4HLZH

Crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
b'DIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPWTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
molecule tags Viral protein/immune system
source organism Influenza a virus
publication title Structure of a classical broadly neutralizing stem antibody in complex with a pandemic h2 influenza virus hemagglutinin.
pubmed doi rcsb
total genus 46
structure length 211
sequence length 211
chains with identical sequence J, L
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH01
1S3KH 3TYFA 4LIQH 3WXVH 1U8QB 1AIFA 4Z7WA 3BP6A 3C5SB 4NQEB 2QQKH 2VC2H 4QOKE 2ERJC 4O2CB 5AYUL 1GRWA 2NY3C 4K3DH 3RWHA 2EXYD 5DUBB 2V5MA 1QQDB 4KI5F 4M9PA 4NRZB 1NUGA 4M3JA 2A1WL 3K4ZA 1T1WB 4RRPG 4F33B 3VFRB 3QO1B 1YNKL 4UQ2B 5JHDA 2COQA 2RGSA 2J1KA 3FTGB 4BUGA 1PFCA 3SDYL 2JLLA 4ZUTA 5C0CE 4PJ7A 3RWJA 1JZ5A 2A2QT 3P4NA 4MD5B 4R8WL 2M1KA 3O6FA 4NKIH 4Y8DC 1OGAD 1FYTA 1RURL 3QEQD 4CNIB 1E4WL 2Y36H 4X8JB 3J8F7 4S1RL 4PJBA 3K8LA 2NZ9C 3MV8B 2HTKD 2YA0A 2DYPA 4HZLB 35C8H 4MJIE 4FFZH 5DD3H 3OAYH 4DGYH 2BVYA 2KZ1B 1A7OH 5D72L 3L6FA 5TE7H 1JMZA 1LEGB 2MHAA 3WHE1 3KPPA 4OCSH 2F58H 3RWFB 3UROR 4TRPL 5DS8A 3G9VA 3OSKA 1G0DA 1QFUL 5HI4D 3T2OA 3GI9L 4JDVA 2IPTL 4MAUL 3BQUA 5DD5H 3VXUB 3KPNB 4KQ3L 4IBLT 3IDIB 3RY5A 3QFDA 2O61A 1AO7B 1RV6X 4JFFD 5KSBA 4M1CC 3FT4A 3O9WC 4I3GA 4QTHB 4CDHA 3RWJB 2Q86B 1T04B 3B83A 4FFYL 5IEHB 4UU9B 4UQ2A 1CFSB 2BXYA 5J8OA 4ONHB 2Z92B 5DT1L 3UC0L 1D6VH 3IXAB 3SDXE 3GRWH 5EOCH 1NGQH 3EOTH 3RA7L 4FQ2L 3LRSB 1FNAA 1ZA6B 4JHWL 4TTDD 4HQQH 3T0ED 3FQXA 4FQHB 4J3TA 4WTXA 3BRFA 1U8QA 4Z7WB 5F7EL 5EZOL 3P0VH 3S35H 3VRIA 1ONQA 4UNTA 4O5LL 4PR5B 2ARJA 3BT2H 5F7FA 2XKNA 4PLJD 3RGVA 1FORH 4LNRA 4BH7A 3WFEH 5DHXB 5BO1H 2CDEB 1T83C 4P57A 3PNWB 2C1PB 2PW1B 4XC1L 2P8PB 3K1DA 3HNVH 5IK3B 1MF2L 3K46A 4F3FA 5E4EB 3WFDL 5I1AA 5T3ZL 5E6ZA 3MR9B 4LBEB 3TC9A 3SCMB 4RGMC 5E00A 5ADOH 4KDWA 3ZDYF 4UIKL 3D0VA 3SJVD 3LQAL 1CK0L 3INUL 3LIZH 3VXRA 2OL3A 3LD8C 5DVMA 2GAZB 4WW2B 5J11B 3CFJA 4XMLH 5EBLA 2FRGP 2WBWB 5TFSL 4OCWH 3K7UA 3U0PB 4M7LT 4Y5VB 2NYYC 2JTDA 1C7SA 1Z6JT 5IESL 3DARA 1FPTH 3IFOA 1P4IL 2XZQH 4AQ1B 5KS9E 4JFXA 4YHIB 5I1LB 1FL3A 4URTB 5GIRA 1WVZA 5TGBB 1CCZA 1QNZH 3IJSA 3IJYB 1MCJA 4F9LC 3DVGA 4TYUA 1U91B 4O2FA 1D9KD 4JGUA 2IAMB 5TDOB 3TZVB 5C6TL 4CMMB 5HGAA 3QAZB 2QBWA 3ZHDA 4LP5A 4PYGA 2VXTL 5HHVH 1CL7L 2ATKB 5I1KL 2PO6A 3FCTA 4CN4A 1QSEE 4NQSB 1J0ZA 4RDQF 5FKPA 3GIVA 3MXWH 5EO1A 5IUSA 1EZVX 4NNYA 4M62L 3HPJB 1CFTB 3C2AH 2FGWL 4PJ5D 3FFCA 4HJ0C 1UXWB 2FJGB 2IQ9L 4FQ2H 2VDOL 1VACB 2DLGA 1MCEA 2A73A 3KHOA 3O81A 4FG6D 5T1DH 4KZDH 4JN1H 3NGBB 5EFIB 4GW4B 1H3PH 2JCCA 1FJ1B 3PGCA 1II4E 3MUY1 3I84A 3RPKA 3C5ZB 4XPHL 2ZCLH 4D9QD 3ULSB 5F1NB 5CMAB 4ZSOB 5LAXB 3KPRD 1I7RA 3CLEH 3T3MF 1VKXB 3MBEC 2BZDA 2P43B 5D7LA 2B0SL 1LHZA 5K9KB 1OGTB 1EO8L 1OQXA 2KPNA 3H3BC 2DRUA 4N68A 4L8DB 4UV4H 2V2XB 5EIIB 3LIZL 1CXHA 4XGZA 1AH1A 4UIKH 2CO7B 1DANU 4HDIB 1JPSH 4I13B 3VDBA 5TDPB 2HVKB 5FV2A 4AEIH 1UM6L 4K3GA 1TITA 2J8UE 4P2RB 4BZYA 1AGBB 2BNQA 2LVEA 4I0KA 3E6FA 1ZEAH 5DMIH 3HE6A 1A6TA 2JB5L 3HAEH 5C0IB 1UB6A 1A7PH 1AI1L 4QNPE 2CJUH 1JV5B 3VE0A 1AGBA 4IM8A 4XH2B 4DGVH 4NKIL 2IH3B 1ZLVK 4NQXA 4CL7A 5MEQA 5IBLD 5LVEA 4F7TB 4X5WA 5I71C 3C9NB 3EZJB 4NKDB 2CR3A 1U36A 4ORZC 4O02L 2V2XA 1PQZA 2J6EL 4N9OB 1OCWL 5D9SB 1HN1A 5HI5D 3G5ZB 3QISA 5TPWH 1NPUA 1CZ8H 1EJOL 3IKKA 3SO3C 1JNLL 1JK8B 5E70A 2CIKA 4DK3A 1HE7A 2OJZH 5IHZA 4RQQA 1S9VB 3P9LA 1H0DA 2DMCA 4M8QB 1MJ8L 5E7FA 5DRZA 4Z0BH 1A8JH 5L9DL 4P5KB 3PIQB 4JPIB 1AE6L 5GRVK 2Y7QA 4Z77A 1EVTC 4WI9A 5DSCB 3ISWA 4RRPA 5EO9B 3LS5L 4HXBH 3AREB 3ZKMD 4JM2C 1A7RL 4L29A 4XVSH 3EYSL 5GGQL 1B4JL 4HD9A 1GZPA 1UXWA 1VB9A 2Q76B 2VLLA 4OLUH 4XNQA 1CLZL 3VD7A 5I66B 2CKNA 5DR5L 1CDIA 2DQHH 5FGRA 5FO8B 3GO1L 3U7AA 4U6XA 5HDQH 1R3HA 1A2YA 2FHFA 3PL6D 4K8RC 5CAYB 3KYOA 5C0EB 3SO3B 2FX9L 4YH6A 2ZP0T 2K1MA 2X1QA 3LH2L 4LSTH 5JLZA 1JVKA 3QXUA 3B43A 4N5UA 3SO5A 4FMKA 1WAAF 1TJIH 1EDQA 5HYJE 2IQ9H 1Y6MR 3QIBA 2JK5A 5DEZA 2ICWJ 1S5IH 3GMRB 3REWB 2H32B 3V4UH 1U41A 5D7IA 4H5SA 1IAMA 2DAVA 3F12A 3CH1B 3SDYH 3MV9A 3H3PH 4G3YL 1YEKH 4YUEH 4PJGE 4YEFA 1LP9F 3QHZH 2A1WH 4Y1AD 3MV11 2BVOA 4I3RH 5J57B 4RISL 2DIAA 1F6FB 2EIZA 2FJHA 3OKEA 1NGZA 1QLFB 4C56D 3O6FD 4G80B 3FT3B 2EIZB 5GS1A 4K2UL 5BJTB 3SPVB 2JCCE 1JTPA 3NPSB 1J1XH 3MCLL 2CRMA 3VGBA 2VZUA 5E6ID 2V5RA 12E8H 1HHHA 1T7YA 3JWDL 3CX5K 5KSAA 3WE6B 3S37H 3F12B 4L3EB 2F53A 5I1AB 3JWDC 2JELL 3T4AB 3W11C 2P1YA 2EDLA 3VD9A 1NBZB 4HS8L 4JRYA 1QRNB 3NIDF 1G7PA 1T66C 2OSLB 4DVBB 1MVUA 2ZG2A 3VRLE 3ARQA 3PNWA 1P4LB 1JJUA 1BVZA 3EUUA 5MEPA 5EC2A 4LPWA 1MHHB 1RJYA 4LNRB 5DWUL 5GRWA 1RHHB 1WAAA 4KV5E 1NCDH 2ARJB 1MY5A 1TZIA 3STZB 1AGCA 5JIPA 1EV2E 1FRGL 5T1LD 4D94A 4MHHG 5CZVH 2FBJH 4HUXB 3AVEA 3QUZD 4JVUA 4FQCL 2JJUA 4LSRL 1MCBA 3GMLB 4NWTL 2WM0A 4F15B 5MENA 3T2PA 2OYPA 2BFVH 5GZND 2WP3O 1QFWM 1VFMA 3B9EA 3ILPA 1A14H 1BFVH 4H25B 1L0QA 5LKNA 5F21B 3L7FB 4JEGB 1P1ZB 1SVZA 1H0DB 3QXAB 3T4YB 2HJFB 4O51B 4QHMB 4JO3L 3P0VL 1LD9B 3QCTH 3MLWL 2O61B 1S7XA 5FA3A 2FX7L 1CDYA 4HWNA 4FQQA 4Y5XB 1XH3B 4JDTL 1XGYL 4NJAH 4BFBD 5EUOA 4I77L 1GZQB 1KJ2A 4JPKL 3FT2B 2GCYB 4I18C 3V5HB 1RUPH 4YXHL 2F8XC 2EC8A 3L6FB 4JG1H 1LVEA 4H0GA 1IGCH 4LQ1A 2WAHA 5J1SC 3EJYC 5SWZA 5B38B 3OHXB 5JOFB 3PP3K 4FXGB 1W8NA 1BHGA 3IETB 3ARED 5HHPB 1YEFH 1D9KC 2XTJB 1M05A 1D5BB 4PJBE 3BE1H 5IR1B 1YY9D 5TE7L 1YUHA 3ZE1F 2AJ3A 1SVCP 5DURD 3QO1A 4IOFC 1A4JB 5DVOA 4CVWA 1T2QH 4HC1A 1NC4D 2AK4B 1J0KA 5CP3H 2PYFB 5ICZB 2WW8A 3O2VH 4XC3L 5E99L 4YHPA 3RWIB 3NZ8A 1ZGLP 3MA7A 5T3XL 3BP6B 4EN3D 1BVLB 1WITA 4BQ9A 1FH5H 4FXKA 1UWGH 1AC6A 4KRPC 4LPVA 4MNQA 2D2OA 4WI5A 1S9YA 2NY4C 4A6YL 1OAQH 1A4JA 3NZHL 2NY6B 2DBLH 3C8HA 1YC7A 2VL4A 2BC4A 4NO0A 4PJ8A 4Y16C 2FJGA 2PYEE 5L8KB 4S10A 4GKZB 4QRQB 4JVPA 3TBVA 1K8IA 1CK0H 4Z95L 1VA9A 3LQAH 5DQ9B 1N6VA 4JFQA 4YXKL 3FQTA 1T5XB 5CJXA 4XVSL 4UTAL 4G8GA 3ILQC 1DZBA 3MJ7A 5JOFA 4U7MA 4O2EB 1OAYL 3LPFA 3KLHD 4U1SA 3WJJC 1NJ9A 4LGPB 4PV8B 3C60C 3HB3D 4AIXA 3GNMH 4ZQKB 3DVGB 3VA6A 2ADFH 3FT2A 3UCRA 1J1PL 3BQUC 3LS4L 1PZUB 3C5ZD 3S96A 2W9EH 4U0RB 3RZCA 5F7UA 1SEQL 1ZLSL 2CLRA 5F71A 1QFWH 1NUFA 3I02B 5E1AB 3TA3C 5LCVH 1MRFL 3FFCE 1RU9L 4QO1A 1U3HD 1S7QA 2FO1A 4WHDA 3BP7A 1C5DB 4WEUD 2Q8AL 5DHVA 3FO2B 4BQBA 2UWEE 3N85L 3KJ4C 5HHXL 2QQLL 5TQ2L 3RTQB 1FCGA 1ZHKA 5IIEA 5DMIL 2DM3A 1UWEL 2CUIA 4UINH 1S7VB 4MJ6B 1KJVA 1C12A 4OJFL 4WV1A 1XGRB 5EG6C 2UWEF 4D0CB 2EDHA 4TUOA 5IB3A 1FYTD 3C08L 1QFUH 3I6KA 2CDEA 5HVHC 2GJ6B 3PV6A 1D5XA 3H7BB 1G6VK 2H9GB 3X14B 3QI9B 4IS6B 3QUXC 3LPGA 3QJFA 2HT4D 2HT2D 1T1YA 1GOGA 4U33A 5ACMA 5DVKA 4NM8H 4NWUL 1I1CA 4HIJA 1NBZA 2X7LA 1KV3A 2J5LB 2Q87A 3WCYA 1E4WH 2Y36L 3QDMB 4HK3J 4TSAL 3BX7C 4ONHA 4OT1L 1CFSA 3D18B 3MRQA 2IFFL 4Z0XA 3GM8A 4PJIE 3WBDA 2Z8VC 3HPLB 1QLFA 3B8YA 4LK4A 4QY8B 1P6AB 3FB8B 3EGSA 2DLIA 3EW3B 4C58B 4MA7H 1FIGH 1KTRL 3CU7A 3MRGA 2QQQA 3M07A 4HX1B 5FUZL 1BJ1H 4F15C 5C0CA 4Q9RL 3HE7C 1Q38A 3SGDH 1E6JL 2VWEC 5HD8C 4HC1H 2VLRB 4WEBL 2J8UB 1ZVHA 3LN4B 4H5SB 4GAJH 4OF0A 3O3EB 4MQSB 3DBXB 1S8DB 1HWGB 1MEXH 4EUPB 2HMIC 1UC6A 2WIIA 3MRBB 4WO4D 2IALA 3M8OL 3U4EB 2NY5L 2MCPH 3VFNA 4HUKB 5E6IC 3ZTNH 3ZL4L 3GSWB 3E8UH 5DJ6B 1QTYT 2D9QB 2VQ1B 3IDNB 3MYZA 3MV7D 4G6FD 3W39A 1RIVH 3RWGA 3SKMA 5IJKC 5DJ8B 3HMWH 5ESAA 5IBTL 1I3RB 3X11B 1FFOA 5DO2C 3QEQE 3P4NB 4WI7A 3L3IB 4JPKH 3G08A 3V52H 3DOSA 4YPJA 3QUXD 2E9JA 4J3WA 4WHTA 2X4RA 3WFHA 1SJHA 3MV9E 5FB8B 1ZTXH 5CGMA 5F3HB 4F33A 1T1WA 2E7BA 5HVFB 3HRPA 4GQPH 1HCVA 5KSBF 4NRZA 2QADD 4XXCA 1A6VL 1YDPA 2HFFB 5DRZB 3UDWA 2B4CC 3VD4A 5I15H 1FL5A 4PTUB 1IQWL 2FHBA 5ISZB 4O2CA 2X5PA 4E42A 5I1EL 2ZG1A 1NC2A 1RAMA 3BMWA 3D48R 3RWEA 1FO0A 2I07A 4GW5B 3ETBF 3KLDA 3Q5TA 3PHSA 4FMFA 1NBVL 1F3JA 4L4JA 1KB5H 4KK6D 3IAPA 5GSRB 2OXHA 4WI3A 3RI5F 4P2QD 3FQNA 4RAUB 1PY4A 1S8DA 3RTQD 4F7TA 3I9GH 5J89A 4OCYL 3P0YH 4NHUA 2OM5A 4HCRL 4NRXA 2V2TB 4NGHL 1OOAA 1FN4A 4HPYL 3HCVA 5K59F 1UB6B 3VGAB 1JF1A 4NZRH 2OL3L 1IKFL 1N0XH 2NY0C 3CVHL 4PRHE 3WNMA 1KC5H 1XGUA 4JN2B 5BVJA 1PYWA 4EEEA 4MZ2A 3HS0A 4EIGB 3P3YA 4NQDD 3EGSB 4PY7B 3HPLA 3MRJA 3FB6A 5BZDB 1IM3A 4HDIA 1O7VA 1WZ1L 1Y6NR 3S37X 3UDWC 5ACLA 2O5XL 4JPWL 4TVSa 2FZ3B 3BKJL 3LRGA 4JY6B 5EOTB 5GZNC 5I18L 3RVUD 3GSXA 2FJFB 4JFEB 5FIEA 3OXRA 2EICA 1OGTA 1TDQA 3SEPA 4L4VD 1C7TA 1XF3B 4XCNA 5DQJB 5KVFH 2NY1B 4PGDA 1YEHL 4I48B 3ARFD 3RWCB 2EH7L 4G8EA 1DFBH 1KIQB 4LSUH 1EUTA 2ZUQB 1UJ3C 3WLWC 2IPUK 5E2UL 1MCWW 2JCCB 1JRHI 3MA9L 1CVRA 3P4MB 4CU6A 4M7ZB 4OV5A 1OGAA 2A73B 2CH8A 3EO9L 4X5XA 4POYA 2CRIA 3FQUB 4KK5D 1K4DB 3S5LG 1RURH 4WV1B 4KKBD 2GTWA 1WIOA 1RIUH 4NKOA 2E6PA 3LMJH 4ZUUB 3CUPB 4V1DA 1RUML 1QEWB 4R6UA 4X6CF 4TN9A 4PJDA 4OZFA 5DHVB 1I9EA 1QPPA 4AQOA 1XEDA 1DQTA 2NLJA 2ATKA 2WUBH 4NZDA 3BGAA 3OKKA 1FFPA 1AO7E 1U8OA 2ZSVA 1A7RH 1MCIA 4CVZA 3AS2A 4FTVD 4K23L 4TNWK 5TDOA 2VC2L 1MCNA 3TN0A 4Z7WF 1EAPB 2R15A 4LIQL 3WXVL 1YY9C 5LXGH 1G9ML 3TIEA 1CFVL 3O2WL 4Z9KB 1NCAL 4Y4KD 2XQBH 5E0QA 5I1LA 3QB7C 3S36L 5DLML 3IFOB 4OM0L 2ESVB 4LCUA 2WP3T 4X8XA 3QIBC 1U8OB 1A1MA 2VLJB 3X3GL 1EZVY 4YC2B 2Q6WB 3WN5C 2ZKHH 3QBTB 3L3HA 1U92A 2Z8WC 1WSST 3KYKL 4XPGL 5HHNA 1OP3K 5A16A 4BJLA 1NEZB 4KI5D 2OL3B 3RIFK 5JOPE 4O02H 4I4WA 2C7UB 2OI9B 4U0QB 4XI5D 3CUPA 4V1DB 5E00B 4S2SA 3C5ZC 4X4MA 1ZMYA 2HLAB 2VLKE 4P2OC 1V7MH 3MRLA 1CGVA 4QRQA 4DGVL 4LF3A 4F3FB 1TZGL 4GKSB 2FECI 2PUQT 4RGNC 3SOBL 1MI5D 1CLOH 1R5VA 4N8CH 3V9FA 4NO0B 1AI1H 1KFAL 2R1WA 5GGTL 3UTZA 2H8PB 4YHOL 2MQCA 4YDLC 1NBVH 2X9YA 5KTEH 4XAWL 3RY6A 4NN6C 1U8IB 1G7HA 2VSDA 4IRSB 2FX9H 2CDFA 5IW1B 3WUWA 1ED3A 4M1GH 2UZIH 4DOHB 1ONQB 3U83A 3CZFB 1R3LA 4R7NA 4JFOA 5E9DA 3MREA 3VWKD 1F58L 1UWXH 3RP1A 1MCSA 1WFOA 2CQVA 3ROLA 1WZMA 1UENA 5L8LB 1E6OH 2QTEA 2B5IB 4NOBA 1CLZH 4YHPB 2IANE 1IQWH 4ODHH 4TUKH 4LLUA 3HZVA 5CINL 5HYQB 1NGWA 4LLYB 2GSIB 4OIAA 3W0WE 4EI5A 2FZ3A 5E2JA 4MCZA 2FEEL 3IF1B 3OKMB 1DQQB 2KZWA 1MJ8H 1T04A 4HWEL 4KUZH 3ZDXF 3FB6B 1IZJA 2APBA 2EE3A 4TNVF 3OAZH 3MCG1 4NNXA 2HVJA 3V7AE 1FZMA 2W92A 4JY5L 1NCNA 1RZKC 2AERT 4NO2A 2R9HC 1CFQA 4WJ5A 2D03L 3IXTB 3HNSL 1DQLH 3QCVH 4J3VA 15C8L 5BW7A 4MQXD 4E5XA 3KPPB 4QXUH 3CGTA 2MHAB 4OSUH 4KUZL 3W5MA 2EDNA 1JNNL 4G9DB 4JB9L 5EU7E 1CE6B 3SKJL 2OR8A 4Y19D 4OTXL 2BVPA 2BSSB 4XTRD 3CD4A 1B2WH 3BO8B 1GYAA 4K94C 3CMOL 1HIML 2PO6D 3DV6B 4GW5A 2Z9TA 5C6TH 1ZSDB 4IRJC 4U6YB 1WQVT 1O5DT 3NACL 4AEIL 1MFBL 1C1EL 1JPSL 4PTUA 1LDSA 1P1ZA 2VDPL 1BJMA 2HRLA 1HDMB 2UUDK 3WS6C 4U6VL 1NGYA 3JZ7A 3LHPL 4DN3L 4X0KA 1FPTL 1EMTL 3VFRA 1DLFH 1DQDL 5I16B 4UILH 5C0FB 4YHOH 4UQ3A 2H3NB 4XPBH 5EN2A 3RX5A 2X4UB 4OZHB 4M6NH 3U46B 2ITDB 3IDUA 4YDVA 5DI8B 1V7ML 4ZS6D 4XXDA 3L5WB 5DEFA 5IFJB 4LOUC 5ESAB 3K80A 3ZTJG 3BH8A 4HH9B 1UB5A 3RKDC 1I8KA 2ZCLL 5DJ6A 3QJHB 1A7NH 5JW5B 5SX5K 4Y4HD 3G5YB 1VFAA 2Y72A 3VFNB 1FNEB 3FRUA 3E6HB 5JIIA 4NZTH 4XNZC 4OF8A 1NUDA 1B0RB 3RJDA 2E8ZA 3Q1SH 4BK4A 1XMWA 1T22B 1MVUB 3EAKA 1JPTH 4DKAA 1EHXA 1G7PB 3WIHH 1YEIH 3C60B 3V5KB 5JR1L 2DB8A 4KHTL 4BQCA 2CD0A 4GLRI 4RA0C 5ACZB 5C0RL 2DKUA 2PTVA 3WE6A 2FECL 1U2CA 1YN6A 4JQIH 1I1YB 3PDGA 4Y1AE 3T77B 2NPLX 3L3OA 4WU5A 2DL9A 1LEKB 1X5GA 2ICWI 4K23H 3VXPB 3ZZ1A 1I7TA 2AXFB 1BMGA 4DAGL 1WT5A 1MH5A 1KPRB 4G80A 2V5SA 2R0ZH 2FJHB 2NXZC 2V6HA 2W38A 1HCFX 4LCCA 2VDML 3HZMA 5TE4L 1A9BB 3BD5A 4H26B 1SEQH 2NY2C 1LO3L 1CXIA 2EEAA 2P7TA 4IMLB 2R4SH 1BVKB 5J6GB 3GSVA 3SKOB 1RUAH 4WIQA 4NNPL 3GJEB 4PJ9D 3TFKD 4DZBB 2J8OA 1MSPA 4MNQD 2CUHA 5SWQB 2JJVA 4IRJB 1Q9KB 2DQTH 1DSFH 3WJJA 5AUMA 1UM4L 2D7TH 4NO3A 4L8CB 1E0OB 5GS0C 4OLVL 4QHUA 5J12C 3WYRA 4OUOA 4DKDC 3QI9A 4IS6A 4JFZH 2AAVA 5I1JL 5I75B 3IKCB 4LSSH 3FO9A 1EEZB 4P3DA 4ERSH 1FIEA 4ETYA 2EE2A 3FOLA 4JFPA 2WNGA 2XQYK 4F7CB 3VWKA 2NY1D 2XN9B 3GSNA 1YEHH 2RIKA 4N0UA 3TBSB 3S5LA 3TN0C 3W5NA 1LILA 4U0RC 1DBJH 3I3EA 1HWHB 4XCYB 5DD3L 4XWOD 4YWGH 1DTUA 4KHXL 4PB9H 4OCNC 4M03A 3MRDA 3V8OA 5IB2A 1CDUA 5T1LA 3HAEB 4NQVB 1J8HA 3RTQA 5B8CB 2DQTL 2OJEB 4B50A 3CSGA 3FO2A 3JVGC 3QNXA 3SDAB 3WV0A 4EDXB 1XR9A 1C5DA 3SE3C 3K0WA 1S7QB 5EU3B 3A67H 4JFYB 4WW1B 3P9LB 2BERA 3BWAA 3HC0B 3QUMB 2VOTA 2BK8A 1FH5L 1WTGT 4KRPB 4H1LB 2X89A 4BSWA 3MRCB 2YD3A 1RK0B 2QSQA 1KTDB 5T1KD 1ZWIA 4LCIL 1K4CA 3KLAB 3BIBX 5GRJH 2F53D 4QTIH 4HIHB 1ND0B 4B7LA 3MLTB 2KUTA 4NZUL 2XZCH 3FMGH 5LQBL 3I9GL 5GGRB 4HEME 2XKUA 2YEZA 4GBXC 2P5ED 1L9MA 4X5WB 4Y4HA 1UYWH 3AAZA 3WKMH 3BPNB 3DXAD 1INDL 1FNGA 3QXDA 3R0NA 5DMKA 1HEZA 2VN4A 1BQUA 4J3SA 3K74B 4KHTH 4ONOA 5E2WH 1A6UH 4J6RL 4E41D 5E56A 5E1HB 3G6AB 1EH9A 2PYEA 1AR2A 3T0AA 4H20L 2BNUB 2PYEB 4WUUD 3U30C 5HTSA 4QXTA 5I17B 3C2SA 1RD6A 2NY7H 4F7EA 3WHXA 4MQ7A 1P9MC 2F58L 1YYLL 3BZDA 5DDHB 5HDLA 1S7SA 4AIOA 1FFQA 2J7LA 3GSQA 5GGRA 1QSZA 1SY6H 1JGVH 2GY5A 4W81A 3VWJA 5D4QA 4ZSOE 3T08A 4MNQB 3UPAA 4HHAA 1XCQB 4Z7UE 5F9WC 5IBUG 1J0IA 3VGFA 3ZE2E 43CAA 2P44B 4X7TA 3HR6A 5DRNA 3OKDB 3HTLX 2OR9H 3VXTA 5CZXD 2Y23A 5CWSB 5IJVB 4ODSH 4MA8L 5E9DE 4OQTA 4FHBD 1V05A 1ORSA 1NCBL 1ZGLA 5I73B 5JDJA 1BQSA 4DKFH 4MXWH 4LRNH 3VI4E 3P9MA 2LQRA 3C5JB 3SKUD 2XWTA 3QQ4A 4IEFB 4ORGA 1MEXL 4GBXA 4JR9H 2QHLA 2R2EA 1A22B 1DDHA 2GJZA 4ZFFB 4RA3A 2PR4H 3VCLB 4JAMA 1IJ9A 1BD2E 4LRIA 2BSTA 2W65B 1HH6A 4UUJA 5LGJA 3ZE0F 1EXUB 3WUZA 5IEKA 1KUMA 1F4XH 4WU7A 3MYJB 5FKPB 3N06B 1CICC 1F4WH 5BRZB 4AEFA 3R0MA 2R2HB 32C2B 3QXWA 2AXJA 1J0JA 3GKWL 1F8TH 1AHWB 4Q0XL 5HGAB 2W9DL 2R1XA 4PJHF 2DQFB 2GK0B 2E7HA 2ZJSH 3MXVL 4PRNB 4GMSL 3AB0C 4PG2C 3GMNA 2JCCF 2E9BA 4DZBA 1OGAE 3NCBB 1H3WM 2H32H 4ZPVB 5EUOB 5L2JB 3S37L 1RZ8A 4U1HB 3SY0A 5E24E 3QPQD 3MV01 5H37G 4OCLC 2IMNA 4G9FA 3QRGL 3Q3GA 3MLXL 2DBJA 1F45A 1NCWL 1U8KB 1JGLH 1RY7B 2NY5C 3MNZB 1H3UA 2BRQA 2HJFA 5C07B 3MRPB 1IEBA 3U7YH 4RISH 3VG0L 5IJKA 3MJ8B 1K6QH 4W6YB 4FQXB 3QUYD 1I8IA 2BFVL 4PLJC 3MRNB 5DJAB 1L7TL 4N8VG 4TVPE 2CPCA 3WSQL 1F4YL 5EA0L 4M00A 1OARH 1FDLH 1SBSL 3STBA 4ODVL 1FGVL 1WFTA 2YA1A 5DYOA 1U8MB 2HTLD 1OP3H 3STLB 2Z4QB 5DVNA 4S1DD 2MFNA 2AV1A 1ACZA 1TZIB 2QADC 5TQ2H 1TZGH 1JZ3A 4N0FA 1RHHA 4LEOB 3RIAK 1KN2L 4N0FB 4Y88A 4R97B 2BNRB 1TJHL 4YFLI 1RJYB 3S4SB 1B6DA 2Y5EA 2J88H 3BKMH 2F54A 3D3VE 5HDQL 1GGUA 1G6RB 1XZ0A 3CSYB 2WWKO 1Q0XL 4WI8A 3S7GA 1QRNA 4X7FC 2OK0L 2R4RL 3F7QA 3LRSA 4UOW0 4PJ5B 4N8VB 1REIA 3KPRE 5C0BE 3S88L 2N4IA 5CCKH 4J6RH 4HKJA 1I8IB 1U9KA 1WFNA 2PW2A 5CEXA 2V17H 4PUBL 4GKOA 4JFED 3EDJA 5F9OH 3EYQC 3ZKQD 1X5KA 2YD9A 4WFEE 5FYKL 1I85A 1GC1L 1KPUA 4PRHB 1NCAH 5C07A 1MFCL 1E27A 5IMMA 3OKEB 5F7NC 5C3TA 1PLGL 3FT4B 1RZGA 2Q20A 2ZOKA 3MNZA 5KSBB 5LQBH 1LE9B 3LEVL 1KXVC 3OGOE 3QHZL 1YN7A 2DWDA 4PJXA 3D0LA 2CO6B 4CW1B 1CD1B 4NKQB 4JFFA 1H5BA 3BESR 4R9HA 3MV9B 3NFSH 3QDJB 3BVNB 3BO8A 3HFML 1KB9J 3OZ9L 4LLMA 1YEGL 3LPWA 4AZ8A 4JFZL 5B39B 1Q9LA 4KKAD 4DCQB 4N0RA 4PRNA 3TH4T 5M94B 2R1XB 5A3IC 1N6UA 3PXJA 3ARBC 1F6LL 4HV8A 1MFAL 2DBLL 5E4EC 4GO6B 5BRZA 1JP5A 3DUSA 4RFNC 5JLZB 4HZLA 3VFWB 1JFQH 2HWZL 4GSDH 1XIWD 4PG9B 1JHTB 3ZKXC 1J10A 5GHWH 3CVHA 5C0EA 3VXRD 4B5EA 4LLVB 3KJ6H 4X8JA 1S7TA 4U6XB 4F9PC 1FZMB 5IBLC 4P5TA 1XGPA 2DQHL 4XPAH 3O6FB 3MV7B 2BNQE 1YEGH 2PN5A 5E5MA 5J56B 3I6LD 2XNAA 2H1PH 1FC2D 4WTZG 2XWJB 3NIGF 3ES6A 5EOQL 3UZEA 4ODTH 1Q72H 3C8KA 3T1WA 1YPZE 3LQMA 4G5ZH 1A6AA 2V9RA 4M1DH 2PCPA 4KKBC 5L9DH 5ICXB 3PIQA 4PJ7F 2HN7A 3BHBA 2NY1C 5GRVL 5CSZA 1NGXA 4ZXBA 4WI2A 5BW7C 3ROLB 5CWSA 1EHNA 3F8UB 5JXAL 3MOAH 3AFLA 3MMEB 2VISB 4OGXH 1EJOH 2C3VA 4ZYKA 1KEML 2AQ3A 3V6FB 2O26U 3PHOA 4Q97A 2J6EH 2HFGH 5IMLA 4PRPB 1F4HA 5HBBA 1A7NL 1AY1L 4YLQT 3GSQB 1OTSC 1QBLL 4OLZL 2XZAH 1MUJA 2DM7A 3O9WA 3QFJB 2GIYA 4O4YL 4Y0GA 3MRKB 3OAUL 4HZAA 1AQDB 2F5AL 2NMSA 1BD2B 5I17A 4R4FH 3AUVA 1XGYH 2Q1EA 3GMMA 4GQ9L 1HSBA 4WI4A 3QIBD 2UWEB 5IFAH 1QRKA 2FX7H 4YHYB 4Y89A 2A9MH 4ODVH 4P2RA 3N9GH 1ZV5A 1A1NA 1IM9A 3DHMA 3T3PF 4M61B 1HEZB 4U6VH 4LHUB 2AV7B 5KSUA 3AAZB 3QIUD 4U1IA 4OIIL 3UX9B 3NACH 3PWVA 5AG8A 4RGOL 1ACYH 1MRCH 4JFFE 4WFHE 5IG7B 4PGEB 4I1NB 4UB0H 3VG0H 1GAFL 2BMKA 3TNMB 1FNSH 3TV3H 1U93B 3U7WL 3U9UA 2AJUH 4PV9A 4HF5L 5J0BA 1LK3H 1B2WL 1TETH 5KAQF 2GEEA 5F6HI 5FHAL 3O6FC 5GGVL 4ZPTA 3LKSA 3SDCA 4X4XA 3FONA 1BBDL 2BVUA 1U95A 1VEPA 1XR9B 4TTDC 4OZFB 3CJJA 4DQOL 4OZ4A 5IB4B 1IAII 3HNSH 4FQIH 1QEWA 3SQBA 1J8HB 4ZUWB 2W9DH 3B2UD 4M43H 3C87A 3W11D 2UY6A 1IC4H 4G9FD 2MCG1 4DGIH 4JGJA 3HZYA 3R06A 4XP9L 1HYSC 3KPOB 3CPLA 2GTWB 3CH8A 4J8RB 5T3ZD 3ULUH 3RUGF 4HS6A 3V4VH 3AS0A 3S5LB 2XN9A 3GSNB 1JWMA 4NN7B 5T3XD 3VFVA 3U6RA 2EC9U 5FA4A 5HHOA 1YJDC 3GIVB 3AU1B 4XNXH 4HJJL 3H3KA 2EECA 1HKLL 2P5WA 5EZLA 2C3HA 2EKSB 2XRAH 4DN4H 3F62A 1ZVYA 3DUUB 2WV3A 3K2UL 3O41A 1NGPL 2N1KA 4Y4KB 1DEDA 3IJYA 4GW1A 5C0JA 5I8OL 2ZPKH 3LZFL 3HRZB 4NCC1 2OTPA 3RZCC 1D6EA 5DJZA 4MA8H 3QIUC 5I1HH 3FZUC 3DROA 1IARB 3U36A 1ZANH 3VWJD 4L5FH 3ULUC 2GT9A 2R1YB 4JQXC 4BA8A 1G0XA 4HWEH 5I19L 3PWUB 1FAIL 4FQLH 2X4QB 1NMAL 3PL6A 3S34H 3NH7L 5IVNA 4R2GB 1I1YA 4NO5B 5ESVA 1UZ6F 2B1AH 5KW9H 3E3QC 5GRYA 1F90L 2Z93A 4NRXB 4LGRB 3MRHA 2XXCB 1MF2H 5FYJD 4EVNA 2ZKHL 1GGCL 1T3FB 1WFUA 1T22A 2ERJB 2YBRA 1A1OA 4EUPH 1QSFB 3O2DA 3QEQB 5EC1B 3LS5H 4NCC2 1F3JB 2M8XA 2FL5A 1QA9A 5E2WL 2VAAA 1A6PA 4KDTC 4LHJB 1KTLB 4UDTA 2FYYA 4HJ0D 4HH9A 3S3SA 4L3CA 2VKWA 4X6BA 4TVPD 3D2UD 2I27N 4P49A 3SOBH 4KMQA 2VDKL 3D2UA 4MX7A 1C16A 5BZWA 3O8XA 1G7MB 1N8ZA 5HJ3B 1OW0A 4R2GC 3X13A 4Y19B 5BVPL 1BX2B 3IXAA 3WIFB 4K71C 4QYOB 1J0HA 5D7JA 3KLSA 4NFBA 3TWCH 3GBNH 43C9B 2X4RB 3WFHB 2VDRL 5I8EA 1NKRA 4AY0A 3L3IA 5DK2A 3QFDB 3PJSA 4RMTA 4MX7B 1OP5H 4HAGA 3OB0K 5DJ8A 1MWAB 2Y4SA 1ZSDA 3VWJC 3C6LB 1LMKA 2E27H 3BWUC 1DR9A 3O9WD 2EYRB 2HG5B 4C59B 3NABH 1VCAA 2EEBA 1DBJL 3OJVC 4E9LA 4Y16D 3K4DA 1EEQA 4YHZL 4MNQE 1V7NL 1A7OL 4XXCC 4GAYA 2NY6D 3NIFF 3GHEL 4P9HL 4I18A 4NDMA 1BWMA 2H6PB 3QA3B 1IKNC 1ZT4B 4KRLB 1EO8H 4LFHG 2DDQL 1PDKA 4NM4L 5C0CB 2MTPA 4X99B 4F7MB 3OJDB 3OGCA 4A6YH 4N0UE 2Q8BL 5F3BB 4TOYL 1UKSA 3V0AC 2E7LA 1Z9SA 2BHUA 3QDGD 3CFBA 3IDMA 3QPXL 3KPMA 2IBGA 4U2ZA 4OM1H 1Q1JH 3LCYA 5I6XC 3RBSA 1QR1A 3HI5H 1U58B 2IPKB 5JHDD 4TSCH 2R0ZL 1NLBL 4KPHH 4DAGH 5GSVB 3WLWD 4Y5YB 3CDFA 3P0YL 1NGPH 3DRTA 4TVPL 2FATH 1QSFD 2GYSA 5EU6E 3RIFF 4YHNA 1WWBX 3C6SA 1T5WB 5J4MA 3MXWL 4J4PA 2CDGB 5CBAA 5HVHB 1WAAE 5J9PA 4KTDL 4ZMAT 4LVHB 1UZ8A 5DURB 2BSED 4RMRA 3P73A 4JRYD 1JNJA 1IGJB 1J5OL 3UTZB 5F89B 4P46D 1D9KB 3TZVD 3HI6H 1G9NH 2ICES 3VXSE 3UBXB 4PFEA 5GRUL 3L5HA 2OL3H 3ZMRA 4RIRA 1OF2A 5GGUB 5ELIA 1MIEL 1P2CB 5ANME 3U1SL 1LQSR 2EDRA 2I60L 3BQUD 1NL0H 5EIQA 3NH7H 3PWLB 1RK1B 4HCRH 1NEZG 4ZFOB 5KSAC 5CP7A 1UADC 1M4KA 4PJGB 5A16B 4WENB 4WUUE 5ALBL 1TPXB 3SN6N 4JJHA 1MPAL 2X4PA 3KYNA 2BDNL 4ZD3L 4JM2B 5KVEL 4FTVA 4H8WC 4R90L 3FONB 4UIMA 5F6HJ 5I1GL 5LG1A 3TYGL 3QG7L 2CLRB 3VI4F 4QGYA 2X4OB 3G6JB 2OS7A 4U4BA 3DXAE 4GRWH 2HLFD 1BLNA 3CDCA 3MFFA 1VADB 1VGKA 1BQHA 3MO1A 3H0TB 4YBLC 4TPRH 3H0TA 1DN0A 1KCSL 4K94L 4R7DB 4Q58C 4WV1C 1YECL 1ZXQA 1R3JB 4KKLC 5IM7B 2EE9A 4K7FB 4U1IB 5D5MF 1LEIB 1BEYL 1L0XA 5JDSA 2E6JA 1A6VH 1NJ9B 3PGFH 4RFEB 4U1SB 1FO0L 4L1DA 2QSTA 3RUGA 1MAML 1IBGH 3PWLA 1OWWA 2OTWB 3TJHD 2C4FU 2EDWA 2HYMA 1AC0A 5AD0B 3VXMA 5C6WH 4ZUUA 1CF8H 3QO0B 4LCYA 3CXDL 2FLBT 1K8IB 4PJCB 3MRKA 5KBNC 5HVWA 4XPFL 2NQCA 5AZEL 4AEHH 1MI5A 4QRSB 2CK2A 4BUHA 2EH8H 3RGVD 4IDJH 5D2LE 1D6VL 3QWRD 1JTOA 2IFFH 5BS0D 2I9LB 4NT6B 2JE8A 4QCIA 1W0VA 4X9IA 4B41A 4ZYKB 1T1XA 2K9UA 3UPRA 1OVZA 2PXYB 1J8HD 1Q0YL 3O8XC 4I48A 2GUOB 1LNUA 5DJYA 3QIWB 3DRTB 5K93A 3V6ZB 4PJ8D 4D2NA 3MA7B 1QPXA 1WZLA 4Y5YA 4GAJL 4ZXBB 3ARDD 2BHZA 1CU4L 1H8OA 3BHBB 3SDCC 2AEPL 3NPZB 1X4XA 1FNHA 4EOWL 4KJYA 4X4YB 3T1FA 2HJLB 6FABL 1U42A 2QADB 1MRCL 2R2BB 2M2DA 2VXVL 5IT2L 3FB7A 3C8KB 1RZIB 2AJ3B 2VH5L 4I5BA 3ARPA 2VMFA 4JRXA 1JWUB 1U8NB 1AKJD 3MRJB 4OUUB 4M93C 4E41B 2Y25A 1M05B 5I71B 5L2KB 2A6JA 4PY7A 3A6OA 4RDQG 2ZCKH 1NFKA 3VFUB 2GSGB 3O3DA 4O9HL 4R4BB 2MQ3A 2HA1A 3F5WB 4C56E 1R5WB 3CVIH 5BV7C 3BGMA 3ALWA 1Y0LB 1ZLUK 5C8JA 3QUYA 5CJ8A 1ZHNB 5H2BA 3QZWG 4DZ8A 5D1ZD 1S9WB 5I8KH 5JW3L 3VRJB 1SJVA 3PP4L 2EDKA 4KK8D 2NY0B 3GB7A 2B5IC 4X6DF 4L3AA 3SE9L 3F58L 1ZHBA 3RVVD 3BRDA 4GAYB 1CS6A 4OKDA 1W72H 1RZJL 4PJFB 4YDIH 2DYPD 1C8PA 5KN5A 3U79A 2ENYA 2P49B 3FO0H 2HG5A 4OZHF 3BVNA 2OI9C 3O2DH 2VERN 2E7CA 3SDXF 3TO4C 4P23B 3PL6C 1RFDL 5JHDE 3SGDI 2A77L 4XNZB 4JG0H 3EJZD 3QXAA 3T4YA 2IEPA 5HXMA 4POZC 1HI6A 2FDBP 2QHRL 4GG8B 5E8PA 5I8EB 4EI5C 3DI3B 3ARZA 3Q48A 5KS9B 1J86A 4LOUD 3RVUC 3DX6B 3VFTA 1UJ3B 1WBYB 4N8VA 3GMLA 1YJDL 1BX2A 4FQXD 4HIIA 4K3HA 1CGYA 3RVXC 3VW3L 3OPZL 3O8XB 3MCKB 3WS3B 4RX4A 1I3RA 1A9EA 3A6BH 4QHKI 3UXFA 1INQB 4UDTB 2W60B 4S1SL 4Q9QL 3IGAB 4OCMC 4CN1A 5IOPA 2IGFL 3SDAC 2B2XL 2FL5B 3V2AR 4JKPH 4M6OL 1SJEA 5C0CD 1HINL 1P4LA 3DX8A 3D39D 3STLA 4XCCH 5GGTA 4KY1L 2HP4A 2R69L 3DBXA 4JRYB 5GJTL 3MODL 4M5ZH 3BN9D 2CKBB 4Z5RA 4L3EA 3VXME 1WC7A 2V7HA 3RUGE 5MI0C 1JZ7A 5DJ0A 4P0DA 4ZS7H 1A64A 3LQZB 1JI2A 1SJXA 1QP1A 4PJIA 4RFOL 3CFKA 5SWSE 1WGOA 3MRPA 5BJTA 4QY8A 2LABA 4HPOL 4OZHE 1N64H 5FFLA 3ZYJA 1PG7L 2X2YA 4J1UB 1WBXB 3S3JA 4WCYL 2GTZA 3WHE0 3DRQA 4XRCA 1X5LA 3UYPA 5ID0A 1T20B 4ZDHB 3X3FL 1T0MB 4P23C 4Y4KA 4M48H 3H8NA 1QOKA 3HA0A 5C0ND 2ZSWA 1RZJC 1KC5L 2EIEA 3D3VB 3HI6L 4JG1L 5HYIA 2J4WH 3CFEB 3CAFA 3TN0D 3BRGC 4TUJA 3T2NL 5F72S 3KS0J 5JNYA 2YK1H 5HHQA 2HFTA 1WUNT 3BH9B 1XF2A 1UKQA 5IEKB 5E6IA 1OWRM 2WLYA 3AC0A 1A2YB 4I9WD 5LGKA 3BE1L 4G8IA 5LGJB 5JQHC 1HH6B 2DQIL 4WO4A 3V6OA 4JAMB 1JYXA 4WTZA 4DVRL 4GBXB 3QFJE 5L6YH 1F11A 3BPNC 5C08A 1A3QA 3OKYA 4MHHI 3ARGD 5EO9A 5FUOL 3VG9B 3HE7A 4G42B 3IS0X 4XNMB 4JPIA 1CFNA 5BS0E 5EULV 3IJHB 3M1BB 3EJYD 4LASL 3B9DA 2I24N 3EYUH 1U95B 3ET9F 4WFGE 4OQ1A 3FN9A 2DQUL 3I02A 4RQQB 5KAQG 7FABH 1T21B 3KHQA 2IFGA 5D5MA 4HEPG 4LPTA 4FG6C 3IDJB 3QEUB 1S78C 3I6LE 4X6CB 3WXWL 1OPGH 1YC8A 3OG6B 3QCTL 2YPLE 4OLXH 3MUGA 4NN5C 3EYUL 4OBSA 1I3VA 3KXFD 3ZL4H 1A1NB 5D7KD 4HKXA 2LU3A 3NABL 4W70A 2ZNWA 4GXVH 3SJVB 5C0NC 1S9WA 4P4KC 4XC1H 2J12B 4NQED 1AXSB 4U1KB 1NLDL 2EDJA 3E6FB 1BD2A 1J8KA 2GSGA 1NMBL 1CI5A 3OMZA 5E8DL 2VLJD 5AZ2L 3UBXG 4N1HB 4OZIE 5FGSA 3MACH 5BOPA 3FQWB 2NY4D 1KN4H 4J3OC 3UYRH 3BZEB 5JHLH 3F7YA 1R5IA 4R4ND 5C0DB 3GBNL 4LCWE 2C9AA 2R2BA 4MA7L 4NZUH 3DNKA 4P2QA 4A6YB 2ADGB 4HMCA 3MLVL 5D7IF 4H0IA 5C70A 3V6FA 4GG6E 2ILLA 1J87A 3WUWG 5L0QC 3DJ9A 3PQYE 4PRBB 5K9KA 4WWKD 5L8JB 3BKYH 3MGOA 1LNUB 5DJYB 3ZSTA 4WW1A 3HUJA 4P4KB 4Z7OF 4XP1L 1OAUH 1LK2A 5ICZA 1W0VB 2Z0BA 2OJEA 3JV0A 2NNAB 3VXMD 1SY6L 3RY4A 4W4NA 4PLNC 3HC4L 4S0SD 3OR6A 3S98A 4FN0A 3KNBB 1PG7H 5D7LD 5EO0B 5DXWA 1YY8A 1EA9C 4X7SH 5E5MB 2R56H 2D31B 3Q6GL 5E8NB 4LARH 2CIIB 2QSCL 4N0UB 2OTUA 3MSPA 4YBHA 4OLUL 4DJMA 3VWKB 4JHAH 2YUWA 4NNYB 1VSCA 3IU4L 1DL7L 3V4UL 1U3JA 4MVBC 2QEJA 2DLFH 4NFCA 1CLCA 1K5NB 35C8L 1INDH 4OQTH 1N3NA 2P5WE 3MV7E 5AYQA 4L8CA 3QPQC 1LEIA 1QSEB 4PP2B 5AUMB 5CLTA 1NANH 2AQ1A 1DSFL 3B9VA 3VGHA 3IJSB 4R7DA 5A2KH 3JWNC 3JWOC 4Y5VC 1DN0B 1NC4A 5I1HL 1FL3B 5GIRB 4BZ2L 3LRHA 3A6BL 1H5BB 1OT1A 4R4NC 3J7HA 2E7LC 1RZ7L 4OGZA 1MHPH 4OGAD 4Y5VA 4YHLH 5GS0L 3KYKH 1NAKL 1M7DB 2ZCHH 4LCCB 3MNWB 1YNLH 4MJ2A 5DD0L 2ZOKB 1UT9A 4CGTA 4PP1D 4XMKH 1E27B 5H8DA 5IMMB 2X4PB 3KYNB 1MH5B 1ZT1B 5FGCE 4KGLA 1U3YA 1WZKA 2IADA 3MACL 4HXBL 4KAQH 1CR9L 3V5DA 4FS0A 1N0LA 4LAQH 1I3GH 1QFOA 3O3AA 1BJ8A 1N26A 2P45B 4YFDB 2C3GA 1OF2B 3ARFC 3QNYB 1CFVH 1NANI 2YPLD 3O2WH 4LBEA 5ITFB 1AHWC 3G5VB 4KJQD 4ETQA 1QHOA 3Q0HA 5IF0B 2G60H 1FSKC 3EJZC 3QYCA 2L7JA 4RMWA 4QEGA 2RFXA 3L5XL 4NCDA 2WUBL 4CAGA 2FX8H 1BP3B 4LLDA 4CRPA 1CR9H 5BOZG 3EKCA 4LLDB 2J8UF 5I6XB 1QKZH 3OF6D 1YYMH 3FQRA 3O6KL 1U8MA 3GSRA 1FFRA 2NR6C 1G6RH 4RGMB 3MOBL 4NFDA 1P84J 5BV7H 5ID0B 3ARBB 5JMRA 4HWBH 1RI8A 4RZCA 2N7AA 3MRNA 3JV6A 1UEMA 1U58A 5DJAA 5HYEA 4XPHH 2Z92A 1UWGL 2YC1A 4UB0L 4FQXA 5D2NA 4M6AA 1WBXA 3P77A 3QUKA 5E99H 5ISZE 2BVTA 1BPVA 2EH7H 2MKLC 2R0KH 1IAIL 1BOGA 3QQ9C 2ICWB 4OQTL 1M7DA 4KKAC 1OTUD 3NCEB 4WI6A 1IAOB 3UJTL 5JTWA 5I18H 3HG1E 4CU8A 5HYJA 3UZVB 4LPCA 1WC7B 2V7HB 1G7LA 1OB1A 3GMPA 2HKHH 4NPYA 1CDJA 2QQNH 3BP5B 4MZ3A 1RQ5A 2GY7B 1A3LH 1T1ZB 4OLZH 3GSNL 2XACC 2ADIB 4OCXL 3OG4B 4MD0B 32C2A 1HILA 3LV3B 1BF8A 1G9MC 1N3NB 1H3VA 3BW9B 5CJXC 4NYLA 2DLHA 1INQA 4PREB 1TVBA 1Q9WA 3ZKNC 1W72B 4YZFE 4JQXA 4TULH 4UUJB 1Z3GH 3FO1A 3VCLA 3T0BA 5J06A 3C2AL 4EN3C 4OIBA 2ED8A 4JFDA 4XP4L 1MJUL 2O5ZH 3QQ4B 2BRRH 2DQEL 1I9JL 2F5BL 4JVWA 4P46C 4DN3H 1AR1C 3WIFA 4MS8C 3IFLL 4P5KA 3HZVB 5HYQA 5E8PB 4LIQE 1UH4A 3AREC 4G7VH 1G7MA 1N8ZB 5IHZB 1OTTC 4I0PD 3R8QA 5E9DB 4K07A 2DWEB 1MCLA 2AGJL 2HAZA 4NP4H 1NLDH 4KI1A 2HRPL 4OFKA 4LSPH 4QLRA 3G6JE 3EIFA 4R96A 3UTTA 3MOBH 5IESH 4NOFA 3QI9C 4S1SH 4Q9QH 4YGVB 5ICYA 4AENB 1JNNH 4JB9H 3FHQA 4PJFA 3KLHC 3IDXL 5JW4M 1R5IB 2R1WB 3KR3H 3CX2A 2OZ4A 3V52L 4BZ1L 3S9DB 2CK0L 3PQYB 4PJ9A 2VIRA 3KG5A 4LHUG 2G9HA 4MQ7B 2F15A 3OF6A 3NMEA 1MAJA 1CQYA 5DWUH 3LN9A 2PETA 3U1SH 2YWZA 1HHGA 5H94A 1NGQL 5ESVB 4DZ8B 2DQDH 3MNVB 1SMAA 4P9HC 5ENWA 1GIGH 2C7UA 1FHGA 5C8JB 1MJ7L 2BNQB 4LLWA 3D39A 1NEZA 1YEJH 1RZFH 2HFGL 5F1SA 1VDGA 5EZIH 5JZ7C 3VI3E 1IAKB 4PJ7E 1OD9A 2X10A 4Y5YC 5CZXC 2AJYH 5CJOL 3BMVA 1KCKA 3ORJA 3TJHC 3GSNH 4BYHA 3ARGA 4LASH 3AM8C 1IC7L 4I5BB 1XF1A 2MMXA 2I9TA 1FNLA 1FORL 1NSNH 3EDFA 2YD1A 2HJLA 2G75A 3HG1A 3HMXH 3PWJB 5C09A 3SGKC 1NAML 1K4CB 3ILQD 3HLAB 4AG4H 3CC5A 3LKOA 1A47A 4TRPH 2VUYA 5F7EH 4TVPH 2DI9A 2V9TA 5E5UB 3WEXB 1T21A 3BZ4A 2X70B 1EGJH 4D9LL 2EC9T 5FCUL 4LEXH 1U8LA 2ZSVB 4CVZB 3DVFA 2J88L 1N5YL 1UXSA 4JFHD 4JJ5A 3SQOL 2OQJA 1G1CA 5EU3A 3NN8A 5ITBH 3QDGA 4HWBA 1PG7X 1U8HA 1ZHLB 2C4FT 3C09B 2C4XA 2FH6A 4QCIB 2FIRT 2W0LA 2YK1L 4OZFH 4I3SL 5JPMA 4N90D 3O11B 4RBPH 5FECA 3VFVB 4R97C 4XBGA 2J4WL 3E2HB 2YKLH 3KXFA 1QBBA 5TDNA 4GXUM 5IVXE 1AP2A 3U2SB 1AP2B 2BY0A 1QACA 2NW3B 3MLSL 1S7UA 3BEWA 4BSJA 3KXFB 4PJDE 1YMHB 3D9AH 5SX5H 1M71B 1X7QB 5DMGC 3O11A 1BIHA 4OV5B 1QSVA 4RWYH 4OF5A 3GIZH 1FVEA 5B21A 3D39E 3DO7A 5IB4A 4NUJA 4JFDD 3QDGB 4NC2B 1XIWA 4PRDA 1J9CT 2VDNH 3LB6C 2GQHA 4HPOH 3TVMA 2NY3B 3IFPB 4CMMA 4XI5C 4ZPTB 2R0LL 3WEXA 1Y18B 3GI8H 4F37K 1GL4B 4G6MH 4M7LL 2QV2A 1SHMA 4ALAL 4PJFE 4XPTH 2YMXL 1U93A 4UNUA 1GC1H 1RJLA 1VGKB 3JBG7 1QRNE 3HNTH 4Y2DD 3PWVB 2QR0A 4JO4L 2WMPA 4OKVB 1ZAGA 2AXGB 3U0PA 4YR6B 1RU9H 1C5CL 1K8DA 3NTCH 4PD4J 5EBLB 3ZHLA 3OKOA 3FN0L 1I7TB 1PKQA 5CUSL 1CICA 1GVIA 1V3LA 3BDBA 4Y19E 1HSBB 4RX4D 5ENWB 2IQAA 3VGEA 3QZWA 5GGUA 4CVXB 1IT9H 3LMJL 4NN6B 4LQFH 4IRZH 4P46A 1LDPH 5I1DA 4Z5RB 5EBMB 1IMHC 1HHJB 5E7BA 4OCYH 2RCSH 5F7KC 3PQYA 1S3KL 4JRYE 4MNGB 5EPMB 5I1IL 3NTCL 2VL5A 1JHKL 5CSBA 3DGCR 4ZG1A 1UJTA 1FNEA 1XIWC 4MA1C 1TZHA 2O5YL 4MNHB 1GOFA 5EU6D 2CDGA 5CBAB 1WCBB 4K7PY 2ITCA 4GKNB 1KB5B 1PVHA 4ELMF 1L9NA 4ODSL 4JCMA 2HT3D 4Z95H 4MXVE 3GMOA 3UTSD 4APQB 3HE6D 5KVGL 5DI8A 3FQXB 4FQHA 1G7IB 4S11A 3LN5B 1X5JA 3U46A 1ZA6A 5I1GH 5GS2D 4Z76B 4X9GA 4MQXC 5SX4H 4D0BA 3HC4H 4HGWA 4NBYB 3D85B 1CGWA 5CEZH 1IAIM 1LP9B 4JPWH 3DECA 1J7VR 5HY9A 4CVUA 3NFPB 3CZJA 3GM0A 4FQLL 3IVKA 5HYFA 1HHIB 3RZWA 4KRNA 1QG3A 4GXUN 3G08B 2APWA 1LP9E 2BNRD 3G04B 3GZKA 3ARBD 4OBRA 5TE6L 3MV7A 2G5BB 4K7PH 4G43B 5MHSD 3EDDA 5D6CB 4PREA 3X17A 5F7HA 3QA3A 2H6PA 4WVRA 4I18B 3H7LA 1A5FL 1HZHL 3VFWA 5F7DA 3CVIL 1BM3L 4KTDH 3DUSB 3MRIA 5JXEC 2FEDC 5BRZE 4GG6B 3MLRH 3UYRL 1QRND 2RHEA 4M4PA 2FATL 4IOSD 2ZUXA 1P9MA 4U05A 5AZ2H 4LLMB 4P4RA 4PJEB 1G7LB 1OB1B 6FABH 4HBQA 5KVDH 2EYRA 1CL7H 3IXTA 4PJCF 2XY2A 4LCIH 3S35X 3RVWC 4G43A 2LV4A 1Y0LA 4ZFGH 2WLZA 1MWAA 4AJ0A 2B4CH 3DTXA 4K7PL 1FYTB 2VXSL 4OD3L 3PJSB 3ZDZE 2IMMA 3EFFA 4Z7NE 4Y4HC 1IC4L 4PJ7B 2BY2A 4KGJA 4OCRH 4PTTB 4OLXL 4ZAKA 1NFIA 1CGXA 1NDMA 3B2VH 2X1PA 3EOBA 3GGWA 4OT1H 4M4RA 2IAND 3TT1L 4TSAH 3D85A 4N0YL 4WFHD 3JTSB 4RZCB 2BY3A 5TFSH 1N64L 4PRPD 1JNHA 3L95A 1JGUH 4DKEL 4L1HA 1UGNA 1N59B 1YQVL 5JIHA 3MGTB 3GI8L 4UTBL 2AK1H 3QIWA 3V6ZA 2AI0L 2APVA 1X5HA 4BQ8A 1KLGB 1KCVL 1KB5A 5AWNL 1MCOH 5HGBB 5FM4A 5C92A 3BKCL 2IG2H 2GJ6D 5FYJL 3BXNB 3GIZL 2FSEA 2GJ6A 3PV6B 4AIZA 3O4LE 3C60D 4PLOB 2E27L 1FVCB 4HKBB 4TUOB 1DUZB 4AEEA 5IB3B 5I1IH 5E9DD 1G9EA 1XGRA 2VITB 3D87B 3VJ6A 1R0AH 1C12B 4JRXD 4LCWB 1UA6L 2X40A 4KROB 5LWYH 5ITFA 4PLKD 1NDGA 1N2RA 1YMMA 1MCFA 4KKCC 3S35L 2IQAB 3IDGB 1QZ1A 5GGRY 3N85H 1WCQA 5CD3A 1IL1A 2F5BH 1I9JH 3OPZH 1L0YA 3IT8D 4DW2H 3TO2B 1AXIB 4HFWA 4LCCC 3ZLQC 1A1MB 2VLJA 2VR9A 4ZTPL 1MFEL 4KK5C 1K8DB 4PJCE 2V2WB 3MNWA 5K59E 4XBEL 5ALBH 5FCUH 1B0WA 1XGTB 4ODXB 3H9HA 4NSKA 5DJDB 5FGBA 2ARWA 1RJLB 4GRWB 4U1HA 5SWZD 3LEYH 4Z7NF 3HRZA 3IDYC 2A77H 1RPQA 1OAKL 2D7OA 3I2CH 1MCHA 2ADFL 3O41B 3TN0B 4P2OD 2GK0A 1KNOA 1V3MA 5ADPH 5D1XA 4H1LG 1H9VA 4OI8A 4Y2DB 4FQ1L 2VDNL 2CUMA 3OKKB 4I3RL 2QQNL 4PRDB 1FG2A 2FO4B 5KANG 4S1QL 3BPLB 1IEHA 1FBIL 1MJ7H 1YEKL 4WU7B 1UM5H 1X9QA 4V2CB 1EXUA 4EI6B 1AGDB 1UQSA 4ZS7L 3RWDA 3D9AL 4RIRB 4JFQB 2NXYB 1YMHA 1JWMB 2XYCA 3QI9D 4G8FB 2OTUB 4XX1G 3RDTD 2I25N 3FB5B 5DRWB 4JLRB 3UBXA 3S34L 1XFPA 3O6LH 2APXA 3HHRB 2GJZB 1EO5A 4ZFFA 1U3HB 2DJUA 1P84K 4XCCL 3R06B 3HZYB 3QWOA 1H8NA 2BC4B 1O0VA 3KPTA 5M7QA 5TH2B 4OZIA 2DIBA 4AMKH 4MDIA 1FVDB 1WISA 3OR7B 2VRAA 1QO3A 3FZUD 1KENL 4U3HA 2Y1VA 1ORSB 4HFUL 1ZGLB 3MUZ1 4QOKD 4PJEE 4QRRD 2Z31C 3MJ9H 1CDBA 2NTFA 4OLWH 2X1OA 4G8EB 1S5HB 4GRLB 3OQ3B 1CQKA 4F7PB 5C09E 4QRPB 3TA3B 4XCNB 3KPSA 4OZGB 1M7XA 4QF1B 4WFED 2WQ8A 5T3XH 4P99A 3RWIA 3MRFB 3WL9A 3O6KH 2DDQH 4ENED 3KWWB 1JUFA 4JQVC 6CGTA 3WFCL 4BFIB 3BD4A 3NA9L 4UT6L 4GAGH 4DTGL 4UDUB 4Z7UA 3H9SD 4XNXL 3UMTA 2HH0L 2FX8L 1T03L 4PJHB 3D6GA 1X3DA 5KJRH 1P7QB 1IGMH 4LKXA 2VTFA 3F7YB 5DDHA 5C0RH 3MTRA 1KIRB 15C8H 4JKLA 4DFHA 2BJML 4YDKL 3UAJD 1KYOK 4LLWB 1W0YT 1JPTL 2D03H 1MCPH 5MI0B 3EO1B 3O2DL 3GMMB 1ULVA 1FFNA 3U9PH 4KXZH 1PZ5B 4YPGB 4JPVL 4LSQL 1JF6A 1AFVH 2P5WD 3W0WD 4ODUB 1Q0XH 1N7MH 1FNGB 5DMKB 1JRHL 4PJ9B 2DMKA 3WJLC 2OMNA 1W2KT 1KULA 3K1KC 4P9MH 2YEZB 4R2GD 1YNLL 5A2FA 4XHJC 3U0TB 3MUJA 5TF1H 5IMLB 5HHMB 3I75B 2AEWA 4POZD 4W6WB 1KSRA 2JIXA 3QEHB 4BZ2H 3HMXA 2ED7A 3TV3L 3RL2A 3GJFK 4JRWA 1X44A 1ZT7A 5DC9B 3LB6D 2Z35A 1MHCA 4O9HH 1ZE3C 4MJIB 1UM6H 2X4NA 1QSED 5DK2B 1LD9A 2DS4A 3RPIA 5AG9A 3LDBC 3ARWA 2CKBH 1V5JA 1CICD 5HGHA 5J12B 1YDPB 2Y07L 3L7FA 1CFNB 3ARFB 2BXZA 3HE7B 2YPVH 3Q2CA 1RIHL 5FB8A 2E3VA 1LO5A 4AM0B 5DUPL 2F5AH 3X13B 1NH6A 3MBED 4GUPA 1JPFA 4C56B 5I8CA 3OAUH 5IFHL 4P5TB 4TULL 3D2UB 4ZFOL 1FRGH 4KXZI 3QNZA 1AGCB 1AGEA 2RB8A 4LLVA 5IQ7L 1R3IH 4FZEL 3BAEH 4GT7A 1OT2A 3IKCA 3QT2A 2VAAB 5F8QC 2R8SL 3QQ9D 2XPGA 1NCCL 3UAJC 5A1AA 3I3BA 5IKCA 1HILB 3LV3A 5FV1L 4WFFD 2HFEA 1M6OA 4RGNB 5AEAA 4CMHB 2NXZD 2ZSWB 3DYPA 4PBVC 4EIZC 4Z78B 5F6IB 5KSVA 2FCBA 2XXMB 5HHOD 1EHLL 1J1OL 5SWQA 1WTLA 2BVEA 5DFWH 1T20A 1NBYA 3QQ3B 4YDLB 1PKQE 3DSNA 2VLRA 3KXFE 1U3ZA 2IH1A 3QWRA 4LEXL 4ZNEA 3DX7A 3VXSA 4D8PB 1IEAA 1HXYA 1I3GL 4V1DD 3ESUF 2PYED 5JXED 1Q94B 5I1KH 4J1UA 2EDDA 3FB8A 4U1JA 2ICWA 2HT3C 4X4ZA 4HWZB 2BY1A 4TUKL 3WFCH 4QOKB 2BVOB 2CMRL 2PTTA 2VDLL 5FAAA 2JF1A 2L0DA 3T77A 3DX7B 5EU7C 1TTUA 4PBXA 1F02I 1MLCB 3V4VL 3VG9C 2Q8BH 3IRPX 3IU3A 4KKNA 4X6DE 2OLDA 3REWA 1J1OH 4LPUA 3TIDA 2JK5B 4ODWB 1D5IL 3CSYA 4XWOC 3VGGA 4O00A 5DZNA 2EZ0C 1JIBA 1UVQA 4XWGL 2YZ8A 5EZLB 2WUCL 4HULB 4MCYA 3D69A 2BNRA 2NY2D 1Q8MA 1VFAB 2ESVE 3AU1A 1FZOB 1UB5B 3BZFA 3B9AA 2AV1B 1PBYA 2I26N 2Z4QA 3N1GC 4YHMH 5IB1B 2DD8H 5DEFB 2D9CA 3MCKA 2WINA 2OBGA 4HS6B 2BCKA 4IMKC 3R1GL 3CK0L 1PD6A 2ITDA 2JELH 4Y4KC 5DUPH 5F96H 4OF3A 5EN2B 3DMMC 1A3RL 1EVUA 3L7EA 3QNYA 3VFTB 2AGJH 4NP4L 3NGBC 4POUB 3HB3C 5I16A 1I7UB 1J1XL 3V5DB 1S9XB 3V7AG 1L7IL 2P24A 3EYOB 4HLZG 3ARDA 5HPMA 2FWOA 2B1HL 5HGHB 3O8XD 1ZT1A 3QCUL 4YDJB 1NCUA 2C26A 1LO4H 4UV7L 1I3UA 5E1AA 3WLBA 3FMGL 5GS0H 3MV9D 2OJZL 1MJJA 2YPLB 3SGKA 4P23A 1FE8L 4KVNH 3K8KA 1JK8A 3PGDB 5GRJL 2YSSB 5EWIH 3FFCD 3QEHA 1BQHG 2JIXB 3GK8L 5CJQH 5BVPH 4A2LA 4AK1A 2BMKB 3TNMA 1P69B 2BVPB 4HS3A 1KCRL 1PQZB 5TF1L 5IG7A 2CR6A 5KN5B 3OJMB 4H88L 4HLJA 3F65A 1KJ3H 2VDKH 3GJFH 3LKNB 4AT6B 3RRQA 3WFBL 3QCUH 4EN3B 5ALCH 4PGBB 5E03A 2R2HA 4LHUA 3N1MC 1JRHH 3VH8G 1MWAH 5CP3A 4M48L 2ATPA 2RBLA 1W8OA 4WJ5B 1XT5A 1A3RH 4K3EL 1BWWA 1CFQB 2XIDA 4JHAL 1T5XA 1ZEAL 4GXVL 1GGBH 4XVJH 2F19H 2GFBB 3QULB 5GISL 4OCSL 5EBWA 4WEMB 5DFTA 3Q5YA 1U8NA 3P11L 1KEGH 1C08B 5HHMD 3ARDC 1A0QL 3UJTH 1DQQA 4IJ3C 2EDYA 4XGZB 4PJHA 2DLTA 3P9MB 4KJPC 2ZG3A 3T65B 2VXQH 3PWNA 3WXWH 3D1MC 4FFZL 5GGVY 1CTNA 2WUCH 4Z0BL 2WWKT 3HUJB 4P4KA 2VISA 3KWWA 1B90A 4I9WE 4FXKB 4PRIB 1KXQE 3ARSA 2GUOA 1INEH 3I85A 5EZJA 4GRLA 1FZKA 3CZFA 4PRBA 2W1NA 4WUKH 2IANA 1T1XB 4HWBL 5D1QC 5CMAA 4ZSOA 4HHAB 5HPOA 1G7HB 4IRSA 3KPSE 1LWRA 3U4BH 4F37F 3WMSA 4OI7A 2C5DC 3LAFA 4LKCA 4AMKL 1DQMH 4O58L 4F80A 4NZRL 3T0EB 5DGRA 4E0RB 1IQDA 2BHYA 3GHBH 4U1LB 4X6FB 5FK9B 2IAMC 4FP8H 3BZEA 3UTTD 2XWJA 4Q9BA 4GKSA 1N7ML 1X6NA 2XNAB 3ZSSA 3CLFH 3FB5A 3BUYA 5DRWA 4F7EB 3FJTA 4PJCA 1U8JB 1BQLL 3HFMH 4K9EH 1S7TB 3RWDB 1XCTB 4U1MA 4EI6A 1YJDH 5M95B 1UCBH 1JHTA 3D3VD 4JANA 4Q9RH 1UZ6E 3Q6FB 4N5EC 2PO6B 3I3DA 3BGFB 2P5EE 1A5FH 4LLQA 1S7WB 1L6XA 1QVOB 1QUNA 4OFVA 1BIIB 4YAQB 1F2QA 5DC0A 5KJRL 3BPCA 4P5TC 2ESVA 4O2FB 1MCDA 3SKNA 3ULVC 2W0FB 1CL7I 1J0YA 4HS3B 4ACPA 5TGBA 4F57L 5IB5B 1ZWIB 1BQHB 1KTDA 4JGMA 2DQCH 3U0WH 1BLNB 4G8GD 3SGEI 1K9TA 3RVTC 2B0SH 4ZAKC 4QXGL 1WEJL 5CEYA 4BH8B 1IRAY 1YN7B 2D3VA 2DWDB 3TLRA 2E5EA 4GFTB 3OKNA 1MHEB 1FAIH 3MBEB 1RZJH 1RZGB 4BELD 4O51A 4QHMA 3LKPB 3HI1A 3UTQA 2DKSA 1FGNH 5HPMB 3M1BA 1GAFH 5CEXB 3ILPB 1PEWA 4F2MA 4MB5A 3LHPH 5B8CA 2YD4A 1YMMB 1I4FB 3HAEA 3KDMA 1NDGB 2YUXA 5ADOL 5MENB 1F11B 4JO1H 1C1EH 3MRDB 4RMSA 2AEQL 4Z6AT 4NKOB 1MLBB 2J2ZA 2MCPL 2VITA 1GH7A 5EA0H 4KRPD 1UFUA 2F54B 2VLME 5SV3A 3BN9C 3L1OH 3FOLB 4JFPB 3EDKA 2IAMD 3V7MA 4OLYL 5J9PB 3MZTA 1GGYA 3QIUB 3VXUE 5HHQB 2WBKA 4Z7VE 4NUGH 4QHUB 5E95B 2OSLA 4NHCH 1KCUL 1Q9KA 4UOW1 4Z7VB 4N8PA 3X3FH 1ERNA 3AROA 4U2YA 4MMXC 2FJFA 4Z7OE 4LSQH 5DMYA 3KYMA 3T0DA 5C9JA 1AGFA 2XZQL 1P4IH 1A7BA 5DT1H 3UC0H 4OZIF 4HUVB 4WGWB 2F8VA 1IGYA 4TQEH 4QWWC 3W2DH 3F7RA 4UU9A 3ULVD 2HLFC 4P23D 3CFBB 3PDDA 4LMQE 4D3CH 2R23B 3W82A 1N5AB 4EXPX 4OCRL 5GS1B 2AABL 3B5GA 3B9KD 2EIBA 1U8KA 2AJSH 3HS0B 1KCUH 1CWVA 4NHCL 4X99A 5TQ0H 1JF1B 1SY6A 1RJZA 1WBZB 4NQDA 1FN4B 4QKXB 3QQ3A 5E2TL 4LSSL 1MFDH 2CKBA 3GBMH 4M5ZL 1TIUA 2D0GA 2H32A 2BOBB 3EYQD 4IIQB 3AS1A 4OFIA 3FOMA 3FQNB 2EIDA 4OLVH 5DJCA 1HINH 1KPVA 5D72H 1JFQL 3MLSH 5FYJH 3BKCH 2A9ML 2OCFD 4A2MA 5F7DB 5JW5A 1UWEH 1MCOL 1ZS8B 2YN3A 1JGDB 4TPRL 4R4FL 4J23A 2X4TA 1AGEB 3TNNA 1DVFC 1F3RB 1I8LA 5FO8A 1AR1D 3DPBA 4OI9A 2Q8AH 5ITBL 1VEOA 4GUPB 2R2EB 5IGXL 3MGAA 1LO5B 4AM0A 1HHKA 1HOCA 3EYFA 4LFHD 2VH5H 3TT1H 3AREA 4QYOA 1JL8A 5IW6A 3W9DA 4MD4B 1SJHB 2EE6A 1PLGH 4X80L 2ARJQ 3RWHB 4M7JH 2EYTA 3GMOB 4APQA 4LHQB 1GGBL 4M7JL 4UNVA 5CCKL 4UMGA 3CNKA 5A2LH 4CUCA 4CN6A 3GI9H 3W39B 4PGZA 1JI1A 2VQ1A 1JGDA 3VMNA 2ITCB 3NIFE 1KTLA 5JO5B 1KOAA 5LXGL 2NY4B 1EIBA 3I75A 2W59A 2O5YH 3QDJE 1TZHB 5C0AB 5F1IA 1F6AB 3IFNH 1Z0MA 4YX2H 4KI5C 4YDIL 4YO0B 4HT1H 2IALB 4C4KT 4GRMB 4XB7A 5DJCB 2VL5B 4ODTL 4EUPA 2EH8L 1DBMH 4K9EL 5D1ZC 4JY4A 3WDIA 4JZJB 4B53A 2W0KA 4NQXB 3O3EA 2IH3A 1HH9B 1DBKL 1RJCA 3VH8A 3WHXB 5KANI 4P46B 3AXLB 4Y2OA 4CVXA 2FD6L 4V2BA 1PZ5A 4YPGA 4NQDB 1FFNB 2XV6B 3V79C 2HWZH 3MRGB 4GSDL 4KROD 3OB8A 5HGDA 2P48B 4X4ME 3U4BL 3N1FC 3QXDB 3PWUA 4HUUA 5D6DA 3NCYS 5K33A 2B1HH 1JWUA 5CHNB 4LKXB 4YBLB 1BFVL 3IS1X 1S7RB 4PB0L 1KTKE 4OFYD 3TBTA 4X4YA 2GSIA 4Y4FA 2V5YA 3REVA 3LY6A 1HIMH 1DFBL 2JJTC 1BZ7A 2EKJA 3NIGE 2X7LB 3ZT6A 1OLLA 2CGRH 2QQKL 1R24A 4UAOB 2ZUTA 2F74A 4H1LA 3DI2B 3T09A 2XT1B 4R3SA 5EDXA 1S5HA 3DETD 3TGXA 1MFCH 4YHZH 5LAXA 4PYHA 2CDFB 5IW1A 4KJPD 5LGHH 3C5ZA 3QNXB 1PKOA 4PB0H 1IGIH 5GRXG 3LEXB 2H8PA 4QRTB 3I6KB 4KJQC 1MIEH 4YZFF 2VAJA 5TH2A 2HJKA 3I6GA 5F9DC 4XWGH 4D0CA 1R5VB 1F4WL 1U3HA 3SDDB 1KJVB 5DGQA 3SDDA 1LDPL 1NCTA 4XBGB 3QH3A 1NBQA 1UCTA 3VXMB 1AGDA 3SCMC 4XNUH 4OZ4B 4U3XA 2FB4L 4XX1E 1FG2B 2FO4A 4P3CH 1EPFA 5HHNB 5L0QB 4WDIB 3B2UC 1DJSA 4JR9L 3K2MC 4KV5F 3TPUB 1EO7A 5DO2D 4XVTL 3SDCB 2ICEB 2LTQB 1DE4A 1NC2D 4NC1E 4M8VA 3O3UN 2VDQL 3HLAA 2UZIL 1IGFL 3OB0H 2NY0D 4Y4FB 3REVB 1YMMD 2HTLC 1EAPA 5CFHA 4Z8FL 1JYNA 2BOCA 3WIHL 3QG7H 1FAKT 4KTEH 4ZOAA 4YAQA 1GGTA 4P59H 3QUZA 1JZ8A 5E8OB 4ONGH 4IJ3B 4KJWC 4XCFL 2NX5E 3CFJB 4HFWB 5CLWA 3RU8H 5BMFL 1G6RL 2R8SH 4HJGA 4PJDB 3MJ7B 2DD8L 5KW9L 4G8GB 3D0VB 2DIJA 5HGGS 1JZ2A 4RMUA 4S0TD 3GJFB 3NCYP 2G9HB 4G8GE 5C07D 5FXCH 2Q7YA 4ISVB 3RHWF 5IK3A 1G7JA 1MNUH 1MUJB 2NR6D 4QHLA 4X6FA 1HXMB 2OX5A 2A74B 3PV7A 1T4KB 4GRMA 1T7WA 4OD1L 1D5IH 4LKCB 2EDOA 2FSEB 3RX8A 1A6UL 3G5YA 5DLMH 5DK3A 4CJ0A 1UH3A 3C09C 1F4XL 2Z8SA 3WD5L 2Y5TA 4LSPL 1IGFH 3BH8B 4M02A 2DWEA 5GRZA 5IFJA 1MAKA 4XXDB 4B0MM 2VN7A 4EQ3A 5IHLB 4PRIA 5JA8B 3O6MH 1XF3A 4YDVB 1SM3H 1MFDL 3GBML 5IWLA 1N59A 2YRLA 1P6FA 4J12A 4KPHL 3HUJE 5CSZB 4PRAB 4WRLA 3GSXB 2PYFA 1G1YA 3T8XB 1DQML 4MD4A 3QR2A 1QR1B 5TQ0L 1Q1JL 5EIVA 3EOBB 3GGWB 4XNUL 3B6SA 1IC7H 4JFDE 2NW2B 3KPMB 1IM3B 1DEEA 4XP4H 4Z7QE 4HK0B 5EZIL 1Z3GL 5JOPD 3IDIA 3OGCB 2C3WA 1Q9WB 4DGIL 3LQAC 5F88A 4JPVH 4HMDA 1ZT4A 4XPTL 5MEOB 4ALAH 4KJWD 5K9JH 3OHXA 1NCCH 3ZE1E 3UTTE 5E2UH 5B8CC 2D7MA 5FUCE 2UVFA 4QRPD 1CF8L 2APTA 3EOYG 5ID1A 1I1AD 4NUGL 3LKNA 1KCLA 2A6KA 1Q9LB 4E5XB 2Y9RT 4X7SL 2HKHL 5D93B 1KJ2B 3OV6A 1F90H 5LJYH 2PNDA 2VR5A 5HHME 3MQIA 4NBZB 5MEOA 3MV8A 5KZCD 4MS8D 3UJIH 5D7KE 1AO7D 4JFFB 3PGDA 5FDYA 5F88B 3S3PA 2EZ0D 3ME0A 5FA3B 1LE9A 2HVJB 4RGND 5DD6A 3WLBB 4XVUD 2LAAA 5INDB 1SBBA 4XP1H 2Y07H 2YKLL 4QHNB 4JZJC 4HKZA 2FWOB 1N5AA 3MFGB 3QG6B 1F2XK 4NN5B 1F42A 3EYOA 2AP2A 4KVCL 1S9XA 5D2NB 2QQLH 2HT4C 1U6AL 3NFPA 5EUKA 5I73C 1IGYB 3TESA 1ZANL 1KCRH 3PWPE 1B0GB 3MPCA 5C9JB 5T3ZE 2MQ0A 3SE8H 1B4RA 4L4VA 4N8CL 1EEUA 1QFWL 5KVMC 5I8OH 5IP4A 1CDGA 2WINB 1FFOB 1XZ0B 4PJFF 3NOIA 5D93C 4TTGA 5D2LF 1LO4L 4JFOB 1DBML 4JQIL 4UV7H 3B9KC 2XRAL 4DN4L 1I1FA 4FQJL 3RWGB 3S4SG 3SKMB 4FTVE 4X6DB 5GGSA 2Y5TB 1WCBA 5D7SL 3GSWA 1NMBH 2DL2A 4MCYB 3BGFC 4OFPA 3U4EA 3CX5J 4Z7QF 5IVZA 1A1OB 1NQBA 2A74A 2EO9A 5DJXA 4UAOC 3BN3B 5JXAH 1X5ZA 2K7QA 2G60L 4F9PA 3JXAA 3L5JA 4XMPL 2BVQA 2G5RA 2XQBL 4S2SB 4NO5A 5IVXF 4LDEB 4L4TA 4F2MB 4KK9C 3MLUL 1JGEA 2ZUUA 8CGTA 1NAMA 2IADB 1PKQB 2X4QA 2VZ3A 2DKMA 2UZYB 4DUVA 3FT3A 4HWZA 5FYKU 3WNKA 1R6VA 5FF6B 4OKVA 5J6HA 4WUUA 3NPSC 3TBYB 7FABL 5BV7B 1MI5E 3B3IA 2IH1B 2DTMH 2P46B 4HF5H 5L2JA 4L4VE 3LD8B 2C3XA 4HFUH 1INEL 4GW1B 3WFDH 1DBBH 4G6KL 4RGOH 3K2UH 2VZVA 4JN1L 2YPKA 3ULVF 3QIBB 2GJJA 3M8OH 4RMVA 3UJIL 1AHWA 3IFPA 1KELL 4ZUVA 5INCA 3KJ4B 3MA9H 2NLJB 1VFUA 1GGIH 3S97C 3KYAA 1UH2A 4JANB 3T0VA 4I0CC 1FVEB 3DO7B 5I74C 1CT8A 1PSKH 4OF7A 1KCVH 4XCEA 3U6RB 3W9EA 2K7PA 4PGJA 4ZO7A 1UM5L 1U8JA 2BSTB 1N4XL 1S7UB 3BEWB 5I8CB 5J1AA 3P4OA 3Q6GH 3QCVL 1YY8B 4XVJL 1YEFL 3WJLA 5FYLD 1NFDE 1VFBA 3LDBB 2H26A 1CGTA 5TDNB 4U1LA 1JGUL 5FK9A 3Q1SL 3VD5A 5SWSB 1QBLH 4DKEH 4HGKC 2XWTB 4W4OA 3T0EA 4E0RA 1GPOL 2FH8A 2KH2B 1ZHKB 3JUYA 5F9OL 4ZUWA 4FQIL 3SHSA 4LAQL 4KDTA 3W2DL 4Z77B 4M1CD 3ARFA 3L3JA 3NN8B 4YFEA 3JTTB 5J11C 2X4NB 3SDXA 3CFDA 4PGDB 2YHGA 3ZDYE 3G6JF 4MJIA 5T1MA 5FHAH 3DGGA 5HYSA 4NQCE 3VXTB 3S96B 4MDJB 4OCWL 4RSVA 4OB5L 4ZTPH 4U6TA 3GFUA 3JV5A 4DW2L 3PWJA 3T0EC 3HG1B 1FE8H 1DQDH 3T65A 5L88L 4JQVA 1S7RA 2CRZA 4IIQC 5KG9A 1Q72L 4CMHC 5BZDA 5KSBE 5HVGB 5EBWB 1MCKA 1OP9A 4HUUB 1KLUB 1KB5L 3G5XB 4BFEA 5E94A 4PJ8C 5C0BD 4O2EA 4K8RH 2HT2C 2UWEA 5C7XH 4OD1H 1RHFA 3SDCD 1IE5A 5BVJB 4ZOEA 3MNVA 1DUYA 4JO1L 4ZFZA 1BGXL 5I30L 3TFKC 3SJVA 2I5YH 3IB4A 4HKXB 2IGFH 4HAFA 3G5XA 2OZ4H 3OX8B 3FRPA 5IQ9A 2VABB 1ES0B 4YHML 4ELMA 3AMLA 1P7QA 4AT6A 5FO9B 5CSGA 4AENA 4WHCA 3TT3H 2AK1L 5EIIA 1CD0A 3MLTA 1OD7A 1H5BC 1S9YB 3QEUA 4HQQL 3RU8L 1ZTXL 3TBWB 3PHOB 4F8QA 4XCFH 3GRWL 2FNBA 2YSSA 5I76A 1RK0A 4G7YL 4CADA 5D5MB 2DM4A 3MOAL 1FG9C 4OZGE 3B4NA 1G84A 2P5EB 1BVLA 1VKXA 4QRPA 3JTTA 3PWPD 1H3GA 3M17B 4CJ1A 2DQUH 4JZOB 3UTPE 5F44A 2HN7B 4YIQB 1YPZF 1G9MH 5ICXA 2ZPKL 3SDAA 4EDXA 2AK4A 1T03H 3PGCB 1I7UA 5IW6B 4DEPB 3HAEG 4OZIB 2NY6C 1E4KA 2IWGA 1YUHB 1JHKH 4DWHA 4WGVB 2H1PL 4FABH 2CXGA 4NC1C 4C4KO 1J8HE 4X9HA 5MEND 1V3JA 1M7IA 1N6QL 4OFDA 3R4DA 1I1AB 3HPJA 5MENE 3NFNA 3T0EE 1A21A 3TNNB 2X4TB 4EI5D 5MP6H 5CEZD 5E6IB 1ZS8A 4PP1C 1XGQB 3SBWA 3BW9A 5KTEL 4MJ4A 5E08H 3U30B 4H8WL 1DANT 9CGTA 1GHFL 5HSFA 1D7FA 4CKVX 3FOMB 1T1ZA 2YPKB 1KNOB 3TIDB 4NJ9H 5JW4N 4IIQA 4UBDC 5IHUL 1OARL 4R8WH 5JZ7D 4PLKC 5IW3A 4X9FA 3WSQH 3K3QA 4LNVA 4LSVH 1J88A 3DRQB 3O2VL 4GRWE 1MLCA 1XR8A 1BVKA 1KT2B 1XH3A 5J6GA 4IMLA 1T7ZA 4KQ4H 4WFGD 1MCWM 2OMBA 2ZWLT 4FQQB 4Y5XA 4CW1A 3C6LD 4S1QH 5SWSD 3D0LB 5IFHH 3IDYB 1A9BA 2YD6A 4QOKA 3PABB 4P5MA 3QIWC 4C57C 3P11H 1KEGL 5GGQH 1RMFH 4M7KL 4P59L 3TO2A 3WNNA 5DA4A 1Q94A 3V6OE 4ELKA 3L3OB 4KK6C 3VXRB 1ACYL 1HXYB 2PW2B 3JV4A 4EXKA 2VUOA 2VLJE 5D1QA 1UWXK 1OAUL 1AGFB 4GAFB 4OIIH 3SCMA 3JV6B 2GHWB 3MROB 4LSVL 3KYMB 1I9IL 3TJEH 3MR9A 4HSQA 3RI5K 3VXOA 2RAMA 2X6MA 2R4RH 1K85A 3N9GL 4Z7VA 1UG9A 4Q6IC 4GMSH 3MLZL 1RULL 5JORB 4P57B 1FVCA 1MFEH 3DVNA 1F8TL 1JBJA 4KMLB 2RJMA 4PY8I 1ZLUH 4JKPL 3VGAC 2L7UA 1KLGA 3QNZB 5JHLL 4ZUSB 1CDCA 3DVNB 4MLIA 4JDTH 3ULUE 1GCFA 5DVLA 3L5WA 3IFNL 1URLA 1IZKA 2EEDA 5E8DH 1AFVL 1MLBA 5IF0A 1TQCC 1S7VA 4MJ6A 1I1AC 4OZHA