL 4EN3D 3ZL4H 4BH8A 3WD5H 4XGZA 1FRGH 2OL3L 1C5CH 4HT1L 1Q9KA 2GSGA 4Z7VB 2FEEL 3C2AL 4HS3A 2OR9L 4S11A 3ZTNH 2N1KA 3HG1D 3WO4B 2NY3B 4J3TA 3C87A 5IOPA 3L6FA 1CFNA 5ICYB 1IT9L 4ZTOH 3TT3L 1VFBB 2IFGA 1BZ7B 1IQWL 5SX4H 4UTAH 4O51B 4WUKL 1C8PA 3GRWA 3SDXE 4KJPD 4GXUM 3VFOA 2FIRT 1OCWL 2BJML 4K23H 3W11D 1EVUA 5IQ7L 3T4AA 3P4LA 2FX9L 5KSBA 5B8CC 4PJ8C 3SE8H 5I8OL 1I3RB 4LCCA 1CE6A 3QNXA 5FO8B 2XNAB 1T21A 3I50H 4OB5L 1DR9A 4HIJB 1YEEH 2BDNL 5LGHH 4IMKA 1CFQA 2FJFA 4LLVA 2HN7A 5E4EB 4O58L 2YK1L 1EBPA 4OTXL 3FRPA 1DN2A 3RUGA 3S96B 1F97A 5HD8D 3CSYA 1I7TB 2AQ2A 2NR6D 1Q9WB 1BBJB 1GGBL 5IGXL 4QTIH 5LXGL 4XVJH 2EDOA 4OAWB 2P46B 5KTEH 3ECBB 3GGWA 1NCCL 1K2DA 2DLIA 3D48R 1E28B 2BRQA 4JRYE 5F6IB 1A4KA 3DVIA 4KKAD 2MSPA 2R2BA 4FQXA 5GRVL 4RX4D 5GJSH 2QHLA 1C1EH 3S37X 4A2LA 3GSXA 5FO8A 5F3BA 4NP4L 1G7QB 4L4VE 3R1GH 1EO5A 3VXMD 5BJTA 4AIZA 3UDWC 1HEZB 1OAUL 5SWZB 1KENL 1CF8L 1IL1A 1GC1L 3CJJA 3K2UH 1HK6A 4RFOL 1AC6A 3BKMH 2EECA 5SWSB 4LNVA 1FJ1B 4G80B 5DT1H 2E8YA 4X6CA 1DEEB 1Z0NA 2JB5L 4L5FL 4APQA 3OL2A 2XWJB 1NC4D 1S7UB 3TVMA 2B1HL 3NFSL 3QCUH 4HDIB 1BFSA 1CFTB 3E2HC 3DO3A 3GSRB 3PF2A 3PGCA 2X44D 5CD3B 2OQJA 4HUUB 3VFPA 3PDOB 3VDAA 4FQ1H 2CK0L 1K8IA 2YPVL 3LKNA 4PGBB 1VGKB 5J1TC 4LAJH 1FO0B 5ANMA 1YN6B 3UTQB 5HHPA 4M03A 3DLQR 3B5HA 1KCLA 3MRLB 2Y23A 4BZ2L 1MIML 3QUKB 5FDYA 3VRIB 2BHUA 1T7ZA 1R0AH 2A6KA 5K59E 2P5EA 5IHUL 2OJZH 1INQA 4KROB 4KAQL 4NKDA 3KPQA 5FYJD 1LO5A 3JV4B 3O6KH 1YN7A 1AR2A 2BSTA 3VGEA 1VENA 4XP4H 4Q6IB 1Q94B 1ORSA 1AIFB 1E4XH 5HHMD 4DGIH 1UZ6E 7FABL 2HWZL 4UTAL 3VXQB 4NZJA 1IM9B 4G5ZH 5MENE 3C9NA 2Y5TA 4GH7B 2FGZA 3ILPA 4ZUUB 3TO4B 3UROR 4Y19A 2BSTB 1LQSR 1QPPA 2OP4H 3V6FA 1I3GL 2R1YB 5JUEL 4IS6A 5MENA 4JFPA 4Q7DA 1SBBA 3PHOA 3O6FC 3N9GH 1J8HA 1F3RB 3H9SD 3E3QE 2VLJE 1N4XL 2J8UF 4XNQB 3GBML 2GJJA 3DX6B 2VL5B 3NCJL 2X89D 4R0LC 3IFNH 1VFUA 1W0YT 3IVKA 4P5KA 1FFQA 4X6CE 1HHIA 2C3HA 4N8VB 4G6MH 3WIFB 4QOKA 2VERN 5F7UA 5IB4B 2AGJL 3FN0H 4M1DL 1CE1L 3EDFA 1CL7H 2BNQB 2BJMH 3G9VA 2R0LH 5KSAB 4Z77B 1HQRA 1K5NB 3V0AC 1NLBL 3PL6C 1E4JA 3BXNB 3T4YA 3ZKMD 4Z18A 3QI9D 5EOCL 2MCPH 4I3GA 1T04B 4F58L 3WLBB 4XP4L 5C0RH 1W8NA 4XNYH 4DTGH 4HFUH 1LDSA 1X5YA 4G6JH 3PABB 1EO8H 1WICA 3FO1B 3T0DA 2DI9A 3V2AR 4FQXC 3NH7H 1C08A 5T1DL 1OAXL 5GGRY 1HH9A 2WW8A 4OUUA 2FSEB 2EDJA 1KB9K 4LASL 4O5LH 5HHXL 5ACMA 5BRZE 2D7MA 2AJUH 2CH8A 1KCVL 4HFWB 5A3IC 3MRPA 4JM4H 3U83A 3QWOA 4LPTA 3VFMA 1K3ZA 1BQUA 1OP5K 2Z91B 4G8EA 3EAKA 3EYOA 4K8RH 1G7PB 4XAWH 1N64L 3BIAX 5J9PA 2O26U 1A9BA 4YX2H 1FP5A 4PG2C 3QI9A 4PBWD 1AE6L 1WAAE 5ADOL 4F15B 1FNGB 3UPRA 1L7TL 3U2SA 2P42B 4FTVA 3CDGA 1NEUA 5T33L 3QYCA 2NR6C 2ZCHH 4RGMC 1KN4L 1I9EA 3NVQA 4LLUA 3HUJF 1N0LA 4Q0XL 3U30C 1XF5A 5C2BL 2X70B 3LIZL 5CSZA 4PGCB 1JJUA 4H0HB 3FJTA 3NA4A 3QWQB 4QRQA 9CGTA 1TZIB 5FM4A 1BX2A 5BVPH 4RNRA 3BD3A 1T20B 2BZDA 4MLSA 5C09D 3T3PE 1QFWL 3EYOB 4JZNA 1WBYB 1E0OB 4JG1H 3O11A 3W0WD 5FOBB 3VXME 1IM3A 2MCG1 2H2PC 2Z35B 5F7HA 1MPAL 1N59B 5T1LD 4X7TB 3FHAA 3WO3B 3S35H 4FZ8L 3VDCA 3A6CH 4ELME 1ZTXH 4RFEB 3MLVL 5D5MA 5ID1A 3GSVA 4X9BA 1AFVL 3TA3B 2WQ8A 4OCSH 3F62A 5DVLA 1XGPB 5KVGL 2X09A 2AXGA 5KANG 4HJJH 4PJBF 3K8LA 4PTTB 4WW1B 1WEJH 5EUOE 4XPAH 2XPGB 2UZYB 1KPVA 4D3CH 4MA1B 1MREL 3TBVA 4OGAD 5SX5K 4MA8L 1GSMA 3K74B 4XPTH 1LP9B 1KUMA 3PDDA 3STLA 4YNYA 5E7BA 5I75C 2R0KH 2A0LD 2Z31A 4I0PB 3FQNB 4TVPL 1MUJB 5EFIA 4KKLD 1ZT1A 4V2CB 1MCIA 4JJHA 3RWEB 5D5MB 4WWID 5ELIA 1FNEA 1X3DA 2MPAL 3FT3B 4U6YB 2H3NA 3QUKA 4OD2B 1NH6A 1MCNA 3QQ9D 4EDXA 3QCTL 4WW2C 4NFDA 4Z7NF 1OPGH 2FEEI 1YN7B 2ZG3A 3GSUB 4GRWH 4KK6D 5TDNA 3CFEB 1AGBA 4I3SH 4Z0XA 1CQKA 3PABA 5IR1A 4YHMH 1F4YH 2EICA 4V2BA 3KPMA 3NZ8B 3O0RL 3T2OA 1LD9B 3BISA 3LKOB 2CJUL 5B39A 2HFGL 1VFAA 3WIIH 3RIAF 4JDZA 3OB0K 5B21A 1ZXQA 3TO4C 1T7WA 4G8GA 5GSVA 2Y25A 2YEZB 2D0GA 1BIIB 1AXSB 2YHGA 3GSQA 1WGOA 2EC9U 3NTCL 1YECH 1MY5A 3HNSL 4Y1AE 4LVOC 3PHOB 1TXKA 2EDRA 3IGAA 4LLAA 3VD9A 5FGCB 5I8OH 4YLQT 4JRWA 2V2TA 3MJ9L 3SKMB 3MV9A 4AG4H 1QR1A 2R2BB 2J88L 2YPLE 5CZVL 1RZ7H 4XPHL 5DFTA 3IVKB 3T0ED 4H0IA 4RA3A 3RRQA 4P23A 4HQQH 1IAIM 3IDIB 4PB0L 2C9AA 4XAWL 3A6BL 3BIKA 2JK5A 1A7PH 5E2WL 4JM2D 5IB2A 5FCUH 2Z31D 3BGMB 3QJFB 2APBA 1S7QA 2QHRL 4JREB 4NUGL 3S36L 3QO1A 4KHTH 5CINH 3LOWA 4GW5B 2HKFH 3CVHL 1T20A 3VI4E 4RGNE 4UMGA 4EUPB 3LS5H 3SO3C 1MRCH 5KSVB 4N0CD 4FZ8H 4EQ3A 1T89A 2CLVA 3MLVH 3MNZA 3Q3GA 1MQKH 2R4SL 4P59L 3RI5K 4IEFB 4QEGA 5JIKA 1G9ML 3OKDB 4WY7L 4YDLC 3O41A 4PRHE 2Z93A 5F8QC 1AGEA 3MCLH 3OPZL 3RX7A 5LQBL 4U31A 5B38A 4NKOA 1JGDB 2X4PB 4LNRA 4CNIB 1G7IA 1VPOL 3HMXA 1A3RH 1HHJB 3S88H 3SCMA 2O5ZL 5EU5A 4NM8H 2PUQT 3NACL 3BI9X 2QADD 2DQEH 5D2NC 3RY6A 3SPVA 2ARJQ 2CRMA 4ZDHB 3WJJC 5AAWA 3TCLA 3QI9C 4JB9H 1G9NL 1U8HB 4MLIA 5DVOA 4WUUD 3VFMB 2R8SH 3VGAC 1F2QA 2VH5L 1R5IA 4O9HH 1LHZA 1DEDA 4HMDA 3AMKA 1FNLA 1G7MB 4Q74A 3I6KB 3HMXH 5IEHB 5DO2C 3BMVA 3QNZB 3RHWF 3VGDA 5SWZE 3VXOA 1GIGH 1R3LA 4PGEA 4RZCA 4O58H 3BZEA 3BKCL 5BXFB 2X1OA 3AU1B 1QFPA 3GJFB 1BJ8A 3JZ7A 2IAMA 5LGJB 1XGTB 4QRPA 4NYLB 1KLGA 1JMZA 3VXMA 1GC1C 4ZFGH 4GBXD 4QHMA 1FN4B 3V0VB 3T0VA 5J13B 4L4TB 3IDJA 3SY0A 3U36B 4WI9A 4I18C 4JFXA 4JFFA 3RI5F 3VWKB 2R69L 3MXVH 4JO3L 3P0GB 2ZUTA 2HJLB 4LL9A 2A74B 3SGJC 4LFHG 2GJZA 1SJEA 2OI9C 3L3JA 4KH2A 2V9TA 3LEVL 1G7PA 5F89B 1RZGB 3VWJC 2VN4A 3MLUH 4JO2L 1LD9A 2A83B 4H5SA 3VRLE 2YPKB 2AK4B 2B8OT 5GS2D 1KB5H 4WCYH 3Q1SL 2YRZA 1A6UH 4G43A 2XT1B 1P7QD 3KPSD 2YPLA 2VDML 2YPLD 4JCLA 3TBTA 1M6OA 4HS6B 5BVPL 3IT8D 4UOW0 5GGVY 2VDKH 4GAFB 4QHMB 4PJEE 4HULB 1RUAH 2CKBL 4A6YB 5IMOB 2GJ6D 2OQJB 3SKMA 3G6JE 1KB5A 1CZ8H 3QZWA 3IU3B 5DQDH 1GPOH 5DVMA 2D03L 1NCWH 4MD5B 4HHAA 2CK0H 2VXVH 1MCOL 1XCQA 4X0KA 4HKXA 2R56H 5F6HJ 2VXQL 3LY6A 1LP9A 3WFDH 2E9BA 4Y8AA 4M9PA 4YFLF 5DJZB 1AGCA 1IGTB 4PRBB 3QUXB 4X7SH 4HUWA 1RHFA 3MCG1 1NAKL 1WIOA 1KF9B 5IMMB 3DIFA 4J4PC 1MFNA 5E8PA 2DDQH 5DA4A 3SDAC 2YBRA 1U3HD 2A77L 4OFYD 4NQSA 4F7TA 1KLUA 3C6LB 3IFOA 3T8XB 3H3KA 1OOAA 2EE9A 3BH8B 1A4KB 3UJTL 4YNYB 3L7EB 2X4QB 3IXAA 1WITA 2EH8H 1BFVH 4JFFE 5DSCA 3S7GA 2Z93B 1M1SA 1CGVA 3BWAB 3BQUD 4LHUB 4D0BA 3MLUL 1E6OL 4JO2H 1WZ1H 3U4EA 5I2IA 5IMKB 3UC0H 1RUQL 5I1JL 2FEDD 1GH7A 4TULL 1P1ZB 4ENEC 4U1IA 2X4TB 4BSVB 2VQUA 2QQLH 4ZUUA 1B3JA 5JXEC 4NBYB 4DN4H 1S7SA 4MNGA 5JHLL 3LSOB 3H7BA 4TUOA 2ZWLT 5JR1L 3D3VA 4PJIB 1CFSA 1HI6B 3KLHD 5I66A 4JAMA 5IMKA 5I2IB 3M07A 1HHHA 5FA4B 5IQ9A 5F97E 1CYGA 4HJGB 3P4NA 2NX5B 4BKLB 5C7XL 5GS0L 3H2WA 4JLRB 4M3JA 1CE1H 3L7EA 4RRPG 4DK6A 4PB9L 1VFAB 3FFCA 5DRXB 2GEEA 3DX7B 1F90L 2IQ9L 1A21A 3HRPA 3KPRD 3OHXB 4O00A 1T7YA 1TZGL 1KNOB 1RUKL 1I7ZB 1GCFA 3HE6A 2DLGA 4HPYL 4OZIB 5GISL 2ZP0T 4L5FH 3S35L 3ARWA 2EDTA 1OQXA 4N5ED 1IC5L 1NGXB 1X5XA 3NH7L 3TWCH 3F7VA 4FQIL 2GCYB 5GZOC 3KDMB 3MV01 4AM0B 1ZVHA 2Z8WC 4Y16C 3O9WC 4HDIA 4OLYL 2G5RA 1CGWA 2AK4A 3D0VA 4TTGA 5KANI 5DS8B 4D0DB 4I0PA 2HJKA 1FFNB 2X41A 2K1MA 2OJEA 1A5FL 4ZUVA 1U3JA 5AG9A 3ARBB 1TVBA 3BJ91 4YZFE 4S0TD 1LILA 5BS0A 4RBPK 2WUBL 3BP7B 3ABZA 1F3DH 3QJHA 5FGBA 4R7NB 3RWCB 3FOLA 1LP9E 1OGAD 4S2SB 2NW2B 3A67L 3PHQB 4ZTPL 2YC1A 2O5YH 4Z95L 4D9QE 1AXTH 1Z9OA 2BVQB 3ISWA 3VXRB 3GB7A 4O5LL 4BELD 3ZYZA 4KY1H 4LU5H 5E5MB 4PJ8B 2QLVB 5H35B 4MXWL 4PV8A 2YZ1A 2A73A 3VD3A 3LV3A 3VXOB 4UDUB 5EBWA 1RZKH 2F5AH 4PRBA 5DJZA 3FO2A 1JZ6A 4TUJB 4NHCL 3VH8A 1B0RA 3CDGB 1CGTA 4HH9B 4EBQL 3CFDB 7CGTA 2Z92B 5F9JA 2Z4QB 4KZEH 2A1WH 2F54A 4TNVF 1WZ1L 2R29H 3O9WB 3QPXH 1X5IA 3MLSH 4HBQA 3MA9L 1R24A 2NXZC 4OM0H 5D7KD 4IRZL 3Q6GL 4XZUB 1ZEAL 4XVSL 3WFZA 4ODWB 5D7IB 3BPNC 3LPWA 4PJEA 5CSBA 2YR3A 5GGUB 4P5KB 3REVB 1LVEA 2CR3A 3U6RA 1OD9A 2JJSA 1A7NH 3FB5A 4MNHB 3HPJB 4LSSH 4NFBA 5CMAA 1Z9MA 1D5ZB 5D9SA 1GGCL 3IB4A 3S37H 3L95B 3NFNB 4L4TD 2FSEA 1NBZA 1AD9A 1D5IL 2ESVD 1VFBA 1U42A 1S7SB 4JN1L 5F1SA 3K1DA 5BMFH 3K7UA 4X7FC 2W0PA 4JFDB 5M95B 1OM3H 3OB0H 4K3GA 2GJZB 1X6NA 4M7LL 5DMJB 4Z8FL 4ZOBA 2PO6B 5EO1A 3CFCL 3OAYK 3O2DL 2VC2L 2Z8VC 3W5MA 5DA0B 5HSFA 4CW1A 3EKCA 2JELH 4YBQC 3WHE0 4KXZI 2R1XA 2Y9RT 5EIQA 3ROOB 3T2QA 3F5WB 3GSOA 4OZIA 3FT4A 5D7IE 1Z2KA 5CJ8A 4F15C 4IDJH 3SDXF 3LPGA 1JL8A 5FFLA 4CVZB 3SJVB 1AGDA 1FFRA 3MACL 1OTUD 4P3DB 4GSDL 1UEMA 2AJVH 4W81A 1E4KC 3MLTB 5TF0A 4UI2A 1MFEL 4EJ1C 3IF1B 2D4DA 3GMLB 3NPSB 1YMMD 4OZFA 4TSAL 5DWUL 3WIHA 2W38A 1JI1A 3P9WB 1YEJL 1QFOA 3TT1H 4PREB 4DAGL 1UXWB 1MEXL 3CX5K 1ODAA 3OB8A 1A3LH 5BZDB 3ULVH 1FZKB 3UAJC 5FYJH 2W0FA 3GRWL 4A6YL 1U2HA 3GSQB 5E1HB 1LO0H 1NMCC 2D9QB 3QHZH 2F53D 1FO0L 5AD0B 4KKAC 3ME0A 3VH8G 5L0QC 4Z76A 1UJ3B 5KZCD 4FABL 3KYKH 2QR0B 1KJ3H 1OTTC 4LLDA 4AENB 5K9OB 3Q6FA 1RZ8B 3T1FA 1KIRA 4NM4H 4KTEL 3MROB 1T1XA 4OZHF 5DD0L 1OAUH 2V9QA 1MWAA 1G9MC 5A40E 5L7XL 1RZGA 1WZLA 3MGOB 1I4FB 2FR4B 1KPUB 3O6LH 4ZOAA 4YBHA 3JWDL 1RAMA 1NFDB 4XHJC 4EDWH 3BP5A 2W60B 5DRZB 4XCFL 4D0BB 1UJ3A 5HGAA 2BVOB 3W82A 4XMLL 1JF1B 2UWEE 3ZDZF 2BSRB 2ZSVB 1WISA 5AYUH 1K85A 4NC0B 5CP3A 5AAMA 1A8JH 4GW4A 3DSFL 3P11H 4RGOL 1KCRH 2X2YA 4KDTA 4QHUA 3ARYA 4JPIA 3MODH 3H42L 1MNUL 3OJDB 3I85A 2XQYG 3IJHA 1HXMB 4X9IA 1ZGLA 4KPHL 4RFNC 5T1MB 3WDIA 3LEVH 4HHAB 4UTBL 5IWLA 1YEKH 1XR9A 2XOTA 3QNXB 1QSEB 1NL0H 2JJVA 5AUMA 3DPBA 5E24E 4H20H 1T7VA 3L3GA 2HT3D 3NCFB 4GBXC 1DVFC 3UX9B 1ZT7A 4OF7A 4I2XB 2X40A 4NUGH 2ZOLB 1FYHB 5C6PB 1CXLA 3L9RA 4PJFE 1UH3A 1E4KA 2YK1H 4XMLH 2I9LA 3BZ4B 4Y4FC 5F3BB 3O6FA 1FNEB 3GIZH 4TOYL 3QDME 2Y36H 4NNYB 3MRCB 1FG9C 1FGVH 3I6KA 3K0WA 4KKLC 1DE4A 4WI4A 3ARBC 5ISZD 5C08B 3UAJD 4KTEH 4WHTA 2ARWA 4AEEA 4N0FB 1U8HA 4OIIL 5JW3H 3RTQD 4NNXB 4WTXA 4CRPA 2AXJA 1IAKA 1LO2H 5ITFB 1EAPA 3CXDL 4JFYB 4M7LH 3LV3B 1HH9B 4QHNA 4ERSL 4LCIL 5EC2B 3T77B 1YJDH 3MYZA 5F96H 4MDIB 1E6OH 4MD4A 4MX7B 3T0EA 3ZLQC 4OF0A 1RK1B 5HGBB 2NQCA 3H9HB 4ZYKA 1XGTA 1U3ZA 5CIPB 2XTLA 4PIRF 5DTFA 4WV1A 5D1ZB 1NBQA 1DZBA 5INCB 1A2YA 1DLHB 5MEND 1W72L 4N0UE 3K81A 4N8CH 4L8CA 1QKZL 4BFIA 4TSBH 2XXCB 3FMGH 1L9NA 1YY9D 4Y5XC 5IF0B 5C08A 4M7ZB 2X7LA 3CFKB 4JQIH 5DEFA 3TPKA 1ED3A 3WBDA 1SJEB 3F58L 4OFIA 5J4MA 1NANI 1CD0A 4UBDC 4JFYA 1FLRL 3DETD 4PRNA 1AH1A 2EDQA 2NY5C 1QSVA 1CGSL 1K4DA 5D7LA 4J2XA 1EHNA 4LPXA 3WXVH 2BNRA 4JKWA 3T0EC 3H3PH 4JFOB 3VG0L 5FYKL 3RWJA 5C0FB 4PJEB 3BP4B 1JRHI 5T3ZH 3O8XB 3OX8B 4GG6F 1J8HB 2CLVB 1G6RA 1OSPH 2EYSA 2W0LA 4TVSa 4P5MA 1ZVSA 2BNQA 3QI9B 1T22B 1FYTD 1N0XH 4JVUA 1R3JB 3AREA 5CIPH 5FUZL 3TO4A 2MJWA 3BHBA 4JZOA 2NXZD 1R3KA 3RQ3A 4XH2B 2AV1B 4R90L 3KLSA 3CZFB 3D9AL 1YNKL 2CJUH 2DYPA 5T1KA 3JWOL 1IEAA 4YDIL 1NMBH 2D7PA 1F5WA 3GM0A 3PWJB 4FXGA 3RWIA 2GK0B 1ZHKA 4KMLB 2XWBA 3ZHKA 1CS6A 3FN3A 4OSUL 1OB1A 4XTRD 3ZKSD 1MLBB 3FRPG 3LRGA 1Q9KB 4Z7VA 5KVFH 3ORJA 4P2RE 3RZCD 3ZMRA 1EFXB 3NMEA 5IWLC 3V4VH 2P5ED 3LIZH 4IM8A 1AKJA 1ZA3A 1Y6NR 5FUOH 2COQA 2CIKB 3UO1L 2DLTA 4CKVX 1XF1A 3HZKB 4MA3A 2AABL 2A2QT 3O8XC 1HH6B 2X4SA 4L9LA 4QCIB 3SE9L 2P5EB 1PKQA 4AL8H 4H25A 3HNTH 3BT2H 4GS7C 4KHXL 3ROLA 4QRRE 1UXWA 1WFNA 4JY5H 4NNXA 3UTSA 1KGCE 1CU4L 4YBLB 3RGVD 5HJ3B 1ZLUH 2K7PA 3LCYA 3QIUB 4TTDC 5L0QB 1ZGLM 1YEHL 4U1KA 5DJ0B 5FDWA 5I1LB 2ICWJ 3MRRA 2DJSA 1RZIA 4U1GB 2H26B 1O5DT 1JVKA 4LCUB 3WJJA 2H2PD 2CDGA 2VLLB 4MGXA 1UJTA 2W9DL 3QIUD 3GMQA 4DN3L 5TE7L 3HC4L 3TJEL 4HG4J 4JFDD 4LLMA 4BFIB 5AZ2L 2WAHA 2FZ3B 3MNWA 1HKLL 5B39B 4JKLA 3T1WA 2W9EL 4KUZL 2ADGA 4WU5A 3RZCB 4CJ0A 3QP3A 1CLZL 4NOFA 5J57B 1XR9B 2ID5A 4JR9H 1P4LA 5D5MF 5DFVD 1ZA6B 1IGML 4DFHA 3MRKB 5IW6B 2VLRA 4DEPB 1QSFA 2CMRH 2NNAA 3VFTB 4P2RA 1KV3A 3PIQA 5T3ZL 3TIEB 3EIFA 3ARGC 1RUML 1Q9LA 4DGVH 4S1DC 1NC4A 5HGAB 4A2MA 1ACZA 1X5HA 2A9NL 2G2RA 5I66B 1T2XA 1KTLB 3DVFA 3EOYG 1XGQA 3FQTB 2VQ1B 3G5VB 4UINH 2NY4C 2IPTL 3HCVA 1CFQB 4LLVB 3VFPB 5L88L 2GTWB 3V7AE 4M7KL 4APQC 2NY7H 3BP6B 5ALBH 1JCKA 5F88B 4LDEB 2NY5L 1A47A 2XNAA 4GKSB 3NIGF 1YMHA 1IFHL 1EAPB 2DKSA 3AB0B 4NCC1 3MRLA 1G7IB 3BN9C 2Z92A 5IBLC 1BQLL 4QRSA 1M05B 3G6DH 5EN2B 1JZ4A 2ZOKA 4WFGD 3UXFA 4LARL 5L8KB 4QNPE 1CTNA 1NGXA 1UXSA 1BJ1J 1X5KA 4F9PC 4RGND 3RWIB 5HVFB 4XVSH 2ATPB 3R06A 4FXGB 1MJJB 2KL6A 4TNWK 4C83A 1AO7E 3ARDA 4I2XE 3BX7C 4R9HA 1NC2D 2A1WL 3J7HA 3EO1A 1QHOA 2X7LB 3CFKA 1G9NC 1KT2B 3KPOA 4U7SA 3S9DB 3U2SB 5L7XH 3BW9A 1J86A 1YMHB 2WWKO 1KEGH 5FYLL 5C0CD 1KPRA 4L3EB 4DUVA 1H8SA 5DTFB 4NQCD 1HDMB 3U36A 3SCMB 2BVPA 1OTSD 3GJEA 3SDDB 2ZSWA 2Y06H 4OFPA 2VITB 4XWOC 3HI5L 1LEKA 5TH2A 4M1GH 1I8KB 4AJ0A 35C8L 3QFJB 4QXUL 4RMRA 2HFEA 4GKZA 4Y5YB 3C60C 4CDHA 4XP1L 5IEHA 3ARGA 1KYOJ 4G42A 3IDJB 1DUYB 4UT6L 4MQXC 4ODVH 1DN0A 3QDJB 3AY4A 1FSKC 5KOVC 3SGDH 1QYGH 5AG8A 2HT4D 3JV4A 1C5BL 4Z77A 4NYLA 4XCNA 1X6LA 3W2DL 4U0RC 1PX4A 3QQ3A 4KI1A 2XKUA 5GGSA 1HN1A 2XN9D 4KJYA 4S0SD 2VXUH 3TNNA 3MNWB 2VLJA 4P5TB 4OFDA 5DVNA 3TO2B 2J3SA 5GIRB 5C0DA 3WIHL 3WFCH 3X12B 4FQ2H 3FO1A 4JPWH 1NGQL 1N7MH 3MRJA 1A6ZB 3MNZB 3Q3GB 4EN3C 5DHYA 4K8RC 4NHCH 3MRDB 2VN7A 1F3DJ 1YY9C 5C07A 5ITBH 4OZ4B 4UDTA 2Y07L 3S36H 4NM4L 4PRHA 3U9UA 1OGAA 4MVBD 1JNNH 2X9XA 1F6AB 5CEYB 1RZJH 2CPCA 1VGEH 4NJAH 1G7LA 4R97C 2CLZA 5FUCE 2Y06L 1KJMB 4NRYB 5HDLA 1AHWB 2NY2C 4X6CF 5EU6E 3I02B 4L8SA 4OCYL 1U8QA 4Y88A 4WTWA 4MNQA 3BP5B 2PTUA 3ARVA 3I6LE 5CBAA 3QIWC 3X11A 1UVQA 5IHBA 5C9KA 5DJDB 3BDYH 3BZFB 3CCHA 1WAAA 4GAYB 2GK0A 4XBPB 4BUHA 1X4XA 4B5EA 1H15A 1CLYH 4OI7A 5D8JH 3H0TB 3L95A 5IM7B 4E41E 2BVUA 3QFJE 5GGTA 3WSQH 3FO9B 4J4PA 4ODUB 4Y4KA 2XPGA 3H7BB 3LEXA 1G7LB 3VXSD 2ILLA 3KJ4C 4ODBD 1UCBH 2X4OB 3LRSB 3GSRA 4D8PB 3ZT6A 2F58H 4NWTH 2JB6B 3K46A 3DYPA 2V5TA 3V5HA 2P5WA 4C56D 4WFGE 4U05A 4ONFH 4LCCB 1I1FB 4J8RB 4XXCC 4EKXA 4OIAA 1OD7A 5DK2A 1S8DA 1SBSH 4IIQC 4JPVL 3MV7E 1F11B 2YD4A 3BPLC 2J6EL 4AIXA 4JM2F 4WW2A 4MA7H 3RWHA 3HFML 3RVUC 2VITA 3IU3A 3KVQA 4LSTH 2OSLB 3V52H 3KLHC 2A6JA 2M1KA 3TYFB 2QR0A 2ARJA 1YJDL 2VOTA 5ACLA 3NOIA 5D7SH 4JJ5A 4M02A 4L3ED 4NN6C 5EPMA 4ZXBA 3L3JB 3LS4H 1LO2L 1X9QA 1EBAA 4P4KD 2F58L 1JF6A 4LLWA 2QQLL 4G42B 3W39B 5E6ZA 3TV3L 3GIVB 4OLVL 1TZIA 3H9ZA 3ZZ1A 5IHZB 5GXBB 1G0DA 4JG0H 4YWGL 1ZLWH 2YXFA 4R7DA 1II4E 2NY3C 4LEOB 4JQIL 4OCMC 4OLXL 2O61A 1MHCA 3T0WA 5D7LD 5LKNA 3NN8B 1TJGH 3EYUL 4M3KB 5F9DC 2XZCH 1JFQH 1SHMA 2VLJB 4PJ9A 4CW1B 1A1OA 3ARFB 1LK3L 1MFBL 4RAVA 3N1PC 3FONA 1DQDL 3QQ4B 1IFHH 2VSDA 2HRPL 3DUHA 2AXFA 3I9GL 4JCMA 4NQCA 4XBEL 4P2QB 4LQFH 5CKAA 2WBJD 4JQXA 3CVHA 2HJKB 3T3PF 1I9IH 5I9QC 1GYAA 4JN2B 5C0AA 4G6KL 4NQCE 4G7YL 2EH7L 3EW3B 4PGDA 4O2CB 4AL8L 4WHCA 1RUPL 1JGEB 4TNWF 2VLMD 4OGYH 5GGRA 1OTUC 4U1HB 1G84A 3HC3L 3TFKD 1QP1A 3EO1B 5D96C 2BCKB 1G9NH 4KGLA 2XA8H 3OSKA 2BMKB 1HI6A 2ICCA 1KJ2L 4MHHI 4XX1G 3QXDA 1VFOA 3ULUL 4LSQH 5LWYH 3P77A 3VA2C 2LAAA 2MWCA 3HUJB 4HUXB 3MLWL 4OD3L 3ULVC 4RISH 5JOPE 3FFCB 2AK4D 4LPYA 1ZS8A 3L3KA 5IJVA 5H94B 1RD6A 4ZFOB 2JKXA 4HS6A 3TBWA 5I18H 1S9WA 2QSQA 4OGXL 4F7MB 4FXLA 5C0NC 4XNXL 2H3NB 1VACA 3EYUH 4NRXB 4OLUL 1A9EA 3CLEL 2KDGA 5KW9H 4D8PA 3VE0A 2X4OA 3LRSA 5EBMB 1SMOA 4LRNH 5L8JB 2NYYD 3C8DA 1Q0XH 1LK3H 5IFAH 5JW4R 3MRMA 1FFNA 5FUZH 2GSIA 3VXRD 4PV9B 3UTPE 5HYFA 2F53A 1UKQA 4WI2A 5FCUL 3EZ8A 4P2OB 4J7RA 4ZUSB 4GAJH 4UILH 4FA8A 2AK4E 4U1MA 3SBWC 3E8UH 5HYSB 4F7PA 3SJVD 2WBJA 1VB9A 4Y2OA 1IAIH 5BQ7B 5CLWA 1CIDA 3IJHB 1P7HL 1HQRB 2G9HA 1OGTA 2DWEB 1O7VA 1IC4H 3MO1B 4GW1B 1P9MC 3OKLB 2CO6B 1S5IL 2EDDA 1A6ZA 3G5ZA 3DRQA 5IB4A 5FECA 3C5JA 5I1GL 4NO5A 4OUUB 4LLWB 1N59A 3BPLB 3CPLB 1KJVB 4Z7QF 2O5ZH 5ANMB 2VDQH 4F2MA 2CUMA 4Z78A 4MMZC 4NZTL 1SVCP 1BLNA 1A6AB 3HB3C 1ZV5A 2ICWB 4L8BB 5L8LB 3QBTB 4YDLB 1YA5A 5DJ2A 1J8HE 2Q87A 2EE2A 4MJID 3K80A 3NGBC 5FA3B 5I17A 3MRRB 4Q9QL 1RURL 5DFVC 2ZG2A 2VRAA 3LKQA 3VFWA 2SEBA 4P57A 5SX5H 4L4VB 4LDOB 4F2MB 4J3XA 3KJ4B 4JREC 4LPVA 2VUOA 1QTYT 3LKRA 3W9DB 1YEFH 4WWKD 2DQFB 4JM2C 4HKXB 1HINL 3HE6D 5I1AB 5J12C 3KYAA 3G5ZB 3DVNB 1DQMH 1J11A 4P5MB 3M1BB 5JOFA 1N2RA 2MCPL 3RUGB 1R3JA 4JN2A 2ZUQC 4HW6A 5I1EL 3SKNB 3VXUB 4XMKL 2FEDC 2VUYA 4GW4B 4N0UB 4QXGL 1YPZA 1BQSA 4R4BB 4HK0A 3JWDC 5KVEL 3FB7B 4WO4B 1WTGT 5EWIH 1Z3GL 1A4JA 3D3VE 3SE4C 1WEJL 4QXUH 5F6HI 3CSYB 2WWKT 4F7EA 2FATL 5C70A 1JI2A 4PP2B 3QZWG 5KVGH 2XWBB 3ZDXF 5BRZD 5ICZA 2EE6A 5GGSY 4OZGF 3ROOA 4PJ5E 5C7XH 5GS0H 4H26A 1UM5H 1I8IA 5E56A 1S7TB 4FZEL 4M5YL 2EC9T 3EYQC 3A6OA 1PKQE 3ZE1E 5DDHB 1ZA3B 1XF5B 2HLFC 3CLFL 2OP4L 5DD5L 5IW1A 3RWJB 5C0FA 3QISA 2JF1A 5ITBL 3OG4B 3MGAA 3K4AA 1JPTH 4LSPL 1G0YR 5TDOB 2IBGA 3DOSA 3ULUC 3AFLA 1T5WB 1AR1C 4JKMA 7FABH 3P9MA 5AEAA 4G6FB 1JGUL 3R06B 1KFAH 2ATPA 2VXSH 3GBNH 4JQXC 3O45A 4HX1A 1N3NB 2KQNA 2YA1A 3PGFH 5L2KA 1FAIL 3C5ZB 3WN5C 4DGYL 4B53A 4JANB 5SWQB 2ZCLL 5I9QB 4WUUE 3RJDA 1AGDB 4PJ9B 1I7TA 5BS0E 1MCKA 4M1GL 5I76A 3JTTA 5E4IA 1J5OL 3U7YL 4GW1A 4IOIB 2DQUL 3B6SA 3M8OH 2Y1VA 3WNLA 5CJOH 1KBGL 3LB6D 1HSBB 3TGXA 5FYJL 1QRKA 5K9JL 1K6QL 1GGUA 2EE3A 4I0PC 2PW2B 1F8TH 1NGWA 3HI5H 1N8ZA 1FNGA 4OUOA 5D5ME 3SDDD 3TT1L 4DAGH 4GKZB 4YUEH 5BV7C 1RUMH 4ZD3L 1HSAA 2DRUA 4GO6B 2IPKB 1Q9OA 2QSCH 2R9HD 4D9QD 4CVWA 3CVHB 2AI0H 2P8PA 3PG2A 5FYKU 1QLRB 4UOW1 5IF0A 2I5YL 4NKMB 4GMTL 3MV7B 1VKXB 5HD8C 3QEUA 2OSLA 1KLFA 4MCYB 3GUTB 5ENWB 3TC9A 3O8XD 4EBQH 1JF1A 4F58H 3CXDH 2VDOH 3VI3E 4ELKA 4KXZH 1XGRB 4LPCA 1QD0A 5FOBA 3MRBB 1QOKA 1YNLL 1UENA 1QBBA 1BBDH 4XP6H 5DMKA 3UPCA 3RU8L 3IJSA 4PD4K 2N7BA 3KWWB 1B4JH 4BZ1H 2BNUB 5FYKD 4Z7OF 3JVGC 5CEYA 2GJ6A 2D0FA 2NXYC 3FTGB 3EOAB 5LGJA 1UG9A 1M7XA 1KCUH 1MJ8H 4TUOB 3LQAL 4QOKB 1AHWC 3KS0H 3O2DH 4EUPA 1T1ZB 1FZMA 4LRIC 5C9JA 1OF2A 2ADIB 2NZIA 1HWGB 4KU1A 4U1IB 1DQML 1MJUL 2KQMA 5FM5M 2C4XA 3ARDD 5DJYA 3BGMA 4EVNB 4L8DA 1NEZB 5BMFL 3MRQB 3DBXA 2IH1B 5JDSB 2FH8A 3TIDA 4JY4A 4LDLB 2DIBA 3HMXL 4AQ1B 1FZMB 3RP1A 2HVKB 5IFHH 3S36X 5EFIB 4GBXA 2R8SL 2VDOL 3AS0A 4P49A 5IJKC 3EOAA 1CLZH 3LEXB 3MRHA 3TYGL 5ID0A 4B7LA 3B3IB 5MEQA 1DBAL 1L6XA 3V5KB 4OAWA 5EOCJ 4OD2A 3FOMA 4XCCL 1IGMH 5C0JA 1HCVA 5HHOE 5IG7A 1EDQA 1KCSL 5KVFL 1I1AC 2JB6A 4DGIL 4OF5A 3UBXB 4JFDE 5DJYB 1IGCL 4EVNA 4YHOL 2G9HB 4NQTA 3RDTC 1VESA 3Q6FB 5DD5H 4V1DA 5I16A 1JGLL 3QXDB 1UQSB 2VDPL 5DURB 4ZNCD 4XWGH 3HG1B 4CVXA 3MRFB 1A22B 5FO9A 1KC5H 3IDXH 3N1MC 3Q2CA 3NPZB 3RKPA 5L88H 4NCDA 3X14A 2FX7H 1DDHB 4PLOB 1H3WM 1B2WL 1JPSH 2HAZA 3HFMH 1NMAH 1T66C 4JFOA 4XXDB 5JPNB 1L7IL 2J6EA 1K5NA 4HC1L 5FYJE 4R0LB 4EN3B 1K6QH 1AO7B 2DN7A 3VFOB 3MLPA 5B3JF 2F5BL 2IMNA 4LFHD 5EOTB 1SBSL 2YXMA 4XI5D 3TVMB 1HCFX 4KK6C 5D2LE 2YPKA 3IDMA 2BNRE 3OKMA 2XY1A 1OGAE 4C55A 3U0TB 4MA1C 1S7WB 4PJHA 3C5ZC 1VGKA 5IESL 3Q0HA 3BHBB 4JZOB 3W9EA 4L29A 3BPOC 2OL3A 3W0WE 4X4ZA 1UKSA 3KNBB 5DJ6A 3HG1A 4CVXB 1T22A 4NZUH 4OZ4A 3BQUA 2F19L 1LEGB 3KLAB 1JRHL 1JYNA 1VCAA 1CK0H 4XCCH 5JNYB 2D2OA 1H3VA 1EA9C 1DQJB 4OGAC