3H9ZA

Crystal structure of the ige-fc3-4 domains
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
209
structure length
209
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig epsilon chain C region
publication title Conformational flexibility in immunoglobulin E-Fc 3-4 revealed in multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9zA02
2XN9B 4FTVD 2UVEA 4QHLA 4QRRD 3L1OL 3PHOB 5JLZB 2ILLA 3AREC 1F3DJ 5FO8A 3KPRD 1Q72L 1DBKH 1FJ1B 4PBWD 4IRSB 2XA8L 1C5CL 1MAML 4RMQA 2BNQB 5BVPL 4I48A 2IBZY 2JK5B 3S4SA 5IEHB 3VWJC 4GG8A 1PLGH 4LNRB 3W9EB 4XCYA 5E2JA 4RCAA 4QKXB 3M1BA 4OGYH 3MXVL 2A0LD 3FFDA 5T1KB 1S3KL 1F90L 1OGTB 1ACZA 2VDNL 3W11D 3IDYC 4I3SL 2HJFA 5BS0E 1X6NA 1A1NA 3B9KA 4YNYB 5EPMB 1J8HB 2Y6SC 3VXRB 3QUKB 4M03A 4D0BB 4ONHB 4YBQD 2Z31B 3SDXF 4LHUG 3PWJA 4NN7B 1WGOA 4JJ5B 3SGEH 3RWHA 4DN3H 5E6ZA 1AXSB 2O5XL 4ZOCA 1A5FH 1I9RH 4EUPG 5ANMA 2DTSA 3ARGB 3RUGF 4F37F 2AVGA 5D6DC 5DMKA 4IIQC 1QKZL 1CIUA 1HIMH 3KAAA 2BVOB 1BBDH 1I3GH 1Y0LA 5E9DA 5DEFB 1TZGH 1AQKH 3HMXL 4BZ2H 4CVZB 3VXNA 4OIAA 3MUZ1 5BZWB 3V7AG 1WF5A 2CK2A 3PWPB 5C0EB 5JR1L 2X70B 1U8IA 3DX6A 5IROC 5FA4A 4KTDH 1N64H 4OCRH 3VFUB 4HBQA 4NO3A 3FQWA 4PG9B 3D9AH 2R1WB 4JO4H 1JHTA 5K93A 4MZ3A 5KSBA 3THMH 4NOFA 5ITBL 4LDEB 3LIZL 4HLZH 4GRWF 1CLZH 3KXFA 1SYSA 3TZVB 3MLVH 1UZ8B 5J12C 2DQEH 3OGCB 3I75B 4L8SC 1I4FB 2RJMA 4HIEB 1S7VB 1Q94A 4ZSOA 3N06B 4PS4L 5C07D 1FFQA 4JFZL 5BQ7B 5IR1B 3W0WD 1YNLL 5I66B 3OB8A 1XR8B 5E1HB 3RVXC 4WCYL 1T89A 4HS6B 4JN1H 4MSWA 4OFDA 4W4NA 4CMMB 4JFPA 5DRWA 1S7XA 3K2UH 1KIRB 2P48B 3Q3GB 4ZS6C 3S37X 1ACYL 4P3DA 1T1WA 4Q0XH 3VGAC 5FYJH 1Q38A 4BFBD 3UJTH 5ACMA 2A73B 4L3CA 1V8HA 2C4XA 4PJ7A 4U0RB 3B43A 5DI8B 2AABH 4QGTA 2EYRB 3QUMH 3GB7B 3LKSA 3W82A 2OI9B 3VXUE 4M6OH 3K46A 3U6RB 4CNIA 4FFVC 3DPBA 3ILQD 4PP2B 4HT1L 4Y5VC 4ONOA 1KPUB 1FSKB 1UQSA 4XVJL 2DMBA 4M5YH 2XFXB 5HYEA 2E6PA 3IETA 4LPWA 3WNNA 1F5WA 3RWCA 2HRLA 4XPFH 4HULB 5EU7C 2J3SA 4XCFL 3VXQA 2AK4E 4PRBA 5L2KA 5A43C 4OLUH 1IGYB 5ISZA 4OCSH 4XCCH 3QXVA 1IFHH 4UT7H 4PJIE 4OKDA 4KRPD 5E8NB 5DQ9A 3BZEA 2ITDA 5BXFA 4NQDD 1IC5L 5C09A 4M6NL 4ZNEA 2NY1C 4CMHB 1U95B 5FOBB 4YHOH 4ODSL 5J3HC 2J6EL 3OB0H 3SEPA 3DRTB 4GXVH 5HHPA 3E6HB 2VR4A 2R2HB 1T2JA 3H9SA 5M7QA 1VFUA 4XP1H 1BBJB 4N90D 1FYTD 2AW2A 3EIFA 3MJ8B 1Q9KB 1SY6H 3BZDA 2WWKT 4I8DA 2PXYA 3V5KA 3C5JA 4LFHD 2FL5A 1I75A 4G7VH 1HSBB 2NTFA 3TNMB 4JFYA 4AMKH 1EGJA 2GCYA 5F88B 5DEGB 4MHHG 3QWRD 4MD0B 1F11B 5I1HH 1G0YR 1NCCH 1UM6H 2A83A 5L8KB 5CJQH 5KAQF 5ICZB 3RAJH 4S11A 4IRJC 1TDQA 3DMMA 3X14B 4DCQA 4LHQB 1T22A 2C4FT 2AV1B 2CH8A 2HFEB 2P8PB 4OIIL 5EZIH 1DANT 4Z5RB 3SY0A 3REWA 4ERSH 4YK4B 5ESAB 1KCSH 1EJOL 2KQNA 1BD2E 1WIOA 5IB1A 3VGBA 5C6TH 5KOVC 1KBGH 1QSEA 1SQ2N 3KYAA 2NY0C 4XP5L 3P4OB 3IKCA 2AEIT 2ED9A 2F53E 2O5ZL 4NKMB 2XTJC 1CLOH 2XZQL 2ZSWB 3MRQA 4RMWA 2FR4A 3BIAX 3QIUC 4WHTB 3ULUH 4S0SD 2APWA 4NO0D 2OSLA 4ZFGH 3EO1A 1K8IB 1B6DA 1B0GB 2ICES 1RJZA 8CGTA 5D70L 4PYHA 1R3HB 2CIKA 2ADFL 4JFEB 4F9LC 5K9JH 4Q6IC 3CZFA 4KI5E 5JA9A 3TWCH 2GTZB 1U2CA 5J9PB 4PGZA 3GM0A 4WTWA 2X4UA 2EXYD 5AUMA 4Z7VF 5BS0D 5L7XL 2XG5A 4PJAA 1RZ8B 4RGMB 1FH5H 5HI3D 3U46B 4JO3H 4U2YA 2OJEA 1DQDL 2E5EA 4EDXB 2F58H 4TSCH 1SJVA 5I1GH 3BKYH 4X4YB 1PKOA 2BDNH 4IOIB 1WWBX 2E6QA 3C6SA 5T5FL 1RUPL 3T0DA 4PV9B 1AR1D 1HNGA 5DUPH 5J1AB 3OBAA 3U9UB 4OZGE 2FO4B 4RRPA 4ZAKA 2DQGH 3ZSSA 2A9NL 4CU8A 4NWUH 3OKLA 3MZGB 1IM9B 3RL2B 3CVIL 5KS9E 1G7LA 4PJCE 4QRPD 1NCBL 2M8XA 4GRLA 1FZKA 4JAMA 4GKZB 2H2SD 1ZGLA 3QXAB 1AI1H 2EH8H 2X4PB 3S35X 1A7OH 4Z7WE 2MCG1 1U8HB 4JFFA 4I9WD 1QO3A 1P69B 4P9HH 3QIWD 3P30L 4XPGL 5I71B 3VXSA 1KJVB 3O2VH 1ZOXA 4GMTL 5EOCH 4CN1A 2DMKA 5C9KA 4X6BB 2V7HB 2BXZA 1FCCA 3HTLX 4FQXA 3HPJA 4GAYB 4LASH 1EBAA 4JANA 3TCLB 3F6IA 2Z91B 3PHQB 5BCAA 4G9FB 2CLZA 4PJ9A 5A3ID 4G8GA 1MREH 4HW6A 4PLJC 3FB8A 4GXUM 2MMXA 4H25B 4GBXC 2DLEA 2QL1A 2VDLH 3WKNA 5EC2A 1CCZA 3VRJB 1P9MA 4P49A 1YMHB 3LRSA 4ELMB 1JNJA 3LKOA 4LSUL 4GSDH 4N8VG 1SYVB 4U1LA 1QZ1A 1CWVA 2P8LA 1MLBB 2Q7YB 1IKFL 2JB5H 2Y36L 2X1QA 3DX9B 1KTDA 4Y16D 4MAYA 1OP3H 4OZIA 5DSCA 2PNDA 3QXDA 4LHUB 3LMJH 4OB5H 4M62H 1A0QH 3LQZB 2EC8A 2GSIA 3ARFD 3IKKA 5E8DH 4RFEB 3SDXE 1M4KA 2A0LC 4IM8A 4EUPB 4ZFOL 3MACH 4DVRL 4P2CG 1CGYA 1X5KA 2DL2A 4L1DA 3W11C 3VH8G 2CXGA 1M7DA 4H26A 4JPIB 4BQ8A 2R0KL 5FHAL 1AR2A 3MFFB 5EU6B 3VFNA 5AZ2H 4NQCE 2AJVL 3SGDI 1QEWA 3RWGB 3ZMRA 3U7AA 4YBQC 4UQ3A 3UYPA 1VPOH 5BV7L 1CICA 3V0AC 3I02B 1WZLA 1SM3H 3D6GA 4YHKL 2M1KA 4WGVB 3DYMA 2OM5A 2EYSA 1WBYB 4R90H 2AK4D 1FVDB 2ZCLH 3TBSA 2VERN 1ETZB 1V7MH 1QR1A 1WIUA 3C6LD 4TPRH 4YHYB 3MRFA 1SJXA 3MGTA 4UT9L 3IJYA 3BHBB 5C3LD 2VLLA 4TUKH 5DD1L 1QBLL 3MLSH 3MGAA 2DTMH 3LD8C 1MH5B 1Z3GH 4X4XB 4HK0A 1MCPH 1JZ3A 3PP4L 5FKAA 4ETQA 2WLYA 3GI8L 1IAKA 4PJHF 4ODHH 3CUPA 3L3GB 5IHUH 1X5FA 1AXIB 4MXVF 3VFRA 3H9YA 2NY7L 2MPAH 1FN4B 4X6DF 4B41A 3MBEA 3AC0A 3B6SA 1OAZL 3HI6L 4M48H 1JRHL 1SJHA 1S9VB 5CD3A 5IBUG 5E94B 4LLQA 2GITB 4NN6C 5LCVL 4DN4H 2FECI 4YDJA 4CGTA 4L3AA 5GHWL 3QHFH 2DLTA 3MMEA 3ZDZF 3HMWL 5EC1B 2UZYB 2BNRA 1FO0A 5AG9A 1P1ZA 1YMMD 2DMCA 1FBIL 1DBML 4S0TD 2HVJB 2VXTL 4JVWA 1U3HA 3W81A 3WXVL 2AJZB 1RJLA 3SBWC 2IC2A 5TGBB 3D0LA 1ADQL 5I8EA 3TO4D 4G8IB 4WNQA 4EQ2A 4JY4A 5E2TL 2FX7H 1I85A 1NLBL 3NPZB 2XWTA 2IAMB 4PJGA 4N0CD 2DBLH 4S1SL 2YKLH 3O4LE 4NQXB 2DKSA 1F4XH 3GMLA 2A38A 1T5WB 2F53D 3SCMA 1EFXA 2NNAA 5D96C 2X4NA 4APQB 3GDBA 2EKSA 1TENA 3RGVA 4LKCA 3VRIB 4OSUL 3JTSB 25C8L 2CDFA 4OZHF 4XBEL 4ZS7H 1X5AA 1IGMH 1CVRA 4OCXH 2ZJSH 1DQQB 1Q0YL 4P5MB 4KI5D 1T83C 3FTGA 4XBPB 1S7SB 3NBNA 1K4CB 3MV9B 3NA4A 1VGKA 3JV6B 4UOW1 2P49B 3QT2A 5FIEA 3ILQC 4D9LL 3INUL 1MJJA 3VD5A 5I17A 1XCQB 2ADGA 4YXLH 1BM3L 2ATKB 2AGJL 1QRNE 5D1ZD 3O6KL 1P84J 3KPPB 2XYCA 3ILPB 5INDA 35C8L 3BN9D 4ZXBA 1S9XA 2UWEB 3F7YA 2EDXA 4FQCL 1FPTL 4QRUA 3SGDH 3NCYS 3ZE0E 1QTYT 3IVKA 4Z7UB 3RDTD 3MRKB 2HJLA 1EEYB 4G43A 2ARJA 2AV7A 3H3PL 4KRPC 2GJZA 4JRYB 4FQJL 1H3VA 1DVFA 4E9LA 3A67H 4LF3A 3LDBC 2JJUA 1PY9A 1CFNB 1QNZL 3U9PL 4DZBB 4GAJH 3T1FB 4Z95H 2VR9A 4PJBB 3WIFB 5F7UA 2DQFA 1U8LB 1N0LA 4KHXL 1HHKA 4G6MH 1INQB 1P4IH 1A64A 1BZ9B 1B2WL 1JPSH 1M7IB 2CLVB 1KCRL 4DFIA 2ERJC 1VACA 1RJYA 2NY5H 2Q86B 1GGBL 1ERNA 1BFOB 4LLVB 1AGEA 1H5BC 4P5TD 3KYNA 4F7TB 5FV2A 3MRNA 5B8CB 4UQ2A 1GCFA 1T0MA 3S4SG 3QO1A 1UCBH 1PKQE 4ZUTB 1XZ0B 1U8NA 3KPQA 4U1JB 3QUMB 5EWIL 4X4ME 4Q9RH 5HPMA 3DGGA 3MNVB 4WVRA 2R69L 3DYOA 3RBGA 4AEIL 1FZJB 2ZKHL 4XGZA 3HZYA 4U1KB 4YHML 1KPVA 5F9JB 3HPLB 3MRJA 3U1SH 4L8CB 4D0DB 4OTXH 1FL3B 4XNXH 1DTUA 4W6WB 4Y1AE 3VFGL 1HOCA 2WIMA 4OCYH 4AG4L 3D85B 1Q9WB 2VAAA 2PO6B 4ODTH 4L3EB 5DK2A 4M6AA 3O0RL 1AO7D 3T0BA 3N85H 2F8OA 4J3TA 3M17B 2QJDA 1NPUA 1GGUA 3WKMH 3IRZA 2B5IC 3MV01 1MAJA 5F6IC 3SDDA 2IALA 3FO1A 2I24N 2YOCA 5TPWL 2BVPB 2YMXH 4MJIA 2EECA 2FRGP 3D3VE 1FLTX 4LCCC 3IDGA 4MJ5A 4WU7B 5KVFL 3VXUA 2F74B 2N7AA 2EXYC 5IK3B 4FXGB 4XNYH 1TLKA 1HEZA 3AY4C 4YDVB 5DJCB 5C0GA 4CVUA 1IC7H 4XNZC 4KWUA 5H2BA 1GJIA 4UINL 4RGND 1DJSA 4MJ6A 4NQCD 1PSKH 4IRZH 5HI3C 4M61A 2ATPA 4YO0B 1X5ZA 1JZ2A 3QA3B 1RVFH 5F7EL 1L6ZA 5D7LE 2IPUG 1YPZA 2Y07L 3IT8D 3EGSA 1FQ9C 4OLXH 3I6LE 1AR1C 3NFNB 1GGCH 1PQZA 3ARYA 3OR7A 4LSQL 3ARRA 1BJMA 1MY7A 5CGTA 1QP1A 2IBZX 3RNQB 3GMQA 5FGCB 1EGJH 2IFGA 3LZFH 4R6UA 3EZJB 4K3EH 5GSVA 3VI4F 1MI5D 5JOPE 2FO1A 2Z9TA 1FGVL 2H2SC 3BZFB 3V0VB 4IS6A 3S3JA 3UTQA 4R3SB 1BQLH 1NCWL 2HT3D 5DRNA 1SMAA 2FH6A 4NRYA 3MJGX 4UIMA 1KG0B 3DNKA 1PAMA 4HFWB 1Q1JL 1Q72H 4PJEA 1A7NH 3BKJH 3FN0L 3R06A 3DWTA 3E6FA 5IBLD 4GS7C 1DSFH 1JJUA 3QIWC 4UU9A 4YIQB 3P3YA 4X9GA 5EA0H 2A9ML 4TUOB 4N8VB 3BOVA 1ZS8A 1MRDH 4WI4A 5T1MA 4HV8A 3SGKC 3NZHL 3HR5B 4I0PD 3RNKA 4KK8D 5ALBL 4M1GH 1L4IA 1V3JA 2ZOKB 4JZJA 2DBJA 4FQIL 5ADOL 4ZTPH 4WUUA 5A3IC 1S3KH 3HC0B 1NAKH 4PTTB 5E4IA 3QIBB 3L7FA 4ZUVA 1PEWA 3E3QC 4IJ3B 1NMBL 1I7ZB 2IQ9L 1KTKE 3N1PC 5D2NE 4CADB 1KCKA 2OX5A 1K9TA 3LEXB 5CS7A 1I3RB 3IJSB 3JV0A 3KLHD 3C5ZA 3OF6D 3KDMB 4TQEL 4ZO7A 4NM4L 2OR9L 5T1DH 2EC9T 2HA1A 2HKFH 3O4LD 3QDGA 4KMTH 4PJFF 1ZANH 3TBWB 1A14L 4QOKE 1MIML 1RK0B 4X5WB 4YHZH 1OSZA 2HVKA 4OUUB 3MOAH 2HFGL 5CEZD 4Y16C 5ACZA 2FIRT 5J11B 5F7WC 1EHLH 2A2QT 3T65B 3QEGH 1VA9A 2H2PD 3VG9B 1QKZH 1PGRB 2WIIB 1HHHA 5HGDA 4R4ND 1F8TL 1G7PB 1T6WA 5BV7C 1RAMA 1A6AA 3H9HA 2NY3D 2VDRL 2BOCB 4QHNB 5GRUH 1RUQH 4NKDB 1A4JB 3F65A 1C08A 4DKEL 1AGFB 1JE6A 3IF1B 2QKIB 4KJPC 4MLSA 5CGYD 3QFJE 2YXMA 2IH1B 4PGBA 1X5GA 3RPIA 4O58L 1QRND 2X5PA 5EBMB 1N2RB 2QEJA 4NQVA 4LSVL 1MY5A 4YLQT 2DQDL 1CN4A 3VJ6A 3WHXB 1LO5A 1UA6H 3MREB 4AIOA 3ECBB 3X3FL 4X0KA 4LGRB 1ZA6A 1CDGA 5F6HI 2AXFA 3ULVE 1NGWA 3C6LC 5C08A 3BEWB 4MXVE 4OT1L 5I9QC 3FT3B 1I8IB 4NQED 5IBUB 4HUUA 4GMSL 1RIUL 1PX4A 3HFMH 5C3TA 2OQJB 4GT7A 5IV2B 4YEEA 1QBML 4LU5L 4HZLB 3S88H 1FVEA 5I15H 2B20A 4R0LA 2DYPB 3NTCH 5DJYA 5ALCL 1EAPA 3BKML 3RU8H 3BUTA 4U3CA 4XRCB 1KJMB 4EJ1C 3GIVA 4DAGL 3DXAB 4F33A 2J8UE 2N1KA 3CSYA 3MLRH 5HTSA 4OM0L 1G9NH 3BGMA 5EFIA 1CL7I 3RHWK 4CU7A 1D5XB 1MVUB 3MV7D 3PXHA 4PRHB 4R4BA 1IQWL 3GHBH 1KYOJ 3C8DA 3OAZK 3K80A 4FFYH 4LSPL 1G9EA 2Y23A 1ZHLA 3JBG7 4NWTL 3GNMH 4NBYB 3O3AB 1CU4L 1YEFL 4DKDC 4L8DB 5IQ7L 1HCFX 1T80A 4GKSB 1HKLH 3EOAB 3QYCA 5TFSH 2VXUL 3SQBA 3TO4C 3CXHK 2R0WL 4OZ4A 3BWAB 2IQAB 4WO4D 3SDYL 2R23B 3QG7L 1EPFA 2C1OB 1HH6A 4XPTL 4N0CC 4M6MH 1X4YA 1NGQL 5JPMA 4Y1AD 5EU3A 4OZHE 4EDWH 5D71L 1IAII 2I5YL 1CGUA 2V6HA 4CDGC 3ZTNL 4ZNCD 5FM8A 5JUEL 4HK3N 1J1XL 1BEYL 4N0UB 1BMGA 5I1KL 1XGTB 1HWGB 3EYVA 3KS0J 4JO1H 1DUZA 4N1HB 2GTWA 4PJ5E 4PLKD 1UYWH 1J1OH 2A6KB 4RRPG 3I3EA 1EUUA 3GSQB 5DRXB 2E7CA 4KUZH 4ZO8A 5KVGH 4MA3B 4RAVA 2OMBA 3SDXA 4KI5C 3PJSB 2PCPA 1JYWA 5C0CA 2CKNA 4XVTL 3I85A 4JLRB 2HFFA 3LB6D 4RDQF 4ODUB 1JPTL 1CZ8L 4GFTB 4PTUA 4WDIA 5FF6B 3UPRA 1F6LL 1OAXL 2NY6D 3G6JB 4FXKA 4GRMA 1ZLVH 2NTSP 3RUGA 3V6OE 3HI1B 4K71B 4X99B 4FA8A 5IIEA 1KSRA 2VH5L 2EDEA 3O2WL 1ZV5A 1J5OL 1TXKA 2O5YL 3KJ6L 4RMSA 3RDTC 5D7LD 3KVQA 2B2XL 3QUZA 5IB5B 3FOMA 2KUTA 1YEEL 4QHLB 4Y4KD 5FO8B 4PJDE 1KN2L 3BVNA 5FUCE 1F58H 3PP3H 1P6FA 1EJOH 4I48B 4KJQD 3S4SB 4ZO6A 1DUYA 4GG8B 5GJTH 3BE1L 1FO0H 2A74A 3X12A 1N7MH 4XCYB 5FGBA 4ODBD 1FFNA 3M1BB 2OLDA 2N56A 5T3ZE 1MHHA 4AQOA 4LCIH 4XP4L 3FFDB 4Y2DA 4IOFD 3BESR 2VKWA 3EYQD 1NCDH 3VI3F 3MZTA 2HJFB 1BECA 1TJIH 1A1NB 3B9KB 3O8XD 3K4DA 3WFBL 2ZWLT 4LCUA 1OP9A 3BQUA 5D70H 4P5TC 1CL7H 1NC4A 2Q76A 1LO4L 2RCSL 3BX7C 3PWJB 3W2DL 4PJ8A 5IFAH 3LEYL 4PBVC 1D3CA 2L7UA 4LIQH 1WZKA 3RWHB 4K7FA 5GGRA 2YRZA 5IVXF 1IGJA 4KI1A 1CD9B 5ANMB 3V6ZA 3BYYA 4UILL 3SO3C 4XPHL 5E00A 5DMKB 4KFZC 1ZHBA 3G5VA 3ZE1F 5EORL 5DD0H 4XMKL 3OZ9H 4PB9H 1Y0LB 1BOYA 5E9DB 4DTGL 5GGQH 1GGIH 3STLA 3VXNB 2P42B 4E41E 1IAIH 4DK3A 4P9ML 2X44D 3ALXA 2EDWA 5KVDL 1F4WH 3CFCL 1U8IB 3Q2CA 2GHWB 3DX6B 3QXTA 5FA4B 3TIDA 1QSFA 1KB5A 1NCBH 3Q6GL 4JFDD 1YZZA 1XGRA 2V5YA 3MQIA 4JPKH 3D2UD 4NO3B 3FQWB 4DUVA 4WRLA 1F02I 3FOLA 3N50A 1JHTB 5E2WH 4YWGL 5DJAA 1XH3A 3O3BA 3TYGH 5KSBB 2GAZA 1WZ1H 1RHFA 1U92A 3DUSA 4RWHA 1IT9H 1J1PL 1AE6H 3KXFB 1SYSB 3WD5H 5I19H 2ZUSA 3J7HA 1RZFL 3CJJA 3KLDA 5ESQA 3GSXA 4RGNC 2NR6D 5JW4Q 5KSAD 3V52H 1Q94B 4ZSOB 2IFFL 3QCUL 3ZDXE 3UYRH 4MXWH 3AS3A 1CGSH 4OBSA 3HG1E 4KAQL 5IVOA 1KEMH 1A6UL 4U6TA 1JHKL 3TCXA 5LKNA 3ULVD 4MSWB 1KNOA 2P5WE 1A7RL 3CSBA 4JFPB 5DRWB 1S7XB 3IFPA 4IMKA 4P3DB 1T1WB 3B5HA 2CSPA 3SQOL 3TEUA 3VD7A 4ALAH 4BH8A 4N0FA 4XX1E 4F7MA 1GC1C 4F57L 4L3CB 5GS0D 4L29A 2XV6B 4PJ7B 1MWAL 1MFEL 3MLXH 2XN9E 3ULVL 4MWFA 1TMCB 1OD9A 2HT3C 5C7XL 3LKSB 3BDYL 3T0WA 4MAUL 1A2YA 4IMLA 2ZG2A 2NY4B 4CNIB 5IBLC 1SEBA 2ZOLA 1BPVA 5GRWA 3RX5A 2BNQE 4ELMF 3PNWA 5E6IA 5GS0L 3K4ZA 4B5EA 1S7WA 1MCJA 1UQSB 1VGEL 1NGPH 5D6CA 4AEEA 3CXDL 2Y5TA 5EOQH 5EUKA 1IAOA 4XT1C 1NFKA 3IETB 3ARSA 4RGOH 3GSUA 4I0PC 3RWCB 4KK8C 4MMZC 3VMOA 3VXQB 5L2KB 4PRBB 1BZQK 5HI4D 4Y8DC 5ISZB 4W81A 4D9RD 5I1DA 2UYLA 2V7NA 5IJKC 3MRMA 5GJSL 1LO3H 5DQ9B 3BZEB 1OM3H 2ITDB 3WFHA 5BXFB 2R0KH 1LEKA 5C09B 4TSBH 4KJWD 3KLHC 4OM1L 5GGSA 3RKDD 1DLHA 5BVJA 3MR9A 1UB5A 4AQ1B 3QWOA 5HDBE 4OLEA 5HHPB 2EDHA 1DE4A 2IPKA 3H9SB 3L5HA 1X5YA 2BHZA 3WEXA 5L6YL 2VDQL 4R26H 4WFFE 2DDQL 4KJYA 4U6XA 4F9LA 2PXYB 3V5KB 3C5JB 3QAZC 1F6AA 1QBLH 2FL5B 2IF7A 1FG2A 1WBZA 2H2PC 2NTFB 3DVIA 3ZYZA 4Z7VA 1DBBH 15C8L 4JFYB 4G7YH 3CLEH 4LK4A 5SX4I 4OBRA 2DKMA 3PP4H 4R4NC 2GCYB 1A6WL 1OW0C 1E28A 4DW2L 4ZOEA 1RZJH 2P4AB 4BH7A 2NY3C 2A83B 2GKIA 1E4WL 4GQPH 4CN6A 5A2KH 1NAML 5TE4L 1J0YA 4DCQB 4R97B 3L95A 4G6FB 1T22B 1P4BL 1JNLL 2A77H 3OAUL 3PWPE 5ECJE 5CGYC 3BJLA 2AJYL 4QO1A 3CH8A 3SY0B 4RMTA 3WIIL 3REWB 3WUWB 5L88H 5IB1B 2I60H 5F1SA 1D9KA 2IPUK 3TM6A 4IBLT 4K94C 2C26A 4AEHL 1DFBL 1QSEB 3NH7H 1NBYA 4OGXL 3IKCB 1S7QA 2VXTH 1C5BH 2VRAA 4WJ5A 1PZ5A 4R7DA 5GS2D 1MFDL 3MRQB 2FR4B 1YYML 3CH1A 3B9DA 4LVHC 3EFDH 1I9IL 3QDJA 4G6JH 2OSLB 2ID5A 3EO1B 2KKQA 1G6RL 2D7NA 4JM2D 3HRPA 4JZOA 4YFDB 3VFVA 1RJZB 5FDWA 4Z18A 1A9BA 2CIKB 2GQHA 1UGNA 1M05A 1A1MA 1CLYL 4HK3J 5MHSE 5AWNL 3CZFB 1LNUA 4BZ1H 4I18C 3QCTL 4BA8A 1SHMA 4PR5A 2R8SL 5FYJU 5I18H 4KTEH 1OP5K 2X4UB 4L4TD 3V5HA 5AUMB 2E9JA 3TYFA 1H0DA 2CXKA 4PJAB 3BP7B 1EO5A 3PGCA 1UWXH 4PPTA 2OJEB 2FB4L 2DD8L 3O6FA 5T3ZL 4LEXH 1F42A 5D72H 3WXWH 2RAMA 4D9QD 1FE8H 3LPGA 3C6SB 5GRXG 3TN0D 1X5HA 1MFBH 1JV5A 2BVTA 4ETYA 2AEQH 5D5MF 4D9LH 1PG7X 3KPTA 3P11H 2IG2H 1IVLA 3DO7A 4ZAKB 3U0WH 1PG7H 1QSZA 1EDQA 3EJJX 4WO4C 3OKLB 3AMLA 3KPLA 1U93A 3EBAA 35C8H 5CCKL 1G7LB 4AM0A 4GRLB 1FZKB 4RWYL 2NW3A 4JAMB 4JB9L 5J57B 1ZGLB 2CK0H 2Z8RA 3STBA 4HC1A 3F7RA 1L9NA 1N3NA 3EO9L 4QOKA 4UNUA 1QD0A 4JFFB 4RX4A 2B1AL 1JZ6A 1QO3B 2VIRA 3VXSB 3S9DB 1TETH 1U58A 4PLKC 3MNWA 3CVHL 2IH3A 3G9AB 3TJHD 4Z7UF 2PYEA 2QHLA 4WFEE 1A3LL 4FQXB 3HPJB 5SX4H 3JVGC 1E4XI 4JANB 2L0DA 5D1XD 1DN0A 5AG8A 2QSCH 1F4YH 5EZOH 1WEJH 2B4CL 5GS1C 1SVZA 2CLZB 5HYFA 4PJ9B 4G8GB 3FB8B 2VDOH 3CFKA 1P5UA 2NY6C 1OAKH 3M45A 2XY2A 5AYUL 3WO4C 5I8OL 1ZT1A 5EC2B 2EH7H 4NP4H 5BW7A 1NFDF 1GGBH 3B8SA 3LRSB 3LKOB 5HI5D 2OYPA 4JKPL 4U1LB 5DC4B 4PLOB 2P8LB 4PJHA 3MLWL 2Z35A 3HG1D 4Y4KC 4OQTA 4ODVH 1KT2A 3BSZL 3BT2L 1C8PA 4IDJL 2HKHH 2P5WD 2PR4L 2XZAL 1KTDB 4X6DA 1HINL 4OZIB 4MAYB 5DSCB 2R69H 2AJ3B 3QXDB 4HPOL 4YAQA 2C3XA 4KJQC 3QZWA 2GSIB 3JV5A 3JWOC 4AG4H 3H9ZA 4NHCH 3LCYA 2XOTA 1OLLA 4I1NB 3P4LA 4IOFC 4Z7QE 2M26A 3LY6A 2X89D 4OCWL 4N9OB 5AZEH 3H8NA 1M7DB 4H26B 4HGMA 4WWKA 3O8XC 1W8OA 2BNQD 2OZ4A 5CSGA 3VFNB 3G6DH 1WQVT 3P4MA 1QEWB 4KHTH 1F3JA 1O7VA 1WT5C 4NKQB 3CX5J 1G7QA 4LHJB 4UQ3B 3T77A 2VDKL 1CICB 4JFEE 5K59F 3ESVF 4KVNL 2EYSB 3BGFC 1INDH 3TBSB 5EZJA 5I73C 4NZTL 5C07A 4JZNA 1QR1B 3UPAA 3MRFB 4ZOAA 3O11A 5KJRL 3MGTB 3W0WA 3IJYB 4XMPL 5HYSA 1DQMH 2VLLB 1N4XL 3VFSA 1J8HD 3VXRD 1XFPA 1UB6A 4TULH 4RFNC 1DEEA 4HK0B 2Z31D 5HGBA 3LOWA 5FKAB 4ETQB 1SEQL 1IAKB 1EXUA 4YHLL 2V2WA 3RTQD 1TVHA 4OZHA 3GO1L 3CUPB 3VFRB 4P3CL 1LO0L 3SDAD 4WEBH 3MBEB 1AGDA 1CIDA 3B6SB 4WFFD 3ARGD 2YHGA 1SJHB 3GSOA 5CD3B 3Q5OA 4GKOA 5JW4R 3WNMA 4K07A 4LLQB 3M07A 1RZ7L 4YDJB 2WANA 1ZKAA 5TE7L 3MMEB 3JSSA 1FGVH 4HHAA 3T8XA 1CXFA 2BNRB 1FO0B 4JPWL 1P1ZB 4JEGB 1U3HB 2FD6L 1RJLB 5CSZA 4AJ0A 1K6QL 1UJ3C 3PWPD 4XAKE 3D0LB 5I8EB 2NR6C 4WNQB 1T04A 1R0AH 5KSAC 2VXVL 4JY4B 1NCAL 5D93B 2XWTB 3D39D 4PJGB 5JXAL 2WUCL 3U36A 1W0VA 4NZRL 4G9FE 5LQBH 3AXLA 3ULVC 3GJFA 5FCUL 3BKCL 1LDPL 3GMLB 1CD0A 3SCMB 3LKPA 1EFXB 3SHSA 3QQ9D 3ULUF 4GRWH 5F1IA 2NNAB 1LGVA 3TZVD 1HQRA 5CD5C 2XNAA 3IFLH 5AYQA 2N7BA 3CK0L 2X4NB 2EKSB 3RGVB 3DJ9A 2R2BA 4ELME 5GS0C 4U6HA 4LKCB 5GS3A 3FKUS 2A6IA 2HWZH 2CDFB 1TTFA 4NM4H 3WDHA 1J10A 5MHSD 4UI2A 4JQVA 3FTGB 2NXZB 2VQ1A 1BREA 5J6HA 2UY6A 4GW1B 1VGKB 3QWRA 1A4KA 3UROR 1UWGL 2QSVA 4EI5A 2R29L 1SMOA 1LEGA 1MJJB 1FZOA 5I17B 1D5MA 2ADGB 5C0RH 3OKMA 1R24A 3MA9H 4TOYH 3BN3B 5INDB 5JA8B 4GXUN 4ZXBB 4JJHA 1S9XB 5E8OA 1T66D 3MLZH 3F7YB 4LRNH 4QRUB 4X7EC 4X5XA 1AGBA 4HGWA 2VDRH 1M1SA 3IVKB 5HI4C 4JR9L 5J13B 1PBYA 2HJLB 1MHCA 4G43B 3WN5A 1SBBA 1YJDL 2ARJB 2AV7B 2GJZB 5GGUA 2BJMH 4UTAH 3Q5YA 4F58H 2LU4A 5EU6E 1DVFB 2WBWB 1F2XK 3FO0H 4KJWC 1CFTA 3QHTC 4LF3B 5GRJH 1H8NA 1KB5H 1CR9H 3RKDC 1OARH 2BK8A 2GK0A 5F7LB 3AMKA 3U7YH 1XF2A 4X6FA 1VEPA 3V7AE 4F15B 3OAYK 3QI9A 4NHUA 5CKAA 1LE5A 4I13B 1MNUL 1ZWIA 1BJ1J 4XC3H 2DQFB 2EDDA 2OR8A 5H94A 4BQBA 1VCAA 3QJFA 3NA9L 2L4OA 1HHKB 3F8UB 4C55A 1WCBA 4XVSH 4LCCA 5D9SA 2QQLL 2ZPKH 3OV6A 2KL6A 1VACB 1RJYB 5EU5A 4FN0A 1AGEB 3O41A 4L9LC 3GKWH 3MRNB 4UQ2B 3C60A 4N1EA 1T0MB 3QO1B 1KJ3H 5ERWA 1RY7B 4MNQA 1U8NB 4F9PA 3KPQB 4P2RA 4U6YA 5FYKE 3NFPA 1FZMA 4PIRF 2CO6B 5HPMB 3DGGB 2CUMA 4OM0H 1NJ9A 2XKUA 2PF6A 3CX2A 1C7SA 3EYSH 5CUSL 4JG0L 4XGZB 3HZYB 5FK9A 2E3VA 1IQWH 2BSSA 3MRJB 3V6OC 1RURH 3PP3K 4KDTA 5HYIA 2IADA 2QQQA 5JNYA 3ARBA 1HOCB 5BO1H 2VAAB 2HH0H 3GBML 3IGAA 1JF1A 4S1RH 1JZ4A 5DK2B 5D7JA 2JKXA 3L5XL 1UACH 4YQXH 5DJZA 3LS5L 1UZ6F 5IMOA 3LN4A 2JJTC 4FP8H 4Z8FH 1NL0H 1A6TA 4FFZH 4JM2C 3A6CH 3SDDB 4WTZG 5IHZA 2IALB 3QIWA 3FO1B 2JLLA 5C0AA 1NGQH 2OS7A 4MJIB 2I5YH 3BW9A 2EE6A 1G7HA 3IDGB 4MJ5B 3VXUB 4BSVA 1GIGH 2V17L 3SGKA 4NC1E 1T2XA 3TP4A 4Z78A 4NKOA 1HEZB 2VDPH 5C0GB 4JFHE 5BMFL 5JQ6L 3CPLA 4H8WL 3T2NH 5H2BB 4MJ6B 4ELKA 2VJXA 1LWRA 4M61B 4U1GB 2FDBP 2D9CA 2ATPB 2D0FA 2ORBL 3CGTA 1V7NL 4ZTOH 4KY1H 4Y19D 1OGAA 1YPZB 3MV9E 5LGKA 3TN0C 3EGSB 4PJFA 4WFHE 2R56L 3G6AA 4E5XA 1IGFL 1PQZB 3OR7B 2BNUA 5CJ5A 3AB0C 1IBGL 4HAFA 1EBPA 2R0LH 3GMQB 3T3MF 4LCWD 2X09A 1KIUA 1T1ZA 4Y5XC 5GSVB 4TYUA 3RY6C 2DQIL 3KYOA 4HAGA 4V1DE 2UWEE 4Y16A 4JHBA 4M7JL 3GIZL 1IL1A 4Z7UE 2VH5H 2VZTA 4IS6B 3UTQB 3VFMA 1EO8H 3GRWA 2A6DA 3HZVA 3O9WA 4P2OC 5DRNB 3ARFA 4UDTA 4MJ2A 1ZSDA 3IDXL 4JRYE 4NRYB 2XKSA 4UIMB 2PW2A 2B4CC 3PWLA 4PJEB 5TE6L 3R06B 4H88L 3E6FB 2E8ZA 4K23H 3AU1A 5CP3A 4L4VA 1MHEA 5C71A 4UU9B 3VD3A 3O2DL 4EIGB 3BMWA 1IM9D 4KPHH 3MXWH 1JIBA 5A16A 3TJHC 1ZS8B 5B38A 5BJTA 5T1MB 4HV8B 3UO1H 4PJBE 5D1XC 4K7PL 3VW3H 3RNKB 4GW4A 4BZYA 3UJIL 5JW3L 4JZJB 2X4RA 4WUUB 3NGBB 4JHAH 2GEEA 3T3PF 1MPAH 1A7PH 4O4YL 4ZUVB 5TDNA 1N26A 1N8ZA 1GHFL 5CEYA 4XAKD 4UOJA 4WI8A 4C57C 6CGTA 5KAQG 1MF2H 3C6LA 2P8MA 3TA3C 2Y4SA 1FLRH 1FAIL 5CMAA 5FFLA 1KELL 3C5ZB 5ILTL 3B83A 3CZJA 2Y1VA 5HI5C 4P59H 4RAHA 3QDGB 4NNXA 5CBEA 3K8MA 1OSZB 2HVKB 3NCJH 2VOTA 5ACZB 1TJHH 5CSBA 4LPUA 1R5WA 3QBTB 1HHHB 4NJ9L 1MCWM 5HGDB 5JXED 5H8DA 1Z0NA 2P5EA 4OLVL 3KG5A 1A6AB 3H9HB 1YY9D 3JUYA 1NEZA 2F15A 3ROOA 2W9EH 2J88L 1AH1A 5DVMA 2FGZA 1KENL 3KS0H 1C08B 4Q9QH 5B22A 5FUOL 1MVFA 3DUHA 1YMMA 3EDDA 1VEOA 4PGBB 3RPIB 3CFCH 3SE3A 4NQVB 5JHLL 1AC6A 1FIGH 3VJ6B 1GVIA 1LO5B 4HC1H 4X0KB 1ZA6B 5A2JH 2AXFB 2OTPA 1NGWB 5C08B 5JOEA 3VGHA 3WS6A 4HUUB 3PGDA 3DECA 5EU6D 2VXSH 3QUYA 2APTA 5JIKA 4HBCH 4OD3H 3S5LG 1BFVH 2Z31C 1EHAA 5KSVA 4GO6B 4NN7C 1FRGL 1T6VN 1FVEB 3FJTA 1NKRA 1Q9LA 4Q58C 4R0LB 1GZQA 3RTQC 5DJYB 1C12A 2VLKA 2ZZUT 3CD4A 1EAPB 3GBNL 4PY7A 1A7QH 3V7MA 1JZ8A 3SDAC 3I9GH 2MSPA 3GIVB 1AY1H 3FRPA 3ARGC 2QQNH 3CSYB 4F33B 1X44A 3VXME 4ZYKA 3BGMB 5EFIB 5HVHB 4NYLA 5F97E 4R4BB 4JPVH 4DGIH 3CFDA 1ZHLB 4MXQD 3TESA 5D1ZA 4OQTH 1EO7A 3ZKXB 2X6MA 5C0BD 2XICA 2WWMD 4YBLB 3MJ6A 4NJAH 1U9KA 2OXGA 4UIKL 5DMIH 5KVMC 4O2CA 3ULUE 1JI1A 3PDDA 3GSVA 1K85A 4OZ4B 3WS3A 4UAOB 1VGEH 3BAEL 1HH6B 5ID1A 4H0IA 5F96H 5JPMB 5EU3B 4U7KA 5DHYA 4JRXE 4U6VL 4YDIH 2VLJD 1DBKL 1NGYA 3QQ9C 4LEOA 3TZVC 3ARDA 2OZ4H 4L8BA 4LLDA 3EYVB 1DUZB 1TCMA 4C54A 2GTWB 1PLGL 1IKNC 2IAMD 1DDHA 4QHMA 2BY2A 3IU4H 4OGYL 4RAVB 1F6FB 1UWXK 3SDXB 4DWHA 4QF1A 4YH6A 4LPVA 1G9MC 2PCPB 3K81A 4P5TA 2JJSC 5C0CB 2HFFB 2VDMH 3VWKA 1BOGA 1YJDC 5F7HA 5IVXA 1TQCB 4PTUB 4WDIB 3UPRB 4FXKB 1JWSA 2XTLA 4GRMB 3T4AA 4U0RC 3RUGB 3L3JA 1T1XA 5JIIA 1P5VA 1T66C 4X8XA 2Z0BA 5EIVA 4OLZH 5IIEB 4HX1A 1E6OL 1CE6A 2OI9C 4X7TA 4DN3L 4K2UH 3QUZB 4RZCA 1HHJA 3FOMB 1A5FL 4WFHD 2AJUH 1I9RL 3F12A 4X6CF 1I8LC 3BVNB 5DJ8A 1T1YA 4R96A 3GMRA 1VSCA 2RFXA 1FSKC 5I0ZA 1HIML 1BBDL 2H6PA 1DUYB 1I3GL 2G5BA 3DYPA 1TZGL 2A74B 3X12B 1AQKL 3NPSB 4BZ2L 1FFNB 2BERA 4NZDA 1MHHB 2BX5A 3MLYH 5F7DA 4Y2DB 1LP9F 1QFUH 2FHCA 1W0WA 4HKJA 3WNLA 3HN3A 5CZVH 4GRWB 3MA7A 1ND0A 5GGVH 4LCUB 1ZT4A 4KTDL 3BQUB 1N64L 4PY8I 2BMKB 4FZEH 4OCRL 1NC4B 1FNSH 1RHHA 2Q76B 4PJ8B 4LQFH 3D9AL 3GJFH 4JO4L 3DXAE 1MCRA 1XGQA 5DD5H 1UC6A 3UEZA 3THML 4K7FB 5GGRB 1CLZL 1IGJB 3MLVL 3BP6A 2DQEL 3V6ZB 5E00B 1DEDA 3OX8A 3O3EA 5FYJD 4NKIH 1ZHBB 3G5VB 1YECH 5ID0A 5F7MC 3RX8A 5EN2A 3STLB 4JN1L 1CF8H 1DP0A 3K2UL 4UT6H 5CLWA 4Q0XL 2O61A 4YK4C 1AC0A 5FYJL 3OKEA 3Q5TA 4H8WC 2OCFD 5DGRA 5HYSG 1IARB 2B1HL 1RZKH 3TIDB 3GZKA 1QSFB 3ESUF 1KB5B 2AABL 3C5SA 3QUML 1XGRB 2PO6D 2P47B 1D5IH 4L3ED 3FOLB 4M6OL 2XQBH 2VNCA 2QADB 5DJAB 5DEZA 3ZDYF 1XH3B 3O3BB 5E99H 4N0UE 2GAZB 1U92B 3DUSB 1ORSA 5GGTA 5F7KC 5DZLA 1BFTA 4R8WH 5ESQB 1GOGA 3S7GA 3GSXB 4HMEA 3RFZC 3LSOA 1P84K 2J8HA 4M5YL 1VESA 3CVHH 3T3ME 5IJKA 4HFUH 3WHE0 5KSUA 1U3ZA 1X9QA 3IDMA 2VUOA 1EHXA 3LHPH 4HWZA 1CD8A 4AIZA 4UV7H 4OCSL 2ITCA 4XCCL 4XXDA 4D2NA 2VN4A 1IFHL 4UT7L 5E1AA 3MLUH 2Q1EA 1KNOB 4J8RA 5MI0C 1V05A 3G6JE 1YEHH 5DJ0A 4Z7NE 3IFPB 4RGMC 4YXHH 4BH8B 4N0FB 4DEPB 4F7MB 4F37K 3MRPA 4L29B 2H1PH 4GXVL 5IGXH 4UZGA 4MWFB 2OP4H 4XP1L 1EV2E 3MLWH 3PDGA 5LWYH 4JFQA 1NMCB 1SY6L 2Z8SA 3BT2H 1A2YB 4IMLB 1YDPA 3EOBA 3HE7A 3T3PE 1SEBB 4G7VL 1JTTA 2ZOLB 4OF3A 2XRAH 1BP3B 4M7KH 5D8JH 3PNWB 3OWEA 4HPOH 4AMKL 5E6IB 1S7WB 1L6XA 5D6CB 5FV1L 2Y5TB 5EUKB 1IAOB 5I1HL 1HYRC 1NCCL 1UM6L 3ZTJG 3GSUB 5CJQL 5J1TC 3RAJL 5HVFB 1ZGLM 3P40A 4H1LA 4URTB 3FFCD 3S3SA 3PWUA 1WV7T 5I1DB 4KQ4H 1F00I 2UYLB 2V7NB 3EYUH 3MRMB 5EZIL 5E03A 3WFHB 4ERSL 1KCSL 2VL5A 1LEKB 5MENE 1EHNA 2WBJA 4Z76A 5GGSB 1DLHB 5BVJB 4NQSA 2XTJB 5C6TL 3MR9B 1UB5B 1KBGL 3QWOB 2GT9A 2Y72A 2N4IA 4KVNH 2EIBA 5I2IA 2FJHA 1DE4B 2IPKB 4NZTH 4CRPA 3BRDA 3WEXB 1CLOL 2D03H 1QG3A 5ANME 3ULUL 1MRFH 4KJYB 1CXKA 3QDME 4U6XB 3O6MH 1J11A 1F6AB 4J4PD 5DUMH 4POZD 1ZLSH 4XVUD 1FG2B 1WBZB 4ZFGL 5IFHH 3DV6A 4Z7VB 2EEDA 1K2DA 4ZQKA 2DQUH 4MS8D 4ZPTA 1I7UA 5JXEC 5E9DE 4DVBA 5ADPH 1PY4A 2ZUXA 1E28B 2P1YA 3DVNA 3MV7A 5C0FA 1WFNA 5K9JL 2QR0A 4BH7B 3TWCL 4A6YA 1NBZA 1YY9C 1TIUA 1AQDA 3L95B 4R9HA 2V2TA 5JO5A 4L4JA 3ZT7A 5D5MA 1FH5L 4JO3L 4G9DA 4PG2A 2F58L 4TSCL 5I1GL 1D9KB 4QHKJ 5HDLA 3GRWH 1KGCE 3BKYL 2BDNL 4NUGH 5KSBE 4OQ1A 5DUPL 1NBYB 3FAWA 1S7QB 3KXFE 2IANA 4P0DA 3BPNB 4WJ5B 1PZ5B 4R7DB 5CP3H 4YPJA 1KJ2A 3GK8H 1DBJH 5EIQA 2DQGL 1K6QH 3CH1B 3QDJB 4NWUL 5J89A 2GJ6D 4UTBH 1NC2A 4ZSOE 1CTOA 1NLDH 1NCAH 1U3YA 4JZOB 3VFVB 1B4JH 4V1DA 4YGAB 1A9BB 1HXMA 4HSQA 4NIKB 1M05B 1A1MB 2CRIA 1AI1L 5TDOA 4YHYC 2EH8L 5KTEH 1LNUB 1A7OL 3D0VA 4PR5B 1T7VA 1S9YA 3HI5H 4Y8AA 4P9HL 4EN3A 3V5HB 3O2VL 4GAGH 1H0DB 2BRRH 3TYFB 5EOCL 3CK0H 3SE4C 5F1OB 2E7BA 3TPUA 3OJ2C 4PJ7E 2OMNA 3PGCB 4LASL 4MXQC 4LVOB 1NFDA 2QHRH 3GI9H 1IJ9A 3L5IA 1K3ZA 1MCOH 3O6FB 3Q6FA 3DXAD 3OPZH 1MREL 2WWMC 2NXYD 4LBEA 1JV5B 3V2AR 4TUJA 2VDLL 5D7SH 3DO7B 4PRHD 1QPPA 5D2NB 2ZUQB 1U8OA 1YEKH 2MTPA 5B21A 3KPLB 1U93B 4GSDL 4JKKA 1XR9A 4AM0B 2NW3B 5L2KE 3MRLA 5ISZE 4YX2H 1JMZA 4MZ2A 2JB5L 2ICEA 1RJCA 1CVSC 1N3NB 4KRNA 4QOKB 4JE4B 1EERB 1WWCA 3OQ3B 5C09E 2W59A 1KTRL 1X3DA 4ZNEE 3LMJL 4LVNB 2VIRB 4MA1B 4NN5B 4OB5L 4M62L 1A0QL 1U58B 4EI6A 3MNWB 2IAMC 2IH3B 4WI6A 3P73A 5E8DL 2PYEB 1OLZA 3H0TA 1U0QA 4C56D 2DQTH 1MCNA 3H9SE 3MACL 4POUB 1DN0B 5EU4A 4NQTA 5HHVH 2E7LC 1WT5A 4IDLA 2YPLA 2YUWA 4NC1C 2DKUA 4X6CE 1VFBA 3CFKB 4EIZC 4M8VA 5HHOD 5AZ2L 4M7LT 1I7TA 5BRZE 2EDYA 3CIQA 2BY1A 3SE8H 2DIBA 3RWEA 1ZT1B 1X6LA 1VPOL 1LMKA 5E70A 1SM3L 3OKOA 3K1KC 4YXKH 1KLUA 5ITFA 5MP6H 2KDGA 4R90L 4PJHB 5B38G 1V7ML 1OT1A 2Z35B 4J3OC 4TPRL 1KT2B 2X05A 2EXWD 5FHBH 3DBXA 2CR6A 2HMID 4TUKL 3UTSA 4XPBH 2DIJA 4D0CA 3MLSL 4X6DB 4Y4HA 3MO1A 2DTML 4J3WA 1JYVA 1IAIM 1Z3GL 4YAQB 4E0RA 1MCPL 2C7UA 4I3RH 3QZWB 4M3KB 4HKZA 4ODHL 1FHGA 1K3IA 4YFEA 2LVEA 1TTGA 1J9CT 1UH4A 4NN6B 2JJVA 2MPAL 1QFWI 4JFDA 3QNZA 4M48L 4NCDA 2NY2B 3D2UA 4YHIA 3R1GH 3VXMA 2FWOB 4WWKB 1RQ5A 1ZXQA 4DN4L 1DQLH 5FM5O 3CMGA 4HUWA 4XP6H 3P4MB 3CDGA 1KYOK 4M8QA 1F3JB 1D5BA 3QHFL 1MCSA 3ABZA 1G7QB 3TNNA 3T77B 2ADJA 5HGAA 3BPCA 5KSAA 2C3WA 5EZJB 4YFLF 5C07B 4OF8A 4JZNB 4HIXH 3O11B 2Y9RT 1NEZG 3W0WB 3K4AA 3B9KD 5HYSB 3BO8A 3BPLC 4PJAE 3VFSB 5HYQA 2QSQA 1UB6B 3SOBH 1NBQA 2FX7L 1DEEB 4F80A 5HGBB 4AENA 5B8CC 2DBLL 4MYWB 5MEOA 1SBSL 2YKLL 1EXUB 2V2WB 5GISH 3SJVE 1IGIH 5J06A 1TVHB 1F4XL 1MCCA 4OZHB 3SKMA 4JRXA 2IMMA 1NH6A 4C4KO 5DRZA 1AGDB 4JY5H 2PYFA 4OV5A 2VR5A 2VMFA 3GSOB 4BJLA 4WFGE 3G5ZA 5HBBA 1U8MA 4ZS7L 1IGML 5F7NC 5F7FA 4OCXL 1YA5A 3MBXH 2Q8BH 2ZJSL 2PO6C 1CK0H 4HHAB 3T8XB 3NCEB 4I5BA 1P7KA 3HZKA 4M7ZC 4TTGA 4FOMA 4V2CB 4JFFE 3IDXH 3DHMA 3DO3A 1Z9SA 2C1PA 3NFSH 3FO2A 1GGTA 2CKBA 5CSZB 5HHMB 1MCFA 2PUQT 4UV4H 3VXSE 2H45A 4YXLL 3CC5A 5C9JA 1T04B 3FONA 3D18A 5HPOA 2E6JA 5LXGH 4RDQG 4K7PX 4XNQA 4KKNA 1KGCD 3U36B 4EXKA 1W0VB 4XBGA 4NO2A 3LDBB 4RIRA 4GAFB 3AXLB 2DWEA 2LE9A 4G8GE 3GJFB 4GOSA 4XCNA 1IM3A 3N9GH 3SE9H 3KXFD 5IOPA 2F5AH 3LKPB 1RU9H 5F1IB 1CS6A 1HQRB 2XNAB 3A67L 5KZCB 1E6JH 2EICA 3MYZA 3S3PA 2YD8A 3NVQA 3GHEH 4A2LA 5MEQA 3ETBF 2R2BB 5CHNA 4U6HB 3MV8A 3L5WA 2BSED 1J0KA 5E5RB 2A6IB 5D7IF 5E4EB 4GAJL 4Z95L 3V4PH 2NY0D 2C4FU 1VERA 1CQYA 2VQ1B 3CLFL 5J6HB 4NCC2 1DANU 4OZIE 1A4KB 1P4IL 4EI5B 1ODAA 3HCVA 5IMKA 3VXOA 1JPSL 2BFVH 1LEGB 3WJJC 1FZOB 1D5MB 2NY5L 2XZZA 1FNEA 1QFWH 3OKMB 4KKCD 1R24B 1HI6A 3OJDA 4JHZA 1LD9A 3DVGA 3WDJA 5E8OB 1UCBL 4LLMA 5LVEA 2FECL 4X5XB 1AGBB 4HGWB 4OLVH 2R2EA 5HHQA 3LN9A 3TVMA 4YPGB 2NY4D 1I8MA 4Q9RL 3WN5B 1NEUA 5GGUB 3C2AH 3DIFA 1KCVL 1UH2A 2AXJA 4WW1A 3U1SL 4O9HH 4Y0GA 1CFTB 2XT1B 4OTXL 2GK0B 4LARH 4PGDA 4XNXL 1XF2B 2LAAA 2JCCF 4X6FB 3CVHB 1U2HA 1JGLH 4OCYL 1NANI 5L2KD 3P0YH 5ISZD 3QI9B 4NHUB 5JHDD 1LE5B 2V5MA 1ZWIB 2F54A 3QIBC 2PTVA 5GGTH 5H94B 3N85L 4EBQH 3NZ8A 3QJFB 3IB4A 4J4PC 3WKML 4POZC 4XVUC 4JQXC 4LCCB 5D9SB 2RBLA 3OGOE 4MS8C 5EU5B 4L4TA 3UDWC 2FHBA 3C8KA 3O41B 1JPFA 3DTXA 3A6BH 3C60B 3H9SD 5DHXB 4KV5E 2BC4B 5ERWB 3GSNA 4MNQB 4P2RB 4U6YB 3O6LH 5EB9A 3NFPB 5IEKA 5J11C 1FZMB 4XNYL 4HD9A 2Q8AH 1IC7L 1NJ9B 2V5SA 5J56B 3VG9C 3MYJA 4MB4A 3QNYA 4OF7A 5CEZH 1PSKL 4IRZL 5FK9B 5I76A 1GL4B 2BSSB 4M9OA 1DQTA 1BIHA 1HDMA 2BNRE 2IADB 1RVFL 5JNYB 3ARBB 1MCIA 4XNMA 4Y5XA 3RY6A 4OLXL 3V79C 3IGAB 4LSRH 1GGCL 4G6FD 1JF1B 2X4OA 1JHLL 4ONGH 3NIFF 5D7JB 4PRPE 3GMOA 5DJZB 3H6JA 5IMOB 3LN4B 4P9HC 1EGJL 3EYOA 5I1IH 1A6TB 3LZFL 4K3EL 2VE6A 1HH9A 1Q0XH 4GUPA 3QXUA 4G80A 5IHZB 3QIWB 5EZLA 3FZUD 5C0AB 4H1LH 1QSED 1BQLL 2EDRA 5DK0A 3ZKND 1TJGH 3KPNA 5FYKH 3BW9B 1UVQA 4LIQE 1G7HB 5HGHA 4BSVB 4XHJD 3GJFK 1A7NL 3BKJL 3TH2T 1DSFL 4QLRA 3EAKA 1KIQA 4Z78B 1PD6A 3QXWA 4JGMA 4NKOB 5CZXD 3CPLB 5EA0L 3U7WH 1D5ZA 1MRDL 4ELKB 3S8WA 1KLGA 1X5LA 4M1GL 4OGAD 2W92A 4JHWH 1J12A 4ZTPL 1OGAB 1AD0A 2NXYC 1NAKL 4PJFB 1U8JA 3G6AB 4E5XB 3JWDL 5FO9A 4JVUA 2BNUB 2M2DA 4LKXA 3ARUA 5IJVA 3IFOA 5MENA 3ALWA 1T1ZB 3ARWA 3KYOB 1XT5A 3LRGA 3NN8A 4Y16B 5T1DL 5T33H 4A6YH 2HKFL 1IL1B 3NABH 4KMTL 4N8CH 1E6OH 5IBTH 1ZANL 3VFMB 2HN7A 2A6DB 3HZVB 3O9WB 4YHZL 2BVQA 3ARFB 4ORGA 4UDTB 2EDLA 5SWZA 3MOAL 5L9DH 5T1LA 1NANH 2PW2B 3PWLB 1I7RA 1EHLL 2E27H 3PHSA 4F7PA 4ZAKD 1JFQH 3PWVA 3QDMA 4HUMB 3AU1B 2WMPA 3QEGL 4L4VB 1MHEB 5I1EH 2UZIH 1P4LA 4XCEA 1H3PH 5A16B 3WNOA 1H9VA 4GRLD 3ZHKA 5B38B 1E4JA 5BJTB 1B9ZA 3UTPD 2XQYK 1W72A 4GW4B 1XGUA 5GRUL 3QQ4A 5IG7A 1RUQL 1E0OB 2X4RB 1KJ2H 3WMSA 4JFFD 2BVUA 3GMMA 1KV3A 5TDNB 1N8ZB 3LQAH 3VXSD 5CEYB 1U6AH 3AM8C 3C6LB 2P8MB 4M3JA 3ES6A 5CMAB 4U1IA 1UA6L 1I1AA 4FQXD 4WHYH 3QCVH 1NBVL 4P4RA 3U4AA 5IHBA 5JW5A 3KYKH 2A6JA 3HNSH 1FDLH 1BAFH 4NNXB 4PJ9D 5CBEB 4G8GD 2EXWC 4XB7A 2AJSH 4LRIA 3RTQA 2HMIC 1YQVH 3FCTA 3HFML 4H1LG 4NT6A 5L8JB 3SDAA 1INEH 2DI9A 2OL3A 3I2CL 1QFHA 3S88L 4K71C 4GW5A 5I15L 1H3XA 1R5WB 3NTCL 1NUFA 4L5FH 4JKWA 4ZD3H 1YEGH 1R6VA 2P5EB 3RVUD 3RU8L 5KW9H 5CBAA 1UADC 4JM4H 1NEZB 3ROOB 1M71A 5I6XB 2OTUA 4N8PA 3MLRL 1G9NL 4MAYD 4ZDHA 2ZP0T 1YMMB 1JTOA 3GHBL 3CFBA 3SKNA 2EDNA 4FFYL 2B1HH 5I16A 1NKOA 1RZGA 4MJIE 4G5ZH 3GNML 2C3VA 4QRTA 3UZEA 2QSTA 1WFOA 4M1DH 1RUAH 4I77H 4LSTH 2K1MA 1CFQA 4KVCH 3JWOH 3D39A 3MJ9A 1HKLL 1ITBB 2ICWJ 5TFSL 3B9KC 3OJVC 3BXNA 3GM8A 4LDOB 3T0ED 4TVSa 5IF0A 3QUYB 4OJFH 2EIDA 5KSVB 5HD8D 3WFDH 1CICD 4M6ML 3FN9A 2EIZA 1Q9LB 4EDWL 1GZQB 1C12B 1II4E 1YPZE 2RR3A 2VLKB 4PY7B 1IKNA 1R5VA 1VEMA 3IXAA 3L3OA 3VU2A 4N9GA 4ZYKB 2J1KA 4JO1L 4NYLB 1EVTC 1AHWA 1OHQA 3EFFA 5KOMC 1UYWL 1H3TA 2X1WL 1KIRA 1J1OL 3ZT6A 4KUZL 4FQ2H 5KVGL 3CFDB 3HR6A 2K9UA 3BD5A 3LKNA 1T4KA 3U2SA 5D1ZB 3WDIA 5EOTA 3TC9A 1IQDA 3DROA 3FT4A 4QXUH 1OCWH 4PJEE 2EDBA 4WHYG 3S98A 4AK1A 3BPOC 3PL6A 5HDOA 5KVEL 4X6CA 4O2CB 1OB1A 1FGNH 4HIJA 3GSVB 5BRZA 1A22B 2DM4A 3GKZA 3WS3B 2YN5A 5A2LH 3QEQA 5ID1B 1MRCH 3B2UD 2BNRD 3T1WA 1DLFH 5DHYB 2P24A 4WUUE 1U3HD 4PJXF 3KPMA 4QXGH 3F7VA 1NGYB 4LEOB 1F58L 5DJ2A 3ARDB 3CMOH 5DQDH 2VWEE 1GZPA 4L8BB 2Y25A 3OAZH 1LP9A 3HUJA 4LLDB 4WHDA 1JGDA 5EO9A 5DD3H 2HTLD 1K5NA 2NY5C 5GJTL 1A3QA 3LKQA 5F21B 1FO0L 1DDHB 3UTZA 1N7ML 3HB3D 4QHMB 3TO2A 4Q74A 2L7JA 1RUKH 3QDGE 5CWSA 4DFHA 4LCIL 4QF1B 4HUNB 3RI5K 2LQRA 4P5TB 1EFXD 3SCMD 2FEDD 1NCDL 1VFOA 2AXGA 3L3KA 3VWKB 1BOGB 4PRDA 3I3DA 5F3HA 1TJIL 3BP4A 5IVXB 1ROWA 1ZA3A 4WEMB 3RGVD 1MIEH 4KKCC 4HPYH 1JWSB 1CE1H 1MEXH 3T4AB 3QH3A 4CAGA 1HILA 2IJ0C 1CL7L 3L3JB 4PUBH 1T1XB 3CX5K 3DX7A 1S5HA 5IFAL 4R7NA 4HX1B 3SO3B 1CE6B 4LIQL 3O81A 2CMRH 4J3VA 2CJUH 4X7TB 2NXZD 4M9PA 2R1YA 3RZCD 4RZCB 2G60H 2NY4C 1HHJB 4QGYA 5DVKA 1D6EA 4QHKI 1FC1A 4AT6A 1LK3H 3F12B 1RPQA 5DJ8B 1T1YB 4R96B 1O0VA 1LILA 3GMRB 2RFXB 1P7QA 2D2OA 2GK2A 5DD0L 4JDZB 2H6PB 4ZXBD 4YDKH 3OZ9L 4PB9L 3OHXA 2G5BB 5GGQL 3K8LA 3SJVA 1GGIL 2GYSA 3U0PA 5C08E 1OTTD 4K8RH 3ZYOA 4OZFA 2CKBH 1IAIL 2YD4A 5F7DB 2DWDA 1DVFD 1W0WB 4HKJB 4KU1A 4NC0B 2APXA 3MTRA 4TSAH 2BVEA 4NBZB 1S5IH 1F4WL 1AFVH 3MA7B 4QHUA 2ZSWA 1ND0B 4J6RL 1EZVX 1ZT4B 2H8PA 2ZNWA 1RHHB 3I3BA 4JPKL 3FQRA 4ENED 5C0JA 4RGNB 4TTDD 5E2WL 2UY7A 4C4KT 1XGQB 1L7TL 3TYGL 1WZ1L 1IT9L 4AIXA 1AE6L 5I19L 3WD5L 4Y19A 5IMMA 5EBWA 4AY0A 1AP2A 3BP6B 4K3JH 2AERT 5DVOA 4YZFF 3V52L 3OX8B 3O3EB 1P2CA 2ZUYA 5CZKA 3UYRL 4MXWL 5ID0B 4X83A 1BQHA 1CGSL 2YA2A 1BQSA 3WL9A 4LCWA 1S78D 1MCHA 1KEML 3K1DA 1HSAA 5E2VH 4F8TA 5EN2B 4R97C 3U48A 2W60A 4OV6F 2V9RA 5DJ6A 4B53A 2HRPH 2O61B 3DVFA 4ALAL 1JP5A 3OKEB 4H20H 3MLXL 4DKFH 2UUDH 3FZUC 4KUCF 3C5SB 5ACLA 3ZKNC 4RSVA 1G1YA 1L0XA 3GMNA 4XHJC 3WE6A 1U3JA 2JIXD 1ORSB 4JQIH 5LGJA 1FNLA 3FQXA 1Y6NR 3KYMA 5CZXC 1YEJH 3T09A 4X7CC 3V4VL 3B8YA 1NGPL 3LSOB 5DGQA 5EOQL 5CINH 2EC9U 1U41A 4NGHH 5KSUB 4RGOL 5DA4A 4MJID 3MLTA 4OGAC 3IDMB 3H42H 2BOBA 2YK1H 4HWZB 4NZUH 4AH2A 4AIZB 2V7HA 2LAGB 3VXUD 5C0CE 2D7TH 2ITCB 4XXDB 1IZJA 2R4SH 5E1AB 3MRCA 1LO3L 3IDNA 2K7QA 4J8RB 1OM3L 5DJ0B 4KJPD 3BEVA 3WLBA 4TSBL 2X7LA 2VO5A 3RUGE 4NOBA 2D4DA 3UJJL 2YWYA 1TZIA 3MRPB 5FA3A 3RVWD 4RMVA 4HG4J 5E5UB 3GSNH 4RISH 5D2LF 2FATH 4QNPF 4EVNA 4J12A 4JFQB 4R26L 1YQ2A 4POYA 1YDPB 3EOBB 3HE7B 4J1UA 4ZAKC 2I9LA 1F4AA 1DBBL 4G7YL 3CLEL 1FIEA 3S36H 4BK4A 5IP4A 4CW1A 4GRLC 4HEME 3TBTA 4F7EA 1RZJL 1K8DA 3T2PA 3VXTA 1JWMA 1QQDA 4XC1H 4H1LB 1DL7H 2DI8A 2JJWA 3QRFM 3PWUB 1XIWA 4RFOH 1GSMA 32C2A 4JY6A 2A77L 2Q3AA 2BSRA 5KG9A 3PGFH 4GRWE 4MA8H 1MJ8H 3DX8A 5F72S 2CGRH 2VL5B 5L88L 4XPAH 2I60L 2WBJB 5E24E 4Z76B 3KLAA 1F13A 4FQXC 4NQSB 2UVFA 1UENA 1UKTA 2ESVA 2GT9B 3NH7L 1PDKA 5I2IB 2FJHB 4PJ9C 4WUUD 2NLJA 4BFEA 1C5BL 5DXWA 1H8SA 2C5DC 4PRPA 4HMDA 4FQ1H 3EFDL 4HUVA 3MLPA 1ED3A 4YJZL 4G6JL 3BUYA 1OVZA 2F5BH 1P9MC 1QBAA 3DV6B 1BD2D 3WBDA 2ZG1A 4M00A 2YD6A 1K2DB 3C5ZD 3O3DA 2W65A 3DARA 5DK3A 4ZPTB 1I7UB 4ZQKB 4DVBB 1SBSH 5DWUL 3DVNB 3MV7B 5C0FB 4PRIA 3RVUC 3QDGD 5J8OA 4N0YH 2QR0B 3VA2C 4BZ1L 4A6YB 1MLCA 1NBZB 1YUHA 2ICWA 2WSKA 2EE3A 1E4KA 4MDIA 3E1F1 5I18L 4KTEL 1XGYH 1XF1A 3KR3H 4MAYC 2YD3A 3UC0H 3GGWA 1AQDB 1ZLUK 2V2TB 1KC5H 2IBGA 5C0BA 5JO5B 3L6FA 4P46A 5D5MB 1QSFE 3QWQB 3MRIA 1R5IA 3MRGA 4G9DB 3UXFA 2XY1A 4M43H 2XWBA 4TNVK 5IWLA 4LEXL 5D72L 3WXWL 1FE8L 1UM4L 3H3BC 1MFBL 3KPOA 5ESVB 1VADA 5EU7E 2IANB 1KN4L 2AEQL 3P11L 1KJ2B 2IG2L 3T0EC 3U0WL 1PG7L 3VDCA 4HJ0D 2C3HA 2VLJA 4OCMC 1OY3B 4I3GA 4R2GB 1TVDA 1NC2B 3ARTA 5HD8C 4BQCA 1CICC 3PABA 4V1DB 1W72H 1HXMB 2CK0L 2RIKA 5TDOB 3HE6A 3L9RA 2J4WH 2YBRA 3D0VB 1QHOA 1S9YB 4QT5A 3F7QA 4BQ6A 4EN3B 4QY8A 4OAWA 4OD2A 1TETL 1YN6A 3VFWA 3TPUB 4K9EH 2EYTA 3UTTA 2BSTA 1NFDB 3WO4B 3Q6FB 1NSNH 2QSCL 3QPXH 2A1WH 5SV4A 1F4YL 5EZOL 4TRPL 1WTGT 1WEJL 2EDFA 3PDOA 4KZDH 1HXYA 3CLFH 2VDOL 2J7LA 4CDHA 4LBEB 43CAA 4WTXA 4TUJB 1OAKL 2OL3H 3U0TA 3LKRA 5CJOH 2K3TA 1BVZA 3SKJH 3T04D 1U8OB 2EH7L 4NP4L 2C9AA 5D1QD 4OLYH 3NCMA 4ONFH 3SO5A 3B2UC 5TH2A 1CDIA 1XR9B 2MKWA 2FX9H 4G8FA 2X4SA 1OP5H 3MRLB 4ODVL 1U3HC 2ICEB 2HKHL 4XZUA 4X7FC 2AEPH 4FNLH 3MOQA 2XZCH 1QOKA 2KBGA 1SJEA 1KCVH 4P4KD 4KQ3H 2HTLC 5F9OH 2XTJE 4EI6B 1NCUA 5D93C 1I85C 3QJHA 3HB3C 2VQUA 3CAFA 3P73B 2XXCB 4QRQA 1Q9OA 3H0TB 4NHCL 4YC2B 3SN6N 3MJ9H 5EU4B 3KPSA 3VGEA 3SCMC 2FEDC 1KPRA 7FABH 2LABA 4P23A 5AZEL 2YPLB 1QRKA 4G3YH 1FCGA 1VFBB 4Z7VE 2WZPD 3QFDA 3RGVC 2LU3A 3G6DL 1WUNT 1I7TB 2PW1A 4KHTL 4NRXA 3RWEB 5EIIA 4MX7A 3MPCA 1CYGA 3OKOB 1KLUB 1IILE 5ITFB 1NDMA 2HFTA 5HHXH 1UXWA 1INDL 2NXZC 3R4DA 3RZCC 3V4UH 4KMLB 5B8CA 5JDSA 1FNHA 1QHPA 3DBXB 4KRLB 1DQML 3UTSB 4D0CB 1G9MH 1RIVH 4DUXA 4Y4HB 3MO1B 3IU3A 4TULL 5SV3A 3KWWA 4K3GA 4E0RB 2C7UB 4ZXBC 3AROA 5CILH 2WWKO 4LMQE 1CFSA 1NMAH 4HKZB 2VLRA 3FT2A 4U31A 5J13C 5IESH 3TIEA 2ED7A 2FLBT 3QUZD 1OTTC 4X5LA 2D9QB 4WEBL 1Y18A 2VUYA 1JHLH 4JFDB 3QNZB 9CGTA 1DVFC 2I27N 3D2UB 1S7TA 4YHIB 3QDJE 3VXMB 1RI8A 2MWCA 4HUWB 4YZFE 3CDGB 4LAQH 3QRGH 4M8QB 1D5BB 4HGKC 3TNNB 4ENEC 3ZL4H 2ADJB 5HGAB 4TTDC 3PE9A 3BPCB 1C5DA 5KSAB 1AKJD 4Y2DD 4X4ZA 1E4XL 2PETA 1LEIA 1UWEL 3SGJA 1CDBA 1L7IH 2JELL 2B8OT 1FFPA 1FORH 3BO8B 1R0AL 4WUKL 5HYQB 1IEAA 3BQUD 5F93C 2GJJA 4UBDD 3AAZA 2OTWA 4AENB 4E42A 4PJ8D 5MEOB 1S78C 3HNVH 4KK5D 5LQBL 4BYHA 4Y2OA 5D7IA 3SKMB 4JRXB 6FABH 4HWNA 3NCYP 5JPNA 5MEPA 2VZ1A 1JGEA 4HDIA 3W39A 3JWDH 5DRZB 4FTVE 1I8KA 3IFLL 4QRRE 2PYFB 4OV5B 3VRLF 3RA7H 3KPRE 5HYJA 3N1GC 2HWZL 3KGRA 3G5ZB 1U8MB 4JCLA 3WJJA 3D1MC 3VH8B 4I5BB 1P7KB 3HZKB 3K74B 3ARPA 3LV3A 4XP9H 3SKUD 2C1PB 3BIBX 2NW2A 3FO2B 3NACH 2CKBB 2VSDA 3D69A 3FFCA 2I9TA 3SDCA 5C0RL 2G5RA 1JPGA 2NYYD 4S1DD 3CC5B 3MA9L 4TOYL 5DC9B 3FONB 5C9JB 3D18B 3P0VH 4WW2C 2PYEE 3MLZL 4LRNL 1CI5A 1WJ3A 4XNQB 4WW2F 5IKCA 2JCCA 4XBGB 4NO2B 5GGRY 4OZFH 2QADD 4RIRB 2DWEB 1DBAH 3TH3T 5D2LE 4MQ7A 4XCNB 1IM3B 2BJML 4UTAL 5IOPB 4F58L 2Z8VC 1G0DA 3CDFA 3FO0L 1NDGA 5GRJL 1KB5L 2BXYA 1CR9L 3QP3A 1OARL 5MEQB 4M7LH 3U7YL 5CHNB 4HWUA 1C1EH 3MV8B 4CADA 3L5WB 3RVWC 1NBVH 5L2JA 1RZJC 4JQXA 4PJHE 3DI3B 2BCKA 4Y4FD 4XC3L 3UDWA 1BLNA 3TV3H 4EEEA 4X6DE 2ZUUA 1MJ7H 4XVSL 4PJIF 3MC0A 3HCVB 5IMKB 3VXOB 2ZPKL 2XKNA 1J18A 1FNEB 3I2CH 3AUVA 3OJDB 1HI6B 3DGCR 5I0DA 3GKWL 1LD9B 3DVGB 3RI5F 1F3DH 3ZDZE 4W6YB 4LLMB 1KJ3L 1U36A 1EUTA 2R2EB 5HHQB 1Z9LA 2GSGA 3TVMB 1I8MB 3D25A 5JMOC 3EYFA 3EYSL 5LGHL 3DIFB 4M02A 5E6ID 3BP5A 3RIFF 4WW1B 2ICWI 1RURL 4DOHB 3FMGH 1F4HA 2NX5A 3F5WA 4PGDB 1VHPA 5I1LA 2GJ6A 5BO1L 4JZJC 2HH0L 5C07E 3NGBC 4S1RL 4EXPX 2F54B 1UACL 4YHNA 3TPKA 3W0WE 4YQXL 5C0ND 3NZ8B 4FP8L 2VWEC 4Z8FL 1NL0L 5L0QB 4HXBH 5HDQH 4FFZL 4HWEH 1L9MA 1JNHA 4JDTH 1A21A 3A6CL 3AREA 1MQKH 3C5ZC 5DZOA 4B50A 5T3XH 2AK1H 2HP4A 3C8KB 1JPFB 3DTXB 4BK5A 5GRZA 4F8QA 1TNMA 2W9DH 1YC7A 5DFVD 3VWJA 5FGSA 1GIGL 1QSVA 3GSNB 3IYLW 4KRMB 5IEKB 2VDPL 2YUXA 3T2NL 5LBSH 4OZFG 3MYJB 5H35A 4X6EA 1PZUB 1KCUH 4UDUA 3MJ7A 3QNYB 1GPOH 3OAYH 5I76B 4HCRA 1HDMB 3TBVA 3AB0B 2K7PA 4PLNC 5C2BH 4KH2A 4ZTOL 4KY1L 3D3VD 4XNMB 4Y5XB 2C3GA 2SEBA 2WW8A 3MUHL 3RJDA 4OLWH 4KI5F 1FVCA 3CDCA 2X4OB 5HHME 4JN2A 3GUTA 3GMOB 3C09C 4LAJH 1Z9OA 2R0LL 5KVEH 1ZLWK 3D87B 4HJ0C 4HH9A 3EYOB 5GGSY 2VE6B 4YUEH 2YPVH 4NQDE 3G08A 1D9KD 3HAEA 2DLFH 4GUPB 3EJZD 4G80B 5EZLB 4NM8H 5D6DA 1EO8L 4WY7H 4H5SA 4IIQA 3NCCB 5DK0B 4MNGA 2Q6WA 3KPNB 5FM4A 1BQHG 1UVQB 3I6LD 5HGHB 4O2FA 4OFYA 4DKAA 4C56A 4NRZA 2YPKA 1QYGH 3E2HB 4K23L 3QG6A 1KIQB 3F58H 3QDJD 3OSKA 3TJEH 1UCTA 4KPHL 3MXWL 1D5ZB 4OZGF 3G04A 2E7MA 1BQUA 4R0LC 1JVKA 4LCYA 3MUGA 3UO1L 5JOPD 5HHOA 1KLGB 4FFWD 3VW3L 5KS9F 1D6VH 4DJMA 4PJCF 3LH2H 5IROA 4LL9A 1AD0B 4JHAL 1MPAL 1KCLA 1A7PL 2GIYA 1U8JB 2YSSA 2DF3A 2XI9A 1T20A 2W07A 5FO9B 5HVHC 4Z7WF 3WFCH 1UEMA 4LKXB 1MF2L 4M4RA 5IJVB 1FLRL 3IFOB 1S8DA 1ZEAH 3CFJA 5D1QC 5MENB 2FGWH 3NN8B 5I1AA 3QEHA 4P59L 4YFLI 4I2XE 3ZKXC 4L8SA 2F19H 1G7MA 5C6PB 2HN7B 3X11A 2FLRT 2UUDK 5EBGA 4YBLC 4MD4A 1AXTH 2EDJA 2BVQB 4ORGB 5SWZB 3NCJL 5T1LB 1AIFA 1TJHL 2ED8A 3V0WH 1I7RB 4F7PB 3PWVB 4WTZA 1CTNA 3QDMB 3QUXD 4P4KC 4UAOC 1P4LB 2W0KA 4WU5A 3X13A 4XCEB 2V2XA 4WENB 3BISA 1UXSA 1IEHA 1W72B 2W9EL 3FHAA 5ENWA 1XGUB 4QOKD 5DLMH 3QQ4B 5IG7B 2KQMA 5TF1L 1N5YH 4Q9QL 4RX4D 4U3XA 5EUOF 3GMMB 4YDLB 1TQBB 1HK6A 4UB0H 3OJMB 4J6RH 5DT1H 4AL8H 3ES6B 4WI5A 1FIGL 4HF5H 2PYED 4U1IB 5FXCH 1I1AB 4O02H 4HC1L 4Y5VA 3IXTA 4KZEH 3DV4A 4P4RB 1YY8A 4JVPA 1RULH 4MNQE 3FHQA 5JW5B 1FL6A 1N6VA 4P2RE 5ICYA 2A6JB 1L7TH 4LNVA 1MFCH 1TQCC 3RTQB 3FCTB 4NT6B 3RRQA 3V8OA 2VXSL 3RIAK 3QFJD 4HBCL 4OD3L 1BFVL 3SDAB 2FX8H 2OL3B 4Y5YC 1Z0MA 4GW5B 3CSPA 3VI4E 4P2QA 1JMXA 3MRRA 3QUZC 1A7QL 4LLUA 4X80H 4QRPE 3I9GL 5CBAB 4H0GA 1AY1L 1M71B 5JW4M 5EO1A 2GUOA 2OTUB 2QQNL 3NAAH 1HE7A 3NCBB 4ZDHB 5A40E 5I8KH 5CD5D 1XEDA 3EHBD 4PFEA 1ITCA 5C0IA 4KC3B 2AJXH 4I9WE 3CFBB 3PQYA 4JPVL 4XAWH 3SKNB 4DGIL 3WIHA 5FYKU 3N1QC 5C0AE 3NPSC 5FGBC 5I16B 5TQ0H 1RZGB 1B90A 4OQTL 2C3VB 2NMSA 4QRTB 1KEGH 1J0HA 2VXQH 4Y2DC 1IMHC 1YNKH 1CFQB 4NJAL 3D39B 2NY2D 1MHPH 1JZ7A 1I3VA 1RV6X 4PJXA 5DMIL 4WWKD 3BXNB 1X4XA 4IRJA 3B9AA 4Y88A 5IF0B 4TNVF 3BQUC 3V4VH 3VRLE 1TFHA 3HLAA 4UBDC 1N6QH 3FRUA 1ORQA 3E3QE 1LHZA 4PJ8C 4Z9KB 4IHOA 5F96L 2EIZB 4KK5C 4YDIL 1F45A 1OGAE 5F6HJ 4PJFE 3OKDA 1R5VB 3NOIA 2X1OA 2OZ4L 1BF2A 1TCRA 3IXAB 3L3OB 4N5UA 5TQ2L 3W5NA 5E2UH 4N9GB 4WWID 1MAKA 3STZA 1OT2A 1AHWB 3EFFB 4LLWA 2DN7A 2FJGA 1LO2H 2F8XC 4EZMA 3UJJH 3P9LA 3QIUA 3IU4L 1QFWM 3DSNA 3WJLC 4O5LH 3S37H 3LKNB 3KJ4B 1T4KB 4XMLH 3U2SB 4PRNA 43C9A 5DVLA 5EOTB 1RIHH 1IQDB 2YD5A 3DROB 3FT4B 4A2MA 2VDML 4Q6IA 4L4VE 3GJEA 3PL6B 4W68A 4X6CB 1OB1B 4FS0A 3VG0H 4HIJB 1MFAL 2NYYC 4S1DC 2FIKA 4PJ5D 5BRZB 4XTRD 2VZOA 5SWSA 3QEQB 1X7QA 4OLZL 3EDFA 1HQ4A 2QADC 4K2UL 4U1NA 2Y06H 2P24B 4P5KA 3DMMB 2LU7A 5DD6A 2AJUL 5GZOD 3HNTH 3ZKSD 1KB9J 3KPMB 3S5LA 3F7VB 5HHMD 3S34H 5DFTA 1X5IA 5DJ2B 5IVNA 3PXJA 1TPXB 5JHDA 1GZPB 5A2IH 1LP9B 3HUJB 4MDJA 1JGDB 5EO9B 4GQ9L 1K5NB 3LKQB 3IDIA 4PREA 4CKVX 1WFUA 3UTZB 3TO2B 4M5ZL 4NNYA 1GAFH 3E8UH 5CWSB 4Y4FC 1NGZA 4ZMAT 3MLYL 1I1RA 3RL1A 3ZE0F 4EOWH 3AFLA 4LLAA 5MERA 1QFUL 4XWGH 4IMKC 5E7BA 2AXGB 3L3KB 4FQQA 4PRDB 5CZVL 4JFOA 5KZCD 5F3HB 3BP4B 3ULSA 1ZA3B 1CBVH 4DEPC 3VFPA 3WFEH 5GGVL 4MQSB 2AI0H 3QH3B 3F6LA 5CP7A 4FZEL 1HILB 1FNSL 2P5EE 3DX7B 1S5HB 4LQFL 5DWUH 5DMYA 4HWBA 5I30H 4R7NB 3EOTH 2OJZH 1H8OA 3MODH 5CIPA 5DD5L 4HLZG 1NMCC 4QTIH 5T3ZD 1MCWW 2R1YB 2P44B 3BFOA 1D6EB 4AT6B 1O7SA 2DQCH 4EI5D 1YMME 1NQBA 1PJ9A 5E6IC 4G42A 1P7QB 4RAUA 2JTDA 2XIDA 5DR5H 2VN7A 4NKIL 5GGVY 1YECL 4GBXA 4XNUH 1YNTA 4FQLH 1RMFH 3OHXB 4WGWB 3WUWA 3TT1H 1UM5H 3SJVB 1UM4H 1CF8L 3U0PB 4LQ1A 4X7SH 4OZFB 3B2VH 5C0NC 1YYLH 2YEZA 4UT6L 1KN4H 4WV1C 4OFIA 2DWDB 3FB7A 4FTVA 1B3JA 4QRRA 1A6VH 3KPRA 4QHUB 1OQOA 1RZKL 1EMTH 2VLME 2H8PB 2VC2H 2VLKE 3FQRB 3QI9D 5C0JB 1D5IL 3ARZA 5DFVC 3UAJD 2XQBL 2Q20A 4HIIA 4P2OD 1JF5A 5E99L 1T03H 5GXBB 4E41D 1L0QA 4G8EA 4R8WL 1O5DT 2W0LA 4Y19B 5IMMB 5EBWB 1AP2B 4UUJA 4HFUL 1P2CB 5MI0B 5IW6A 2VISA 4K3DH 3DHJA 3LHPL 1P53A 3C60D 3B9VA 1BQHB 5IVZA 3B5TA 3BP7A 1CDYA 1BGXH 3ARVA 5E08H 4UV7L 3WL9B 4LCWB 1UFUA 4MNQD 4P2RD 1HSAB 1UJTA 3MLUL 4TRPH 1KACB 3DSFH 3CU7A 1JNNH 5D2LA 2W60B 1NGXA 1YEHL 3U4BH 1NCNA 1RUMH 5DJ6B 3JV4A 4YXHL 2WBKA 4OD1H 3HMXA 5I74B 4JO2H 1JGVH 2ZCHH 3TA3D 4F3FA 3PG2A 1D9KC 1EEZA 4GG6A 3LAFA 3VA6A 1XAUA 3BI9X 2H1PL 3EJZC 3QO0A 5IGXL 3ARBD 3B5GA 4D3CH 2OP4L 4JDVA 2WUBH 5LWYL 2R1XA 1BHGA 4BFIA 3GMNB 3BPNC 5D7JD 1TNNA 4DGYH 3WE6B 1EEUA 5LGJB 3A0OA 2XRAL 3FQXB 4FG6D 1I9EA 2YZ8A 3NCFB 3KYMB 4M7KL 4MCYA 5D8JL 4G6KH 3VI3E 5ETUA 4HS8H 3S35H 2EZ0D 4M93B 2ZCKH 4RA0C 5C0AD 4FFWC 2YD9A 1NFIA 3MLTB 4PYGA 1FYHB 1MCLA 2XN9D 3EO0A 5DTFA 2BOBB 4AH2B 2DQJH 4KXZI 1IGCH 4KQ4L 1T0PB 2V9TA 1ZK9A 3JWNC 2EO9A 2EE9A 3EYUL 3KNBA 3MRCB 2NQCA 5IVXE 3IDNB 4IRSD 5FOJA 1XF5A 3BEVB 3WLBB 2MNUA 1JWUA 2X7LB 4ISVA 1EFQA 3SBWA 1H3UA 4LVOC 2HG5A 2WAHA 3C9NA 3ZE1E 1TZIB 5FA3B 3O6FC 2IPTH 4HXAL 1OGAD 5T1KD 3DUUA 1EX0A 4LSSH 5GSRA 4MA7H 2WNGA 4EVNB 4C83A 5I1CH 2D03L 3QEUA 1MRFL 2X4TA 2D0HA 3O6ML 3L3DA 5SX5K 1JCKA 4J1UB 5D2NC 2ZUQC 5DUML 3QUXC 5I75B 1ZLSL 5IFHL 2I9LB 4HIHA 2VAJA 5EUOE 2OR7A 1AO7E 2R4RH 4HMCA 4HCRH 2DQUL 5DC0A 3DLQR 5ADPL 1BVLA 2AJ3A 4CW1B 3CDYA 3TBTB 4F7EB 1K8DB 3VXTB 5E6YA 1BVKA 1PYWA 4RQQA 1JWMB 1QQDB 2V5RA 3O9WD 4BKLA 3HRZA 1XIWB 2FZ3A 4XH2A 32C2B 4JY6B 1OAUH 2BSRB 5KG9B 4LVNC 2DM3A 4L4VD 4MA1C 4NN5C 1T83A 3BYTA 3DX8B 3U79A 3HAEH 2FSEA 2CO7B 1T7YA 3KLAB 5IB3A 3GRWL 3T0EA 2B39A 3IAGC 4YGVA 2X40A 4HQQL