4OKVA

Crystal structure of anopheline anti-platelet protein with fab antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGLIDPSDSETHYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARGGTYWGQGTTLTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords heavy chain of 8H7 mAb
publication title The crystal structure of anopheles anti-platelet protein, a powerful anti-coagulant, in complex with an antibody
rcsb
source organism Anopheles stephensi
total genus 45
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvA02
2AJZB 2RFXA 4XAKE 4TUOA 1AGCA 1B0GB 2NY4B 1CLZH 5IMLB 2X09A 5GRUH 1HOCB 1R24B 4X7SL 3RGVD 5CEZE 3VXRB 4MCYA 3MUZ1 3SGDI 3ESUF 3JV0A 1I9RH 3WFBH 2JIXD 2VLLA 3RGVA 4CMHC 3QDMD 2ESVD 3K2MC 4R4ND 1PY9A 3IDMB 1QFWH 4PJ7F 2WIIB 3MRFB 4MZ2A 3QDMA 1QQDB 4XX1G 2ESVA 2HFFB 4QTIL 2W38A 4UT7L 4NN5B 3RY5A 3RI5F 4KKBD 5JLZB 2WWMD 1RJLB 4ZYKA 1CFQA 2BRRH 5D5MB 3JWDH 5KS9E 1AR2A 1IZJA 4XVUC 3O6ML 1PKQB 3BKCH 4WI2A 4WHDA 2W9EH 1IEBB 3ZDZF 1DBKL 2LVEA 3CFIC 3IDUA 3MRRA 4I3SL 4MNGE 1EO7A 3REVB 3VXTA 3QQ9C 3HZMB 1K5NB 3I9GL 1I8MA 4I4WB 3SDYL 1FZMB 4U1NB 2A74B 1DUYB 2BOCB 3NH7L 1DP0A 2APXA 3K2UL 3GSOB 3MRMB 3LRHA 5J1AA 4J1UA 2R4SH 1KEML 4XNYL 4OZ4B 4Z0BL 1JHKL 4WNQA 1AHWC 4UTAL 5F7UA 3T0EB 4OLZL 5IQ9B 4KVNL 4V2BA 1R6VA 3WEXA 2G5RA 3X13A 1PG7H 4PLNC 3WSQL 3V4UL 4DKFH 3BXNB 3VFSA 3VFPA 1NAKL 4BH8B 4OKVB 3FHAA 1BOGB 3IS1X 2VDRH 1QSEB 1OP5H 1NC4B 3UP1A 3MXVH 3ULVC 5EU7C 1P5VA 3SKUD 1F3JA 1NBZA 5CEYB 2VC2L 3B2UC 1A5FH 4MXQC 4X80L 3VFTA 3CX2A 5D7JD 4KQ3L 2EYTB 1FNAA 2LAAA 4HCRL 3RX5A 2DICA 2NR6D 5D7JA 1E4XI 1U8HA 1RK0A 5DRXA 3SDXE 1QA9A 3VMNA 1K2DA 3WD5H 3PHQB 3OKOB 2I07B 1JF1A 5KVDL 4DOHB 4ZO9A 3AUVA 5D1XC 3WV0A 4GOSA 4LBEB 1ZGLM 5I18H 3L5WB 1P6AB 2X42A 3KJ6L 4Z7QF 1M05B 4FOMA 4NYLA 4HF5H 1QNZL 5HTSA 5IW6B 1CCZA 2B1HH 3SO3C 5I17B 1TVBB 4K94C 1OAUL 3UTPD 3G6DH 1GGCH 5ITBL 5DXWA 3DMMC 3KPLB 4AK1A 3C5JA 3LS5L 1KULA 4P2QE 4AL8L 5IVXB 2OR8A 1P5UA 4ZFGH 4F33A 4KXZI 1P7QB 2ORBL 4OV5A 3RVVC 1IAOA 5EOTB 1RJZB 1YEEH 4NC1E 5D93B 3BJ91 4I0PB 3O6LL 5I19L 3QH3B 4QLRA 1N64H 1OF2A 3MBXL 4PJGF 5AYQA 4KDTA 4L4VD 4PTTB 4AEFA 5HYJE 1FYTB 2H2PC 4N8PA 2BX5A 2W65A 1GPOL 4U3XA 3IU4H 4WUUA 2ITCB 5GRVK 2B4CC 5IESL 5F1IA 4CMHB 3DPBA 2OR9H 2MWCA 2FSEB 2YRLA 1KCKA 4Y1AE 1BF8A 1CFVH 2H2SD 3EJYC 5IWLA 2R29H 3PGCA 1FL5B 3OJVC 2HFGL 2H1PH 3ARDD 2OS7A 3L5HA 4FQHB 1D6EB 1P1ZA 4HLZH 3ARDA 3OKYA 4N0FA 1EZVY 1LEKA 5D1QB 5J06A 1Z5LA 5FCUL 4K8RD 2PYFB 4LKXA 3QO0A 1HZHH 1IBGL 4XT1C 2F9BT 4OZFA 1MLCB 4NNPL 2K1MA 2HWZL 4XTRD 4Z7WA 1KPVA 5HGAA 2XKUA 4DUWA 4KUCF 4J3UA 3WHE0 1GGBH 3IDNA 4XP5L 2GITA 2K9UA 3S5LA 5FM5O 3TPKA 3PIQA 3LCYA 3MOAL 4LSUL 2AXHA 3B83A 3CVHA 2X4SA 2PW2B 2OMBA 4XNXH 3EO9L 4RAUB 3QXVA 5LGJA 3SKNA 1DUZA 4J3OC 4YPGB 1A1NA 1AHWB 1YQVL 5JDSA 1HH6B 1EEYA 3QZWB 3S3SA 3QO1A 4G6JL 2BHYA 4Y4FA 5F6HI 5KOMC 1QKZL 4FQXD 1F6AB 5CLTA 5A16B 3JWOH 3CAFA 3NACL 4PV8B 2ARWA 4RWYL 2MMXA 4U2ZA 2WBJD 4OB5L 2QQKH 2N1KA 1N0LA 2VERN 4U2YA 4WWKC 1AXTL 2FGWL 4UU9B 2WUCL 1IE5A 1CN4A 2WBJA 2AK4E 2NY0C 1DFBL 3ARFC 2EYRB 3HC0B 1UB5B 2NTFB 2YPLD 1FVEA 5GJTH 4MGXA 1ZA3A 1A1MB 2H9GB 5IKCA 1PYWB 3GIZH 3AS0A 4LLAA 2EXWD 1AKJB 2YPLA 5ANMB 4Q97A 3U0WH 2VDQL 4PJFB 3L7EB 4BKLA 1I3RA 2XKNA 4XPGH 3S36L 5KN5B 4FXGA 2VDKL 1B4RA 3CDYA 3ULUD 4M7JL 1QVOB 1C1EL 5DUBA 5TE6L 3BWAB 1GL4B 4MD4B 1HKLH 2H6PB 1K8IA 1XCTB 1ADQL 5D1XB 3VGAC 1ZANH 5DJ8A 1ND0B 2W9LA 4HH9A 1F58L 1MVUB 4XPAL 3MJGX 4FQLL 4D9RD 2C3VB 3ZE1E 3T0DA 4OLEA 3DMMB 3BWUC 3BMWA 4C54A 4XXCC 1L9MA 3L3KB 4OGZA 4WJ5B 4PJ5D 5SV4A 1B4JL 4KMQA 5E94B 1FP5A 3PWJA 2X4OB 2KPNA 3MBED 3DSFL 1YJDC 1GHFL 2P8MB 5F71A 3VJ6A 3PP3H 4D0BA 5IIEA 4KJQC 2IBBA 3CVIL 4OLWL 3MBEA 4Y89A 2D0GA 2J5LC 4HW6A 4KQ4L 1OAZL 1I7RA 2D31A 3HC3L 4HPYH 4C56B 2QTEA 1UJTA 4ZTPL 2UVFA 1W8NA 1A1OB 4J3XA 5ESQA 3S5LG 5FV1L 5ACLA 1K8DA 4CUCA 3NAAL 5L88H 1I8LA 4I0CC 2QL1A 2B7DT 2H32H 1OTUC 4F2MA 1T5WB 2D4FA 5EFIA 2HLAB 5JXAH 4GAYA 4LPTA 1MREH 4WI5A 3ZYOA 4LU5L 4F37K 1NGPL 3WNOA 1PX4A 2V9QA 3Q3GB 3ES6B 4HH8A 1WCBA 4RX4D 1AGEA 1X6LA 4JREB 1S7TA 3CGTA 1ZHLA 4MXWH 5BS0D 4H20H 4RX4A 4L8DA 2NPLX 3OHXA 2C3GA 5IHZB 1IGYA 5GGSY 4PJDF 5BS0A 4TULH 4H25A 5CSZA 1RUKH 4NHUB 5I8OL 4FNLH 5AWNH 3ILPB 1YUHA 1NC2D 3B9AA 1T1XB 2BSSB 3KR3L 4DJMA 1ZLUK 3DUUA 4MJIB 2E27L 1A3RH 4PJ9D 2J6EL 3EYOA 4MA8H 4HJ0D 1NC2A 4X7TB 3T0XA 1ZGLB 5E99L 3RVUC 3UPCA 1V5JA 4V2CB 4PJ9A 1CGSH 2P5ED 2ENYA 2FCBA 2VDML 4XP6L 4ONHB 3FRPA 4MNQD 4HK3N 1IC1A 2IFFH 4NQSA 1DQDH 5E9DA 4WWKB 2WP3O 5I1JH 3CMGA 2ZCKH 4MNQA 3FN3A 5TE7H 1WAAE 2HG5A 3ARFB 2BOBB 1U91A 1CZ8H 3KHQA 3I3BA 4R6UA 3TCXA 4EUPB 1GJIA 4DN3H 5J6GB 2NY2D 4P5KA 3ESVF 2YD8A 4RQQB 2Z0BA 2EE6A 1QFWI 2CDEB 1YQ2A 1T2XA 3DVGA 3HMXA 1KEGH 4AJ0A 2NZ9C 4E42A 2AJVH 5T1DH 4PLOB 3ARYA 2YUXA 1CF8L 1T5XB 2DQCL 1M6OB 2YRZA 1P7KB 2Z8VC 2X9YA 3P9MB 3SGKC 2NYYC 3DV6B 1UC6A 1B2WH 4X5WA 3BRDA 4U6VH 3VGAB 1QFOA 4NZUH 4U05A 4HS3A 4ZOCA 1KTLA 5DF0A 3M8OL 3VXUE 3MLZH 3D3VD 1MFBL 2F54A 3BPNC 3LRSA 3KXFD 4ZTOL 1CGTA 1J11A 1FIGL 5GZNC 1JPGA 3KGRA 2HTLC 3D3VA 1KIQA 3BGMB 1G6RH 4JG1H 3KXFA 1U3YA 2ZOKA 1D5IH 1UZ8B 1CXLA 2DL9A 1TCRA 3MRIA 1G7LA 4S11A 5T5NF 2BSTA 5BRZB 3OTTA 1CXEA 1SQ2N 2Q8AL 3TZVD 3VFVA 2FB4L 3F58H 3V0WH 2FZ3A 2J5LB 4PRPB 4PRHB 3W39A 1GAFH 4PRAA 1MCNA 3QDJE 4IRJB 3H8NA 3GSNH 1X5KA 5F9JB 1CIUA 4ZUTB 1EEUA 4Y5VC 1TTFA 3TBYA 1WFOA 3U46A 3BGFC 3GMNA 3IGAB 2QSVA 3IAPA 3WMSA 2VLRB 4Z78B 3ZDXE 2GYSA 4LLMA 1NBYB 3GNMH 4JCLA 3E6HB 4RIRA 2DI7A 5I0DA 4MD0A 1MIEL 3V8CA 1MRDL 5DLMH 3P0YH 4Y4HA 1A2YB 4JFFB 4P5TC 1DEDA 3MRQA 3RWCB 5F88A 2CQVA 3FRPG 5MERB 4M4RA 2J2ZA 5C08E 1O7VA 3KLHC 2DQEL 5HY9B 3TV3H 4L5FH 3KPPB 3S34H 5EWIL 1KUMA 4MJ6A 1WTLA 1F4YH 5K33A 4H0IA 4NBYB 5FYKH 4RMRA 4G7VH 3AGVA 1OQOA 5IJVA 5E6ID 1QD0A 2EIDA 2W91A 3IJHB 1GC1H 5J6HA 4JQXC 1QEWB 2G75B 4JFOA 4Y2DD 5E6IA 5A3IC 1MRFH 1QBMH 3EDDA 5CKAA 1IGMH 1DN0A 4JO1H 4NCDA 4G80B 4Y2DA 2ADJA 4RNRB 1JGUL 3FT4B 2DD8L 3QUML 5C6PB 3ZZ1A 3FKUS 1I7UA 3CFBA 4ZO8A 2V6HA 4WI6A 4L29B 4HMEA 1MCSA 1Q0YH 3CMOL 1CXHA 4X6DE 2VLJE 4ZFZA 2J1KA 1N8ZA 1Y18B 4MX7A 1EGJL 5C7XH 3V0VB 4FRWA 5T33L 3P30H 5EN2B 1NEZA 3VG9C 5F7LB 5IFAH 5C0CB 4HULB 4NQXA 4TOYL 3SY0A 4ZFOA 3VXOA 4U6TA 1I9JH 1OD9A 4XVJL 2P42B 2IH3A 2O5YH 3L95B 4R4BB 1UWGL 5BVJB 1J0ZA 4OLYL 2W0KA 3MO1B 4NKOA 5FM8A 5K9KB 5DJYA 1C16A 1QSEE 4G6KL 1OB1B 4WGWB 4PRBB 1CLOH 1L7IL 4KK6D 5I1KL 2BVPB 5DMGD 1VPOL 1CLYH 2UUDH 1T04A 1MJ7H 1F11B 2AQ2A 1QRNB 3PP4H 2CRYA 2LFGA 5LG1A 3SDAD 2ITDB 4PJXA 3WYRA 3HCVA 1JFQL 3LKOA 4OGYL 4NFDA 4Z7WF 4Q9QL 4V1DB 3QEGL 3NMEA 5DEZA 3BPNB 3D18A 3S37H 3L3IA 1NCAL 1VEPA 3D48R 5EC1A 3CSGA 3DGGB 4XCFL 5EH1A 4Z5RB 1FE8L 1IC7L 3HI6H 3QCVL 4DOHE 4CVXA 5J9PA 4K3DL 2XQBL 1YNTB 2NY5L 3SE9L 4NO3A 5AD0B 3ALWA 1E4WL 2BK8A 4LCCC 3HLAB 1CVRA 1TZGL 5L9DL 4TSBH 4JFZL 2BNRE 1RI8A 4WCYH 2Z35A 3C6LD 2R4RH 4Y5VB 5DMIL 3MJ9A 4KKAC 5MHSD 1C12A 2AEIT 1NFKA 3BGFB 2MCG1 3C6LA 4O4YH 1AGFB 3X3GH 1M7XA 1XGTA 4NWTH 3WLWC 1LQSR 4S1RL 2AJ3A 4QY8A 4DTGH 3K8KA 4HLZG 3UPRA 5FB8B 1CR9L 1U95A 5KS9A 3KPRD 3AS1A 4OD1L 4NNXA 3MRHB 1B3JA 4LASL 3NFSL 4GKZA 4LQFL 4ODXB 5EUOB 5IBTL 3KPRA 3GSVB 2L7UA 4GBXC 5TDOB 1IL1A 1JPTH 4OFVA 4MQ7A 4QRSB 5H8DA 5D96C 4YHPB 3FT2A 1NEZG 3GMOB 1EX0A 1N6VA 1C5BL 1EHLL 3SEPA 2OSLB 2OL3A 2YPKA 5E1HB 3LH2L 1N0XL 1CGWA 2O61B 3E0GA 5JW3L 1EBAA 4NQCE 3G5YB 1T7YA 1Z9LA 4LMQI 2R39A 4FMKA 3K74B 4Q0XL 4TVPL 8FABB 1JV5A 4EI5D 4HXAL 5TE4L 1OGTA 5DK2B 1XCQB 5GIRB 1AFVL 4EI5A 5JXEC 4I18A 4Z77A 1XGPA 4BUHA 4AQOA 1S5IL 1HEZB 5CIPH 4LDOB 3SE3A 3OKDA 1ZVSA 1I1AD 2Z31C 3LZFH 4KAQL 2V2TB 1JHLH 2CKBL 4YHYC 1QBAA 1WF5A 4TNWF 4HDIA 5ID1B 3SDXA 5CJBA 3U0TA 4HKXB 1MCKA 2ED9A 3GDBA 4YHNB 5HDLA 3LQMA 3F7VB 3UYRH 4NM4L 2FX7L 2X70B 4F15C 3K80A 1EJOL 2M2DA 4HGWB 5JNYA 3LKPB 3V5DA 5IVZB 3CFKA 1JGDA 5ANME 4JFDB 1MY5A 4C55A 4IOIA 1QYGH 5EU5B 4RBPK 3S9DB 4KHXL 3DURB 3D25A 5ESVA 5FK9B 4JJ5A 5LVEA 2EYSB 3O8XC 4E0RA 1CT8B 1RFDL 2WQ8A 3OR6B 4X9HA 4LCYB 3QUKA 5K9QG 4JKPL 5JPNA 3MRCB 1FZKB 1MFDH 1VFBA 2X6MA 3VE0B 4LEOA 1XGQB 2CH8A 4CW1A 2FJHB 3HNTH 5BV7H 1HHIB 3TYFA 4FZ8L 1U36A 4H1LA 2EE2A 3EOAB 5SWQA 4D8PA 4LCCB 5CBAB 4W4OA 5HYJA 3PL6D 2YS4A 2CIKA 4M4PA 5BOPA 5KG9A 5D4QA 4PB0H 2VDLL 5DZNA 2MCPL 3PL6A 2YBRB 3BH9A 5C0GB 3HI1B 4F7EB 4MSWB 1EVUA 3KLAB 4RZCB 5E03A 4Y1AA 3R4DA 5GHWH 2DQIH 4WHTB 5I73C 4XCCL 1GOHA 2DLHA 3UTZB 4ZOAA 3H3KA 4MA7L 2HJLB 4JRYB 5DI8A 5JPMA 2P47B 5GJSL 4WFHE 3KDMB 3L9RA 5IEKA 2VZVA 4HBCL 2FJFA 1K4DB 1LE9B 1ZT4B 2GUOB 4L8SB 1IILE 4JM2A 1GIGL 3BW9B 5BQ7B 3P11H 2W59A 2Z93A 3ARGC 1KFAH 4MD5A 3CFEB 2Y25A 3WXVL 2CLZA 3A6BL 1T89A 1RUAL 3W2DL 1S9WB 3OKLA 4GBXB 5CGYC 3V6ZA 3QCTH 4XPTL 4YHLH 4YXHL 4YDJA 2BSRB 1G0YR 2I9LA 4LOUC 2ZWLT 2VLMD 5ADPH 2WIMA 1MIMH 3WNNA 3BE1H 2PCPA 2X89A 1F4HA 1CE1H 2AV7B 4ZUUB 1KCSL 2XTJD 3GSRA 3TYGH 4JQVC 3NFPA 3T2PA 3TO2A 4ELKA 1NJ9A 3T1WA 1OSPL 3QXWA 4OCSL 3T0AA 3VDCA 1XF2B 2EDFA 3TBWA 2FEDD 3O6FC 5E8PA 3N1PC 2VXVH 4FG6D 4TSCL 5FYKD 1R3JB 1AP2A 3FL7A 3PWVA 3C09C 5T1MB 2GAZA 4I77L 2AK4A 5HI3C 4WFGE 4WDIB 2FRGP 3BIAX 2J4WH 1EERB 5BZWA 3IJSB 4P4KC 4UV4L 1H5BC 4R0LA 2V7HB 4G7YH 5ICXA 1A6UL 3CFJA 4I3RH 3QRFM 5I15H 1NANH 3WUWB 4N8CH 5FO9B 3KNBA 4YHYB 4PJEE 4X9FA 3BFOA 4A6YH 1IGCL 4YHKL 1R3KB 2AP2A 3O81A 4ZNEE 4G3YL 4M7KL 1J0YA 3HB3D 4H1LG 4MB5A 4RMTA 4WO4C 1N7ML 1MQKL 4MNHB 5HGDB 4HHAA 1C08A 4EQ3A 4LFHD 2APBA 4HZLB 3WFCL 4POUB 2EDJA 4F15B 2FO1A 4K3JH 4QCIB 1NLBL 4DVBB 4LSRL 4ELMB 5E1AA 1A9EA 3EHBD 4Y16A 1E4JA 2N4IA 4BYHA 4NRYA 1I7ZB 1HSBB 3G5ZB 4IDJL 1A7OL 2DQDH 4XI5C 2P45B 4G8GD 4J4PC 5T1KD 4OI8A 1P4IL 1Y6KR 1EEQA 3BI9X 3O8XB 5GZOD 4JGUA 3WIHA 4HWEL 2O5ZH 3MYJB 1Q1JL 1DZBA 2XRAL 2EECA 3QPQC 3GK8H 2XA8H 2HFEA 2ID5A 2CLRB 3RL2B 2OK0H 4U1JA 2Y6SC 4CJ0A 4EOWH 1S5HB 2WM0A 3O3AB 4CJ1A 1JNNH 2PYEE 2XPGB 5F1SA 3WFZA 5DA4A 4K9EC 4N8VA 5JR1H 2XKSA 2X4UB 4PB9L 5I1GH 3OAZK 1G7QA 3CZFA 2CJUH 5DJAB 5ESAB 5INDB 1KACB 4U7MA 1MCCA 1SJEA 3M45A 2VL5A 3QDGB 4LL9A 4Z7NF 1KCRL 1VENA 5I73B 3QFDB 1MCWM 1BWMA 3N85H 4PRPE 5DQDL 1KGCE 3OJDB 3P4OB 3RWGB 1AQKH 5GRZA 3KPNA 3FQNA 4N1CA 1JZ2A 1ZS8B 1DQML 3GGWB 1HDMA 1ZT7A 3ARGB 5CEXB 4NJ9L 3BO8A 3IXTA 2YD1A 4X8JB 2VLRE 1KT2A 1G7PB 1KJ2A 5KAQG 4XPFL 4PJXF 1U8OB 3GMLA 2BVUA 5D2LE 4TUKL 1W72L 3CXHK 3FN9A 5IJKA 4ZPTB 5DSCB 2G2RA 4P5MA 3Q5OA 4XWGL 3RGHA 3RIAF 5BOZG 3TJEH 12E8L 2YKLH 3OWEA 4NRXB 1B0RB 4BQBA 4DKAA 4TQEL 2X4PA 1IT9H 1OVZA 2XWTB 3UZQA 5T3ZH 3NTCH 1LGVA 3OAYK 4F9PA 3ULSB 1HXMB 1UXWA 4X98A 4EDWL 1JZ4A 2HVJB 4BQ8A 3RNKB 2XNAB 1I4FA 4JM4H 4ETQB 1NSNL 3O6FB 4X6CB 4ZUVA 4LFHG 3QUMB 4JO4H 1A7QH 1CU4L 2KZWA 4X99B 5FA4A 3QRGL 3TM6A 3C9NB 2PO6A 2VR9A 2PF6A 4GW1B 4R90L 1I3GH 2PTTA 3DYMA 3TIDB 1UADC 5IBLD 5IV2A 3TLRA 1OTSD 2BDNH 1HINL 1TZHB 1KB5H 1TXKA 5FYKU 4P4KB 4NHCL 1H5BB 4HIXH 3SGEH 3MLPA 3MLYL 2DJUA 4MWFA 3X3FL 3BQUC 2E9BA 4KHTH 3LV3A 4YHOH 3ZYIA 1UXSA 4UZGA 2OJEB 4JANB 5C07D 1F3DH 4P0DA 4MA1C 1I85A 3ZKND 4TRPH 4NQTA 1I1FB 3MGOA 4HZAA 5CP3A 1UYWL 1XGRA 1HCVA 5C07A 1F97A 3O2WL 4WO4B 2APVA 5GS0C 1T20A 3O4LD 1OD7A 3MRLA 3BPCA 1FAIH 5KS9F 5IBUG 3IETB 2A83A 2P5WB 5JW4Q 3I6KB 2FWOB 1YN7A 3IFLH 2B39A 3O4LA 5FV2A 1LO4L 5A1AA 5BZDB 3ILQC 1CK0L 2W1NA 3TA3C 3VXUA 5ETUA 1O5DT 2DQGH 4NN6C 1VHPA 1BZ9B 1N5AA 2Z8WC 1MHPH 2Y07L 1RIUL 3V6OE 3SE8H 3QG6A 4NO0A 3QWOB 1BAFH 2P8LB 5IR1B 4H0GA 4O2CA 4DCQA 3VFNA 2IPUG 5EA0L 1YYMH 3B9KD 3U36B 1QRNE 3VWKD 4NNYB 4IS6B 2QADD 4CNIB 1QR1B 1AQDA 3C60C 3QDJD 5FYLE 3B9KA 3VWKA 2DN7A 2Z91B 3CC5B 1G9NL 4M9OA 4O58H 3SKMA 2FIRT 3QDJA 3MRPA 4OZGE 4NIKB 4JPVH 1E28B 1XFPA 3LHPH 3U9PH 4S1SH 3CPLB 1TVHA 3A6CL 3PABA 4OZHB 5I74C 1ZA6A 2YK1H 1S9XA 1T1ZA 2GY5A 3G08B 3FN0H 4KJYB 4JY5H 2Y06H 2A6KA 3V6BR 4AM0A 2JELL 5BXFB 3VD5A 3MRNA 2XWJA 3SBWC 4FFYH 2QQQA 5C08D 1S7VB 1S7SA 3O3DB 2XZAH 1ZTXL 3SDXF 4PJAE 2OJZL 2BJMH 2AS5M 4Z18A 5C08A 3IVKA 3RUGA 4ZS6C 1S7RA 3WHE1 5J12C 1MJJB 1J0KA 3KPTA 5IB3A 4I9WD 1J9CT 1ORQA 4WU7A 1JNLH 1DL7L 4YHIA 3U1SL 3RI5K 1J05B 1G7MA 2GJZB 5GS1B 4KWUA 3PNWA 1OARH 3LN5A 3ARRA 1GSMA 3I2CH 5C09D 2DWDA 2YWYA 2A6JB 3K46A 3TBVB 5KW9H 3EFDH 4JG0L 5F89B 2R15A 4UOW0 3VW3H 3JTTB 1ITCA 4IIQB 1HH9A 5ICYA 2FDBP 2WUBL 2D0FA 4X6DA 4X4XA 1MEXH 1U6AL 2VLJA 5C9JA 4ZO7A 4UDTB 1I1CA 3F5WB 5HPMA 2JCCE 3FQTA 2R2HB 3HKFA 3O3BB 4MQXD 3VXSB 3WNLA 3QHFH 3U2SB 4YLQT 3VFRB 3V5HB 1I7TB 1BGXH 2HJKA 2VH5H 3UAJC 4BZYA 4UILH 5DJ6A 5F3BB 1FG2A 1KIUA 3BQUB 4JAMA 2FYYB 3PWNA 1OTTC 1U8IA 3OKEA 5DUPH 3TIEA 4MA1B 1KTDA 5EZJB 1J8HB 1JRHH 3QHZL 2VABA 3BEWB 4ZS7H 1K85A 3ARED 5HYQB 2CKBB 3HE6D 4ODSH 1OLLA 3KYOA 4L3ED 1BLNB 3AREA 3UTSD 2BMKB 2Q86B 1NQBA 4JM2F 4YC2C 3HE6A 3QCUH 3HRPA 5DJ0A 1ORSA 5H37H 2HH0H 4GAJL 4L3EA 4ZPVB 3VFGL 4APQD 5DD1L 4JHAH 1RZ7H 5JA9A 1RIVL 1P4LA 1Q9LB 4PGZA 3TA3B 5KSUB 1UM5L 4NN6B 3GBNL 4G8EB 3ZTNH 3AAZA 3V4VH 1OAKH 3LIZL 5E8EB 5IW1B 4NSKB 2V2WB 4HGKC 1HHHB 4D0CB 1RU9L 2VOTA 3CXHJ 5HHXL 1BVLA 3D39E 1SEBA 5DJCA 3U83A 2CK0L 1BIIB 1GOFA 2UWEB 1QLEH 3CVHL 5AZ2L 3C60B 2FATL 3BSZH 1FPTH 4LSTL 1K4CB 4LGRB 2XQYK 3OXRB 5EO1B 1T6WA 2BNRD 3FONA 4PP1D 3TN0C 3EO0A 3GEWB 4DAGH 4UQ3B 3L1OH 1K6QL 4NBZB 4JPIA 4L3CB 4QXGL 2BNRA 4URTB 3UTTD 2HKHH 2R23A 4ZOEA 2CLVA 3O0RH 1LO5A 3NN8B 4FQCL 4PP2A 4XGZA 5I74B 5MENE 3BOVA 3F7QA 3QUYB 4PJGB 5ISZB 3CLEH 5IG7A 2H3NA 4U7SA 3EBAA 4UBDC 4UDUA 4HWZB 2DRUA 4M1GH 3NCJL 1IAIL 1FV1B 3FB5A 4OJFL 5C0FB 2EDYA 3B3IA 4G9FD 3O2VL 3ORJA 2W0LA 2RBLA 4OF3A 4OFYD 4WI7A 3WFDH 4YDIH 2PXYD 2OQJA 3MROA 4JRXE 1NANI 4OFYA 5DQJB 1FFOA 3S96B 5J12B 4YBQD 2PXYA 4NZTH 5SWSB 2VR4A 2Y9RT 3SDDA 4X6EA 2G5BA 4BUGA 3B2VL 5IMMB 4NZRH 1BFVL 3JUYA 1R5IA 3ZE1F 3ULUL 5L7XL 3D6GA 2N56A 3MV7D 4ZUSB 1FFQA 2VJXA 5D8JH 4ZSOE 1OAYL 1P9MA 2Q3AA 3CDFA 3ECBA 3VFUA 4UUJB 5D72H 1NGWB 4NQCA 1JF5A 4EN3A 2BXZA 3IFNL 2F5BL 3D0VB 1C8PA 1KBGL 2E5EA 5C0IA 3DO7B 4K3GA 3O3EB 3SDCB 3D2UB 5L0QC 1BZ7B 1MCPH 4UNTA 1TETL 1G7IB 3CDCA 3RWHB 3CDGA 1NKRA 4KTEH 1IM9D 4AEHH 3F8UB 1ZXQA 1D9KA 3L3OA 4U1IA 1WQVT 4HWUA 1HI6A 3TJHC 3KVQA 5D6DC 1FVDA 1IM9A 1DE4B 2OZ4H 2J88H 5E6YA 1F4WL 3MR9B 2NMSA 1MI5B 1E27A 5L6YH 3WFHA 5IGXH 1HILB 5HHMD 2WP3T 3Q0HA 3OXSA 3OKNB 2CIIB 4L4TD 4I0KA 3S98A 2E7BA 1WBZA 4G42A 2V17L 1DVFC 1P2CB 4YHMH 3TFKD 4CKVX 3S4SA 1KJVA 3S36X 4L4TA 1HIML 3WJLA 4N90E 4F9LC 2XN9E 2DBJA 4ZXBD 1RK1B 3HS0B 1HXYA 4KZEH 2ZJSL 4YC2B 4WIQA 1U8KB 4JHWL 1YY9C 3REWA 1RD6A 2FX9H 5IF0B 2HJFB 4U6YB 1J86A 4R8WH 4UNUA 4MDIA 1DANT 3S3PA 5GGSA 4MAUH 4DUXA 1VGKB 3H0TB 5A2FA 1VCAA 3PDOA 3QISA 1MFEH 2EIZB 2WWMC 3GKWH 4ORGA 1A6VH 2J8OA 2E9IA 3KPQA 3MLUL 4DZBA 1ZOXA 3GKZA 3GMMB 1IC4L 1T0NA 5C2BH 4LCUB 2NW3B 3ISWA 3DRQB 1C7TA 2X4RA 4WRLA 3W11D 3VRIA 2CUMA 4LQ1A 5EO0B 3P73A 4HQQL 3MRKA 3H9SB 3QPXL 4RRPA 4FQIH 4HX1B 3TN0B 5D2NA 4QOKE 5I8EA 2BRRL 4L3AA 3W9DA 1UA6H 1NMAH 2AABH 2YD6A 3WN5A 2FH8A 3BPOC 1NUGA 3EO1B 1G9NC 3BKCL 4MS8C 5MI0C 4JFQB 1FL6A 1WAAF 1B9ZA 1QRKA 3HAEH 1RHFA 2Q7NA 5TF1H 4OFIA 1U8JB 5DHVB 4JY6A 3D69B 4ONFL 3QXDA 5BMFH 1MRCL 3FRUB 5IEHB 3LSOA 3U4EB 3PWUA 3R0NA 5DURD 5LJYH 3QUXD 4LLDA 1KCLA 3SGEI 3DUHA 5HJ3A 4XCEB 5BV7C 4GSDH 1S7XB 4G5ZL 1PG7L 1MAJA 5EIVA 25C8L 5D7JC 4ZUWB 4G6FB 3MUGB 3NZHH 1TQCC 4J6RH 3ZKXC 5FF6B 4E41B 2VDRL 2P1YA 2IFGA 4BSVA 4HC1H 2ZCLH 1W72B 1OY3B 2Q76A 3FQUB 4JFXB 5LAXB 5I6XC 1M7DA 1KPRA 1A5FL 4PJBA 5F7DB 1HYSD 1J10A 2KZ1B 4PJDB 3I6LE 3VRJA 4DN4H 2H41A 1EAJA 2BY2A 4YWGH 5L0QB 1VEOA 2R69L 1DQJB 2PETA 3DXAB 3W9EA 1MJ8H 2B0SL 1DQTA 2R2BB 1BBDH 3VFOB 5JA8B 4QRRB 3GJFA 3MGTA 4ZDHA 4NGHL 1NDMB 2BFVL 3EOBA 3RA7H 4BJLA 3HG1D 3EYVB 4MDJB 2W07A 2HT3C 4K3EH 1IAIM 4XMLL 1MY7A 5DVNA 4JHZA 5SWZB 1IKFL 1NMBL 4J8RB 5C0RH 4HG4K 3VD3A 3D0LB 2D2OA 4TUOB 1AGCB 1R5WA 2JLLA 3PDGA 4KDTC 3EFFA 4HUNB 4N9GA 4PJEA 3ZDXF 1NCWL 4KKLD 5HD8D 1WFNA 4MCYB 4X6CE 1WJ3A 5FECA 4GRLD 2VLLB 1DVFB 1JN6A 4ODTH 4K23H 2JB5L 1OOAA 5DHXB 2EC8A 4RRPG 5BCAA 2UZYB 2VZSA 5EU6D 5TQ0L 4XMKH 1OGAD 3QDMB 1VERA 1NGZA 4PGCA 3ZLQC 2ESVB 5IWLC 2F5AL 3TPUA 5JHDB 5EU6A 1OGAA 2BVOA 5F8RC 2H2SC 4YFLI 2C7UB 1MF2L 1CFQB 4XH2A 3ARDC 1RIHH 1WISA 2LAGB 4RA0C 4M1DL 2GTZA 1QSFD 3IS0X 2OR9L 2YSSA 3RVXC 3VXTB 1A7NL 1QSFA 2A77H 3G9AB 5MEQA 1VFAB 3EYUL 3C8HA 1U3HD 1JZ6A 2YWZA 4QO1A 1BD2D 5KVEH 2BZDA 5J1AB 5ACZA 4J1UB 2GK0A 1LILA 4X6DF 4WV1C 4WNQB 4P9MH 3BPOB 2X4QA 4Y4FC 1YMMB 5MI0B 1WWBX 5FGBA 5TDNA 3X13B 3H9HA 2F15A 1AE6H 2ADIA 3VFSB 3VFPB 2IANE 4BFEA 5C0AD 1T3FA 4LPCA 3BEVA 3HRZB 5I30H 1WIOA 4RSVA 5D7KD 4ZFOL 4DFHA 1F3JB 4M02A 3P4MA 1LP9E 2YD7A 1IJ9A 3X14A 3VFTB 2UYLA 1HQRB 4OLXL 4YEEA 2P7TA 1JRHI 3JWOL 4RAVA 5D7JB 3GM8A 5KVFH 1U8QA 1TQCB 1U8HB 2JJVA 2RCSL 4MLSA 1RK0B 4NCC1 5D2LA 2EXWC 3ZYZA 1INQA 1D3CA 2AEWA 2VXQH 5DRXB 3ZKXB 4Q9RL 3T4AA 1QA9B 4HPOH 3RX8A 2AI0H 1KB9K 3RDTD 1Z3GH 1LDPH 1YNKL 1JF1B 1N2RA 2Y36H 2YOCA 1UENA 2ZUYA 4MA3A 5I6XB 1ULVA 3RDTA 3GMRA 4NDMA 3EIFA 4NYLB 3EAKA 1ZLSH 1V3LA 3GJEA 4DZ8A 3BD4A 1JBJA 4N9OB 4EZMA 3C5JB 5FYJH 1EMTH 4UT6H 4Y4KD 4F33B 4P3CH 4GH7B 4XB8A 4WHCA 2J8UA 3HZYB 2GT9A 3LN4A 1IAOB 4JO3L 1HKLL 1LHZA 1FLTX 4RISH 4PLJD 1UVQA 1MAML 1OF2B 2O5XL 3JVGC 5DO2D 3J8F7 4O2FA 1SY6H 2V5TA 4IDLA 5TQ2H 1C5DA 2W65B 4YQXL 4WUUB 4R7NA 4TVPE 1NAMA 5J0BA 5F1IB 2DM4A 3Q1SH 1FORH 3HNSL 3OG4B 2ERJC 2ICWJ 2MPAH 1NGYB 4NO5A 3UDWC 6CGTA 5F9AC 5HDOA 5D1ZD 3OMZA 1RHHA 1P1ZB 2VE6A 4TSAL 3ARDB 4K7PL 4N0FB 3WIFA 2R2EA 5D1ZA 3MOBL 1LEKB 1YEIL 1Z5LB 4P2RD 4HK0A 1MWAH 3BD5A 3QO0B 4LKXB 2DJSA 2A1WL 4DVRH 2Q87A 4OZFB 2JE8A 5L88L 2DWEB 4Z7WB 1KPVB 4R2GD 4BFIA 1YMHA 3IDNB 4X9IA 1CDGA 3VXMD 3S5LB 4S10A 3ARQA 4M6AA 3PIQB 4PLKD 3KPSD 4Q2ZA 2W60A 3MJ7A 3V79C 3CVHB 5JQ6L 3VXMA 4OTXL 3DVNA 4KK9C 5LGJB 3PXJA 1DUZB 3KPSA 3SKNB 3OKKA 1A1NB 4LPYA 4XRCA 5CJXA 2EDKA 5I1CL 1EEYB 3QO1B 1UH3A 4Y4FB 2HT2D 4KTDH 3QI9D 2GJ6D 2OTUA 2UWEE 1IQWL 1QBBA 4HT1L 3QI9A 2GTWA 1T2QH 3MCG1 1RUKL 1WC7A 2R0ZH 2WBJB 2XZCL 4GS7C 2R0WL 4MHHI 3ARSA 1UM6H 4XP9H 4PJAA 3QT2A 2ATPA 1FVEB 1ZA3B 1T80A 5DS8B 5GS2H 1EO5A 2UZIL 3AS3A 5IKCB 2CRIA 5ISZE 4NC2B 2YPLB 3DJ9A 4DQOH 3T77A 4EXPX 5HYSA 4ZAKD 3TVMD 1CGSL 3PGDB 1I8IA 4YPJA 4BKLB 3KYMA 1I3RB 1OCWL 2XKNB 4YDKH 3FOLA 2ADFH 7FABH 4ZAKA 1BM3L 1FH5L 2NY2C 4FXGB 2V5YA 4GAGH 2VUYA 2ZCKL 4KRNA 4P23D 4HS8L 1U2HA 1CXIA 4IRSC 5TE7L 3RTQD 5DUBB 1PSKH 4ERSH 1FYHB 1W0WA 1CZ8L 1K8IB 4P23A 2QR0A 3WDJA 5DJ8B 4YIQA 2C1OA 5F97E 2A73A 4HH9B 3OG6B 5LKNA 2NXYC 4DN3L 5C0ND 3DECA 5FGCB 3C87A 4WI3A 5EZIL 2JCCA 3OJ2C 4FFVC 5DYOA 4M7ZC 3G5XA 1TJHL 5T1DL 3A67H 1VGEH 2R56H 3RU8L 2EDRA 3VA6A 3PWJB 3L5XL 2DJ4A 4MHHG 3UO1H 1LK2A 1DBAL 2NLJA 3VJ6B 4D0BB 5IIEB 3BX7C 4O51A 3MBEB 1INEH 4HC1A 1A02N 4U1HA 1I7RB 2D31B 2KQMA 3MLZL 3CNKA 1RZKL 3BH8A 1QHPA 1MAKA 3RWDA 5IM7A 32C2A 3VI4E 5ESQB 5F6IC 1K8DB 1RV6X 4JG1L 4XVSH 2V5RA 4JDTL 3RVWC 3W82A 1MI5E 5D9SB 2ZCHH 4F2MB 2EC9U 2BVYA 3GMPA 5EFIB 1SEQH 4GAYB 4TNWK 2K7QA 4Y4HC 3WHXA 4KI5D 2B1AL 4UV7H 1ED3A 1WCBB 3FO1B 3L6FA 1AGEB 3QQNA 2WMPA 3D39A 5E2WL 4U0RC 3F6LA 5E2UL 3VMPA 1N5YL 1S7TB 3DX9B 1ZHLB 4KV5E 4OZIE 5CS7A 4L8DB 3OHXB 4PJBF 1IGYB 4M03A 3GNML 4NP4L 5BS0B 4H25B 2L0DA 1IGIL 1YUHB 3MV9E 1TLKA 4P57A 5HYSG 1KYOK 3B9EA 3DUUB 1UH4A 2QSCL 5D7LB 1BJ1J 2BHZA 5DTFB 1FNFA 1NC2B 3HAEG 5MENA 1BQSA 3S34L 4PJ9B 4AG4H 1Z0NA 2Q20A 3I3EA 4NKMA 5CUSH 4ZO6A 4ZOBA 2HFTA 4NQSB 3E6FA 3UJIH 2F53D 1MPAH 5E9DB 3MLTA 3H9SE 4PJEF 4MNQB 5I1IL 1GC1L 4R3SA 4GS7B 2F53A 1ZV5A 1E6OH 2HG5B 4XX1E 1U91B 1S7QB 4JRXA 2QBWA 4ETYA 1MRFL 3U7WL 3VFMA 5DRZA 1RURL 3OJMB 4OUUA 3UBXA 3WJJA 4P5KB 1PQZA 3V52L 4KK8D 4Y19E 4H26A 1PZ5A 2NY2B 5SV3A 3DVGB 4DK3A 4E42B 4ZSOA 2DM3A 4IRSB 4PUBH 1A3LL 5DMGC 1NMCB 4X5WB 4JPKH 3JV4A 4HS3B 1ZWIA 3VXQA 1LEGA 1DQLL 1WUNT 3BYYA 1KTLB 5I2IA 3DX7A 4AQ1B 4FMFA 3LRSB 2F54B 4HGMA 3TNMA 1SBSH 2AERT 4JVPA 5LXGL 3FTGA 1JPGB 1I9IH 2FNBA 3D3VB 1KIQB 1CLOL 1CL7L 3KXFB 2ZOKB 3KYKH 4M7ZB 5JZ7C 3WNKA 1TCRB 1CLYL 3MRIB 3Q2CA 1MJ7L 3OX8A 3ROOB 4PYHA 4JQIL 5I8KL 3C08H 3VFVB 3MZTA 1CGXA 2QQLH 5ECJE 2FZ3B 1JPFA 1OL0A 3WIIL 4PRAB 5GGQL 2EH7H 3Q48A 3DXAE 5F9WC 4YXKL 4X7CC 4N90D 2E9JA 3S37L 3QULA 4IRZL 4ODVH 4EVNA 3VWJA 2Y5TA 3TBYB 4LVOC 2XN9A 3U46B 3GMNB 5ALBL 2EEBA 3C6LC 1NFDE 4PJ8C 4LLMB 3H3BC 2IGFH 4LIQL 4LPUA 4RIRB 3HR5A 2ADGA 2E6PA 2P8PA 5EU4A 4WW2A 4Y4HB 3MUHL 1BQUA 3MRQB 2B8OT 4RGOL 5D2LF 5F88B 1KJ2L 4JO2L 4G6AC 3NA9L 4POYA 1WZ1L 1I8KA 4Q6YA 1CDUA 1N3NA 1SY6A 5HDQL 4MJ6B 4U0RB 5LBSL 1LMKA 1L4IA 1UH2A 3I84A 4O4YL 2ESVE 4OF5A 1CI5A 1HKFA 1MH5A 1Y6NR 3MA7A 5IJVB 5IQ7H 4DTGL 1KCUH 4XPBL 4HMDA 3IFOA 1VB9A 2GSIA 4ALAH 4QOKA 2P48B 5J6HB 4QF1A 3UBXG 4JFOB 3BP7A 4X5XA 3QIUA 3RNQA 5E6IB 3QJFA 2QHRL 3IDGA 3K1DA 4CRPA 4X6BA 1DN0B 2QEJA 1U93B 3BUYA 4NCC2 4XWOC 3ULVH 5DGQA 4PTUA 4QRTA 1NCDL 2ADJB 3RAJH 1I7UB 1RZJH 3L3GA 4GRWB 3CFBB 4FQ1L 4NPYA 1NGXA 3FB6A 4ZFZB 2NQCA 1IGTA 1N8ZB 4MX7B 4HV8A 4I18C 2OI9C 2GEEA 4HUVA 1NEZB 1EPFA 3N50A 1UGNA 2NY6D 4NQXB 3IFPA 3SY0B 1UCBL 4ZFOB 5ALCL 4M1CC 2IH3B 4JB9L 2A0LC 5C0DA 2WK2A 2OMNA 4YAQA 2WZPD 3DLQR 4O02L 3WKML 5KSVA 1WEJL 5DJYB 1C16B 2MFNA 4O2EA 3ARBD 4K94H 3NOIA 3B8YA 3M07A 3HTLX 3HUJE 4OCWH 2VAAB 1T04B 3ARBA 1Q72L 4UOW1 3MA9L 5DK0A 1LNUA 4PJXB 3MC0A 1BMGA 3HCVB 4TPRL 2GHWB 1IEAA 3JTSA 3KPOA 2BRQA 2FD6L 3S88H 3D18B 1BBJA 5HHOD 3L3IB 3W0WD 2R9HD 5EC1B 3GSUA 4UIKH 1AI1H 4OZGF 3WE6A 2E6JA 4CVXB 3DWTA 4CAGA 3O41A 4NC1C 5DVKA 3HNVH 3INUH 5DZOA 5GISL 2B4CH 5D70L 4M5YH 3FZUC 4NO3B 4LSVH 4RMSA 3QIBD 5D7IE 1QFUL 4W4OC 4HUXA 1KC5H 1QYGL 3VCLA 5DD0H 2DI8A 5F9WB 3QIBA 3UTPE 1GGYA 2BHUA 5KJRL 2VZOA 9CGTA 3PL6C 4RFOH 1LO0L 4LVOB 1C12B 1RZKC 2VQTA 4NKDA 4PJAF 3UJTL 5MEOA 3VXRD 3C6LB 4PGBA 1NCBL 4PJCE 1XGTB 3OPZH 5IMLA 4P59L 5D71H 2AJ3B 5FYJU 4LSQH 5EG6C 4QY8B 1YECH 3QUZD 1NUFA 3LS4H 4LCIH 5FHAH 5HGGS 4P2OD 1CQYA 1DLHA 4DGYH 5EZOL 3PE9A 1U95B 4MAYC 4QHKI 5F72S 4FABH 2V7NA 3QUZA 5KS9B 4JM2C 1ZLUH 4P2OA 4L4VE 4NNXB 5D7SL 3IXAA 4KMTL 1OAQH 1QQDA 1T89C 3KPRB 4EBQH 5GS3A 3VH8A 6FABH 4QRPD 1XR8A 3BJLA 1IL1B 4MNGB 4MQ7B 2Z4QA 3S7GA 3FT2B 1DDHA 4QRPA 5LCVH 4I2XA 1SYVA 1V7MH 5TH2A 5I76B 3EUUA 5FO7A 1A6WH 2OL3B 2YPKB 5IUSA 1YEHL 5E2TH 4CBPA 3R06A 1QR4A 2F19H 4KY1H 4PRDA 5JW4N 4OLUL 5ICZA 1J18A 5FHBH 2AQ1A 2JCCF 2FECL 2GIYA 3HZMA 3L3HA 1EH9A 4I4WA 4LARL 2F8OA 1DUYA 2BOCA 2QQNH 3S97C 2IANA 1JV5B 3ME0A 3LEYH 3DRTA 1OGTB 3T0ED 4EUPH 2FIKB 4NN7C 3MREA 2XI9A 3RKDD 1MIML 3BE1L 4I18B 1H3PL 2OI9B 4Z77B 3IKCB 1LP9A 1M7IA 1QSZA 4K2UH 3VG0H 5JHLL 5DT1H 4LGPB 2DBLL 1FRGH 4R0LC 1OW0A 1YEJL 1AD9B 3OKDB 1ZVSB 2SEBA 3SJVD 2VXSL 1FVCA 4R26H 4HDIB 4GMTL 3SDXB 2YR3A 3U0TB 3BISA 4QHNB 4OQ1A 3SJVA 3O45A 4GAFB 3MYZA 4KJWC 2VAJA 1NL0L 2BY1A 2IQ9L 4Z7UE 4YXLL 2DKUA 3I3DA 4OCLC 2IBZY 4ENED 5JNYB 3V5DB 5AZEH 4G7YL 3CFKB 1JGDB 2YPLE 5I15L 2AXJA 2PTUA 4Y16C 4IOIB 5AYUH 3CFCL 1KN2H 1ODAA 1YJDH 4RMWA 5DRNA 5H94A 2EDLA 3D25B 4OGXH 3MRJA 4CDGC 1NCCL 4Y0GA 5C2UB 4YX2H 5JPNB 5KOVC 1YDPA 5DD5L 5DR5L 1VFBB 5K93A 4GKOA 5CJOL 4JHBA 4C57C 1JIBA 4LEOB 3ULUE 4D2NA 4YFEA 4X0KA 4X7SH 4N0RA 3TYFB 1PLGL 2FBOJ 4H1LB 1P7QD 1UM4L 2CR6A 5SWQB 4KU1A 5GGTH 3VH8G 5IVXA 3RJQB 5HYJB 3KYNA 2X9WA 2CIKB 1P7QA 1JYNA 2NCMA 5FGCE 1S78D 4BZ2L 4D9RE 1A14L 4I0PD 4GG8A 3PL6B 4O9HL 4JN1L 5EOTA 3BH9B 4KPHL 3LKNA 4QTIH 2O5ZL 1UQSA 1BFSA 4Y1AB 2XXMB 4PJ5E 5JDJA 1FYTD 3MUJA 3BHBA 4WHYG 4YFDB 2IAMA 3SE4C 1NDGA 5DI8B 5JPMB 4EOWL 1MJUL 4F58H 3L9RB 5IEKB 4EDXA 5EBLA 5EU3A 1XH3A 5GQBA 2FJFB 2ITCA 3O6MH 4PBXA 4FFZL 1N6UA 4JM2B 1DBKH 4O5LL 4I3SH 4X7FC 1D5BA 1SMOA 2AW2A 2Z93B 4MD5B 5I1LA 2CLZB 2AK1L 3T1FA 2DMBA 3SDYH 3OKLB 3V5KA 3NH7H 3V6ZB 4WU5B 1KXVC 1R3HA 3K2UH 2A6DA 1QUNA 3BYTA 4YDJB 4XVUD 1KEMH 4XNYH 2I9LB 4Z0BH 3KAAA 3N85L 1JHKH 1SVCP 4UTAH 5T5FL 4QWWC 2PCPB 1RZIA 5M7QA 1T7VA 3QQ9D 1AXSA 5CZKA 1MCJA 1NLDL 4IOFC 3FO2A 3V4UH 3WSQH 3NFPB 2NY3C 3QIWA 5EORL 3TO2B 3D1MC 1FNLA 4F9PC 1NAKH 3MCKA 1NJ9B 2AJYL 5SX5K 3GI8H 3BIKA 3RPIA 4B0MM 2X4NA 3TBWB 5I1EL 3LQAL 2E8YA 5BS0E 5E8PB 1JGVH 1FNSL 1AP2B 4NN7B 1GZPA 4X7EC 2GAZB 2AK4B 2G60L 2PO6C 4X80H 3QQ3A 4H8WL 4LNRB 3TJEL 4POZC 1KOAA 2PNDA 5BZWB 5IT2L 1XGUA 3NTCL 4PV8A 4H88L 4R0LB 1TCMA 5ICXB 3CFJB 5ID0A 3LEXB 3ULVD 5DDHA 5JIIA 4OD2A 3KNBB 4P9HL 1I85C 3B2UD 1PAMA 3KS0H 1IAKA 2P5EE 3ZDYE 5T1LA 1RUML 1BX2A 5KVDH 4LRNL 3H6JA 3TO4A 1Z2KA 4M93C 5FUOL 3OGOE 1A7QL 1UB5A 4TVSa 1AKJD 4HHAB 3KJ6H 4F7TA 1C08B 5CINL 1QNZH 2KDGA 2BDNL 1AKJA 5ITBH 4HIXL 1UKTA 3GSWA 5E1AB 1A9EB 4PJFA 3LS5H 4ONOA 4AMKH 4AL8H 4Y16B 4NRYB 2ORBH 4LHUD 2FO4B 1XIWC 1B6UA 5JORA 1XCTA 3BP6A 2XXCB 4LHUA 3NCYS 2HN7A 3O6LH 4GG6E 1FAIL 5I19H 3DMMD 3OF6D 1KLUB 3MBXH 2HFEB 3CSYA 4U1JB 1LD9A 5E7FA 2IMNA 4OIAA 3DMMA 3VWKC 3OF6A 1GPOH 3G6JE 3P2TA 5IBUB 4N8VB 4HXBH 5IESH 5F7EL 2DQGL 4NFBA 2MNUA 1OP3K 2ICES 1CS6A 3CZFB 3SE8L 3D3VE 1ZT1A 4ORZC 1SJEB 4UB0L 3S35L 2EH8L 2VL5B 2HFGH 2COQA 4C56D 1UEMA 2H2PD 1ZAGA 3TCLA 3P40A 2NY4C 2YZ1A 1UFUA 1ONQA 3JV5A 4C56A 3K4AA 3UC0L 3GSQB 4U1GC 1FFPA 3E8UL 1A1OA 5DFVC 5F9OL 2RAMA 5FCUH 1I75A 1MCOL 3C5ZC 1IBGH 3KPNB 4JPVL 3EJYD 4Z7VE 1M71A 2HWZH 1HDMB 1ZT7B 3WFEH 4NOBA 3SO5A 3WS3A 5IFJB 3E2HC 3BO8B 3S3JA 3IXTB 1T5WA 4QGTA 3HPJA 4XP5H 1KT2B 1KJ2B 5CKGA 4OZIA 2R0LL 5EBWA 3MV9D 2JJWA 3MOAH 4LSUH 3GMLB 2V9RA 3EO9H 4IJ3B 3SOBL 4FFYL 2P44B 3MV9A 2G2RB 4P5MB 1YQVH 1X5LA 2D7TH 4G6JH 3IDXL 4KFZC 1QKZH 1U8PA 4NQUA 2D03L 2BJML 2E3VA 2X4PB 3NACH 1FN4A 2NY3B 4RWYH 3KJ4C 3LY6A 2VTFA 4OB5H 4KZDH 1JMZA 1UXWB 4X98B 1UACH 1L9NA 1RULL 1D6VH 1AXTH 2FGWH 4MJID 2WUCH 1G6VK 3I50L 1I4FB 1T1XA 4HIIA 4RGMC 4ZUVB 1I1YB 3NIGE 3L5IA 1JYXA 5FA4B 1MCWW 2PO6B 4X6CF 5E8DH 2A9ML 2FL5A 4N0YL 2PTTB 2FBJL 5IV2B 4Q6IA 1DBBL 5EULV 4KRLB 1FAKT 4WWKD 1H3XA 1KTRL 3JXAA 1OPGL 2VDQH 1KXTB 4MWFB 3QWRA 4R4FL 4LHUG 2NY0D 3LV3B 4OF7A 4Y19D 1UXSB 4GRWE 4YNYA 3S36H 3ARFD 2VDKH 4WWKA 3GRWA 2ICWA 4M7JH 1C1EH 3MGOB 4RBPH 4OT1H 1JF6A 3DHJA 4Y19A 5TE6H 1XGRB 4XC3H 3ARFA 3MV8E 5C07B 1AD0A 1LVEA 3QEUA 4M93B 3BRGC 1ADQH 2AJXL 4JCMA 1T20B 2WW8A 3MRLB 5LQBL 3BPCB 3AREC 4JVWA 4D94A 2EO9A 4LLYA 3DBXA 2A83B 3NCBB 3MLRL 3HE6C 1F58H 4RMUA 4XPAH 4FQLH 4EJ1C 2K7PA 3KPMA 1YN7B 3O4LB 1CXFA 1CDYA 5J6GA 3RWEA 1EFXB 1CD8A 3VXUB 1DBMH 2DOCA 5ETUB 1B4JH 4S1QL 3TP4A 1N5AB 3V7AG 4MYWB 2DAVA 4NO0B 5KANI 3DSFH 1GHFH 1V8HA 3TH4T 3DV6A 1F3RB 1QACA 5A2KH 4O2CB 4DCQB 3VFNB 3AM8A 5F9DC 2DYPA 4OLWH 4KQ4H 1AQDB 2DQTL 1TQBC 4OLVL 2HH0L 2F58L 3HC3H 3B43A 5E08L 5F7WC 5KSAD 3FFDA 1J8KA 4ZTPH 3VWKB 3R0MA 1Q9WA 3SKMB 3QDJB 1SJHA 3MRPB 5KSAA 2ZOLA 5BRZD 3Q6FA 4PP1C 2XY2A 3QG7H 4B5EA 1TVHB 4YDVA 4KJQD 4D9LH 3PABB 3FCTA 1ZA6B 1KLGA 1GGUA 1T1ZB 2C26A 4PRHD 5BRZA 1LP9F 2B5IC 4PGEA 1NFDA 2VDPL 2VXUL 2VLKD 4AM0B 1AR1C 4PRHA 4LU5H 4XPHL 1NGPH 3BSZL 1TENA 3MRNB 1TITA 5IMOA 4U1GB 2VLKA 2FX8L 1S7SB 1OTUD 3QQ4A 2CXGA 3C5ZB 4U31A 5C08B 3IVKB 3LRGA 4FTVE 1S7RB 1RMFL 3DNKA 5GGTA 2GKIA 1GCFA 4JZJA 3O0RL 2JIXA 2PXYC 3E2HB 5IB3B 4LSDA 4KRPC 4JFFD 1U8NB 1ORQB 4WU7B 3SDDC 1U8LA 5MHSE 5I8OH 1YPZA 4YHIB 5FKAA 4KJPD 3KYAA 4JFFA 4JRWA 2BXYA 4LKCA 5IOPA 1G7MB 2J6EH 1OWRM 1BQHA 2VWEE 5E99H 1KG0A 5D1QC 1P9MC 1A6ZA 1BHGA 3PNWB 3LN5B 2VSDA 3WNPA 4UAOC 1YY8B 4ZMAT 1VKXA 4EN3C 2FHBA 2VDMH 3KPRE 4XP6H 1RZ8A 3KJ4B 4YZFE 4HEPG 3PG2A 3CFDB 1T83C 1E6JL 2CO6B 2E7CA 3TBSA 4CU6A 1HH9B 4NM8L 4ZFFA 5ICYB 1B6DA 3AXLA 4IMLA 4RGMB 4X4XB 1D9KC 2VLJB 4X6DB 5C9JB 5ADOH 3RVUD 1GXEA 4OBRA 3FQTB 8CGTA 1JGLH 3LQAC 4M3KB 5JQHC 1AJ7L 1X6NA 3HC4L 5AG9A 5D8JL 2Z92A 4LVEA 4RNRA 1CWVA 5MP6L 1DANU 1GGTA 4GKSA 3Q5TA 5DJ6B 1FG2B 1FGNL 4PFEA 1NAML 1NBVL 5CILL 3OKEB 2QLVB 3TIEB 3I85A 2H26A 1KTDB 1F8TL 3UROR 2VABB 1CF8H 3VMOA 2DQCH 4OQTA 3V0VA 4P9HC 3BZ4B 3KYOB 3HUJA 3EW3B 1TMCB 3TFKC 3AREB 1RZJC 4YR6A 3HE6B 3MQIA 4PJIE 5DJ0B 1ORSB 3BD3A 3M8OH 4L3EB 1MFBH 5IGXL 2I9TB 1S9KC 1MHEA 3C6SA 1W0VA 4ZTOH 3O9WD 2NZ9D 1FIGH 3X11A 2BNQE 1OB1A 2YPVH 2ZKHL 3M1BA 3CUPB 3AAZB 2NYYD 2BVPA 3O9WA 5CP7A 3OAZH 3AY4C 3VRLE 1UT9A 4V1DD 3SGKA 5FYLL 2Q8BL 1BVLB 1WSST 3BT2L 3GO1H 3OAUL 5T3XD 5DJCB 2Q8AH 2FB4H 1DR9A 3SQBA 1BEYL 3PWLA 1FO0A 4V1DA 1YEGL 4PJHE 3H3PH 1TQBB 5GZND 1QPXA 2HTLD 2FX9L 5D7IA 2UWEF 1MOEA 4RFEA 3W11C 2HMIC 3FONB 1S9YA 5HGHA 5TGBA 3EO0B 2YA0A 3DGGA 2NW2A 4Z95L 3WN5C 3C8DA 1QBLL 2ZUQC 4JPIB 3BMVA 2I25N 4LHQB 5L2KE 2BNRB 3GKWL 1X44A 2DDQL 4YO0B 4WWID 2R23B 4I48A 4IOSD 2CLVB 3LB6C 4KRMB 1LO5B 4XGZB 1QFHA 4KKNA 1BQHG 2B5IB 1F45A 4PR5A 1M1SA 4PJCA 2H3NB 1FSKC 4X6FA 1MRDH 2VUOA 5CAYB 5MEPA 3P0VH 1BREA 1G0XA 3FB5B 5EZLA 3B3IB 3V2AR 2DQEH 5CJQH 1UA6L 5EWIH 4K7PX 4L4VA 2OQJB 3MROB 1RVFL 1FFOB 2WLYA 4QYOA 7CGTA 4CVZA 4YGVA 2PXYB 1S7WA 3SQOH 4KRPB 3OAYH 1HQ4A 2EDHA 4P5TD 3SDDB 3ALXA 2NX5D 3LMJL 2ZG1A 5DD3L 2KUTA 2G5BB 1CQKA 3NABH 5JW4M 1A47A 3KLHD 4P5TA 4XNZC 4P3DB 1R5IB 2NX5A 5GPRA 4PRIE 1FL3A 2CDFA 1JWUA 4M8QB 3ECBB 4Y5YA 3VFUB 2DD8H 3QUMH 4NQCB 4UAOB 2YA2A 4EN3B 3LKQA 1JUFB 4JREC 3U7YL 3OKMA 5C0IB 3CMOH 4XBEL 1EV2E 1J1PL 3CK0L 4M48L 3NZHL 3ZTJG 4IMKA 5A3ID 1EGJH 1NUDA 3T0VA 4UTBL 1DTUA 1D9KB 3L3OB 4U1IB 5T33H 1HI6B 2Q7YA 1A64A 3HPLA 1FVDB 1IM9B 2DM7A 3GI9H 3FOMA 5C70A 2VLME 4HC1L 3VI4F 1JI1A 4XVJH 5BVPL 1E27B 1UWGH 3WFHB 5KVGH 2XTJE 1X4YA 5CBEA 3OXSB 4YWGL 4G6KH 3C2AL 4DK6A 4FQXA 5HHMB 1L7IH 5I1KH 5F8QC 1VPOH 1LWRA 2ARJB 3IDJA 4G42B 3EYFA 3S4SB 2C3WA 3V4PH 1KJVB 5HD8C 4M62L 4WI4A 2VDNH 5FYKE 2IH1A 1HXYB 1JFQH 2IPTH 4OGYH 4HKZA 4OI9A 4Z7UA 4JR9H 4Q9QH 1QG3A 1SHMA 5E8NA 3REWB 2M26A 1JZ3A 5C0RL 1YNLL 5ID1A 4KV5F 1NCAH 1CD0A 2DS4A 4OZIF 5GGSB 3SGJA 4HKXA 4XCFH 3PDOB 4G6ML 1EHXA 4OM0L 3UJJL 1GYAA 1IC7H 3QCVH 3F7VA 4K3DH 1U92A 1VFOA 3JV6A 2XQBH 1A9BA 2H8PA 2X70A 3KPQB 5E4EB 4DZBB 5IB2A 3SE9H 4K9EH 1AGBA 5TDPA 4AT6A 2UY6A 4NT6A 1E4WH 2X2YA 4XMKL 4U3CA 4EIZC 2NZIA 2X4RB 1TZGH 4I8DA 3VRIB 3QNZA 2AEQH 1JK8B 3P73B 2I5YL 4JFZH 4KDWA 1N4XL 3ZE0E 3MRKB 5EBMA 3TH3T 5DEGA 5IVOA 5I8EB 5DMIH 3WN5B 2ZUQB 1KENL 4G8GE 5FGBC 4LLWA 1FL6B 4S1RH 4S1DC 1AY1L 4PJ5A 4WENB 4OUOA 4XBPA 1S7UA 4JY6B 4N5EC 2A77L 4LP5A 1CR9H 1FSKB 2YUWA 3QXDB 5C92A 2LU4A 4KKAD 4OD1H 1S8DA 3G5VA 3LSOB 1IGFL 4JY4A 3T04D 3GB7A 3PWUB 4IRJC 3NFSH 4LQFH 2YBRA 4AZ8A 2D7OA 5IBTH 3HI1A 4MSWA 1DQQA 3WLWD 5HJ3B 5F1NB 4JRYD 5DD6A 4GT7A 2X7LA 4P9ML 5DURB 3IT8D 2AGJH 4I3GA 1PDKA 35C8L 1C5BH 3MRDA 4RDQG 1EHLH 1ZHKB 3VGDA 1AE6L 1UWEL 2X5PA 3LH2H 1K4DA 1V7NL 4QXTA 1ZT4A 4GW4B 5JW3H 4PYGA 1UWXK 1FFNA 4XNZB 1A7PL 4GBXD 4BSVB 2F74A 4LIQE 4OF6A 2AJSH 2Q76B 2VKXA 1M7DB 4GBXA 1KPRB 2IALA 4TVPH 3RDTC 4PJBB 3DX6A 4HXAH 3VRJB 3ZKMC 3GUTA 5TE4H 4F3FA 1IEHA 3F7YA 1AFVH 1MCEA 5KVFL 1PX3A 5HHVL 3W9EB 1R3IL 4M6NL 3GJFB 3MGTB 3T2NL 2DTML 1S5IH 4HPOL 1KIPA 1A6AA 2DMKA 3EOBB 4M7LH 1T4KA 1MVFA 3GJFK 5FKPA 3WBDA 2HKFH 1JCKA 3VGHA 4KAQH 3CJJA 2CKBH 1QLFA 3SHSA 1XR9A 5GS0H 1K3IA 5DGRA 2R1XB 1R5WB 2PTVA 1NFDF 3EFFB 3DTXA 5JXED 2VQUA 4N9GB 4PLJC 4PJEB 1AO7D 5F44A 3FQRA 2P5EA 2VYRE 5FECB 1JVKA 4NM4H 1JN6B 2FX7H 3BAEL 3FT3A 1Z0MA 1AO7A 3GBML 4WTZA 2Z31D 1EJOH 4HJGB 4XP1H 4NBXB 2QV2A 2EEAA 2I27N 2Z31A 4PGCB 1NGZB 3WUWA 1F5WA 1IGJA 3V8OA 4KHXH 4OF0A 3TPUB 5EU6B 1OGAB 2BVOB 4XH2B 1RFDH 1SY6L 1YPZF 4O00A 1JP5A 3V6OC 5D1ZC 5HGDA 5FO8A 4NO2A 5C07E 3AROA 4OGAC 4GG6A 2F8VA 4FZ8H 4DGVL 2DLIA 2YSSB 1FORL 4M8VA 1H8OA 3O4LE 1QSFB 4HUMB 4LHJB 4HKJA 5MEQB 2PUQT 2XA3A 4PG2A 5I16A 3O8XD 3EJZC 1FDLL 2PYEB 5IB4B 3G6JA 2VDLH 2MCPH 3U30B 5KTEH 3UZEA 2GK0B 1OT2A 2BP3A 1CD1A 2VIRA 1J1XL 2X4QB 4Y88A 4XCCH 3AB0B 1EVTC 4LDEB 2KH2B 5GSRA 4DW2H 5TDNB 4MA7H 5GJSH 1KPUA 2ADIB 2IF7A 4Q9CA 4HBCH 3THML 1T3FB 3BEVB 1JPSL 4XMPL 1GIGH 2EICA 3GBLA 3HFML 4LLVA 3TZVA 3I6GB 3QDGD 5DZLA 3H7LA 3WXVH 3A6BH 4Z7VA 1RUAH 1TNMA 3P4MB 4Y7MA 5KZCD 1ZLVK 3X14B 5IHUL 3ARTA 1WBYA 2OM5A 2I26N 3HUJF 4X83A 4YXHH 5EO9A 1YEFL 2P7TB 5GGRY 2DLFH 1CDHA 3C8KB 5CSBA 4OIIL 1U8QB 4C59B 5B4MC 4N1EA 2IADA 1DEEA 5D2LB 1INQB 5CMAA 3T4AB 2ZUWA 3ARGD 1T2QL 5DHYB 3OZ9L 1KCSH 1JNHA 5DK3A 1ZS8A 2VZUA 4IHOA 5CGYD 3MLVL 1N2RB 1TJIL 3RUGE 1FZOA 4OCSH 4MA3B 1FBIH 3RDTB 3I02A 5KBNC 4LOUD 1U3ZA 4NDMB 5JMOC 3H7BA 4WTZG 1UJ3A 3STLA 1U8OA 4L1DA 3X12A 4TSCH 5LWYL 5DSCA 4OCXL 4DZ8B 5F3HB 3K3QA 4I77H 4I9WE 4BSWA 3WUWG 2UV3A 5D7IF 4YDKL 2FR4A 5EC2A 4LRIC 5A2LH 2ADFL 7FABL 4S0SD 4Q74A 4GAGL 2BVEA 4UV4H 1OSZB 1MNUL 2W9DH 1A6UH 2J8UB 2GT9B 3FFCD 3V95A 4JDZA 4ERSL 2A38A 4U6HA 1HXMA 3DSNA 2Y7QA 3K0WA 1UVQB 3FFCA 5SX4H 4F7CA 2XICA 1IGCH 4YHKH 1CFTA 5HI3D 5C09E 3MV8D 4G3YH 4M7KH 1XGYL 4O2FB 4PJCF 5CFHA 1N7MH 1MQKH 1C5DB 3C9NA 2X1QA 3MV8A 4P4KD 5I1HL 4R7NB 2VN7A 3WFCH 1NAMB 5ELIA 3TGXA 1NLBH 3OB8A 3RWFA 1FNGB 2R56L 2X44D 4LSRH 4GXVL 1OLZA 3V6FA 2HYMA 2OJEA 4IDJH 4XAWL 3ZL4L 1A7OH 4GO6B 4NO5B 1LK3H 1I1FA 5I8CB 1RHHB 5HI5C 1P4IH 2P5WD 1F90L 2D4DA 2VE6B 3QP3A 4PGJA 3WIFB 4RMQA 4HWEH 5D1ZB 1Q1JH 2LE9A 2XRAH 3QNYA 4HK0B 2WV3A 1WZMA 1B90A 3I6KA 5TFSL 3MLSL 3LD8C 1KCVH 5C0JA 4BZ1L 3O6KL 2HRPL 5D6CA 3D9AL 4XI5D 2ZCHL 1WIUA 4L3EE 4JVUA 1IM3A 3UTSE 4BFIB 1YMHB 5B38A 4XVTL 4PB9H 1BZ9A 3SDAA 5DHVH 4OFKA 5FAAA 1J1OL 4Q2ZB 2W60B 3QPQD 4OZGB 2PR4L 3VXMB 5GSVA 3DVNB 3KPSB 3OKKB 4XRCB 1KCRH 3WS6A 1PG7W 4RDQF 2OTUB 2UZXB 2GY7B 5A2JH 3PQYD 4JFEE 4W6YB 3BKML 5DQDH 1FJ1A 3QI9B 1QTYT 4UINL 4KROD 1WC7B 3PQYA 2A9NH 4XCNA 1DQMH 2JK5A 3K8MA 4FTVD 4JJHA 1BQLL 4NJ9H 4PJAB 4Z0XA 1QOKA 4FTVA 2ATPB 1J12A 3BZFA 3UZVB 1AC6A 3UTTE 4TUKH 1W72H 4Z7UF 4DFIA 3HZKA 3T77B 3WJJC 1CYGA 4DKEH 5HYSB 1I8IB 5FXCH 3KYMB 3RY6A 3FOLB 12E8H 4PJ7A 4JKLA 1MPAL 4PD4K 4TQEH 4QHUA 5K9JL 1WZLA 1V3KA 4L8SC 5HVWA 4MVBD 4GLRH 1E6OL 2BY0A 3FO0L 1W0WB 4G9FE 3F65A 3ZE2E 4YIQB 4HEME 4IM8A 4F57L 2C1OB 2A73B 1NSNH 3ULUF 4MJ2A 2XWBA 1OP9A 2K3TA 3VFWA 3QRGH 1L6XA 2EKSA 2GCYA 2RB8A 2QHLA 4R90H 2DB8A 2H32A 2X40A 1A0QL 3MSPA 2JCCB 2J7LA 5DYOB 1MCBA 3G5XB 1CLCA 5F96H 2GK2A 3MLYH 4WFFD 3MV7E 4HUKB 1LK2B 2NLJB 5EUKA 5CCKL 1I3UA 4N0CD 4RWHA 2KKQA 3ARPA 2ATKA 4O51B 4PGDA 5FOBA 1UYWH 3VXSD 1SBBA 1Q94A 4XXDB 2BY3A 4GRMA 1EZVX 3BH8B 1SBSL 4YHZL 3RWDB 5IM7B 32C2B 5B38G 3VWJC 3HE7D 2E9WA 3RBSA 3BQUD 5HHPA 1LO4H 1SMAA 5IB5A 1CK0H 5F3BA 4PJIA 4UIMA 1WT5A 1J8HD 4HFUL 3HE7A 5LGKA 2BNQD 2P4AB 3BQUA 3GMPB 2E7LA 4YH6A 1RIUH 5GS0D 2BNQA 1I1AA 2X1XR 4HWNA 1U42A 5HHME 5C6TL 3WHXB 1J5OL 3U4BL 5BJTA 3BDYL 2R1YA 1RY7B 1ED3B 2ZG3A 4QTHA 5EA0H 2V2XA 4L4TE 4KGLA 3L6FB 4JGJA 3D39B 3TA3D 2VMFA 3LD8B 3BZEA 3MXWL 4PY7A 1CFNA 3UTOA 2AXFA 4PJHA 1G9NH 4WUKL 2D7QA 2R0KL 4YK4B 2R8SL 1RZFL 5L2KD 5CZVL 5C71A 1INDL 4P48A 3RL1A 3A6CH 4P57B 5LGHH 5F7KC 1GGIL 3FJTA 3QIUC 5L2KA 1MFNA 3IU3A 2DQJH 3C60D 3R1GL 3ETBF 4JKMA 1IKNA 4Q58C 5MENB 1GRWA 2X4TB 2A2QT 2JELH 2WSKA 4XHJC 5L2JB 3TWCH 2C4FU 1SYSA 4NKMB 2DQHL 1DSFL 1JJUA 3E6FB 3EDJA 1ZTXH 3MLTB 1R3LA 2OJZH 3TT1L 1M4KA 5D2NE 4R3SB 4G9DA 2F53B 3ZDYF 5C0EA 4OCMC 4JRXB 5DJ2A 2A6IA 4KKCD 3VFMB 5DRZB 1DL7H 3LPFA 3U1SH 4P4RB 2RGSA 4DUVA 4OUUB 3UBXB 3K4DA 3RAJL 4PRID 2KQNA 3SBWA 1G6RA 2ZPKH 3EYQC 1PQZB 1XZ0A 4ZS6D 1LE5A 4H26B 1PZ5B 4PRIA 4U1LA 5C8JA 2VQ1A 5SWSD 4ZSOB 4NKIL 3DV4A 3ARBC 3VXNA 3W5MA 4JG0H 4CN4A 4FA8A 4TTGA 5SWSA 3JV4B 4XP4H 4GG6F 3VXQB 1LEGB 1HHGA 2WUBH 3MTRA 1U6AH 5I2IB 3GSNA 5IMMA 3DX7B 4S2SA 1I1RA 3DVFA 4KUCD 3TNMB 4R7DA 4ZUSA 5J7CC 2XOTA 2BVTA 2XZQL 3FTGB 3G6JF 4UUJA 4K94L 5F93C 3VA2C 2EIEA 2WINA 4BQ6A 1EK3A 5IFHL 1I3VA 3O3EA 3OX8B 2XV6B 4PJBE 1K3ZA 1KELH 2DQUL 3QEQD 4FQQA 3RWIA 5ERWB 4LLUA 4BFBD 1CE6A 5EOQH 3QHZH 5IHBA 2VISB 1JPFB 5C9KA 3QEQA 3QIBC 3S88L 2ICCA 3UAJD 3QULB 4EVNB 3VWJB 2Y5TB 1NGQL 1U58A 1U8MA 2XN9B 4GAJH 4A2MA 3VFGH 2UY7A 1X5JA 4Z7VF 1OTTD 5DD1H 3R8QA 3HG1E 3INUL 1KJMB 1RIVH 2V9TA 4FZEL 2CIIA 3MLXL 1UM5H 2B4CL 1QP1A 4LSVL 4OZFH 3U48A 1TPXC 2XQYG 2JJUA 3LIZH 3VDBA 3HR5B 2ADGB 1P2CA 2P8PB 2WNGA 5EU4B 4DEPB 2P43B 1FC1A 1RU9H 5HHXH 4P2OC 1RK1A 1JL8A 3AMKA 5E00A 2CK0H 1EAPA 4RFOL 2MKLC 5CZXC 1S3KL 1I8KB 1N3NB 3CVHH 5KSBA 1L0QA 3DYPA 1TZIA 5AZ2H 4PD4J 2FATH 3DIFA 5FM4A 3BDBA 3MFFA 4CMMA 4LF3A 4G8IA 3OPZL 1MH5B 2D7MA 3RX7A 3MACL 4OBSA 4QRUA 5EU6E 1K6QH 3MA7B 1OGAE 4TYUA 1YECL 4QXGH 3IFOB 4QOKB 4QF1B 4XB7A 3PGFL 1A7RL 3BP7B 4X5XB 1XT5A 3QIUB 3RNQB 3NIGF 1N26A 3QJFB 4OCRL 4P49A 4KC3B 3IDGB 4G8GA 2FEEL 4W6WB 1EEZA 4X6BB 5T1KA 3BUYB 4CADB 4QRTB 3JBG7 6FABL 3S35X 5CLWA 4FXKB 1QSFE 1IAIH 5C0BD 3L3GB 4OJFH 3O2VH 4HX1A 4GKNA 4NPYB 1NGXB 2NY1D 1SM3H 5C0BA 1MCIA 2NY5C 4GRWF 5TJWK 1IGTB 5E24E 4HV8B 5FM5M 4HUWB 2F19L 4KY1L 4JFQA 1TDQA 5SX4I 4HUVB 1BD2E 5JIHA 4UBDD 2DF3A 3IFPB 1OW0C 1U8JA 3GRWL 4ZNCD 1HE7A 1YEDA 4E5XA 4FP8H 3B2VH 3M17B 4F7MA 1BFVH 5C0DB 2YUZA 3FRUA 3STZA 5IEHA 3ULUH 5IB1A 2QQNL 5L7XH 4YAQB 4P46D 1W8OA 4M5ZL 3LEYL 5KSVB 4FN0A 5E4IA 1OAYH 5C86A 4O2EB 2PW1A 4Z8FL 1T7XA 2GSGA 4P46A 5C0AE 2CO7B 4G6FD 2F5BH 1MUJA 1KBGH 3ARBB 43C9A 2XT1B 5D7KE 1C5CL 1TJGL 1LNUB 5DK0B 1NBQA 4NUGL 4E41D 2ILLA 1IEAB 4GMSL 3JTSB 3U0PA 3MLWL 3EKCA 2EEDA 5FDWA 5B3JE 1BBJB 3ZHKA 4C83A 5GS1C 1F4WH 1T1YA 3GSUB 4AIOA 4JFXA 5EPMB 3SCMD 2OX5A 4Y8DC 5F7DA 2X05A 5JW5A 3CLFL 3O41B 5ITFA 4XNMA 3SCMA 4NQVA 2OCFD 4WFED 4QRRD 2AV1A 3TJHD 5AZEL 1DQJA 2L4OA 5I75B 3U9UA 4IIQC 1WWCA 2V17H 4HUXB 4X4YA 4JFPA 4QRRA 1X5HA 3VCLB 1KN2L 1QZ1A 5SWZD 3QIBB 5E8OA 2I60L 2MJWA 1S9VA 2BSED 3DI2B 4NQDE 1YYLL 4MDJA 4HBQA 2ZJSH 3PJSA 5SWZA 3EOYG 4JHWH 3CSPA 2J8UE 4HS6A 2OP4L 4J8RA 4MQTB 3K8LA 3D0LA 2IAMC 2YRPA 4PGBB 1JWMB 2YMXH 1MFAL 4F7PA 5EIIA 1DVFD 4D3CL 2VDOL 2AAVA 5ILTH 2YEZA 3HZVA 4HIJA 2XIDA 1TPXB 3E3QE 5GGTL 1DLHB 1MELA 1DVFA 1NUNB 1IRAY 3F12B 3MLUH 2V7NB 3QUZB 4KUZL 1IC4H 4MJ5A 5EOCL 4F9LA 4P2OB 1YY9D 4AYFA 5JHDD 1XF4B 3IXAB 4YBLB 3VH8B 4J23A 4MCZA 1XR8B 2XZZA 4M6MH 4NRZA 5JHDA 4HQQH 2Z4QB 2VITA 3FO9A 4ISVA 3H42L 1ZLWK 5F1KC 3QPXH 4LLQA 2C7UA 4YZFF 2VXTL 1DDHB 4QRPB 4I2XB 1SYVB 5TH2B 1O7SA 5AEAA 4F58L 2X1WL 3BPLB 5FO7B 3MNWA 4WEBL 1T1WA 4GLRI 2V5MA 5CIPA 4CL7A 3V0AC 3R06B 4PRDB 2AQ3A 5ICZB 1E4XL 3QNXA 4LCWD 2J3SA 5JTWA 5K9OA 3QIWC 2QKIA 3G04A 3OL2A 4ONFH 3SKJH 3L3HB 3N1MC 1MCDA 4P2RE 1VFAA 4LCWA 1MRCH 1CGYA 3BN9C 3P4LA 3PHSA 1A6TA 2IANB 5E2VL 1H3GA 3DROB 1IFHL 5J56B 2LTQC 3DRTB 1YMMD 4MS8D 3MREB 3GHBL 2DQFA 3BKJL 3LQZA 4G5ZH 3VXME 3VU2A 1L6ZA 1LP9B 1M7IB 1YMMA 5DRWB 3KPSE 3QAZB 25C8H 3HMXH 5FUCE 2EXYD 3QBTB 4FQ2L 3QUYC 1RUQL 1ES0A 4OSUH 4OQTL 4PJIF 2SEBB 3GI8L 3HRZA 5JOFA 3PWPD 4CDHA 2GJ6E 1FVCB 4M43L 4TNVF 4G8FA 1ZE3C 4MXVE 2V5SA 3TO4C 1JGVL 3EYSH 3PWPA 3SJVB 3O45B 1EUTA 3SPVA 1HQRA 3VRLF 5HVHC 3BZDA 2R69H 1E0OB 1LEIB 2YUVA 4F8TA 1FGVL 1VFMA 2B0SH 2E7HA 2AEPH 4PJHF 4NGHH 1J0JA 2BFVH 4NJAL 5DRNB 5FUZH 2EO1A 5H94B 3KLSA 3WCYA 4XMLH 4JZOA 3MRJB 1FO0L 1F2XK 3PF2A 2BCKA 1DBJH 1IKFH 3HMWL 5T3XL 5GGVH 1NMBH 1YDPB 2BVQA 1OAXL 3H2WA 3TNNA 5DWUL 4X0KB 5DJXA 4FQJL 3SDCC 1NCWH 2R1WA 3O11A 1Q8MA 5C09A 4R97C 4MJ4A 5AUMA 4AMKL 2ZUVA 5HI4C 1H15A 4HAFA 2HT3D 3KYNB 1J7VR 2JB5H 4JFHD 2C5DC 4KK5D 4GG8B 1X7QA 3ARXA 3HZYA 4YE4L 5TQ0H 1JHTB 3LPWA 2F5AH 15C8L 3LKNB 4F8QA 5CJ5A 1ZEAL 1UQSB 2DIBA 3BHBB 3PHOA 2IAMB 5F7FA 3Q6GL 1MF2H 4WUUD 1NDGB 1XF1A 1MHCA 1MFCH 4EDXB 2G9HA 5EBLB 5EU3B 1XH3B 4M1DH 1ETZA 3RVTC 2HLFC 4HXBL 4KGJA 5TPWL 1A22B 5JOEA 1D5BB 5I1LB 1A7NH 1NGYA 3ZHLA 3T1FB 1EO8H 3AS2A 4LSPL 4J12A 3EYUH 4HIEA 4LSSL 5T5NG 3V5KB 1XF3A 4QHMA 1R3HB 2A6DB 3UTSA 5E5RB 3GSXA 3H9YA 3QXAA 1YN6B 3QFJD 2E8ZA 4APQA 4GRWH 1RZIB 3RVXD 4K8RL 4R96A 3QFJA 5CD3B 4QXUH 1AXSB 4PS4L 3FO2B 2DWEA 1P6FA 4KI5E 3MODL 3QIWB 1KXQE 3WFEL 4JFED 3NZ8A 4A6YA 3MCKB 4QHKJ 2IG2H 1VESA 3HI5L 3IDIA 3BIKB 3RPIB 2X4NB 3RY4A 1KIRA 4JFEA 5HHNA 1RUPL 2HT4D 4XNUL 2LTQB 2FLBT 4Y4FD 1GZPB 4WV1A 2ZNXA 4YJZL 3QQ3B 2IEPA 3UEZA 4FFWD 2D7TL 4OLXH 4NWUL 4JLRA 4U1KA 2NY7H 4Q6IC 4NQED 1FLRL 3R8BB 1XGUB 5E5UB 4ODHL 3UTTA 2FGZA 2RCSH 4HFWA 5ID0B 5KAQF 4NQEA 4Q9RH 4KZDL 3MRBA 5DDHB 4OD2B 1UACL 1N59A 1D6VL 4JPWL 1T03L 1QLRA 3N9GH 4RGNE 3ROLA 3OSKA 1FZJB 1IAKB 1YNKH 5T1LB 1BX2B 1DLFL 3TO4B 4U1SA 4N0UE 4W81A 3PV6A 5H35A 1JGEA 2F53E 3ARVA 1X5GA 5E8DL 4F7TB 3L7FA 2ZSWA 3CXDL 5DS8A 4G9FA 4AENA 1ZHBA 1X5YA 5HVHB 5KSBF 2XG5A 3PGDA 3GSWB 2DMCA 3LEVL 2B2XL 4PRNA 4BH7A 4ACPA 4ZQKA 4R9HA 4YEFA 3OBAA 3ZE0F 4OT1L 5DC9B 2MOVA 4XC3L 3AU1A 4JO3H 5B39B 3DX8A 5CEZH 5JORB 3JWNC 4GUPA 3BP6B 4AEIL 4LHUB 1DN2A 2HN7B 3AM8C 3UYPA 1MAMH 3B5TA 3RHWK 3MV7A 2O5XH 2GFBA 3GHEH 3SO3B 3CSYB 1LD9B 3MJ9H 4OM1L 3TESA 3ABZA 2AJUL 4ODBD 1T21A 4YQXH 4R97B 3KG5A 1SVZA 1DBML 5KSAC 1PBYA 4Z7OE 4X4ZA 3DUSA 1G7JA 3HNSH 2MQ0A 4WEUD 1ZT1B 1IAII 1G9ML 3T8XA 1EA9C 3TH2T 1FG9C 5I1DA 3KWWA 1ZHNA 3JVGA 5T3ZD 1IQDB 4OZFG 2YXFA 2IPKA 1T66C 3TCLB 1ONQB 4TSAH 4K7PH 4CU7A 1ACYH 1FFPB 3MOBH 4QGYA 3MCLL 1YEIH 2X10A 1PGRB 5BO1L 2A1WH 3RWJA 3RGVC 5A43C 2D9QB 1M71B 1U3JA 5JUEL 2OL3H 3QG7L 4D9LL 5D9SA 4JZJC 3WS3B 3HPJB 1UCTA 5CSGA 1ZSDA 5FYJE 4R4NC 4OZIB 3CSBA 5EBWB 3UDWA 4ZXBA 2VSCA 3EZ8A 2WAHA 5JQ6H 3DETD 4OTXH 2IQAA 1CLZL 5GRUL 1YEKH 3MV9B 4KJPC 1KB5A 5I1CH 4KKBC 3FO1A 3EDEA 1I9RL 4K7FA 3WFBL 1U8PB 5F7NC 3DX9A 1FN4B 4EQ2A 1IQWH 3WDIA 1R5VA 4HT1H 1QFWL 2XG4A 4AEEA 4NC0B 5DUMH 5J57B 5D7LD 5FIEA 2XZCH 3OB0K 4KK9D 2QJDA 2R0WH 4HIIB 2JKXA 5D7LA 1EUUA 1GVIA 4EI6B 1UG9A 2E6QA 5DTFA 3JWDL 2FL5B 3BP5B 4ZD3H 4OAWA 2UZIH 3QJHB 4PV9A 1OHQA 4Q6IB 2OTPA 1U9KA 2W9EL 5E9DD 3NCFB 3UTQA 3MPCA 1OCWH 4OD3H 1BM3H 1FH5H 3NIDE 4YNYB 4L8BA 2ICWB 4HS8H 2HVKA 2NY0B 4Y19B 3TBTB 5ADOL 4WGVB 1AD0B 2NNAB 1S7QA 3RJDA 3QEUB 2C4XA 3AFLA 3FHQA 2R4SL 1JGLL 4LLYB 3DBXB 5I0ZA 5ENWA 3QUXA 3KPMB 3RIFF 3FAXA 3T2QA 3RWEB 4DKFL 4IRSD 5EZIH 2AKRB 2NR6C 4NUJA 4MMZC 4Y5XA 3O9WC 1TJHH