4HLZH

Crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPWTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
publication title Structure of a classical broadly neutralizing stem antibody in complex with a pandemic h2 influenza virus hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
total genus 46
structure length 211
sequence length 211
chains with identical sequence J, L
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH01
3QFJA 4QXGH 4O51A 2NTSP 4PJEA 1NANI 4IDJH 4P49A 4XPHL 3MUY1 1ZT1A 2Z35B 4NJAH 1HYSD 1FC2D 2X4UB 1F4AA 2VXVH 4KI5E 4QRRB 4XXDA 3C5SA 2FO1A 3P77B 1OTUD 4RBPK 3FN0L 5E8OB 4Z7WE 4M7ZC 4BELD 3CFCL 3HZKA 3TNNA 1U93A 1IC5L 4HZLB 4NNXA 5JW5B 4MDIA 2HTKD 5T1LD 1SVCP 2AEPL 2D9CA 3MGOA 3MRBB 4K7PL 1S8DB 4MA1C 5L88H 1OSPH 1ITBB 3ES6B 4MNQB 3ZKMC 2F53E 2VKXA 1ODAA 4K7PX 3PDGA 4LLYA 5EFIB 3JTSB 3QEQA 4NIKB 3SCMA 4GW1A 3ZL4H 3G9VA 4RGMB 2DQEH 2P5WD 3QDMD 4I3RH 2AVGA 2J8HA 3DVGA 1UT9A 4TNWF 2VAJA 3DNKA 4QO1A 4O4YH 4RRPG 1MUJA 1DUYA 3BWAA 1K3IA 1R5VA 1YN6A 3LSOB 4HKZA 1EFQA 1EHNA 2E9WA 2DIJA 1YYML 1EX0A 1DSFL 5L0QC 1Q72H 4OGAD 4PJIA 3TC9A 3QUKB 1BF2A 1UKSA 2OZ4H 2ZUTA 3WUWB 4NZTH 2X4NB 5LXGH 2VRAA 1OTSC 3S34L 1PFCA 3C60C 5INCA 3VWKC 3I85A 4ONFL 4PJ5B 4AEHL 4PV9A 5D1ZB 1D6EB 3GGWB 4RQQB 1ZANL 4WU5A 4UIKL 4CMHC 4JKPL 1U58A 3EDDA 1MQKH 3BDBA 1RHHA 3RX7A 5ADOL 5ADPH 1FGNL 3RAJL 2DI7A 3V8CA 4AEEA 2ZCHH 3MJ9A 3BFOA 5EOTA 4GG6E 3OJMB 1JJUA 2XXMB 2EYSB 5CJ8A 3GMMB 3V5KB 5JR1H 3BN3B 1R3HA 2A74B 4HUMB 5FKAA 3SKJL 4I4WB 3ARED 1GGUA 3RUGF 1NC4A 3QEHB 1HILB 3OQ3B 1ZWIB 4BSVB 3IDXL 4AIZA 4P2QA 2WMPA 4JR9H 5HPMA 1DDHB 1FNEB 3KJ4B 5GZND 1HHGA 2H9GA 4PRIA 3V6ZA 4Y4KD 4PLNC 2JELH 3CK0H 4U1LA 2R4RH 4GKOA 1ZVHA 2BVOB 1N6VA 4NN7B 2AK4B 3HZYA 3NIDE 1OD7A 3KPPA 5DJ0A 3IJHA 2O5XH 4IRZL 4R26L 5EZLA 1NH6A 2H2SD 3BH8A 3HC3H 1MJ8H 4OZ4A 1ZLWK 5F7KC 5KSBB 5HYSB 4DN3L 3GSOA 4Z95H 1UKQA 3RY5A 4CVZA 4G9FA 3DXAD 1A6WH 1IC7L 5GS0L 2X9YA 4PRAA 3S5LA 4MCYB 4LRIC 4BZ2L 4Y2DA 4M7JL 4Z0XA 1BPVA 3K74B 2DDQH 4YHZL 1GGBL 4BFIB 2J88H 3T0DA 5FGSA 1YA5A 1MPAH 3CPLA 4DKEH 1HHIB 1I7TB 1OAXL 5FYJL 1QVOA 5K59E 4F8TA 1IAIH 4KC3B 3KWWA 3D1MC 1S7UB 4ODVH 4DUVA 5M7QA 3VXMA 5E95B 2G9HA 3GI8H 4NQED 4FQ1H 3L7EB 4G80B 4HPOL 3AY4A 2FZ3A 3MGTB 4Q6IA 2BVPA 1NL0H 4WW1B 4YQXH 2PNDA 2HH0L 2G2RB 5EZOL 5EBLA 5C0RL 2DLHA 3WFDH 1I7ZA 1PKOA 3OXSA 3LDBC 4U1JA 2XN9B 1H15B 5ALCL 1JFQL 1WAAF 1FRGH 3HFML 4LCCA 4TPRL 1NLBL 4QY8B 2MCG1 1CGTA 5AZ2L 4PJXB 2YMXL 5EOQH 3CLFH 4BZ1L 1JF1B 2FDBP 1NCNA 4IM8A 1R5IA 5GPRA 5KSVA 3LKSB 4N0CC 1ZTXL 4JREB 2FB4L 3V0WH 1ND0A 1KULA 2RHEA 2N7AA 4FQHB 4U1NA 1RUQL 3JV5A 2ZP0T 1B90A 5C09E 2WBKA 3JUYA 5TE6L 2BRRH 1YEIH 5DF0A 1I9IL 1X5XA 3U7YH 3MLVH 1PYWA 5I1IL 1INEH 1CR9H 1GHFL 2A0LD 3H9SA 2Q20A 1NLDL 3JUZA 4K3EL 1MSPA 2XFXB 3TCLA 5GGTH 4FFWD 4IIQB 4DFHA 3SO5A 2DBLL 3VFPB 3T2PA 5BV7B 4P23A 4JKKA 4L8CB 3TN0D 4L3EA 1MJUL 4R90H 1SYSB 4Z7UE 1DEDA 4F15C 2E7LA 1BQHG 4UV4L 2M2DA 5LBSH 5FO7A 1AO7E 4PJCA 5H2BB 1I9JH 3DVNA 3UTOA 5DMKB 3LHPH 3HC0A 1AI1H 4GAJH 3L3DA 4JY5L 2F54E 3EBAA 4NUJB 1BFVH 1NUFA 2H41A 1XEDA 3O3BA 5HHQB 1YEJH 5DRZA 3PQYE 5L7XL 4YBLC 1NBVH 2VLLA 1BGXL 5J11B 4QF1B 1EK3A 1U3HD 1QA9B 3IDYB 5HHME 1ZHNB 1UJ3B 4OGXH 4UINL 4WWKD 3U7WH 3TPUB 3GMNB 2DWDB 4NJ9L 5I74C 4LHUB 4X7EC 4Z76B 4P5TA 3MRRB 5KJRL 5DDHA 2BDNL 5GS0C 1G6VK 3DRQB 1GPOH 4BQ6A 1D5BA 1KTLA 2B0SL 2HFGH 2ZJSH 2UY6A 3D18B 3F7VB 1MI5B 5DK0B 4G3YH 4DZ8B 5EWIL 3BKJL 3OB0H 1C5DB 4OCRL 5MEND 1CDGA 1GSMA 2J7LA 4KRPC 2GHWB 3RWCB 5ERWA 4K9EL 3K2UH 1ZHBB 3FB8A 2CIIA 3WFEH 3BKYL 1RIHL 5AD0A 3SGJA 2JIXD 5I66A 5C0CB 4NQVA 1MCWM 3WN5A 1T1YB 3ARBC 4WGWB 1FVEA 2GQHA 3MRKB 4EXPX 1T2QH 5E2VH 3W81A 2ADIA 1LK2B 1CQYA 1N59A 1A4JA 3REVA 1SJEA 2ZSVB 3G6JB 4JQIL 3WFHA 3SDAA 4LCWD 1MRDH 2VR5A 1WBYA 1CN4A 5DD1L 3LPWA 3QUYC 2JLLA 1BD2B 5I1CH 3KHOA 1I1YA 1UWXK 2Z31A 5KVGL 1MCJA 4C56E 4TVPD 3HE6B 4DFIA 2YK1H 5BS0E 4TRPL 3KG5A 4P2RA 1HH6A 4X6DA 4S2SB 1MAMH 3V7MA 4OUOA 4WCYH 5INDB 3QDGD 3HPLB 3HNVH 4HV8A 4O02L 1QBAA 1U8JA 2NCMA 3C2SA 3JWOH 3T3PF 1BJ1H 1PG7W 1TPXB 3IFNH 1Q9KB 1S9YA 1D5MB 2IPTH 2B4CH 3FB5B 3QUMB 2R39A 1AFVL 1O5DT 2D7TL 4CL7A 4R7DB 3MV9B 3CVHB 5D6CB 4JQXA 4NO3B 1TNMA 3BZFA 5T1KB 2YA1A 4YJZL 1G7JB 3DYOA 3T0EA 5B8CC 1P7QA 4KHTH 4APQB 1Z0MA 2I24N 3TO4B 5IB4A 4JAMA 1WIUA 1CF8L 3JV6A 4G6KL 1RUKL 4V1DA 3CXDH 1QR4A 2NXYD 1S7SA 4NSKB 3AU1B 3EOAA 5EC2B 1KPVB 5GRWA 3BPCB 3DV6A 3MJGX 3PUCA 1W2KT 4U49A 5FGCE 1FE8H 2OQJB 2HWZH 3WIIH 4I77H 4UTBH 3DX8B 2Z35A 5HXMA 2X4UA 3EJJX 4QRRA 3RNQB 3MLYH 1F3JB 5E5UB 3ULUL 4M5ZH 2L4OA 3P77A 5E8OA 3V79C 4HZLA 5JW5A 2ARWA 4KVNH 3OR6B 1BVZA 4KVCH 2W91A 2CJUH 4ALAL 1SBBA 4H1LB 1C5BH 3MRBA 3IVKB 1S8DA 5F93C 5IFHH 1PY4A 4K9EC 4LLUB 5F88B 3ES6A 5FK9B 4MNQA 1JNJA 1XMWA 4LPXA 3EYUH 5EFIA 2WANA 1ZEAL 3O45B 3JTSA 1CTOA 5C6TL 5KS9B 1T20B 4D94A 1G6RL 4EI5A 5E08L 1FIEA 4TSBL 5C0GB 1L9NA 1QQDB 3OWEA 4WIQA 3V7AE 4Y5YC 4FNLL 3DROB 1EGJA 3LSOA 5TFSL 3QHFL 2P5EB 1XF1A 1P7HL 4NQCB 3HG1D 5JO5B 3TP4A 3JVGA 3QUKA 4HUWB 4U1GC 1RZ7L 4PJAE 3U4BL 5I30L 5DHYB 3V5DB 3WUWA 4PY8J 2X4NA 4GXVH 1DQJB 4Y1AE 4H5SB 5GGSY 2R1XB 1CXHA 1X9QA 4Y19B 2ERJC 2W9EL 4PJ5A 4KJYB 5D1ZA 1D6EA 4GMTL 4WHTB 5CD3A 3GGWA 4RQQA 4N5ED 3QCTH 4GS7B 5A1AA 2IWGA 1G1YA 3D3VB 5BZDB 4EUPB 3MNWB 1NEZB 5I17B 4TUOA 3TBTB 3SE3A 3C6LD 5DRNB 2MCPL 2EXYD 3PGFL 2EYSA 1XF3B 1JNNH 3GMMA 3V5KA 1CICB 4WI8A 1JRHL 2A74A 4AK1A 1LWRA 4UILH 3V7AG 3QEHA 1HILA 3L5HA 1ZWIA 4BSVA 4EIGB 2VTFA 2VIRB 1DDHA 1FNEA 1NFDF 2YUVA 2P24B 3WS6C 4MX7B 1HEZB 2B2XH 4E41E 4HWBA 4HCRA 4NZUH 3NPSB 3DI2B 4Y4HB 2BVOA 2AK4A 3ZSTA 3VDAA 4NKOB 3BH9B 3U82B 1JGUL 1JGLH 1E4WL 1L6ZA 3ARDC 1TETH 3VGHA 3N85H 5KSBA 1CD1B 3RVVC 5HYSA 4KKAD 1IKNC 1I8IB 2VERN 2WWMC 3ULUC 5J06A 4PJGB 4DN4L 4MCYA 4EN3B 1A7QH 3BQUB 1RIVL 3MC0A 1P6AB 2BNRB 4BFIA 4PGZA 4A6YH 2DMBA 5IESH 3CX5J 1R3IH 3TF7C 3Q1SL 2UZIH 1K6QH 1JVKA 3BUYB 3GSNH 3SDDB 3D6GA 1HHIA 1I7TA 1QRND 4LU5L 4EDWL 3I2CL 1S7UA 3BPNB 2DL2A 1RK0B 4OM0L 3D2UB 4ONGL 2N1KA 3L7EA 4G80A 3BHBB 1Z9LA 3MGTA 4GKZB 2FWOB 4KFZC 4WW1A 5FA4B 1EMTL 3C09C 3CFEB 4HBCL 2G2RA 1FG9C 1HQ4B 4FQJL 3ROLB 4JVUA 4NC2B 1OGTB 2XN9A 2QQLH 1H15A 2I25N 5CEZL 2NY2D 5FYLD 3ARFD 4QY8A 2YN5A 1DCLA 2FNBA 4PJXA 4P9HL 2NY0C 1MFAL 5CCKH 2CLVB 4YH6A 1NMCB 1NBQA 1JF1A 2R29H 4MXVE 4O2FB 2I60L 4BJLA 3LKSA 4QHNB 2DLTA 5EUOE 4M7LT 4FQHA 5C0BB 2EE3A 1JPGB 3G04B 4NWTL 1JGVH 1SEQL 1PQZB 4N8VG 3LQZB 3ZMRA 2XFXA 3CXHK 3IDUA 3IRZA 1J1OL 2BNQA 4IIQA 3IAQA 1V7ML 3QP3A 2QLVB 5HYJE 1VFAB 5B4MC 3VFPA 3T0BA 5D7LE 4L8CA 1SYSA 1NCWH 1JIBA 5T5NG 5H2BA 4OLYH 5DSCB 1GYAA 5DMKA 2RAMA 4YEFA 1A7NH 3R0MA 3I3EA 1AD0B 4JPIB 1MREH 1DBAH 3WMSA 4MQ7B 4D3CL 4MQTB 4J4PC 5HHQA 4YZFE 4YBHA 5E9DE 4QF1A 3FRPG 1A9BA 1T04B 4OLEA 5E8EB 1QA9A 1CD8A 5IB1B 1ZHNA 2UWEF 1UJ3A 5C2BL 3TPUA 3GMNA 3SHSA 3X11B 2DWDA 4LHUA 4ZUTB 1OTTC 4Z76A 4CAGA 3MRRA 2QTEA 5KANG 2VDLL 3QRFM 3ZTJG 4Z7VB 3DRQA 4KK6C 3QEGH 1QFWM 3CVIH 3D18A 3F7VA 1MI5A 5DK0A 4Z77B 4DZ8A 1C5DA 4X9HA 5CINL 3UTQB 3RWCA 2R0ZL 4Q97A 1ZHBA 4Y5VB 4UTAL 3CLEL 1HKLH 5MHSE 1JF6A 3O6MH 5C0CA 4KU1A 1T1YA 1G9EA 1D5XB 3MRKA 4ZOCA 5IWLC 3CDFA 3Q5TA 2AP2A 4L4JA 1LK2A 1TITA 5KVDL 3V0VB 2ZSVA 3K7UA 3G6JA 2EH8H 3TYFB 1VEOA 1FFPB 1JRHI 4HJGB 3UP1A 5FYKL 4LLAA 3EFFB 1QSZA 3GIZH 2CK2A 1OAYL 4GAGH 2NY7L 2K9UA 4IRJC 4W68A 1BD2A 2P8MB 4P99A 5C6PB 5I76B 4M6NL 1P69B 1L7TH 5I2IB 5FUZH 2F19H 2DMKA 5E6ID 1SJVA 1X6NA 4KJWD 2PTTA 3HE6A 1UWGL 4X4MA 4TSAH 2P5WB 4P9HC 5D7IF 4K71B 4M1DL 5DXWA 4RFNB 1C16B 2MPAL 3GI9H 4S2SA 1GAFH 2AEQH 3UJJL 5INDA 3SJVE 3S36H 2CUIA 3O6LH 2EDTA 5DJ8B 1FFOB 3C5JB 3RHWF 5TDNB 5JIPA 4NM4L 1Q0XL 1Q9KA 1D5MA 3FB5A 1HINL 3QUMA 2NYYD 2VSDA 2V7HB 4PG9A 4JM4L 3MV9A 4R7DA 3CVHA 3X3FH 1W72L 5D6CA 4NO3A 4H26B 5T1KA 4TULH 1FBIH 1G7JA 3TJHC 2A6JB 3GK8H 1FVDB 4PR5B 1CFVH 4APQA 3SBWC 3TO4A 3ZKND 2R56L 1JK8B 5FO8B 5BO1L 1IC4H 2OR9L 5C08D 4L4TB 4CJ0A 2PO6D 5LGKA 4E5XB 3ULVE 4NSKA 4ZNCD 5HDBE 3QXAB 3AU1A 1KPVA 4ZXBD 1BJ8A 3BDYH 3S96B 3BPCA 3MRPB 5DJCB 3RZWA 2J5LC 1A7BA 2OQJA 3QI9B 1Z3GH 3DX8A 4YHLL 3GKWH 2BXZA 3UO1H 3TESA 2EDFA 4CGTA 3RNQA 1ORQB 1F3JA 3TLRA 3B3IB 4XPFH 3SOBH 1JMXA 3O8XC 3CSGA 4FS0A 1RJCA 4UV7H 1WT5A 5M94B 3MJ9H 1JTPA 3OR6A 3ECBB 2OR8A 3QQ9D 3HAEH 3PNWA 4Y2OA 1A02N 4H1LA 1JI2A 1YZZA 3IVKA 4IOFD 5GRUL 1TQCB 3GM8A 3ZKSD 3MJ8B 4LLUA 4CMMB 5FK9A 3HR5B 3O45A 3QQNA 3GJFK 2AS5M 1T20A 4MB3A 5LKNA 4NHCH 5C0GA 4XCFL 1QQDA 5DEZA 4JFED 4F9PC 3DROA 3TIEB 5EC1B 5HHOD 5SX5K 1WFOA 2P5EA 3HHRB 5LQBL 3LKNB 2APVA 3GMPB 4UB0H 4NQCA 4QRQB 3LAFA 3OPZH 5J56B 5JO5A 2FX9L 1T89C 4HUWA 2CLZB 3V5DA 5BOPA 1KB5H 1KT2B 3HR6A 2H45A 4S1DC 1DQJA 3A6BH 2AGJH 3LPGA 1U2CA 2IFFH 4H5SA 1CE6B 1N7ML 2R1XA 1DLHB 4LCIL 4YDKL 5HBBA 1R3LB 4Y19A 4KJYA 4WHTA 4F57H 1I1AB 3FQXB 3L6FB 4TUKL 1A6PA 4YWGH 3RL1B 3QDJE 5T3XH 3D3VA 5BZDA 3O3DB 4EUPA 3MNWA 1NEZA 1M7IB 5I17A 4JN1H 3TBTA 3RX8A 1YY9C 3QUXC 3C6SB 4JDZB 3TBYB 3GHBH 2KUTA 2XKUA 5DRNA 3OAUH 1KN4H 1XF3A 4Z8FH 5B39G 3NZ8B 1CICA 2JB5H 4WW2C 4LASH 4KKCD 4NQTA 3X12A 5T33L 1P84K 2VLJD 1QLEH 5HHVL 1HI6B 5CBAB 4L4VD 4LIQL 2VIRA 1XF5B 3T09A 4Q74A 3RY6A 2P24A 1CDHA 2AAVA 3RRQA 1C8PA 3MLZH 1BF8A 1CIUA 4K07A 1RPQA 4FFYH 5F6IB 4NKOA 5AZEL 3EDKA 3BH9A 5HYQB 4NQDB 2R69H 2W92A 1UM4L 3HNSL 1XGPB 3U9PL 1G7HA 3HB3D 4M6OL 1CD1A 1OAZH 1QEWA 2ZG3A 1J0IA 1I8IA 1FVCB 3VXSD 2CK0H 3CXHJ 4PJGA 2YRLA 4EN3A 3MBEC 3KXFE 3BQUA 1U3HB 1UEYA 4WWKB 4LF3B 5FAAA 2BNRA 3DETC 1N64L 1QFUL 1MCCA 4RA3A 3L1OL 3VD4A 3BUYA 3SDDA 3TIDB 3V5HB 1VHPA 5F3BB 3P9WB 1QSEE 3L3IB 5H35B 1OPGL 1RK0A 3D2UA 2VZUA 3HC4L 3RDTB 2I07B 2GJ6E 3BHBA 4FP8H 4KI5C 4GKZA 3Q5YA 2FWOA 3NCEB 5FA4A 1FFRA 3GO1L 3G6DL 4LPCA 1JPSH 3CFEA 3EYQC 1HQ4A 3ROLA 2JIXB 4PLOB 1OGTA 5DA0B 4RWHA 3BGMB 3HNTH 4WO4B 1VCAA 3NCMA 4XC1L 3PP4L 5DMIH 3LEYH 1BECA 3GKZA 4LAQL 5SWZB 3WNPA 3V95A 2CLVA 2A6KB 4NBXB 1H0DB 3EOTL 4YUEH 4O2FA 1Q94B 4J6RL 4FTVD 2NW2B 1XT5A 4QHNA 3QNYB 2WM0A 3P9MB 5C0BA 5KG9B 2OBGA 3WNNA 5IFAL 1MFNA 1JPGA 3G04A 3RWHB 5F1IB 5GJSH 1KCSH 3NFNB 3TA3C 3QRGH 2AJXH 1PQZA 4PFEA 3LQZA 4NM8H 4XPHH 4OTXL 1VFAA 4XB7A 3B2UC 1DL7L 3KPNB 4HUVB 2R23B 2W0KA 4M1CD 5J12C 1QBLH 5K93A 3FAWA 3RKPA 5J6HB 4JZOB 4GFTB 4KKLD 5EO0A 5C8JB 5DSCA 1AD0A 4JPIA 4XT1C 4MQ7A 3E8UL 4X6BB 3WSQL 2ITDA 3MXVH 2X9XA 3V4VH 4DVRL 5EA0H 2A6IB 3JZ7A 1Z0NA 1FYTD 3BN9D 5TE4L 2CIKB 4DGIL 1T04A 2FYYB 4WUKL 5E8EA 4URTB 3V4PL 5IB1A 4MB5A 4HUKB 2Q6WA 3QHZH 5FF6B 3RZCD 4ZUTA 3NCFB 5I75B 3MOBL 3RWGB 3I6GB 3QDME 3ZDXE 4Z7VA 1T2XA 2CXGA 5D96C 4XVJL 3BX7C 2B5IC 3W39B 3ARYA 5HDLA 3SKOB 4Z77A 4U7KA 3UTQA 5D7SH 1JBJA 1YPZF 1CZ8H 2EZ0C 1W0YT 4OZIF 4ZNEE 4KQ3L 4Y5VA 5TE7H 3NIGF 1WWWX 3HUJE 3F8UB 4FQCH 1D5XA 3V0VA 2DTML 4JDTL 3TYFA 3LRGA 1FFPA 4HJGA 5A16B 1N8ZA 3EFFA 1QYGH 2PETA 1IGML 1KBGL 1RJZB 1UEMA 2OJEB 1FIGH 4OD2A 4YGAB 1CXIA 4XI5D 5F9JB 4XNYH 5KAQF 2P8MA 3MTRA 5I76A 2KKQA 3NGBC 5I2IA 4MJ5B 1B4JL 4ZUSB 2P5WA 1VB9A 3CAFA 4M48H 3AVEA 2F58L 3SKJH 3H3PH 1C16A 4PD4J 4ZOBA 5T5FH 1N5AB 2Q8BH 4OCNC 1PSKL 2XWJB 3WD5H 2R2EB 2AXFB 4RRPA 5DJ8A 3UTTD 2APXA 1XIWD 2FCBA 1FFOA 5FOJA 3C5JA 4NZRL 1CK0L 5TDNA 4OF6A 5IT2L 2E7LC 2V5MA 3ILPB 3VMNA 4QRPB 3IS0X 1CD0A 1Z9MA 4H26A 3NVQA 5C9KA 3CJJA 5E00B 2A6JA 1FVDA 4PR5A 3DXAE 5GHWL 4S10A 4ZS6D 4PJDF 3RVWC 5FO8A 1CXLA 1FNAA 1TJIL 3OGOE 5EBWB 2B20A 4L4TA 4TNVF 3QIUC 4GRWB 2HT3D 1J1XL 3KR3L 4E5XA 5IJKA 1QNZL 3VDCA 3QXAA 4S11A 3S96A 3MRPA 2C3GA 4FXKB 5DJCA 1ES0A 4YFDB 4OZGE 1HHJA 1RUAL 2APTA 4P5TC 2OI9C 3K3QA 3L7FB 3RGVB 3RUGE 3QI9A 1VEPA 3VGDA 2Y4SA 4C4KT 3LKQB 1INQB 4ISVB 3DIFB 1LGVA 1ORQA 1LO4H 4NQEE 3I9GH 5L2KD 4XNQB 3B3IA 2LU7A 4PRPD 3UZEA 1CLZL 3KPQB 2V9RA 1EHXA 2UVFA 1YY8B 4LNVA 1KN2H 1MCQA 4LL9A 1O7VA 5CGMA 5K9JH 1AHWB 3ECBA 3V6OC 2QEJA 4LKXB 4MJ2A 1JFQH 2OMBA 3HFMH 2HT2C 1JNHB 5C0NC 4NNPL 2YKLL 4X9BA 1GGIH 3MJ8A 4PJ7E 3SDAC 4QTIL 3DV4A 1P84J 5ID1B 4CMMA 3GUTB 3HR5A 1EGJL 2G75B 3WDHA 4HWBH 4HCRH 1MIEL 5DFTA 1XAUA 3ABZA 2DKMA 1V5JA 1GVIA 4LSRL 4XCYA 1JHKH 3OAZK 3S8WA 3MMEB 4OCLC 5GGSB 4X6FB 1U92B 5ISZD 3QWQB 4MMZC 5A2KH 3TIEA 1DQDL 2ITCB 5EC1A 1F4YH 1U41A 5F71A 1NFDB 2PYED 3LKNA 3GMPA 4O9HH 4QRQA 2OXGA 5IR1B 4BSWB 2CLZA 1KT2A 3E0GA 5JHLH 3KVQA 4EEEA 1DLHA 2NX5D 5H37G 1R3LA 2XQYK 4JQXC 3ARFB 2XV6B 4LFHD 1RQ5A 1I1AA 3FQXA 3L6FA 4JFDE 3T0EC 4K3JL 4HXAL 5IOPB 15C8H 5DJXB 3B9KD 4WFFD 3LB6D 5TQ2L 3O3DA 4IOIB 1S7WB 3MCLH 5JOEA 5JA9A 3C6SA 1OP3H 5BOZG 4PJFE 3TBYA 3S35L 1YUHA 2MHAB 4JM2F 2GT9B 3QG7L 3MACH 4IJ3B 3NZ8A 5KJRH 4K8RL 3MV7D 1QOKA 5FM8A 4JHWH 4UBDC 2B0SH 5MI0B 1FPTH 5CBAA 3S35X 1VKXB 5HD8D 1HI6A 2OL3B 4XNMB 4N8VB 1HYRC 1XF5A 3V6BR 4XPBL 3BKJH 1NGPL 4WJ5B 4HAFA 5E2TH 5JXEA 5MENE 2D03L 1TJGH 1CWVA 3LD8C 4NRZB 4KRLB 4ERSH 4LEXL 4KMTL 1I3VA 4HPYL 1BQHA 1L4IA 5MP6H 4ONHB 4QTHB 5HYQA 4NQDA 4E0RB 1XGPA 1WAAA 1INDL 1OM3H 3EOYG 5B3JE 5FCSH 4JQIH 4ZD3L 1CDCA 1FZJA 1S7RB 2BZDA 2R0WH 3VD9A 4LCWE 2DYPD 1V3KA 4HH9B 1BAFL 1NCAL 3CH8A 1RU9L 2JJUA 3O9WD 5BV7H 3TYGL 1U3HA 3JTTB 3K2MC 5TDPB 3DHJA 1AJ7H 2FH6A 4WWKA 1T3FB 2R0KH 4JM2D 4QOKB 4XZUB 4TVPE 2VLRE 5DUML 3BYTA 1ZLSH 2NZ9D 3TIDA 1NGQL 3AXLB 2VXQH 3V5HA 4TRPH 2BVEA 4D9LH 5F3BA 3FJTA 3L3IA 5H35A 3QCVL 1ACZA 1WLHA 5HI4D 3TWCH 3W82A 3RDTA 2I07A 1QBML 3QDGE 3O0RL 1T83A 1OGAD 3DUHA 2DQCH 4NN5B 5SWSD 3IDMB 1OAUH 3B43A 4KK9C 4M8QB 4YAQB 4JN2B 2JIXA 3EGSB 1F4WL 1TXKA 5IHLB 2ZUUA 4B53A 4M62H 3BGMA 4U6HB 4RGOH 3B8YA 4WO4A 4P9ML 4S1RH 2AI0L 4HUNB 4OZFB 4XP1H 4YPGB 4ELMF 5SWZA 1HOCB 5D1ZC 4RDQG 1OAKL 2A6KA 1KLFA 1H0DA 4G6AC 5HYEA 2DKUA 1Q94A 4PJ8D 5B4MD 1KEML 3QNYA 2E8ZA 4N5UA 3P9MA 4L8BB 4PJBE 5KG9A 1I4FB 1WK0A 2J8UF 4OCSH 2HLFC 3QHTC 3RWHA 5F1IA 5E6IB 5C3TA 2EE6A 3NFNA 1BBDH 2XACC 4PPTA 5E0QA 3SE3C 3VFUB 3MBXL 4AG4H 3QXVA 4I0PD 1OARL 2VDMH 4HQQL 1CBVH 5E1AB 5CFHA 4KZEH 2DQIH 2VDOL 2VITA 3LV3B 5MERB 2NY1B 1WCBB 3T3PE 3KPNA 1J1PH 4OKDA 4HUVA 2R23A 2Q7YB 1D9KD 5J6HA 2IALB 3JBG7 4K8RC 1URLA 3SDXF 5C8JA 4NN7C 3Q6GL 3HLAB 1T66D 1WZ1H 5D71H 5IEHB 4PJ9D 4X6BA 4JPVL 3DO7B 1A7OH 2EXWD 1KOAA 2A6IA 4J7RA 4M61B 4KK6D 5K33A 4F37F 4H0GA 1CU4L 3O6FC 2ED8A 4ZAKB 1TZGL 2CIKA 3ARGC 2FYYA 5GRYA 1J88A 3F6LA 3WJJA 2PO6B 5TF1H 1CDUA 5C6TH 4Q58C 1F6LL 3QUMH 5HHXL 3VH8B 5FF6A 4ZXBB 3RWGA 3CVHH 3I6GA 5I1HL 5D7IB 4RSVA 1OT1A 3MRQB 4HFWB 3IAPA 3H3BC 2ICWJ 3W39A 5J0BA 1F58L 4G6MH 1QR1B 3QQ3A 3SKOA 5BS0A 3QHFH 5D1XD 1FCGA 3HG1E 1FORL 1A6UH 3EUUA 3SDYL 2Y7QB 3ARQA 1WF5A 1IAKB 1YYLL 1HCFX 1F3DH 4NOBA 3RP1A 3ZLQC 1MJ7H 4CW1B 3D39D 4EOWH 4MD5B 4HS8L 1YQVL 5A16A 1FN4B 4XHQA 5ICXB 4MA3B 1RJZA 2OJEA 3H9ZA 1DN0B 5EU6E 5F9JA 3DX6B 1KTRL 2KBGA 1Y6NR 3M8OL 4MJ5A 4ZUSA 2MCPH 3QA3B 4JFOB 1T4KB 1CLCA 2APWA 5CJBA 2V9TA 1II4E 2WUCH 4KTEL 1C1EL 3NACH 1CVRA 1N5AA 4P3CL 4H1LH 2FLBT 2XWJA 3VXRE 2HFTA 2R2EA 1RVFL 4M6MH 2AXFA 4YHMH 5T3ZE 4FZ8L 4W6XB 4U6TA 4J3TA 1EA9C 4WTZA 1LDPH 3EDFA 3QAZB 2WSKA 4MAYA 4JJ5B 3NZHL 4QRPA 4ORZC 2IBZY 3SPVB 1JGUH 4BSJA 3KNBB 1DQMH 1A6TB 1E4WH 3EJZD 2KZWA 1B3JA 5E00A 1M7XA 1MWAL 5IBTH 4H0IA 1UYWL 3T2NH 5CP3A 3BZ4B 3QISA 3UTSD 2CRIA 3V9FA 3ZTNL 2BHYA 5GGQH 4P5KB 5EBWA 4O58L 4WI2A 4DK6A 1X5JA 3BP6B 1CLYH 2YR3A 3STZB 3W2DL 5IVXF 3MV8D 1UJ3C 5I8EB 1GJIA 2VUYA 4Z78B 1EHLL 4FXKA 5F7HA 2VDQL 1DEEB 2VWEE 1P5VA 4NFDA 4TOYH 3L7FA 1QRNE 4G8IB 5D2LB 4X5WB 2FIKA 5E5RB 3RGVA 4H20L 5B39B 2H26B 2HJFB 3LKQA 1INQA 4ISVA 4NO0D 4PS4L 4J23A 2XNAB 3DIFA 4G8GD 4XPTH 4ZUVB 4HS3B 3P0GB 3W5NA 4XNQA 4ZO8A 1CT8B 3C5ZD 3KPQA 4HFUL 5I1EL 1YY8A 5GGVL 4FQJH 5I6XB 2HKFL 2VDPL 5A2LH 3TT3H 3LMJL 4DKFH 3EJYC 3ZE2F 4JRYE 1AHWA 3GMRB 4ZOAA 4LKXA 2DJ4A 3ULVL 1J8KA 4JKWA 1TVDA 5FYLE 1JNHA 4Y1AA 1ZLUK 3SDCB 4ODXB 2A38A 1JZ6A 3NFSH 4PJEF 3VXSB 1UZ6E 4XNXL 5ID1A 3BPLB 3GUTA 2P47B 4ZG1A 3TJEH 2G75A 2HP4A 4XP5L 3ILQC 1VGKB 1AR2A 3FQWB 4LGPB 4MSWB 2XT1B 3MMEA 2QADC 4XVSH 5GGSA 4HEPG 1U92A 1LEKB 3PWPB 4YHKL 1V3MA 3P0YL 4G6FB 1BBJB 2XG5A 1ZOXA 2ITCA 2EYRA 2IMNA 2X44D 3AS2A 3RWFB 1I7RB 2NY3C 4R97B 4X4ZA 4HT1L 4OSUH 3UBXI 5IR1A 4BSWA 2H2PD 2VQ1B 4YXLL 1TPXC 4WUUE 3WIFB 2BVYA 2IANE 3C8HA 4OFPA 2AJUL 4DKAA 2V5SA 1FNGB 1QHPA 4U7MA 1OP5H 1H3PH 3LPFA 5DD3L 2JJWA 2GEEA 3BOVA 4XPAH 4HWEH 3ARFA 3QFJD 1L6XA 2JF1A 5DLMH 5LGHH 1HHHB 5DJXA 5IOPA 1I9RL 4NO2B 4APQC 5J1SC 4IOIA 4RCAA 3NH7L 3FO0H 5FHBL 5AYUL 1A3RL 3IT8D 4K7FB 5C2BH 4XP9H 4P46C 1JPST 2QR0B 4JO3H 2MHAA 2YPVL 4JRWA 4TNVK 4PJIF 3QXWA 2GT9A 4KY1L 4I48B 3I50H 3W0WE 25C8H 2VDLH 5DURB 3QDAA 4M93B 3EHBC 3T77B 2ZNWA 1VKXA 4KTDH 1MHPL 2OL3A 2QHRH 4XNMA 3HMWH 4N8VA 3O2DA 4FXLA 4WJ5A 1QSEB 3O2WH 4MA7H 3TBVB 3IFLL 3RIFF 4G42B 5IKCB 3FL7A 2V5YA 1OCWH 2WLYA 1X4ZA 1W0VA 1MFBH 1SM3H 4PB0H 4ONHA 4QTHA 1UACH 5F7DB 4M4PA 4E0RA 1I1RA 2Z4QB 3QEQD 5IBLD 3RKDC 4FQLH 3SCMD 4NYLB 1D6VH 3UJIL 3MLUL 1NDMB 1MEXL 4OLZL 1SHMA 5DQJB 4G8FB 1EBPA 3FO1B 5GSVB 3NPZB 1S7RA 2H6PB 4J3OC 1N2RB 1BMGA 4HH9A 3U6RB 4BA8A 1MHHB 3JTTA 4FFZH 5TDPA 3E3QE 1JTOA 5KVEL 4I9WD 3FRPA 2UYLB 4U2YA 1I3RB 1T3FA 4QOKA 4XZUA 2FHCA 5FKPB 3ULVC 4MLSA 3RZCB 2PCPA 4ODSH 2VL4A 3H42H 2EKJA 3BMWA 2DLFL 3RA7H 3THML 4HG4K 2Z8WC 2NY4D 2B1HL 5C7XL 3WLBB 3FQTB 2NY5L 4QRTB 1R0AH 4M7KL 4FG6D 5GRJL 3IDMA 4XMLH 1Q0XH 4M8QA 4YAQA 4JN2A 5GSRB 3EGSA 1MCEA 3AMKA 2R8SL 3QYCA 4U6HA 2KH2B 1FCCA 4NN6B 4D9QD 1F8TL 4E9LA 5I18L 2BHUA 4HX1B 1WWBX 1S5IL 4OZFA 4YPGA 3VXOB 4F9LA 3O2VH 1HOCA 4LSUL 2NPLX 5I73B 3FMGH 1WC7B 1NC4D 4U0RC 2DQGL 3GBML 2XPGB 4GS7C 1QTYT 5F7EL 1LE9B 2IPUG 4P2QD 4RAUB 4L8BA 5C08E 3EW3B 1EZVX 1LO2H 4OD1H 4XHJD 5E6IA 4XXCC 3VFUA 3HE7B 3U46B 4X6EA 4QRSB 3HMXL 1R3KB 4XP4L 1CICC 5E1AA 2MFNA 4JJHA 3LV3A 5MERA 4AH2B 3V52L 4L8SC 4UT9L 2FL5B 1QLFB 2D9QB 5CJQH 3UTTB 1WEJH 1WCBA 4I18C 4XC3L 4OZIB 2PW2B 3BKCH 3UYRH 1OLZA 2Q7YA 3CD4A 4Y2DD 3NPSC 2IALA 3QWOB 4Y4HC 4D2NA 4YX2H 1PZ5B 4WNQB 3RU8L 5IEHA 4OLVL 3ZSSA 3UC0L 3DO7A 2RCSL 4M3KB 1HCVA 3H8NA 1IRAY 4M61A 4DGVL 4EBQH 4HAGA 4XBEL 1CGYA 3QNXB 5F7UA 4ZAKA 3WFCH 4F3FB 1JZ5A 3AROA 4R7NB 5DFWH 4J12A 2AXHA 3WJLA 2A77H 5T3XD 2PO6A 4K3DL 4N8PA 5BRZD 2Y36H 3ZDZF 3DHMA 3VH8A 2DMCA 3KPSE 1JNLH 4ZXBA 1XGQB 2I27N 5D7IA 3LH2L 1VADB 3V0AC 1QFWL 3MRQA 3SDDC 3AM8A 4OJFL 4PJCF 4Z5RB 2VDNH 1KFAL 4G7YL 4JFEE 2OYPA 4NBYB 2CKBA 1EEZA 1DVFD 1QR1A 5HHOE 3BPNC 3PWUB 2V7NB 4UQ2B 1Y0LB 3BRDA 5I9QB 2Y7QA 4OCYH 5JUEL 1EPFA 4XNZC 4MXQC 1T7WA 2XQYG 4CW1A 4CDGC 4LCIH 2WBJD 4YXHL 3KYKL 3VI3F 1IEAB 1YEGL 1A64A 3D5OF 3H9SD 4AYFA 1FN4A 2NY5C 5ICXA 1KJ2H 1RFDL 4MA3A 4PJDB 5CLTA 3ULSB 2OSLB 5B3NA 1T80A 1DN0A 3C8KB 3GBLA 4KJQD 4GRMB 4OLXL 1NCUA 3DX6A 1FJ1B 3LKOB 2BSED 3LEXB 3OZ9H 4KRMB 4JGMA 1TTFA 1ZVYA 4P23D 1F4XL 1OWWA 3MFFB 4L3ED 1S3KH 4KV5E 1YN7B 4JO4H 4HWZB 3NCJL 3QA3A 4JFOA 4ODWB 1T4KA 4DJMA 4U4BA 5KZCD 5EBMB 3EDJA 3DJ9A 4OUUA 5T33H 3S88L 1J10A 3LKPA 4YC2C 2L0DA 1BM3L 5DR5H 4K7PY 4L4VE 2HMIC 2XKNB 3O3UN 1EJOH 3Q6FB 3UPRB 2J6EA 3FCTA 4K94H 1ERNA 2XZAL 3SPVA 3KNBA 3BIAX 1A6TA 5FDYA 2FATH 2NX5B 3QEUB 1RULL 4OF7A 1FDLL 4P5TD 5EU3B 1IGIL 3K8MA 4M9PA 1CLOL 1WISA 4HJJH 2X41A 1CGUA 3ZE1E 3BZ4A 1FO0L 1G84A 1J5OL 4CRPA 1TCRB 4X6DF 4P5KA 5EZJB 2GI7A 3BP6A 5LCVL 3STZA 5I8EA 3ZDYF 3RFZC 1LQSR 4Z78A 2FEDD 4RX4D 3QNZB 1DEEA 3O4OC 3UXFA 5IHUH 3AAZB 4G8IA 4PGBB 4X5WA 5D2LA 3RBGA 3FQNB 2DM2A 3LRSB 3UX9B 5B39A 2H26A 2HJFA 2QQKH 1CFNB 2BFVH 2MNUA 2XNAA 4F80A 4ZUVA 4HS3A 1HYSC 2KQNA 4NFCA 1CT8A 5LWYH 1CFTB 3CFBB 2VXUL 1OTUC 5FGRA 3WKMH 2MSPA 4RISH 4U6XB 3GMRA 1NAKH 1N0XL 4JFFE 2Z31D 2HTKC 2FGWH 4TSCL 2DBJA 1E4KA 2J4WL 2NY6D 1C5CL 1UGNA 3SDCA 3VA6A 4ODXA 2DQTH 1U95B 3MXWL 4P2RD 3SE4C 3MRLB 5IK3B 5A3ID 4YDIH 2Y06L 3I75A 3QDJA 4TQEL 5E2WL 1VGKA 4YFEA 3MOQA 3FQWA 3KLAB 4MSWA 4ZTPH 1FH5H 5DRWB 4PBXA 3QULB 4BFEA 1LDSA 2UUDH 3ARSA 1LEKA 3PWPA 2W38A 4K71C 1BBJA 2VLME 5IFJA 2ADFL 1TQBC 1QFPA 3RWFA 5IW6B 3INUL 3H2WA 1I7RA 3T0ED 4MAUH 1P7QD 5SWSB 2A6DB 4OGAC 2RIKA 2VQ1A 5D7JB 1DBML 1AH1A 5FV2A 1FNGA 4UDUB 4OFVA 4Q9QH 2GITB 1VFOA 1QFWI 4YNYB 4LSSL 4U3XA 1HHHA 4EDXB 1TNNA 4NO2A 4CKVX 2MKLC 3STLB 4JDVB 4AEFA 1UB5B 3EYSH 1QHOA 1S9VB 4HK0B 4K7FA 4QRRD 2ZCLH 2Q76B 3CMOL 5CZVH 2QR0A 3KXFA 5D72L 4W4OC 1NCCL 4ODTL 1FYHB 5JIIA 3TVMB 5ALBH 2E7HA 4I48A 5T1DL 5FYJE 3KGRA 4I0PB 2XTJB 3T77A 4X8XA 1MFCH 3AREC 3QI9C 2EO1A 1V7NL 1UH4A 5F9WC 1QSEA 2ZPKL 5F89B 3TBVA 4P4KB 5IKCA 2Y5EA 5IB5B 5GGUB 4KROB 5GZNC 4LSTH 1A7RH 3OHXA 4ZFOL 2GJ6A 1ZVSB 4Y4KC 4NCC1 4MNQD 1NMAL 3O6KH 2EDBA 2BSTB 3BWUC 4R3SB 4X0KB 4FQXB 3BYYA 4Q0XL 2Z4QA 4MJIB 2W07A 3BP4B 4NYLA 1W8NA 1CFBA 2DTMH 1NDMA 2H2SC 4ELMB 1HXMB 5DQJA 4EI5D 4YLQT 4G8FA 4B50A 2Y23A 3FO1A 5GSVA 2H6PA 2FJGB 1N2RA 4QHMB 5CS7A 4EI6B 4TVSa 1F6AB 3U6RA 2IF7A 3BGAA 5J1TC 1RZJL 3EO0B 1AQDB 1A22B 3K8LA 1W0WB 1LILA 2VH5H 2VDKH 5FKPA 2B1AH 2H1PH 3VG0H 1ZGLB 4MVBD 3RZCA 43CAB 5AUMB 3NIFE 3P30L 1SJHB 2FBJH 1QZ1A 7FABL 1PSKH 4NZDA 1F3DJ 2YN3A 2JJTA 1TZHB 3H0TB 1DBJH 1JPFB 4PJ5D 3VU2A 3WLBA 3FQTA 3HZVB 5F9OH 4FOMA 1YPZE 4QRTA 5BQ7B 5D70L 3GSUB 3C2AH 2R9HD 4L9DA 4PRBA 5F96L 3S4SG 1XF2B 5E5MB 5GSRA 4QWWD 3S6CA 3SDXB 1NCBH 5CGYD 3VCLB 1EVTC 2WWKT 4YIQB 5IB3A 2YXMA 4HX1A 4ODUB 4LP4A 5KSAD 2K7PA 4I2XE 4Z7NE 5JXAH 4TVPL 4Z0BH 1EBAA 1FZOA 4NC0B 5ITBL 4BK5A 3LQAH 3ZYIA 4KMLB 3T0XA 3PHOA 1WC7A 3U1SH 4GMSL 2XPGA 4OB5L 1LE9A 1JUFB 5I8OL 3S3JA 1YNLL 5E8DH 35C8L 1TLKA 2QKIB 4NHUB 2GUOB 3HE7A 1I8KA 3U46A 2AK4D 2VLKB 4QRSA 4A6YB 3V4UL 2A0LC 5DS8B 4MXWH 4WHYG 4MMXC 4AH2A 5GQBA 4FFWC 5DWUH 1TJHH 1AXIB 1QLFA 2FL5A 3IETB 2WZPD 3UTTA 1CD9B 3ZT5A 4R4ND 1UENA 3TBSB 4NQXB 5L2KE 2BHZA 1CLZH 2PW2A 2SEBB 4PRPE 4QXWA 1CI5A 2OCFD 3C08L 3MRJB 3TN0C 2RQ8A 3DRTB 3QWOA 4P2OD 4XWOD 4UOW0 3TZVB 5I1JL 1KENH 1T0MB 1PZ5A 4WNQA 2X4OB 1RZGB 4OFKA 1NAML 4M5YL 4JLRB 3QNXA 2V2XB 3VGBA 1PX3A 4F3FA 4MD0B 2AJVH 1PDKA 3UTSB 4FQQA 3QXDA 1M1SA 4Q2ZB 4MYWB 2WV3A 2A9ML 1CDIA 2ZG2A 4N9GB 1U3HC 1MIEH 2PXYA 1DBKH 1CYGA 3S37H 4WWKC 5EU6B 2NTFB 5I71B 3G08B 1NJ9B 4OIAA 3UTZB 1BQLH 1XGQA 2ESVE 2IQ9L 1E6OH 1VADA 4JRXB 5SWQA 1FFNB 2CO7B 4GQ9H 1WZLA 2XN9D 5ISZE 2XTLA 1RZJC 2ENYA 4QT5B 5C2UB 3JSSA 3QUZA 1LP9E 2PYEE 3PWUA 2V7NA 2D0HA 5CP3H 1SBSL 4MCZB 4LEOA 5BVPH 4UQ2A 1Y0LA 5GGTA 2HT4D 3Q5OA 3QR2A 3C5ZB 4GRWH 1WCQA 2DQDL 5IBUG 4DVBB 4S1SH 4UI2A 1NUNB 3VWJB 3LS4H 1SEBB 5ILTH 5D93B 1TIUA 5C0AE 1IEAA 4K3JH 5GGRB 4PJDA 1A3QA 2OSLA 5C92A 4PGJA 3C8KA 3KPTA 4PY7A 2BNQD 1IAOB 1X3DA 4GRMA 2CRYA 4PLKD 1FJ1A 3LKOA 3WNLA 3LEXA 2FLRT 3MFFA 2IBGA 2DB8A 4WFGD 4HWZA 1VACB 4ODWA 1LO3L 4AEIL 3MV7E 5EBMA 2JJSA 1MHEB 4HBQA 3ARVA 4OD3L 4PUBL 3SE9L 5D9SB 1U6AH 1MQ8A 1MCIA 2XKNA 1PW3A 3ULUE 1KEGH 1MFEL 4PP1D 2D03H 5C07D 1NCDL 3RWEB 3U0PB 3P4NB 1IGFH 3UPRA 5DVLA 4PJHE 2DL9A 3A67H 4M43L 2NX5A 5CJOL 4O2EB 4LHUD 1DQLL 1PY9A 1VESA 4HWUA 3ZE0F 1AY1L 4JRYB 5EU3A 2J12B 2A9NH 2CH8A 4HF5L 4PJEB 4J8RB 5I19H 1MRCH 1TCRA 1RU9H 2X4SA 5EORL 5EZJA 1G7MB 4WHDA 2HRPL 4XCEB 4U1IB 4WEUD 5DT1L 1A6VH 2NXYC 1G9MC 5IW3A 4U6VH 1DLFL 3AAZA 3FQNA 3LRSA 3NCYP 4OQ1A 3CNKA 1CFNA 3I6LD 2P44B 3MGOB 4TYUA 4BQBA 2BX5A 2V2TB 1CFTA 1SJXA 3CFBA 4KDTA 2DD8H 4RZCB 4X4YA 4WEBH 2LU3A 3ZZ1A 4LDLB 2FRGP 4U6XA 2HVKB 4KUZL 4PV8B 1JYNA 5IG7B 4LKCB 4O5LH 1F11B 3HE6D 4KKBD 3S97C 4Q6YA 4LVEA 2OL3H 1JHTB 1B2WH 2P1YA 3NABL 1U95A 2D7NA 3O2DH 3MRLA 1MUJB 4FQIH 2HLAB 5IK3A 2NXZD 1U3ZA 1EERB 1HK6A 1B9ZA 2ZNXA 3GHEH 2WAHA 4RBPH 3DMMA 1Y6KR 4P3WA 5CILH 2MMXA 4PJIB 3KLAA 4L29B 1JGDB 1FGVL 3ZO0A 3QULA 3N9GH 2P49B 1G0YR 3VXUE 4LMQI 4QEGA 3QIWA 2F5BL 5I8CB 3OJVC 4G7VL 3MV9D 3TV3H 1J8HB 2Q8AH 2NY4B 1KB9J 5T1KD 5IW6A 3BD4A 4GSDL 3MLWH 2LU4A 4YK4B 5FYLL 1AC0A 1B88A 1XFPA 3TO4D 1JWMB 2AXJA 3NAAL 1D3CA 2GY7B 3T4AB 4OLUH 5D7JA 5JW4R 2BJML 3T1FB 32C2B 4JFHD 4JFXA 5DJ2B 4UDUA 4JZJC 5D7KE 5KW9H 2ICWB 2K1MA 2NNAB 1RZFH 2GITA 3WHXB 3JV4B 5E24E 4YNYA 1CGVA 3ZTJH 3HAEB 4EDXA 5JMOC 4I13B 1Z9SA 4N5EC 1LO0L 2R1WB 5FXCH 3STLA 1NC4B 4JDVA 2BMKB 2X40A 4CVUA 1UB5A 1UWEL 1I3UA 1ZT4B 3W9DB 3WHE0 1S9VA 4HK0A 4DZBB 5DQDL 1FL3B 3VI4F 2Q76A 5IQ7L 1OB1B 2J8UE 1Q9WB 3U0WL 3V6ZB 2X42A 3TVMA 1MVUB 3KLSA 1X5LA 3C6LC 4Y89A 1BVKB 2AXGB 2EXYC 4K3GA 5TJWK 1AQKH 1CXKA 4I0PA 2VLRA 4QHUB 4EZMA 3BH8B 3NA9L 1I3GH 1XCQB 3BPOC 2V17L 4PRHB 5F89A 4J3WA 1IGTB 4P4KA 4KQ4H 1A1NA 5GGUA 5IB5A 4LLMB 5SX4I 4HXBL 1ZVSA 2DAVA 1E0OB 1HZHL 2BSTA 1HH9B 5EO1B 4R3SA 4X0KA 4FQXA 1RV6X 2W9LA 3D39E 4MJIA 1IBGL 3EYOA 1KB5B 3BP4A 2M26A 3K80A 4HS8H 1YQVH 2ICEB 4ELMA 1CFQB 3UDWA 3Q2CA 2WNGA 3M17B 2FJGA 3G5YB 1BIHA 4NBZB 4XH2A 4QHMA 4KKAC 3SQOH 4EI6A 1F6AA 5D2NE 5LG1A 3EO0A 5IUSA 5JZ7D 1AQDA 4F2MB 1W0WA 3PE9A 5BRZB 4NFBA 1EO8L 4H88L 1ZGLA 4OIIL 4Q6IB 1IKFL 4M02A 43CAA 2F74B 4S1QL 5AUMA 2E27L 3L3OB 1EEUA 2VDRH 4WEMB 3RTQB 1ZLWH 3CFDB 4P3CH 4M7ZB 1E4XH 1DVFB 1TZHA 4C55A 3H0TA 1FAIL 2O26U 1JPFA 4O00A 4Y19D 1T1WB 3HZVA 1F2XK 2VNCA 3HI5H 1N26A 5EDXA 5BQ7A 3GSUA 1ADQA 4LSPL 1U8OB 1XF2A 5E5MA 3B8SA 3D3VD 4PJGF 3RWIB 1G0DA 3SDXA 2G60H 3VCLA 3NZHH 4IMLB 4JY6B 3TFKD 4M1GL 1U8LB 4YIQA 5CUSL 4YXKH 3MJ7B 2WBJB 4ODUA 3OX8B 3OKYA 1IQWH 5TDOB 2NY2C 3ARFC 2CKBH 1MWAH 3PV7A 4G5ZH 1OW0A 3P2TA 5FHAH 1I8LC 3N0PB 4XVUD 2JJVA 4U05A 3BT2L 4WI7A 4W70A 3W2DH 3WIHL 3MV8E 2DQJL 5D5MF 5L0QB 2QKIA 4L3EB 4NHUA 2GUOA 3BSZL 5JW4N 2VLKA 3UTPD 4A6YA 1A5FH 1UA6H 5KZCB 4DW2L 5DTFB 2VC2L 1KC5L 3CGTA 3MUJA 4MA8H 5DS8A 4F7MB 3F7YB 1KELL 1X4XA 4DWHA 4P48A 1QO3B 4RGND 1KCKA 4G8GE 3IETA 1JWUA 2AQ2A 3TBSA 4NQXA 2R2BA 4JO1H 4ZPVA 3MRJA 3KYOB 4NP4H 1AGDB 5JIHA 5I1EH 1A9EB 3F7PC 3DRTA 4EN3D 3BQUD 2VDPH 3TZVA 2VXSL 3LMJH 3FONB 5F9DC 4CMHB 1T0MA 5FM5M 2BNRD 1H8NA 2A1WL 2X4OA 2QQNH 1RZGA 3LKRB 4NKIH 1UKTA 5FYKE 4QHKJ 3UAJD 1C7SA 4JLRA 3VFTB 2V2XA 4ZFGL 2ZUQB 4MD0A 4POYA 5TQ0L 5IGXL 3UTSA 4AY0A 2BSSB 2ICCA 2D7PA 4Q2ZA 3VA2C 1KJ3H 3D2UD 4HH8A 2YUXA 5IVXE 1OAQH 4X99B 4ZSOB 5EU6A 4ZMAT 2NTFA 3G08A 2ZZUT 1NJ9A 2J6EH 5IMOB 3UTZA 4MXQD 2HVJB 3BO8B 4JRXA 4UQ3B 1FFNA 4HC1H 2CRMA 2CGRH 1JE6A 3GSVB 1QPXA 4X5XB 3QIBD 1PG7H 4QT5A 3CDCA 3MX0A 1X5YA 4XP6H 2XA8L 2MWCA 4MCZA 3P0VL 4Y5XC 3C5ZA 4B0MM 4N0FB 3GMQB 3L3GB 4JEGB 3QB7C 3KS0H 3ZE2E 2XI9A 5C0BD 5HDQH 3VWJA 1SEBA 1L7IH 2GJJA 3QPXL 3DYPA 4KHXH 1WGOA 3IFPB 3QCUL 5C3LD 5KOVC 2NY6B 4OM1L 1FL6B 2JKXA 1S9WB 3QFJE 5GGRA 5F9AC 4UUJB 4Z7VF 4JPWL 2X70B 1NCTA 1IAOA 1FNFA 3MNZB 1NSNL 3CU1A 4XNUL 4JFPB 1VACA 2H32H 5E6IC 4X80H 4FQ2H 1S7VB 3CZJA 2IAMD 1MF2H 1K9TA 4M7LL 2WW8A 5HPOA 1MHEA 4ZO9A 4NC1E 1QSFB 1T7ZA 3B9DA 1OP3K 1GH7A 3LDBB 5D9SA 3MLXH 2BY1A 1WFUA 4LLVB 4U31A 4CBPA 3X3GL 3VD5A 5EOCL 1XGRB 3RWEA 3U0PA 3P4NA 4ZTOL 4HJ0D 1HIMH 3BEWB 3JV6B 1UWXH 1MCFA 3O4LB 4MDJB 1HNFA 1ZA6B 2NYYC 1VPOL 1PG7X 4YHOH 3QEQE 4WFHE 1UM5L 4O2EA 5BW7C 3CDGB 4JRYA 3PABB 3D9AL 4J8RA 1A2YB 3TPKA 3WE6B 2LE9A 3MRGA 4WI6A 3ZKNC 1G7MA 4XCEA 1CDYA 4WHCA 5KVEH 4U1IA 1NC2B 3BE1L 3C9NB 3PDDA 2PO6C 1CE1H 5ESVB 1RUPH 2OK0L 5IP4A 3QZWB 4M00A 2WIIB 4ZXBC 2CLRB 3BJ91 2C9AA 4DQOL 4MWFB 1CL7L 2J3SA 1A7PL 4F7CB 4Z7WF 4UT6L 4YFLF 3HRZB 4IHOB 5ICZB 4PB9H 2BVUA 5JHDB 2YSSB 4DTGL 2AEWA 2V2TA 3MODL 5GRJH 4AL8H 4H0HB 2QL1A 4RZCA 1NUDA 1YJDL 1UM6L 1S7XB 1MCSA 5DMGC 6FABL 4YBLB 1SY6L 3MLRL 4X7SL 2OP4L 1WITA 2XRAH 2HVKA 1F90L 4OBRA 4D9QE 4PV8A 5IG7A 2IANA 4LKCA 1F11A 3GFUA 3QQ9C 2YEZB 3OKOA 4EI5B 5I74B 3WXWL 3ZYZA 1JHTA 4P2YA 4IOFC 4R4FH 1H5BC 2HLAA 2I5YL 1ZXQA 2F5AL 5F7EH 4ELKA 1WWAX 3KJ6H 4P2QE 4F58H 4IDJL 1AC6A 5DGRA 4PRIE 4NJAL 4L29A 3W5MA 1JGDA 2DM7A 2FX8H 2VXVL 4K2UH 2YD2A 5KVFH 2PW1B 5I8CA 3HCVB 3ZYJA 1J8HA 3OKDB 2PF6A 4LIQE 5F7WC 1BWMA 3HS0B 4N90D 4NGHH 5CD3B 3AS1A 1J0YA 4G9FE 4XAWH 1MRFH 5MEPA 1JWMA 3T4AA 3T1FA 32C2A 4L4TD 5DJ2A 4TUOB 3QAZC 4WDIB 1T21A 2QSQA 2ARJQ 5L88L 4A2MA 2ICWA 1OSPL 2NNAA 2VQUA 5ABDE 5E99H 3SN6N 3WHXA 5KSAB 5ANMB 3JV4A 4LPYA 4ZPTA 4LOUD 3HAEA 5C71A 1KXTB 1DTUA 4JB9H 3RNKB 3QI9D 2CD0A 2R1WA 3ZL4L 2BMKA 2DQEL 3W9DA 1ZT4A 4I3RL 3L5XL 3VXME 4DZBA 1FL3A 4LVNB 1OB1A 1Q9WA 2OXHA 4O4YL 1JF5A 5HGHB 3BAEH 1MVUA 2LVCA 5D8JH 1BVKA 1Q72L 2AXGA 4QHUA 4KKCC 4R9HA 4N9OB 2OZ4L 1XCQA 4NZTL 4BQ8A 4MHHI 4PRHA 5LXGL 3NIDF 1WVZA 3MOAH 5FCUH 3BP7B 1IGTA 1S7TB 4LLMA 5B8CB 1EUTA 5E70A 4P2OB 1HH9A 5EO1A 4Z7QE 5I6XC 1KB5A 3R1GH 1DE4B 1N5YH 4YXHH 3KYKH 2ICEA 1MQKL 1CFQA 4XMKH 3M17A 3G5YA 3HB3C 5ADPL 3H9SE 4YDVB 1WSST 1KYOJ 3SDCC 2ZCHL 1JZ8A 1FSKB 1H3GA 1YJDC 3T0WA 3BPLC 5JR1L 2RJMA 4DEPC 3FT4B 4F2MA 5K59F 4MNHB 5BRZA 5IMLB 3MUHL 5DUPH 5J13C 4QXUL 2F74A 5I16B 4JR9L 4XX1E 3L3OA 1BX2B 2FD6L 4PJCE 3RTQA 3CFDA 3SY0B 3CK0L 5C6WH 2R4RL 3S88H 4OKVB 5FB8B 1DVFA 4OZHB 3ZHDA 1T1WA 4L3CB 4NPYB 2O5XL 3GRWH 1I1AD 4WI4A 5D6DA 1U8OA 3HC3L 2GIYA 1MJ8L 3VFGL 5DYOB 3RWIA 4Z95L 4X7TB 3BKMH 5HY9B 1A6WL 4IMLA 4JY6A 1U8LA 5DFVD 3SQBA 3MJ7A 2WBJA 2DDQL 3OX8A 3GZKA 2F8VA 5TDOA 3KYAA 2ED7A 4ODHH 2J88L 1CL7I 3N1PC 5CIPB 4QCIB 1MPAL 5J6GB 2BNQB 2I26N 4DKEL 4K23H 1IAIL 5TGBB 5JXED 1YEKH 4HK3J 4ODVL 3GSWB 4FQ1L 2WUBH 1DN2A 3KPRB 5ICYB 4XX1G 3MA9H 4U1GB 5DTFA 2C3XA 1PEZA 3KPSA 1NL0L 3V6OE 4NQDD 4F7MA 4YQXL 3F7YA 3U4EB 2DJSA 1QO3A 3LS5H 3F7RA 2AW2A 3WFDL 3C60A 2ERJB 2EIEA 5C07B 4XBPB 1FRGL 1LP9B 3KYOA 1AGDA 1A9EA 5LGJB 3MV11 4M1CC 1A9BB 3KHQA 5EOQL 3WFBH 3FONA 3CLFL 4N0UB 2HN7A 4KKLC 4JGUA 1U0QA 4KMQA 1N0XH 2DLGA 2CMRH 5FUCC 3LKRA 3UROR 3V0WL 1H3TA 1RJYB 3VFTA 2BRRL 1YEIL 3QBTB 5I8KL 4Y8DC 4X83A 2BSSA 4OQTA 4X6DE 3U7YL 3MLVL 1INEL 1CR9L 3BN9C 1U2HA 3BD5A 1VGEH 2FIRT 5E2UH 3RDTD 1RMFH 3DVFA 2Y06H 2ILLA 4X99A 4ZSOA 5IMOA 2PTVA 5D4QA 4Z9KB 2HVJA 2ZKHH 4RX4A 3RPKA 4WRLA 3QH3B 3BO8A 2E3VA 1RZKH 3RZCC 4UQ3A 5DI8B 4LQ1A 3GSVA 4R90L 3GSQB 4Q9CA 4X5XA 2RFXB 3IJYB 4YE4H 4WV1B 3ARRA 5H37H 5LBSL 4WO4D 2BSRA 3FQRB 1I9JL 3INUH 2JJTC 3VFMB 1P4IH 3LHPL 3T0EE 5SWZD 3HA0A 1AI1L 4GAJL 1D7FA 4A2LA 1BFVL 4N0FA 3GMQA 5EIQA 3L3GA 2YD4A 1M71B 4S0SD 1A3LL 4V1DE 3CMGA 5DMJB 1NBVL 3DSFH 4NN6C 3IFPA 2PTTB 3GB7B 1VDGA 4OGXL 2AQ3A 4MNGB 1FL6A 4KGLA 3U7WL 1S9WA 4UUJA 4HDIB 4UDTA 1OP5K 2X70A 2GSIA 3GIVB 2NXZB 1ZS8B 3MNZA 3FRUB 5L6YH 4XI5C 1GPOL 2ZUXA 4QRRE 3LN5B 2WP3O 4P59H 1NCCH 2HFGL 2ZJSL 2CRZA 4PTTB 4JFPA 3WXVH 4G3YL 1P4BH 3EDEA 4FN0A 1S7VA 1T6VN 4PG9B 3K2UL 1QSFA 3WFEL 12E8H 1S5HB 1G9NH 4FQPA 5BJTB 3BP5B 1P9MC 1TZIB 1AGFB 1T2QL 3CH1B 4JCLA 4LLVA 3MRIB 5E2VL 1PAMA 1XIWC 1I1CA 1XGRA 5DD0H 4GXUM 2NY0B 3J7HA 4QXTB 3BEWA 3QJHB 2BERA 4CNIB 4JFQB 4MNQE 2ORBH 2KZ1B 3O4LA 4MDJA 3WNKA 1MRDL 2X10A 1ZA6A 1I1FB 5IW1B 1MH5B 1EJ6A 5F70A 1B0RB 2VR9A 1LE5B 1UB6A 5HYFA 3CDGA 3EYFB 5I1CL 2AK1H 1H9VA 1JPTH 3PABA 4TN9A 4JFFA 3MREB 4FABL 1A2YA 3WE6A 2EDRA 3B5GA 4ZS6C 1A0QH 1GGCH 3WO4B 3WLWD 5DZLA 2YK1L 3OKNA 5BS0D 4HGKC 5E8NB 3L5JA 3RJDA 5IMKB 1NC2A 1BP3B 3E6FB 3C9NA 2HT3C 4X6CB 1MAML 5ESVA 4DAGH 3QZWA 4AMKH 3HNVL 2WIIA 5EIVA 2CLRA 1C08B 2Q7NA 2EICA 4Y4FD 5ACZA 1FNSH 7FABH 4MWFA 1K5NB 3IFNL 4F7CA 3FFCB 2IPTL 2B4CL 3PNWB 4KXZH 3HRZA 4IHOA 4PJ5E 5ICZA 3FOMB 5JHDA 5CZKA 2YSSA 5HI5D 1T6WA 1BREA 5F96H 4YDLB 3T0VA 4M4RA 1IFHH 2HKHH 1S7XA 1IAII 3N1MC 4P5MB 1N3NB 4KHTL 4GRWF 4HWNA 1BQSA 4M9OA 2VN7A 3F58H 5KVMC 1X5HA 4XB8A 5BMFH 2YEZA 3MRDB 3CXDL 4PYHA 1KTDB 2RBLA 2AJSL 2R4SH 3MJ6A 4NT6A 2VZSA 1U8MB 2BVTA 1P1ZB 4I0CC 1KIUA 1YEEH 1ZLVH 4UNVA 1YMMB 1OQOA 3T2OA 2HWZL 3WIIL 4I77L 2GW5A 4UTBL 5DJDB 3HKFA 1L0QA 3MLYL 4N0YH 4XVTH 2PW1A 2AK4E 1IGCH 5I1KH 3WUWG 4MAYD 1XR9B 2DS4A 3HCVA 4QRPD 3RWDB 4W6YB 3OKDA 1KCRH 1T5WB 3HS0A 5KSBE 5DUBB 1X44A 4M03A 3QPQD 3PP3K 5SV3A 4KVNL 3JWDH 1DQQB 2E9IA 2CJUL 2VZTA 1C5BL 5AG9A 5IFHL 4WDIA 5DZOA 5TPWH 1QKZH 2GK2A 4IRJB 1G9MH 4HHAB 1MCPH 4OF3A 5ANMA 5KSAA 1NAMH 3EYUL 2YD7A 4KPHH 2XZQH 3QWRA 1GC1H 4J3UA 2Y07H 4I3SH 5SX5H 3N50A 3RNKA 3RGVD 1M7DA 4BQ9A 1PKQB 1RZ8B 3X12B 5DD5H 2DWEB 3U9UB 3B9KC 1ADQH 3LB6C 2XXCB 3JXAA 5HGHA 5EU4B 5HI3C 5C70A 5SV4A 2YD5A 4CN1A 4FA8A 1Q1JL 3I3DA 2XN9E 2BC4B 4BFBD 4RGNB 5E7FA 1G7HB 1LK3H 4GXVL 5HD8C 4Y1AD 4OGZA 1QSVA 1SBSH 1QEWB 3BP7A 4K3HA 4PJXE 5ACLA 3VRLE 2EH7H 1S7TA 1A47A 3K8KA 4C4KO 1N4XH 4NUGH 2X1OA 5B8CA 1CDJA 4X9FA 4P2OA 3VFRB 5L9DH 1N6UA 2PTUA 3QCTL 3LCYA 1DE4A 2YPLE 3BMVA 2B4CC 4GT7A 4KK8D 3HN3A 4MZ3A 1Y6MR 4U3HA 4YDVA 4D0BB 3BW9B 5DEGB 3LRHA 1AE6H 1YNKH 4N8CH 3ISWA 1JNNL 3G9AB 4JG0H 3FT4A 4TNWK 3O9WC 4LK4A 2VMFA 4MNHA 4JO2L 4RNRB 5IMLA 3GEWB 4UILL 5D5MB 2ARJB 4HLZG 4JPKH 4JM2C 4NCC2 2E7BA 1GIGH 4WFGE 5I16A 1BX2A 1LO3H 4KRNA 3O8XB 4E41D 2XWBB 1E6JH 2B2XL 2NZ9C 5L2JB 4G6JH 4NZUL 3SY0A 3H6JA 2LQRA 3QIBB 3OF6D 4OKVA 3KS0J 4OZHA 5F3HB 5T5NF 5FB8A 1BEYL 4NPYA 4L3CA 5FDWB 3U7AA 5HI4C 1LD9A 4IMKA 1JGLL 5DYOA 5HHNA 1TETL 3N85L 5K9OB 3VG9C 4OIBA 4X7TA 5HY9A 3GNMH 1RZIB 3BXNB 2DOCA 4R96B 4XPGL 5IROC 2APBA 1KXVC 3V2AR 1X5FA 4MXVF 1A7QL 1X5GA 3B2VH 3N1GC 1DQLH 1CQKA 2AABH 3D0LB 3PV6B 3SE8H 1J0JA 2YOCA 4A6YL 2IGFH 5IESL 1R3IL 5JQ6H 5CIPA 4QCIA 2UZIL 1K6QL 3GSNL 5J6GA 3VFNB 5EORH 5FUOH 5I1AB 4PJ8C 1MI5E 2HRPH 1N6QH 5TGBA 5T3ZH 2IG2H 5F7MC 3GSWA 1PX4A 4I3GA 1JHLH 4HK3N 4YHIB 3RVXD 3KPRA 5DMYA 2CR3A 4DOHB 5ICYA 5EO0B 4QLRA 5C0CE 1EAJA 2IAMB 2XQBH 4RMRA 4Y0GA 4I0PC 3U4EA 4TTGA 2FHBA 4HKJB 5CMAB 4OCXH 5DD6B 3F65A 2ITDB 1YEFH 3G6JE 4X9IA 5D1QD 2R2HB 5E94B 5C07A 4XBPA 4P4KC 1IZJA 5FYJU 1LP9A 4RFOH 1FV1B 1NFIA 5LGJA 2EYTB 4H8WH 4YZFF 2NQCA 1QACA 1D9KC 3IU4H 1DR9A 4U1HB 4N0UA 1BD2E 2Q6WB 3QXUA 2R29L 4QOKD 3ZE0E 1T66C 4LHUG 4PJ9C 4X4ME 1RJYA 1AXTH 2EDHA 5HGDB 2EXWC 3PXHA 2JCCB 1JGVL 1MCLA 3UBXG 5GIRB 4WU7B 5CWSB 5GJTH 4WENB 1DQTA 1KJMB 2AKRB 4OCWH 3GJEB 4HIXH 5J3HC 3OB8A 2R0LH 5HYJD 1FGVH 4EVNB 3QH3A 3WS6A 3EFDH 5DI8A 3X13B 3HI6L 2Y6SD 1VEMA 4G7VH 3GSQA 3MV9E 2RFXA 3IJYA 4DGYH 4WV1A 1NCWL 1WFNA 1T5XB 3FQRA 4NQUA 3TT1H 3LZFH 5JA8B 4OLYL 3VFMA 1J0ZA 1N8ZB 4LSQH 1A7NL 1MREL 1DBAL 5D1XC 1IKNA 4XTRD 3G5VB 2DQHH 4OD2B 2K7QA 2VXTH 1M71A 1I75A 3MBEB 1MJJB 2QQQA 4I1NB 3CSYA 4R8WH 5J89A 1DP0A 4KDWA 1E28B 2YUWA 3GB7A 1IEHA 2Q3AA 4MNGA 1GCFA 1IEBB 1FLRH 3WNOA 4HDIA 4R0LB 1OW0C 5D2NC 3GIVA 1ZS8A 3FRUA 3FFDB 2D31B 1MIML 2NY1D 3AFLA 2BOCB 3LN5A 3QEGL 4PTTA 1KLGB 3B9AA 5GGVY 2ADJA 2X1PA 3WDJA 2P8LA 2HG5B 1SYVB 1ACYH 2ADGA 2X05A 5A2JH 2H3NB 4Z7WB 1S5HA 4KUCF 1HKLL 5BJTA 3O6ML 1WWCA 4Q9RH 2E9BA 3BP5A 1TZIA 4LQFH 1AGFA 3CH1A 4XGZB 3DURA 1UG9A 3H3KA 3MRIA 2ZOLB 3FZUD 4JQVC 4ZAKD 2M8XA 2EH8L 4QXTA 3QJHA 4CNIA 4JFQA 5EU7C 1MNUL 3ALXA 1V3JA 3GIZL 1I1FA 5IW1A 1MH5A 3S7GA 1L0XA 1B0RA 4GAGL 5KS9E 1LE5A 2F53B 2VYRE 3EYFA 2A73B 3EJZC 3D85B 1ES0B 3MREA 5GZOD 1L7TL 7CGTA 5FUZL 1HHJB 2F19L 2P45B 5HDBF 1FZKB 3TA3B 3X14B 3MLSH 4TSAL 1JN6B 5E8NA 1KJ2B 5IMKA 2P5EE 1K4CB 3E6FA 2C5DC 3SKNB 3RWJB 4NQCE 3KLHD 4X6CA 3GI9L 2XICA 2AEQL 3MNVA 5GISH 5IEKA 3S36L 4MD4B 5DMGD 4YHYB 3O6LL 3P11H 4KAQL 1C08A 5J4MA 5DGQA 3IYLW 1K5NA 4KUCD 1QG3A 3ROOB 1NANH 3IDNB 3PHSA 4LVOC 3FFCA 1A14H 3S36X 1FAIH 3OL2A 4Y19E 5E1HB 5ESAB 1GOHA 2D3VA 2ZUWA 1RURL 3FOMA 3DGCR 4L3AA 3X3FL 4TULL 1FBIL 4XMPH 3C5ZC 3DV4B 1MCOL 3D3VE 3GK8L 4P5MA 5FECB 1CFVL 1N3NA 4LARH 5I15H 5C0EB 4LLQB 1XCTB 1F02I 4AM0B 1U8NB 4OT1H 1IC4L 2YHGA 4XCYB 2EDNA 3MRDA 3PWJB 1CDBA 1KTDA 5JQHC 2HJLB 3BRGC 3Q48A 1U8MA 5D2LF 4GG6B 3BDYL 3EO1B 3GBNL 1P5UA 2OJZH 3W9EB 5D96B 1P1ZA 4X7DC 1YMMA 2P7TB 2FX7H 1Z3GL 3TNMB 5DJDA 2G5RA 3UO1L 4ZS7H 2X2YA 4MLIA 3K1DA 3PJSB 3UTPE 1Q9OA 4WFEE 4XPFL 1XR9A 3SOBL 3RWDA 1FZMB 4BH7B 1T5WA 2E7MA 1ZGLP 4UV7L 5IWLA 5DUBA 3MJ9L 1T7XA 3MRNB 3Q3GB 2VZ3A 1DQQA 5B21A 3M07A 4H25B 2H2PC 4GXUN 4AZ8A 4EUPG 1NEZG 4I0KA 1MAKA 2BNRE 4IRJA 5K9QI 4HHAA 1YUHB 4OLWH 2COQA 5ACMA 1RUMH 2V2WB 3EYVA 1Z6JT 1PKQA 1RZ8A 2DWEA 4FZEH 3U9UA 5IQ9B 4JFZH 5EU4A 1Y18B 4EIZC 5C9JB 4UB0L 2MOVA 3OPZL 3VGEA 4NWUH 1WBZB 4ZOEA 1BQHB 3SGDI 4JKLA 1P6FA 2BC4A 1KB5L 4NC1C 1DBBH 3VW3H 4EKXA 3A6BL 1P53A 1O7SA 2IFFL 1EZVY 1JI1A 5MEQB 3SDCD 1FZJB 3RY4A 2GJZB 1IM9B 3WDIA 4F57L 4F8QA 4OF0A 3SBWA 4YWGL 3VFRA 3LIZH 3NCBB 1LVEA 2D4FA 3QDJD 5C0BE 5T3XL 3QIUB 5IBLC 1K2DB 3SCMC 4JN1L 5MEOB 4KJPD 1RIUH 3O11A 4D0BA 4ENED 5C09B 1S9XB 3BW9A 3GHBL 5DEGA 3PWPD 2Q3ZA 4PRNB 4JVWA 4G6FD 3OAUL 2GAZB 3U83A 1S9KC 4Z8FL 5FGBA 2DLEA 2OI9B 2JB5L 3UJTH 1EV2E 4LASL 1BZ7B 1NSNH 4RNRA 3OJDB 5GS2H 5D5MA 2ARJA 1QLEL 5DC9B 4X98B 4RMQA 4XNUH 5IVOA 3O8XA 2XWBA 3MLZL 4Z7UB 5L2JA 2QSCH 5E4EB 1M6OB 3QIBA 5F3HA 4FFYL 1AO7B 5FDWA 2NY4C 5EPMA 2Z8SA 2R69L 4R4BB 4OQTH 2VN4A 2F54B 4FG6C 5K9OA 1OAZL 4ESKA 4ZTOH 2LAAA 1OHQA 4MQSB 2OM5A 4HGMA 3B9VA 3PQYB 1RZIA 2UY7A 4BK4A 3BXNA 2CK0L 1IT9H 3P4OB 5F8RC 5JORB 4R96A 5IMMB 2DQFB 3KXFD 4UT7H 1UCBH 1KUMA 5HHMB 1R5WB 3D0LA 3PV6A 1YEHH 3OR7B 3OV6A 3D9AH 5DK3A 5DURD 1JMZA 4U1SB 3VFNA 4EQ2A 2VITB 5I1AA 2IEPA 4F9PA 1ONQB 1QSED 1ULVA 1UC6A 1FG2B 3PGCB 4TUJB 4ZO7A 2OK0H 3E6HB 4YHIA 2I9TB 1EVUA 2GJ6D 3FN0H 4XHJC 4P57B 3CFCH 5IHZB 4FP8L 2IAMA 1IC5H 2W0PA 2WINB 3DUUB 1K8DB 2AEPH 1JPSL 1ETZB 1UFUA 4HKJA 4JY4B 5CMAA 5DD6A 2HTLD 1U8IA 4K7PH 2R2HA 1DJSA 5E94A 3HNTL 2GTZB 3MODH 1FV1A 4MS8D 5FM5O 2EYTA 5DMIL 3LEYL 6FABH 4U1HA 4Y2DC 5J7CC 1DANT 2B39A 2A83B 2D4DA 1F3RB 4YUEL 3CUPB 4R6UA 5FEBA 5IJVB 2P5WE 1YQ2A 5HGDA 2BY0A 4C56B 3GMOB 5GJSL 2JCCA 1KCSL 1AR1D 5GIRA 4WU7A 5CWSA 4N0RA 3QRGL 3QQ3B 2F5AH 5BS0B 2AJXL 1PGRB 1YYMH 3ZDXF 3NOIA 4HUUB 1DSFH 2AKRA 1KJMA 4NM8L 3GJEA 3E2HB 3VRJB 2DF3A 3AY4C 3BI9X 4EVNA 4Q6IC 1VA9A 3X13A 1EFXD 4EQ3A 3LD8B 4Y4FB 3RVTD 3FHQA 3RTQC 3S34H 1QBLL 1TVHB 1T5XA 1WFTA 4ONFH 1DVFC 3HUJF 4N90E 4AEHH 3ZT7A 4LCCC 1ZANH 5FA3B 5D6DC 3G5VA 4UIKH 3MXVL 3FT2B 3QFDA 4JKPH 3V4VL 1KJVB 4OFYA 5EA0L 1J18A 3F12B 4L4TE 5DHVH 3MBEA 1MJJA 5ADOH 1FGNH 4LGRB 3RAJH 1FNHA 3P40A 3EO9L 1E28A 2WBJC 3HE7D 1IEBA 3QHZL 4R0LA 1CGSL 4IDLA 3SEPA 1PLGL 3IDXH 3FFDA 3L5XH 2D31A 4GAYB 2BOCA 4KJQC 5FGCB 5JTWA 1J87A 4PIRF 1KLGA 4P23C 5C1MB 1I8MB 5DC4B 5D7SL 2HG5A 4FRWA 1CZ8L 4MAYB 1SYVA 4IRZH 4R26H 4WY7L 5TE7L 2H3NA 4Z7WA 2F8OA 3DLQR 4FQCL 2LTQB 4DN3H 4XGZA 1F97A 1IC7H 1VFUA 2ZOLA 4J3VA 5GS0H 3OMZA 3ZYOA 4KI1A 4LPWA 3IFOB 1KCUL 4BZ2H 4M7JH 3KPOB 1QYGL 4NRYB 4YHZH 1GGBH 2PXYD 1FIGL 2F53A 4XNYL 3M1BB 2A73A 4HIEB 3AGVA 1EXUB 3D85A 3NCCB 1OAXH 5FYJH 1FZKA 2FIKB 3TA3A 3X14A 2ZUQC 5KBNC 4Z7OF 4ORGB 2DQUL 1JN6A 1KJ2A 4M48L 3QUZD 3IB4A 4OZGF 1K4CA 3H3PL 5T5FL 4UOJA 2Q8BL 3RWJA 4HPOH 2IBBA 3SKNA 1VFBB 5FYKU 3WD5L 3H7LA 4MD4A 4QXUH 4NKDB 1G7LB 5F6HI 5C0JB 2HH0H 2FEDC 5FIEA 5EZOH 2FD6H 5C0RH 5KSUB 1WQVT 3SGJC 4PJAB 3WN5C 3ROOA 3IDNA 2B8OT 5ALCH 3OAYK 5EUKB 2NMSA 5KN5B 4TPRH 5ESAA 1NLBH 4Y1AB 5AZ2H 4OI9A 2YMXH 3VFGH 4BZ1H 1J11A 3DECA 4WVRA 4B7LA 1CVSC 2ATPB 5FECA 3O6FB 1QFHA 1ZTXH 2FB4H 3ARGB 4PJ7F 5C0EA 4LLQA 1XCTA 1RUQH 4AM0A 1U8NA 5HVHC 2QHLA 5TE6H 5HVWA 3PWJA 1I9IH 2Z31C 4Y8AA 5I1IH 1GHFH 5HTSA 2NY6C 1NLDH 1LEIA 2HJLA 4K3EH 4NCDA 4GG6A 4RWYL 3EO1A 2N56A 4WHYH 3W9EA 2DBLH 2EYRB 5CZXD 5A3IC 2P7TA 3TNMA 3VMPA 3R4DA 1MJUH 2Z8RA 3P9LB 4UV4H 1LO4L 3RHWK 3PJSA 4V2CB 3I9GL 2GCYB 4E41B 1YECL 4NQDE 1FZMA 1ZLUH 2YWYA 4BH7A 1WAAE 4JY5H 3UPAA 1KN2L 2XZCL 5K9JL 5ID0B 3WUZA 3MRNA 3Q3GA 2IQAB 5L7XH 4IS6B 2OTPA 3KYMB 4H25A 1BGXH 3T3MF 3D0VB 1GGIL 4UINH 1IQDB 3C8DA 5HI3D 1B4RA 4NJ9H 2AV1B 4CUCA 3TBWB 3TGXA 4HWBL 4HCRL 2ZSWB 2ZUYA 4PJFF 2BDNH 2V2WA 2YPLB 1JHKL 1MCRA 5I8KH 1JZ7A 3LN4B 5IQ9A 4PTUB 2Q87A 3PL6D 5EWIH 4OCRH 1BLNB 1Y18A 5C9JA 1F4YL 4K9EH 1JYVA 1BOGB 1W0VB 3BKYH 4OAWB 1RIHH 4O9HL 1IJ9A 1WBZA 3IKKA 1U3YA 3CX5K 3PWLB 3O3AB 1XGUB 3ESVF 5JHLL 3G6AB 5AAWA 5CIPH 5MEQA 5D1QB 1H8OA 5SWZE 2W9DL 1V05A 5IV2B 2GJZA 5B3JF 1IM9A 5DD1H 4JFDD 5EZIL 4OI7A 4RDQF 1A3LH 4PREB 15C8L 2CQVA 1R3JB 1IGJB 2EDDA 3DMMD 3DARA 5KVGH 3QIUA 3HRPA 3MCLL 1K2DA 2PCPB 5MEOA 5EUOB 2X89A 4RGMC 4EI5C 3SKUD 5C09A 1S9XA 3NBNA 3QIWD 4PRNA 3ZT6A 5JDSB 2GAZA 3UMTA 3MACL 4UNUA 1BZ7A 2X4PB 3AUVA 4JHWL 3UBXB 4O02H 3OJDA 1HHKB 4ZO6A 1FPTL 4CU6A 5F7NC 3OKEB 2C7UB 4X98A 4WTXA 3JVGC 1Q8MA 5HYJB 1KG0B 4LSDA 4MVBC 5D7JD 5D7LB 5E2TL 1AFVH 2D7TH 1TJGL 4Z7UA 2C3VB 1JZ4A 3BIKB 1M6OA 3FTGB 2E8YA 4ERSL 1AO7A 3V6OA 4BZYA 5MP6L 4DK3A 4R4BA 2F54A 1OM3L 3LN9A 2NR6D 2R9HC 1CF8H 2P8PB 3SKMB 2EDEA 4G6KH 4LPVA 3PQYA 1RUKH 3NN8B 4LMQE 3F62A 4QWWC 2R0WL 5CGYC 4JHBA 3P4OA 5E9DB 5JORA 5IMMA 2DQFA 2HYMA 5BV7L 2ZCKL 1JL8A 3TVMD 1R5WA 4ONOA 1AJ7L 1I7UB 5KSAC 3OR7A 3GSRB 4PJBF 4FABH 4U0QB 4X6EB 3CIQA 2R0KL 2XTJD 2VLRD 2QADB 1FHGA 4U1SA 1ZLSL 3MLPA 2VXQL 2N4IA 1ONQA 4D9LL 3OGCB 1S78D 2ZOKB 4P4KD 3KJ4C 3ULUH 1FG2A 3PGCA 4LVNC 4KROD 4TUJA 1UXSB 4QKXB 2MQ0A 3RVUD 3TWCL 3U48A 3E6HA 4IEFB 2NY3B 2I9TA 4P57A 4S0TD 2WIMA 3QQ4B 5CEXB 5IHZA 2DQCL 3IAGC 3FT3B 2Y9RT 1OAUL 2WINA 3DUUA 4FQXD 1K8DA 4MJID 8CGTA 1ETZA 4JY4A 3T08A 4ALAH 3W11D 4M62L 1SVZA 2Z8VC 5I0ZA 2GTZA 2OTWB 4GUPB 4RGOL 1IC1A 1G7IA 2PYFA 4R4NC 4EXKA 4S1RL 1QLRB 4XP1L 4PGCB 2ICES 3VFWB 2A83A 4P2OC 4XWOC 1ZEAH 2X4QB 5J3HD 4CADA 3MSPA 1B6DA 3CUPA 4HEME 6CGTA 1G6RH 5E08H 4P46B 4TSBH 5IJVA 2AJSH 3CFIC 3O3EB 4OCSL 4C56A 3GMOA 4FNLH 1BBDL 4L1HA 4AG4L 5BVJB 3NTCL 2CKBB 1MWAB 1EEZB 1FSKC 1PBYA 5TFSH 4YGVB 5GRVL 2VDML 2E9JA 4HUUA 1CBVL 3EOBB 4KZEL 3VRJA 1F2QA 3L9RB 3DVIA 3SJVB 2DQIL 4OFDA 1RZ7H 3U4BH 4F7PB 5I30H 3VXQB 5HGBB 3CZFB 2VOTA 3GSXB 4Y4FA 1J1PL 1MLCB 4QRPE 1TVHA 3IJSB 2J1KA 2W9EH 4GMTH 1K3ZA 5FA3A 1WZ1L 2EDWA 5D71L 2HT4C 3BESR 3FT2A 4IMKC 2EIDA 1IE5A 1A7OL 1KJVA 4OV5B 3F12A 4GRWE 5F7YC 1ZT7B 3LVEA 4JREC 3IU3B 2CPCA 2OX5A 3PGFH 1J12A 2VLKD 5TF1L 1BFSA 2WWKO 1JRHH 2DIAA 3QUML 5EIIB 4W6WB 4OUUB 3CVHL 3LKPB 2MTPA 4GAYA 4IIQC 4J3SA 1AKJB 4PLKC 3BZDA 2BP3A 1NBYB 4G6ML 1HWGB 5BV7C 4TTDD 4WTZG 3C87A 1S7QB