4OKVA

Crystal structure of anopheline anti-platelet protein with fab antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGLIDPSDSETHYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARGGTYWGQGTTLTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heavy chain of 8H7 mAb
publication title The crystal structure of anopheles anti-platelet protein, a powerful anti-coagulant, in complex with an antibody
rcsb
source organism Anopheles stephensi
molecule tags Blood clotting
total genus 45
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA02
5E1AB 3VI3F 4P2OC 3ILQC 2ESVB 4K3JH 3MBEB 1JMZA 4AZ8A 1N6QL 4UIKH 2B4CL 3AGVA 3DTXA 1JL8A 2W60A 2EXWC 1HXMB 3T0ED 2BNQA 4OKVA 4P2QB 5DA0B 5IHLB 1J5OH 1X5HA 4XI5D 3D39E 2LTQC 4IBLT 1GC1H 3MRQA 4M5YH 5IB5A 3BKML 4HUWA 3UEZA 2P8MB 4LQFH 1NMAH 5FYLH 4H20H 2DBJA 3FQTB 3GHBL 1OF2A 1WQVT 4JZJC 2CH8A 4IS6B 2X1XR 2YBRB 6FABL 3T1FA 5EO1B 2YR3A 3QUYC 1JF5A 4TOYL 2M1KA 3RWFB 1IGJA 1NCWL 3VU2A 2A9MH 1DUYA 2NYYD 4KQ3H 3MUGA 1FFOB 4LLYA 3K8KA 3U30C 4X5XB 1YPZE 5JA9A 2HT3C 1WCBA 3EOTH 2I60H 4LLAA 1LD9A 5D4QA 3BP5B 4KVCH 1TVBA 2ZUSA 1T5WB 4V1DD 4EVNB 4UIKL 4PJ7F 1OGTB 2WBJC 3S5LG 4D0DB 1B0RB 1MOEA 3K46A 1INEL 1SM3H 5E00A 1J5OL 1NCDH 1EGJL 3MRIB 3VGFA 1GC1L 4M5YL 1HHJB 2E9IA 5CJOH 3S97C 1KGCE 4KI5E 9CGTA 3ZHDA 4HAFA 1NMAL 4LQFL 4RZCB 5FYLL 3WLWD 4U1NB 4R4FL 1OSPL 3GSXB 3HRZA 1KACB 2W91A 4FXGA 2I07B 4L4VE 5I76A 2E7BA 4HDIB 2HA1A 3O3EB 1U95A 1XGQA 1S7UB 4I0KA 3IU4H 5L8LB 5BRZA 4GAYB 4PPTA 4ZO8A 4NRYA 4DZ8A 2VRAA 3SE4A 5EN2B 5DMYA 4QF1A 3EOTL 4G8FA 4JQIH 2I60L 3KS0H 3JTSA 1E4WL 4KVCL 4NQXB 4WNQB 3KPLA 4ZMAT 5I71C 3X17A 1HI6A 4AH2B 1MFDH 3MNWB 4BQBA 2HKHH 3GNML 3SE3A 3GK8H 4GT7A 3SGKC 3RL1B 2P45B 5GGQH 1SM3L 3R06B 2R69H 2D7NA 4HC1A 3GUTB 3PWUB 1NCDL 3FONB 3LCYA 3V0AC 1YC8A 3WNLA 3HS0B 3TNMB 3SJVA 2R4RL 3OKNB 3VA6A 1FNFA 1ZLWK 3HN3A 3MLTA 3GKWL 1MFAL 1RIUH 5BO1L 2YZ8A 2MHAB 4XPHH 4QXUH 1EAPB 1OPGH 1S7WB 3QNZB 5FUZH 1U3HD 4GW4A 1A22B 4XNXL 3UPRB 1CQKA 4R0LB 4Y1AA 3IU4L 1CZ8H 3EYVB 4HEME 1I75A 1FL5B 2HAZA 4IMKA 3RDTC 3ARVA 5ACLA 5C0DB 1YN6B 4LHJB 3R1GL 3GBMH 4QWWC 3GB7A 5FKPB 4MAYB 4JQIL 2OR8A 4LSVH 1MRCH 1PLGH 3BVNB 4XWGH 4Y16B 2V5RA 1G1YA 3QFJE 5CJQH 3QIBC 4P5TD 3L3IA 5BXFB 4K7PH 4PJIF 5HPOA 4LCCA 1MFDL 2NPLX 2X4SA 2ZCHH 1GH7A 1QSFD 2HKHL 2MCPL 3GK8L 3D0VA 1PQZB 4ZPTA 1I8LA 2WP3T 4DVRH 5CEZH 5DMKA 5C0GA 3FTGB 4OGYL 5HDBE 2FB4H 3DARA 3RUGA 4TTGA 3QQ4B 5EOTB 4UMGA 2WUCL 5T3ZD 2LAGB 2YD5A 2JB6B 5IOPB 1I8MB 4H1LA 1Z9LA 3WHXA 3SDDB 2EXYD 5J1TC 3JUZA 2ZUUA 3PP3H 4Y4KA 1A7NL 3S3JA 3VRLE 1WAAF 1CL7I 4I48B 2H8PB 1T0MB 5GRUH 2ZUTA 4XPHL 1SY6A 1CF8L 4P46A 3QXWA 5K9JH 4TULH 2FYYA 1MVUA 1TETH 3MJ8B 2KZ1B 1LWRA 4O2FB 1CZ8L 2RCSL 3CVHA 4MJ4A 4Z7VF 3L3HA 5ANME 2J6EH 4Z76A 3UDWC 5HHXH 3DYPA 5C3LD 2BZDA 3GBML 4POYA 1T3FB 1NBYB 4OFYA 2J3SA 1MRCL 4XWGL 4K2UH 5CJQL 2CIIA 3HMWL 5C2BH 4RGND 4H88H 3S98A 5F89B 1U2CA 1D9KC 4DN3L 2EKJA 4DVRL 2ICES 1TJGL 3PDOB 4GXVL 1FNHA 4PJ9A 3O4LB 1FVDA 4S1SH 3TO4C 3VH8A 5HGAB 1FN4A 2MOVA 1PYWB 4LVHB 1PEZA 4MVBC 1DTUA 5IBUB 1GGYA 2DIAA 4ORGB 4BSVA 5FOBB 1VEOA 1LO2H 4KKAC 3ZYOA 3IJSB 1A6PA 1YEJL 1KENH 2XIDA 5GRUL 3K4DA 3MUHL 4KUZH 2DQUH 5D93C 5F7FA 1ZWIB 4TULL 1TETL 3T65A 1VFAA 1F5WA 2J6EL 3QFDA 4YFLI 3OHXB 3VXMD 3L6FB 4TUOB 4MNQD 4LHQB 4NQCB 4JFEE 4KXZH 5B4MD 1R6VA 5BZDA 3HZYB 2IPKA 4PB9H 5C2BL 4F58L 4K7PX 4H88L 4KK8D 1UCTA 2APFA 2P24A 3S9DB 1ZHLB 1ZS8B 3DVNB 1A3RL 3QNXB 4PV9A 2PNDA 5DEGA 4PJ5E 4PRHE 1KIPA 3KHOA 3GSOA 2IAMB 4YPGA 1AQKH 4MJ2A 4E5XB 1LO0H 2OMBA 2EIBA 1QNZH 4F57L 3TYFB 4JPKL 3B5TA 3I75A 5CWSA 5FGBC 1R5IB 4KJWC 2A0LC 5ELIA 2WINB 3G6AA 4S1RH 5E03A 5CD5D 1T2XA 3N9GH 1LO2L 4ZSOA 2NW3B 5TDOB 2DQUL 3PWPD 4HIIB 3QJFB 1HSAB 2YD2A 3BGFB 1C08B 4YE4H 4GAFB 4Z7OE 3W2DH 3T4AB 4NYLA 4FXKA 3MNZA 3LKQA 3VDCA 3PGFH 4WW2B 3DRQA 3MGTB 1KF9B 4L4VD 3HNSL 2R56H 4A2LA 3CFJA 5ESAA 1CDIA 3U6RA 5I66A 1NAKH 1RZ7H 1T0NB 4PB9L 2Q8AH 5AEAA 4I5BA 2OR7A 2Z93A 4ZFFA 1XGRB 4QRTB 2HN7A 1CGWA 4ZODA 1J1XL 4RBPK 5H2BA 3SKMB 1LO0L 1MLCA 1JUFA 3SDAA 3WN5B 4CU8A 5HGGS 2FWOB 2LV4A 4EDXA 5BJTA 4YBQC 5LGHH 3O3BB 1QRNB 3N9GL 3PQYE 1K3IA 3U9UA 3G6JF 3V0WH 3MRPA 3U79A 1LGVA 4ONFH 1LP9F 3KLHC 3H0TB 4YE4L 3KG5A 1YEKH 3TT1L 5IB1A 3UAJC 1OD7A 3PGFL 5BMFH 5DURD 4RISH 1TCRA 4PJXB 3DO7B 2V9TA 1DQQA 4X83A 2OI9B 3B9KB 1DJSA 3KDMA 3UO1L 5BW7C 5B38A 3D3VD 4U7SA 2VISB 4XCEA 3GMLB 5IMOB 3PXJA 3QH3B 1BZ9B 3GO1H 1NDGA 1XIWB 3FAXA 3GSQB 1JPFB 4HIEA 5FA4A 3TCLA 1ERNA 4U1LA 3EO1B 2Q8AL 5CSZB 5A43C 2X41A 3LDBC 4GW5A 4OF7A 4DAGL 4CU6A 4R90H 1J8HD 5CBEB 4U05A 5C1MB 5C9JB 4HLZG 1NGZB 4MA1B 4BELD 3FO1A 1AFVL 1T83A 1YMMD 1C5CL 4DEPB 3RJDA 3BD5A 5JPMA 3QNYA 2ENSA 2KZWA 3RWGA 4Z9KB 4JG1L 4O2EA 3S6CA 3TZVB 5L88H 4Q0XL 5LGHL 5CP3A 4HCRH 3B83A 1HNFA 4EI5C 1T20B 5DUMH 1QD0A 2R0KH 2UWEB 4X6BB 3SKJH 2O61B 2D7QA 1LDSA 3HFML 1PD6A 1CLZH 3FQWB 3KJ4C 1YEKL 1DR9A 2IALA 3H9HB 1N8ZB 1K8DB 4L9LA 5C0JB 3RVVC 2YXFA 1B3JA 2H9GA 3KPMA 4Y4FC 4RISL 2MWCA 5EC2A 5BMFL 4NRZB 3T2OA 1MJ8L 4GXUN 5CLTA 1KCVL 5T1KB 5SV3A 5I30L 4O00A 3MXWL 5CD3B 5C0BE 3IFNH 3GO1L 2HT2D 3F7VB 2NTFB 3QCTH 3O6FC 3AAZB 1U8NA 2MQCA 2R1WA 4N68A 3OAUL 4F9LC 1LK2A 1S9WB 4QRUB 5HHOD 5IG7A 3MA7B 2VQ1B 4X6DF 1IRAY 2D7PA 5DJDA 3LQAC 3CFBB 4Z77A 1QLEH 1VFMA 2HFGL 2X1OA 4ZFOL 2ZG1A 5L88L 1CXEA 2K3TA 1IGTB 3IDYB 4HCRL 4X7CC 1MCCA 3TBTA 3T0WA 5DUML 2JELH 1HHHB 3SKJL 3FB6B 5IBLC 5BZWA 3T08A 1CGSH 3FB8A 2YRLA 4QOKE 4C58B 4JQXA 5E0QA 3C5ZB 3VG9B 1FNGA 1OAZH 3LH2H 1GOHA 2Z91A 5HHPA 3K2UL 3ROOA 3U0TA 3BW9B 4PY8J 5IT2H 5ABDE 3IFNL 2DLTA 3P0GB 4U49A 5A16A 4OQTA 1VEPA 3V2AR 1T7ZA 4ETYA 3QCTL 4EI6A 1M4KA 5HGBB 5GZOC 1F3RB 1YYLH 4G8IB 5ISZA 2C3VA 4NC1E 3RGVB 1RMFH 1A7RL 5EU7E 4K3HA 3ESVF 3QEHA 2JF1A 3VXRD 2IF7A 3QEQB 3HR5B 3WUWA 3BT2L 1QLEL 1GGBL 2P5EB 5EOCJ 1EEZA 4GRMA 3PF2A 3I84A 5EH1A 5HYJE 5F7DB 3IRPX 2K7QA 3UBXG 2JELL 5JDSA 1FVCB 1IAIM 1AGEA 2YRPA 3OAYK 3ARGC 3P2TA 4F7MB 3QUZA 4Y5VC 3GMOA 4FTVA 1O0VA 2Y7QA 2C1OA 3P73B 2CKBL 4NC1C 5D7JD 1DQTA 5EU7C 5TDPB 1KEGL 5TQ2L 4D94A 5BS0E 4TSAH 4FMKA 5KSBB 2ESVD 1KTLA 4MA3A 4MXVF 4PJ7E 1AY1L 4L29A 3ME0A 2DN7A 4GO6B 4MA8L 3VWJD 1RMFL 3RWEB 1EVUA 4YDLB 4GLRI 4NQUA 3DV4B 3N85H 1A02N 1QSZA 1HHIA 2A74B 4P2QD 5H94B 2NR6D 3KXFE 5J8OA 4X7DC 2O26U 4JKWA 2GT9A 4N0RA 5D5ME 1FFPA 2BXYA 4H26B 1RIHL 2WW8A 4U6HB 3IVKA 1JIBA 5AAMA 3IGAA 1INQB 4U1GC 4PR5B 2W38A 4OBSA 4BSJA 4YHYB 2PUQT 1H15B 3Q48A 4NZRH 4ODWB 1XF3A 5C8JB 1FJ1B 1CS6A 1BFOB 1QQDB 2D2OA 1WEJL 1NL0L 3H9ZA 2CUMA 1QSVA 3NCFB 4HLJA 4KAQH 4KRPC 5IVOA 4C56B 1H8SA 3P9LA 2Z35A 4FN0A 2CQVA 4JM2B 7CGTA 4P9HC 1ORSA 3MGAA 4U1JB 1WBZA 3JTTA 3QIUC 3P77B 4RSVA 1HZHH 2GCYA 3UJTH 4OZIA 3O3AA 4OZFA 1AO7D 5DC4B 1BLNA 5HHQA 2QADC 4OIBA 1XR9B 1KCSH 1Q0XH 4WW1B 1T5XA 3S8WA 3T0XA 4PS4L 1I7TA 4XNMA 3N85L 3NFSH 2PW1B 1OQOA 1JZ6A 1DZBA 4JB9L 1CT8B 4QXTB 1QYGL 3UTTE 2NY4C 3DX9A 1FO0H 5C0RH 5EDXA 4Q9RH 3WIHL 5ACZB 2B4CC 4DVBA 1BWMA 3QBTB 4M3JA 2OBGA 5FGRA 1Y6NR 3MROA 5HBBA 5L8JB 4NZRL 1G7HA 2KQNA 4P4KD 5LWYL 1T1XB 3THMH 4XP6L 5C08B 3REWA 1OVZA 2VJXA 3MR9A 3KPNB 4IRJD 1V5JA 3G9AB 1UCBL 5FB8A 4TRPL 3PHOA 3ARUA 3LOWA 1IE5A 4LNRA 1P84K 3KNBB 1KN2H 2FSEA 3SKNA 3RUGF 2F54B 3TBWB 5ETUA 2W60B 2FGWH 5TH2B 2AXGB 5CP7A 3UJTL 4U1KB 2PKDA 5DEFB 1T66C 1L6ZA 3NCBB 4P49A 4PJIE 1JF1B 3HAEA 4WFFE 4MQTB 3T1WA 3BEWA 1VHPA 4M1CC 1KCSL 1Q0XL 3IDMA 2XQYK 5GS0C 1QFUL 1DBJL 1BQHB 3NFSL 3IKCB 1C5DB 4U1HA 1I1FB 1SYSB 3WFHB 1JGUH 2GJZA 2JK5B 1WFNA 2E7LA 3CDGA 4DWHA 4H5SB 2B0SH 4BQCA 4YXHH 3ZSSA 2NCMA 4K71C 5C7XH 5B39B 5AYQA 5F1IB 1B6UA 3DXAA 4XX1G 5J6HB 2V9QA 1S3KH 3BH8A 5ESQA 1S7XB 1GC1C 2YUZA 1U8OB 4RA3A 3E1F1 2DB8A 3BGAA 2PXYC 1PW3A 4UDUA 5ERWB 3D85A 1KN2L 5CAYB 4JZJB 1T1WA 4NFCA 4Y16D 1YUHA 3BWAA 3ZKND 2CRYA 1RAMA 4HUKB 5DFWH 5AWNL 3STZA 3CC5B 3BUTA 3U30B 4TNWF 4M8VA 4N5EC 5EUOB 3GSVB 2FNBA 1EGJA 4HX1B 3SBWC 1EFXA 2X4PB 1JGUL 1QFPA 2A83A 4YHML 4AEHH 3RY6C 1IM9B 1K5NB 4YXHL 4PTTA 2WBJB 1P6FA 4FFZL 4WGVB 3HI5L 3RZCB 3SDDD 2CK0H 5IFAH 1BQSA 2VZ1A 1EO7A 3OKEA 4YHLH 1NJ9A 1I1AC 1RVFH 4AT6A 4QF1B 3KPSE 1S3KL 3MRFA 4G6AC 4G8GE 3VFVB 5FHBL 2Z92A 2P44B 4LLVB 4FQQA 1W0YT 3ZT7A 1ZOXA 4JFOA 4P2RB 4BQ8A 5I6XC 1KIUA 1X7QB 4CVZB 3NZ8B 2VDNH 3FOMA 4LLMA 2X9XA 5C0AE 3FO9A 5DDHA 3VXUE 4FOMA 4I0PA 3TNNB 4QHKI 2XTJE 4YO0A 4YDKH 4MMZC 5LJYH 5BS0D 1JVKA 4LPUA 3B2UD 1Q94A 1N5AB 1CBVH 3O6LH 1A1MA 4EIGB 1FL3A 3MLTB 3FQRA 1CE1H 4JKKA 4A6YB 2XRAL 3OKOA 4PLOB 4U6XB 4PLNC 4AEHL 3H2WA 5JIHA 3ARFD 1L7TL 4WEBL 4K9EL 5CIPB 3OR7B 3O41A 4HEPG 3U1SH 1DVFA 2CK0L 2NY6B 4YHKL 5IFAL 3KXFD 1VKXB 1ZV5A 5C71A 4YHLL 2IGFL 5TE4L 2H6PA 1QHOA 4LSQH 4MD4B 2XV6B 3QJHB 3WXVH 5T1MA 4YXKH 4WJ5B 5H35B 5CEZE 1XFPA 3QWQB 1W2KT 4JEGB 4LVOC 3MLSH 1MCKA 4FZEL 3LZFH 2XTJC 1ACYH 3BSZH 1BGXH 3GJFH 4U6VH 5IHZB 3BQUD 1QLFB 2E7CA 5KVEH 1ACZA 4NQCD 3TVMC 5FYJL 4JO2H 2GW5A 1WZ1L 4W4OC 3G5ZB 1J88A 3I6GA 5F9AC 1KJMB 4YDKL 1FC1A 4U1MB 2D7OA 2YPLB 4H1LB 1BFTA 1JI2A 1MLBB 3IXTB 5DJ2A 3ULVL 5DI8A 1CBVL 3O6LL 5F1SA 2PO6A 4AIZB 2E5EA 5EZIH 3HB3D 1BZ7A 2ZP0T 4ZYKA 4Z7WB 1FLRL 2FL5B 4MSWA 3QIBB 2BMKA 3CFCH 4YJZL 1I9RL 1I1CA 4X6FB 2VLJA 1CE6B 3G6JE 4NNYB 4PJFA 4Z76B 4HKZA 3UTTD 1LP9E 3BPOC 1KV3A 3L5JA 2EH8L 5D2NC 5FM4A 3WXVL 2KDGA 4FP8L 1Q0YL 4OI7A 3C2SA 4ZTPH 3QRFM 2OR9H 2CIIB 3BEVA 4NN5C 1MWAL 1IKFL 3S96B 2AKRA 2W65B 4UQ2A 3IDIA 4DUXA 2XZCH 4QRRB 3I2CH 3LZFL 3ZL4H 2CJUH 1ACYL 3BSZL 1BGXL 4U6VL 5MEPA 4L1HA 4NC2B 5KVEL 4YX2L 3O8XC 1UB6B 3MNVB 2N56A 1UXWB 1CL7H 4TSBH 2FO1A 3I6LE 2OMNA 3LKRB 1ZVHA 3VXPA 5SX4I 3VCLA 1EXUA 2DBLH 3LB6C 3D0LA 3OKKA 4WFFD 3P4MB 2QR0B 2J88H 4G9DA 3TH2T 2FO4B 1JFQL 5D7LA 2C3HA 4M03A 3OR6A 1NDMA 5BVJA 1H0DB 4ORZC 4OI8A 4X7FC 4WI6A 4I18C 3T65B 5K93A 3V5HB 5ILTH 1KJ2L 4JFZH 3F5WA 4MMXC 1D9KB 1KLUA 5JMOC 1DEEA 2VLRE 3GMMB 4XZUB 2J8HA 4OD2B 3F6IA 5JO5B 3C9NB 4JN2B 4LLQA 1AQDA 4TVSa 1UKTA 4ZTPL 1Q72H 2OR9L 4LKXA 1R24A 5EO0A 5DD6A 3PJSA 2CO6B 3GSUA 2DDQH 4RA0C 4G43B 5EA0L 1P4LB 1IFHH 4WI7A 2VDQL 1QR4A 4FHBD 1CLYL 2Y6SD 2I26N 1A6TB 3TBSB 4TSBL 3N50A 3UZQA 1RHHA 2DBLL 5DF0A 5DJXA 5E8EA 4B53A 2CLZB 3P4NB 4QHUA 4X6DE 5DUBA 3BP7A 1N2RA 4CJ1A 2HT4C 1G7MB 2W59A 3QDAA 5ILTL 5HGDA 4RGMC 5FO8A 4JFZL 4XP4L 3ARBC 1MREL 3LKQB 5DJ8B 1T4KB 2NX5A 1L9NA 4XNYH 4NCC2 2IH1A 3W0WD 3FO2B 3HG1B 5F7HA 3BJLA 3HUJF 4APQC 5D2LA 2NXYC 4JLRB 2DQGH 2BNQE 4JRYA 2F74A 4OIIH 5JHDA 1AHWC 2D4DA 1LEGA 4UDTA 3KYAA 5DRNA 3V6OA 1PY9A 4JFFD 2G5BB 1OW0A 3SDAB 5F8QC 5FOJA 4LLWA 2ZUYA 5C07A 3U7YH 4Q6IB 4EDXB 3TPKA 4PRIB 3OF6A 1BVLA 1CFTB 1MCRA 1QBMH 3UJIH 2FIKB 5C0AD 2DM3A 5IIEA 5K59F 2BCKA 3X12B 1QLRA 4NO2B 4NQVB 3LQZA 2R9HC 3BDXA 5GSVB 2VO5A 5HI4D 4WEUD 1K4CB 5DT1H 3ULUL 2VIRA 3FRPG 3B6SB 5IBUG 4XNYL 1XF5B 1CG9B 4ZOCA 5E8OA 1JNHA 1P53A 1UB5A 4JZOA 4G9FA 3ZE1F 1FVEA 4S1DC 5JUEH 1MJJB 1RZKH 3C5ZD 3MRDB 3QO1A 3TCLB 2DQGL 1S7TA 4FQJL 1BHGA 4GW5B 3WKMH 1F02I 1GGCL 3CDYA 3CJJA 4OCMC 2X70B 3H7BA 2BHUA 3VFRA 3V7AE 3FO1B 4BUHA 3UTSB 3PWNA 3D18A 4MZ3A 3VFTA 4OTXL 4WENB 4ZS6C 4PLKD 1YA5A 4L5FL 5J56B 1LE9B 3U7YL 5GS2D 2EDNA 4RX4A 3KYNA 1ORQB 1JRHI 1QBML 3PGDB 3UJIL 1KB5B 2AP2A 1M05A 5EZLB 4L9DA 2NY1B 4ISVB 1N5YH 4PRPD 4HSQA 1G0DA 1BD2A 3ARPA 2P5ED 3JWDH 4ZD3L 4EEEA 1G9ML 5FGCB 2IALB 3CFKA 4XGZA 3D5OF 3LDBB 4L9LB 4YAQB 3VFUB 4U0RC 2AJSH 1ZXQA 5DJ6A 2F5BL 4AG4H 2R1XB 5GS1B 3PQYB 2DJSA 3QO0A 2PYFA 1MHCA 1UZ8A 5JUEL 3TA3B 3ALXA 4WUKH 2BOCA 5GRWA 5HXMA 5D1ZA 1ZKAA 3HZMA 1TVHB 4AEIL 4BH8A 4LPVA 3KPQA 1SJXA 4M61A 4HXBL 5DR5H 4OSUH 3RTQA 3H3PH 3SJVE 1WIPA 5C0FA 2BVQB 2OL3B 2F53A 4Z77B 5HYIA 1UADC 2X5PA 1X5AA 2F5AH 2Y4SA 2ZPKL 1MJUH 3ARYA 2IEPA 1G7LB 4PGDA 2ZJSL 1WBXB 2I9LB 4NZJA 4NZUL 1N5YL 1C7SA 4KROD 1AGFA 4ZFOA 1KLFA 1Q9WB 1Z0MA 2GFBA 3QEUA 3JWDL 2YEZA 4M1DH 1FNGB 3KS0J 2P1YA 3UZVB 1BFSA 2AJSL 5FYKH 4JFDB 3CDCA 3T0VA 1QFHA 4NCC1 1K8IB 2ZUQB 4ERSH 5HHPB 5FDWA 2XPGA 3V8OA 4Y5XA 4WUKL 2VLRD 2NXZD 4JM2D 5C0IB 1L0YA 4EI6B 1MCDA 5JMRA 1O7SA 2XA8H 4WV1A 1VFUA 5AUMB 4N0YH 1B90A 3W9EA 4OSUL 4N0FA 3H3PL 1F4HA 1YQVH 2DLHA 5SWSA 3GBLA 5I19L 2AV7B 3SN6N 5C0BB 1QUNA 4IMKC 1U2HA 2BNRA 1MJUL 1UJ3A 4L3EB 2CLVA 2XN9B 2IPUK 2B2XL 1DUZA 2ZG2A 2GSGA 3WE6A 1WIOA 3DVFA 2ZOLB 1BVKB 4QT5B 5CBAA 3WO4C 2O5XL 4HUMB 2CUHA 5FYKL 4U7MA 2WIIA 4FTVB 3P4OB 3HR6A 4P9ML 3P0YH 1A9BA 4JRXA 1U93B 3MLRH 4ERSL 4FZ8L 2BSTB 4U4BA 1EEUA 4X6CA 1R5VB 3BPCA 1NAMB 1R3KA 1XR8B 3TV3H 3HC0B 3FB5B 5DTFA 1P9MC 3RWJB 1FNSL 2LU3A 1E4XI 3TFKC 4WHYH 4Y4KC 2CDEA 2CKBA 2XA8L 4HS6B 5E2TH 3NAAL 4ZFZA 4N0YL 5FF6B 4RAUB 3LKSA 2P43B 1IEBB 4P46C 4UTBH 1YQVL 4Y2DA 4MDJB 2BNQD 2EDOA 4LQ1A 2DYPB 3D25B 3VXTA 5BQ7B 5F97E 4M6OH 4JN1H 5JW5A 4NKIL 2AVGA 4LDEB 4HS8H 1PGRB 1DSFL 1MRDL 1F3JB 3PIQB 4L4TA 1JNJA 1XF3B 5HYSB 4Z95H 4U3HA 3WDIA 3QQ3B 1IZJA 2J8UA 1X44A 3CSGA 3QIWA 3V6ZA 4BK4A 5KZCB 1W0VA 3P0YL 4PJ9C 4U6YB 4Z7UA 5IB2A 3NFNA 2D7TH 3FT3B 2R0ZL 3JTTB 1TZIB 3VA2C 4GLRH 3TV3L 4OCYH 3SGJA 4GG6A 1TTFA 3O3AB 5M7QA 2X6MA 3QCVH 4OZIB 4G7VL 1UWXH 2BVPA 3WLBB 5D72H 4CDGC 3OJVC 4U1GB 1T5XB 5T5NF 3CLEH 4Z0XB 5E9DB 5K9OB 4UTBL 2XWJB 5KVGH 4UB0H 3VE0B 1G84A 3F62A 4M6OL 5J7CC 4ZSOE 1WTGT 5EOQL 3L3JB 2ICWI 2MFNA 4NKQB 2IPUG 4HS8L 5F88A 3L3KA 3QRGL 3ZKMC 4KJPD 2H2PC 1HQ4B 5E8PA 1G7HB 4Z95L 1KBGL 5FHAH 3DV6B 3WIHA 1NPUA 1JGEA 3U48A 2QADB 4GJTB 5D5MB 5EULV 1Y18A 4JVWA 3V6FB 1WZLA 3HTLX 2H32A 5BRZD 2D7TL 4LK4A 5JOFB 3RZCD 1OT1A 4K3GA 5I1DB 2X4UB 4M1GH 4OCYL 5IK3A 2NY4B 1TJIH 1A9EA 4C55A 1U8KA 3EYQC 4LASL 4YK4C 4PBXA 3TWCH 2GY7B 3G5XB 5EU3B 5I18H 1RZ8A 4MD0A 4N8VB 4DFIA 1AH1A 1LMKA 3CZJA 3O11B 3CLEL 1DBKH 4GRLA 1W72L 4U1HB 3ETBF 5KVGL 4UB0L 2HYMA 3MRRA 4ZAKA 1VESA 2HVJA 5FKAB 3QDGE 2DWEB 3ABZA 1YECH 5TPWH 4PJFF 2OK0L 1BZQK 1H3WM 1I8IB 3S35H 3WS3B 1RK1A 5DQJB 1MCNA 2R4SH 4XMPH 2CGRH 2X2YA 5HI3D 1IQDB 1U8IA 4HWEL 5FHAL 5JOPD 1XMWA 2BVOA 4QTHA 4MWFA 5JXEC 1F58L 2YD7A 4HUVA 4KVNH 4Y1AD 4UDUB 4P23B 1YY9D 2NY6D 4NWUH 5SWZB 4M1GL 1PBYA 4I3SH 4ODTH 3U4EB 3MRBA 3OKMA 4KZDH 2R23B 3HE7C 1VENA 4LF3B 3DYOA 3U9PH 1YUHB 4HH8A 1A1NB 1AC0A 4K71B 3TO2A 5ICYA 4JKPL 1A14L 3ZHKA 2FX7L 1WITA 2IFGA 2WWKT 5EU4A 4HD9A 4G7YL 1LVEA 3PP4L 2IBGA 3ELAT 1YECL 3FOLB 2X89A 5TPWL 1U8QA 4JY4B 5HYQA 1KCRH 1PDKA 3T4YA 2EKSB 1S9VB 2YPLD 4MS8C 4IMLB 3E6HA 3X3GH 3ZKXC 2R4SL 3EW3B 4CL7A 5E08H 3Q3GA 4X7SH 1CICA 2A6KB 4ZUWB 3RU8H 2GKIA 3D2UA 1BBJA 5E2UH 1D6VH 2HJLA 3L3DA 4JFHD 5EIVA 1N4XH 3JWOH 3U46A 3QDMA 1ITCA 4OFYD 2AABH 4ODTL 4Q97A 4MQ7A 4KZDL 2UUDK 1F6AB 4OZHB 5DDHB 1RJZA 3U9PL 3MGOB 3V52L 4QRRD 1BOGB 5EC1A 1JWMB 3ARDC 2YC1B 3C2AH 3EJJX 4IRSA 4HKBA 4KK9D 1I1AB 5ICXA 5KTEH 1AJ7H 3NIGF 1BF2A 1FG2A 5BCAA 1A1MB 2X4OA 3FQRB 3REVB 3OKDB 2X1QA 4KKCC 1HHKA 1KCRL 3GSNH 3QG6A 3H42L 1EH9A 1VCAA 4V2BA 3X3GL 3NCJH 4M62L 4GMSH 3S35X 5DGQA 5I6XB 3FT4B 5GJTH 1ONQB 2BNUA 3LIZL 1J9CT 5E08L 2QJDA 2H6PB 5D2LF 3H9YA 4X7SL 3DETC 5JW4R 5T1MB 1BQHG 1HSBB 5E8NB 4WO4A 1Z5LB 1IMHC 4OV5A 2VLLA 2AEPH 3SDCC 2LVEA 1LEIA 4G6JL 1QEWB 2YUVA 4OM0H 2D3VA 3HUJE 1TPXC 1II4E 5D8JH 1ADQH 2MJWA 3DUSB 3L5HA 3JV6B 1ZT1B 2XWTA 4X7EC 4PJCA 3SEPA 5JPNB 3IU3B 4CU7A 2MTPA 3C2AL 1F3DH 4LIQE 1H8OA 3KYMB 4JGJA 4R9HA 3OG4B 5CEXB 5KTEL 5CEYA 1AJ7L 1CDYA 1PSKL 4BH7A 2Q7NA 1H5BA 1XZ0A 4PTUB 4LVOB 3RHWF 1KPVA 1QVOB 1A6UL 1GIGH 2APWA 4LNVA 2AEIT 3VXUB 3V9FA 2GJJA 3NCJL 4GMSL 4RMUA 2XTJB 4PJGB 1JNNL 4UI2A 4KK6C 5GJTL 1BFVL 1ZHBA 2A38A 5E5MA 2E6QA 5JORA 3MRLB 4V1DA 15C8H 1L4IA 1U8MB 3BEVB 4BSWA 4XTRC 1EO5A 1QOKA 5E70A 3JV5A 3DGGB 2QV2A 2A6DA 1NFDA 4OM0L 3ZE1E 5C6PB 1ZGLB 3TBVB 5D8JL 1ADQL 1LK3H 1M1SA 3LV3A 4DCQB 1MWAA 3HG1D 3E8UH 3NPSB 3EYOB 3M45A 1XF2A 2Z4QB 3AXLA 5IR1A 1OTSD 4HIHB 2OQJA 3V79C 1Z9OA 2UZYB 3BPOB 3JV4A 5D2NB 1MQKL 2YUWA 4K07A 3PHQB 5JIPA 2B5IC 3SDAD 1ZHNA 4NN5B 5E8DH 4XP9H 3MV8B 4Z6AT 2FZ3B 2O93L 1JN6A 3RIFF 4KUCF 2YK1H 4DZBA 4PRID 5TDNA 2DD8H 4L8SC 2CRMA 3CX5K 3U83A 3O8XB 3FQXA 2J8OA 1BAFH 3HLAA 4P5KA 2DJ4A 2Y36H 1OT2A 1ETZA 15C8L 1KJ2A 2XQBH 1P5UA 3EOBB 8CGTA 1KXVC 2XTLA 4FQ1H 3RVUC 4JDZA 5DD6B 4CAGA 5A2LH 1FYTA 3E6FB 4XNUL 2GITA 1NGPH 4NQSB 4J4PC 2AV1A 5GGVL 4TNWK 3KYKH 1CVRA 4GBXC 4UV7H 1JV5B 1HILB 3HZVB 4LCWB 4I18B 25C8H 3DX8A 1D5MA 2YD6A 3SCMA 4X9IA 1UM4L 2FEDC 4QHUB 1B6DA 4AYFA 5EBGA 2JJTA 1X4ZA 3WJJC 1VGKA 3UTSD 2D03H 1CIUA 1YEFL 3FCTB 5E8DL 4Y7MA 4O51B 3V0VB 4XP9L 1IC5L 1T89A 5T3XE 4KI1A 4JAMB 2YK1L 4ZUUA 1FGNL 4M5ZH 1XGPA 1MVFA 3ESUF 2DD8L 1TTGA 1R5WA 1IZKA 2NY1D 4WWID 1BAFL 3L95A 1F4XL 3EOAA 1JK8A 2Y36L 4H1LG 4P5TA 3TC9A 3X11B 1RV6X 2XQBL 1WISA 1FGVL 1QSFA 4FQ1L 5GSRA 2VSDA 5HHNB 5I17B 1PEWA 5ID0A 4JRYB 1KJ3H 3S36H 1ZA3B 1F00I 4K94L 4Y0GA 3IDJA 2R1YB 2BOBB 2VAAA 3O2DH 4PGCA 4UV7L 4YIQB 3OXRB 3WSQH 3S88H 5J06A 3TA3D 4G42A 4FXLA 25C8L 3EO9L 3GMRB 1FP5A 4FRWA 4RGMB 1OP5K 1YY8B 4HH9B 1AGCA 4Q6YA 1VGEH 3ARBB 3LSOA 2CR6A 2WZPD 4L4JA 4NQTA 5HYFA 2A9NH 2E9JA 4WWKB 4LRNH 5I1EH 5CHNA 4ZOBA 1YDPA 2N1KA 3BHBA 1A4JA 4LBEB 4OAWB 5SX5K 4APQB 4JFPA 2NXYB 3TN0A 3MYZA 5MP6H 2BC4B 2UV3A 3DXAE 1AHWB 4OZGA 4X6CF 2FRGP 1I9IH 2F58H 3O0RH 3WJLC 4YDVB 3FZUC 1R3LA 5DS8B 1MELA 1EVTC 4MJIB 1MHPL 4X4MA 1B2WL 1IILE 3RWCA 3WFDH 5I75C 3RNKB 1FFNA 1TQCC 2NNAA 1RZFL 3OJDB 2YPVL 2G5RA 4I9WD 4NQDB 1JHLH 4PJEA 3S37X 5J13C 5E2WH 4ONHA 2OSLB 2R29L 3SDXA 3GIVB 3VFRB 2OX5A 1DDHB 2I5YH 3PWNB 4X80L 3D18B 2Q76A 3KPRB 2APBA 1AP2A 1OQXA 5DJAA 3J7HA 3O45B 3VFGL 5EBLB 5ISZD 1MI5A 4P59H 3RKDC 5LAXA 2J8UF 4K8RH 4MHHG 5JHLH 3P9MA 1RZKC 2E7MA 4H25A 4Z7UF 1M7DA 1M7IA 4JO4L 4J3WA 4HJJL 3WIFA 2QKIA 4L3ED 1U3ZA 2XN9D 3VW3H 4LCUB 4MNQA 4NKMA 1UQSB 2VE6A 4XVJH 4X5WA 1OP3K 1ODAA 4GG6F 2Y23A 3LMJH 2VN7A 4XVSH 1MHCB 4TUJB 2Y07L 4ZXBC 3OMZA 3QUZD 3WFDL 4O5LH 1XCQA 2ORBH 1HH6A 4LDLB 4XCCL 1EBAA 4FTVD 3VGBA 1YNTA 5HD8C 4JDVB 4KK5D 1S7VB 2ADFH 12E8H 3HZMB 5DLML 5E2WL 3S3SA 4O4YL 3O2VH 3S36X 4M61B 1KTDA 5IVXB 1JRHH 2X4TB 2I5YL 3UBXA 3VFWB 1KNOB 2BSED 1CWVA 2EYRA 5FO9A 2ZWLT 3VXSB 3KLSA 5KANG 1G1CA 3QA3B 1IGIL 4RMRA 2OTWA 5CSBA 3B43A 1ND0A 1T0PB 2DM2A 5B3NA 4MNHA 3PWPA 4J3UA 2P5WA 4K8RL 5JHLL 2DYPD 4UILH 4IEFB 4OQ1A 2BVYA 1NGQH 4QRPE 3TJHC 4WI2A 1OGAA 1GZQA 1RJYB 5IMKB 4KJYB 2VXTL 1LEKB 2W07A 5FECB 3VW3L 3Q6GL 5BV7H 5EFIB 4XVJL 1KC5H 1GL4B 2EC9U 2GQHA 3LMJL 4MJ5A 1A4KB 4XVSL 2HRPH 1MCQA 4PG9B 4FQHB 4FNLH 2I24N 2K1MA 4F80A 4O5LL 2ORBL 2UY7A 5C70A 3FRUA 1MHEB 3N0PB 2ADFL 12E8L 4F3FB 1IEAA 3L7EA 3O2VL 1ZLWH 1M6OB 1JTTA 3GEWB 4O9HH 4PB0H 4NKOB 4YXLH 5B38G 5K9KB 1A7PH 1IL1A 3D69A 2WANA 2MMXA 2Y25A 3BZEA 3Q5OA 4M4RA 5EBMA 4OLYL 1SJHB 1DUZB 5EWIH 1AIFB 2VLJE 2BY1A 5DQ9B 3IETB 1HEZA 1NGQL 3G5VA 1EV2E 3LRGA 3VFMA 4CRPA 3BIKA 4UU9B 1YJDL 1ED3B 1CD8A 3GI8H 3NCMA 1HYRC 4QHNB 4HIJA 1VSCA 2R2EB 4EN3B 5EU6A 5BV7L 3D3VA 4R7NB 1A9BB 3OSKA 2ZUXA 5IGXL 1KC5L 2MQ0A 1A7QH 2AJ3A 5K33A 2EZ0D 3GMPB 4JJ5B 5GJSH 4FNLL 2OZ4H 4X99B 5T1LB 3BYTA 1RQ5A 5C0CA 1I7ZB 3QG7L 3Q0HA 4DK6A 1A2YB 5KS9B 1J0IA 4UT9H 2X10A 5FCSH 3QXUA 4HGKC 2PO6C 4U3CA 2GK0B 2YSSB 3I3BA 1YMMA 4JPVL 5FK9A 4X0KA 1OAYH 4O9HL 4PB0L 4XMKH 5F8RC 3FL7A 4WHTB 2NY4D 4HFWB 3T3PF 4AM0A 3V6BR 5CCKH 1P69B 2QSCH 2Q6WB 5IV2A 2MPAL 5C0EA 4XVUD 2CPCA 4LPXA 2EDQA 1UG9A 1IGCH 3PDDA 3B9VA 1UM6H 4S0TD 1ZLUK 5GHWH 3WCYA 2DWDA 4GMTH 3M1BB 3LRSB 1J0KA 3B3IA 2FHBA 3GI8L 3QDJB 4X6EB 1PX4A 2ZNWA 3MODH 4EQ3A 3V6ZB 5DRXA 1V3JA 1W0VB 3WO3B 4QYOB 3VRJA 5ALBH 3NFNB 1A7QL 1LHZA 3TIEA 1E4XH 5F3HB 4JVPA 4LU5H 2X9WA 3ZT6A 3H9SA 3VRIB 1SJEA 3G5YA 5D1QC 5GJSL 1CU4L 1FZMA 4O58H 1MH5A 4NPYA 5J1AA 5F3BB 5IW1A 2WWMC 1BEYL 1CXFA 4UT9L 3ROLA 4D8PA 5HHOA 2EDJA 1N59B 3C5JB 4J3XA 3SE9H 5DK2A 4P23D 1QFOA 3D85D 1MHHA 1NUNB 2VERN 1TNMA 1XCTA 3T3MF 1AR1C 1OAYL 3BJ91 3EDKA 4XMKL 1K4DB 2OJEA 1OAQL 2BP3A 5CCKL 3MCLH 4X9GA 3ALPA 4AENA 3Q6FA 4UV4H 3MRMA 2CMRH 2ZUVA 3CDFA 2VWEC 1A3QA 4HPYH 3JWNC 1R0AH 4HK3N 1T1ZB 3X3FH 1VADA 4Y8DC 5KG9B 4QY8B 2IC2A 1XT5A 4YC2C 1MCSA 1QA9A 1AR2A 5TE7L 4GMTL 5F6IC 1EFXD 2X7LB 1S8DB 1A47A 1OTUC 1ZT4A 4OT1L 2DMKA 1EO8L 2A6JA 5FYLD 1KB9K 2C4FT 3CZFB 3DIFA 3FHAA 3BZFA 3BIAX 3N1QC 5D2LE 1A1OB 3B5HA 5JHDE 4MDIB 1I85A 4MCZB 5IROA 3S7GA 1P7KB 1RZGA 1EERB 2V2XA 4O58L 1UA6H 1XGYL 4KGJA 3V6OE 4ELMB 1WZKA 4HGWA 2O5ZH 3SE9L 2FBJL 5CJXA 4Q58C 1YZZA 3WD5H 3VXRA 3AS2A 4YDIL 4LSSH 5TQ0H 1EEYB 2LABA 1XGUB 3MX0A 5EUKA 4N5ED 5C07E 4NQEA 5IUSA 3NACL 1KJVB 1ZAGA 1CFSA 1QTYT 2Y06H 2D4FA 5CLWA 2EDBA 4J3SA 5AD0A 3ULVF 1PKOA 3K7UA 3RPKA 3OX8A 1NLDH 2BSRB 1KFAH 2CMRL 4I0PD 2Z9TA 4PJDB 1NCUA 1FSKC 1W72A 1C7TA 1KEMH 2ILLA 3LEVH 2BVEA 1RK1B 2DQEH 3O3DA 5D9SA 3X3FL 5J11B 2AJZB 2DQFB 3IS1X 2ATPA 2FLRT 4FA8A 1VFBB 1FO0B 1PKQB 1RJLA 4RFEB 1SEBA 4YK4B 2BSSA 1KTKE 3CUPB 1DBAH 1NFDF 3AFLA 4HFUL 1SMAA 5EZOH 3V6OC 1D6EA 4KKLC 1DVFD 5E1AA 2HJFB 1C16A 5EORH 5GGTH 1QBLL 1OW0C 1I7RB 1IC7H 2ESVA 4RBPH 1KIRA 3MBEA 5HYSG 2O5ZL 4LLDB 3IFPA 3WD5L 4NDMB 4LSSL 4NGHL 5DD5H 2VDOH 1B0WA 2ZSVA 4P2QA 4M6NL 5I15L 3BWUC 3MFGB 2Y06L 4U1SB 4ODHH 3BP6B 1MAMH 2P8MA 5TF1H 4K3EL 2YD3A 3FQTA 2YRZA 1BD2E 4XP5H 5DHVH 3LEVL 3SE8L 3E6HB 4XHJC 2OTPA 2YBRA 1ZA6B 5EO1A 1RK0B 3RWFA 1EHLL 3RI5K 3DO3A 3CXDH 3N1PC 1JMXA 4GRWF 2GYSA 1B4RA 1I9EA 3KLAB 4GAGH 3HE7B 1NGYB 1YQ2A 3DSNA 4WTZG 3U0WL 1OM3H 3RNQA 3QDGB 1GYAA 1FFOA 1IQWH 4LPWA 3PV7A 4X5XA 5D7KD 2HJLB 5DD3H 5GGTL 2NTSP 3NFPA 5JIIA 5AZEL 5KN5B 4QRSB 1JHTA 1T5WA 4EVNA 2OJZH 3G6DH 4KHXL 1OGTA 3CSBA 1UVQB 3T0DA 5SV4A 4Q9QL 3RX8A 1UT9A 5SWQB 3ALWA 3MBXL 1B0RA 2F53E 3ZKXB 4ZG1A 2VDOL 1QSEE 1EZVY 1E4JA 5TE6H 4Q9BA 4TVPE 4R4NC 3SQBA 1JE6A 4ODHL 2VKWA 1HHJA 1MAML 1U91B 4F7CB 2DQDH 2RR3A 5I8KL 5TF1L 5JQ6L 1SJVA 4U1NA 3NIDF 4QTIH 1R3HB 3FN0L 5CZXD 5IWLA 3OZ9L 4NKDB 3GSXA 1JPTH 3JWOC 2I07A 2BNUB 2NLJB 4HDIA 3O3EA 2APVA 5D7LD 5LXGH 2RGSA 1B0GB 1S7UA 1BPVA 3FMGL 4GAYA 3NCEB 3QPQD 1Q1JH 3HNTL 5EN2A 3GJEB 2W9DL 3RVTD 3V4VH 4WNQA 1EUTA 4O2CB 2OJZL 3G6DL 3QSKB 4YZFF 2XWTB 3PWLB 4AH2A 1J10A 3MNWA 4PJCB 3OWEA 4WFEE 5HI5D 5SWSE 3RL1A 2V5TA 3R06A 4X8JB 4PV8A 3C6LC 3RA7H 2BNRE 3PWUA 3GUTA 3UROR 5IEKB 3MLXH 4A6YL 3FONA 1U41A 4LCWD 5KSUB 3HS0A 3TNMA 4GUPB 1UM5H 2DQDL 3OKNA 4OZGF 2OYPA 3WL9B 4YFLF 2V5SA 3FJTA 3SDCB 5D7IA 1FAKT 4Y5XC 1JGLH 1EAPA 3QI9C 3ULUF 3BRFA 1ZHBB 3QNZA 5DRZB 2B39A 1R3JB 5LXGL 3UPRA 1IVLA 1FFQA 4FQXC 4PJEF 4V2CB 3EYVA 1AXSB 3QYCA 1IAKB 1FL5A 4X6CE 2QTEA 5IFHH 3MTRA 4QHLB 2VL4A 1YN6A 4XPFL 3SDXF 2ZNXA 3PWJB 4N1HB 5FKPA 1FCGA 4MAYA 2NX5D 4IOFD 1A8JH 1WBYB 3BVNA 4Y16A 3V4VL 4HIXH 1CGTA 4OZ4B 1XGTB 4O02H 4L8BB 1DE4B 2HKFH 4ETQB 4LCYB 1XF2B 4MXWL 4JRYD 3GJFB 3AXLB 3FTGA 3LS4H 2AJYH 3O9WB 4HWUA 4AMKL 2VLME 3QQ4A 1CIDA 3OAYH 3MLXL 5EOTA 3QEGH 3ES6A 5D6CB 1UM5L 4ENEC 2JB6A 3MV7E 5DVNA 3IXAB 5A3ID 1I8MA 5C07D 3B8SA 1JN6B 3UPAA 4I48A 2H8PA 2J8UE 1T0MA 4FQ2H 4N90E 3BIBX 5I8EB 4WWKD 1D5XA 1AXIB 3C6SB 4UQ3B 4Z7UE 4DGIL 5AAWA 5F1NB 2FX8L 2NY3C 3MJ8A 5INCA 1CFQB 1EJ6A 4O2FA 1CFBA 2UY6A 5ADOL 5D1XA 3QUXC 5GQBA 4PJHB 1G7PB 1MCWW 4GG6E 4TTDD 1T3FA 43CAB 1NBYA 2AV1B 1UKQA 2VDPH 4Q9CA 4G9FD 4YPJA 5F89A 4RNRB 4NQDD 3PDOA 1AGBB 3O4LA 5JLZB 5HGAA 2W9EH 1PYWA 4OCXH 1IBGL 3FRPA 4NNPL 1XEDA 3KPRD 4ORGA 4J6RL 4MQXD 4HS3B 5FOBA 4WVRA 4RX4D 1V05A 4ZUUB 1QP1A 1DQJB 4FQ2L 3SGJC 4UTAH 3CFEB 2AQ3A 4GBXB 5I1AB 1GXEA 2HH0L 3G08B 5EPMB 4YHZL 2IH3B 4I2XB 3HC3L 3BGMA 1K3ZA 1FBIH 3OHXA 3L6FA 4KUCD 4Z18A 3K8LA 2VDPL 3UP1A 2BRRH 3HZYA 4P0DA 2P4AB 4G42B 3ECBB 1RZJH 2Z8SA 1ZHLA 1ZS8A 3DVNA 3QNXA 3DX7B 1OD9A 3MJ9A 5D1ZD 1GZPB 1FV1B 4YR6B 4W81A 2IAMA 1GJIA 4E5XA 4OCXL 3RTQD 3TYFA 5I9QB 1H3PL 2DKMA 1R5IA 3WEXA 3GGWB 3I85A 1BMGA 2VUYA 5DEZA 3CK0H 2VZSA 3AREC 3MRJB 1CN4A 3HMXA 2L0DA 1MUJA 2NW3A 5TDOA 4UTAL 4HIIA 3QJFA 4LSUH 1HSAA 4NT6B 1YNLH 4OIAA 3R8BB 5J6GB 1F90L 1C08A 2JTDA 3T4AA 3WFBL 4OGXH 4WW2A 1FBIL 3MGTA 5HHME 4HKXB 5MI0C 2GTWA 3M8OL 3B4NA 3GBNH 4ZAKC 3SDXB 5KVDL 4GG8B 4GKOA 1T0NA 3WFEL 4I8DA 5JW4M 1AP2B 3CU7A 1CD0A 4YDJB 3C08H 3RHWK 4DOHE 4F7TB 5GISH 1XGRA 4QRTA 2XKNB 4D9LL 1CD1B 1PZUB 3SKMA 3GMQB 3WFZA 3WN5A 5AG8A 3P0VH 2BXZA 5SWSD 2FWOA 1HINL 4LSRH 3O2WH 5I75B 1PG7H 3O3BA 1TQCB 1Q8MA 1QRNA 2JIXB 3NCYP 4IRZH 5KSVB 3RX7A 1P4BL 4LSUL 1YNLL 3H0TA 4X5WB 2IJ0C 4KU1A 4HJ0C 5I1KL 3BKJL 4M9PA 4ALAH 2HMID 4FS0A 1DQDH 2PCPB 5E6IC 4PJXA 5LG1A 3DO7A 3QDME 3B9KA 5MENA 3WKNA 4EN3D 1IM3B 4PG2A 3PL6B 2RHEA 4JRXD 1J05B 2VISA 3MLVL 2ED8A 4X4XA 3GBNL 3GMLA 4HG4K 5IMOA 4D0BB 2D0GA 4M7JL 2W9LA 4LOUD 1XIWA 3GSQA 1JPFA 4WU5B 3DVIA 2ITDB 2OM5A 3KVQA 3SPVB 5CSZA 2Z31C 2J7LA 5FO9B 2Z8VC 1AD0B 3C08L 5CBEA 5GISL 1L6XA 5C9JA 3RIFK 4CMMB 1NGZA 2PR4H 3MV9A 2VNCA 2XZZA 2QSTA 4YHOH 1CICC 3MJ6A 1RJCA 4Y2DD 5CUSH 1EZVX 4NP4H 3TZVA 4Y4HA 4ZXBB 1J0ZA 4LSRL 3O2WL 3ZKQD 3LN4B 4IIQB 1T20A 4GQ9L 2YXMA 5IKCB 2UWEA 5LQBH 1MCBA 5B8CB 1ZEAH 2H1PH 2O61A 4WI5A 4BFIB 4XXDB 4L4TD 3W9DB 2W0KA 2X09A 3TT3H 3H9HA 1N8ZA 1K8DA 5C0JA 3ZDYF 4XVTL 3T0EE 3MRCA 4JY5H 1DQDL 3QDJD 4NRZA 3QIWD 1U92A 2XKUA 3FRUB 2FCBA 2YWYA 4FABH 3V4UH 2RAMA 3P30H 5T1KA 5CD3A 2YD9A 3F7VA 2NTFA 4XRCB 3AAZA 4UZGA 1GCFA 1S9WA 4QRUA 3RL2B 1M71B 5JDJA 3LKOB 1G0YR 3MA7A 3VWKB 2VQ1A 2XZQL 4IDJH 4OGAC 2PTUA 3CFBA 4NM4H 2AGJH 5CUSL 4R2GB 1FDLH 4KMLB 2L7JA 5C6TL 1IGTA 4GSDH 5JR1H 3C87A 4JM4H 3T0EC 1HHHA 1PG7X 2WSKA 3FB6A 3BD4A 4KMTH 5LQBL 2H1PL 4M43L 4JDTL 4V1DE 5EU6B 4R4BB 4XI5C 3MO1B 4QHKJ 1GVIA 1A6WL 1SBBA 3C5ZA 3LQAL 3BUYB 4WUUA 1IKNA 3SY0B 1NFDE 4JY5L 4HK0B 3IFLL 3RWDB 4QXGL 1FZKB 4HPOH 1JZ2A 4QRPB 2XT1B 5C0CB 3RIAF 2YN5A 4FABL 3V4UL 2E27L 3BW9A 3P30L 5FM5M 2J12B 1F3DJ 4C83B 4HGMA 1U3JA 5F1OB 5FK9B 2NYYC 4EUPH 1H5BC 1J1PH 4Y8AA 5HGBA 5GGRY 2DICA 4G8IA 3WS6A 3RGVA 1QBBA 4XPBH 4EBQH 2DM4A 3ZDXF 5DFTA 4RFNC 2ZCKH 3QEQA 2CXGA 4GRLD 2P5EA 2AGJL 4YH6A 1KULA 3L9RB 5F7DA 5DUPH 1SBSH 4F7EA 4KMQA 4GSDL 5JR1L 4HXAH 5KVFH 2NY2B 3KPOB 4LP4A 1FVCA 2G75B 5DRXB 4RWYL 1H3TA 2HTKD 4F7MA 4OCRH 4GRWE 1MCIA 3QHFH 3WLWC 3TJEH 2ERJC 4XPTH 2IQ9L 3AS0A 4W70A 4HPOL 4NPYB 4JO1H 1IGFL 4R3SB 3P73A 1JZ4A 4KDWA 1JHKH 5I1GH 5TDPA 4DW2H 5KSBA 3MV01 1G6VK 1T2QH 3EO0B 1E28B 5HHMD 2NMSA 1CR9H 4MD5B 4HMDA 3RWEA 3A67L 4I3RH 2VDMH 4EBQL 4P9HH 3MLYL 3DV4A 2AK1H 2A74A 3VXQA 4WY7H 5H94A 2EDYA 1MIML 5D1QB 2ADJB 4NUGH 1RZIA 1AD9B 4H26A 5DUPL 3NIDE 1SBSL 4IHOB 5CJ8A 2VDRL 4U6HA 5KVFL 1TNNA 1ZT4B 1INQA 2B20A 4PR5A 3BYYA 5C8JA 1FJ1A 1BFOA 1QQDA 1QSFE 4C56A 4JZNA 4K7PY 5HY9B 1TQBC 5I8CB 3VXNA 2NZ9D 5TFSL 4DFHA 4JO1L 1FNAA 4U1JA 5T3ZE 3QULB 3DGCR 4KKBD 1JHKL 3P77A 4NN7C 3D2UD 4Q74A 3BH9B 4LSTH 1C12B 2BERA 1U3HC 4DW2L 4H0IA 3IJYA 1WVZA 3W5NA 4YZFE 1T89C 3GRWH 3HE6C 1CR9L 4ONGL 4I3RL 4RDQG 2VDML 3OX8B 4JPIB 4P9HL 4QHMB 3NTCH 3OKLB 3U2SB 2VB5A 2PW1A 4N0CD 4P5TC 4WY7L 4IRSD 1AE6L 1KN4L 2IQAB 4QXTA 1G0XA 4NUGL 4LARL 2LU4A 3BO8B 4NZDA 5ACZA 1WWAX 5KSAB 2BSSB 2FH8A 3BKCH 4ODVH 3ULUE 4MCYB 3C60C 4X4ME 3I50L 1T1XA 2D7MA 5GS0H 4RGNE 5HVFB 5C08A 1C16B 3VFOB 4PJEE 3KPNA 1F97A 1KIRB 1G6RH 3TCXA 4I77L 1JPSH 2EXYC 2PYEB 4WO4D 1FIEA 2ZUWA 3IFPB 3KNBA 2DQTH 4UNTA 4KQ4H 2F54A 3TBWA 4LSTL 5TH2A 2AXGA 5D6DC 4U1KA 5DEFA 1WT5A 4PBVC 3BXNB 1JF1A 5J57B 2ZSVB 3P9WB 4CKVX 5IB4B 3FHQA 4HWBH 1QPPA 3SOBH 2H45A 4D2NA 2AXJA 3T77B 2ICWA 5E56A 3NTCL 4ELKB 1BQHA 2XNAB 1NC2B 3IKCA 1C5DA 5JW4N 3E2HB 1P7HL 1LO4H 4PGZA 5DSCB 1ZGLP 5FYJD 1I1FA 1SYSA 3WFHA 2JK5A 4RGNC 4WIQA 3VXME 4MNQE 4H5SA 4YFDB 2EE6A 3QUKB 1BIIB 1P5VA 1JWUA 4PJBA 5F7NC 6CGTA 5B39A 3RNQB 5F1IA 1J1OH 2I25N 3ULVD 2ARWA 5DMIH 1NH6A 5F9WB 5GS0L 5J6HA 1S78C 4XC3H 4YBLC 4B5EA 1S7XA 1CFVH 3NFPB 4K3JL 1G6RL 1U8OA 2A6IA 3MJ7A 1JHTB 1NCTA 1MFCH 5ERWA 3V4PH 3RQ3A 3EJZD 1OAXH 4KQ4L 5GGTA 1OAUH 4JZJA 3DBXB 1S7SB 3QUYA 4HWBL 4CMHC 3EGSA 4X5LA 2D0FA 3DROB 3SOBL 3AS3A 3PWPE 4NOFA 1EHXA 5IVNA 1E6OH 3CC5A 4H20L 4Y2OA 5DFVD 4KZEH 5B4MC 1LO4L 2NY5H 3O9WD 3GSVA 5EUOA 1UXSB 5DRWB 4HX1A 2X4PA 1VEMA 4BYHA 2Y1VA 2G2RB 4KK8C 1IM9A 1K5NA 2ADIB 1I3RB 1K6QH 2A9ML 2WBJA 4GXUM 5DHVA 4KQ3L 1S9KC 4CNIA 3RZCA 4N0UE 4WHCA 1J1OL 4JG0H 1ZE3C 5DMIL 4XC3L 3LN9A 3VFVA 3QWRA 1CFVL 4LLVA 3B5GA 1ZANH 3CXHK 5CD5C 3RPIB 5IM7B 3V4PL 1OAXL 4OFKA 3EBAA 4P2RA 2J4WH 1OAUL 4KI5C 1X7QA 1FYTD 2CLRA 4CVZA 3NZ8A 4PV8B 5JW4Q 4Y19B 4EJ1C 3TNNA 5CJOL 1HCVA 3SCMD 5IQ9B 1OY3B 1N5AA 3WNNA 2IADA 5D7IB 4A6YA 4U6XA 1QSEB 1T22B 3HI1B 3D3VE 4G8EB 3GSNB 4WW2F 3G04B 5CIPA 3OJMB 3OR7A 2R2HB 1VKXA 4JG0L 2VXUH 1IAII 5ADPH 2XXMB 2UZIH 3C6LB 4MD4A 3QJHA 1J8HE 3DLQR 1ROWA 4WJ5A 5H35A 2GJ6B 4ZO6A 4Y5YC 1AKJB 5HPMB 1YMME 4E41B 1U8PB 5IHZA 5GGQL 4J8RA 1QLFA 5J3HD 3O4OC 2ZOKB 2R69L 1C1EH 1H3GA 2XY1A 3OPZH 2P49B 4G6KH 3QI9B 1X5LA 3G5ZA 5HVGB 4LKCB 1KJMA 3ES6B 1IARB 3EUUA 2FECI 2ID5A 4U1MA 4KWUA 3RDTA 3CMGA 2YPLA 1MLBA 3IXTA 5F6HI 2JCCE 1RIUL 4AIZA 4M7ZC 4Z7WA 2FL5A 4HKJB 4K23H 1D5XB 4QXUL 3QIBA 1OPGL 2A73B 5FUZL 4ZDHB 4PJXF 3KAAA 2AXFB 5INCB 3TN0D 4X6FA 3ZT5A 1IT9H 1CE6A 3H9SE 4OV6F 3SKOB 4NNYA 1BX2B 5D1XB 1V3LA 5L0QB 3ZYIA 3CMOH 4AL8H 4LSVL 1PLGL 5HHOE 4XWOD 4FQPA 4NJAH 4OFIA 3S96A 1L7IH 4KHTH 2W65A 4HUXB 4K7PL 4QRRA 3AM8A 3ULUD 2ZCHL 4M7LH 3MLUH 2N4IA 4RMSA 1S7QB 5CEZL 4OBRA 4XAKE 5ITBH 1GHFH 4UIMB 1C1EL 3OPZL 1UB6A 5I73C 2FB4L 4XX1E 5MEQB 3MNVA 5CS7A 1UXWA 3GSRB 5ENWA 3LKRA 5CZKA 5EU5B 1RI8A 2FR4B 2UWEF 1SQ2N 3QUXB 3UDWA 3P4MA 4XBPB 2QR0A 2HT2C 5E24E 3MQIA 3LEXB 4WDIA 1MI5D 2FO4A 5I0DA 5EIQA 2ZSWB 2BY3A 1H0DA 3QUMH 4F33B 5K9JL 4C57C 3V5HA 1HNGA 4JJHA 3Q5TA 1IT9L 4HMEA 4F8QA 1D9KA 4L8CB 3GMMA 3BGMB 2JIXD 2XFXB 4XZUA 1LE5B 1WUNT 4X9FA 2RBLA 4LGPB 3CCHB 4OD2A 2V5YA 3C9NA 5HHXL 4JN2A 3ZSTA 4BUGA 5JO5A 3CMOL 4OD1H 4K2UL 3ZDYE 3IF1B 4KHTL 4LHUA 3VXRE 5AG9A 3C09C 1WZMA 4JRWA 3MLUL 4GS7C 5DZLA 4G43A 1P4LA 3K0WA 1IAMA 5F7LB 5I1HH 3PL6D 2VXVH 1RIVH 2EECA 5EIIB 4S1SL 1MRFH 1A6TA 3NA9H 2QL1A 4XAWH 3TBSA 3QCUH 3UTPD 1TFHA 1GAFH 3FO0H 4G6FB 1BQLH 1MEXH 3Q1SH 4J3VA 3WEXB 1I1YB 1HQRB 2CLZA 3P4NA 4ESKA 5DK0A 1C5BH 2JE8A 4R96A 1I85C 1KENL 5DHYB 1MUJB 4KUZL 2P5WD 4YQXH 3QUML 1G7MA 3LD8C 4ZXBD 1RZJC 2JJSA 2A1WH 5CJXC 4KH2A 1EBPA 4NHCH 2ESVE 4YNYA 1OGAD 5DJ8A 3L3GB 1T4KA 4WU7B 1FZJB 1D5IH 4AIOA 2GTWB 5FUCE 3VDBA 2ARJQ 2VN4A 3FO2A 3HG1A 2ICWJ 4JLRA 1CDGA 5FGBA 2W1NA 4UT7H 4P2QE 1MCPH 2WLZA 2HLAB 3AREB 2DMBA 1DN0B 2VXVL 3CH1B 5L2KB 1MRFL 1AQKL 3PV6A 3NA9L 4PP1D 4XAWL 2G5BA 3QCUL 1QNZL 1GAFL 4HZAA 3FO0L 4D3CH 5IW6B 3Q1SL 4D9QD 4JFXB 1G7JB 4Q6IA 4J2XA 5D7JC 3ZDXE 4PRIA 4S1RL 1CFTA 4NFDA 4X9BA 2FIKA 3VWKD 4ACPA 5MI0B 1S5IH 4YHNB 1LO3H 3X12A 4NO2A 4NQVA 1TZGH 3EFDH 5GSVA 3L5WB 4R2GD 3VWJC 5FUCC 1K4CA 3W2DL 3NGBB 4FQIH 2AS5M 4NHCL 1B9ZA 3B6SA 1XF5A 2P8LB 2R56L 1AO7E 1D5IL 1O7VA 2NR6C 4LVEA 1CG9A 5EU6D 5KSBF 5MENB 4KPHH 4X4XB 3CGTA 4Y88A 4YGVB 1JZ8A 1MJJA 3MRDA 1NAKL 1RZ7L 3GHEH 4XB7A 5C0ND 5FYKD 5C0CD 2X70A 1XH3B 4F9PC 5MERB 3UTSA 2DQHH 3MV9B 2GY5A 2EEBA 4PJAB 4ODBD 2YZ1A 1LE9A 2I27N 3NIFF 1RD6A 2VR5A 4JKMA 2VLKB 1DP0A 4Y4HB 1ORQA 3PGDA 1VB9A 1KB5A 4CVXB 5EZLA 4IOIA 4MNGB 1S5IL 4ISVA 3V0WL 1SEQH 1LO3L 4JM2F 4CVUA 4ONFL 2JLLA 1TZGL 4UBDD 1HCFX 1TITA 1WIUA 2Z31B 4TPRH 1NGXB 2LAAA 2SEBB 4YAQA 3VFUA 1MJ7H 4FQIL 4YGAB 2UUDH 2QQQA 3MRCB 5K9QI 1QO3B 3DYMA 2NY2D 5E7FA 3PDGA 4EOWH 1U92B 2R1XA 2EE3A 4KPHL 3A6CH 1ZLSH 5GS1A 3PQYA 1KYOK 3TA3A 1Z3GH 3H9SD 3AROA 4LGSB 3ZO0A 4WI8A 3GHEL 3MA9H 2DJUA 4R90L 1TVHA 3IAGC 4P4KC 5FO7B 4B50A 1A21A 3HCVB 2FJGB 4R97B 4HC1H 1T7WA 5E4EB 4I3GA 4IRJC 2BVQA 2OL3A 5F9DC 3MJGX 3D9AH 3W82A 4YEFA 4XAKD 1G7LA 4Y4FA 3DX6B 1NCNA 1WBXA 4LEOB 2I9LA 3QXAB 2R0KL 5J0BA 2DQCH 5LGKA 1SEQL 1CLZL 1Q9WA 1WFTA 4TPRL 4DKFH 1MJ7L 4WUUB 1PG7W 2P7TB 3ARZA 3DNKA 1WF5A 4JFDA 1N0XH 1TIUA 4ZOAA 4EOWL 5BV7B 1K8IA 3VI3E 1ZLSL 1MFEH 1T6VN 4Y89A 3BPNB 4FMFA 3SDYH 1Z3GL 2IANB 5C0IA 1FL6B 3MA9L 1OSZB 1V7MH 2QQKH 4LSPH 3VGHA 5DD0H 4HUNB 5J4MA 5AUMA 3T0EB 2YKLH 1QFWM 4ODSH 3WNPA 3QR2A 4Z78B 3D9AL 2R0WH 1DQLH 3VD5A 4NQED 2AJVH 1LNUB 4R0LC 2AV7A 5D7SH 5C0BA 5C09B 4AIXA 2F8VA 3UTZB 3T09A 4HULB 4F7EB 1A64A 1ZLVK 3UYRH 4P2CG 4L3EA 5L8KB 2XN9A 2OP4H 1MQ8A 2DQCL 2ARJB 1FPTH 5KW9H 3EZ8A 1CGSL 2EDXA 1MAJA 5F70A 2ZOLA 1SY6H 4JQVC 1BVKA 1YEDB 1Z0NA 2EIZB 4QT5A 3ZKNC 4DKFL 1OAZL 4JPWH 4Z8FH 3K4ZA 3LH2L 3RAJH 3DOSA 5FIEA 1KIQB 1Q9LA 2AERT 3CVHH 3L3OB 4NUJB 5DO2D 3P4OA 1MF2H 4U0QB 5KSAD 5FV2A 3DUUB 1U93A 4RGOH 3LKPB 4D0CB 1HOCB 2BSTA 1MFEL 1R5VA 5IT2L 1IGMH 1NAMA 1XR8A 4H0HB 4P99A 1AXTH 2LE9A 4MJ6B 3HC0A 5IVZB 3FB5A 5F7EH 4MX7B 3T0AA 1DBBH 3RWJA 3MBED 1HKLH 3GI9H 4XXCA 3O4LE 1V7ML 2QQKL 3SDDC 1YYLL 2XICA 1J7VR 2PYED 2FIRT 4HS6A 5EUOF 5FF6A 3F12B 4RAUA 2WBKA 1IEBA 4XB8A 4HWNA 3ARGA 4I0CC 1CYGA 4MDJA 3DI3B 5L2JB 3VXQB 2R0WL 2DYPA 3D25A 2AJVL 2AJXH 5BQ7A 1WV7T 2BJMH 4Y5VA 4GKNB 2MKLC 1RZIB 2WM0A 4H8WC 4LP5A 2NY0B 4P4RB 2OP4L 4KTDH 3MPCA 3FFCB 1F3JA 1NC2D 3PIQA 5HYSA 3KYOB 4M48H 1SY6L 3QQ3A 4PD4K 2OS7A 3AB0C 4JZNB 3C5SB 3VXNB 3ORJA 2AK4B 4NQCE 1MF2L 3B2UC 4U6YA 5HYJA 2JJWA 4PRBA 3FT3A 2CIKA 1TZIA 4LVHC 3ARFC 4TSAL 2FATH 1I4FB 2R39A 3IJYB 4PJ8C 3RVXD 5KAQG 1UYWH 3GI9L 1KELH 4MB3A 4UNVA 2CK2A 2GSIB 2R2CA 3WLBA 1CTNA 5DMGC 1X5JA 4Z0XA 5E9DA 5K9OA 2XWJA 4WTZA 1T80A 3VE0A 1GGIH 2BJML 3L3JA 4PJ7A 1I8KB 3BQUC 4KV5F 3FQNB 2WQ8A 4KTDL 1OTTD 5HHVH 3NN8B 5BVPH 1HQ4A 4NN7B 4Q2ZB 3X14B 5I1JH 3KR3H 4M48L 1U3HB 4RFOH 4KAQL 4P3DB 2ZCLH 3MACH 3DV6A 3OXSA 2GAZB 3F7RA 2PW2B 3HE6B 2OTUB 2D0HA 5HGHB 1X4YA 5D5MA 1OP5H 4N1EA 3V6FA 5JOFA 3IDNB 5I1DA 3HB3C 2X4UA 1HZHL 4ODUB 1CK0H 1F8TH 4MQSB 5KJRH 2FATL 3RWHB 2VZTA 4OUUB 1UYWL 1KELL 5SX5H 2AAVA 2WLYA 5IBTH 2EYTB 3G5XA 1A0QH 5EU3A 2FX9H 5J12C 4N8VA 2CRZA 35C8H 2ICWB 3O11A 3U7AA 1F42A 3MRKB 4Z7WF 5JNYB 3C60B 4YHPB 3BGFC 1A6ZA 1EMTH 4P2OB 1P84J 1GGIL 1QRNE 2DWEA 4ZO7A 5FKAA 1F11B 1FO0L 5C0RL 3F8UB 4Q9RL 4MXQD 1K2DB 1I8IA 4S2SB 3W39B 2CDGB 4P57B 1FC2D 3WS3A 3UCRA 1JWUB 4PJBB 5HHVL 1G7IB 5DQJA 1WAAE 3RIAK 4MYWB 5BVPL 4CN4A 4JKLA 1IQDA 3KR3L 3V7MA 4WHYG 1JWSB 3THML 2ZCLL 3MACL 3TPUB 3IDGB 4UOJA 5KOVC 4NM8H 4Z7VE 3RX5A 4XH2B 2LTQB 1BOYA 2A6IB 3EDDA 3MJ7B 1J11A 4DQOH 4P23A 1BWWA 4TUKH 5SWZA 3MZGB 1CK0L 3T2QA 2FGWL 4MAYD 1NC4A 1JF6A 1G6RA 4QRQB 1P7QB 3U4EA 3QUYB 2R23A 2GJ6D 4LF3A 5IBTL 3EGSB 1JGDB 4M7KH 2FX9L 1A1NA 4E41D 35C8L 4XBGB 3IJHB 2C3XA 3D48R 2QLVB 3EYSH 2W0FB 4OJFH 1EMTL 1KOAA 1QR1B 1OP3H 1CXKA 3IT8D 2UWEE 1FRGH 3FOLA 5ID1B 4JY4A 4K7FB 1DEDA 3W0WE 2OI9C 2B0SL 4DGVH 3MCKB 2EKSA 3EHBD 1S9VA 5DHVB 3D39B 4IMLA 4CADB 5C7XL 4CNIB 4PLJD 2Y6SC 3UJJH 4RMTA 3QHTC 4NNXB 3RGHA 2A6KA 4CMHB 3V5KB 1N6VA 4JFFE 4DQOL 4ZUWA 4XT1C 5D1XD 4E9LA 2NY5C 1U58B 3HC4H 3QZWB 2CLRB 3SBWA 2Q8BH 1UKSA 1F6AA 3BDYH 1YPZB 4OZHA 1IEHA 3RVWD 1JYXA 3MGOA 4M7KL 1BOGA 1JWMA 2YC1A 1K85A 4MZ2A 4HQQH 1KG0B 1I1AA 4OCWH 2NY7H 3O4LD 4OJFL 2IADB 3LN5B 1H3XA 3REVA 4KDTC 3OKDA 3IFOB 4RAVB 1KLGB 3PABB 3EZJB 2D9CA 5I71B 5MEOB 4DGVL 2R15A 1RUKH 1OP9A 3FT4A 1ONQA 1UWGH 3EJYD 5KBNC 5DVMA 1RVFL 3KPTA 5DVLA 3HZKB 3MFFB 3U0PB 1HSBA 5E8NA 1YEEH 1Z5LA 1RU9H 4L4VB 5F9OH 4QNPF 2ATKA 3W11C 1JZ5A 1G9EA 3HC4L 1QEWA 2EEDA 1HXYB 4J8RB 4XBEH 4FFWD 5HI4C 5DJ0B 3DUSA 2Q8BL 2VDNL 1NANI 3JV6A 4OQTH 3VJ6B 1ZT1A 5DMJB 3DPBA 3BDYL 2ZKHH 3KPSA 3MLZH 4G8GA 5JPNA 1NCAH 3IU3A 4PRPE 1RURH 3QEQE 2CXKA 2P5EE 5FYJU 3RDTB 2W0PA 3BX7C 3KYMA 3LKNB 5CEXA 4WCYH 5I2IB 4OCWL 1FHGA 3C5ZC 2AEQH 2IAMD 1CE1L 1IAIH 4LIQH 2V17H 4QEGA 4G6FD 4PTUA 4Y5YB 5ALCH 1QVOA 2FEEI 3TBYB 4RIRA 3VXUA 4LAQH 1RUKL 3U1SL 3QXVA 4PJGA 4PRDB 3O4OB 4LSQL 3QWOA 4PLKC 2VDLH 4YXKL 3MRLA 1IC1A 3U36B 3F6LA 1YEEL 1U8MA 5DURB 1RU9L 4ZS7H 1GGUA 2HFEA 3MLSL 5KSBE 3DRTB 3DGGA 5INDB 2H2SD 3IRZA 5HSFA 1ZGLA 4TSCH 3TBVA 4XBEL 4XNQB 4DCQA 4JO2L 4M7ZB 4OQTL 1ZLUH 2YD4A 4ZUVB 2ZKHL 3EYOA 4YHIB 5ENWB 1HE7A 1P4IH 3MLZL 1NCAL 1RURL 2Z4QA 4NO0B 3QFJB 1ZGLM 4AQ1B 4HIHA 3LQMA 4PRNB 4POZD 4IDLA 4XCYB 1SMOA 5L2KD 2H26B 5D2NA 3WNOA 5JZ7D 2AEQL 4WDIB 4GQPH 5ACMA 5EZIL 1IAIL 3PHQA 2V17L 3NIFE 1YYMH 4JHAH 3CFCL 3MV8A 3QQ9D 2FZ3A 5ALCL 5LBSH 3F58H 3MXVH 4I4WB 2HTLD 4ZUSA 4KTYA 5F96H 4FFVC 5JQHC 4OLEA 1QRND 4NN6C 3O8XA 2FJFB 5I73B 5CJBA 3TO4B 4QGYA 1T7VA 2JCCB 3VMPA 4XHQA 3EOBA 2YUXA 4ZS7L 4LHUB 7FABH 2DKUA 2J6EA 2XZCL 3FQUB 3I2CL 4JVUA 2BVTA 1FIGH 5DD1H 1Z2KA 3H3KA 3E6FA 3ZL4L 2D31B 5I1CH 2CJUL 2K7PA 2QHLA 2FECL 4NQSA 5LGJB 4KROC 3B9KD 3DMMC 5MEND 4L1DA 1OLZA 4DN4H 3G6JA 5ANMB 1RUAH 1SYVB 4HUUB 5M95B 2GTZB 3KWWB 4FFYH 5D93B 1JV5A 1HILA 3HZVA 4LCWA 4UAOC 1P4IL 1CL7L 1XIWD 4OZFH 2EDKA 4GKSB 4I18A 5EBWB 3GSWB 5E6YA 2DLEA 4F7PA 2D9QB 2HRLA 5E2JA 5DK0B 4ZNEE 2J88L 1OB1B 1NUFA 4R96B 4AEEA 3MV9D 2NXZC 4JM2C 4XC1H 5JOEA 1E6JH 3FCTA 4JANB 4U1IB 4O51A 1YYML 2I9TB 3V0VA 4JHAL 3TH3T 3V8CA 5LBSL 3MXVL 3ULSB 4JAMA 3TZVD 3HKFA 3C09B 4Y4HD 3C8KB 1TJHH 5F96L 4GS7B 2VTFA 4YNYB 5T3XH 4IOSD 3QUMA 4XPAH 1JZ3A 4K8RD 3VD9A 3X11A 1JNLH 1Q72L 2X9YA 4NCDA 4EXKA 4HJGB 2F54E 1JYWA 4ZUTB 5HHNA 1MCOH 4J7RA 5I17A 3SO5A 2DDQL 5I1CL 1D5ZB 1CGUA 1ZA3A 3BFOA 2N7AA 4DN4L 1IFHL 1BJ1H 2R1YA 2BOBA 5T1KD 2DAVA 1DBMH 4YIQA 3OXRA 4M02A 3HAEH 3PV6B 1UH4A 3UTQB 4J12A 2C4XA 2X44D 1N6QH 5IMMB 3GMRA 1RHFA 1YY8A 4JFEB 4HH9A 1VFOA 2HFTA 3ARBA 3G9VA 2ENYA 4NWTH 4WWKA 4L3AA 4XC1L 3BN9D 2A77H 1E6JL 4LBEA 4OAWA 4APQA 1ZSDA 1DFBH 3ARRA 4PJ5B 4PRHB 5GGUB 3BKMH 5J9PB 2BC4A 1TJHL 3MOBH 1AHWA 4FG6D 3AUVA 3GHBH 3KGRA 5T3XL 4YDVA 1WT5C 4XPAL 1FE8H 2X4QB 5DS8A 1BM3H 5CMAB 2VXSH 4OD3H 4MJIA 5E94B 4WUUD 1JJUA 3RNKA 3PGCB 3ILPB 4NQDA 3OJDA 4OIIL 5D7JB 2CSPA 1NFIB 2Q3AA 2OLDA 3MRGB 1HDMB 2BRQA 2OSLA 3GIVA 5CGYD 3MRNB 1DBML 1DDHA 4OGAD 4MXVE 4AK1A 4NSKB 3KPRA 1KPUB 3VWJB 2IAND 3O45A 5EUOE 4HV8B 4L3CB 32C2B 4KJQD 1TTUA 5EBLA 3U82B 2V2TB 3R4DA 3RGVD 1INEH 2K9UA 2EDDA 1DCLA 2EDFA 4IOIB 4NWTL 4OI9A 2FJHB 2A77L 1EGJH 3FAWA 3NPZB 3QEQD 1DFBL 5BRZE 3F7YB 4NHUB 2JJVA 4TNVF 4BKLB 4CVWA 5C09D 5E5RB 4ZPVA 5DT1L 3MOBL 3VFPB 4R4FH 3BMWA 2EO9A 1OSPH 4LCUA 1S9XB 1UQSA 3HPJB 1Y0LB 1RUQH 5I74C 1CFNB 1FE8L 1WLHA 5IEHB 4OZIF 1BM3L 2VXSL 4OD3L 4TUJA 4P2RE 1RZKL 3FT2B 4KJPC 3WKML 3LAFA 4JDVA 4HW6A 1S7VA 4EI5B 1YMHB 3A0OA 2DL2A 5M94B 5IVXA 2H3NB 5CGMA 1WTLA 2X4TA 3UC0H 1E4WH 3VFWA 1AO7B 1KNOA 3KJ4B 4Z0BH 3S34H 3VXSA 5A2IH 3LRHA 3QA3A 3GNMH 1N3NB 2KKQA 2UYLB 3RZCC 2FH6A 5JOPE 4Y4FB 4OB5H 3BZ4A 3SE4C 4PGBB 4HZLB 4Y1AE 1O5DT 1WK0A 5CILH 2R4RH 5D5MF 4KV5E 2WP3O 3O6FB 4HCRA 3SE3C 1RJYA 5IMKA 4KJYA 2NY0D 1LEKA 5FECA 3EDJA 4P4KB 5EFIA 3GKWH 1MFAH 3VFSB 4U31A 5BO1H 4CBPA 3FFCD 1RUQL 5H37H 4AG4L 4JCLA 2VAJA 4WFGD 1A4KA 1J86A 3ZE2F 4IRJB 4PG9A 4FQHA 4XNXH 4XCNB 4C56D 4F2MA 2M26A 2AK4D 4OFDA 1WCQA 1MHEA 2DM7A 3R1GH 5HI3C 4G6MH 3RUGE 4F3FA 1E27B 1A6AB 1M6OA 2NQCA 5DR5L 1NFKA 4W68A 2WIMA 3UC0L 2EDWA 1V3MA 1EJOH 4HF5H 2YPLE 1Q9OB 4NKOA 4Z0BL 5L6YH 3S34L 1S5HA 5K9KA 1V7NH 2MCPH 1YY9C 2F5AL 2NY6C 1NBZB 3DUHA 4Z7WE 4OB5L 4OGYH 5HTSA 1BECA 2NW2A 1SJHA 2JB5H 1CGXA 1AIFA 2WUCH 1JYNA 1X6NA 5DQ9A 3IETA 5CILL 4JFHE 5ITFA 4LCCC 4UU9A 4M1DL 4M8QB 1ED3A 4QHNA 1I8LC 2VQTA 1Q9LB 2R2EA 1A7NH 4EN3A 2CR3A 4R7NA 1YEGH 5DYOB 4JY6A 1QACA 4H0GA 3GMPA 1CF8H 4QRRE 4JJ5A 5FYKU 4X99A 5C08D 5I1LB 5T1LA 3RI5F 2RCSH 4QOKB 3HE6D 1I7ZA 5KS9A 1A2YA 1H8NA 4L8DB 4G6ML 3DECA 3STLB 1LO5B 2GK0A 2YSSA 1ES0B 2F54D 1EJOL 4HF5L 1T2JA 5IB3B 2EO1A 3ARGB 5L6YL 4WHTA 4EUPB 3HMWH 4HFWA 2VL5B 4ONOA 1V7NL 5GZND 2Q6WA 4Y5VB 3ZTJH 2F8XC 4DN3H 1VPOH 5FCUH 1TJGH 4GXVH 4J23A 1BVZA 2JB5L 3C60D 2E7HA 3FB7B 1V3KA 5E2VH 4P2OD 3ILQD 3D1MC 3RY4A 3M1BA 1P9MA 3AM8C 3LRSA 1W0WA 1U8JB 3QDJA 4X6EA 4BM7A 4KK9C 4QYOA 1YEGL 1YEJH 5HYJB 3MLRL 3I6KA 4PRBB 5F3HA 3SGDI 4X4YB 2EXWD 1T21B 2CIKB 1KPRB 2XZAH 4UOW0 3VRIA 4OZHF 3S4SB 3V5DB 43C9A 1UFUA 2HWZH 5TGBB 5F3BA 4PUBH 1OLLA 1N59A 3C5JA 1KXQE 5E2TL 1A5FH 2X4NB 5D70H 5HDOA 1T04B 3EYFB 3WBDA 4X98B 2QSQA 5KOMC 4CUCA 1K4DA 1P7QD 3KPPB 4KRPB 3QUYD 3AB0B 4F58H 3L7FB 5BS0B 4LMQE 1VPOL 5FCUL 1WFUA 4JN1L 1A3RH 4PJ7B 2HVKB 3CSYB 1T1ZA 1Z9SA 4RRPG 5KG9A 4QY8A 3QIUB 1HH9B 5E2VL 4F57H 1S78D 3ARFB 2HT3D 4JPKH 5F9JB 2X7LA 4PJ8B 1BJ8A 1R3IH 3OXSB 1S8DA 3VGGA 3X13B 3KXFB 4KGLA 2XWBB 3CZFA 1IM9D 1EIBA 4PY7B 3HG1E 2DQJH 2WBJD 1CVSC 3D39D 1HWGB 2X4RB 2Y5TA 1A1OA 2XZAL 4PP2A 4MDIA 4PGEB 4MCZA 2M8XA 1P7KA 2HWZL 3B8YA 3QWRD 4QNPE 3QCVL 1BF8A 4PUBL 5C2UB 4ELMA 1D5BB 2HG5A 2QBWA 3BQUB 3CFIC 3HNSH 5D72L 2C7UB 1A5FL 5D70L 4BFGA 3CPLB 1EEYA 4P2RD 1XGUA 1KJVA 1Z6JT 4PRIE 1A6ZB 1ZHKB 1XAUA 2JJSC 5A1AA 5DVKA 4LFHD 1ZT7B 4Q7DA 2BSRA 4PJGF 4PJDA 3QAZC 4JHZA 3MV11 1J1XH 2AJZA 2DQFA 4KFZC 4R7DB 1VFBA 1FO0A 2AI0H 1PKQA 3CD4A 1R3IL 1N26A 1U36A 4RFEA 1OTSC 1CQYA 3BKYH 3CUPA 3UTTB 1NEZB 2ADGB 2DQJL 3BZDA 4Z7QF 5J12B 1KGCD 2HJFA 2ITCB 4KI5D 4ZFGH 3SDAC 1I7RA 5I16B 3TT1H 5FA3B 1NC4B 1G6RB 1TJIL 3RY5A 1C8PA 4Q6IC 4LLDA 3UTSE 5EG6C 3TWCL 3UO1H 1YN7B 1S7RB 1IC4H 5I18L 3NMEA 4NDMA 1J8KA 3C8DA 1DBKL 5DQDH 4EKXA 2QQNH 4U1SA 4JFYA 3BP6A 4DAGH 5JXEA 4PJIB 2PXYB 3S35L 3T8XB 5D96C 4BA8A 4KTEH 4OF8A 3RDTD 1AFVH 3UBXI 1NGWB 3H7LA 1ZA6A 5FGCE 4XMPL 4PBWD 1C5CH 2CGRL 5GRYA 4QWWD 2AI0L 3MMEB 1RK0A 4JG1H 3MCG1 3WHE1 3QIBD 4Q0XH 2Q86B 3KLAA 3HE7A 1NGYA 3BKYL 3JVGA 5IJVB 3QDGA 2V7NB 4KVNL 8FABB 1UZ6F 1W8NA 2RFXB 3M17B 2EYSA 4ZFGL 1EA9C 3HFMH 4NWUL 1T83C 3UXFA 2WMPA 5KN5A 4I3SL 4QRSA 2HLFC 5IMLB 3PWVB 1UVQA 4NZTH 5SWQA 1MJ8H 1CXLA 1IC4L 2NY1C 3EKCA 4Z7VB 1KCVH 5I30H 3MXWH 4BQ6A 4RMQA 5DQDL 2DTSA 3DHMA 2IFFH 1DLHB 2QQNL 4L9LC 4GKZB 4K55A 4Z5RB 1U91A 4F7CA 3OAUH 2VZUA 5GGRB 4NO0D 4TVPH 3QFJD 3BMVA 1R3HA 3MOQA 4KTEL 4M3KB 4OCNC 5GS1C 4NKDA 3TA3C 4I9WE 5T33H 1BBDH 2HFGH 4JFDE 2NLJA 4G80B 3I3DA 3CAFA 1B0GA 1LQSR 2BHYA 3ARDA 3W81A 3BP4B 3RU8L 2ATKB 1D9KD 1RUMH