4OKVA

Crystal structure of anopheline anti-platelet protein with fab antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGLIDPSDSETHYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARGGTYWGQGTTLTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heavy chain of 8H7 mAb
publication title The crystal structure of anopheles anti-platelet protein, a powerful anti-coagulant, in complex with an antibody
rcsb
source organism Anopheles stephensi
molecule tags Blood clotting
total genus 45
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA02
3QEQD 1A22B 2AV1B 3OPZL 5TE4L 2XZCH 3TO4B 1ND0A 4ONOA 1U8JB 3O3BA 1UXWB 5EO1A 3CDYA 5IEHB 3C6SB 2ICWB 5IR1B 1XGRA 4CADA 5JW4M 5C0RH 4BJLA 1OAKH 2AJYH 1D5XA 3L3KA 2XKNA 4U2ZA 4GG6A 1RZGB 2OP4H 2NY4C 1BFOA 3OXSB 5HHOE 4QHKJ 5C0AB 1FNEB 5ESQB 5DHYB 5CIPB 5IMMA 5I76A 5T3XH 2HJLB 1IE5A 2N7AA 2IPUG 1YEGH 4HFUH 4S2SB 3CFIC 4PJFF 3Q5OA 4PJ8D 2P8LB 4PJEB 3S34H 3O9WA 4U1SA 2YA1A 4JFYA 2NY0B 3DMMB 3LHPH 3QDGA 1EV2E 4K71B 4WJ5B 3BIAX 4Y19B 4LCIL 3H3KA 3L9RA 4K71C 1Z9LA 4Z78B 4KPHL 4X7CC 2P5EA 2EYSA 2QL1A 3HN3A 1HI6A 4PJBB 2AJUL 3CSPA 4H1LA 2I07A 5DD5L 1BBJA 1II4E 1RPQA 2P48B 2YD9A 3I6KB 2WAHA 1G7MA 3UTTB 2AVGA 5HHXH 4AL8L 3BW9A 3S5LG 3VRJB 3AROA 3QPXH 1IQDA 3ARTA 5EOTB 5SWQB 1SVCP 4Z76A 1FBIH 1WQVT 1N7ML 1DP0A 1CGXA 1CL7H 3PQYE 4ZAKB 2Y5EA 4OLWL 4W4OA 4DN3L 3H9HA 4YAQA 4OLVL 4X6FA 1JF5A 5DZOA 2AABL 3T0WA 1PZUB 1T3FB 3ILPA 3MACH 4L8DB 3IDJB 3OG4B 2WUBL 2KQMA 1OLLA 2I9TB 5I6XC 5ICXA 1OW0A 3MCKA 5DJCB 3BP6A 4N0UB 4FQIL 4X7SH 4PTTA 1V3JA 3EDFA 2ATKA 1WZKA 2LFGA 5D72L 4LP4A 3BWUC 3P0VL 1NC4D 4M1DL 5ABDE 3L3DA 4OQTL 1PSKL 1S8DA 1KN2H 1EGJA 4ZQKB 2GCYA 2G60L 3QA3A 4ZD3H 3KVQA 2H26B 1NGZA 1J1PH 2DMKA 1WCBA 1V5JA 3IB4A 4QRRD 4MD4A 5HHQB 4ZXBB 3FOMB 4MCYA 5C0ND 4LPUA 1QSFE 5AUMB 5DK0B 5INDA 4ZXBC 2YSSA 2IG2H 4X83A 5DR5L 3CAFA 4JDZA 3QIUA 1M71B 1T0MA 1ZHLA 3MV7E 3D1MC 4R7DA 1IT9H 1KXVC 4JFDE 4I4WB 1T03H 1A6WL 4NQDB 4AY0A 4G8GE 4HS6B 3DHJA 4ZG1A 1GH7A 2Z31B 1A2YA 2NR6D 1NKRA 3PWJA 3WFCL 1IM3A 1AKJA 1DBJL 5DEGA 1J12A 1X9QA 5E00B 2FIKA 3MLSH 4LVOB 4IDJH 3ARDB 2J6EA 3GB7B 4RIRA 5EO0B 1R3LA 2AERT 1U8KA 1OP5K 3S97C 5F3HB 4GUPA 4WU5A 2IPTL 1VPOL 4M7LT 3B8SA 1PKQE 3VD7A 2Y36H 1DVFA 5DURD 3W5MA 5J1TC 3VFMB 4FTVD 2D9QB 2Y5TB 1A9BA 4JRYE 1JPST 2F8OA 4FZ8H 3EHBC 4KKBD 1CU4L 1H15B 2YC1B 2I25N 4OSUH 3KPNA 4U6VH 4WRLA 1VACB 3DBXB 5GZOD 3BAEH 4P5TC 5E6IB 5KANG 1HCVA 5GS1A 5JUEH 3ZDZF 4XT1C 2H8PB 1R5VB 4I5BB 1FVEB 4LSPH 3CSYA 4ODWA 1DTUA 1QYGH 4Q74A 4CN4A 3VWJD 2R56L 3F7RA 1CFNB 3PL6C 4M6MH 4U7KA 1N2RB 4XTRC 4X4YA 3OGCB 4NN6C 5J9PB 3OKEA 3S37X 1IEBB 1LO0H 4RSVA 1KJMB 1KLGB 1BVLB 2APFA 2R69L 4J1UA 3LY6A 3VXTB 1XGUB 4I8DA 1G7PB 5LQBH 5GSVA 2HWZL 3MQIA 3QB7C 5FKPB 1YY9C 3I6GB 4UNVA 4UNTA 3B3IB 4ZFFB 5H37G 1I85A 5F7FA 3JZ7A 4MXQC 2DJ4A 1GPOL 2K3TA 1R6VA 4DGYL 2OTUB 4FFZL 1MQKH 1H5BC 4EDXB 3IF1A 4X6DB 4KGJA 3TBTB 2Q8BL 4XPAL 4JFZL 4ODHL 4GMTL 4EBQL 1VKXB 3EOTH 5TE6H 5J12B 2EE2A 5T5NG 5J12C 4QRPD 1NMBH 3DECA 4ELME 1NMAL 4Q6IA 2YPKB 3W39A 5SX4I 2IPKA 1QD0A 1A6PA 5DMGD 5GGRY 2IQ9L 4HPYL 2V5YA 3VFVA 1QEWB 3FT2A 1E0OB 3C5SB 5L2KE 4X9IA 5AG8A 3HCVB 4L9LB 1Q0XH 1NLDL 2IANB 1KXQE 5DRNA 3WYRA 2HRLA 4HHAA 2YPLE 5DYOB 2XWBA 1UEYA 2FJGA 2WM0A 2VYRE 3R06A 4ALAH 2C4FT 1ZA6B 4OLZL 4DZ8B 5HGDA 3PWLA 4A6YL 4L3CA 5KS9E 2CDFB 4NM4L 4X99B 3VXOB 4R2GD 4U6HB 1S7WB 2EDWA 3BHBA 2IH3B 3C8DA 3EOYG 3HE7C 3EYUH 4M5YL 1EERB 3TO2A 15C8H 5IGXL 4WDIA 4HMDA 3VI3E 5A1AA 5IQ7L 1MAML 1RUAL 3BOVA 4X4XA 1VFUA 2UY6A 3O2DH 4JAMB 4ZFOL 3FQXA 2DBJA 4IHOA 3NAAH 4KJYB 3W9DA 1ZA3B 4GLRI 1DL7L 4HGWB 5FYKE 2NY5C 4PRPA 3HTLX 3P30L 4GW1B 1FFPA 2BVPA 1OP3H 4NO0B 3P73A 4L29A 5ENWA 1QBML 2BVOB 3B2VL 4X5LA 3UJIH 1Z3GH 5D6DA 2GK0B 5C0GB 5I1IH 1W72A 4XX1E 2BCKB 3P4NB 2F54A 1F8TL 1FZOB 1U8IA 1PY9A 3OZ9L 1AO7D 1NSNL 1YEHH 2W38A 3LV3A 1F00I 1MHCA 4RBPK 2FSEA 4MAYD 5TDOB 1LMKA 1DFBH 4KJWC 5IB5B 4U0RC 1Q9OB 4KTDH 2AK4E 1HHIA 5FXCH 1UCBL 4YWGH 1NCUA 4NQEE 1BWWA 1R3KA 1ORQA 1NCDL 2EYRB 4CVXB 2P46B 1NFIA 2QEJA 2VDPH 1QOKA 1NAMH 5IHZA 3HI5L 4XB7A 4C58B 3RVUD 3VFOA 4MJID 4DGIH 3LKQA 5BV7H 1CD0A 3OJ2C 1MVUA 3T2PA 3NZ8B 3LKNA 3ARGA 4NHCH 5F3BA 3FFCA 5HGAA 3EJYC 3HUJF 3W0WE 2YD3A 4WI2A 2GSIB 2UYLB 4MD0A 2Y6SC 1NANH 3QHZH 5D8JH 2DOCA 2QQKH 4XMKL 3PUCA 4MA8H 4Y4HB 4YHIA 3O6FD 3H42L 2MKWA 3TH2T 3GBML 3DSNA 2YD7A 1U58A 1AD9B 3NFNB 4JDTL 4YPGB 2IADA 2JCCA 3DV6B 1F11B 2EDJA 1HH6B 4V1DD 1IGJA 3MRNA 5DEFA 4X6CF 5J3HD 1J1XL 1WBYB 2EDLA 1YYML 3P0YH 3UX9B 2IQAB 1A9EB 1WWWX 1QVOB 1YEKL 2DTML 2X89A 4NKDB 4PTUA 2EEDA 2PYFB 2CMRH 3QXUA 4FS0A 1FYHB 1RUKH 4LAJH 1MUJA 3S36H 3THMH 3DJ9A 4NN7B 4HSQA 3EAKA 2NZ9D 4XHJC 5B3NA 1P7KB 4NN7C 4TVPD 5T5FL 2QQQA 2R9HC 4GAJL 1KXTB 5T33L 3MBXH 1FYTD 1FL6A 2CUIA 4ORGA 4PJIA 3GK8L 5INCA 1R3HA 3JUYA 3HMXH 3MLYL 4HJGB 1OM3H 4PRHE 2X4UA 5E2VL 3D85A 5DJ8B 3OXRB 4FFWD 2UWEB 3WIHA 4J3SA 5DDHA 5BRZA 2J2ZA 4GBXD 3V4PL 5L88L 3QCTH 3RHWF 1IVLA 1OCWH 3OKNB 2D7NA 4OFIA 1IEAB 4OLUL 1KF9B 3TIDA 1RULL 5I75B 4R3SA 5GGSB 4HG4K 3V7MA 1AGFB 1FG2A 3MRBB 3QR2A 1RIHL 1PW3A 5DQ9A 5HJ3B 4JJ5B 3HZKA 2VLRB 5IUSA 4WUUE 3RAJH 1RZKH 1IGTA 4K8RD 4FQ1L 4NDMB 2VZTA 3HHRB 4ZS6C 3FMGL 1VDGA 1MIML 1DUZB 3SGDH 5ICYB 1O0VA 4NNYB 4NZDA 1JTTA 3F6IA 4NZJA 3S8WA 3RNKA 4IM8A 5CLWA 4K07A 2Q6WB 4AEHH 1I7UB 3BYYA 4W68A 3V5KB 3WNMA 3QCUH 3VDCA 5JXAL 1A1OB 1RJLA 3CVHH 5DD6B 1KPUA 3DXAA 3RL1B 1DQLL 2VDQH 3KJ4C 3ISWA 3OKDA 3QDGD 1R5WB 2KZWA 3Q1SH 3V4VH 1RJCA 5D9SB 1YMHA 3HRZB 3QNYB 3VJ6B 1PDKA 2OQJA 3BD4A 2MQCA 2RBLA 4Y1AA 1KENL 3N1QC 3TYGL 1H0DB 3WS6A 3QFDB 4PGCB 3I75B 5BV7C 5J06A 1A7QH 1F3DH 4JPVL 1TVBB 3LH2H 5C0FB 2E27L 3RI5F 1EVTC 5DUPH 2X9WA 4F9PA 4OCXH 2BVQA 2QQLH 1NDMB 1I1CA 1F4AA 3VXUA 3B2UC 5FM4A 3U4BL 2JB5H 4S1SL 3VXSD 3HNTL 4POZC 3KYMB 1D9KB 3ILQD 3Q3GB 4QTIL 2DYPB 1B0GB 5C8JB 4L8CA 1FNGB 2X7LB 3LDBB 4JM2B 3MUGA 3B9AA 3QBTB 5SWSE 1W0WA 2P24B 2ED8A 5I30L 1E4XH 2DLFL 3BMVA 3LDBC 2QSCH 2R0LL 4D2NA 4MHHI 3MA9L 4M61B 4OFVA 4PRIE 5I1KH 2B1HL 3SJVE 5LWYL 5AWNL 3VH8G 2WUCL 2X4TA 3MA7A 2LE9A 2I27N 4Y16D 2ZZUT 4D0BA 1SM3H 1QRNA 1XH3B 4YHNB 3DOSA 1BQHA 1T66C 5DFVC 4DQOL 2OJZL 4HCRH 1X5IA 4TOYH 4EI5D 1ZV5A 5HHOA 1VFAA 1QPPA 2VDLH 3QEQB 4AIZB 4PB9H 4TUOB 4YXKL 5GIRA 5JLZB 1N3NB 3PWVB 1Q94A 3H7BB 1S3KL 3L3JB 4ZNEE 3A6BL 1FVCA 1FNSH 3MRCB 1AFVH 3MLXH 1ADQH 1BOGB 4F7CA 2IFFH 1F6FB 1AKJD 1Z9MA 1N64H 1HIMH 1OD9A 4RWYH 3G08B 5CILH 3WLBB 2EIEA 3TNNB 4HUXA 4XP1L 2ICEB 3MLTA 3S88H 1N0XH 4O51A 1INQA 4M4PA 4ZTOH 1JHKH 4XPGL 1RZKC 2HFEA 3FTGB 4PJHF 2V2XB 1HHGB 1YMMD 4J4PC 1MFBH 4PJCB 5HTSA 3IAQA 4U6XB 1DVFD 2FJFA 5JHLL 1HEZB 3MRLB 4JHZA 4LCYA 4PJ8B 2HKFL 5D7SL 2FO1A 1RU9H 1NUDA 3FO0L 1KJ3H 2EEBA 3Q6FB 3V52L 1BECA 2DM4A 1TCRB 4Y4KB 4WI9A 3PQYA 5DRWB 2W9EH 1CFQB 1RVFL 5L2JA 4RAUB 4MD5A 1ZE3C 1CXIA 2OZ4A 2W1NA 3BH9B 4ZDHA 3QEGL 2I5YL 5DI8B 2DWEA 2OLDA 3X3GL 1BIHA 3NTCL 3G6JF 4F9LC 1MFAH 4MNQA 3C5JB 3RX5A 3VDAA 4H0HB 4MSWA 3QUXD 5KVGL 4KZEL 2EE6A 1HWGB 1Q9LB 3RPIA 4XNZB 5I19H 1IAOA 4HKJB 2Z8VC 1HOCB 5L6YL 4XNZC 1OOAA 4ODUA 4R0LB 2EE3A 4ZFOB 3RUGE 1U93A 3ZSTA 4AH2A 1UVQA 1QSFA 2VISA 1KTLB 4D3CH 3E6FB 1MCPH 4DWHA 2XA8H 4UQ2A 3MV7A 3RBGA 2ORBH 2W0PA 5IVXF 4JFDA 4P9ML 2SEBA 5ILTH 1F13A 2Q8AL 1NC4B 4G8GA 2IH1A 4UDTA 3VFSA 4NT6A 1RUPL 3L3HB 1QFOA 2G75A 2EDBA 4O5LL 3BDYL 4QRRB 2CIKA 1ZHBB 2HTLC 4OCLC 2HFGL 5AYQA 1BLNA 1RHHB 4D94A 1JCKA 4L9DA 3BPLB 5TQ2L 5EWIL 3MRMB 3D3VD 2XTJB 5FK9A 4ZUSA 4OCWL 4WEBL 3B5HA 3MGOA 2AJSL 4YUEH 5HVGB 1PKQA 5JW4N 2V2TB 5FGRA 1YY8A 4UILH 5GJTH 5IMLA 3T04D 3SKMB 3S3PA 4XBGB 4N1HB 1Y6NR 4FRWA 3UC0H 1EHNA 4PRDB 2HH0L 4D9RE 1MH5A 4M6AA 3P9LA 3DVIA 2FR4B 3O41A 5I1EH 1IBGL 2MFNA 5LBSH 2HTKD 3F62A 4NPYB 4PRPD 3MRPB 4N8VB 5HDQL 2B7DT 5GS2H 4P2OA 1CR9H 5H94A 1F4WL 4L4VD 4G43B 5DURB 2NY1D 4FTVB 4WEUD 3FRUA 1YN7B 3SDXB 1CYGA 1CXKA 1FH5H 1EGJL 5C0JB 2PUQT 3LEVH 4O02H 4HUVB 3U0PB 5FYJU 4ELKA 4Z7UE 3EZ8A 4ZTPL 5ANMA 3I3BA 4JG1L 4KKBC 3G9AB 5T1KA 2V7HB 1N6UA 3DX7B 3T3PE 1AQDB 3MNZB 4XVSH 1CZ8L 4MB3A 5D1ZC 2OTWB 5GZOC 1B0RB 4XPFH 1EX0A 5FA3A 1EHXA 1IILE 3VWJB 2XFXB 3N9GH 1I4FB 4M62L 1IKFH 2X05A 2E8YA 3ZLQC 3D5OF 1BF2A 4R96B 3VWJC 1LNUB 5B39A 1X6NA 5JZ7D 5CD3B 4E0RB 4JHBA 1PKOA 3NH7L 2XWTA 5D2NE 2EDEA 3MJ8A 1OGAB 3VFRB 2YWZA 4QRUB 5ITBL 1FAKT 1I1RA 2E6QA 4QWWC 4Z7OE 1IC4L 1ZT4A 1MAJA 2BY0A 1YYLL 1FNAA 4R4FL 5L9DH 5BJTA 1VFMA 5IESL 1MI5A 3GM0A 5E4EC 5A2JH 2CSPA 3UTZA 2YR3A 4JO1H 1XF1A 2J6EL 3RWEB 4ZO9A 2D7QA 2X4QB 4OM0L 3B5GA 1RZ8B 1W0VB 4NIKB 5KG9B 3SBWC 5EU6A 1JP5A 1DDHA 1B4JH 4TPRL 5TPWH 5I17B 5IIEA 4RGOH 4D9LL 5FEBA 1NL0H 2BMKA 1L7TH 4OV5B 4OUUA 1S5HA 1YNLL 4LPTA 1JPFB 4U1NB 2F8VA 3AREB 2PW1A 4QRTA 5KS9A 4WFFE 3CXDL 4LSTL 3KYKH 4NZUH 4AM0B 2J8HA 3QG6A 1TITA 2WBWB 1F6AB 1UH3A 3V0WL 4LFHD 3BE1H 1FZKA 3B5TA 5E2JA 5F96H 3DGCR 4P5MA 5DMGC 4LLDB 4LLUB 1EO7A 1K6QH 3PDGA 1OAXH 4YHMH 5MEPB 2H2SD 5T1LA 2GQHA 3G6AB 1RZJH 4JDVB 5EULV 5KJRH 4JPIB 4LDLB 1GGTA 4PGDA 4CVWA 4H8WC 1RD6A 3NACH 1NUNB 4MA3B 1NDGA 1OAUL 3A67L 4OF8A 3OF6D 4OIAA 4OZFA 1UH4A 4R2GB 2BRRL 1ULVA 1A3LL 2VQTA 3QXTA 1HKLH 3D85D 4N0YL 4R8WL 3FONB 4DTGH 2AXGA 4JQXC 2G5RA 4CVUA 1RK0A 1VFBA 1LILA 4MX7A 1ZT1A 4EEEA 4MA7L 5DGQA 2K7QA 2AK4A 2X4OB 1CDJA 2YKLL 4N8CH 3ULVD 1MRCH 4NRXB 5HYSB 4DN4L 3BKYL 4K8RH 3O3UN 1U8OB 5F9JA 4YGVB 3Q6GL 5FDWA 3FQNA 5C0BE 2UY7A 4O2FB 3DVNB 1NGQH 1VENA 1XMWA 2XNAA 1S9VA 5JOFB 4D8PA 3O8XC 2DQCH 4OLYL 5AYUH 1D6EB 3CPLA 3EIFA 2NY2C 4RISH 3OB8A 2EIDA 2I24N 4MAYB 2I60H 3HC3L 1XIWD 2XRAL 3QZWA 2HKHL 3W0WA 4MAYC 4HUUB 3S9DB 2X4NB 4YDVB 2W07A 3BN3B 2O5ZL 4IRSA 3LEXA 1H3UA 1I3UA 3BGFC 1WITA 3Q5YA 1MHHA 4YLQT 5FHAH 2W65B 5FCUH 5HYIA 1FFNA 3VGFA 4MJIB 3GJEA 3DLQR 5D7IB 3TN0D 3ULUL 5FUCE 3RVUC 4KKAD 1IGCH 1BFTA 2C3VB 4HGMA 2PNDA 3HAEA 3SO3B 4GRWF 1LO4L 32C2B 3SO3C 4TRPH 3KPRE 1U36A 1KCVH 1DJSA 1ZK9A 2EC9T 2G9HA 3C6LC 2B2XL 2BVUA 2P8PB 4M9PA 4Y7MA 3SOBL 1DQDH 1KEMH 5I9QB 3O6FB 4XAWL 4YEEA 4BKLA 5I9QC 1XGYH 4WGVB 3UJJL 4RRPA 3O6FC 3WFEH 3S4SB 3IFOB 5ISZE 5GS0D 1W72L 4V1DB 3IJYB 3DSFL 4AEIL 1QR4A 2APVA 3MCLL 4DZBA 2IGFH 3BGMA 3V6OC 3DUSB 1T89A 3X3FL 2PYEE 5DTFA 4ZO6A 1U8LA 3PP4H 3HPJB 5C71A 5IB4B 2I26N 4PV9A 1UACL 5CJXA 2VAAB 2O5XH 4JO3L 3TV3L 4J3UA 2WINA 3ULUF 4MDIB 2FO4B 1DN0A 4QHNB 1NCBL 4XMLL 3INUH 2JB6A 2ZSWB 4I3RL 5DK3A 2VLME 2G2RB 5GISL 4WUUA 1D5BA 1QRND 4DVBB 2BX5A 3OR7A 2DQEH 1WC7A 4OCYH 5HY9B 2DJUA 2J4WL 3JTTB 2XN9E 1ZWIA 4ZMAT 4JFPA 4M43H 4P4RB 5C0AE 4FFWC 3BZ4A 3VXRD 4ISVA 1I1AA 1KYOJ 4GBXC 1TLKA 2EO9A 1ND0B 1E27B 4M03A 2D03H 1GSMA 5F93C 5D70H 1T6WA 4Y4FA 4F7EB 2BNQD 1B6UA 3HPLB 1VCAA 1R5IA 2VDNH 5I71C 3MV8D 5ADOH 4PJEE 1XGRB 4CADB 5IW6A 1EFXD 3L3KB 2AEWA 3CD4A 4KMTL 4GG6B 4QHKI 5EU7C 3QG7H 3PGCB 2NTFA 1FPTH 4N8VG 4Y19E 1BFOB 2VDOH 2VXVL 5C0IB 4K8RC 4KVCH 4FN0A 1JTPA 3V95A 1FLTX 2EKSA 12E8H 1U3HD 4PJBE 3TBWB 5F6IB 3MJ6A 5IMMB 2OI9C 5I2IA 2X1WL 4W4NA 1EEZA 5F6IC 4NM8L 1T2QL 1Q1JL 3UTTE 3F58L 2W9DL 4D9QE 1BD2E 1S5IL 2CUMA 3WIFA 4JFYB 1MRFH 3ZHLA 3NPSC 3LZFH 3VWKA 5KW9L 3QDGB 1EEYA 1TZIB 1V3LA 5EU3B 5DUMH 1FRGL 2H32B 5KTEL 3CZFA 3DROB 3L9RB 1R24A 3WIHL 5K9QI 3MO1B 3NFSL 2O61B 2EYSB 1NC2A 4M1GL 1HI6B 1A6UL 5F71A 5SWSA 3LQZA 2E9WA 3MUJA 3BRFA 3MREB 3JV4A 2ZPKL 3EYQD 3GHEH 4LGRB 3WV0A 5FUZH 4NJ9H 1G7MB 4N0UE 3VGDA 4HK0B 4MNQD 1P4IL 5F89B 5D1QD 3SJVA 1IQDB 5KVDH 2PN5A 5DD3L 1ZEAL 4M7LH 3E1F1 1NKOA 4OBRA 3VXSB 1L9NA 4YAQB 1RUMH 4HJJL 4X6FB 5DJAA 2XZZA 2YA2A 4OD2B 3ILQC 1A64A 2EECA 3ILPB 2APWA 1JPSH 3FN0H 2QADD 4XXCC 4JQIL 4B7IA 4H25A 4G6JH 5ICXB 3MCKB 5GHWH 3QEHA 4LKXA 1N6VA 3TT3H 4PJIF 4KKNA 5HVFB 3PABA 5DRXB 4FQLH 1MWAA 4Z5RA 5IWLC 5D7KE 2DLTA 3RZCD 1MELA 5DJ2A 2BP3A 4ZNEA 1I75A 2EDQA 4TN9A 3W9EB 5E08L 3QA3B 3K4ZA 4UTBL 4YHZH 1CDCA 1NGZB 4Y16B 4K3GA 1JTOA 1WCBB 1NCCL 4QY8A 4QNPF 4MD4B 4MCYB 4Y16C 4WGWB 3I9GL 3VRIA 3EYFA 1BM3L 1MCDA 3L3OA 2YSSB 3LQAH 4WO4A 4LSQL 2XKUA 2FD6H 1ZHLB 4EI5C 3FRPA 2V5TA 1IAMA 2VITA 5DVNA 4FQQB 2WBKA 3CK0H 1AHWA 5F21B 2X4SA 1GVIA 4I18C 3FT3A 4U05A 4ONHA 5T3XE 1Q0YL 5DD1L 1TJIL 2GAZA 3GKWH 3PWJB 1BOYA 1ZTXH 3MRIA 4JY6B 1AKJB 5KSBB 4L3ED 3PNWB 3K46A 4KJQD 4NN5B 4X0KA 5GJSL 1J9CT 4JHWL 4QGYA 4RIRB 5DJ0B 5HYSG 3DO7A 3MRQA 1R3LB 4NQCD 2LAAA 5JPMB 1U8QA 3I50L 2IALA 5BVPH 1IGYA 5KSUA 3S6CA 3TIEA 4K2UL 4WU5B 1G84A 4KUZH 3QQNA 2N56A 5A16A 1YMMB 1D6VL 1FLRL 1DVFB 1NLBL 4NQVB 5JHDD 1A9BB 3WXVL 2B20A 2EDYA 4Y5VA 1GIGL 3WO3B 3M07A 2CRZA 3BI9X 4HC1H 4XPTH 5I8KH 1VEOA 1AE6L 1H3PH 1MREL 3I2CH 3KPNB 5TJWK 2OK0L 2X4PA 4PJ9C 2VSDA 4TQEH 1FE8H 5GS1B 3DWTA 1KJ2B 4NCC1 1J10A 3UXFA 1QNZL 3R0MA 4FQXA 5FYJE 1DQQB 4ODWB 1LK3L 3K8MA 2Y9RT 3RUGA 1N4XL 4Z8FH 1FAIL 4X4YB 1UWEH 1FGNL 3MXWL 2XZAH 1MOEA 5FF6B 1J5OH 3OKEB 2HLFD 3HZVA 4N9GA 5BQ7B 1HNFA 4X6DE 5J6HA 4QYOA 5TE4H 2D7PA 1SJHA 2GJZA 5IF0B 1ZLVH 4KU1A 1CVSC 2EDDA 1MI5D 4YHPA 3VD3A 3QUXC 2G5BB 2VZ3A 1JPGA 2ZNWA 4ZFZA 4EUPH 4GAYA 3VFUB 1WZLA 1WAAE 4LEOB 1FORL 3AS2A 4MJ2A 3PDOA 5HPMA 4UINL 4WW2C 5IVZB 3WE6A 5BVJA 2NPLX 2ITDA 3ARZA 4L4TD 2IANE 3CFKB 4M48L 1GOFA 2PXYA 3I84A 1OAQH 1B6DA 2FATH 3ALWA 1FNLA 5E7FA 1MFCH 4G8FA 5JQ6L 4OB5L 1LE5B 5IQ9A 2FCBA 3SGJA 1D5MA 2YZ1A 4WU7A 2UVEA 4ZPVB 2BJML 4LARL 1KFAL 4X7DC 1G6RA 2ESVA 1R0AH 3VFVB 3NIGF 2VC2L 1I7ZB 5F7EL 4WHTA 1FGVL 2IWGA 4LCIH 3VE0A 2UUDH 1U8PA 3O3DB 3D3VB 3KJ6L 2M8XA 2OZ4L 5DRNB 3WN5A 5T1LD 4HHAB 2GW5A 3RVVD 1CFTA 4HIHA 2XWBB 1O7SA 4XNYH 1A6ZA 2FJGB 3E0GA 3R06B 5KVFL 5DD5H 4L1DA 4OKVA 4IMKA 5E1AB 3TFKD 3N0PB 5F9AC 5HGDB 3CLEH 4AT6A 3PWLB 1I1FA 4ACPA 1I3RB 3LQAC 3OL2A 4AL8H 4GSDL 4I77L 4X6BA 3BHBB 1ODAA 5F1NA 4O58H 3CH8A 4KK5D 3AAZA 4WDIB 3PHQA 2CD0A 3S5LA 2MHAB 3FQXB 3M8OL 3FO9B 3ARVA 1EJ6A 3LVEA 1AJ7L 3UPAA 3SDAD 3LSOB 1JYNA 4PRPB 3RFZC 43C9A 4HIJB 3CFDB 1FFPB 5IHBA 5E6ZA 2XPGA 2HTKC 4HS8H 1M6OA 4JKPL 3P73B 1EAPA 4ZS7L 1IM9A 4L4VB 2NY1B 2NY7H 1J11A 5ID0A 1BBDH 1IL1A 5IFHH 2MKLC 5CP3A 1HHHA 5D2NA 2NY1C 5D72H 3P0VH 5CJQL 3ARFA 1KNOA 4KK9D 4JM4L 4OQTH 4QTHA 1INDL 1PSKH 2VZ1A 3HZYA 2G60H 1MHCB 5IB2B 1V7NH 1QFHA 2ADIA 1EHAA 2UV3A 1G9NH 3VMNA 3SY0B 4KI5D 5F1IA 5GGUB 4JVPA 3GJFB 2NNAA 2ZCKL 1C1EH 1ORQB 2CKBB 4PJFB 3EKCA 4R4ND 3CX5K 4KZDL 5IHZB 5IJVA 5T1DL 1X4XA 1AXTL 5I18L 1UA6L 1PYWA 4PP1D 3IDYB 3P3YA 4NUJA 2VXSL 1MVUB 3IDYC 3LKNB 1KACB 1FDLH 3ARGB 2QSQA 4F7PB 1KPRA 5JXEC 4QCIA 1FJ1A 3WFCH 1TQCB 4GRLD 4R7NA 4C4KT 2F74A 1EH9A 4FQCL 4JHAL 1OGTB 1AXIB 5HHPA 1X5KA 5GS0H 3PXHA 4YX2H 4BZ1H 3FB6A 1ITBB 4JKLA 1LP9F 2IADB 2JCCB 4N0RA 1FC2D 1G9MC 3AM8C 4L4JA 35C8L 4RZCB 5T3ZD 1AGDA 4RGNB 5DEFB 3WEXB 3HNVL 1P4LA 5CBAB 4QEGA 1U2HA 1HSAB 3QJFA 1V7ML 4JQVA 3UZVB 2E8ZA 4C56E 2FBJL 5CGTA 2UWEE 3CC5A 5EC1A 4P23D 4I0PA 3ULSB 2FX9L 4TSCH 3AC0A 1WWBX 4K94C 4U1GC 5C92A 2LV4A 1KCSH 2VDRH 3PWNB 1I8KB 4OF0A 2CK0L 2YWYA 3IDXL 4M1CD 2H2SC 4G6FD 5EIQA 4OIBA 2R0KH 2OL3H 3SGKC 4GMSH 2VLRE 5I15L 1R3HB 5EFIB 5SX4H 1ZLVK 5IBUB 5C0BA 2X4UB 2KH2B 3D85B 1UWGH 5EZOH 4HKBA 2BFVL 1WIOA 1ED3A 1EO5A 5DDHB 1C16B 3DV4A 1HE7A 3EYOA 2R1YB 2WWMD 5JORA 4YDKL 1I1AD 4HJ0C 2EXYD 5E9DD 1IGML 2XQYG 3LCYA 3IDNB 5IMOA 2JJTA 1FG2B 3JWDL 3ARBD 3ULVC 4K7PL 4K3EL 2NW2B 3QQ3A 4M4RA 4QT5A 1B9ZA 4PY7B 1QHOA 3NMEA 2GFBB 4U1IA 2Q8BH 2HA1A 4JFZH 2VLJD 4GMTH 1IGTB 3QAZB 4ODHH 2DQFA 4W81A 4TNVF 2JK5A 2R2EA 4GLRH 5FOBA 3TNMA 4HXAL 1NMAH 1D5ZA 3LKOA 5E56A 1XIWB 4JZNA 5EG6C 2IQ9H 7FABL 4HPYH 2FX7H 1XIWC 4I9WE 2CH8A 3DUUA 4XH2A 3RGVA 3IYLW 2O5YH 4WHDA 1QR1B 3WLWD 4K9EH 3IFPB 4ELMF 4P49A 1X5ZA 3VWKD 1G9NC 3PGDA 3TN0B 2WANA 4OLZH 1UZ6E 1JWUA 3CX5J 3JWNC 3PGFH 4A6YH 4NJAH 1C08B 4Y88A 3QUMH 1DEDA 5E1HB 5TQ0L 1GOGA 3BEVB 3TN0C 1BREA 4Y1AB 4Z95L 4KKAC 2FDBP 1NC2D 6CGTA 4WWID 5DGRA 5JR1L 1P5VA 4GRMB 1JRHI 1MAMH 2PYEA 2GUOA 3T0ED 5I1HL 4NQTA 1YJDH 1HYRC 2ITCA 5J11B 4RFNB 1DL7H 2QHRH 2AV1A 1GC1H 2R29L 1JGEA 3BPOB 5J11C 3TO4A 5DEZA 2Y7QA 5E8DL 3VXUB 2Y25A 5HGGS 1MCSA 1UXWA 8FABA 3NZHH 3SE3A 2BSSA 3C6SA 3DNKA 1EO8L 2ICWA 3ZYJA 5MP6H 2OBGA 3MUGB 4QHMB 3NIDE 5GS0C 3VGAB 5D4QA 1I9RL 3UROR 4C54A 1LEGB 2XN9A 4QHLB 3OXSA 4X5WA 3NCJH 3I3EA 3QEQE 4GXVL 4KQ3L 5DHYA 2F5AH 5CIPA 3LKPB 4HIXH 3HG1D 3IXTA 5IK3B 1F97A 3FCTA 1UCBH 3O4LD 4YC2C 5ALBL 3IS1X 5IW3A 1Q9WB 3DVGA 2ENYA 1NBZB 4S2SA 2OM5A 2BNRD 4MJ5A 4PJGF 4WTZA 1RZ7L 2EXWD 2P8LA 4PJEA 2RB8A 3MCG1 1QRNB 1BQHB 2GYSA 4NWTH 3BPNC 1CVRA 1VESA 4Y19A 3QNXA 4G6ML 3VMPA 1TVHB 1IGIH 8CGTA 4Z78A 3VXRB 3FO2A 4K3DH 3MRFA 4WVRA 5IROC 4HKZA 4UV7H 3GBLA 3CIQA 4PJBA 4BYHA 2QQNL 4RAVB 1MSPA 4DGVL 1Q94B 4PJCE 3NBNA 2WZPD 4Q97A 1RIVH 3I6KA 3TBSB 3UTTA 2KBGA 1KN4L 1BD2A 3D39D 4NQXA 3MV8B 4G6KL 4XP6L 3H42H 3HB3D 5T3ZL 2FJHA 5SWQA 1OTTC 5TGBA 1M7XA 3G5ZA 1NGYB 3LS5L 5I74B 2E7CA 1WZ1L 1CBVL 1OTSC 4HUXB 3W5NA 1D7FA 1SY6A 2R1WA 5KBNC 1A7PL 1INQB 1J1XH 1U3HB 2XOTA 1T3FA 1JGDB 3IDJA 1AXSA 3QRGH 1TXKA 5I8OL 2HFEB 1YEKH 2DTMH 4OBSA 1PY4A 2ZCHL 1U3HC 2FJFB 1J8HA 4N0UA 4I0CC 4G9DB 1SMAA 3TA3D 3DETC 5IB3A 5J1SC 2H45A 1F90L 3IDUA 2D7TH 1NJ9A 4ZQKA 2ZUSA 4PGBB 1OVZA 4OCRL 4CMMB 4NCDA 4FQXD 3BP4B 2D9CA 4K9EC 5FKAB 2H1PL 5HHQA 2X42A 3MOAL 3FOMA 4MD5B 4ZXBA 5I73C 4GKZA 5AUMA 3BRDA 5DK0A 1S9XB 2DWEB 3V4PH 2D7OA 4Z7NE 3STZA 1AI1L 4MNQB 5D1QB 2JE8A 2R4SH 1JN6B 1MCOL 4I4WA 1U42A 1MVFA 1UH2A 5D1QC 5I1AA 2ZCLH 2HT3D 2HG5A 5SWZD 4Q9BA 1RIHH 3RPIB 1X5FA 2VZVA 1YJDC 2X40A 1DLFL 4EUPG 1GC1C 4QRRE 5EN2A 1DANT 3ZKXB 2QADB 5CCKL 4FQ1H 3TESA 4O9HH 1UVQB 1QSFB 3FMGH 5E00A 3ARDA 3H7LA 3GB7A 2B4CC 1S7SA 1N59B 3O45A 4OIIL 2SEBB 4G8GB 2IH1B 4UDTB 4Q6YA 3VFMA 4LFHG 4PJ7B 5F9WC 5FHBL 3V0VB 1ZHKA 3RZCC 4XCFH 4TSBL 2YC1A 4P5TA 5CINH 1VACA 5D7JD 1OPGH 4M02A 5IHLB 3N1FC 4ZUSB 2AK1L 2H8PA 2AQ1A 3GMQA 3TT1L 4I5BA 3L5XL 1FVEA 3K8KA 4LIQH 2Q76B 3P4LA 1CFNA 1VEPA 1MRDL 4JPVH 2IAMC 2WQ8A 3OGCA 5C3LD 1YY8B 5J9PA 4FTVE 3P9WB 1IEBA 3SDXE 2H2PC 5IHUL 3BO8B 1W0YT 4WI6A 1ZLWH 3LPGA 3C08H 5IV2A 3JV0A 4JLRA 4MB4A 3VXTA 2P5WA 4L3EB 5C9KA 2Y07L 4HPOH 1G7PA 1PG7L 4IIQC 4YK4B 1KCUL 1EBAA 3BKML 3P9LB 4LLMB 1GOHA 4KJQC 5KVEH 3I6GA 4M3JA 4CDGC 3B3IA 3BUYA 2QR0B 4DFIA 1CD8A 4KY1H 2DLFH 4HF5L 4UT7H 5A2FA 1H5BA 2NX5A 5C0CD 4K55A 1J1OL 4RX4A 5H94B 1MWAL 2OTUA 5JHDB 1FZJA 3MA9H 2AI0H 4EDXA 4X6DA 1L7IL 3MJ9A 5LWYH 4KRPC 1KV3A 3B9EA 2X1PA 5EOQL 1HN1A 4ELKB 2ADGA 4OCMC 1JF1B 4P46D 5ANMB 1CLCA 1KIQA 1A7RH 3HC0A 5T1KB 1S7UB 4M7ZB 2HFFB 4UIMA 2YPKA 1M4KA 5FA3B 5EUKA 3GO1L 4DQOH 1WAAA 3RDTD 2E9JA 4LASH 3S7GA 1QEWA 3H9SD 3MLWL 4BFIB 3HCVA 3KYAA 4KK8D 2CDGB 4YHYB 2IANA 4GKSA 3ROOB 2XWTB 4HFWB 3MJ8B 4MJ6A 3LMJL 3MGTB 2HLFC 4YHYC 1L6XA 4CRPA 1ZA6A 1XF3A 5CEZD 3U9PL 4DZ8A 2HVKB 3KYNA 3NCYS 5BJTB 3HE7A 1MI5B 2CDFA 4RDQF 1JGUL 5JIHA 3VXOA 5HGBB 4U6HA 1ZLUH 1OARH 4P9HL 3UTZB 2IH3A 5MEOA 3FAWA 2A77H 1JVKA 3OAZH 2BVTA 5EU6B 1QZ1A 3V7AG 4HT1H 3ZYZA 4HLZH 4YHLL 1ZA3A 2BMKB 4KHTL 3PWPD 1XFPA 1LEKB 4WHCA 4XP9H 3QCVH 2NZIA 1S5HB 2W9LA 4JEGB 4NO0A 4UT9H 4QRTB 4F33B 5KS9B 3NCEB 1FG9C 5D7SH 3QG6B 3CMOL 2GK0A 4ONGH 5ALCL 5DJZB 5L7XL 3EDJA 3FO0H 3X11B 4YO0A 2BCKA 3V52H 1FZOA 5HDOA 1YN6B 4KROB 4ODTH 2VE6A 4FP8H 5DMJB 1Y6MR 5T1LB 2YA0A 4YQXL 5IB5A 1F3DJ 3MV9D 3STBA 3MGAA 4LAQL 1Q9OA 3ZTJH 3F5WA 2VOTA 4PJ5D 3OB0K 3ZE1E 1UM6H 3QEGH 5E8EB 1NDGB 4CVXA 5J13B 2VWEC 3NABH 5F9DC 4I2XB 1IGFL 2C4FU 2AXGB 4KK5C 1AO7E 3NZ8A 1A3RH 1KB5B 1G7LB 2OS7A 5KN5A 1VFBB 4GH7B 5L6YH 2W0FA 3SDAB 4ONFL 1VB9A 5C09A 5HYJD 2XT1B 5EPMB 5E8OA 5F9JB 2HFTA 4M6OH 1UYWL 3FQNB 4JY5H 1HSBB 4MJIE 5D7IE 4P9MH 1U2CA 4XVTL 1AD9A 1YNKL 2XNAB 3VXQB 4DCQA 3GI8L 3D18B 3TBVA 1AR1C 3R8BB 1N8ZB 3RUGF 2E9IA 4D8PB 3DV6A 3TH3T 1S9KC 1RUPH 1G6RL 4O5LH 3BDYH 3BKJL 1WBYA 1BFVH 3DURB 3NFPA 1J0ZA 2IQAA 1N5AB 1QVOA 5KSAD 1AY1H 4NKDA 2PYFA 3LEXB 4KI5C 2DQDL 4H1LH 1HH9B 3KWWB 5TF1H 1MHHB 2MNUA 4PFEA 1TJGL 3B6SB 3SDYL 3ZTNL 3H6JA 3QO1B 3HR5A 3LB6D 3R8QA 4R4NC 3BDXA 4Q9QH 4EQ3A 1HZHL 4LSVL 4FZEH 2GI7A 4KK6D 3V6OE 3MV01 4V1DE 3QULA 4HJGA 3GMPB 3U7YL 4HWZA 3U0WL 5DJ8A 3OXRA 4GRLB 2EEAA 4Z77B 4C56A 2UWEA 1RZIA 2G9HB 2HH0H 2NXYD 3G6JB 4GRLC 3OKNA 1IBGH 3KNBB 3FQTB 4BKLB 4Z7VE 4EN3D 5HDQH 4I3SH 4TVPE 1MCWM 2EH8H 3U83A 1FYTE 4JJ5A 4F58L 1PG7X 1VADB 4N90E 4DZBB 1EGJH 2CIIB 3BGMB 3RY6C 4QHUB 3CFJB 2BY1A 5I1JL 1C5BH 5DTFB 4JY4B 4ZTPH 3C5ZC 4EI6B 1U8LB 2XV6B 4TUJB 4JG1H 5ICYA 3G5YB 4HV8A 2ZG3A 4WUKL 1JZ6A 1CFSB 4P23C 3WMSA 4PV9B 1CZ8H 1HK6A 1A8JH 4NBXB 2ZUQB 2Q6WA 3KLHD 1I7UA 2NY6B 4KKLC 4LLQA 2ZUQC 4M62H 4MYWB 1A1OA 2JB6B 4Z7UF 1BZ9B 2ZKHL 3QUYC 4M1CC 3RL1A 5EU7E 3U79A 3NH7H 4NKMB 3T3PF 4OCSH 1M7DB 1D5BB 3QDMA 1KLUB 5A43C 5E2TL 4LOUD 1CK0L 3O4OC 1R5WA 1ZWIB 3ARPA 1U41A 4R4FH 4JFPB 5D9SA 1KELH 3HRZA 3QNYA 3FO1A 1AD0B 1CTNA 5GRJH 4YFDB 4M8QA 4ISVB 1I1AB 5E9DB 1H0DA 2VN7A 2WWMC 1FNHA 1QFWL 1IFHL 3DYMA 3QFDA 4PGCA 5HDLA 3ALPA 2EXYC 1KIPA 5CZVH 4Z7OF 1H3VA 4Y4FB 1GGBH 3ARBB 4GAGL 5E2UL 1YECL 5C0FA 2ZOLA 1A6VH 3HLAB 1R5IB 1BHGA 2AJ3B 3ESVF 3IFNL 2R8SL 4PB0L 2VLJB 1NDMA 3OAUL 3QDGE 2A9NL 3L5HA 1YNLH 3KYMA 3QXVA 3Q3GA 1C5CH 1WTGT 3EYSL 2DYPA 4IBLT 5C8JA 1I3VA 1U0QA 3CXDH 2EKSB 1FNGA 5HHMD 4JM2A 4LU5L 1HHJB 1GGCH 3K1DA 3V0WH 1A5FH 3SE9H 3TWCL 2VIRB 2LU7A 1YEJL 1GGIL 4APQD 4OZHA 1J8HD 2V9RA 1IAIL 3VWKB 3UJTH 3WLWC 5IKCB 1G7IB 3VXSE 3QH3B 5TF0A 3E8UL 1DLHA 2DKSA 1OAUH 3A67H 5IOPA 4LVHB 2BRRH 1F4XH 1WCQA 3V4UL 1NC2B 2FZ3A 1XH3A 3QDJA 1R3JA 5SWSB 1CT8B 1VA9A 4LVHC 4N0YH 1F5WA 1INEL 3BT2L 2A83B 4JCLA 5D5MF 4GQPH 3T0EB 4XMPL 5DT1L 4MA1B 3BQUC 3RJQB 3HMXA 4JZJC 3QEQA 4OZGB 5BO1H 3T0EC 1EJOH 1YC7A 4U49A 2PO6C 2VUYA 4GRWH 1OWRM 4W4OC 1QFWM 3MLUL 2AJVL 3PWVA 4JZOA 3TJEH 5GRVL 3RVWC 3T08A 3IJSB 4DN4H 3BKYH 1VGEL 2CQVA 4OGYH 4Y5YC 5DRZB 3MRCA 2W92A 5IVNA 5GQBA 5I16A 1TJHL 1JPTL 5FO9A 1LVEA 4AG4H 4QO1A 2R0ZL 3D9AL 2DI9A 2F19H 3WLBA 4JR9L 4OLYH 1WFTA 3L3GB 1BEYH 3HC3H 5ACMA 3K1KC 2HKHH 1MWAB 4Z5RB 4B53A 3WDIA 2V2XA 2J3SA 4WFHD 4PD4K 4ETQA 4U6XA 5DJ2B 4NRYB 1HEZA 2IBZY 3VDBA 4LSSH 1J0YA 3T65A 2MPAL 1IAIM 1MHPH 1P9MC 5KSBE 1MFEH 3CXHK 1DBBL 1MJ8H 2CRMA 2VJXA 5BMFL 3ULUH 1MNUH 3QIUC 3CVHA 1OQOA 4ODVH 2E6PA 4URTB 3L3OB 4N5EC 3ZT6A 3GHBH 1HINL 4MHHG 3RZWA 3PL6D 4WENB 1UKTA 1LO4H 4RAUA 1DUYB 4LSDA 1BPVA 1JMXA 2J88H 4XTRD 4FG6D 2VITB 4JFFD 4YR6A 4F9LA 1YMME 2N1KA 5DVMA 2VR9A 2X4SB 3UO1H 5IFAH 3I02B 5F7HA 3T1FA 2X41A 1PBYA 1U3JA 2V2WA 4PLOB 4CNIA 1TZGL 3C5JA 4S1QL 4V2BA 4XAWH 1CGTA 2GAZB 4MXVE 1AR2A 2E6JA 2F5BL 3O11A 5I1CL 2P5WD 4XCCH 5T5NF 3UJJH 1MY7A 4OQ1A 4X0KB 3DRQB 1Q9LA 3TZVD 3K2UL 1W72H 1MEXL 5D1XD 3VFNB 1HOCA 1U8QB 1ZXQA 2VQ1A 4PREB 5H2BB 2IALB 3VGEA 1IGYB 1VGKA 3TIEB 4DUXA 5KSUB 4R90H 1KEGL 1OAZH 4JFEA 3SQOH 2VXUH 1KTLA 4C4KO 4H0IA 1AIFB 4Z7WE 5CMAB 3TA3B 5IBTL 2MQ3A 5D93C 3TA3C 2H9GB 2VTFA 1NC4A 3WKML 4XMLH 1U95B 2P44B 1KB9J 3HRPA 4KTEL 3L3HA 1WICA 3VW3L 1A1NA 2XQYK 4FQXB 4QRRA 2ICWI 1KG0B 3ZE2E 4JG0L 1RMFL 3JWOC 3MRMA 5JOEA 4X80H 4QYOB 5J6HB 2J8UE 2NXZD 3MRGB 3V8CA 1C12B 1SJHB 3P4OB 5E95B 1Z0MA 2V6HA 1J8KA 3VFGL 2GJZB 3MTRA 2XWJB 4U2YA 1FZMB 2OR9H 4OJFL 5SWZB 2V2TA 3WNKA 1UGNA 5SX5K 4YHPB 1RJZB 5L2KD 4OGXL 4ZFZB 1I85C 1BJ1H 4GAYB 1SY6L 4ERSH 4KMTH 1BAFL 4N5UA 5HI3D 3PDOB 3MC0A 1NPUA 4PRDA 1FSKB 3WXWL 4WEMB 3D3VE 4HLZG 1WBXB 5SV4A 4M6NL 3ZZ1A 4MQ7A 2Y72A 1ZANH 1FSKC 1QO3A 4PJEF 4XP4L 3MLRL 4N8VA 4BSWA 5DMIL 2JELH 1CDGA 5F9OH 2VKWA 1IZKA 2Z8WC 3D6GA 4R4BA 4Q6IC 4GAFB 4NM8H 1Q1JH 2A6JA 1CLOH 1JZ3A 3TC9A 2W9DH 5IQ9B 1S7TA 4FTVA 1D5MB 3A6CL 4ORZC 3SDXA 3F8UB 2A74B 5C0JA 4HUVA 3GMNB 4NO5A 2RCSH 3FB7A 5KW9H 3FQUB 1G6RB 2ESVB 4PJBF 1TTGA 4H88H 3VD4A 3D69B 3GSOB 1FRGH 4WHTB 4KJWD 5D1ZA 5D7JB 3VE0B 5KTEH 3DX7A 3MNZA 3LD8B 4CMHB 2FNBA 1IC5L 3CXHJ 3WDHA 3NFSH 5D7JC 1B0RA 4HIHB 4PRPE 1A6UH 2ZG2A 1A6ZB 1JE6A 4LKCA 3VWJA 1SBSH 5LG1A 4HX1B 4N0FA 4G6AC 4AT6B 1NEUA 4L4VE 3C09B 1I1FB 4JPKL 1V3MA 3ZE0E 5MERA 5GRUL 4X6BB 4DKEL 25C8L 3VFRA 2XZCL 2X9XA 1ZEAH 3S35H 3PHQB 4NKIL 4XAKD 3S5LB 3U4EB 4F37K 5DF0A 3REWA 3MRKB 3DPBA 4HJJH 4IOIA 2Y6SD 1JFQH 3RWEA 5C0RL 5CKGA 1OAKL 5C09D 3GMRB 4HZAA 5C0CB 1EAPB 1DN2A 1EUUA 4PJFE 1KIUA 3UYRH 5CSZA 1IL1B 2Q7YA 3JTSB 1HHHB 5D2NB 3ZT5A 4OV5A 3LKSB 3ARFB 4GW5A 5T3XL 4XNUH 1KNOB 3DX9B 4QTHB 1JPFA 3KPOA 1P53A 1X4ZA 3NCFB 1WBZA 1I9IH 4P46C 2FIRT 4MJ4A 1MFNA 4UTBH 4QRPA 4AM0A 3S34L 5EUOB 3UTPD 5F1IB 3QPQD 4JKKA 3RDTB 3I9GH 2NNAB 1P7HL 2VZUA 4Q58C 3Q48A 1BM3H 3H9SB 1FL5B 4LLDA 4LLUA 3RDTC 2DQGL 3GFUA 4LSQH 3KPMA 3RTQC 3T77A 5IJVB 4JRXD 3G6AA 1TZHB 2AXHA 2X2YA 4LCCB 1PYWB 3QDAA 4JPIA 2JCCE 2YUWA 1BQUA 5DA4A 1U8MA 1NUFA 1MJUL 3IETB 4CN6A 4CAGA 5I1GL 1TJIH 4MMZC 1YQVH 4QCIB 3U7AA 4BH7B 4X9FA 3QPXL 4C57C 1QA9B 2CRYA 4R7NB 1RI8A 3FONA 1YPZA 1MCFA 2ENSA 5FYJL 3PF2A 5GJSH 4JHWH 1CL7L 4FXGA 1RK1B 4NC2B 2AGJL 5EZIH 4P5KB 5HHPB 3AUVA 4X9BA 2GTWB 5GGRB 3VXMD 4X8XA 2X4OA 3MACL 4NRXA 3MJ9L 5HYSA 3GJFK 4R9HA 2DQUH 1U8OA 4ODSL 4YGVA 3P0GB 1P4LB 1GIGH 4X7SL 5JPNB 4O2FA 1HDMB 5FV2A 1CCZA 3O8XA 4R26H 2MMXA 3CC5B 1AE6H 1MREH 2OK0H 3ZHDA 5JOFA 1AO7A 4M7JL 1I7TA 4BSJA 1KN2L 1ZGLM 4ZD3L 4UIKH 4MAYA 1HKFA 1J1PL 1AQKH 1MLCB 2ADJB 3WUZA 4KDVA 3MV9B 1PQZB 3ULVE 1LK3H 5E94A 4NRZA 4PJ5B 1CGYA 4YDVA 3RWHA 3T4AA 2P47B 1YQ2A 2IG2L 2CJUL 3GSNB 1D3CA 4S0TD 5ERWB 1BGXH 2KZ1B 2Q3ZA 2W65A 5KVMC 4MJIA 1IT9L 1F3RB 4G8IA 1S7XA 3MRHA 3SPVA 4MCZB 3RVTD 2YRZA 1QRKA 3DV4B 3MRRA 2VZSA 3EYOB 5KOVC 2F58H 5CEXA 4L8SC 5CP7B 5JORB 1PG7W 4PJXA 2NY5L 4YXHL 4X6DF 4AQ1B 3C6LA 5CGMA 5HYJB 3D87B 1ETZB 4DKAA 3MLSL 2MCPH 4IDJL 3LN9A 3WNNA 4M48H 4QT5B 3O6FA 4U1IB 4LLWB 2EDNA 1SJVA 4EJ1C 1WFNA 4PLNC 2DQFB 1P1ZB 3U0TB 1WVZA 1T1YA 1WAAF 2X1QA 5JQ6H 2Y36L 2HJFB 2PW2A 1BX2A 4U3HA 3IFOA 4BQ6A 3V6OA 2XY1A 3TNMB 4V1DA 3IJYA 2BJMH 1CXLA 4FABH 5J8OA 1OP5H 4FZ8L 4S1DD 5H8DA 3QWRD 4EOWL 2VC2H 5F7EH 4J3WA 1FGVH 1PX3A 4LPVA 4U6VL 3BAEL 5KSAC 5ITFB 4Y5XB 1JL8A 5JUEL 5HYQA 2VAAA 1H3GA 2DLIA 4Z7VA 3VFWB 3VXUE 1OY3B 4Y5XC 5KVFH 4LSPL 3CFBB 1QYGL 4P59H 4E9LA 1JWUB 3IS0X 1QPXA 2X9YA 3LB6C 6FABL 1ZVHA 2ZSWA 3CH1A 1FYTA 1IC1A 2P42B 3LPFA 4GSDH 3L5IA 4I77H 1CICC 4KK6C 4PRID 5I1LA 4DVBA 3GNMH 3Q2CA 3PXJA 4J2XA 1A1MA 5HY9A 5DHVH 4HIEB 2PYEB 1P4BL 4GBXA 4LRNH 2ITCB 1MCEA 2DQIL 1T4KB 3IVKA 4ZO8A 2M26A 1JGEB 4FMFA 4MGXA 2NXYC 4EN3B 2Y7QB 1E27A 1G1YA 2VN4A 5CEYA 8FABB 2EC9U 2BSSB 4EN3C 4F7EA 4XCYB 5TE7L 3BRGC 3HPLA 5CUSL 1KGCD 3DRTA 1MQKL 1VSCA 4LHUD 4FOMA 2NY4B 1QRNE 1N0LA 4Z0XA 1CLYH 3EOTL 3PGCA 5TE6L 2XN9B 1TIUA 4LEXH 4X5WB 5C0IA 1JV5B 1J05A 3VXRE 1NMBL 4J4PD 4YIQA 4LCWD 3TBWA 2VLLA 3V0AC 3IXTB 3FCTB 1T1ZB 2EZ0D 5J6GB 4MB5A 4M3KB 2ZCKH 3DVGB 1B4RA 3KLHC 2V7NA 1MIEL 2AV7B 4JGJA 4MJ5B 3MV8E 3E2HC 4LVEA 2AJZA 1FQ9C 3CUPB 1AXTH 1T7WA 1UA6H 4CW1B 4OI8A 5FGBC 1CE1H 4J8RA 1TZIA 2JTDA 2VXSH 4ALAL 4S0SD 1TVDA 3QNXB 5EU3A 2KUTA 2D4FA 3C2AH 2H32A 4DAGL 1TFHA 4JFQA 4LOUC 3DROA 1FO0B 3FO2B 3MRFB 3MO1A 2O61A 3KDMA 4HKZB 3EYUL 15C8L 3H0TA 3MREA 5I66B 4OAWA 1GYAA 1LO3L 4FQCH 4WY7H 4HK0A 4JHAH 1BD2B 4NQXB 5F89A 4DVRL 3NAAL 3N1GC 4GKOA 2FJHB 3SDCD 5EIVA 5TGBB 1KPVA 3G5ZB 2VMFA 3VXSA 35C8H 1SJEA 5LGHL 5LGJB 2R1WB 4P2RD 4XXCA 5DQJB 4OD2A 5HHMB 5I6XB 1Z3GL 3KLAA 3JV5A 1V7MH 4PR5A 1AXSB 2FBJH 1N6QH 4JFED 5I1IL 3DO3A 3QIBD 4APQB 1J8HB 4MNQE 1YEHL 3KG5A 2FWOB 4GS7C 4Q9CA 5FAAA 5IB3B 3WNPA 3U46B 2YRPA 5DRXA 4APQC 4XZUB 2CK0H 2YS4A 4KTDL 2PCPA 3WNOA 1NJ9B 2UWEF 3W9EA 1FCGA 3KPQA 5KSVB 2HTLD 4ZOEA 4Y16A 2VDPL 5E2WH 1NAML 3MPCA 5DZNA 4RBPH 1ZOXA 3PP3K 4GKZB 4CVZB 5BV7L 3TF7C 2DLHA 2YUVA 5EU4B 3OKKB 1Q38A 3QQ9D 1T7XA 3RBSA 1HWHB 4EI5A 5IMKB 3K0WA 3STZB 3EGSA 4OFKA 2BSRB 5F1SA 4NHCL 1H9VA 4YFEA 4O2CA 4I18A 5I1AB 4ZO7A 4FQQA 4YE4H 2HG5B 5E99L 3SKNA 3JWDH 2OSLB 4PJ7E 4NOBA 1L4IA 4TSAH 1MPAH 5K9QG 4PJAB 1OLZA 4MA8L 5DJYB 5EN2B 1B2WL 4XPBL 2C3HA 4JY6A 5KSBA 1JRHH 1LD9B 3ORJA 3PNWA 3SKOB 3P4MB 3P11L 5DJ0A 3GRWH 1UM4L 1S7SB 5JPMA 3NIFE 2DQJL 3O45B 5DLMH 5EU5B 2Q3AA 1X5XA 1FVDA 1EMTL 7FABH 1CDYA 2DICA 1LP9B 1YMMA 2EKJA 5FYKH 3T4YA 1AGCB 2WBJD 4NQVA 4LRIC 2CMRL 1ZHKB 5K9KB 1MF2H 2CPCA 4OT1L 4NC1C 4XWGL 1T6VN 2E7MA 2V9TA 4HBCL 4FXKA 4OZFH 4L3EE 4P5TB 2IFGA 5CWSB 3GIVB 5D1ZD 3K2MC 4Z95H 1KJ2A 3DI2B 3VCLA 3PL6B 3GMQB 1DQQA 1EDQA 1FN4A 3HMXL 1OM3L 4NN6B 5I1HH 2DIBA 2I9LA 1UZ6F 2LVCA 4FG6C 5JHDE 4DEPB 5FF6A 1GZPA 1KUMA 3QCTL 4QWWD 5BQ7A 1BF8A 4Z7WA 1QQDB 3QT2A 4K7FA 2C9AA 1F4YL 2GITB 4DEPC 4P3WA 5IV2B 4JM2F 4JLRB 5IF0A 1XR9A 2P5WB 4CKVX 3QUXA 5ANME 4DW2L 1EO8H 4KUCD 4Y89A 1IJ9A 2G5BA 3VFUA 4RA0C 1RV6X 3BUYB 1MLBB 4LEOA 3RAJL 3TZVC 5D1XC 1RZKL 1MCQA 1H5BB 2NX5B 1I9RH 2ZG1A 3WJJC 5IVZA 1FZJB 3CFKA 4CU7A 2GHWB 3DIFB 3NA9L 2J8UA 5D2LA 5IM7A 4LDEB 2Q87A 2ADGB 1QLFA 4PP2B 3NIDF 5DC0A 5ALBH 4JO4L 1KIQB 1Q72L 1WSST 2NY3C 3HC0B 1MI5E 4YDIL 1LE5A 3WIIH 1HHKB 3CVHL 1DQTA 1AP2A 4UIMB 4ZPVA 1RZ7H 5E8NA 3TJHC 3VH8B 4QOKD 2VDQL 5EUKB 3HAEH 5ECJE 5AD0B 5EU6E 1YNTB 3CVIL 1I7ZA 3Q1SL 5FYLD 3O6MH 3V4VL 3O3DA 3D3VA 4U6TA 4GKSB 3SCMD 3PJSB 2NXZB 2A9MH 4MJ6B 4TVSa 1QSZA 2DQHH 2NXZC 1XF3B 4UTAH 5E1AA 3KYNB 4WV1B 5SV3A 1QBAA 3HE7B 3QIWC 1A7QL 1I3RA 4G6KH 1LO5B 5DUPL 4WV1C 5MEOB 2CGRH 2D2OA 2QQLL 3LS5H 2MHAA 4PJCF 1X7QB 1RURH 3FO9A 5HI3C 1YEEH 5D71L 4H20H 3LSOA 1A21A 4HIJA 3CFDA 3OJVC 3LKRB 1MCKA 3KPLB 1E4XL 2ZCHH 4RFOL 4UT6L 1U8NA 2QSCL 4HQQL 5ETUA 5HDBE 4L4VA 2BY3A 1IC7H 3GSRA 3TVMC 2BY2A 5KAQF 4J3OC 4I2XE 5I1KL 5GS2D 3O8XD 2UZIH 3PWUA 2NY2D 2ZJSH 4YO0B 4F8QA 3M1BB 1P84K 4LF3B 5E5UB 3RY5A 4U0RB 4BA8A 5IB2A 5ESVA 1NEZB 3U1SL 2VE6B 1MHEA 4OCRH 4HC1A 3K4DA 3SY0A 1SM3L 1EK3A 5GGUA 1D5IH 3F5WB 3OX8B 3GJFA 4GOSA 1TNMA 2CKBA 5EZLB 5C7XH 3B4NA 4PJFA 2MOVA 1AI1H 4PJGB 4PB9L 2QBWA 2IBBA 5BCAA 3GIZH 1VERA 3DARA 5ACLA 3BPCB 2BOBB 5JXEA 1IRAY 1FNSL 3MLXL 1AFVL 4Z7NF 5KN5B 4F7PA 5MHSD 4UI2A 2W0FB 5EORL 1GGUA 1ADQL 3C6LD 4KI5E 5C6PB 5C09B 2IFFL 4ZUUB 5C07D 1AC6A 3MUHL 2FHBA 5E8OB 1N64L 1HIML 2AEIT 3PIQB 1TTFA 4BFBD 4EUPA 2ICCA 5CILL 5CLTA 1OGTA 3E6HA 4BQ8A 2CXGA 3S88L 1N0XL 5AAMA 4ZTOL 1JHKL 2DS4A 4IEFB 4P4KD 3U9UB 4DCQB 1HXYB 3TBVB 1MFBL 4F57H 4RZCA 5D7LD 5T1MA 5DJDB 2Q86B 5FHBH 3WEXA 5CBAA 4IRSC 3ZKND 3E3QE 1HSAA 3DTXB 1RU9L 3NFPB 5TDPA 3QJHB 3OG6B 3UDWC 1KJ3L 3ULSA 3G6JE 3QPQC 2ARJB 4U0QB 3SDDD 4MAUH 3X12A 2AK1H 5CSGA 4JRXB 4L5FL 3HR5B 1B90A 3PWNA 3L5XH 1I8KA 1PLGH 4EXPX 5F1KC 3C60D 2EDFA 3SGKA 2WIIA 1H3TA 4ZPTB 5T3ZE 3OF6A 5F7WC 4UBDC 2Z91A 1MFAL 2ZUUA 1NFKA 3G6DL 3QULB 4XWOC 5EFIA 3OAYK 5J57B 3QXAA 2Z93A 4P57A 4HWZB 4XCNB 5FIEA 2Y07H 4C56B 1YUHB 2EICA 1RZIB 1PG7H 2DM7A 4KWUA 1C16A 2YK1H 5B4MD 3BKMH 2OXHA 2R1YA 2X44D 1C5DA 4JREC 1KJVB 5F6HJ 4XRCB 3SDXF 2VLMD 3HFML 3IDNA 1DZBA 4XNXH 4F80A 2XI9A 3RX8A 3H8NA 1J1OH 5FO7B 2DBLH 2NW2A 3CLFH 4NO2B 4D3CL 3HZMA 2OXGA 4QXUH 3IDMB 3MV11 2VB5A 4PY7A 5GGTH 1MCPL 4HMCA 2GFBA 1L7IH 1T20B 2ORBL 4PY8I 2CDEB 4LBEA 4LQFH 1ACZA 4P48A 5FA4A 4G3YL 4HV8B 2VXTL 5E9DE 3RNQB 1XIWA 4G9FD 2NY0D 1P84J 3DMMD 3VD9A 4LLQB 3I3DA 4H8WL 5KZCD 3KJ4B 3AS3A 5B3JE 1J88A 4LLAA 1QR1A 3IFPA 3B9KD 3QDMB 2VLJE 3LMJH 3TN0A 1GRWA 3RWCA 3ECBB 3R0NA 1NAMB 1C08A 4KQ4L 3FO1B 5ID1A 3BEVA 2GT9A 4PUBH 3RVTC 1EPFA 4UILL 4M8QB 1A7NH 3EO9H 5GJTL 4P9HH 5BV7B 5TDNB 1A3QA 4YBHA 2WWKO 1Z5LB 2DDQL 4GRMA 1KIPB 4HAFA 4OFYD 2C4XA 3EDDA 3UC0L 2ZOLB 4ZAKD 5L0QC 3AXLA 3RKDD 1A7BA 2HMID 4Z7QE 1CFVL 2C1OA 5I1EL 1F2QA 4KHTH 1NCTA 5I8CB 1Z9SA 3ZL4L 4NP4L 1CR9L 4KKCD 2VXQL 2UZYB 1S9YB 2VABA 2XG4A 3QWOA 4B50A 4QHMA 1FH5L 3VGBA 5L7XH 1T7ZA 3FOLA 4HXBH 4J7RA 4B41A 1LEGA 3T0EE 4Z6AT 4QHLA 1MFDH 1CGSL 4S1DC 4TULH 4OZHB 3CFCH 4OZGE 2ERJC 3LKPA 2D31B 4ODXA 4XVSL 1OT1A 1Y0LB 5HVHC 5IK3A 4XPFL 5B39G 1K3ZA 3RA7H 1F58L 2ATPA 5I0DA 3N9GL 5DSCB 3GGWA 1DLHB 1Q9WA 1NBZA 1IKFL 3OBAA 5IOPB 1RIUH 2YBRA 2P49B 1DQMH 2FZ3B 3QDJB 1R3JB 2KPNA 3UTSD 2HYMA 3F7YA 3ELAT 5BW7C 5JNYB 1MCCA 4NQDD 5DC9B 1FHGA 2OL3A 4NO3A 4PJDB 2ARWA 5IROA 1TVHA 5L9DL 1QKZL 1NMCB 2Z31D 3GMLA 3VXRA 2XZQH 3HG1E 5C2BL 4JO1L 1NMCC 1ONQA 3MJ7A 3MOBH 4RAVA 4JZOB 4WFED 3C87A 1LQSR 4HH9B 3TBSA 2CLVA 2BNQA 3B8YA 1B4JL 1UYWH 3MV8A 2BOCB 3Q0HA 5I16B 4RGOL 4H5SA 1NL0L 4PBWD 1EFXA 3L7EA 1L7TL 5FO9B 2KL6A 1JNHA 1NGYA 4RGMC 3GI8H 1EEQA 3KPSD 3DX8B 4OLEA 3VRLE 4DK6A 3IXAA 1RZFH 1U3HA 3EFDL 3KYKL 4LCWB 1DR9A 1JGDA 3EW3B 5D7IF 5EDXA 2DD8L 4ETQB 2E5EA 3BE1L 5F96L 43CAB 4TVPL 2N4IA 2EZ0C 4G9DA 4PGZA 1WT5C 1CD1A 3T65B 3ZTNH 3SDYH 5IW1A 1NEZG 4PJ9D 4OLXL 5KJRL 3VG9B 3CVHB 3BZDA 1ZGLP 1HZHH 4E5XB 5JDSB 3V6ZB 4PGBA 3G9VA 4U3XA 3NACL 3VG9C 5M94B 2XIDA 4CMMA 1X6LA 3BP4A 3U7YH 4U1JA 5FKAA 2NMSA 4YR6B 5DJ6B 3QUMA 3MXVH 1S9XA 4DTGL 3T1FB 5MEQB 4JKMA 2V2WB 1FNFA 1T1XB 4CNIB 5D1QA 1JN6A 1M05A 3O11B 4WCYL 3QHFH 4N8CL 3BWAA 1MRCL 4XCEA 4M7KH 1UC6A 3SDCC 4K8RL 1UJ3C 4P2RB 1TQBB 4F58H 2VQ1B 1SEBA 4KRNA 1VGKB 1K8DB 3HUJA 4PS4L 4MQTB 2CUHA 3UBXB 1TQBC 1NGQL 2BDNL 4X7EC 4JFEB 3NPZB 4Y5VC 5AZEH 3P77B 5J1AB 3QZWG 4WUKH 3VI4E 1GXEA 3G04B 1LDSA 5AYUL 1KCRH 4N9OB 4A2LA 4CU6A 2YMXH 1N59A 3QIBC 4LGPB 2Z92B 4ZFGH 5SWZE 5DD0L 3RZCA 1ROWA 3MSPA 2AKRA 4PJ7A 2ZKHH 3UAJD 2KDGA 3V0VA 1U92B 5E6YA 5FYLH 5C3TA 1A1NB 3HE6D 1U91A 5FHAL 5FCUL 3HAEG 3EUUA 1CK0H 2C5DC 2XA3A 3L5JA 1KT2A 3KXFA 2J5LB 1ES0A 1DCLA 1IGCL 3GMOB 2J5LC 3QQ9C 1BVKB 1T83C 4MXWH 3MLVL 3L1OL 1IFHH 4TRPL 2Q76A 1KCVL 2DQTH 4GG6F 1A02N 4GAGH 3IFNH 2IEPA 3QI9C 5C2UB 1DQDL 3BO8A 3LQMA 5C08A 2XQBL 4PIRF 4IIQA 2HRPH 3SQBA 2ESVE 3WD5H 4L3EA 4BFGA 4HUKB 4QLRA 3WFEL 2F15A 4OF5A 1JUFA 5E4IA 1H8SA 3EYSH 3RU8L 1RSFA 4NQCA 1EZVX 4LLMA 4MQ7B 1DANU 1QO3B 4O4YL 4FQJL 2IGFL 2QR0A 3CDGB 4LU5H 4WI7A 3U2SA 3VGGA 4BSWB 3SGJC 3TWCH 3MROB 1T7YA 4R4BB 1YEJH 1ZT7B 3STLB 2A6JB 3PP4L 1GGIH 4YDJB 1S7TB 3AVEA 5JHDA 2XXCB 4RMUA 5F72S 2WBJC 1NGPH 1I3GH 1JBJA 4NO5B 3FB7B 2O93L 3A0OA 4IS6B 1CE6B 1JF1A 1U6AL 3E8UH 1OD7A 5D1ZB 3INUL 1S7UA 4FQ2H 3WJLC 2HFFA 3V4UH 1JHLL 2YD6A 2DQEL 3DGGB 2GJ6D 4LKCB 3BT2H 4N0FB 5C0CE 4BFIA 3FB5A 4Y2DD 5GPRA 3BESR 4M43L 2CDGA 5MERB 3ROOA 2X1XR 2FHFA 3FFDA 3QP3A 1GAFL 4G80A 3MBED 4HFWA 4LSRH 3MGTA 3ES6A 2V9QA 3KR3L 2OMNA 1I9JL 1CGVA 3MLUH 3O6LH 5CHNB 5E4EB 5H37H 1SYSA 2VKXA 2AW2A 2HVKA 5D70L 1VGEH 5JXED 3REWB 2W0LA 3VMOA 3O3AB 5HGBA 4IOIB 4U1HA 2VDMH 2VDNL 4N1EA 4Y4HD 5ADOL 2CLZA 5EUOE 1TJHH 3RP1A 3D2UD 1JPTH 3V79C 4HWEH 2IPUK 3IGAA 3H9SE 3IRZA 3K81A 3D9AH 3BX7C 3PDDA 5FUOL 5HYFA 1FPTL 3ZT7A 3U82B 2VDOL 4L4TA 4KVCL 5CSZB 2Q7YB 4HS3B 2VQUA 3HI1A 1NFDB 4BSVB 1LEKA 4R6UA 4AEFA 4GW5B 1OAYL 4U4BA 5CEZE 1C8PA 2P8MB 4HKXA 1K4CA 3KPOB 1BVZA 1WBZB 4F33A 3JVGC 4PRNA 4QRPB 3GEWB 1KBGH 2BC4A 5HHVL 4QOKB 2YOCA 5IFJA 3FHQA 1MRFL 1KJ2L 5JW3H 5DJZA 1A7OL 3LZFL 1A14L 3X11A 5E24E 3OHXA 1E6JH 1YN6A 5DUML 4EDWL 5DS8B 2WK2A 1ACYL 5DWUH 3Q5TA 2BHZA 2DB8A 3KPMB 3N06B 3T77B 4C83B 4N1CA 4YH6A 1FFRA 3BVNB 5EOCH 3PWPE 3WL9B 2HLAB 2P1YA 3WS3B 3SCMC 1FFOA 2EYTB 5GGVL 4AIXA 5KSBF 1PJ9A 1U8MB 2WLZA 1XCTB 3RRQA 5E8EA 5FUZL 1TZGH 1LO2L 2AJXH 4HWBA 4DUVA 3FQRB 4YHOL 1WEJH 1HYSC 4JFOA 1GHFH 1Z9OA 4I2XA 4BH8A 3V9FA 1KYOK 3LAFA 1DEEA 1JYXA 4HJ0D 1YPZB 4M7LL 4MNGE 3RWFB 3EDKA 1IMHC 4FXGB 4X5XB 4S1RH 3V5HB 1KB5A 1G7LA 5CJOL 3ZDXF 3K2UH 1LEIA 1QHPA 2FB4H 1RUML 3LEYH 3SE8H 3X13B 2VLRD 4RDQG 3T8XA 3MV9E 4D0CB 3SDAA 3QXDA 4LHUG 1VFOA 4PJ5E 1JPSL 3FN0L 3K7UA 5CIPH 5EPMA 3BXNB 1A0QH 1BZ7A 3K4AA 3ZHKA 5GHWL 2APXA 3O6KL 4F3FA 5D96B 5C6TL 3WSQH 3EZJB 2E9BA 1HSBA 1UB5B 1XF4B 3O8XB 3QQ4A 5D96C 1WF5A 4FQLL 4UB0H 1P7QD 4JJHA 4OM1H 1DSFH 2NY2B 3VXQA 3D18A 1I8MB 1WWAX 1N8ZA 1MCIA 1AO7B 1A6TA 4OI9A 4YBQD 3RWDA 1I7TB 4JE4B 1B3JA 4F2MA 3TCLB 3WFDH 2R23A 5A40E 3DURA 5E94B 4NRZB 5HYJE 1E4KA 1N5AA 3BGFB 4F7MB 1U3YA 3FRPG 3RWHB 4UOW1 3T4AB 1P6AB 1HH9A 3LQAL 3KWWA 3B6SA 3U6RA 2FD6L 3QO1A 3ZKQD 4G8IB 1S7XB 1CG9B 3MRHB 1WZMA 3SPVB 4YNYB 3H3PH 3MRRB 1EFQA 3ZE2F 3CK0L 3CCHB 3DUHA 2L7UA 5CEXB 2YN5A 3OKOB 4OGXH 4PJXB 1NBYB 2JJTC 4TTDC 3GMPA 1EHLH 3BZEB 1SY6H 3C6LB 3GKWL 4GRLA 4Z77A 1BAFH 1ZTXL 3NN8A 3O2VH 1L0YA 3B9DA 4EVNA 4J23A 4XI5C 4F37F 1BQLH 3G6JA 5B8CB 4CL7A 3KNBA 2BHUA 3FQTA 5FUCC 1CGUA 3MLRH 3RY4A 5B8CC 5BVPL 5FDYA 4PLJD 4KUZL 1T1YB 3AS1A 5J7CC 2PW2B 3UBXG 1BX2B 3HC4H 5D7LB 5KOMC 2DL2A 4P4KC 2VLKA 3A6CH 1DE4A 1VADA 3C5ZA 2CIIA 2YRLA 4QHUA 1MCHA 2QJDA 5IG7A 4E41D 3CFJA 2VO5A 4HC1L 4JY4A 1YEFL 1FC1A 4P23A 4XPTL 4EI6A 5I8KL 4TUJA 3ZKNC 5TFSH 3G5YA 1H3PL 3BJ91 3I2CL 4Z0BH 3IDIA 1CFSA 3SKJH 4PRAB 5EA0H 3SDDB 5HYQB 2CKBL 2AEQH 4Z7VB 5HI5C 4GO6B 3SDDC 4NZRL 3C60B 3QUYA 4OGZA 2V17H 4Z8FL 1FV1B 1J0HA 3CH1B 1FYTB 1BZ9A 1UWEL 2LTQC 3C60C 3LPWA 2XZAL 2JKXA 5EO9A 1J5OL 4NKMA 4DKEH 3GSVB 1M7DA 25C8H 5I1LB 3O0RL 1KLUA 5GRVK 2GSGB 1RZJC 1A1MB 2C1PA 5K33A 2FGZA 3KHQA 2DWDB 4NKIH 2LVEA 4GBXB 3TO4C 5A3ID 1AD0A 2KKQA 3IVKB 3MMEB 3FQWA 4U1KB 1JMZA 2Y06H 3IDGA 5E9DA 3SE3C 3ZE0F 5B4MC 1CXEA 4EIGB 1FIEA 5CEYB 5I71B 4OZIB 1KCKA 1G9ML 3ARBA 3HLAA 4ZOCA 2AJ3A 1OTTD 3DRTB 2Q7NA 4RCAA 1OAQL 2FATL 4Z0XB 2VLJA 4OTXH 1OTSD 3LS4L 5F7NC 3NIGE 4XXDB 1MFCL 4HUMB 4HUNB 1M7IB 1UB6A 5K9JL 3FB8A 2OR8A 4NNPH 4K94L 1J05B 2RAMA 1W2KT 1XZ0A 2OI9B 5HVWA 4YIQB 1IAKB 2C3WA 2VLLB 1HHJA 4G9FB 4Q9RH 4XVUD 2VIRA 1R0AL 3DETD 4DKFL 3MOQA 5ADPH 5KZCB 2NY0C 4AENA 4Y4KD 2V7NB 2DQGH 3DMMC 3NPSB 3UPCA 2AJZB 1BZQK 3EDEA 3PV6B 3B9KB 5FO8A 2EIZB 2A1WH 3O2WL 5HBBA 4J6RH 4J8RB 5CZXD 1T1WA 4XNYL 5IKCA 1G7IA 3B9KC 3QH3A 4LPCA 1BJ1J 3GSWA 1MJUH 4NCC2 4JFQB 4LLVA 1PVHA 3CLEL 3T0AA 2WLYA 2GKIA 2ZP0T 3BP5B 4WHYH 5C0EB 5HHME 5I1GH 1UFUA 3KDMB 1CT8A 4O58L 1BIIB 3BQUA 3H0TB 4OAWB 4IRJD 2ADFH 2A83A 4JZJA 4J3XA 4UV4H 5CKAA 5DC4B 3T0EA 3HA0A 1FL3B 5FYJH 4PGJA 2JCCF 2XICA 1J8HE 3ULVL 4KAQH 2PO6A 2AGJH 2JJSA 4OZGA 4QXGH 4ODBD 2M1KA 4KV5F 2YZ8A 4ZAKC 5E7BA 5DFWH 4Y5YA 5F7DB 3RKDC 1T5WA 2HMIC 2EH7L 1KPVB 3MODH 3MJ9H 4WFGD 1P2CB 2YUZA 3IJSA 2EDOA 4HS8L 4ODSH 5DRZA 3TEUA 5LKNA 1SJEB 3FHAA 2X6MA 2NW3B 2NY7L 4XB8A 2RFXA 4XBPA 3VGHA 1BBDL 5IFHL 1QSED 1RUQH 5EBMB 3UEZA 4KKCC 3KLAB 4PR5B 5CJ8A 1I7RA 2MQ0A 2XACC 4GT7A 2DM2A 3OJDA 3ZSSA 3U36B 4UU9B 4M7JH 2FLBT 3L3GA 4QF1A 2P43B 1V7NL 1WLHA 3HG1A 1HXMB 1IQWL 1G9NL 4AMKH 3MLZH 4XPHL 1QFUH 2PCPB 3O4LA 4LCUA 2AEPH 4UNUA 2R39A 4NRYA 1TCMA 4WNQA 5ACZB 1C1EL 4YZFE 1LE9A 2BNRA 3KPQB 4KHXL 4PJAE 1P9MA 2CJUH 4WI4A 4M93B 3SN6N 2XTJD 4MDJB 1DBML 4GJTB 4ZUVB 4XC1H 1F4HA 3UTSB 4LNRA 1I8LA 4M93C 3KLSA 3QFJA 3KXFD 3ULVF 4EI5B 3QUZD 5M7QA 3EGSB 1FDLL 1G7QB 2NY5H 4YXHH 1DUYA 2IAMD 1S78C 4O2CB 2Z31C 4I18B 5B38G 3W2DL 3EFFA 1LP9E 3LN5B 4WFHE 2H2PD 1QLRB 5MEND 3SKNB 4NC1E 3I02A 3RIFK 4KJPC 4ZNCD 3D39A 4BFEA 3BZFB 5C08D 4XBEL 3P9MB 1JGLH 4LVOC 3N85L 4QGTA 3ARDC 4TNWK 5GS0L 4XVJL 2MSPA 4YX2L 3LOWA 1T21A 4AZ8A 4BZ1L 2AS5M 3DRQA 3KPSB 5BS0D 3AFLA 3VFNA 5H2BA 4PREA 1E6OH 2VAJA 2VL4A 1FVDB 3S3JA 4JFFE 2FRGP 1SEQH 4EOWH 3T4YB 3CJJA 5FGSA 4KRPD 1CLZL 4P2QA 1AIFA 4TSCL 1ZMYA 5CMAA 5FGCB 3TA3A 2GIYA 5DUBA 1JI2A 2W60B 4MLIA 4JVWA 3L95A 5B21A 1KCSL 2VDRL 2P5WE 4FXKB 4PJ9B 1JK8A 2VR4A 2ILLA 2F53D 2H9GA 2YEZB 4U6YB 5E6IC 3S37H 3EO0A 6FABH 1U95A 3WUWG 1LK2A 2D0FA 2R0KL 1NAKH 2OL3L 2V5SA 3KGRA 4GMSL 3VCLB 5LVEA 2F8XC 2QHLA 1FN4B 1XCQA 1OGAD 1KG0A 2NX5E 4Q0XH 1P4BH 1UWGL 5EZOL 2I9LB 3V5DA 3W81A 5JOPD 3MFGB 1K4DA 2DQIH 2ZUXA 1GZPB 3R1GL 4Z7WB 5JIIA 3OPZH 3MRGA 1C12A 4K7FB 3X14A 3FJTA 3P4OA 3ESUF 1XR9B 3VFPB 3QUXB 2XWJA 1AGBB 1FZMA 2BXZA 5SWZA 4LMQE 1NBQA 4Z18A 3BKCL 5TE7H 5CUSH 1RJZA 4P3CL 2B8OT 1A4JB 4HZLB 4WW2B 4I13B 2WNGA 2FYYB 3N1PC 1AH1A 3O3EB 4DJMA 2DIAA 3TYFB 1C7TA 2IJ0C 3RWIB 3S96A 1WBXA 2OJEA 3ARED 2PR4L 2J8UB 5D2LB 5IM7B 1EAJA 1QLFB 2FX7L 5JDJA 4CJ0A 1MIEH 2Z0BA 2D0HA 1AP2B 4JO2L 2O5YL 2X70B 4ZSOA 5E8NB 2A74A 3HE6B 4K9EL 3GMNA 3UAJC 4L9LC 3FQUA 3RX7A 4Y0GA 1Q9KB 3D69A 3HE6C 2LABA 3GSOA 4OFDA 4DAGH 1SQ2N 5D7JA 2WV3A 3PGFL 4NJAL 3QUML 4KPHH 3EBAA 2AJUH 3HKFA 4HX1A 1U3ZA 1LO3H 4JVUA 4PG2C 3ZYOA 1VHPA 1YJDL 5BZDA 3UZQA 4DVRH 2EC8A 2QHRL 4BK4A 1GC1L 2H6PA 5GS3A 1QUNA 4XNQB 1URLA 1N7MH 2HJKA 3NCBB 3U4EA 1EUTA 1N5YL 4TNVK 3NZHL 3MRKA 4WWKD 4OLWH 5LGHH 4DN3H 2B4CL 2YN3A 4OLVH 3RQ3A 5MP6L 2AABH 3V6BR 2YXMA 2L7JA 2M2DA 1PFCA 2WUBH 3GMRA 2DRUA 1U8NB 5C0CA 3QDHA 1ITCA 5ETUB 3GSRB 3NCJL 4PJGE 4FQIH 4KH2A 2NLJB 3JTSA 2F5AL 1AR1D 4HIXL 1YDPA 4MNHB 3MRDA 2EE9A 3LKSA 4AIOA 3PWUB 4P46A 4M1DH 4WTZG 4XAKE 3MNWA 2DKUA 1K3IA 3DX9A 5ESVB 1HQ4B 1MHEB 2B39A 5EUOA 5C09E 5LGKA 3RDTA 3IKCB 2GJ6B 1CN4A 4NWTL 3CSBA 3H9SA 1FL5A 3DI3B 3RTQA 3LN4B 4Y2DB 5DR5H 1IGIL 3D0VB 2HN7B 3MBEB 4K3DL 1TZHA 4NSKA 4Y2DC 4LCCA 4ZUWB 4UV7L 4P99A 1A6WH 3MBEC 3HNSL 5E99H 1DBKL 2RHEA 3IETA 1RIVL 4ZYKB 4QXTB 1QG3A 3J7HA 3UTPE 4BH7A 1B2WH 2ICES 4XPBH 3D2UB 1QBLL 1DBJH 2FX8L 1QA9A 2A6KB 5J0BA 4Y4HC 1G7JA 3P11H 4FXLA 3UTOA 4EUPB 1RK1A 3OJMB 3OKLB 2Z35A 4P5KA 1UM4H 2NTSP 3E6HB 4PJ7F 4JRXE 2GTWA 5EZJA 2DQJH 4HUWA 5GGRA 1TDQA 1K8IA 2IPTH 3PWPA 1VPOH 1EMTH 3QRGL 4V2CB 3GSXA 5T1MB 2VLKD 1SYVB 3C5ZD 5JPNA 1HDMA 4OT1H 4XWGH 5DZLA 1CU4H 3NIFF 4HBCH 5TDPB 1PX4A 2FL5A 4HK3J 2P7TA 4U1GB 3UTQA 4U1MB 4MNGA 3V8OA 2D7TL 4OD1L 3M17A 1BJMA 3X12B 1MLCA 2ADJA 5AEAA 3VXME 3MV9A 4KKLD 1PQZA 4UQ3A 4N90D 3QUYD 4PJ5A 2R56H 3UYPA 3C8HA 3BDBA 3BEWB 3JV6A 2WIIB 3TGXA 4FQHB 4UMGA 3U48A 3GSNA 2Z91B 5ERWA 3M45A 3REVA 3IAGC 3QXAB 1F4YH 2Z93B 2R4SL 4P57B 4PRBA 2R69H 4L8SA 4MCZA 4NFCA 3ZDYE 4DW2H 5DJXB 2ZCLL 2QLVB 4U7MA 4POYA 5F6HI 3ZMRA 4PGEA 2HWZH 3T2NL 5CP7A 5I75C 3BJLA 1C5DB 1IEHA 4G7VL 2B5IB 4K3JL 2EDXA 5FOJA 4KTYA 5HYJA 2B5IC 1ETZA 3KHOA 1GPOH 4O9HL 5GRWA 4DGYH 3T3ME 5IB1A 4FFZH 2GEEA 3CFEA 5IVOA 3HZMB 5HHNB 3NA9H 3QDME 2GTZA 4XPAH 4LLWA 4EBQH 4JFHD 4MQXD 1P7QB 1P1ZA 4LBEB 3U0TA 3I6LD 5FA4B