4OKVA

Crystal structure of anopheline anti-platelet protein with fab antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGLIDPSDSETHYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARGGTYWGQGTTLTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of anopheles anti-platelet protein, a powerful anti-coagulant, in complex with an antibody
rcsb
source organism Anopheles stephensi
molecule tags Blood clotting
molecule keywords heavy chain of 8H7 mAb
total genus 45
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA02
2I07B 3CFBA 5L8LB 3MR9A 2DL2A 2ZKHH 2J2ZA 3WE6A 3M1BA 1FO0L 4MA8L 1HINH 2HFFA 4NWTH 3DVFA 1X5JA 3AU1B 1D5IL 1YPZE 4HIJB 5B39B 2EXYD 1MF2L 4OD3H 3SO3C 1NCDH 3I9GH 4IDJH 1ZVSA 3V52H 4TN9A 4X7FC 5IHLB 3MRBB 4U2ZA 2Y6SD 3UYOD 4D0DA 4O2CA 5I1LA 6FABL 3DSFH 3I3EA 1Z6JT 5FOBB 4YFDB 5T5FH 1YYMH 3O9WA 2Z91B 2UWEA 2HT3D 4L8SA 5HI3C 5TDOA 3TVMA 5CEZL 5HHVL 2VKWA 3EO1A 2EDTA 1CXLA 3C09C 2VQ1A 4ZUVB 1TZHB 3INUL 1JHLH 2BNRE 3G5XB 5JDJA 1EX0A 3CDFA 1U91B 2JIXD 5I1GL 5FHAH 2Z8WC 4WFED 5D6DA 4PRID 4X0KA 2FYYB 3QEQE 5J3HD 3F58H 2X70B 3UBXI 1G7MA 1JPTH 2DKUA 4YHZH 5E8DH 1ZLSL 2HT2D 4F8TA 1JMXA 4QHKI 5AWNH 4UV4H 5AUMA 1RD6A 4K71B 1LHZA 1XGTB 5CEYB 2NY6C 1QOKA 5IMOA 2W0FA 1LEGB 2DBLH 3RDTB 5JLZB 1UCBH 5IW6A 2DQGL 5H94A 4U3XA 1R3LA 4XAWH 1HH9B 5C6PB 3LIZH 5I75B 3O3DA 3VXRD 4NM4H 5IGXH 1QBMH 1D5MB 2VZOA 3S7GA 4O2FB 2J88L 1MUJB 4JJ5A 1JJUA 2RAMA 5LGJB 3RTQB 1U92B 1G9EA 4P4KB 2VISA 4HGWA 15C8L 1UVQB 3RKPA 4PGEB 4P5MA 4KK9C 1UZ8B 4UTAH 4MMXC 3ZKND 4TNWF 3QDGE 1CR9L 2ARJB 2CK0H 5ID1B 2F19H 4OZGA 1O0VA 3BQUC 2Q1EA 2WUBH 3MLTA 3RL2A 3QHTC 4QCIA 1KPVB 3UC0H 3HI1A 3L3DA 2G60H 1YY8A 1PSKL 2VLRA 4KDTC 5F8QC 5IFJB 5FYLD 4KJYA 4ZFFA 4ZFZA 3HZYB 4JZJA 3PDGA 5IWLA 3DXAD 1ZA6B 3I3DA 1NKOA 1BZ9B 3MXWH 2XFXA 4X6CA 4RBPH 3FCTB 4U4BA 3F7VA 4P9MH 1N6QL 2XG4A 3WNNA 4KPHL 5I19H 3GB7B 3GSOB 5IJVA 3OZ9H 4NOFA 5JPNA 3BWUC 1AGDA 4MD0B 4OKVB 5KVEL 1PBYA 1QHPA 3MV7B 3PQYD 2BCKB 2WINB 1ETZB 3TFKC 1BVKA 2DLFH 1BHGA 4UTBL 3D39B 1KJ3H 3VH8B 4OZGE 1IILE 4N5EC 3TIEA 3HNVH 4P3WA 1RIUL 2P5WE 5BVPH 5D7SL 5F7MC 5DD5H 3KG5A 4QY8B 2VLRE 2MCPH 5CJOL 3JVGC 4JR9H 1OAUL 3FFCE 4KI5E 4ZUUB 5LAXB 2HJKA 5FM5O 3GNMH 5IB1A 4M5YH 1D9KA 3EIFA 3QH3B 3C6LD 2VSDA 5ADPH 4Y8DC 1UM5H 2AK1H 3ECBA 1E28A 1QEWA 5C09B 2HN7A 1ZV5A 1OAKL 3C6SB 2RGSA 2C5DC 1AR2A 3OKNA 4HC1A 1RPQA 4GMTH 1HZHH 3VXUD 1D5XB 1DL7H 3RVUD 4YDJB 1YEGH 3FOLB 1UKTA 2R0ZH 2A74B 1NMAL 4C56E 1SYSB 1ZSDA 3HZMA 4HLZH 3D25B 4NN6B 5JHLH 3HAEB 1QR1B 4M8QA 4C56B 2PO6A 5C0FA 3GJEB 4ETQB 5HYQA 3OKMB 4PS4L 3QIWD 2JJUA 3RVUC 4V1DA 4KGLA 2ADJB 3DUSB 3GDBA 5HTSA 2P8PB 3GSVA 4HPYL 5CHNA 5D6DC 1CG9A 2CPCA 1FL3A 3DNKA 1WTLA 1DFBL 5H35A 4E42A 5BXFA 1VGEH 4O5LL 1UGNA 5DRZA 3BW9B 1WISA 4EDWH 1GAFH 4AEFA 5J1TC 1JHKL 3R1GH 4FFZH 3I84A 1CXHA 1LK3H 4M62L 4FQXC 3VGAC 3H9HA 4HIHA 5DJCB 2FBOJ 4GKOA 4R4FL 2XYCA 5IG7A 2BVUA 3X14B 4LVNB 3DV6A 4HS6B 1CTOA 3CH1B 1S7TA 2V6HA 1K9TA 4X9GA 2YBRA 3SBWA 3ARGC 3SJVE 2V7NB 4C56A 5M95B 4OFKA 1FZOB 2OQJB 1QRND 2I5YL 1H3TA 4OV5A 4G6FD 3BMVA 5CEZD 3OX8B 2EDQA 4V1DB 5B21A 3MODH 1VFMA 1ZLUH 1UEYA 2BJML 3JWOC 5E9DD 2J3SA 1HXYA 3CUPA 1M71A 1RZ8B 2EO9A 5H2BA 2QQLL 4E42B 5GJSL 5BXFB 2V2XB 4EI6B 4LCWA 2OMBA 3V8CA 5E08L 1T89A 4PTUB 1UZ6F 1PLGL 4Z7UB 3VG0L 2FCBA 5TE6L 5JUEL 3DECA 3LN4B 1IVLA 1KUMA 3EJZD 4MHHG 4XBGB 3BKJL 4L9DA 4LLYB 4L4TD 1ORQB 5SWSD 4NO3A 1ODAA 2FHBA 1ZGLM 4QTIH 1CL7I 1G9MC 2HT4C 2XRAL 2VB5A 2VN7A 1G7IB 5CJQH 2F54E 3WDHA 4NM4L 4FQPA 3O6FC 2HG5B 3O8XB 5IIEA 5HPMB 1CE1L 3KPSB 4WU5A 1EO8L 2J88H 3GMPA 1BBJA 1BVLA 4L4VD 3SDDC 1NAKL 1BEYL 3S5LA 5D2LB 3U7YH 1UB5A 4U6TA 1CVSC 5FB8B 5I1KL 5IMLB 3MOBH 5F1NA 3LQMA 5ERWA 4WTWA 3MRPB 4NKIL 4NJ9L 4NO3B 1EMTH 4TNVK 4AL8L 4X0KB 5C0EA 5DI8B 1WCBA 4OLWL 4U1MB 1H5BC 3MROA 5F21B 3KPNA 1T1ZA 4J3SA 3DVGA 1HHKB 1IGCL 5GSRB 4CU8A 1IC7H 1UQSA 5EN2B 1YPZF 1KXTB 4QKXB 1UKQA 1BREA 3PWJB 5F3BA 1C1EL 3WS3A 4TUKL 4GUPB 4GLRH 2PXYB 2DIBA 3IDMA 3MRJA 4UDTB 4FQCL 1YEEH 3LKNB 3ILPB 4MJ6A 4CNIB 2HKFL 4PRBA 4PJ5A 3N9GL 2E7BA 3PXHA 1FRGH 3T3PF 1OP9A 3WLWD 1C12A 3AAZB 1EXUA 4R4ND 4FTVE 5BQ7B 3RNQB 2BSTA 2QBWA 4EJ1C 4KZEL 3KWWB 2ADFH 3UJJH 1L4IA 4L5FH 2Y72A 1D5MA 3P0YL 1PG7H 1ED3A 1T1YB 1KOAA 3QAZC 4PJDA 4LLWA 2DQEL 5FO7A 4CVZA 3IB4A 2I60H 1UXSA 3HNVL 5GSVB 2VJXA 1MWAH 1NLBH 3C5ZD 3F6IA 4OLYL 1OVZA 4GLRI 1QYGH 1WQVT 5ECJE 2MTPA 4XCCL 2ZNXA 3RVVD 4NP4H 4B5EA 2GK0B 3K74B 5DJ6B 4BZYA 5HI4D 2C3VA 2APFA 5BOZG 2AXGA 5FK9A 4PRHA 4LNRB 5EUOE 3MLTB 5D7JA 4WWKD 2QHRH 2BC4B 2BNQA 4NT6B 3BWAA 2P48B 2ZUUA 4JHWL 4NYLB 1FL6A 1GZQB 1QFWM 1N6VA 4DGYL 2OR9L 3KDMB 1DDHA 2ZG3A 1GGUA 5HI5D 5ENWA 1YMHB 4Y2OA 5T1DH 3WHE0 4GSDL 5GHWH 5BJTB 3BEVA 4G6KH 2IPTH 1OAYH 2OMNA 2X4QB 3U4EB 4KQ4H 5C2BL 1YC7A 1TJIL 1MCRA 1X4XA 4W70A 4C55A 2H32A 1WZMA 3O6LL 3LZFL 1MREH 1YNKL 5HDBE 5TDNA 3FB8A 4W6WB 1JWSB 2W1NA 4M61B 2ZCHL 3IJHB 4EDWL 3QEUB 2VDNL 3X17A 4NKDA 4LPXA 1RHHA 5K9JL 4H0GA 1VACB 1QSEB 5CP7A 3OKOB 5DWUL 3MV9B 5GGSB 1S5IL 3RUGA 4DUXA 4HJJH 4WO4B 4A2LA 2RB8A 2VLJD 4ZFGL 5CD5C 5I71C 4PJXB 3I85A 4MA3B 1QUNA 4IEFB 3OGOE 1WT5A 4HUWB 2NW2B 4S1QH 3FN0L 3QXAA 3EO9H 3V5HB 2IBGA 4R96B 4XCEA 2H32B 4ZSOA 4HIIB 5B3JE 5H37H 3V7AG 3ARFA 4BFIA 3SY0B 1J0YA 3HE6B 5KJRH 1I4FA 4H25A 4EIGB 4ZDHA 5CUSH 3R0NA 1HDMA 2QR0B 4K9EL 1Z9OA 1RVFL 3MO1B 4JFPA 1P7QD 1X5HA 1FYHB 1T1ZB 3LOWA 5GGVH 4M3KB 1KCRH 3ARRA 2MKWA 4XP6L 2EDWA 3MRCA 5J7CC 1F4YH 3VFRB 5L8JB 5IK3A 2EIZB 1HYRC 1RZ7H 3MZTA 4Y5XC 2Z31A 4UIMA 3SE9L 2W9DL 4NN7C 5CWSA 5B3JF 5I8CB 2WBKA 1CLCA 5JHDD 2IBBA 3N0PB 1EO8H 3QUKB 3D3VD 3GBML 1FL5A 1CD9B 3T3PE 5EU3A 1BECA 1NBZB 5SWQA 4HX1B 5E94A 5C0AD 3RX5A 3H8NA 5E4EC 2CJUH 2ZUVA 3OF6A 3WFHA 2VLKD 2VDRH 1EO5A 3OJMB 4X8JA 4ORGB 2D7MA 5FO7B 4CVZB 2PTVA 3ALPA 1OAXL 5F9OH 3SPVA 4YXKL 3SKOB 4WJ5B 4LVOC 3F6LA 2W91A 5KSAC 3L3IA 5GGRY 1S7WB 3OZ9L 1WC7B 3I2CL 2EDXA 3CFKB 4G8IA 2GTZB 2IFGA 4EN3D 3QI9C 4XI5C 4P23C 4K2UL 5AUMB 3QUMH 2PO6D 5D7LE 3B6SA 4A6YL 1UACL 2OL3B 1QSFD 3QHZH 5CEXA 5EBLA 2AEPL 3OG4B 5F72S 1SEBB 3PWLA 1JPGB 2R1WA 2ZNWA 4PYHA 3MCG1 3VXUA 1HOCB 3FRUA 4NYLA 3IU4L 2SEBB 3L1OH 1NMCB 1A7QL 1OP3H 3SDCB 5GZOD 3DYMA 3QNZA 2LU3A 5D7LD 3NABL 2ADFL 3UJJL 3OAZK 4MD4B 3V6ZA 2FR4B 3P0YH 3BJ91 4Y2DC 3H3PH 3EGSA 3PIQB 2PXYC 3VI4E 2X4QA 4OGYH 1NC4A 5EUKB 4JHBA 3QQ3A 1HILB 2O93L 1TQBB 4PBWD 4JZOA 5SWZA 4GAYA 2EH8L 1EFQA 4JFEB 1UG9A 3ULVD 2XFXB 3GIZH 4LLQB 4FP8L 3QO0B 2Y1VA 2DF3A 1XIWB 4FQ2H 4PTTA 5I76B 1XGRB 1W2KT 2EXWD 1J0JA 2JELH 3OKDB 3Q3GB 1H3VA 1QA9B 2DMCA 4X6FA 5T3XD 4ZO6A 4OSUL 4TSAL 5CJ8A 3D6GA 5TQ0H 2GTWA 4NZUL 3PV6A 4TRPH 3EDDA 1CFVL 1LO3L 4XNZB 5IHUL 2H2SC 1LD9B 2YMXH 4MNHB 2DI8A 5C0JA 4CMHB 1BIIA 2A77H 5F3BB 3TBVB 1KLUB 1NPUA 1CYGA 1VERA 3ZDXF 1T04B 1EVUA 3PQYB 4MDIB 3V0WL 2FHCA 3IXAA 3QDGA 3GMOA 4X4YB 1RULH 3MREA 1LNUB 1JF5A 1U8NB 4C83A 3QPQC 3S5LG 1F13A 1HNGA 9CGTA 4ONHA 4GKZB 2Y5TB 4NQEE 3RVXD 5C70A 4XX1E 4JHAL 4ZDHB 4P46C 3OHXA 3ALXA 3DJ9A 1C7TA 4OTXH 3CCHA 1W0YT 3EYOB 3NIGE 1Q72L 4ZOAA 4H1LA 1QBLH 4WDIA 2ZSWA 5CMAB 4N0UA 1MHEB 1MHPL 1LVEA 4PRPA 3WL9A 4ONGL 4ZPTB 3L3HB 4Y4HA 3MUGB 3MRGB 3FFDA 1WBXB 4JG1H 4YHOH 1LEGA 2WBWB 4PLKD 5GRWA 3X3GH 5CCKL 1F6FB 3QP3A 5D7JB 4LCUB 5C71A 3TLRA 2L7UA 4PY7B 1UEMA 4F7PB 3ARBC 5T1LA 3BT2H 4YWGH 1PFCA 4BJLA 5JW4Q 1IC4H 3IFOB 1FHGA 3MLSL 2BOBB 3ULSB 3NCMA 1FORH 1N0XH 1H5BB 3KNBB 4OCMC 3VA6A 2GJ6D 3MFGB 3S4SG 1TZGH 2IAMA 5JQ6H 1ZT4A 3SQOL 5M7QA 1JNHA 4YUEH 3FTGA 1GSMA 2DMBA 3PG2A 2R29L 1F02I 3BVNA 4H5SB 5IJKA 3TP4A 1MCWW 1YJDH 4UAOB 4NO2A 2VABA 3GKZA 2A1WH 3TYFA 1BFVH 4YJZL 1ROWA 1R3HB 4PRPE 3HG1D 5MI0C 5HGDB 4PR5A 4M7JL 43C9A 5BMFL 4HS6A 5MERA 5DGQA 1F4WL 4P57A 4G9FB 4OKDA 4WO4C 4F9LA 4X6CB 3U0PB 4XC1H 1C5CH 4FMFA 4OGXH 1K8IB 3RBGA 3ARBA 1CGSL 2B4CC 5L2KD 1OAXH 4HULB 4Y89A 1QO3A 3RWGB 4M6NL 1U8MA 5FGBC 4YGAB 3T77A 4ZXBB 3VXNB 2GY5A 2Y23A 3MJGX 1U92A 3PGCB 3L5HA 2UUDH 3GK8L 3VG9B 3QEQD 3DX7B 1WBZA 4YC2C 5F7DA 4PJ9B 3SGJA 1J5OL 4BSWB 5D7IF 4PJCA 5ISZD 1U3HB 3O11B 1CDIA 3SJVA 5CFHA 2GTWB 4KZDH 3Q1SH 1K4CA 2A73A 5GGQH 4I3GA 3RGVD 1DCLA 2HG5A 2ZCLH 4MHHI 3T1FB 2ZKHL 4MJID 4PRAB 5KANI 4H1LH 5HXMA 2EXWC 4QRQB 5KS9B 3VFMA 1QEWB 3VXNA 4M48L 4DKDC 3MRNB 4XPBL 3F7VB 1OD9A 1T2QH 3MRIA 3LKRA 4GMSH 3IT8D 4WU7B 1EIBA 3KHQA 4DN3L 4ODWB 5L0QB 5E94B 2Y5TA 3LRSB 1K5NB 3ZHLA 3PWPE 5I1CH 3RI5K 1FYTB 4BH8B 2OBGA 2PYFB 4M93C 4WW1B 4JEGB 5E8EA 3TJEL 5HHOE 5E8OA 2MNUA 3QG6A 4Y5XB 2C9AA 1OCWL 4X8JB 1A6ZA 4ONFL 4M3JA 3D0VA 3T2NH 5HGAB 5HHOB 1QBML 4WUUA 1SJXA 2WWKT 3L5IA 1CZ8L 1X5GA 4M6MH 5KAQF 4X7SH 1KC5L 3BSZL 4JFEE 1CL7H 3LPWA 3VXPA 3ULVL 4A2MA 2XA8L 1MEXH 2J8UB 3A67H 5ID0B 5KSBB 5LXGH 4HJGB 2E9JA 1PY9A 3ZO0A 2D31B 2B1HH 1KJVA 1G7JB 4NO0D 2DQDL 1JPTL 1NMBH 4DGVL 1INDL 1DN2A 3V9FA 4NQEB 5L9DH 3K4DA 2C3WA 4U7MA 1CGXA 4PG2C 2NY3D 4TVSa 2WQ8A 2NY5H 2YD9A 1A3LL 1JPSL 1RIHH 1T83C 2XKSA 5TJWK 1XR9A 2R23A 1GOGA 1U58A 3FN0H 3I75B 4KPHH 1BZ7A 1OSZA 4XPFH 4JFEA 3LRHA 4ETQA 5HYQB 3GIVB 5ISZA 4PBVC 1MPAL 3QIBD 5CIPH 5D8JH 5CAYB 2NXZC 4HUVA 2BXZA 5D2LF 3LQZA 3IETA 4KMQA 1FNSL 4ZD3L 5HHQB 5FYKD 1FE8L 1H3XA 2D31A 2W60B 4OM0L 3VRJA 2QKIB 4PJDE 4X5XA 5K9KB 5FM8A 3MLRH 5L2JA 4YQXH 3P73B 3RU8H 2EEDA 1RJZA 2JB6B 1BOGB 5IMKA 3HC3H 5FYLL 2FECI 3HI6L 1IC4L 2E27L 4F57H 1K4DA 4WHDA 2B5IC 4Y5VC 3RWCA 1FH5L 5DZOA 3DX8B 1AC0A 2VZ3A 1H3UA 2RJMA 1R0AH 4P9HC 3WMSA 1UB5B 4OI9A 5D93C 5IKCB 2PO6C 4H26A 4Y2DD 4L8SB 4NO0A 2D03H 1FIGL 5HVHC 4JY4A 1U95A 3GGWB 4JDZB 1JWSA 4NPYA 3NIGF 4WEBL 2R9HD 2F74B 5C0EB 4L3EB 1U0QA 2EICA 2X05A 3A6OA 3GBNL 4AT6B 5ESAA 4OLVL 5BRZB 3CGTA 5J06A 2YPVL 2ZUSA 5GS1C 2VITB 3OB8A 3MJ6A 5IQ9B 4NIKB 4Y4FD 3RZWA 4KHXL 1PKOA 4ZO8A 3AS2A 1U8PB 4JFDA 1RIUH 3TZVA 1CWVA 2W65A 1JN6B 3QCUL 4XZUB 3PHOB 2L0DA 1ONQA 3DBXB 3MV9E 4L8BB 1Y18B 3SGEI 5DVOA 3C87A 3CSYA 2MQ0A 2AQ2A 1QLRB 2DQTH 2AJVL 3FT3A 5INCA 4Z76B 2WANA 5F6IB 3NGBB 2F58H 4NCC2 2EYSB 3JBG7 1ERNA 2F54B 2I07A 1V3MA 3CFBB 1EEYB 1TCMA 4OF3A 5I17A 2NQCA 1W0VA 3BZFA 4KAQL 3BZEA 4ODTH 4PJFA 5B39A 4WI2A 2I5YH 4FQHA 4Y19B 1OD7A 5GGQL 1XF5B 1G0YR 5A2FA 2DQJH 3S36X 1S7SB 2BVEA 3CK0H 1GC1C 5DI8A 1T5XA 3L9RA 2XQBL 2GITB 3MACL 4PP2A 1BPVA 2HAZA 5IWLC 2XWTB 4ZMAT 4QXUH 5CZVL 1EHLL 5ICZA 5ID0A 4DKAA 4JFDE 5CD5D 3DLQR 1G7JA 4XPTH 5JO5B 3OGCA 5MERB 5EPMB 5D7JC 1HWHB 3O8XC 4BUGA 5CJBA 5ID1A 1T20A 4XHQA 4YLQT 1TVBA 3WFEL 4TRPL 3VW3L 4NC0B 3PWLB 4MAYC 3QIBC 2A6KA 5CKGA 4U1JB 4XC3L 4ZUWB 3WKML 2OL3H 1KPRB 3B9VA 2B20A 2JKXA 2XXCB 4QRSB 3V0WH 4OD2B 2G2RA 2QV2A 4JKLA 4P46A 5IVOA 3BUYB 2X70A 5E99H 1RJLB 2H41A 3GI8H 2XOTA 4E0RA 4HPOL 2C3GA 5EZJA 3KJ6H 4LF3B 4GRWF 2YKLL 3UX9B 2X4SB 4TTGA 5IM7A 1RJZB 1MOEA 5AZEL 5DUBA 4ZAKC 4P2RD 1MNUL 4D94A 3QQ4B 3RVWD 1IGTB 1KG0A 2EXYC 3ZYOA 5KVDL 1I7RA 3KPSD 1JL8A 1NLDL 5C9JB 4JDTH 2D7TH 1BQLH 1ZA3A 2N4IA 1YNTA 3HHRB 3L7FA 1SYVA 4JFZH 4ZSOB 4MS8D 5ICYB 2V5YA 4B0MM 3LKSB 3WSQH 1M7IB 5SWSB 2HJKB 1RZJC 1RZGB 3QDME 2X4TB 2FJGA 5HHNB 3SE4C 4Z9KB 3KVQA 4LBEA 2RHEA 3RHWK 2NZIA 2J1KA 1QSFA 1MAML 2C3XA 2Y7QA 3V6OC 4PRPD 1M4KA 4Y1AB 1NBYB 3LEXB 4S1DD 3BKYH 4K8RH 3N1MC 4MNQD 4MWFB 3CPLA 1W72B 2VZUA 5HD8C 1VDGA 3VFSB 3WIIH 2HLAB 1M05A 1T66D 4CRPA 4XWOC 3MV11 2E7LC 3G6AB 1WAAE 4YDLB 4QHUB 2NY7H 5DFTA 1KACB 3LKSA 2D9QB 2JB5L 5ANMA 3HC4L 4PJBA 1ZWIA 2CK2A 1AO7B 3H9YA 2ITCA 1W8OA 3QDMA 2YPLD 2QHRL 4PRBB 4YXHH 3ARSA 3LSOB 5B22A 2Y7QB 3W5NA 3FT4A 1N0LA 4U2YA 1PYWB 4U1SB 5DJCA 2OR9H 2Q20A 2AJYL 4N0FB 3CVHB 5DD6A 4C57C 2UY6A 4TQEH 5CSZB 4H8WL 1YEDA 1F11B 3FT2A 3DX9B 5DLMH 4XWGL 4LOUC 5D4QA 4MAYA 1B2WL 1ZGLA 3ZYZA 1UM4H 5BRZD 2DQEH 3HUJB 5IROA 2Z4QB 1U8KB 5DR5L 3S34L 4IDLA 12E8H 2H3NA 4GAJL 3NCJH 5JW3H 4HKJB 3TNNB 4OLYH 3I50L 4W6YB 4BQ8A 4HH9A 1F8TL 4HMDA 3BD3A 2GJJA 4JFXA 5DHXB 4OZ4A 3KNBA 1NC4D 2CXKA 3P2TA 4GT7A 4HX1A 1R3LB 1E4KC 1OTSC 2BK8A 5TGBA 3MGAA 4U1JA 5DRXA 3V79C 1MELA 1Z0MA 3QHFL 2C1PB 4Z77A 4LKXA 3BUYA 1GIGH 3SKOA 1QSVA 2ID5A 4F15B 1MJUH 4QEGA 5F9JA 2Y36L 2CKBH 3BOVA 3BP5B 2OZ4H 4QRRD 2CLZB 3BGAA 1H9VA 5F1SA 4OIIL 4HAFA 1O7VA 3RTQC 5FFLA 2ZUYA 4JN2B 2ADIB 3E1F1 5J12C 4CMMB 4MNHA 3AU1A 4YR6A 2E7HA 2LQRA 1LDPL 3ARQA 1T04A 1WFTA 2F15A 3NPSB 5JXAL 1KYOJ 4NFBA 2BNUB 2FX7H 4YHPB 4Z7VB 5T3ZD 5GQBA 3E0GA 2FX8L 2D4DA 1ZT1A 3OF6D 1NMCC 3FCTA 5ITBL 4OCLC 1JN6A 2DIJA 4KTDH 5EC2A 4LCIL 5C0AA 3TCLA 4JM4L 4FQIL 4Y5VA 2AV7B 2YD6A 4JQIL 3QXDB 3ILPA 4MJ6B 4CNIA 1RURL 3V5HA 2EIEA 4DN4H 2RR3A 1HK6A 1PKQA 3DRQA 1KULA 1MCDA 3JTTA 1EEYA 3DGCR 1KPUA 1HI6B 3AREC 3TEUA 3K3QA 4NQVA 2APBA 2EKSA 4X5WA 2AEWA 4MJ5A 4O02H 4X80L 5GGUB 1RIHL 4X6EA 1YMMB 3C5ZA 4WUKL 3SKJH 5C0RL 4I0CC 1JTOA 4X7EC 5EBWA 1JWUB 2EYRB 1M05B 4LVHB 4P2OC 1S7QB 5HGHB 1CFSA 3HLAB 2N1KA 2CDGA 2XT1B 5FECA 5I8KH 2D7TL 4K94L 2AEIT 5HPMA 1LO2H 4ELMA 5C9KA 2OP4L 5EDXA 3IYLW 3SDCC 3T65B 1G7LB 3S5LB 4M93B 3PJSB 2BSRB 3ECBB 4KROD 4TULH 4YHKH 4QWWC 1RZ7L 5T1KB 2OXGA 5JLZA 3HI6H 2AEQL 1I9JL 5FOJA 3U4BL 4WFHE 4NQXB 3TM6A 1MAMH 5I8EA 3W2DL 1WFUA 3LHPH 2NYYD 1X5KA 4OCSH 1DBAH 3KYNA 4I18B 4OZIE 2FLRT 1DEDA 4ZTPH 4P46B 5KVGL 4OGYL 3RKDC 5DS8A 3KAAA 5DVMA 4HBCH 2W9EH 1A6VH 3B2UC 2R2EA 4ODHL 1QQDB 1KB9K 3OB0H 4GW4A 1D6EA 5BCAA 2ZSWB 4WTZA 1CG9B 1FG2B 1FCGA 1NJ9B 1TNNA 4G8IB 2AGJH 3V6FA 1OTTD 5AYUH 1L7IL 1JGDA 5E9DE 5ISZB 3EDKA 4UU9A 1X9QA 5JA8B 3OXSA 3NIFF 2DICA 5DA4A 3GKWH 3H7LA 3W0WD 3L3DB 4OZIF 1NDMB 4YAQA 1HKLL 5L8KB 2VDMH 4ALAH 3I02A 1XF4B 3IFPB 4PP1C 3O4OC 4JLRA 4Y4FB 1ZA6A 5EOCL 2F5AL 5GGVY 1S8DB 3CH8A 4UNUA 4MD4A 4OZFB 1FFNA 2OSLB 2PYED 5D1QD 2KUTA 4HD9A 4WW2F 2CXGA 3MRHB 1IMHC 4ENEC 3D87B 2NW2A 2LVEA 3CXDH 1AGDB 4MD0A 4B41A 5J6GB 4PRNB 3V0VA 2PUQT 4GAFB 2LVCA 1A6WL 4L3ED 3MRQB 5DHVH 4PJGF 2DMKA 1G0XA 4GAJH 5BZDB 4L3AA 3DMMD 5E9DA 1XH3A 1NL0H 5KSUA 3SCMD 4CU6A 1FLTX 5E2TH 4GRWE 1XGQA 5GZND 4JFHD 3Q6GH 5DJDA 3VWKC 3G5YA 2VL5B 1J1PL 5F93C 4LARH 1T7VA 1XF4A 3IFPA 2DDQL 1TQCB 1UWGL 4H26B 4LFHG 2VWEC 1IQWL 2AXFB 1EEUA 3U9UB 1P2CA 4ZUUA 1JGEA 3BI9X 5KG9A 3EDEA 4FRWA 1FP5A 2Q8BL 1N6UA 2EH7L 3HRZA 3VD9A 1HNFA 5D5ME 2VLLA 1U8OB 1X4ZA 1ZS8B 2A9MH 1DSFH 2VDQH 1U8QB 3QRFM 4MA8H 2I26N 5A43C 3DBXA 4JPWL 3LVEA 1QTYT 4K7PX 3AMLA 1NCDL 2FSEA 1KENH 4I8DA 2VDPL 2F5BH 1D5ZB 2VO5A 4OBSA 2ZUQB 2Y4SA 2DWEA 5F7NC 4LHUD 4PG2A 3L5WA 4NQUA 5GS0D 3CNKA 1HCVA 1E27B 1Q9OB 2A1WL 3X3FL 3EFDL 1I8MB 1BD2D 2E6JA 3QUYC 1JP5A 1K3IA 1QSZA 3ZKQD 2WZPD 1T2JA 3HRZB 3GSWB 1GPOL 2VLLB 4XMPH 5KOVC 1FFOA 2XQYK 5F70A 2FNBA 3DUUB 3C6LA 2R0WL 4ONGH 2BP3A 3QR2A 4MCYB 1AR1D 1FGVL 1ZEAL 1IZKA 3ARFB 4BFIB 1XMWA 5EOCJ 4PJIA 2YPLE 1RUKL 5GS2D 4NRXA 4UV4L 4O2EA 5FYJH 1KELH 3EJYC 1S9WA 4AEEA 1S7XB 2CIIA 4K7PL 3GIVA 3V6ZB 2FR4A 2I27N 1RAMA 1UCTA 1CLYL 4MQ7A 2FIRT 4ZAKD 3MRCB 4JAMB 3QAZB 3AB0B 3QI9A 5DF0A 2DTMH 1C5DA 1ZK9A 1XIWA 3RHWF 4CVXA 1TNMA 4G8EA 3LB6C 1YZZA 2O5ZH 4EIZC 1A7BA 1OGTA 2EDKA 1NSNH 1RU9H 4MMZC 5D1QC 1CLOH 3UTSE 3HR5B 3SDXB 3QULB 3DXAA 3VXRE 3R0MA 2EECA 5DD3L 5EZLB 3VGDA 2Q6WA 5GRUL 1DE4B 4P4KA 3DROA 1FZKB 5DD0L 2EDNA 3B8SA 3QXWA 4WCYL 4Q9RL 3UC0L 4JDZA 4NPYB 3GUTB 3VCLB 2YPKA 3G6DH 2W9EL 2Q7YA 2BHUA 1A3RH 4L4VE 3KYOB 5ACZA 5BVJB 3T0EA 2CDFA 1FCCA 3D69A 2QSTA 2WUBL 4EVNB 1IZJA 1AGCB 5D7IE 5DO2D 3MRFA 3DI3B 1XH3B 5I19L 4XBPA 1ES0A 1I7TA 4I5BB 1DVFA 3O3EB 5JMOC 1RMFL 3QUYB 4PJ9A 1IL1A 5I1DB 4HSQA 1IKFL 4GXUN 5JHLL 2PTTB 2J5LC 1A14H 3GMQA 5HYJD 1J8HE 3OAYH 4Z8FL 4PBXA 1EV2E 3VFOB 4ALAL 1E6JH 2UY7A 1VEOA 4K3JH 5TDOB 4ELMB 3GSNL 4YDVA 1FO0B 3ZL4H 1KJ3L 1DANU 2NXYD 4N0UB 1BAFH 3T65A 4IS6B 3K8LA 1XF3B 3BW9A 4QWWD 5C8JA 1CICC 1YUHB 2PR4H 5CJOH 1QRNE 3TWCL 5DJ2A 1C12B 1TETL 3AAZA 4OCYH 1DBKH 1ZWIB 5ESVB 3OPZH 1ZKAA 4OFVA 3RGVB 1FC2D 5D7IA 2BVYA 4Y4FC 3C08H 3VFSA 2XZCL 4RISL 1T5XB 3HR6A 3QJFA 1CXKA 2X1OA 3VI3E 3IGAA 4KV5E 3HE7B 3MODL 1NC2A 4XPFL 1KCLA 3K7UA 3T2NL 1KLUA 1A7OH 5AYQA 4L9LA 1P7QB 1YQVH 4HC1L 2IADB 2DLTA 1KCSH 2VYRE 1R3HA 4OM0H 1DN0A 4K94C 3HB3C 4M6AA 5L2KB 1T2XA 5BV7H 4R4BA 5CINH 3NCEB 4KK8C 2XA8H 3V0AC 1JYNA 1QRNA 2WIIA 3MJ9H 2YD3A 3RAJL 1U2HA 3RKDD 4O5LH 4Z7OF 4F9LC 4UT9L 3KYKH 4H88H 4Q9BA 1FH5H 4X8XA 1A3QA 1JHKH 3O8XA 3BDYH 4FFZL 2X9WA 3R1GL 4Y5YB 5IIEB 4JM2A 5HI4C 4YGVB 5D5MB 4WU5B 3FQTB 3F5WA 3VGHA 5CMAA 5IB3B 2E6QA 3GMRA 2FEDD 4AY0A 3D2UA 1FGNL 3MRQA 4WI8A 1A7PL 3QDJA 2R1XA 3PQYE 4NHCL 5EIIA 2O5YH 4M62H 3PGDA 4HEME 1T21B 5EBGA 2B8OT 4JRWA 1EMTL 3ARYA 3G5YB 1EPFA 4MA7L 5DDHB 4Z7UA 4JZJB 2P8LB 3B8YA 3DRTB 1CICB 3Q5YA 4QXTA 1A9BB 3E2HC 1BQHG 5DJXA 5D5MF 2PYEB 4X6BB 4FFWC 2IQAB 2BOCB 1RZ8A 5H2BB 4QXWA 3MNZB 2GKIA 1CLYH 2VXTL 5H8DA 5K9OA 2P45B 1A6TA 1A6UH 5D70L 4JPVH 4QRPD 3T4YB 5IVXB 2WIMA 3BQUA 3BKJH 2CRYA 4DZ8B 3GMLB 1ZLWH 5DK0A 5EU5B 3CDYA 4G8FB 3G5VB 4KQ3L 3QJHA 4LEOA 2WW8A 2E9IA 2WP3T 1INQB 3V5KB 3SOBH 2JJWA 3D9AL 5KOMC 1EHXA 3MLXH 3AUVA 4HS8H 3MLZH 3ZKXC 2WAHA 4RMTA 4NWUL 3TBSA 1K8DA 3I3BA 1BIIB 1QP1A 3TBYA 1EDQA 2XQBH 3MACH 4ESKA 2F8XC 3VFRA 1D6VL 3VXPB 2ED9A 4NWTL 4Q6IB 4ZUSA 1Z3GL 3MNZA 5FA3B 3VFPA 1I8KB 4Q9RH 3LH2H 4F7CA 3U0WH 5E6IC 3NGBC 2W0KA 4N8PA 4XZUA 1MCCA 3BH9B 4NZRH 1JTTA 1AE6H 2MQ3A 1JZ2A 3U9PL 1T4KB 3BP4B 5EORL 4C4KO 1IM9B 3SDAA 43CAB 3FMGH 4LNVA 1IT9H 1MJ7L 3KPSE 5C08A 2GUOA 4FFYL 1YN7B 5KSVB 4I13B 2G5RA 1GGBL 2J5LB 1FRGL 2EC9U 3IDIA 2W59A 5C92A 3W39B 4KY1H 4JQXA 3RNQA 1J10A 3C60C 3WIFA 3CFKA 1OP5H 4UINH 5E8NA 4M7ZB 1F90L 2IGFL 4JFED 1QBAA 4HH9B 2OTWB 4HPOH 3MUGA 3VFMB 4RFNC 2UYLA 4NBYB 1YMMD 4OQTH 1NLBL 1MH5A 1MWAL 2FJFA 2CR3A 4OJFH 4RDQF 3FRUB 1DLHB 3C9NA 2NY6B 3QFJE 3CSBA 4GBXA 1SVZA 1KTDA 2AJ3B 4QT5A 1YECL 1DQMH 1DR9A 5FO8A 1GOHA 1NCTA 1UYWH 2AJZB 5INDB 3JV6A 2B5IB 4ELME 3NZ8A 1AFVL 4ZYKA 3UPRA 4S0TD 1H3GA 3MRMB 4HLJA 3JTSB 3QISA 1NFKA 2VR5A 4FZEL 1YEJL 2DQCL 4F37K 2VAAB 2A6IB 2F53A 5DJYB 4YPJA 1YDPB 2GK0A 3FN9A 5CBEB 5FDYA 3FQUA 2IH3B 4IM8A 3J7HA 3QDJB 4JO3L 2D7OA 2VR9A 5FKAA 4G6JH 1MWAA 4EZMA 1UKSA 2QSCH 2HH0L 3Q6FA 3L7EA 1BFOB 1FPTH 3VFWB 4HKJA 1P53A 3V0VB 4UIKL 4XWOD 3X13B 3JV4B 4H1LG 4Z7VA 1G7IA 4R7DA 4UTAL 1MI5B 1WFOA 5DO2C 1N5YH 4XP6H 1QBBA 5EA0L 1L0QA 2EIZA 4IS6A 4M9OA 1NEZB 3CMOL 4KRMB 3QXDA 3BX7C 1KT2A 4IIQC 2NR6C 1GZPA 4ZXBA 4MA1B 4JO2H 4LGRB 5GGSA 1GYAA 5FF6B 3M1BB 2CIKB 1NFDF 1BD2B 3P4NA 3K4AA 4EXPX 1R5VB 3Q6FB 2HFGL 4NQDE 4RFOH 35C8L 4NKDB 2YHGA 3QYCA 3H7BA 3GSUB 4ODVH 1RUQL 1ADQL 1XIWC 3EDJA 4KV5F 1Y0LB 1RK0A 3OKKB 3VFVA 1B6DA 3QJFB 2FO1A 4U49A 1IAIH 4KUZL 5GIRA 2DQIH 3P9WB 4WO4A 4E41B 2XKUA 3UYRH 5CUSL 3AFLA 3WNPA 2FYYA 3ES6B 5JOPE 3U36A 4HWBA 2XN9A 1RVFH 1NFDE 2X40A 3NZHH 4CW1B 3F7YA 1G7MB 4HFUH 4MLSA 4GG6F 3LKRB 1TJHL 4YPGB 2VLJB 3T0AA 4J7RA 5I1HH 4R26H 4XNYH 3WD5H 4LSSH 3S36H 1SJHB 4UZGA 1NCAL 4ZQKB 3SE9H 3SDCA 3UMTA 3BD4A 4X4XA 2BDNH 4IMKC 2NY4B 1F58H 4KUCD 3MMEB 4QRRE 5HYIA 3O0RL 4KKLD 2RFXA 5MEND 4YDJA 3CVHH 5GJTH 5M94B 4KWUA 4Z0BL 1KPRA 3MLZL 4M5ZH 1YEDB 1T1XB 1N2RB 5CD3B 1I3GH 3WEXB 4GXVH 4UBDD 5D93B 1Q9WA 1ZGLB 1F4HA 4PB9H 3HPLA 3U46B 1BLNB 1MAKA 3V4UL 3UJIH 5JQHC 2Y06H 2X7LA 4X6FB 2VZ1A 1CD8A 1T3FB 3RNKB 5F89A 1KB9J 1BQUA 4WHYG 1N3NA 1R5IB 1A14L 3W5MA 2OI9B 4ZXBC 4XPAL 5E5RB 4K9EC 4UILL 1NCCH 5I18H 5GISH 3SDYH 5BZWB 4OGAC 1KEGH 3QNXA 4U0QB 3KYNB 5KS9E 1NGYB 5JPMB 4OUUA 2YA2A 4EBQH 5IESH 3BPLB 5IBLD 3ULUF 1J88A 3VJ6A 5C6TH 3ILQD 1VKXB 1CDBA 4PJIE 4WVRA 2NZ9C 2H6PB 2EIBA 1NJ9A 4KXZH 3N1FC 4HWEL 1A7QH 3X13A 5MI0B 4J3VA 5KTEH 2N7BA 3MA9H 1QSEA 2ICCA 2PW2B 3L3KA 3DMMC 2FEEI 1NBVH 1AH1A 2E5EA 1XGRA 3F7PC 4I77L 4OIIH 4R6UA 2ZOLA 2X09A 2AW2A 1G9NH 1PJ9A 1XEDA 5JORA 1UYWL 4RAVA 4PJAF 5F1OB 2YPKB 4UBDC 1GZPB 1UA6H 5DZLA 1X5AA 3WXWH 5EU7C 1I9IL 4R96A 2VDKH 1LDPH 3OMZA 1NUDA 5C0GA 5DUPH 3SDAD 3VMNA 4WY7H 1R24B 4LSTL 1U95B 1ES0B 5IVZB 3RDTD 3NFPA 4K71C 1VB9A 4AMKL 1P9MA 3UJTL 2HLFC 4DOHB 5MEPA 2H26B 3FHAA 1QD0A 4YZFE 3GI9L 3TIDA 4OCRL 3AY4C 2IPUK 5E9DB 4ZTPL 1YQ2A 3U0TB 2JCCE 3O6MH 3WIFB 4QO1A 1WJ3A 4F9PA 5JIIA 4LAQH 4R0LA 1KJ2A 1HEZA 3DX9A 3TO4C 4A6YB 1CVRA 4MD5A 3MOAL 4FZ8L 4HJ0C 3RWJB 3EYSL 1HN1A 4P59L 3O4LE 3LDBB 1R24A 4P5TB 5DMIL 2NXZD 3MRJB 4RIRA 2AQ1A 2BVPB 1U3HC 1KN4H 1J8HA 2AKRA 1IQDA 1H15B 2ICWA 2Z0BA 5AD0A 5EU6D 1MFDL 1MRFH 3MLWL 1QFPA 4F58L 1A1OB 3TO2A 3QDAA 1E0OB 1NQBA 1EXUB 4TULL 3BT2L 4YWGL 3LB6D 3KWWA 2MFNA 3HNTL 1FN4A 3ARVA 4N9GB 1JNNL 4XMLH 2JCCA 1OSZB 1G6RB 2ICWI 1S3KL 3VXSD 4D3CH 1KCVL 2QQNL 4YFLF 3V5DA 2MMXA 3AY4A 4KKAD 2P5EA 1WITA 3U30B 5E2WL 4GKNB 1DP0A 4QHLA 3VXUB 4Y4KA 1FFPB 5I1AA 5IG7B 2W60A 3UEZA 2OR8A 3MRDB 4TPRL 5C09D 3PDOB 2BOBA 3ULSA 2R56L 5HSFA 3LIZL 3C6LB 4HLZG 2IANE 5IGXL 1ZOXA 1J1PH 2FZ3A 1JHTB 4LARL 5IW6B 5HGDA 1Z9LA 3B5GA 2NPLX 2GY7B 4W81A 1P5VA 4YAQB 2IG2L 3HNSL 5GRJL 3LKOB 4YBLC 4Y2DB 4K3DH 3ZSTA 5GRVL 2J8UE 2VABB 1IGYA 1EUTA 3ZLQC 2D7QA 1KNOB 2NX5E 4UQ2B 2O61B 1RJCA 3FO0L 4JVWA 3O41B 5I76A 1S5HB 4DGYH 4DN3H 4WNQB 2WLYA 3ZE2E 4U7SA 2H3NB 2WBJB 2YXMA 2PYFA 2V5RA 4DFIA 3QIWB 1LO0H 4FFVC 3UTQB 1IGJB 1P4BH 3QUZA 4RGOH 3RVVC 4N90D 3VXQA 4OF5A 1KPUB 3PNWB 3C8HA 4TTDC 1TQCC 1U93B 2W38A 4RGNE 1JHTA 3T4AB 4HXAH 1KJMB 3O9WC 5FUZH 1KC5H 5JW4M 2DYPB 2WQRA 2AI0H 5DJDB 3DV6B 4UINL 4G43B 1CE6B 2R4SL 4DKEH 4JFFE 2X1XR 4LGSB 4E5XB 3O6KH 1F6AB 1MAJA 1V05A 2ESVB 4KHTL 3C60D 3UTPE 4XCNA 4HFWA 4YPGA 3CC5B 4G6AC 1JGLL 4NSKB 4WRLA 2V7HB 2KBGA 3HZVA 4PJBF 4EUPG 1RUPH 2WLZA 4DVBB 5EU5A 5JPNB 5IR1A 4BSWA 5F1KC 4LCCB 1YECH 4F2MA 4MXWH 3VFPB 1SBSH 3U2SA 3CXHK 1U36A 3GSNA 3MRNA 4JN2A 2CH8A 4U1KA 3LQAC 3GM0A 3QWOA 4H1LB 4QGYA 3QCTL 3EOAB 4PJGA 4RA3A 3HZKA 3EOBB 4PJEF 4W4NA 1NGWB 3NACH 4Y1AD 2PXYA 1C08A 3IDMB 1MFCL 5EBMB 1FNAA 4I77H 4N68A 3WO4C 4O4YL 1OCWH 4LPWA 1I3UA 2AVGA 1JFQH 4QHUA 3LS4H 1ZT1B 4JFFA 4RQQA 3IXTA 3MNWB 5I0ZA 3EYVA 1FDLL 1QLEH 2YK1H 4ODWA 1I75A 5J4MA 4FQXD 4GQ9H 4DQOL 1N5AB 4TYUA 5J56B 2ICWJ 2HMID 5LJYH 5F9AC 5TF0A 1KCRL 3OXRA 3MLRL 4XX1G 4XB8A 1PZUB 2W0FB 1F3JB 4UU9B 3GSNB 5C3TA 5DJ0B 3HFMH 3QWOB 1CZ8H 1SY6A 2K7PA 5LXGL 1F42A 3O6FD 3LN5B 4PLOB 1MRDL 5ESVA 1NBQA 4GBXB 1M6OA 2AP2A 1U8IA 3M8OH 1INDH 4M8QB 1LP9E 5ILTH 4XPGH 5T3ZL 5JOEA 5FECB 3WYRA 2ATPB 3A67L 2OK0L 3PGDB 4HIXL 4RWYH 2P8PA 1S7WA 4FNLH 4LF3A 2CRIA 5IP4A 3QQ9C 3I6KB 3BO8A 2JIXB 5L9DL 5HD8D 3ZZ1A 2DQUL 3DIFB 4ODUB 2E9BA 1EGJL 5T1KA 1A22B 1DTUA 1IAIL 4K2UH 1TPXC 3WKNA 1JI2A 1X6LA 4ZYKB 2Y5EA 2C4FU 4EQ3A 1OGTB 4DJMA 3G08A 2OZ4A 1UJ3B 4PJ5D 2FL5B 4X5XB 4M03A 3ZL4L 1F3DH 5FDWB 4NRYA 1Q38A 1RU9L 1DQTA 1JZ3A 2APVA 4OV5B 4UDUA 3L1OL 2E27H 4OLUH 4N5ED 5AG9A 4PG9A 4NUJA 1LP9A 3MBXL 1CN4A 4P3DA 2VKXA 3N85H 3QPQD 3VG0H 4XNYL 1RZKC 4HUNB 3LEVL 4W6XB 4MYWB 4FS0A 4Z76A 3QO1A 2DQTL 2P43B 1NDGB 3GRWA 2DM3A 4OCXL 4W4OC 3SKNB 3OPZL 5FYLH 4Y1AA 4RMWA 3FQWB 3ULUE 4PD4K 4XBGA 3LD8B 1DUYB 4OAWA 4KKAC 1QZ1A 1ORQA 3NFNB 2R4RL 2VMFA 4FQHB 4Z7QF 2F53E 5JIPA 4YHIB 5I9QB 4JREC 4LHUA 3DHJA 1CT8A 2P49B 3B5HA 4ZTOL 4LEXH 3VE0B 5DC0A 2IG2H 4L29A 4TSAH 5CZVH 3H9SA 4X7TB 1HQ4B 4YK4B 1ACYL 4L8DB 4P0DA 4JFQB 2X44D 3VXTB 1C8PA 1E4XL 3MBEC 1N7ML 3C6LC 1YEHL 3QXTA 3IJYB 4NNPH 3B9DA 5A2IH 3C6SA 3STBA 4KK9D 3IKKA 5DJ2B 1CQKA 4HZAA 3T0WA 2P7TA 2VNCA 5TQ2H 4HK0A 4MNGB 5D7JD 4K7FB 3VFUB 1G9ML 1VACA 1J0HA 3V5KA 4D0DB 4EBQL 3GJEA 1ZT7B 4U1MA 2MQCA 4M1GH 2LTQC 3F8UB 3V5DB 3K1DA 5CILL 2R39A 3MMEA 4FQCH 4WFGD 3E3QE 4HGMA 5I30L 2Y9RT 1UVQA 4ODSH 2XKNA 3MLVH 1A7PH 1Q0XH 4MB5A 2YS4A 4HUWA 4LSVL 3TNNA 4I4WB 5CD3A 1KTLB 3LKNA 1JHLL 4HV8A 2OL3A 5EO9B 1RZFL 3E2HB 1EAJA 2A83B 5DUBB 4OZ4B 4YHMH 4UV7H 1NBVL 1FJ1B 1S78D 2YEZA 1S9XA 1ZE3C 4HMEA 4MXWL 1XF1A 5I8EB 1R3IH 5BW7A 1OY3B 4XPTL 2XN9E 3TCXA 4HCRH 2A6IA 2F53B 5DJYA 3JZ7A 3I75A 3SDXA 1UA6L 2ADGB 4U1GB 2R69L 4QHNB 1WBYA 4JDVB 5IB4B 4UQ2A 2H1PL 5IMMA 4KI5D 1E27A 1F4AA 4F9PC 4OI7A 1AGBB 3QIUA 4RGNB 4XAWL 4H88L 3W39A 2XICA 4PUBH 3SE4A 1GGYA 3GMRB 4OZHA 4OUUB 2V2XA 4EI6A 4IIQA 5CWSB 3BE1H 1T22A 1RJLA 5BRZE 1D7FA 1F5WA 1L0XA 4JHWH 1PZ5B 3VH8A 3QA3A 3C09B 2HVJB 3G9AB 1TXKA 5DEFA 5HI3D 4V2CB 3UTTB 1CS6A 5KZCD 4NWUH 3BEWA 2O5YL 2Z8RA 4LLMA 1R3KA 3RWDA 6CGTA 4K7PY 4M7JH 1H3PH 1V5JA 2P46B 2XY2A 5KW9L 3WJJC 5LGJA 1Q1JL 5ALCH 3SDXE 3QO0A 2YD2A 4P4KC 3QEGL 1NGXB 4GKSA 3SO5A 1RUAL 1KIQB 1KGCD 4NNXB 1CU4H 5IR1B 3RWGA 1YDPA 2J8UF 5C0DA 2RQ8A 2WWMC 5C8JB 3WXVH 1GJIA 5EOQH 5D1ZB 3D5OF 4OZHE 4EDXA 2XY1A 4UNVA 2NXYB 4NNYB 3D18A 4F58H 5ESAB 4D9QE 3QFDA 2X4RA 5BO1H 2X4TA 2DQUH 1NLDH 1YNLH 5EZOL 3KR3H 4MAYD 4XMLL 1BJ8A 4I0PA 3TYGH 1R3KB 3RWDB 4CDGC 4I9WD 1FLRH 5KN5B 3JWDH 4R7DB 5A16A 3BRDA 1WEJH 3RUGB 1TTUA 3TBSB 2XACC 4P9ML 5IQ7H 1B2WH 3QZWA 1N6QH 1UQSB 3SE3C 2FD6L 4PGBA 3BP7B 1PDKA 1ONQB 3CPLB 5SX4I 1RFDL 1X5FA 4R0LB 3VGGA 4CL7A 4OQTL 4WFGE 4OZHF 4JQVC 3QDMD 5FM5M 3MQIA 4LAJH 2MCPL 5SWZE 1UB6A 1Z3GH 4LCUA 4KGJA 1FQ9C 4G9DB 4JZNB 1M7DB 3ZSSA 3ELAT 1HXMA 5FA4A 1LP9F 2A9NL 3IFOA 4ISVA 4UT6L 5I1DA 5C08B 5ADPL 5FYJU 5JHDB 3AREB 3NMEA 3MO1A 1L7TL 3QHFH 5LQBH 4QY8A 3FFDB 4LSRH 1HHHB 4JM2B 2ZOKB 5E5UB 4Z7NE 1QQDA 3B43A 3FQTA 4WWKC 3WUWA 4YC2B 1HXYB 5LGKA 4RBPK 3T2QA 5JO5A 1V3LA 5F9DC 4HV8B 3PL6C 3I9GL 3WDJA 2FBJH 1AR1C 3DTXA 1UJ3C 4NO5B 4N0FA 1NGZA 2Q7NA 4I0KA 5F9OL 3TZVD 3QNXB 1DFBH 1FN4B 4N9GA 5DQ9A 3WFHB 1QKZL 4NQEA 4G7VH 3GSXB 5JPMA 2ZSVA 1D9KC 3PWPB 4AQOA 3FRPG 4WHTA 4ZS6D 1MUJA 1YMHA 4DGVH 4NZJA 3STLB 5C0AB 4O9HL 2ADJA 5GS0C 5IT2L 1UACH 3LS5H 4Y5VB 3V95A 2IMMA 1NCUA 1A4KA 2A6JA 3HG1B 3ZYJA 3D3VB 2YSSA 4JE4B 1F8TH 1VFAA 5HDQL 3A6CH 3EZJB 5E4IA 1EZVY 1OGAD 4XHJD 1Y6NR 4LSVH 1X6NA 1I7ZB 1BLNA 1AXSB 2H9GA 2NYYC 4NKOB 3PUCA 2HVJA 5DEFB 5CS7A 2SEBA 1CT8B 4I18C 2QSCL 2DS4A 2ZSVB 1KCUL 2EYTB 4LKXB 4K07A 4PJHB 2ERJC 5HDLA 2P5EE 4HIEB 3HE6D 2Y36H 2J6EL 1QNZH 1OSPL 4QNPF 1IC5L 4GG8B 4L8SC 3KHOA 1PLGH 2Z93B 5HVHB 4X99A 2XZQL 2XN9D 3U7WH 4LMQE 2A73B 1R0AL 4OSUH 4WO4D 4P5TC 1L9NA 1AD0A 2AV7A 1FZMB 4K7FA 3VWJC 3WNOA 2HFTA 1D5ZA 1FIGH 4IOFD 1QSED 3MRRB 4JRYE 2V2WA 4K55A 3LEYL 3CVHL 5GJTL 5C7XL 2G75B 5EFIB 5A16B 1HHGA 2MCG1 3SKMA 4JG0L 3BN3B 4JN1H 2OR7A 4R4FH 3BP7A 4QNPE 1J0KA 3C5ZB 1RULL 3RFZC 2D7NA 5DJ6A 4UQ3A 3W11D 4KDVA 3STZA 2EYRA 1U8MB 3LKPA 4WI5A 1J0IA 2Z93A 4U05A 3MFFA 4L8CB 5FV2A 4HKXB 5SV3A 1OP5K 3ESVF 3JTTB 4XTRD 1MCPH 3F7YB 4CDHA 1MQKH 3NFSL 5J6HA 3MCKB 1D3CA 4NQVB 1JZ4A 2KH2B 5DD6B 3SKJL 5C0RH 4NJ9H 5EWIL 2QADC 2X41A 1AXTH 5EBMA 5FO9A 5L88H 1S9KC 4Y4FA 4TSCH 2YC1A 3ZKMD 1OAQH 2F54A 3WD5L 1XCQA 4KXZI 3EOTH 3F65A 3BIAX 5D7KD 4JRYA 3V4PL 2AABL 4HGWB 2GSGB 3MCLH 4M1CD 4JQXC 5CKAA 4JRYD 4N5UA 3KPQA 1YY9C 1HEZB 3CXDL 2UZIL 4QTHB 4F3FA 4OIBA 4RGMC 3L9RB 4FG6D 5CJQL 2AEQH 3QIUC 1SEBA 5MENA 4I3RH 4QCIB 1D6EB 3H9HB 4G80B 1FORL 3VXOB 5JR1L 1DLFL 2V17H 1DEEB 1EO7A 1JTPA 2MPAH 4QXUL 1FYTA 4BH8A 1DBAL 4JCMA 3Q2CA 2NY2C 3HZYA 5CEYA 1JGDB 4P46D 3SDCD 2OJEB 4JB9H 3PWPA 3F7RA 3GMNB 4XVJH 2Y06L 4PD4J 2B39A 4XCFH 3BPLC 5HHOA 3MV8A 1ZLWK 2RCSH 4MJIA 5LBSH 4CUCA 3VRIA 4DW2L 1BOYA 5LQBL 3G08B 4WUUE 4H5SA 4P2OD 3RWHB 1IFHL 3B83A 3FAWA 5IVXE 2E6PA 1BWWA 1N4XL 1OTSD 4EVNA 4Z78B 4X4ME 5FXCH 2VISB 3HC0A 2WMPA 3VRLF 4PJAA 3UJTH 1MCJA 1WT5C 2D7PA 4NKOA 5EZJB 2B4CH 2GJZB 1IGFL 2VDML 3C9NB 4J1UA 4WFEE 3VGEA 3L3GA 4LRIC 4XC1L 5IM7B 2HKFH 1P69B 4YXLH 3KS0J 5DEGA 2EE2A 4NHUA 3BPNB 1FYTE 2V9TA 1YNKH 1JK8B 5C09E 2BXYA 4PIRF 4WGWB 5KSAB 4ZS7H 2RIKA 5AZ2L 3G04A 1V7NL 3MV8D 4JO1L 1QR4A 3MV8E 4LPVA 1Q0XL 4D8PB 5FCUL 1PG7L 5I1LB 3PWPD 1MFEL 2FX9H 1HSBA 3VWJA 3CZJA 1JZ7A 2NY0D 2X4UB 1I3RB 4PJ7A 4RAUB 4UV7L 1B4JL 4U1IA 3EO1B 3WFCL 3GMLA 3DI2B 4DVRH 5ISZE 2BNQE 5IVZA 3IETB 5E95B 1LGVA 4C4KT 1N59A 3FZUC 4KVCL 4F33B 4WY7L 1J12A 2BFVH 1S7RB 1MLCA 1UWGH 5JDSB 4JPIB 4F7TB 4HJJL 4AMKH 2P7TB 4GFTB 3W9DB 4U1HB 4D0CB 3BQUD 4WUUD 2IPKB 4P23D 2Q8AH 3GI9H 1N2RA 4OCRH 3ULUH 1JRHH 4D9RE 2ZCKH 2ZUTA 4JRXD 5ALBH 2R15A 2A9ML 4EUPB 1DSFL 2GITA 2VDQL 4PP2B 4L8CA 2XWJA 5T1DL 2C4FT 5LVEA 3K2UL 5FKPA 3DTXB 1NFDB 5J6HB 3FL7A 2FO4B 4NQXA 4G6FB 2VDPH 1FG9C 1T3FA 3MV9D 3D85B 5ADOL 5DUML 3BMWA 5DRNA 1ZANL 4K23L 1JNLL 1CL7L 2Y6SC 4GXUM 4AJ0A 3DOSA 3GFUA 3IAQA 2CKNA 4ZODA 4L3CB 1D5XA 1FGVH 1ZEAH 4GW4B 2DLHA 1F4YL 5DZNA 4ZUWA 1HILA 3ZDYF 3HZMB 2EC8A 4X7CC 1A9EB 4JN1L 1KELL 3MUJA 3BZ4B 1WBYB 4U0RC 3VFNA 1UADC 4G8GA 4BFBD 2X1PA 5DWUH 1A6PA 1T20B 2Q76B 4AL8H 4QYOB 2DQDH 5B8CC 3LQAL 2D0FA 4UB0H 2NY5C 4HK3J 1PGRB 3PF2A 4OGZA 5ACLA 5HYSA 4D3CL 5EO1A 5EUOF 3IFNH 4HT1L 5JW4N 4EI5C 3FB7B 5D1ZD 4BFEA 4M02A 2BY1A 4LDOB 2R0LL 2G2RB 5FDWA 4YDLC 3OL2A 3MBEB 1FLRL 2EYTA 1C1EH 1I1AD 1OT1A 4ONOA 1IBGL 5BJTA 1CD1B 3ARBD 2V5MA 2OTPA 1ZHLA 3CLEH 2R2CA 4LLUB 5JORB 4TTDD 4KHTH 4RDQG 4PJXF 2X4OA 3PP4L 4PJFE 3QI9B 2APTA 2GSIB 2YPLB 3B6SB 3GO1L 3ULVC 2J6EA 4TNVF 5GGVL 1UJTA 4QYOA 4TUJB 3DGGB 1FZKA 1BWMA 3GB7A 4MX7B 4ERSL 3T8XA 4Z7WE 1KN2H 5K59F 1HQRA 1MJUL 2A9NH 4UT6H 5IFJA 2VL5A 1RZIB 1WLHA 2Y07L 4IOSD 4PLJC 3QCTH 1YN6A 2LAGB 5MEQA 5JR1H 4U6VL 2B1AH 3H3KA 3NBNA 1ETZA 4NRZA 4BZ2H 3G5ZA 4WCYH 2D4FA 2Z35A 1HQ4A 3WDIA 1JFQL 3L5JA 2CJUL 3UZVB 4XCFL 3GUTA 1IAIM 3QQ3B 1OT2A 4QRPA 4RA0C 5B38A 4OZFG 5D7LA 1CGVA 3DYPA 5CSGA 3BRFA 3HS0A 1JF1B 1Y6KR 4LLQA 1NAMB 5GZNC 4TUJA 5HI5C 4NNYA 1T03H 3MRFB 4NSKA 2A77L 3FO9B 1RMFH 2BSTB 2H6PA 1N4XH 4GS7B 5JNYA 5F7YC 1MY5A 5I16B 1J8HB 4OLVH 3U2SB 2HLAA 2XTJE 3HUJE 4XXDB 2AEPH 1UENA 5TDPB 3OKNB 3KLSA 4K3JL 1KB5H 4G9DA 1G6RL 2BSED 4XNZC 1YYLL 2UUDK 3DARA 1HXMB 5ILTL 5GRXG 3RGVA 3IVKA 4CBPA 3HPJA 3IFLL 3QCUH 3WV0A 1UC6A 5HHVH 4HIXH 3MJ9A 4RWYL 1RK1B 3OKMA 4P49A 4PRIB 5IW1B 3CAFA 1Q72H 1I1AC 1S9YB 1WZ1L 2YZ8A 4HJ0D 4P4KD 2OXHA 3ILQC 2D0HA 3O8XD 4PJIB 3RWEA 3WS6A 1DBBL 1F00I 1J11A 3MXVH 4ODTL 4DVRL 5IOPB 4CU7A 4JY6B 3CDGB 1GC1H 5EZIH 2VXQL 3DHMA 5J1AB 3NTCH 4KRNA 3QWQB 5CCKH 3JWNC 1QSFE 1QBLL 1LO4H 3HUJA 3L3IB 1B6UA 3HE7D 4OB5L 2UVFA 4RGNC 4JKPL 2C1OB 2GCYB 3QUMB 2P24A 3ROOB 4Q0XH 4Q9CA 1ZT7A 4R2GB 1C5DB 1DN0B 5MEOA 2BSSB 3VFTA 4WNQA 4JPKH 3F5WB 5HHPA 4YEFA 4PJEB 1YEKH 5HHQA 1YYML 3MJ9L 3RAJH 1QRNB 2WIIB 4KQ3H 3KPLA 2XG5A 4DCQB 3GSXA 3R06B 3MBEA 5SWZD 4BK5A 2NY3C 1DQLL 4NHCH 3OX8A 2EDYA 2QQKH 4MCZB 4N0UE 1J9CT 5D2LE 2IAMD 5BW7C 2X1WL 1DBJH 3UTSD 1EJOL 3P4OA 1S78C 2BNQB 1CXIA 4B7LA 3AROA 4M7ZC 4PJFF 5C0DB 1TITA 5C0CE 2MWCA 3CSPA 3V6OE 1A4JA 1LK2A 4OZFH 4RAUA 3D18B 1BD2A 4PRIE 4HEPG 5DYOA 3HE7C 3X12A 5A2KH 4YDIH 1ZVYA 2QSQA 5JHDE 2CK0L 5FGRA 3UTZB 3T8XB 4UUJA 3T08A 1Y6MR 1HDMB 1VENA 2O5XH 3Q48A 5BMFH 4OLUL 5HYJA 3QO1B 5F9WB 4IIQB 3LKQB 32C2B 5TQ2L 3T4YA 2IANB 2X5PA 1XZ0A 1GGBH 1A6WH 1JPST 3BHBB 4P99A 4CADB 3LY6A 3QIUD 3FFCD 3QHZL 4G42A 2P8MB 3NVQA 2IQAA 5HHXL 4NN6C 4LLMB 5D2LA 4ODSL 1QFOA 1R3JA 3CLEL 1FAKT 4DFHA 4NCC1 3GSRB 5DJZA 3KYAA 1Q94B 5HDBF 5DMGD 3BAEH 3SQOH 1NCBH 4K8RC 1WBZB 1T1WA 3SE3A 1D6VH 1BD2E 3O4OB 4OKVA 3DVNA 2X1QA 5JHDA 5LKNA 4GAGL 4K8RL 3IRZA 4XCEB 2B7DT 3REVA 4Q74A 2X4PA 3HUJF 1XZ0B 1RJYA 3UPRB 4GMSL 3ARZA 5D1ZC 3QFDB 2I9TA 1GH7A 3DMMA 4PRAA 5I74B 5AEAA 1P7QA 3L3HA 2JB5H 4X9BA 5E2VH 4LIQE 5F1IB 3MRGA 4FQLH 1LILA 5DJZB 1OARH 1C5CL 2ATPA 4ZAKA 3QQNA 5JA9A 3PL6B 4IRSA 3ARFD 3TPUB 1JUFB 4PJBB 5D1QA 3L6FA 5EO1B 3BP4A 5IB1B 4JHZA 5I1EL 4C59B 2X4NB 4CN4A 3N1QC 5FGBA 3LMJH 1EFXA 3UO1L 3WIHH 5HJ3A 5DURD 2VR4A 4U3CA 3AS1A 3EJJX 1UB6B 1OLLA 3GK8H 1W8NA 1MLBA 1N5YL 2DKMA 4XRCB 1JCKA 2ESVD 3EBAA 2A6JB 1I9RH 2HWZH 4ZUTA 1MJJB 1DQML 2P5WB 4AEHL 3F62A 3KDMA 1NH6A 4NKQB 4JHAH 3DETD 1HIMH 3TO4B 2CR6A 4PYGA 3FFCB 3B2VL 5D2NA 3QIUB 4NGHH 5T3XE 3QFJB 2HRPL 1UFUA 4K7PH 1UZ8A 3RTQD 1NMBL 2X4NA 3QUZC 3OXRB 1RUQH 2BSRA 5J89A 1SVCP 1CK0H 3ZTNL 2CSPA 3ULVE 1DQDH 1S8DA 3DPBA 1T2QL 1FVDB 1FNLA 2FEEL 3MA7A 4OAWB 3S37X 4TUOB 1K8IA 4BH7A 3VGBA 3JUZA 4HIHB 3JWDL 3GRWL 1RHHB 2Q8AL 2ICEA 1YEFH 3NCYS 4ZUTB 3IXAB 3GSQA 1OWRM 3QRGL 4OIAA 2AJUH 4PLKC 4OCNC 1E6OH 1AGFA 2BNQD 4XP9H 4JFOB 4HS3B 3VFGH 4LRNH 4DZ8A 1RV6X 3AS3A 3OKEB 4KH2A 5B3NA 5JOFB 1FNSH 3IJHA 3BSZH 2DI9A 2P47B 4S1DC 1SJHA 4NC2B 4P5KA 1BF8A 4KJPD 2CD0A 2PCPB 4S11A 1TZHA 5DD0H 8FABA 3L3GB 1QFWI 4JM2C 5ELIA 4X9IA 1HSAB 1U41A 1BOGA 3QUZD 3W0WE 3VXQB 3GJFH 1RZKL 1CU4L 4KC3B 1CTNA 4MJIE 4F57L 4NC1E 3SKMB 4CGTA 3A6BL 3W81A 4IMLB 3U0TA 1I1YA 1P4LA 2VDLL 4LSRL 3G04B 5DD1H 1CDYA 3C8DA 3DETC 3QEHB 4DZBA 3UTTE 1BQHB 1CE6A 1LK3L 3IKCB 4BFGA 3VFVB 4WFFD 1FNGA 1R3JB 1ZS8A 4BSJA 3KR3L 4X4MA 3RX8A 1VFOA 1MCOH 5I15H 1HH6A 3V4VH 4HS3A 4FQQA 3U7YL 4E41A 5CGYC 3ROLA 3VWKA 1F4WH 5LGHH 3JWOH 1D9KB 3QH3A 5E1AB 1KEMH 3MOBL 2KPNA 2EDEA 3RVTD 1AP2A 3GMOB 2M8XA 2XWJB 3FT4B 4MSWB 3IJSA 5BZDA 3ARDC 4P2QB 3D0LB 3FZUD 3IDNB 3L95B 1DUYA 4IMKA 3HZKB 1EJ6A 3K0WA 2ATKB 3GSWA 3BH8B 1NGPL 4O00A 4O9HH 1X7QB 4TVPE 5SWSE 3W9EB 5DMKA 3HC3L 4ODXB 3RTQA 3RJQB 5C2UB 1G7QB 4U6XB 4PR5B 43C9B 2NLJB 4L8BA 4KTEH 1DEEA 4ZFOB 4M1CC 4HAGA 2Z31C 4E41E 2NW3B 4RWHA 4YBLB 2FATL 1AP2B 3CK0L 1E4WL 5F7HA 3R06A 4YIQA 1A7OL 2VSCA 3U0PA 3TN0A 1P7KA 3RY5A 2VZVA 3HI1B 4XRCA 2GJ6B 3DUHA 4F8QA 5DRXB 1NKRA 3MYJA 4Y5YC 1JZ5A 1X7QA 1HHIA 2QSVA 4RX4D 4NKIH 1OW0A 3N1GC 5SWSA 1L7IH 1T03L 4AQ1B 5L6YH 4EN3C 4ZOBA 4R97C 3BIKA 1Q9KA 1PVHA 3HB3D 1GHFL 4HWNA 3V6FB 1IGJA 2YN3A 1K4CB 4X7SL 4LCWD 1FSKB 2R1XB 3V2AR 4PS4H 5IMOB 1I7ZA 4AENA 1HH9A 2XTJD 4M43L 5C7XH 4HPYH 3RWCB 3QUYA 5KBNC 4AIXA 3G6JF 1UXWA 4I2XE 4HF5H 3AMKA 1XAUA 2YPLA 2NTFB 5DJ8A 1CF8L 4Q2ZB 3RI5F 4KQ4L 5BS0B 4OZFA 2OS7A 4Z7WB 3ARBB 4YNYA 4Z7QE 3GMPB 3TA3B 4LU5L 1I7TB 4I5BA 3FQRA 1XR8B 3MGOA 1MHCA 2M2DA 4NN7B 3MXVL 2QLVB 1INEH 1NL0L 1T5WB 3HS0B 3QG7L 3KLAA 3JV0A 4FTVB 1AY1H 2ZUQC 1X3DA 4OZGB 1AXTL 1PEZA 3LRGA 5TDNB 2XZQH 5GS2H 3FO9A 1CK0L 1G9NL 2Z35B 1MHHA 1KBGH 5F71A 2MKLC 3ME0A 1G6VK 1PQZA 1J18A 3V4PH 4LDLB 3BEWB 25C8H 2VXVH 3I6GA 4U1GC 4U1LB 1LO5B 1U8HA 2HVKB 3NPZB 1RI8A 1OQXA 1FE8H 3O9WB 2QQNH 1BZ9A 2XPGA 1NEZG 1QFUL 2H8PA 3IDYB 3DXAE 3VXRA 2R0KL 3E8UH 4ONHB 2AJUL 4Z7WA 2B2XH 5AAMA 3WKMH 4D8PA 4ZOEA 5DGRA 4A6YA 2ICES 1I8KA 2ERJB 1MY7A 4PJHF 4HIIA 3KPOA 1L9MA 3BRGC 2WWKO 5C0BB 5I1JL 4L4VA 3U6RA 4H0IA 4YH6A 1MRCL 4PY7A 1NANH 3O6ML 3H3BC 3T0EE 4DWHA 3LZFH 5BQ7A 3KJ6L 5FYLE 4P2CG 2YUZA 3MBED 3QBTB 1AIFB 1AE6L 3NA9H 4YDKH 3WNMA 1AGEA 1ZLVH 4AIZA 3S3PA 4PY8I 3TO2B 3QZWB 4EEEA 4OLZL 4KJQC 2EDRA 1XGYL 1BQLL 1TVHB 2CLZA 3LV3B 3EYUH 3WBDA 3BO8B 3BYTA 5IBLC 1MCOL 5I15L 4FQJL 5EPMA 4NM8H 1E28B 1DQQB 1EBPA 4MNQE 4PRHB 3TT3H 3IAGC 1U93A 2D3VA 3RDTA 2BHZA 1T7YA 2UZIH 2NXZB 4JFHE 1WICA 5CJXC 1MCHA 3TVMD 4TUKH 2FL5A 5F7UA 4DKEL 4OD2A 1WAAA 2A2QT 1LQSR 4OLXH 4OJFL 2VLKB 3FQNB 2ZP0T 4L3EE 2GIYA 1CFTB 2FGWH 5IB5B 4LLVA 4U1NA 3I6LD 2J7LA 1IKNA 2ILLA 1B90A 3OKEA 3FONA 1CDCA 2HTLD 1BBJB 1BVLB 2QADB 2XIDA 2PYEE 2DBJA 4PRNA 5FHAL 3VXSB 4KAQH 1Q8MA 4OLEA 2R56H 2XTLA 1T0PB 4G8GB 1XGUB 3CFEA 4G3YH 4WENB 4KVCH 2QL1A 1IFHH 4P23B 4PGDA 3FO1B 3IU4H 4Y19E 4LHUG 4O51B 3MJ7B 4MNQA 4R4BB 1BFOA 1YY8B 3UTZA 4JVUA 1K6QH 5I71B 4RAVB 4UT7H 4NP4L 3HI5L 5L2JB 1WFNA 1OTUC 3PXJA 5IQ9A 2HH0H 2BVQB 5HGHA 1EA9C 4G7YL 3FQXA 1G84A 1IGFH 2BMKA 3ARWA 3G9VA 1KNOA 2O61A 1OARL 1U8LB 3CFDA 4GG6A 4HXAL 4WGVB 3C5ZC 3PIQA 3P9MB 3GSOA 1E4KA 2IWGA 5GGTL 2GHWB 2KZWA 5HGGS 4CVUA 5DJAB 5JIHA 4IRJA 4P2QA 4YBQD 5I1IL 5DUMH 2GQHA 3SY0A 3CLFL 1T7ZA 1J0ZA 4HK0B 4MNGA 4PJ8B 3DSNA 1GGIH 4P2RA 4Y19A 5MP6H 2N7AA 5D2NC 5C2BH 3QG6B 5IHUH 5C0CA 4K3EL 2PTTA 1S7RA 2FX8H 1MCWM 4MB3A 2DJUA 2IC2A 1H8NA 1LWRA 5DQJB 3B9EA 4ZO9A 4RZCA 2I9TB 4NQDB 1FO0A 4O02L 1QG3A 3RIAF 2F19L 1SY6H 1UWEH 3RWIB 2JIXA 5ETUB 1Z2KA 1SM3L 1CFQB 1REIA 3ZTNH 5FB8A 1WGOA 4S1SH 3C08L 1EZVX 4S1RH 4QF1B 1KJVB 4NT6A 5GGUA 5FA4B 2HTKC 1I1AA 4FABH 2QQLH 3X11B 3QUMA 4BZ1L 3AREA 1JWMB 1GRWA 4S2SB 1J1XL 2ZG2A 3K8MA 4K3HA 4RNRB 2IALA 4K94H 3NZ8B 3ZDYE 3LDBC 4HC1H 4RZCB 2CLRA 4RFEA 1NAML 3RGVC 5KJRL 3N85L 3ZT6A 3A0OA 1AQDA 3QIBA 4QT5B 3PJSA 3RBSA 5CGTA 1P9MC 2YA1A 1U3JA 4XH2A 1PG7W 2Y07H 4ODHH 5FV1L 1MLBB 2EE3A 1DBMH 4HZLB 4XP5H 4X6DF 1RURH 1A02N 1U8IB 4APQD 1JV5B 4I0PC 2NTSP 1N3NB 2QTEA 4LSDA 5KVGH 1FAIL 1IAKB 3S37L 5GPRA 4X7TA 3SCMC 4P9HL 2OK0H 4YXHL 3SEPA 3T0EC 4X80H 3VXTA 1FV1B 3L7EB 4CJ1A 4XPAH 5ESQB 1VA9A 3SDDA 4JRXA 3VDAA 1OPGH 1TCRA 4IOIA 5F88A 2G5BA 5FF6A 4P23A 3PP3H 1LO2L 1BVKB 4P3CL 5DLML 4RSVA 1LEKA 4JG1L 3OQ3B 4YHOL 2CDEA 2ITDA 2NY4D 2VLME 4LLDA 4OZIA 3RJDA 4LVNC 2BNUA 2ZPKH 2KDGA 3SDDD 4RCAA 3MR9B 4FQ1L 5JDSA 3G6AA 2HP4A 1ITCA 2CGRL 5D6CA 4GRLC 1G1CA 3VD5A 5DJXB 5KANG 4MCZA 1TJGH 1GGCL 3ETBF 4R97B 1A7RH 2HFEA 4XP1L 3WFBH 5DHYA 4XVSL 1BQHA 3KS0H 1XF3A 1TZIB 3PABA 5CBEA 3C2SA 4JRXB 1OTTC 2HN7B 2AJXL 3TZVB 3MJ8A 3C8KA 1HH6B 1RJYB 3WLBB 3BQUB 3HN3A 3ZHDA 2ORBH 4KZDL 4KVNL 3SOBL 5DUPL 1YMMA 5IEHA 5AYUL 2ITDB 3QDJD 4LLDB 4OZIB 4GMTL 4DZBB 3AM8A 3ZE1E 2BJMH 2YUWA 4FXLA 4CW1A 4WEMB 3IXTB 5E08H 4L3CA 2VIRB 5IFHH 2HJLB 4XCYB 1ACYH 2PW1B 2YD1A 3QWRD 3ARGD 4M48H 4KDWA 4Z0XA 4ZPTA 2NY0B 1A9EA 4B53A 3FOMB 4AEIH 4JFXB 2H45A 5IROC 3G5XA 3NH7H 3O2DL 3TT1H 2E8ZA 2WUCH 2X89A 1LO3H 4QOKE 1W0VB 2BNRD 1G7QA 3IFLH 3OAYK 4U6XA 4KJWD 3T2OA 4JPWH 5L2KA 3TFKD 1NANI 4ONFH 3RPIB 3UTTA 1B0GB 3KXFD 4JZJC 1FC1A 4OFIA 1EK3A 1JWMA 1YMME 4JM4H 4WHTB 5DMIH 5GGSY 1XCQB 3MSPA 4OCWL 3T0BA 4YFEA 1DBBH 2XWTA 4YGVA 4BQ6A 4C58B 2NY1C 1KIQA 2VXUL 1ZMYA 3SDAC 4NNXA 3VXMD 3WN5C 4HG4K 1OF2B 2J8HA 2LE9A 4JREB 5EU6E 4PTUA 3P9LA 4OTXL 1KFAL 5C0CD 1FFOB 3ZT7A 4Z6AT 1U8JB 4XNQB 4LVHC 4P2OB 3K46A 1WF5A 1NFDA 3U48A 1JUFA 3O3EA 1DVFB 1KYOK 4U6YA 2GJ6A 4NQCB 5L2KE 1IGCH 2FGZA 3O81A 4E9LA 2NY5L 4PV8A 5ITFA 5DDHA 4GJTB 1IAKA 3CSGA 4JJ5B 5JXEC 1YEJH 3ARXA 2NY6D 1IGTA 4QTIL 5HHXH 1EEZA 1QFUH 2AK4D 4TPRH 3IF1A 5C07D 3TJEH 5HYFA 1H8OA 2OJZH 4PUBL 4YHNA 5FCSH 1DQLH 3ZKMC 2IBZX 3QZWG 5GRZA 1NDGA 3BE1L 4M6ML 3UXFA 3ZDXE 4JFYB 2R8SL 3GJFB 2DTML 3CFIC 2MHAB 1FPTL 4EXKA 3AXLB 1BEYH 1AO7E 1Q9WB 1TPXB 4PJ9D 4CKVX 3KXFE 1TZGL 4GKZA 4OFDA 5JQ6L 3HC0B 2FJHA 2EIDA 4QXGH 4M7LH 4M1DH 4NZTL 3RZCA 1HOCA 1XGPA 4OT1L 3UTQA 2YR3A 4HKZB 4YHYB 3L7FB 4Q6IC 2R1YB 3SJVD 5DD3H 2VXSL 1JE6A 4R8WL 5EA0H 1MQ8A 2CDGB 1HHKA 3HG1E 1IM9D 2XWBA 2HTKD 1A21A 3ARDA 1DE4A 4WDIB 5KSAA 3QEGH 3KPTA 1RUKH 3NN8B 1A0QL 3RY4A 1CFNA 5DT1L 3GHEH 4ZS6C 1KGCE 5FA3A 5KN5A 1U3YA 5KSBE 2ZJSH 3U79A 3BJLA 35C8H 4M00A 4U31A 3AM8C 1IEBA 1YEEL 1ITBB 1II4E 4AG4H 1AO7A 5BS0D 2COQA 4PREB 4KKBD 2GUOB 4JO4H 4AM0B 1YN6B 5E7BA 1B3JA 4X98A 5FYKL 3CMGA 4L5FL 3TN0C 3VG9C 1QSEE 3IDYC 1SBSL 5F6HI 4MJ5B 5ANMB 1HIML 3QPXH 1IM3B 2DQFB 3NZHL 5IK3B 4ZFOA 2CGRH 1SBBA 4QRPB 5B38B 3PGFL 5FGSA 1PY4A 2E7MA 5F7EH 2YWYA 2PR4L 1DUZB 2AXGB 1YUHA 3H42H 2W65B 3M17A 1VPOL 2WV3A 4FQLL 5I1AB 1R6VA 5IF0B 2NNAA 3I02B 1OM3L 1MFAL 2J12B 3EOYG 4P57B 4X6DA 2UV3A 5IEKA 1HHJA 1UH4A 3MGTA 3ISWA 5MHSD 2E7CA 4LL9A 1CDUA 3CJJA 4QHKJ 3IGAB 2Y25A 1NGZB 4MVBD 3TJHC 2XNAA 2BOCA 1FVCA 2VAAA 5I0DA 1OSPH 5D1XA 5J9PB 3VFGL 2G9HB 3HMWH 4YHYC 3BZ4A 1A1MA 3FQNA 4EKXA 3D39E 3RA7H 4LLVB 5A2JH 1PZ5A 1BVZA 3FB8B 4AEHH 4PJAB 1V7ML 5JW5B 1SJEA 1FZMA 1MREL 4PJXE 3RIFF 1HYSD 4P5TA 2CKBB 5CP3H 3FB7A 1DANT 4UILH 4K3EH 2HRPH 4ODUA 1QFWH 4XT1C 2HLFD 2OL3L 4OM1H 3O4LB 4LLYA 4JKWA 3MUZ1 1BBDL 1Z5LA 1KF9B 1M1SA 3DROB 3INUH 1KJMA 3VWKD 1DBKL 3RUGF 3VMOA 2HKHH 5I6XC 4YBQC 4OCWH 1S5IH 2B1HL 5DHVA 5IB3A 4MA7H 3HMXL 1BM3H 5LWYH 3QDGD 4PJHA 3BUTA 5F3HB 3T0EB 5BVJA 3QUXD 2VDOL 4NUGL 1U3ZA 1AGCA 4HXBL 5E6ZA 3D39A 3TCLB 1G1YA 2Q3AA 5I66B 4DOHE 1XIWD 5E7FA 5TF1L 5IB2A 1NEUA 1NUFA 4XAKD 4I0PB 3MC0A 2VXTH 2C3HA 2X6MA 3BPOC 3DRQB 2X4PB 2PW2A 2BVTA 1NGQH 4U1KB 1IARB 3T1WA 2X10A 3SE8L 3P11H 1Z9SA 2YD8A 3QUML 1QFHA 4HBQA 3ZE0E 4JM2F 3OJDB 1P5UA 2BHYA 3HCVB 2AK4E 5HHMB 5C07E 3R8BB 4RX4A 4DTGL 4ZFFB 5D7LB 4GRLB 4Z5RB 4MGXA 5GS1A 4YQXL 1VEMA 4MVBC 3TJHD 1JVKA 5DTFA 3QDJE 2VQUA 5A1AA 4JFDB 4D9RD 3BDYL 2J8UA 5C0NC 5FYJD 4OFYD 1ZTXL 4FN0A 4GRWB 3DX7A 3H9SD 1FNEB 4D0BB 1DBML 5E1AA 1MSPA 2EKJA 4ZQKA 2NY0C 1QSFB 2FWOB 3WHXB 3LEYH 3OJ2C 1WIUA 3L5XH 2PO6B 5C0FB 2NX5B 5ACMA 4PJ5B 3IJSB 3PNWA 1MQKL 5HVFB 1Z0NA 4GG6E 3WJLA 4LASL 3VD7A 3D3VE 1FFQA 4WFFE 3WS3B 1RIVH 1CD0A 3BGMB 2DLGA 2VLMD 1MCNA 1R5WA 1F6AA 2ESVA 3EAKA 3KXFB 4WW2A 5GXBB 3QFJD 4MNGE 3MCKA 5CIPB 4PB0L 1CGSH 5E03A 1V3KA 1FBIL 5T1LB 1CBVL 1CXEA 1K5NA 5TE4H 1T1WB 3V52L 4QOKD 1F3RB 1HWGB 3J8F7 1K2DA 4IHOB 5DEGB 4J3OC 2P5WD 1HHJB 2A83A 5CP3A 1W0WB 2CO7B 2VLKA 3D0VB 1EFXD 1BAFL 3GHBL 4S2SA 5IV2B 3IDIB 1TQBC 5TH2B 4ZPVA 5T33L 1A7RL 4XBEH 1P1ZA 5J9PA 3KYOA 1UM4L 3Q1SL 4JFYA 5CZXC 4F3FB 1A1MB 2IQ9L 3THMH 4AIZB 4TOYL 5ENWB 2AJXH 3F7QA 3NA4A 2XZCH 1AXSA 2V17L 1VGKB 5T1MB 4P4RA 5J13B 4MJ4A 1OAUH 2OX5A 4WHCA 5D1XC 5JXED 1U42A 4RMRA 5JOPD 2JELL 3F58L 1DQQA 2BRRH 2GYSA 2X42A 1I8IB 4CVXB 3HNSH 4QRRB 5GRJH 1BX2B 3UDWC 2YD4A 1HINL 4G6JL 3G5ZB 4PPTA 1EHLH 2J4WL 1P4LB 4D0CA 1D5IH 3MOQA 3LN5A 3MLUH 5AWNL 4N0RA 3MRBA 4QRUB 4C54A 4YXLL 1BZ7B 3SDDB 4XP4H 4Z77B 4AEIL 2R0ZL 4W4OA 1NMAH 3P77B 5FKPB 1T89C 1RZJL 4FQXA 5ERWB 4UT9H 5A2LH 1H3PL 1RZGA 3JV5A 3QFJA 3ARPA 3K8KA 4L8DA 5CLWA 2NY1D 1AD9B 4JFFD 4FXKA 3RA7L 4HDIB 1MHCB 4XTRC 5TPWL 4LHUB 1S9VB 1MCBA 3P73A 6FABH 3VWJB 2FX9L 3EYFB 2XZAH 4XXDA 1BP3B 1LEIA 3H0TB 3KPNB 4BQBA 1I8IA 4U1IB 4LHQB 4CMMA 4GRMA 1FGNH 4BSVA 5EOQL 4ZS7L 5AZ2H 5GS0L 1BFVL 4X4ZA 3O6KL 4GUPA 1KIRB 5FUOH 4JRXE 3I6GB 3MRLB 1B0WA 3LKPB 4JPIA 4ZFOL 3RVTC 2EDHA 4OBRA 3E6HA 3LQAH 3C5SB 1KIPA 3HMXH 2PW1A 4PY8J 2V7HA 3HZVB 1FNHA 4P3DB 4DUVA 4FZEH 5CGYD 2X7LB 3UBXB 3IFNL 4HT1H 3X3GL 4FG6C 5IQ7L 1VHPA 4Z95H 4Z7VE 2FD6H 2JJTA 2WBJC 1WSST 5ICXB 3LSOA 4KJWC 3MV7E 5H94B 1ZVHA 1ZT4B 4IRZL 2CLRB 3UYRL 3B3IB 1I1YB 4DKFL 4H8WC 1SJVA 4JPVL 3CU7A 4ISVB 3SE8H 4MQTB 1JWUA 3O2WH 1YC8A