4HLZH

Crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPWTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
publication title Structure of a classical broadly neutralizing stem antibody in complex with a pandemic h2 influenza virus hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 46
structure length 211
sequence length 211
chains with identical sequence J, L
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH01
1NGPH 2K7QA 5SWSD 3BYYA 1G7MB 3IDXH 4U1LA 3WKMH 4P5TA 3QDJA 4CN1A 2DN7A 3FHAA 4DTGL 1ZSDB 4KAQH 1A6AA 5I66B 4LPUA 4HKBA 3RWCB 4ZNEA 2VKXA 2Z8SA 5DZLA 4MB4A 3FRUA 4YDLB 2AV7B 3TBTA 5J3HD 5IMLB 1B6DA 3GKWL 3GMQB 5IB2A 1N3NA 4JREC 3RZCD 2AJXL 1EMTH 2EKSB 1C7SA 4MNQA 5CFHA 4Z7VA 1ZOXA 3MLSH 4P5MA 2GUOB 1F3JA 2R8SL 4DWHA 1R3IH 4X6FB 1V3MA 4KI5D 1E4KC 5DFWH 1PZ5A 4UNUA 1U0QA 1ZK9A 1YUHB 4ISVA 4PJDE 2ORBH 2UVEA 4I18B 2YD1A 3KXFD 1B0RB 3DV6B 3L5WA 3MXWH 4U1IA 2APXA 4HJGA 2IGFL 3CFBA 4TOYL 4JFDA 2G9HB 2H41A 2ZSWA 3OTTA 1OVZA 2RFXB 4K3GA 1KCRH 5DRZA 4ZFOL 3RFZC 2AEPL 4DCQB 3ZHLA 3V5DA 4XNZB 5INDA 4OLYH 3DX8B 4PRID 1CICB 4MVBD 5DWUH 3JV0A 2I9TA 4FA8A 2Q7NA 4RMVA 3B4NA 1WAAA 5EOCL 4HXBH 1SBSL 4G8EB 2HKHL 1G6VK 1IM9D 2DWEB 1YC8A 4HUNB 3DX9A 4P3WA 5K9QI 5KS9B 2NTFA 2RB8A 4P2QB 4NNXB 1KN4L 4WI7A 1YEDB 2W9DL 3IFNH 3TO4D 3U6RB 1FC1A 2NW3A 3O3EB 1OAXH 1E4XL 2XWJA 4MGXA 3VFGH 3VXUE 5CGYD 2F53B 4ODUA 5CKGA 5DD5H 1VEOA 3V79C 5I9QB 1WVZA 1CFSA 4KK9D 3T04D 4PRHD 4Y16D 5FO7A 1X7QB 4XVSL 3MNZB 3HC4H 1HN1A 5CEZD 4IMLA 5ID0B 5CJ5A 3WJLA 4WEUD 3HZMA 4XZUB 2GJ6A 2QQKL 1LE9B 4NN7B 3BKJL 3HI5L 4LEOA 2WQRA 2C1PB 5E2UH 4HV8A 1TLKA 3M17A 4WHYG 3ARDD 3E6FA 5FECB 1R24A 4UT6L 4I4WA 3GK8H 3UTTD 4X7SL 3IKCA 5HYFA 5E9DA 3ISWA 4GAJH 1ADQL 2IPTH 3G08A 4HPOH 5C92A 5C8JA 2E5EA 5HJ3B 1IBGL 1P4LA 3IVKB 1WTGT 2EDBA 4NZJA 3VFPA 4R2GB 2BP3A 4NFBA 1S3KL 1T1ZA 2PF6A 1A3QA 1SEBA 2P8PB 1MCDA 2JCCE 3ARWA 3WO3B 1G9MC 1OP3H 1DN0A 3FT2B 2MQCA 4UTAL 5CZVL 3P9MB 3QEGL 2EYSA 2VDNL 1M05B 1AIFA 2BJML 1ZLVK 5KVEL 4ZPVA 2FX8L 5I1KH 3WIIL 1R5IA 2DQIL 3O3DA 4PGBB 4FFVC 5CJBA 5H8DA 4OLVH 1ZHLA 2FSEB 4GMTH 5GGSB 5F1SA 1BPVA 2AXGB 1KSRA 3ARBC 3WO4B 5FYJU 1YEEH 5TDOB 2Q8BH 4JKKA 5EU5B 4LLVB 5E99L 3EOTH 5JXAL 5HGBA 1LEIA 5B38G 3EJJX 4JANB 1IT9H 1BOGB 5HYSA 1CT8B 4FQJL 4M93B 5JW3H 1YY8A 3UEZA 4EN3D 4HCRL 2IPUG 2D2OA 4DGYH 3L3GB 4PJAF 1AQKL 1I3GL 4JRYD 1QRKA 5D7KD 5BV7H 5CZKA 2CIKA 2VITB 2F54D 4LRIC 3GSUB 1KXTB 5IBUB 4PJFB 4G6AD 2UZYB 3O4LB 1S7RA 4NP4H 4CU6A 2VXTH 1ZVSA 1D9KA 5BQ7A 4M8VA 2H26B 1A6ZB 5KG9B 4OFDA 4LNVA 2XG5A 4KROC 3Q1SH 4OCNC 4MWFB 1NBVH 3CVHA 4Q6IC 3S37H 3S4SA 4X8JB 3U30B 2VLKA 1FPTL 5DRNA 5KSUA 4XMKL 2R29H 2JB6B 5IQ9B 2NCMA 4JO2L 4OLXH 3VRJA 5EU3A 1AGFB 4J3SA 5E03A 4I48B 3KJ6H 3GM0A 3MUZ1 1T21B 4ZS7H 1CE1L 1U8NA 5HYJD 2XTJE 1F58L 4EUPA 3EGSB 4R4FL 1XMWA 4NPYB 2OP4L 3MOAH 1OWWA 4XP6H 5KJRH 4CN4A 1JYVA 4PD4K 5DUBB 3SDAB 2DLIA 2Y06L 5IR1B 5C0NC 5C0RL 4DEPB 4I0PC 3AU1A 3D39E 2OI9B 5AUMB 2CO7B 3T2OA 1OSPL 1DBML 1FSKB 2AQ3A 1WEJL 3NH7H 3JVGC 5E08L 1HQRB 1FHGA 2UZIL 3G6JA 5A1AA 3L7FA 4PJ7F 1GGCH 4ZAKD 2DLTA 5BMFL 1GH7A 4OF7A 4LP5A 5D96B 5ADOH 4P2YA 3NCJL 4HKZA 2BSSB 4CVZA 3BIKA 3MX0A 1NC2D 1T7VA 3RBGA 1MFNA 4L4TB 1G7LB 5GGVH 3VMNA 3BP6B 5J6GA 5T3ZH 4HFWB 5DDHA 5IHLB 2YD5A 5KVDH 4BQ9A 1EA9C 1XIWC 1ZMYA 4PLKC 1MFBL 4U1JA 1KPRA 3TIDB 3QHZL 1MNUH 1VADA 5TFSH 2Z31D 4U1HA 4KZDH 1NCUA 5DVMA 2WUBL 3IKKA 2APVA 2Y07L 5CBEA 1F3RB 2ADIA 4WY7L 4YBLC 5C09A 1DBAH 2R0LL 5BOZG 4MAYB 4NKMA 1NSNH 5HGHB 4J4PD 5FOJA 3TVMD 3RI5F 3RKDC 3S3SA 3OKNA 2EYTB 2IG2H 3EAKA 3MLTA 1ORQA 3UPRB 3ZKMC 4NQCA 2FECI 3T4AB 1QKZL 4WCYL 1LO4H 1R3HB 4RWYL 3OKOA 1V7NH 2R1WB 2D0FA 4F2MA 4WO4C 2PYED 3S3JA 1EH9A 1WZKA 5E2TH 5D7LB 1A7OH 1L9MA 4O2CB 2X70A 4PJEA 4F8TA 5J1AB 4JPVH 5I8EB 3HC0A 2WQ8A 2YC1A 3EO0A 4YFEA 3BGMA 5JNYA 3WLWC 3LMJH 3LQZB 2R0KL 5JOPE 2QKIB 1WQVT 1AR1C 3B8YA 2CDGA 4L3EA 3V52H 3QIBD 1BZQK 4IDJL 1S5HB 2BCKA 3MLUL 4O02H 2OTUA 2PCPA 4JKLA 3KHQA 4MA3B 5E2WL 3QB7C 3JZ7A 5HHOD 5DVNA 3ULUD 2HLAA 4PJXF 1MFCH 1EZVX 3UYRH 3MRMA 4O00A 1L7IH 3SHSA 1PW3A 4XWOD 4OJFL 5IOPB 3HFMH 2XA8H 1BJMA 3QZWG 3C5ZB 4ZO9A 4LF3A 2YKLL 3L9RB 1I9JH 4Z7OF 4JRXB 1JZ6A 4TULH 4BSVA 3VGEA 1JGUL 3MUHL 4JFYA 1F4XH 3DETD 4MNHA 4RAVA 4YHYC 3RIFK 3VFMB 2VZTA 4HK0A 4W6XB 4WW2F 2WBJC 3V0VB 3KAAA 5FKPA 1TMCB 2MCPH 3SDCB 3VXMA 3T65B 4HF5H 2XN9D 3NIGF 2NXYB 1CN4A 2LE9A 1J1XL 5EZIL 4XAWH 3WUWG 1YEFL 3F5WA 3R8QA 1YDPA 1T0NB 2B7DT 2HTLC 2K9UA 2P1YA 2A38A 4PUBH 3V6FB 1I8LC 1JPFA 3B5TA 4Y2OA 1RJZA 3SCMC 4YZFF 3MBEB 1I1CA 1J0HA 3TH4T 1K6QH 1VFAA 3JBG7 1PD6A 2HTKC 3X14A 3TA3B 4OTXH 4HIJA 2IMNA 3B83A 3B2VH 1U8KA 4RMRA 5DT1H 3I6KA 4JLRA 4ODXA 5L2JB 3IJHA 3C60B 3SY0A 4RGNC 2GTWB 3T0ED 4Z7WA 4X9FA 5HVFB 1XF4A 5FDWB 3F7VB 4U0RB 3SEPA 1YNKL 3MRNB 1YYLL 2B8OT 3E6HA 2VZUA 2AV1A 2X44D 1G9NL 5C08D 1F4YH 1LO2L 2FX9L 4HGWB 2ZCKH 4ODSL 2QQQA 5IB1B 2M2DA 5DQJA 1KLGA 2VAAA 3K8KA 3Q6GL 4MJ6A 4E0RB 4Z95H 5J3HC 3WSQH 4KUZL 2BNUB 5C0BB 3ULVF 5SWZA 5KS9E 1I1RA 3RZCC 3AXLA 1Z9MA 4GKZB 1P7QB 3TT1H 1NAKL 2RGSA 3TEUA 4NQVA 2PO6C 4WV1C 4FZEL 5TE4H 5BRZA 5CJQH 5I15H 4LCIL 4AM0B 4KI5C 5CUSL 4X6BB 2F53E 4Y5VC 3CLEL 4NSKA 1CWVA 4XBPA 5F71A 1K5NB 5JA9A 1AC6A 3MRGA 3PIQA 1G7JA 1IC7L 5F8RC 3I9GL 1D3CA 2VQUA 2AJSL 3ARVA 1DVFB 4Z18A 3WBDA 3N0PB 4JFPB 1CXLA 4MA8L 1RVFL 1M7IA 2B39A 1DSFL 4R4ND 2NW2A 1F5WA 1FYTA 2GFBB 4F7TB 3P11L 2FEDD 5D71L 2I24N 3LKQA 5HHXL 1A4JB 2ILLA 4HWEL 4MVBC 4L8DA 2HYMA 2YPVL 3LEVH 2RCSL 4GRLD 5E4EB 4ZO6A 5DJ2A 4PJCB 1JCKA 5F9JB 1H8NA 3WEXB 5JA8B 4PGEB 4XCCH 3HC3H 4G5ZL 4RZCB 4U1KB 5J6HA 1C5DA 4WGVB 3CIQA 3KPOB 1GIGH 3TO4C 5KSBB 3UP1A 3L3KB 4JGMA 3VFNB 3RDTB 1XF3B 4G42A 3DVNB 4MJID 5AZ2H 2IAMD 3NTCL 3GMRB 4Q6IA 5B3JF 1A3LL 4GMSH 2J4WH 4XRCB 5B38B 1Q9KA 4D0CA 4Y16C 1UWEL 4LHUA 5CSBA 1A1NB 3TJEH 2J5LB 2VDOH 5DMIH 1QFWH 5HYIA 3RGVA 2IQ9H 4PYHA 3MV9A 1P7KA 4KRPD 4I3GA 5GS1B 3VXNA 4Y8DC 1BLNB 2DQUH 3GBML 2I9LA 2ESVD 3PNWA 3QEQB 3RPKA 43CAA 4ODVH 1H3VA 3MLXL 4ZUVB 4RRPG 5D2LF 2JKXA 1IGMH 1NGWB 4FNLL 3T08A 1JGEB 35C8H 1T1XB 2ZWLT 5BS0D 4O5LL 5TQ2L 4Y0GA 4FQ1H 1TVBA 3QNXA 3NAAL 4OGAD 3RWEA 3ILPB 2XZCL 3TYGL 1U92A 4CVUA 5I75B 1RUAH 5FK9B 3JVGA 2ZCHH 3KPTA 4OKVA 4KY1L 1D6EB 2CK0L 2HT3D 3UTPD 4GT7A 4TUKL 4D9QE 4D0BB 2I25N 1OTUD 1YC7A 1PLGH 3LAFA 3G5YB 2ZOLA 3SJVA 1LK3L 5DJYB 4JZJC 1Q9OB 1R5WB 4MA7L 1UZ8A 3UMTA 2P5EA 2AJVH 5MI0C 3FO9A 4EI5A 2DQTH 1MCWW 4P46D 4YHPA 4Y1AD 4YPGA 3FQTB 3MZGB 1FE8H 1KIPA 3MXVL 5MERA 3G5XB 2YBRB 4ODHL 1LEKA 1CXEA 1ZT7B 5EU6B 2VXQL 1MUJB 4NQEE 3HUJA 5ILTL 2QSCL 1OY3B 1R0AL 1KB9J 5J13C 5I1GL 3U2SB 5C2UB 1KELL 4KHXL 1MCKA 3DIFA 4K9EL 1I1FB 3BDBA 4X7TB 5F9DC 1QFWI 3ZLQC 4I9WE 3H42H 4WDIA 4EN3C 1DQML 1Z0NA 2OL3B 4YIQA 3QFDB 1RZGA 2E7LA 4U3XA 3MRIB 5DHYA 4QEGA 3EHBD 5DHVA 4XNXH 1OSZB 1BF2A 1GPOH 1XR9A 2BOBA 2XNAB 4G6AC 4L4VB 4X7FC 3CK0L 1D5XA 1RZIA 2NLJB 2FATL 4IS6B 4PJBA 3WD5H 3QIWD 2ICWI 3GHBL 2D4FA 3PWUA 1LILA 4KJYA 1DR9A 2FIKA 1EEYB 1UXSB 4N0CD 3H9SB 5ESQA 1FZOB 4O4YH 2VL5B 3SDXB 3R06A 5ESAB 3L5JA 1OP9A 5GSRB 3CMOL 2LAGB 1F4WH 3R1GL 4GAGL 4GSDH 1P84J 1CLYH 4BUHA 5C0IB 2ICCA 2O61B 5DQDL 1IGJA 4PV8A 4H25A 1MRFH 4NDMA 4X9IA 5IIEB 4YDJA 1MPAH 4EDWH 5I16A 3BZ4B 5J4MA 2NY1C 5FA4B 1KN2L 1TZGH 4YHLH 1EBAA 4Z7UE 5F7EL 5I1IL 1F42A 2A0LD 2FBJH 5A2IH 2A6KA 3QWOB 4ALAL 5D8JL 1JF6A 1SY6A 1W8OA 2XKUA 2NNAB 3OB8A 4XHJD 3UDWC 3SDDB 3ARSA 3FAXA 4YFDB 3CFJB 4K3JL 4NOFA 2KDGA 3D2UD 1OLZA 2HT2D 3K4DA 2QBWA 5H37H 3UJTL 4ZAKC 4LASL 3HPLA 4NKDB 4JG1L 1BBDL 2WBJA 2A77H 4BSJA 3C6LC 2XWTB 3FFDA 1EHLH 4YEEA 1AY1H 2V2XB 3PHOB 1JNLH 1OAUH 4PRBA 3U7AA 3ZL4L 4OI8A 3VD5A 4MX7B 4ZPTA 3HLAA 4HS3B 3Q3GB 1FV1A 3ARRA 4MS8D 4MD4A 5ISZD 1BBJB 5C0DA 4K7PH 1WWWX 3FT4A 3QJFA 4NO5B 4QRTA 3QZWB 1MCRA 4HLZG 1P4IL 3ZDXE 1OGAA 3LN9A 3GO1H 3I75A 3QA3B 2N7AA 4Y4HA 1SBBA 2PTVA 3UBXG 2EDNA 5IF0A 1HNFA 2Y1VA 3FQUB 3MV7A 1VENA 4PRAB 4LU5H 1Q1JL 3BP7A 4PTTA 3SDYL 3VXTB 3TVMC 3C6SA 1MELA 1VGEL 3IDMB 4UT9L 2QSVA 3X13A 3FB7A 5FCUL 4Q9QH 3WUWB 5T3XD 4ETQA 3MRHA 1PSKH 4LCCA 4O9HL 4NC1E 4EOWH 4LLDA 1PYWB 4OCSL 4F37K 4OAWB 5SWSA 3F58H 3OR6B 2NQCA 3LPGA 2GCYB 2P5WD 1BD2D 4H5SA 4P57B 5ESVA 4AL8H 2ZUVA 3X3FH 3PQYB 5E1AB 1FBIL 1G6RB 4YUEL 2CKBH 3QNZB 1QOKA 5D72H 3MODL 3MV8E 5EIQA 2WIIA 1X5ZA 6FABH 3HI1A 4XB8A 5EBMB 3RZCA 1VEPA 4G9FD 1ACZA 2J8UA 3EOAA 5DMKA 1AE6L 3W2DH 3T2NH 1JJUA 2MHAA 4WV1A 1IQWH 1O0VA 4M5YL 3GUTB 5DVLA 4Y5YA 4H20H 1E4JA 4J1UB 5IW3A 4FQ2H 4KPHL 1GGBH 4H1LH 3F12B 3QIBC 2Q1EA 4Y5VA 2O5YL 5EBLA 1BIHA 3GSNB 2OM5A 2YRZA 5FYJL 4XVTH 1CIDA 3VRIB 4OFYD 3R0MA 5HYSG 3HNTL 3ULUC 4NNYA 4K8RL 3A6BH 2Y7QB 4DZBB 5J12B 2CK2A 5C2BH 4R0LA 3WS6C 1H3XA 3C2AH 4EKXA 4C58B 3FQRA 1C5BH 1KJMA 5MEPB 1A6UL 4QXGL 4IRSA 1P6AB 3TYFA 1CVSC 5EOQL 1NCWL 2VABA 3EO9H 4PRIA 4NGHH 2O5ZL 4XMLL 5EWIL 3HG1D 1KPUB 1TVHA 4YXLL 4F57H 2YD6A 4JY6B 2YXFA 1G1CA 5J9PA 1B6UA 5DI8B 4HIIB 4ZOEA 1E28A 4JM4L 2X4TB 4ODWA 43C9A 4YXKL 3TO4A 3TT3H 2UWEE 3PV6B 4QWWD 4GRMA 3RVTD 1F2XK 1UGNA 4OV5B 4KJPD 2MKWA 3KPSB 4RX4A 4EUPG 1JI2A 3ZKND 4PRHA 5EOTB 4TTGA 3O8XA 3S88L 1B2WH 3GEWB 1U8IB 4P2OC 1LK2A 4K2UL 1KC5H 1FFQA 2Z91A 3OKDB 2M8XA 1CTNA 4MQ7A 4NCDA 5FYKD 2GK0A 4HD9A 4MXWH 4S1SL 4PJ8C 5IVXF 4BQBA 1GZQB 4HG4J 3ZTJH 1ND0A 1UM5H 3ARDA 5IV2B 1QSEB 4YHOL 1HKFA 2FH8A 4X80H 3UTTA 3IJYA 2DQGL 1MQKL 3PWNA 1INEL 5A16A 1NUNB 1FFRA 3GKWH 1LWRA 4MNGA 5IFJA 3CFCL 2AJXH 4EDXB 1BAFL 1WSST 1ZANH 3QFJD 4U7MA 1VGKB 5ERWA 4BSWA 5AWNH 2R8SH 3ZDYE 1N0LA 2R0ZL 4LNRB 5HDBF 1RUML 4OI9A 4HDIB 4ZO8A 3I6LD 3VG9B 4MJ4A 4ZXBC 1I9EA 4ESKA 4WGWB 1TENA 2BY2A 4OF0A 3VFOA 1UXWA 2H1PL 3RWIB 4CW1B 4UIKL 3V6ZB 4AYFA 3B5GA 3KPMB 3HAEH 3TN0B 4PB0L 4RISH 3DMMB 4HAGA 5EU4B 2FLRT 3MRLB 3D1MC 1N64H 5T1LB 4QGTA 5ITFB 4GRWB 3T77A 4R4NC 3P30L 3MGTB 3NGBC 2VH5L 2FEDC 4BFIA 2VXUL 5EOCH 1YNTA 3GHEH 3SQOL 1SBSH 2HKHH 4X7EC 2ICWJ 4EN3A 5CD3B 3OXRB 4PGZA 4ERSL 5I8CA 5L0QB 3IFPA 3F7RA 3MZTA 5SV4A 4OZGB 1KN4H 2W9DH 4LIQL 2F54A 2BRQA 4WTZA 4PRPB 1PKQB 1E4XH 5HYQB 1H5BA 1CYGA 1NJ9B 4P2RB 3CDCA 2JJSC 2PR4H 1EGJH 3TIEA 1N6VA 1J8HB 2IAMC 4GXUM 1KYOJ 3WFZA 4ORGA 4XVSH 1FP5A 2HJFB 1TJHH 5LVEA 2NY2B 3ALPA 4XPFH 3QDJB 3PWVA 3E2HC 5JZ7C 2QQKH 1YZZA 1A6AB 3BE1L 3KG5A 4JFZL 4KRPC 3BKJH 3HI5H 4XTRD 2WMPA 1NEUA 3IT8D 5FGBC 3FRUB 1OAYH 3TBTB 4JY5L 5HYJA 4U2YA 4LPXA 5IB2B 1N3NB 5CHNA 5EUKA 5EUOF 1FVEA 4NUJA 3ULVD 3DJ9A 1XF1A 1ITCA 3A6CH 4QTHA 4Z7VB 4P5MB 5A2LH 3AVEA 4X7SH 2NY4B 1F3JB 4CADA 3ALXA 2QTEA 3QCUH 1YECL 1IVLA 1NAML 3P4OA 1PZ5B 2IF7A 2IBGA 4OGAC 4ISVB 4Q7DA 1S3KH 5JPMA 3L5WB 4CKVX 4XXDA 5KANG 4U1IB 2WP3T 4HJGB 4MCYB 4H1LA 3QDGD 3GBNL 3CFBB 4JFDB 2HT3C 4UTAH 2X9WA 2VKWA 3QEGH 4L4VE 1OTUC 2CMRL 2EC8A 5IVNA 2VDNH 5DRZB 1NC2A 4A6YH 2BJMH 5KVEH 3AREB 5EZLB 1YPZA 4GW5A 2XRAL 3RL2A 2FX8H 3HMWL 5INDB 1YMME 4WUUA 3WIIH 4J3TA 2DQIH 4JFEE 3FO2A 1RU9L 2I9TB 4P46C 5KN5A 3H9SE 4LCWB 1E4XI 5F1NA 4NJAL 4HUKB 3SDXE 2IWGA 1NMCC 1BFTA 4HMCA 1KEMH 2Z31A 3DX9B 1OP5H 1MJUL 2VB5A 4KTEL 2NTFB 5E99H 5JXAH 5J89A 5K59F 4KKBD 2B5IC 2YSSA 2CKNA 4GBXB 3HPJA 2Q76A 2NW3B 3TH2T 4HCRH 3ZKXC 2XWJB 4J4PA 2W65A 3TVMA 3IU3A 1DL7H 4NBZB 5GSVB 1AQKH 1JHLH 1PFCA 2AJ3A 1I3GH 3S5LG 1CFSB 1A1MA 1CIUA 2ZSVA 5BVJA 5FO7B 5F6IB 3EHBC 2HKFL 2PYFA 4KK8D 2VWEC 1OD7A 3LPWA 4NZDA 4FFWD 1HOCB 3HZMB 1Q0XL 4F15B 4LVHC 4MAUL 4QKXB 3BRGC 3FB8A 3DVFA 3P77A 4QRRD 3UBXB 1FPTH 3EFFA 4LSRH 4XMKH 3DBXA 1ZLUH 1I7UB 4JO2H 1UJ3B 1KV3A 3M17B 4NO0B 4HPYL 1CU4H 1OPGL 4X4ME 2EEAA 3E6FB 5KOMC 1EEZA 4JR9L 1R24B 3KGRA 5F6HI 1LP9A 4I4WB 1NGXA 3T8XA 4WI5A 4YFLF 3CMGA 5E9DB 4C56D 1CE1H 4HIXL 4JFOA 3SKMA 5C0JA 4QRQA 5C8JB 2F15A 1P4LB 4R4FH 5FOBA 2OP4H 3RVUD 3ZTNL 3VFPB 4I2XA 3LRHA 4I3RH 2DYPA 4PJDF 5IGXL 1AXSA 1SEBB 4P9HH 1BZ7B 1WFUA 5HHOA 5HHMD 5C0RH 1HWHB 1X6NA 4JQVA 1EUTA 2EYSB 4E41D 1DBMH 1E27A 1JTPA 3RVVC 2FO1A 1AIFB 1J88A 5E08H 2UZIH 3CCHA 2EE3A 4BM7A 3C8KA 3HE7A 5BMFH 4ZPVB 2UYLA 1Z3GH 4N0RA 2HT2C 1BREA 1R5IB 4GS7C 3NCJH 1AP2A 1SEQL 3DOSA 3RPIB 5FYJD 1GGYA 1ORSA 5IESL 3AFLA 1ZHLB 4H8WL 4OLEA 4LGPB 2X05A 1HQ4A 1ZLSL 3KLHD 3SKOA 3DX7A 1UA6L 5A3IC 1I7TA 4X5WA 3QBTB 5EPMA 1IGYA 4JEGB 2XN9A 1BVLB 2ZJSL 5GZND 3VXSB 5L2KA 4WNQA 4ZFOA 1VEMA 1LEIB 3OZ9L 4Y5XC 1MFBH 5HYSB 1GXEA 4P49A 5HHQB 5F8QC 1YY8B 4LHUG 4DUXA 1QHOA 3QHZH 3CDGB 1CGWA 4YXHL 5ANMA 2Q3AA 2WUBH 4MS8C 3OKLA 4UOJA 1NBYB 2CSPA 1GC1L 3RI5K 2CIKB 1X5XA 4WY7H 1INDL 2EIZA 3LH2L 3W5NA 2IMMA 1NEZA 4QRPD 2HFGL 4FQQB 2OTWB 3BWAA 3MJ9L 4WTWA 1S7RB 5IHBA 1I8MA 1D9KB 5BQ7B 1V7ML 4UAOC 2QSQA 5I74B 2BY1A 1LMKA 1T04A 1UACL 4V1DE 5FKAA 4OSUL 2OCFD 1QKZH 4F9LA 3T0EA 4WCYH 2VLKB 1IAMA 1KEGH 1I1AC 5KSUB 2VDRL 3GNML 4L8CA 4RWYH 4HGKC 5D6DC 2VOTA 5C71A 2DQJL 3ROLA 1RJLA 1KIRA 4YBQC 1GZPB 5HY9A 1I1YA 1AO7B 2B0SH 2R1YA 1U8NB 1DJSA 4EUPB 3PL6D 3OGOE 4DZ8A 2MJWA 3T3ME 2E6PA 2YPLD 3VH8B 1OF2A 3AU1B 4IDJH 3TFKD 3MLUH 1HKLL 2P49B 3B3IA 5E2WH 1ADQA 1WIPA 3G6JB 3L7FB 1IC1A 3KPSE 4WWKC 1MCOL 2X42A 4M7ZB 1CDGA 4HKZB 1JN6A 4TNVK 3GMOB 3L5IA 4LQFL 4CVZB 5JXED 3BIKB 4XCNB 1CFVL 1ZE3C 3JV5A 2YKLH 5J6GB 2ADGA 1U2CA 4P23C 5DDHB 3CXHJ 4Z7NE 3QEUA 3KPRD 2XQYK 4U1JB 1KPRB 4HAFA 2EDQA 4G6KL 1MCCA 1JI1A 2Y5TA 1VADB 4U1HB 1MIEL 4W68A 5EZOL 4GRLA 1S5IH 1QSEE 5CBEB 5FGSA 2Z8WC 5EZIH 2ADIB 1YEFH 4IEFB 3F6LA 2KKQA 4YHKL 1T83A 3VGBA 4NKMB 4YDVA 2FX7L 3O6FD 3OKNB 1DBJL 4QWWC 5JW4M 3RVTC 2VNCA 5T1KD 1ORQB 1R5VA 1M4KA 5EU7E 1JF1A 4MJIA 4HCRA 2IAMA 3H3KA 1JNHB 4NQCB 3S7GA 2B20A 1LO5A 3ZKNC 2HFEB 3UJIL 2X1QA 3OKOB 2NY7L 3TBYA 4L29A 2VZSA 3WFHA 2OYPA 5F9AC 2X70B 2ESVA 4JKMA 4PJEB 3KJ4C 3GSWA 1YNKH 4JREB 1YYLH 4FQLH 1YMHA 2JELL 1KCLA 2YC1B 1HHHA 3ROOA 1LO2H 4EI6A 3BGMB 5BS0A 2FX9H 5D6CB 5E8OA 4ODSH 4LDEB 3A0OA 3ILQD 2CDGB 4L3EB 1RFDL 3Q6GH 4F33A 5C0FA 1XGYL 3MRJA 2BCKB 3JWOC 2FIRT 1U3HA 2Z92A 2OTUB 4KUZH 4LHQB 2PCPB 5F96L 1T80A 2NY0D 4OF6A 4IOFD 1AHWC 4BZ1H 1T7YA 1NAKH 2HLAB 4OZGE 4N5UA 3QI9C 4FZEH 1I75A 4JFQA 3WFBL 4PGDA 4Z78B 1Q0YL 3MRMB 4N0YL 5D1QC 5ID1A 2VLJE 3CDYA 4LCIH 4I5BA 4RA0C 2HT4D 5MHSE 5CUSH 4P2RE 3VMOA 3IAPA 2CXKA 4M3JA 4BSVB 2EIEA 1ZHNB 5FUOH 3WS3A 1A5FL 4MNHB 1J8HE 5CBAA 2NY3D 4RAVB 1IC7H 2K3TA 4P46A 3I9GH 4Y1AA 1A7BA 1U58A 2AJSH 1NFKA 3B9VA 5FKPB 4WW2C 3VFRA 4N0UA 1RVFH 3QDJE 3VXMB 5I1JL 4GKSA 1DSFH 5E2JA 5MEOA 1NMBL 1J11A 4ZNEE 5AAWA 5D71H 5DJDA 4JDTL 2AJYL 4PJ5D 4OBSA 5HHXH 2IADA 4HWEH 3VA2C 1YDPB 1T2XA 2YPVH 1JPFB 4Y88A 3ZYOA 2EDYA 4WU7A 3W9EA 1FGNL 1RJZB 2HRPL 4G6ML 4Z7VE 4JE4B 1E6JL 4NRXB 4X98A 3ARGD 3WIFB 3X14B 1U8PA 3BN9D 2IH3B 3OKYA 4HIJB 5DC0A 2C26A 3QQNA 2ITDA 1A2YA 5DFTA 5E8PA 1MCLA 3I6KB 1XR8B 3WNLA 2NY6B 3TCXA 4C4KO 4JLRB 3QIWA 5DLML 3IJHB 3SY0B 4M7KL 1X4XA 1ZHBA 3R0NA 1XF4B 1UWEH 2X4NA 4MA1C 3E6HB 1HILA 5DYOA 3GZKA 1MJ8H 2AV1B 1BJ1H 3TNMA 3S5LB 1C08A 3I02B 1XGPA 5DQJB 2C4FU 5LWYH 1REIA 4XMPL 2VAAB 4WI6A 4LCWE 4XTRC 1WAAE 3MLXH 2C3VA 3QYCA 3SE3A 5F7HA 2X89A 4FNLH 4MJ6B 1OTSD 1UG9A 5SWZB 2ZKHL 4XC3L 4JHAL 3AXLB 3ULVC 3ULSA 4O5LH 3AM8C 4NQVB 5TQ2H 4HWZA 1MAKA 5HPOA 3L3IA 4YHZH 5BRZB 3NAAH 3S36H 2XZCH 3C2SA 5DF0A 3NIDE 1CICC 4PY8I 4KY1H 4JDVA 3D2UA 2CK0H 3GRWL 1NL0L 3TZVD 3PIQB 1G7JB 3BPOB 1LK3H 1U93A 2OR7A 1M7IB 4ZYKB 2X1XR 2NW2B 1FYTB 3NBNA 3LKQB 5C0AB 2VQ1A 1FGVL 4L8DB 3MXVH 2C3GA 2XICA 2EDXA 3UJJH 3MJ8A 4ODHH 5ISZA 5DJ2B 4PJAA 5LXGL 2VXQH 1TNNA 1GHFL 4ODTH 1DZBA 5ILTH 2QSCH 3O41A 4Y19D 1R0AH 5TGBA 3LHPL 2A6JA 5E9DE 1C5DB 5CS7A 3VWJD 1KELH 1S7UA 2W92A 4GO6B 4K9EH 1NFDB 4NN7C 1QFUL 1U8MA 1EBPA 2ZUSA 4YHML 4P4KD 4L9LC 1DQMH 5FCSH 3BPNB 5HD8D 2AEIT 4AMKL 4Q6IB 5TE6L 3WL9A 4D0CB 2B2XL 3B9KD 3IXAA 4JN2A 2FATH 1CS6A 1IAOA 4KK8C 3RGVB 1C5CL 1U36A 3GHBH 2EYRA 3MV9B 1P7KB 1I7ZA 1Z6JT 4R2GC 2I9LB 3LN5A 3PNWB 1X5HA 43CAB 2PW1A 2CJUL 4IHOA 1KLFA 1HHJA 1MCWM 4ODBD 3VD3A 1K8DA 4PTUA 4JKPL 3CMOH 1ZTXL 5SX4H 4G9FA 4BQ8A 2W0PA 3VXSE 2WWMD 4R26L 2DL2A 3OPZH 4OZFG 1TVBB 3QNXB 3O6LL 5DQDH 3EFDL 3FOMA 4J3UA 1JK8A 1U92B 2CRMA 4KC3B 5IWLA 3RVUC 4OKVB 1KN2H 4KDWA 3QAZC 4HUXA 4YHNA 3P9WB 1MCJA 5F7EH 5I1IH 1CE6A 1MI5B 5I1HL 3EYUL 4ALAH 5D8JH 3SJVB 3RY6A 2G75A 3MA7A 4K3JH 3DRTB 1UZ8B 2GHWB 2H6PB 2ARJA 2YD8A 4M93C 2P5EB 1PG7W 1UM6L 3UJTH 1UH2A 4EI5B 2A9NL 4YHPB 1UZ6F 5GHWL 4HQQH 1AFVL 4DN3L 1IAKA 1QBML 2UY6A 4JG1H 4YPGB 4CNIA 4QHLA 1I3VA 1KIPB 3JWDC 5MERB 4BK4A 4CUCA 2YZ1A 3HG1A 2VUOA 2Q6WB 5FHAL 3ARFD 3FQNB 3KLHC 3HUJB 4POUB 4TSAH 2BSTA 1B88A 1IGIH 1AO7E 3ZL4H 4HT1L 1NCCL 5E6ID 3JSSA 5SX5K 5LBSL 1BVKA 3DIFB 3QUXA 3IB4A 3QULA 4WDIB 3U30C 4B5EA 4YIQB 1NGQH 4RFNC 5HVWA 3HKFA 4WHTA 1RZGB 1XGQA 1N2RA 4PJGE 1W0WA 5DHYB 1ONQA 4XX1G 4RQQA 5DHVB 1J18A 1XR9B 2BOBB 3MBXL 2D31A 2YHGA 1Q1JH 1D5XB 4RSVA 3GJEB 1RZIB 3SDYH 3ZO0A 3G6JE 5SX4I 4KTDL 1YQ2A 3PWUB 1CQKA 3NCMA 4NRYA 5FCUH 1WWBX 2NXZD 3CXDL 3O2VL 4QHUA 1XT5A 3GBLA 2AXHA 2R2CA 1C16A 4O9HH 4OCSH 5GXBB 1QFHA 1JTOA 2OI9C 2CLVB 4M8QB 1FSKC 1U91A 1K8IB 1A9BA 1FBIH 4YUEH 1IGJB 4PV8B 3MODH 4H25B 4NDMB 5DA0B 1S7QA 5EC1A 5D96C 3PL6C 4E42B 1KLUA 4YDJB 4EXKA 1JGVL 1MHPH 4GQPH 5I16B 3BKYL 5J1TC 5CZXD 2H32A 5CSZA 3QFJA 1A7RH 1QBLL 4X6CE 3QUZD 1S7WA 2RR3A 4PJXA 2GEEA 4M5YH 5IEHA 4UINH 5GS0L 5D1ZD 3RVWD 3ARTA 2A6KB 1N6UA 1VPOL 4KPHH 4DUVA 5F89A 3SN6N 1CGSL 1X5JA 1YYML 2O5YH 3DXAD 3NMEA 5FYJH 4J3WA 5D1XD 3EZJB 3HCVB 3HNTH 3U82B 4K8RH 2DWDA 2WBJB 4OZIF 1KCUH 1UCBL 4U3HA 4WTXA 3T1WA 1WFTA 3OGCA 1KCVL 4HFUL 1YEHL 1V3KA 3FFDB 5HTSA 4NHUA 4S1DD 1A6UH 3WFCH 4PRBB 3GGWA 4BFBD 3PWJB 1FO0A 5EOQH 1NCWH 3HLAB 1DQTA 2O5ZH 4XMLH 4MD4B 5C0DB 3FT4B 4OLUH 4WI2A 1ZHKA 3QJFB 4QRTB 4XCFL 5B4MD 3S35X 1P84K 3I75B 4JM4H 4AIZA 4YXKH 4V2BA 3CPLA 3MV7B 3HNVL 3BP7B 4Q0XL 3TCLA 4DKEL 1T0MA 3O6FC 3FAWA 3C6SB 1ZGLM 2AP2A 2GY7B 3KYOA 4RGNB 3X17A 3X13B 1JMXA 3FB7B 2DKMA 1KJVA 1RIUL 1RQ5A 1CG9B 4ETQB 3RVXC 2YD4A 3MRHB 4HUUA 4QRSA 3S88H 4LCCB 3RWJA 1F11B 4M9PA 4LLDB 4LLAA 4K2UH 5HI4D 5GRUL 5SWSB 5BVPH 3EZ8A 4S2SA 4UQ3A 4F80A 1P7HL 2Y4SA 4H5SB 5ESVB 2C1OB 5DK3A 3SOBH 1TDQA 4M61A 2SEBA 4S1SH 4YNYA 1H3GA 4PY8J 2WIIB 3E8UL 1NDMA 1GGIL 2E7HA 3JWNC 4BFGA 3HI1B 3VXME 3RZCB 1DBKL 1FFPB 2J8UB 3EOAB 5DMKB 3GIVA 4YHOH 2MHAB 4WV1B 4HWNA 5HDLA 4Z7UF 1TZHA 2BVPB 1MQKH 4Y5YB 1ZWIA 1INEH 4WI4A 5DRWA 3ILQC 1D5IH 3CFCH 1CFTA 3GJFK 1BAFH 4R7DA 1T89C 1A7PH 3K46A 4Y5VB 4F7CA 5EBLB 5GS2D 1DE4A 3DUUA 3KXFB 3O9WA 3SE4A 2R0ZH 2BXYA 3H7LA 3AB0C 4NM8L 3QDGA 3KPNA 3MJ7B 2NXYC 3WLBB 3U9UA 2GYSA 3FN9A 1OL0A 1T2QL 4WFHE 2HT4C 3FQRB 2IFGA 1KJMB 2AABL 5CEXB 3QG6A 1NEZG 5F7WC 1IZKA 2WM0A 1JWUB 2H1PH 1A14L 4PRIB 2VABB 2C3WA 4UIKH 2NY3C 4KQ3L 1BJ1J 1IKFL 2HWZL 4PB0H 3UC0L 1TVHB 1FFOA 3MREB 5E2VL 3TA3C 3F7YA 2VLME 2CRYA 4X4XB 3KPQB 5J9PB 1MEXL 1IM9B 3DROA 1NGPL 4M48H 1E28B 3P30H 1G0YR 2Q86A 4ODWB 43C9B 2VH5H 2VXUH 3TO4B 4KAQL 3SQOH 1CD8A 4Z7WF 3EW3B 2V5SA 1CXIA 3JXAA 4GRMB 4CMMA 4Z8FH 4JQXA 5JW5A 1WGOA 4ERSH 4RFEA 1G7IA 3N1GC 1SJHA 4FTVE 1EMTL 4H0HB 3FOLA 5BRZE 3ARGC 3PXHA 4PRHB 4Y16B 3A67L 3NCYS 3OKEA 2OLDA 1TCMA 1LK2B 5DZNA 1U3YA 3G04A 2Z91B 4FXKB 3DI2B 1Z0MA 4MQ7B 5JUEL 3UYOD 1MHHA 4K71C 4LPCA 2ORBL 4TVPE 4QRRA 1YJDC 4CJ0A 3IJSA 2L4OA 4R96A 5D2LA 1G0DA 3O4OB 1VKXA 3P4MA 1ND0B 5DO2D 3ARDB 3QO0A 2VLLB 3BE1H 4FZ8L 4MCZA 1BQUA 5CJ8A 4JFZH 1QUNA 3UTTB 3IJYB 3D69A 1ITBB 5C0AE 5E95B 4MNGB 4YR6A 5IFJB 1AC0A 4NT6A 3HN3A 5ERWB 1OTSC 1U3ZA 3L3OA 4KRNA 5LGKA 3T0VA 3UTSE 5BJTA 5T1LD 1YECH 1K2DA 4BZ2L 4TUOA 1NAMH 5DJCB 1NFDE 4PD4J 4QRUB 4M1GL 4E41A 4HEME 3BD4A 2ENYA 1W2KT 5CGMA 2MCG1 2EEDA 3GBNH 1QSFD 3VFOB 5DD5L 1UXWB 4H0GA 4OZFB 3TZVC 4WHCA 2PW2A 4BUGA 4AQOA 5C9KA 1TPXB 5DVKA 3HC4L 3MV9E 2XRAH 3QHTC 3HMWH 4FQXD 3T77B 1BM3L 4O51A 1U6AL 5J13B 3QO1A 3QXAA 4IM8A 1RU9H 3NCYP 1Y0LA 1YNTB 2EDTA 4APQD 2UWEF 3KDMB 4EN3B 3W81A 1MJUH 4KTEH 3B6SB 5I8CB 1KIQA 3PWLB 3IFPB 4P5TD 1BFOA 3F65A 4JRYB 2J5LC 4PGCA 5ALCL 3MACH 2F54B 2NZ9D 5TPWH 1K4DA 5DJ8A 3C5JA 4QRPA 5GS1C 3VWJC 3OAZK 1E6OL 1H5BB 4UB0L 4HPOL 2JIXD 4P4KC 1RZ7L 5D93C 3VGFA 1X4ZA 4MNQD 5E56A 1S9XA 1CDUA 1MI5E 5HD8C 1UQSA 4ORGB 1FZKA 4U6YB 3KYKL 5E6YA 2HKFH 4B41A 3FKUS 2AKRA 4MAUH 5I75C 1MHCA 3QUMA 4I8DA 4M4PA 1JNJA 5DJAA 5HYJB 3DYOA 4PG2A 4Q6YA 5IEKA 2MPAL 5CHNB 5EUKB 1FVEB 4NUJB 4HPYH 1OPGH 1N6QL 4RNRA 4OLVL 2N56A 4JR9H 4QTHB 4GMTL 3HUJE 4KDTC 3X12A 3L5XH 2YPLA 4CADB 1AJ7L 4HIXH 5ENWA 2WWMC 1D5MB 4WWID 2Q8BL 1IAIM 3W39B 3P4OB 3ZTNH 2R56L 2N4IA 4XWGL 2D0GA 5JPMB 2J3SA 4XXDB 2OJEA 3LS5H 3BKMH 4KRLB 4HX1A 4BQ6A 5GIRA 1J9CT 5JXEA 4K94L 1NC2B 5C0CD 4QT5A 3GMLA 4W4OA 4NP4L 1YPZB 5EULV 3RL2B 2AK4E 5IROC 4XPBH 3KPRA 4KKAD 3FO2B 3QH3A 3VRLE 5C7XH 5KN5B 4H8WH 2V5TA 5F1NB 3SBWA 4QCIB 1ZLSH 2NZIA 5CMAA 1M1SA 1UA6H 4U1MA 2Z31B 3WKNA 1OAQL 4NQDA 3GMPA 2GAZA 2R29L 1TETH 5FM8A 3OKMA 4PJBF 2ZJSH 4OLXL 3ZE0E 3ARFC 4DVRH 2GJ6D 3OZ9H 4LKXA 3ME0A 1H8SA 1SJXA 1J0JA 3HPJB 2Q76B 4NO2B 4YXHH 3O45A 1MJJB 2ZOKA 3O6FA 3IU3B 3TVMB 3B9DA 4AEFA 2AJ3B 1AH1A 1GC1H 3V6BR 1EVUA 1INDH 3BPCA 4NFCA 1A1MB 5T1KA 5BO1H 3VFTA 2ZSVB 3MOAL 4TTDC 1BFVL 1MWAH 1X5FA 2HFGH 2OR8A 5BVJB 3MJ9H 1T3FA 4X99A 5JW4Q 1KTKE 3LB6D 1V7MH 3OHXA 1NFIA 4FFZL 1SM3H 3QG7L 3DVGA 2PYEB 3IDJA 3BEWA 3LDBB 5HXMA 3D3VE 4OSUH 3FB8B 5IFHH 3P77B 3ZSSA 3EFFB 2VDRH 3DBXB 3GNMH 1WBYA 2QSTA 3WNKA 1YA5A 5ADOL 2AVGA 4NZTL 3BDYH 2DQJH 4UOW1 3DUHA 1LP9B 1NGXB 4RCAA 3SDDC 5GGVL 5MEQA 2VR5A 4JFOB 2I07A 3SKMB 4QRQB 3MCLL 5DEGA 3QIBB 1T89A 4I2XB 2DD8L 2DIAA 1AXSB 3KS0J 4J2XA 5CZXC 5I1AA 4LFHD 5HHOB 2WW8A 3FJTA 3G5ZA 4KUCF 2FJHA 3SKNA 1N4XH 2FRGP 3MV7E 3QQ4A 5CJXA 1E27B 2ZUXA 3RVWC 1HKLH 4XCEB 3CCHB 3N85L 2ZNWA 1XFPA 4RGNE 1NAMA 2UYLB 1XGTA 1MCOH 1EXUA 1AP2B 1R3LA 12E8H 4JY4B 1A6WL 1ORSB 2GSIA 5IHUL 1QEWA 1HQ4B 1CTOA 1YJDL 2HRLA 3SKOB 3DX7B 2B4CC 5SWSE 1D9KD 1I7TB 4WI8A 4X5WB 3WXVL 3U46A 4LCYA 4MJ5A 5EPMB 4X9GA 2XN9B 2F19L 5MEND 1IGCL 4ZFOB 2XXCB 4G6KH 2HJKA 1MIEH 5ANMB 5EZOH 3LSOA 3OKLB 2J8UE 3OAUH 4JPVL 2EIZB 4NUGL 1NEZB 4U1SA 3BWAB 1JGLH 3VGAC 3VXQA 1I8MB 4KI5E 2FO4A 3WNPA 1FAKT 3KXFE 4MSWB 2AQ1A 1T04B 4FABH 1RI8A 5FKAB 4AIOA 3T0EB 5IVXA 1P5UA 4ZQKA 1AKJD 1MFCL 4MXVE 3UYRL 2YA0A 4C57C 3KLSA 1IM3A 1XCTA 2VL4A 4MXQD 4X83A 5HI4C 3ROLB 1RJLB 3VXRE 2HN7B 5C08B 1KIRB 1I1YB 5DFVD 5K93A 4TULL 4PRIE 3HNSL 5D7IE 1F4XL 3IFOA 2JELH 4DZ8B 3U1SH 3AY4A 1VFBB 1KCKA 1S7TB 4QHMA 1MVUA 4Q2ZA 3GJFA 1Y18A 1JZ3A 4HF5L 1U8JA 2IANA 2W0KA 1XGYH 2DQDL 4QHKJ 3WFDL 5F96H 2LU3A 3B3IB 3F6IA 3QUKB 1EHNA 5ICXB 3G9VA 1R6VA 1Q0YH 4N0YH 1JN6B 3TZVA 5EIIA 1JPGA 5C09D 5DC9B 5CEZE 1DUYA 2I5YH 4GAYA 4OTXL 1IGTA 2QR0A 4R8WL 3CH1A 1A5FH 5TDPA 1CK0L 1FG9C 4NQED 5DTFA 3QHFH 3QEUB 1E4WL 4D8PA 2R1XA 3ETBF 4XCYA 3T2PA 1CD1A 2P4AB 3MLZL 2EC9U 2P8MA 5T5NF 2JJUA 2X9YA 3S96A 2Y5TB 1UB5A 4I9WD 5I1JH 4GRLB 5FM5O 3RY5A 2ZNXA 4Y19A 5DGRA 4C4KT 4JDTH 2UUDH 2AJYH 3U4BL 3UTTE 3HS0A 1QPPA 4YDVB 2OZ4A 3VWJA 4MNGE 2J2ZA 2HRPH 4G6MH 3CU1A 4P4KA 4H88L 4NKOA 4JVWA 1NPUA 1R5VB 9CGTA 1JF1B 4MJIB 1QRNE 2IAMB 2YWYA 3V6OC 2A73A 3TT1L 4X5LA 2FWOB 2Q7YB 3SQBA 3FT3A 4CU8A 3B9KA 4KMQA 5HDOA 4WI3A 3E2HB 5DLMH 1RUPL 3MJ9A 4L29B 4N90E 2IEPA 4ZUTB 4KRPB 2P42B 2HP4A 5ACLA 2ESVB 1KB5A 5JHDE 2VDKL 1A6VL 2P45B 1A8JH 2X4RA 1LDPL 2V7HA 1HHHB 2HVKA 5BS0B 5DO2C 5E8OB 3VG9C 1QLEL 4Z77A 4XMPH 1WC7A 1BQLL 4F33B 5C0FB 3MRJB 3CX2A 2Z92B 3KYNA 4G9DA 4XGZA 1RUKL 4XC3H 1OGTA 4JHAH 3JV4A 4QYOA 3TN0C 4JRYE 4BH7A 3LEVL 4R3SA 4YX2H 5D7KE 4JFQB 3DMMC 1OB1A 3ECBA 5ID1B 3IDIA 2W60A 4IMKA 1SJEA 3HC3L 3UTOA 3F7PC 4JPIA 3T4YB 2FHCA 2O26U 4CGTA 3WS3B 2HMIC 4YE4L 3GRWH 4ZUUA 1NL0H 4EZMA 5CBAB 2IH1B 3BXNA 3BZDA 4P46B 4ZSOE 5L0QC 4Y1AB 1U58B 5E94A 1NC4A 3PDOA 5E1HB 3VFRB 4N0UB 1EK3A 2DMBA 2Z4QB 4GMSL 5HDQH 4GKSB 4HMDA 1LVEA 5HGDB 3TJEL 3FZUC 1T4KA 5DMIL 4FQXC 3LIZL 4OM0H 5DJDB 2IQ9L 2AJZA 2IADB 4QGYA 2UVFA 4XXCA 1FGVH 3LVEA 5HYJE 3P73A 4XX1E 3NZ8A 5E6IA 1P4BL 4AT6A 3W9EB 2VXSH 2YWZA 5LXGH 4PJIE 1GHFH 2VAJA 4X98B 1QHPA 5I8OL 5HI3D 4IRJD 1U8PB 4P5TC 1MRDL 2YK1L 1SJVA 3REVA 2ITDB 2LAAA 5E8PB 4YHMH 1I8IA 4U49A 2DKSA 3QIWB 1OQXA 4AMKH 5L8KB 3RNKA 1ZHBB 1S7SA 5HYEA 1SMOA 4WENB 1H3PL 3PWPD 1ZLWK 3MV8D 4B0MM 4UV4H 1HILB 5DYOB 2DM7A 5F1KC 4XH2A 1C5CH 1I7RB 1YPZE 5FM4A 4XBGA 4Y2DD 4GKNA 1C08B 5DJZA 1XGPB 3FB6A 3DI3B 1Z5LB 4YLQT 5D7JD 1KJ2H 2C3VB 4GW1A 1WZLA 1ZA6B 3EYSL 3IYLW 5EH1A 1UVQA 3ARYA 4PJDA 1FE8L 4I77L 1SYVA 1TTGA 1ZTXH 3ULSB 3U4EA 1DQJA 4BJLA 1VERA 4R26H 3DRQA 4HWZB 1UH3A 5CKAA 1ZVYA 3QUZA 3L3IB 3OMZA 1M7DB 2XZQL 4XPHL 3O6LH 5KVGH 3EFDH 1ZEAL 5KTEH 2QQNL 5D1ZA 5D4QA 5T3ZD 2OX5A 3ARPA 1EERB 15C8L 1KTDA 3DO7A 3DXAA 3D2UB 2BY3A 3IAQA 3QDHA 3TJHC 4GS7B 5D1XA 5I1HH 1PG7L 3EYUH 3R8BB 1V3LA 1U8QA 1F6LL 1GGTA 4ELMF 1U93B 4WVRA 3MLYL 4TRPL 4NHCL 3HMXL 3NFSL 5J1SC 4XNXL 3QQ9D 2NX5D 2PYEE 2V2TA 4POZD 1UM6H 2A9NH 3MGOA 1AFVH 3WD5L 4UDUA 1XGUA 2GITA 2VQ1B 5CLTA 1JF5A 2F8VA 1FNLA 3MYJA 3MJ8B 2OQJA 1OM3H 5ISZB 4LHUD 4PJAB 4OQTA 4X0KA 3LZFL 5FHAH 1LP9E 3BN3B 4JB9L 3O41B 4O4YL 5DUPL 5F70A 3WJLC 2A6JB 4HT1H 4OIIL 4F15C 5DQ9A 5LBSH 4ACPA 5JR1L 4GSDL 1U8MB 4XPGL 1V5JA 4HHAA 4K7FA 2DICA 2EKJA 2VDPL 5KW9L 3K4ZA 4ZFZA 3RJDA 5DD6A 5HHOE 4NCC1 4EDWL 3ULUE 3HZYB 1OCWL 3CFKA 2ZUWA 1Y6NR 3MBXH 3IXAB 4JN2B 1LO0L 3SPVA 3LB6C 3VWKD 1IAOB 1HXYA 3MLWH 2YN3A 1I7ZB 2D7PA 3IDNB 1BD2B 3O2VH 4JO1L 3LN5B 4JVPA 2PW1B 2QADD 4QHNA 5A2KH 1K8DB 4PTUB 2XKNA 5F7MC 3BPLB 2Q3ZA 3DO3A 5CEYB 4G8GD 2A77L 3X11A 4G9FB 4XPAH 3C9NA 2P5ED 2JCCA 5IG7A 1EHLL 5SV3A 3FOMB 4OGXH 1AQDA 1W72L 2EDLA 1JGVH 5ANME 1QBLH 4K7PL 2EDHA 5IBLC 3TF7C 3UROR 1CE6B 1HSBA 5GS0H 1VPOH 2D7TL 1OOAA 3HE6A 4ZFGH 1CGSH 2G75B 4JCLA 3FQWA 2ARJB 3WXWH 5IB5A 4M02A 1CI5A 4LSUL 3U9PL 2EE2A 1IAKB 1RZKL 4CNIB 4J23A 4QHLB 1UCBH 2FL5B 3HG1B 1KCVH 4I13B 4HFUH 4Q9QL 4PREB 1YEHH 4YGAB 3STZB 5CCKL 1ETZA 3VW3L 1PSKL 2EDKA 1FNGB 5C08E 1D9KC 2DBJA 1FZJA 2Z0BA 4MDIA 1JBJA 1MCPL 3EO1A 3EDEA 5I74C 2DM2A 1BVKB 1FC2D 3QUXB 2NR6D 3QULB 4XCFH 2EH8L 4PJHF 2NY5L 3EYQD 1CLZL 1HZHL 5D72L 3Q5YA 3V7AG 4WHTB 4WU5A 1HNGA 1XGQB 4YDKL 1N2RB 3V6OA 1W0WB 1ONQB 3L3JA 3QSKB 3T2NL 2D31B 1GRWA 1F3DH 3NIFE 4M1DH 5CIPH 3RWFA 4GLRH 1RIUH 4QHUB 4IJ3B 4HUVA 4ONHA 4UOW0 3OKKA 1IL1A 1KOAA 2DIBA 3KJ4B 4XHQA 1C16B 4OZHF 4XB7A 5FDYA 1VESA 3L95A 1UT9A 5GRUH 3UAJD 3A6BL 1Q9LA 1UB6B 2KUTA 3ZYJA 4MXQC 4DGIL 4L8SA 1JZ8A 2X1PA 3RWHA 1T5XB 2CIIA 4PRNA 3E8UH 5EC1B 4M7ZC 2CO6B 2BVOA 3WNOA 1AHWB 4JZOA 2W07A 2H32B 5CSZB 3QFJB 5D2NA 2JJTA 5EN2B 5HGGS 2GJZA 4LLYA 1S7WB 4PJXB 4ZUSA 1U8HA 4KKNA 4KUCD 2FJFA 2WNGA 2KPNA 5I6XB 1DQQB 2W0FB 5F89B 3UYPA 4JZNB 3VD9A 1RHFA 3TT3L 3RIAF 4MJIE 1YMMD 2ARWA 1BIIA 1OGAD 4NM8H 1FN4A 4UIMA 4JFED 4JM2A 4Y4HD 2DWDB 5IMKA 4WW2B 1T2QH 1QLFA 3PHQB 2X4OA 2APFA 2AABH 4NHUB 1B2WL 2HH0H 4FQXA 3HI6L 1FO0B 1A14H 3B8SA 2ESVE 4KQ3H 1IKFH 3VXPA 2CRIA 4KU1A 3UC0H 5E2VH 1ZHKB 4APQA 1F00I 1MEXH 4UILH 5LGJA 4GLRI 5BS0E 4G7VH 4OZ4A 4UDTA 5JMOC 3PF2A 4F7PB 4AEIH 4N9GA 1P69B 4PJGF 4X6DE 1UM5L 5K9OA 3CPLB 2DMCA 2WLZA 2XQBH 3WHXA 4UV7L 4X80L 3TCLB 3M45A 3RTQA 1MCSA 2VERN 5KSAD 3KYOB 3EYFA 3QCVL 2JIXA 1C7TA 2Y72A 1KJVB 1ZANL 3UTPE 3ARQA 4QOKE 2R4RL 3MFFA 2Z8VC 1BX2A 3A67H 4HUUB 4QRSB 5AWNL 4MA1B 2DQEL 1ZT1B 3RWJB 1TITA 4DN4L 5HHPA 4S2SB 1A7NL 4UQ3B 3BJLA 4LEXL 5JUEH 4M61B 2CQVA 2SEBB 3PDDA 2A6DA 2J88H 4YNYB 4Y1AE 3JV6A 5KOVC 1UADC 1NDMB 3BMWA 5EO0A 3RAJH 4KMTH 4NKIH 2A83A 3C8DA 1MLBB 3GIVB 3B2UD 4FZ8H 1JPSH 4RISL 4OCMC 1P9MA 1S9VA 3PP4H 4JHWH 4JKWA 4X6CF 4Z9KB 1ZWIB 1N64L 4IRSD 1KTLA 3Q5TA 2DL9A 5DRWB 4NKQB 4Y4FD 2VLRD 5EORL 4R7DB 3MRFA 5GRVL 4F7CB 2R4SL 5CAYB 1OTTD 2FR4A 1DE4B 3AMLA 3C5SA 3GHEL 1BF8A 4FFYH 1FNSL 1FQ9C 5IKCA 3QDGB 3KPNB 5GGTH 4BZ2H 3BKCL 1T20A 4M1GH 3U9UB 2VWEE 3LQAL 3PGCA 3QEHA 4JJHA 3M8OL 1BMGA 4LGSB 4MHHI 5C0CA 4JDZA 4ONGL 3QG6B 2X09A 3WDHA 3RWCA 2PR4L 4RX4D 1EGJL 4EQ2A 2W59A 3W9DA 3Q48A 1FFOB 5IMLA 2BNQD 3O8XD 1TZIB 2EKSA 3DROB 5I2IA 4Q74A 1TJHL 5BV7C 1BM3H 1U6AH 4U6TA 4XPFL 3T09A 2NY6C 1ZAGA 2Q86B 3MUY1 4X6FA 3VFSB 2A74A 2X2YA 3TV3L 3ZE2E 2OSLA 4KKLC 4L9LB 5JW5B 1OAYL 2AJUL 3IS1X 3EOBA 4MD5A 4RFEB 3ZYIA 4S0SD 1G7IB 1B0RA 1SJHB 5FXCH 5ALCH 4F58L 1FRGL 4V1DD 3FOLB 2DTMH 3A6CL 3F7QA 5HI3C 5K33A 1R3KA 1RHHA 4IRJC 2G9HA 3OKEB 1E6OH 3QCUL 1F02I 4UB0H 3G04B 2M1KA 1RZ7H 4GUPA 2B1AL 2GK2A 3D85D 4LBEA 4W70A 4KJWC 5CIPA 4XBEL 3KYKH 3L3DA 2CDFA 4QRRB 3M1BB 3IJSB 1MIML 3N50A 2BVUA 4R96B 5D2LB 2DQFA 3ZDZF 1VKXB 5FA3A 3P4MB 2IQAA 2P8LA 1K9TA 3VI4F 3QO0B 5KS9A 3MRBA 4LSDA 2ED9A 4A6YL 3E0GA 1EO5A 3D69B 3ET9F 4L9DA 3O2DA 4C56B 3QIUD 4YR6B 1UJTA 4AQ1B 3RHWF 2MPAH 5ISZE 4NT6B 3O3EA 1N6QH 4S1RL 3BPOC 3L3OB 3QAZB 1T22A 2F53A 1JNNH 4ELKB 3BX7C 4G3YL 1QR4A 1AJ7H 3BZFA 5BJTB 1VFMA 1DCLA 1KEML 5IM7A 3D9AL 5I19L 5IW1A 3BRFA 1YEGH 4TUOB 5HHMB 3MNZA 2R56H 4E41B 2WWKO 2P46B 4XWGH 2PXYD 4FOMA 1T2JA 4YGVA 4HIEA 3GIZL 3Q6FA 3HZKB 5CINH 4DKFH 4KZEL 1T66D 1DL7L 2VC2L 1JHLL 4K94H 5T3XE 3S9DB 4ZO7A 4XNQA 1RJCA 3QWQB 4N1HB 5DMGC 5F7KC 1WT5C 2XFXA 2E6QA 4O51B 4POZC 2P5WE 1BD2E 3QO1B 5MENA 5DHXB 3WIHH 4MQTB 3BPNC 1Y0LB 1OW0A 3SE9L 5HGAA 2BDNL 1RAMA 1OAQH 4LSRL 4RFNB 2JK5B 1TJIH 1KIQB 4G9FE 3WN5A 1BFOB 2XY2A 3OX8A 2PUQT 4D0DA 2P8PA 4PGCB 3LRSA 2EO9A 1CU4L 3RGVC 3FT2A 1K4DB 1X5LA 5DJ8B 3C5JB 4QRPB 2VDLL 4TYUA 1M05A 4PJ7E 5DURD 1S9XB 1BFVH 4I3RL 5JW4R 1YEKL 1R3JA 2MQ0A 1FZKB 1B3JA 4OCRL 4P9HL 5KAQF 2H2SD 1EAJA 2FSEA 1P5VA 1AKJA 5F1OB 4FFZH 2YZ8A 3QG7H 2V9QA 5TDOA 4ZS6D 3QUMB 5I17A 3P2TA 5EU5A 3MRCA 3O6ML 4KKCD 3WE6A 3OAYK 1KG0A 2NMSA 4O2FB 5DJAB 3UTQA 4JANA 1Z3GL 3PL6B 4PJ9D 5IEKB 4NZTH 1DEEA 3KPPA 4RNRB 3RY4A 4BZYA 2Q20A 3L3GA 3X12B 2EICA 2YPLB 3PP3H 1DN2A 1KPVB 5ENWB 4WUUD 2YUWA 4C83B 2VLJD 3D25B 3MCLH 1A4KA 4EI5C 4MDJA 3CFIC 2DD8H 3WMSA 2H26A 4HX1B 5DMJB 1JVKA 1M6OA 1F3DJ 5GIRB 1AGBA 1MFEL 4X8JA 4OZIA 3CFDA 5CD5D 3QR2A 1I8KA 3GMLB 5CWSA 3N85H 1FVDB 5E5UB 1HXMA 4NQEA 3KPRB 1TQCC 1A6WH 5FYKE 3DWTA 5IHUH 5GGVY 3MRDA 5C0GA 2E7LC 1YJDH 3EGSA 4LOUD 5CMAB 1FYHB 1KEGL 4U1MB 3WXVH 3OKMB 2F19H 5C1MB 1IGCH 3FTGB 5DUBA 3SDAA 5IR1A 4P2CG 3MYZA 2B0SL 1S8DA 3O45B 3O6FB 3MQIA 2AXFA 2NR6C 1HQRA 3BW9A 4P99A 2ZUYA 3BPCB 3EYQC 4PJXE 4NUGH 1A9EA 3BVNB 5T1KB 4Y4KD 3VFTB 1IEHA 1T3FB 4X99B 2BSSA 3FQXA 1TCRA 2LTQC 5F7UA 1HHKA 3LD8B 3OHXB 1NFIB 4NQSA 3I6LE 1J05B 4Z7OE 3CX5K 1G7LA 3DVGB 3BP6A 3IDJB 3BEWB 2DYPD 3LKRB 4Q97A 5DJ6A 3SGKA 1L6ZA 4WEBL 5HPMB 5BXFA 1AD9B 3AS1A 4ZTPH 1DANU 3VXOA 5GRWA 3V8OA 4D3CL 1Q8MA 4R7NA 3UAJC 3HE7D 2V2WA 5MEQB 1B90A 4Z7UA 3HNSH 2BY0A 4X6EA 1K85A 4GJTB 3U79A 2X4PB 4YZFE 2EYTA 2NY0B 4KMLB 1WV7T 4UZGA 1QSVA 5I1AB 5ALBL 4J8RB 3AB0B 3QJHA 4AH2A 1ZXQA 3G5ZB 2FJHB 4NNPL 3SKNB 1S5IL 5L2KD 4CRPA 2GT9A 3QQ4B 5DD1H 3LV3A 2DQDH 4OCYH 3WFDH 3V4VL 4Y89A 1RY7B 3K80A 3L6FA 4CMHB 3MRPA 1XGTB 3H9YA 3P0VL 1EXUB 3B9EA 1R3LB 1RURH 2NY3B 2GSIB 2VN4A 5C3TA 4GG6F 1KUMA 1L6XA 4Y4HC 1VB9A 3HB3C 1QEWB 1G9ML 4R8WH 4KFZC 4B7LA 1UENA 4PPTA 1CK0H 4LCYB 4MJ5B 4HZLB 1E4WH 4WFGD 3T1FA 4PG9B 1CD0A 3LQZA 5IMMA 3MLZH 5A2FA 4PJ5B 1KFAH 5ECJE 4HJ0C 1IQDB 2HJKB 2EH7L 3LSOB 3FONB 3ULVE 4FXGA 4TVPL 5ADPL 4LCCC 4FQLL 3SO3C 3U4BH 1SVCP 2MFNA 3ARGB 3QUYD 4U1SB 3LEXA 3BH8B 4IRJA 2KZ1B 5I1DA 4NO3A 5M94B 3VXQB 2FO4B 4EVNA 2Q8AL 1V8HA 3C5ZA 4H88H 2DMKA 1TTUA 1I9IL 4K71B 4TSCL 5KSAC 4JPWL 4BZ1L 5IVXB 4NN5B 4ZQKB 4P2QE 1QNZL 4AJ0A 3PWPA 4U7SA 3UZVB 3V0VA 2XA3A 3MV8A 4Y5YC 3SDCA 1RUPH 1IM3B 1XCTB 2GTZA 1T5WA 1MHEA 5IMOA 4E5XA 3T65A 4Y2DA 1HYSD 1FCGA 2BVTA 5FUOL 4GQ9L 5D7JA 3THML 2VDKH 1A6VH 3GI8L 1T0NA 3UCRA 3D5OF 1FLTX 1F8TH 1LDPH 4F7MA 3EDKA 3FO0L 4OIAA 3MBEA 1U8LA 4NBXB 4QHMB 1MVUB 3B5HA 4R0LC 4Q2ZB 3W11D 1E0OB 3B2UC 3GJFB 1QLEH 1TQBB 1BQLH 1U8JB 3TP4A 4ENED 3AC0A 4IRSC 4AY0A 5E7FA 1N5YL 1RUKH 1U2HA 4OM1H 4EIGB 3BT2L 1FJ1A 2CH8A 3CSBA 4PB9L 3TZVB 5B3JE 3BGFB 4G80A 2BHYA 1JPGB 4XNMA 3WHE0 1HH9B 3CVIH 1DUYB 5ACMA 2VE6B 4GAYB 1EDQA 3MRNA 3K1KC 1X6LA 1IGTB 4GH7B 2QR0B 4YE4H 1WT5A 5DTFB 2NX5A 1RZJC 2XZAL 4D8PB 1NDGA 4XCYB 1CD1B 2FCBA 5CGYC 1MFDL 2P8MB 3S96B 5D2LE 1UB5B 2UWEA 4HUWA 3MV01 4KK9C 2BNUA 3DPBA 3O8XC 1N8ZB 4QY8A 4Y19B 3OF6D 1MJ8L 3LIZH 5TH2B 4TPRH 5C6WH 3HS0B 3VFUA 4C56E 3VWJB 2F58L 2EDEA 5GGRY 1P4BH 1VCAA 3WDJA 4BKLB 2I60L 5LWYL 2GSGA 4P4KB 5D93B 3NVQA 4NKOB 2R23A 5F7LB 1OHQA 1X5AA 5I8OH 1K5NA 3O4OC 3P0YL 1G7PA 4MJ2A 5JIHA 1MRDH 3ARDC 3D0VA 1T6WA 2YK1H 5HHME 1WK0A 4E41E 3B9KB 4YHZL 4HMEA 3PUCA 3S36L 1GAFH 3VWKA 1U3HD 1QSZA 5M7QA 2R9HD 5JQ6L 1ULVA 5T5FH 2GFBA 2AERT 1H3PH 2EDFA 1KB5B 5GGUA 4PJFE 5GZOD 2X4RB 2E7MA 3F62A 5EUOB 3O4LE 2V7HB 2XYCA 4J3XA 4Z7QF 3IETA 2B4CH 2HVKB 3D0LA 4G8GA 5F9JA 4PGEA 4Z77B 4U1KA 2EDJA 1DTUA 4NQXA 3MLVL 2R69L 2OK0L 1ZS8A 3EYSH 3AS0A 3QIUC 3KYNB 4XGZB 2OJZL 5GRXG 1HYRC 2NYYD 1OGTB 4I77H 3JV4B 4M1CD 3DVNA 3UJJL 4BH7B 3QP3A 1CGTA 5TF1L 1TPXC 1OB1B 2XZQH 4XPHH 3ECBB 5DR5L 1ZEAH 3G6DL 3IDIB 1DDHA 4ODTL 2QQNH 2W60B 1U8OA 1SJEB 1MAJA 3RJQB 4RAUA 4JPIB 15C8H 4Z0XB 1GCFA 5CILL 2PXYC 4PRDA 1KF9B 5LJYH 1KT2A 2YD3A 1PG7H 5DA4A 2E27L 1JFQL 1N59B 4M43L 5E94B 1NC4B 3EYOA 3PDOB 3MFGB 3MLYH 4TRPH 4C59B 4NHCH 3AROA 3HMXH 3NFSH 4WRLA 1T1XA 3ARFB 3V7AE 1H5BC 1AR2A 1T4KB 2AJZB 3P73B 3GSXA 3GSNH 2FDBP 5E6IB 4KI1A 4AT6B 1EX0A 1OLLA 5DC4B 5F3BB 2LFGA 3LZFH 3RKPA 4KWUA 5FO8A 4JB9H 4QTIH 5DUPH 2F9BT 4L4TE 4AG4L 3DUSA 3GDBA 3KYAA 4OIIH 1N26A 1I85A 3TM6A 3G5YA 5JR1H 3REVB 2H9GB 1RZ8A 3OPZL 4XPGH 1I8IB 1U95A 5KW9H 1Q9OA 2VDPH 2X89D 4WW1A 1RK1B 2P44B 2Y23A 5E24E 1DBBL 2APTA 1S7SB 1OCWH 5E5RB 4MD0A 2NXZB 4JFXB 4S1QL 1LO0H 4M00A 2H2SC 3PABA 3G5XA 5B8CC 2YBRA 4XH2B 4FQHA 3P3YA 4XBGB 3IAGC 3MUJA 4JO1H 3FB6B 4ZS6C 2YEZA 2D03L 3HR5B 3LPFA 1F97A 4GW1B 4MQSB 4HQQL 3ELAT 4P59H 3O3BA 1UVQB 4PJ9C 4PJDB 4L4JA 1SYVB 5EO1A 4N1CA 1DQJB 5LAXA 3U4EB 4RMSA 2A9MH 3DRQB 3QFDA 3QUZB 1RSFA 4JFFD 2XV6B 4YDIL 4TSAL 5D1ZB 5D5MF 5D7LE 1IGIL 1W72H 4L4VA 1S78D 4IS6A 1S7VA 3DO7B 3DXAB 1F90H 1JGDA 2UV3A 2V5MA 5B22A 5D1XB 1YMMA 4M7JL 2Z31C 2IFFH 2D7TH 3VD7A 4N0FA 4F9PA 1NGQL 4JGJA 4JFEA 4ONOA 1U8QB 5IJVA 4GFTB 1PEZA 4LMQE 3H9SA 5GGRA 3RNQB 1FZOA 2FGZA 5CD5C 2VLMD 2VL5A 1BOYA 1NBQA 8FABA 3WJJA 3GMNA 2CR3A 4LSUH 5GSRA 3U9PH 3MGOB 4J4PC 4UDUB 2VJXA 1LO3L 1RZKH 1XGUB 3RWGA 2GITB 4PP1D 2V17L 5B21A 3MYJB 2DJSA 2E9WA 1CXHA 5CCKH 2VUYA 3G6AB 3VW3H 4Y7MA 4X0KB 5DJXA 5FA4A 1F6AA 1MCPH 4JRXE 4K7PY 5DQ9B 3VGAB 3LDBC 2XY1A 5I18L 3BO8A 4HHAB 2EH8H 4K7FB 4NZRL 2NNAA 2NY5H 1CLZH 3NN8B 1HZHH 3CFJA 4YDKH 4ZFZB 4WFED 5KSAA 4EBQL 1MHPL 4FFVD 3CFKB 3E3QC 4Y4KC 1A7RL 1AGDA 5JO5A 4CL7A 4UUJA 3ARBD 4CVXA 1LDSA 4FMKA 2H8PA 4GRWH 4UINL 3Q0HA 3ZE1F 4HJJL 2A6IB 3MV11 2ICWA 2XWTA 4LFHG 4M6ML 2P43B 3S98A 1QFWM 1YNLL 3BP5A 2D0HA 1MFAH 1MCQA 4HS3A 4QHNB 2PTTA 5AYUL 3BIBX 1BBJA 3RA7H 1H3WM 1KCUL 1JE6A 4JQVC 3X11B 1X5KA 4XWOC 2IBZY 3H0TA 3C9NB 4DGIH 5IG7B 4M5ZL 1FNHA 1NGZA 4IOIA 5GGQH 5CEZL 3HE7C 4PJ5E 5IT2L 3WFCL 1AQDB 1FAIL 3EKCA 2V7NA 4Y4FA 3DETC 2VLRA 4RMUA 3VXTA 4LVNC 5IHZA 3ZT7A 2D3VA 4KROD 4OLUL 3IDMA 5FUZH 1HSBB 4PFEA 1RZFL 1IFHL 3RIAK 3WUWA 5IP4A 3S4SG 1PQZA 3FQWB 2W1NA 5K9QG 3QUXD 4GKOA 1H0DB 4JHBA 1NANH 3NFNA 1PYWA 5C3LD 5IB5B 3EYVA 2VISB 2H3NA 1IKNA 3I2CL 32C2B 3OR6A 1OP5K 5C0BE 5E5MB 4U1GB 2FEEL 4P57A 5BZDB 5C6TH 3S34L 3BQUD 3IXTA 4LK4A 4XP9L 4IRZL 2ZUUA 2V6HA 2BNQA 1PJ9A 1ETZB 1FL5A 5E8DH 5IFAL 3HI6H 4MDIB 4IIQA 5C0ND 5BVPL 4LSSL 3CSYB 3EO1B 3GUTA 1NBZB 3SOBL 1H8OA 4ZTOH 1JUFA 4F9LC 3T0EC 1CGYA 3U7WL 2D9CA 2X4QA 4WU5B 5TQ0L 1EJOL 4MMXC 4V1DA 3L3JB 1ES0A 5HDBE 1WWAX 4UV7H 1ZLUK 3ARXA 1DLFL 3QCVH 3RWFB 1YN7B 1D5IL 1H3UA 2DQHL 2W9EH 1A7PL 1XIWD 4M6NH 4PJCE 2EDWA 2VDMH 4LL9A 4XVUD 4HUVB 2R4RH 4ONHB 3D85A 3U36A 3NFPA 2DQEH 5FHBL 4DN4H 5FB8A 3L95B 1KPUA 2FJGA 5KSBE 1A7NH 1Q9LB 5F9WB 4LEXH 4NWTH 4PBXA 4JY6A 1FIGH 4AEHL 5IVOA 4KVCL 2YMXL 3MRQB 4HIIA 1VDGA 4L8SB 1HYSC 3RWHB 4LLQB 3BP4B 5FM5M 1WIUA 2CIIB 3QIUA 4PRNB 2LU4A 1NCDL 2BVOB 1NANI 1SMAA 4JZOB 5D2NB 2GJZB 3ZKMD 4LLYB 4Y19E 4ZUSB 1U8HB 3MJ6A 1CGXA 1LQSR 3KPSA 2FJFB 5DRXA 2ICES 4FRWA 5F88B 5FO9A 4QXWA 4M48L 1JZ4A 5EORH 3QEQE 4HBQA 4ENEC 4WO4D 2R4SH 2PXYA 3RUGF 5CLWA 3OKDA 1W72A 2AK4D 1FNSH 4Z8FL 4GRLC 1JP5A 3EJYD 4UIMB 5J57B 1QSFB 4LRNL 3BKCH 4GOSA 2WZPD 4Z76A 5IMKB 1IC5L 3D87B 1EUUA 1RULH 3LQAH 1QLFB 3V9FA 3M8OH 5FYKU 1T83C 5AAMA 3S35L 3GB7A 4ONGH 1J87A 2HLFD 1QSEA 4FQXB 5INCA 3JUYA 1AR1D 2BNRD 2MTPA 1XGRB 3UO1L 3VXPB 1QA9A 5EO9A 4NYLA 4APQB 5EUOE 1PY4A 1OAKL 3G9AB 5AZEH 1OQOA 4FS0A 5LGJB 3BDXA 1VGKA 4TNWF 1RPQA 5I1CL 4U1LB 4P5TB 1UCTA 3OL2A 3V8CA 2BVQA 4HUMB 1EFXD 4MZ2A 5K9OB 2I27N 4HKBB 3TV3H 3WHXB 2AJUH 4LHJB 3EYFB 5L6YL 4OFKA 4KK5D 2JIXB 4F58H 1FRGH 4MNQB 5EU6E 2CKBA 3MFFB 1BX2B 4CW1A 1KXVC 2H45A 3V6ZA 4UBDD 5B8CA 5HHPB 4KH2A 2B1AH 4U0QB 1U3HC 3MR9A 5J8OA 4XBEH 3O9WD 2A6DB 2DI9A 1MIMH 3BFOA 3NCEB 3W0WD 3SCMD 2ZSWB 4PJ9A 3UBXI 5GZOC 4KRMB 4K3EH 3RHWK 3OXRA 2HTKD 5BOPA 1S9VB 3QXWA 1C12A 4OZGA 3QCTL 4X7DC 3V5DB 4WFFE 4JPKL 2VLJA 1IEAA 3V95A 3MRFB 4S1RH 3AS3A 4L8BA 2FR4B 5IVZA 4XP4L 4G3YH 4M1CC 3WNMA 3D9AH 5I19H 5IKCB 3VI3E 2DRUA 4JO4L 3LEYL 3PGCB 3MACL 3QEHB 4ELMA 5TPWL 2KQMA 5C0CB 3GIZH 4JDZB 1QBAA 4KZEH 1FLRH 4EUPH 3UZEA 2VR9A 3AMKA 2VC2H 4ODUB 3I50L 1IMHC 1HK6A 2YOCA 3W9DB 3REWA 3DGGA 3ULUL 4DVBA 4IMLB 5I2IB 2PO6D 1GGUA 2AAVA 1MSPA 3QIWC 2GJ6B 3VFWA 4X6DF 1JRHL 1EEUA 3SE9H 2A74B 5H2BA 2OSLB 2BDNH 4LEOB 3CZJA 1Y6MR 4BH8A 1KACB 4MD5B 2PKDA 3EOBB 2CDEA 4N0CC 4HV8B 4P5KA 3FFCD 3K2UL 4CAGA 4J6RL 1QLRA 4JFHD 4MCYA 3QQ3A 4Y4KA 4YO0A 1R3KB 1RHHB 2VDLH 3L5XL 3IKCB 2UZXB 1A3RH 3G08B 2QQLL 4GUPB 3DXAE 3SE3C 3VXRD 3AREA 5E6ZA 5EZLA 1KNOA 1YEKH 4LBEB 1IARB 1T1ZB 5CIPB 2NPLX 4OCRH 4Q9CA 3L3DB 2CDFB 3LS5L 3BKML 1DN0B 2JJVA 4LCWA 4NN6C 2DQFB 3V0WH 4KQ4L 5FA3B 3P40A 3MOBL 2GW5A 4Z5RA 2IQAB 2P8LB 5EA0H 2A0LC 3PJSA 4U6VH 4XT1C 4DAGH 3MRBB 3NABL 1EAPA 3O6MH 4XHJC 1T1YA 2XT1B 2DDQL 3KPLA 4GBXA 1D5BA 3O3DB 2X1WL 4XPBL 5C7XL 5KZCD 3S37X 2VZ1A 3EOYG 4DK3A 5GSVA 1T22B 1JZ7A 1J0ZA 1EEQA 1MREL 2APWA 4K8RD 2QHLA 1ZGLP 3BZFB 5IM7B 4JHZA 3NACL 5IW1B 2J12B 1TETL 3HAEA 5F97E 1VFOA 5HGBB 3PQYE 4DVRL 3KVQA 4YGVB 1RK0A 4HIEB 1S78C 1HOCA 3CSPA 3Q6FB 1A02N 3OXSA 1PKOA 1MFEH 1U3JA 3UBXA 5BO1L 4XNQB 4X9HA 1I7UA 1MWAL 1UJ3A 3QNYA 3OB0H 4NO0A 1ZVSB 2RBLA 3U4AA 2XFXB 4HWBL 3BUYA 5MENB 1SM3L 1WBXA 2BFVL 4AIXA 4W6WB 3T3PE 4PP1C 3QRGL 1B4JH 2L7UA 3BH9A 3CVHB 5HGAB 3S4SB 3ZMRA 5HHNA 3ZE2F 5IFHL 1FFNA 3LS4L 5DRNB 4PJHA 4TSBL 1EGJA 3WN5B 3VRJB 3OX8B 4D0DB 1MF2L 1QRND 3LRSB 3BDYL 5EU3B 1BZ7A 3VCLA 3ES6A 5IBTL 3QUYA 1KCSL 1ED3A 1BEYL 4XP5L 2EIBA 4OLZL 3BD5A 3N1FC 1QFOA 2WINA 2C9AA 3S8WA 4N90D 1R3JB 3BPLC 3RPIA 2JCCF 5JHDD 4OZHA 1INQA 1AKJB 1N4XL 1G9NC 2WP3O 5L88H 4CN6A 1HCFX 5I17B 5KVFL 4ETYA 4UMGA 3MRCB 3QDMD 4AZ8A 4FMFA 1BVLA 3VXSA 3WE6B 4WEBH 5IWLC 1KG0B 3UTQB 1IEBA 2DBLH 5HHQA 3IRPX 5C07D 2XXMB 3C08L 1O5DT 3CDGA 1DEEB 12E8L 2FB4H 3KPPB 3MCG1 4D3CH 3FN0L 2DTSA 1NBYA 3RY6C 3BUTA 1NLDH 1F45A 4P9ML 5LGHL 1CDCA 2VDQL 1RIHL 5JOFA 4FQQA 2OTWA 3T0AA 1A4KB 4MDJB 1YQVL 1KXQE 4A6YA 5AG9A 4NJ9L 1CFNA 5DSCA 4XAKD 5ALBH 1MCNA 1A21A 3V6OE 4NQDD 4CVWA 4JN1L 1M6OB 4NNPH 3JUZA 5LQBL 1AGBB 3I6GA 2BC4A 3OAUL 4OZIB 3CFDB 4Q9RH 3V4VH 5C09B 1I8KB 5CWSB 2X7LA 1JGLL 2X6MA 3QUXC 5C9JA 1VFUA 3P0VH 4RDQF 4DQOL 1HXMB 1G7QA 4NQEB 3K81A 2AK1L 1GZPA 1KGCD 2BERA 3MLTB 2Z93A 3CLFL 4P4RA 1AO7A 3DV4A 4LCUA 1A1OA 4AK1A 5JTWA 3MRDB 4KJPC 4FABL 3BQUC 5C0GB 2VRAA 1G9MH 1ZVHA 4OB5H 2NY1D 1WWCA 1S9WA 4U33A 1F6FB 1J0IA 1HH6A 5EDXA 4F2MB 3VH8A 2IJ0C 3V4UL 3BAEH 3OF6A 5F1IA 4PJGA 1HDMA 5IJKA 4D9RE 2ADFH 5KANI 1S8DB 4YAQA 4IJ3C 2EH7H 2AXFB 4IDLA 4TVPH 5D2NE 1UWGH 5DD0H 3PGDA 3BW9B 5ADPH 5BW7A 2ZUQB 1EFQA 5DZOA 1A9EB 3HC0B 3EO0B 3U1SL 4N8CL 1L0YA 5JNYB 3FQXB 1TCRB 3GMOA 4GRWE 4ZOCA 1U9KA 1HHKB 4OGYL 4XCNA 2Q8AH 3C6LD 4NQSB 3I3EA 5I30L 4L5FL 1I9IH 2XWBA 4TSCH 2BMKA 4JPWH 1F13A 5DJ6B 5FIEA 4UNVA 1QSFE 5BXFB 4XVUC 1QNZH 5ETUA 4FP8L 1AXTL 3ZSTA 4PRPE 3VXOB 5I6XC 1PKQE 4R7NB 1DLHA 1CR9L 4LF3B 2I5YL 2FYYA 2V2WB 4X6CA 2AEWA 4Z7UB 4GQ9H 4J12A 4JFYB 4X6EB 3THMH 3GI8H 3QHFL 1OD9A 4X8XA 4JM2F 4HK0B 2W91A 3FO0H 3QJHB 4AH2B 1JNHA 3TWCH 2GT9B 2VR4A 3FO1A 3LV3B 4LARL 3F5WB 4BELD 1N5YH 2HFEA 3DNKA 1TJGL 3OBAA 1PVHA 4HKXA 3L6FB 1UM4L 3BT2H 3MRPB 1MOEA 2ATKA 4PB9H 1J1OL 4MNQE 4W4NA 1VFAB 3MO1A 3EJYC 1NCAL 4OI7A 5BV7B 1U8KB 2XZAH 2DLGA 3T1FB 2HLFC 4ODXB 5IMMB 5D6CA 5F21B 4OCWL 1MFDH 4MQXD 2WBWB 4K9EC 4JFDE 1E4KA 4Z7WB 1KENL 3DURA 2P24A 1DQDH 1BZ9A 4FXGB 2ITCA 5FYLH 1ZLVH 3MA9L 4JG0L 3FL7A 3LEXB 5I71B 3DLQR 4IRJB 4U2ZA 3EDFA 5I1DB 5I1LA 2F58H 4Z78A 4NO3B 1TNMA 1JPST 2I60H 2MMXA 4W81A 1UC6A 2XPGA 4EVNB 1KLGB 1MJ7L 3VFVA 3QPXH 5I73B 4TNVF 2DS4A 1ZHNA 4M3KB 1CDYA 3P0YH 3K74B 4KK5C 2YRLA 1RIVL 2KBGA 4YX2L 2WIMA 3PWPB 5JIPA 2IAND 3MV8B 4UBDC 3BGAA 5C0CE 2GTZB 1T5WB 1MHEB 4R90L 4E5XB 5IMOB 5JQ6H 4Y2DB 3NOIA 3SKUD 1QQDA 3CU7A 5TDNA 3D48R 4NSKB 4XBPB 1WF5A 4XVJL 4YK4C 3NPSB 4U3CA 3PHSA 5D7JB 3O9WC 1AGEA 3SE4C 3MRGB 3PGFH 4F7MB 3OJDA 4LSVL 1RUQL 1U8LB 2QL1A 5DHVH 5EZJA 3U0PA 4NRXA 5T3XL 5K9KA 5HDQL 4CDHA 2GJ6E 3WIFA 4JFFA 3MLVH 2IH3A 2R69H 5T5NG 2OK0H 2HFFA 4P2OD 3H9ZA 3ABZA 4OM0L 2OJZH 1CZ8L 1XR8A 3VDBA 5TF1H 1FJ1B 2VXSL 4KV5E 5DR5H 4PJ8D 3G6DH 1X44A 4G80B 4NCC2 4XNMB 4XPTL 1AXIB 4UT7L 5J6HB 5FUCC 1XF5A 2AXJA 4KKBC 3AAZA 5CILH 3IGAA 2NX5B 2RQ8A 2VO5A 3S5LA 4JQXC 2E27H 3EIFA 1NDGB 4G42B 4RIRA 1JFQH 5I0DA