4HLZH

Crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
b'DIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPWTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1
publication title Structure of a classical broadly neutralizing stem antibody in complex with a pandemic h2 influenza virus hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 46
structure length 211
sequence length 211
chains with identical sequence J, L
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH01
4ZAKC 3KWWB 3U48A 5LGJA 2EH8H 4DVBA 1G9EA 5E8NB 3MUHL 4NO5A 3NPSB 1E4WH 5ESAA 4PY8J 1G7PB 4FQLH 1BIIB 3B83A 1A6TA 4RWYL 1PKOA 3RWCB 4WI7A 4DZ8B 5FYLH 1VCAA 2BVYA 5DHXB 4U1IB 1QUNA 1DUZA 1VB9A 1YY8B 1NC2A 3V6OC 4V1DE 5JORB 1KJ2H 3BEVB 5HGGS 3TN0B 3KJ4B 4S1RH 1OSZA 4LCYB 4LSRH 2ZUWA 2ZKHH 1H9VA 3PHSA 4I5BB 2DTML 3UJTL 4BSWA 5IHUH 1UYWH 2A6DA 5GGTA 3G6JA 4UIMA 5EPMB 1OAUL 3ZL4L 3OAYK 1EH9A 2FO4B 3BW9B 1OY3B 1A7RH 4OGAD 4TQEL 3QIBD 2CJUH 4FQPA 3BXNB 5TDNB 3WN5A 1FJ1B 3F7PC 4ACPA 1V5JA 2YUXA 4JRYB 4NRYB 2V17L 3JV0A 2W65B 2UZXB 4CGTA 4NT6B 1Y18A 3GSUA 3VD4A 3IGAB 5DZOA 4LSUL 4NO0B 1U9KA 2HKFH 3SKNA 2XN9E 5E56A 4M61A 1H3TA 5BJTB 2VXQH 4OFIA 3O8XD 2VZUA 3QDGE 4LARL 5F7DB 2BHYA 3VI4E 4LLDA 1PBYA 2DD8L 2WUBL 5SWZD 2P7TB 4GBXC 32C2A 2PW1B 1S7VB 3MV8E 1I8MA 4L3EA 5GIRB 4PTTA 5DEGB 1NUFA 3EOBA 5D7SH 4LAQL 4FQXD 3VXNB 1DP0A 4F15B 5IJKC 1DLHB 2VKXA 5IOPB 3MRPB 3OJVC 1IKFH 5D8JH 4YQXH 1NCCL 1LO3H 2GJ6E 1ZA6A 3P11H 1FLTX 5BZWB 2AQ2A 4LVHC 5LGHL 1MIML 5FA3B 4U1GB 4DN3H 1FNEB 1ZAGA 3TZVD 4OV5A 1A1NB 4NUGL 4WGVB 5A2KH 3DVFA 4M8QA 5MI0B 1UJ3C 1TVDA 1NANI 1QTYT 5F9OL 1SYSB 1YEHL 1WAAF 3WD5H 2HVKB 2DQGL 3HTLX 4QLRA 1AR1D 1FE8L 5JO5B 1A8JH 1FZKA 5C0EB 5IB1B 3U7YH 3KPRD 4C83B 3HI1A 3UDWA 5CZXC 3T0EB 2XG5A 2VDLH 3TYGH 3ARDA 3MZGB 1ND0A 4XAWH 3G5VA 4ZYKB 4CMMB 4X6DB 1KB5L 3ULSB 5D5MF 2WBWB 2Y4SA 4PLJD 5HDBF 4HQQH 3ETBF 1FIGL 1F5WA 3LHPH 4IMKA 5E24E 5FO8A 2OJEA 3MLTB 4Y1AE 1BZQK 4KROC 3THML 3U30C 1DEEA 1XF3A 4N68A 3PDGA 4K07A 3AMLA 1XIWD 3RNQB 1KJVB 1B2WH 5KSBB 2WWKO 2APXA 4BKLA 2FBJH 4UTBH 1QA9A 1YN7A 1YNKL 2OI9C 2YWYA 3BVNA 2QADC 4KPHL 4XMKL 3V6ZA 2EC9U 4FS0A 5LWYH 5KANI 4XH2A 4ETYA 2AEPL 1MIEH 5C0JB 1X5XA 2FLRT 1HKFA 2GJZA 4N0CD 2BVEA 4QRPB 2EICA 1WEJL 3U1SH 5GZOC 2YPLD 3KYKH 2R2BA 5JXAL 4NQUA 3ZE1F 1L7TL 1TQBC 2ZSWB 1RJYA 5I1IH 3IVKB 1WVZA 3MV7E 5D72L 5CEYB 1T5XA 1JF1B 4N0FA 4XGZA 3X11A 2A74A 5J3HC 3K81A 1I3RA 4K94H 5DXWA 5KS9E 5KBNC 1B88A 1YY9D 4KRPD 1FFNA 2B20A 3RJDA 3HMWL 2EO9A 5HXMA 2IH1B 3R4DA 1S78C 5HHVL 2DQUH 1I7TB 1DE4A 1P5UA 3U36A 3ZDYF 4YR6B 5HVFB 1A21A 1I9RH 3MRBB 1IC1A 4OZHE 3X3FL 1JZ3A 3LEYL 4GAYA 5MEPA 5CEXB 4NKDA 5JOEA 5DVOA 3QEQE 4J4PD 3M8OL 4IBLT 4LVNC 1YJDL 3VW3H 4MJIB 3GKZA 2ADJA 3RI5F 4XPGL 4OUUA 3FB6A 3VFPA 3QI9D 4U6HB 3EGSA 3D1MC 5DVNA 3DUSA 5C0IA 1ZHNA 1C16A 5HHOB 4QEGA 3DV4A 2RBLA 1HINH 4NUJA 1U91A 1QSEB 3QG7L 2R2CA 1WCBB 3LSOA 3V0VB 1CXKA 3E0GA 3IDGA 1SBBA 2MKWA 1I9JL 1F4WL 5IB2A 1A1OA 2WWMD 5B39A 1J5OL 2ICWJ 3WE6B 2J2ZA 5IK3A 3T2PA 3RIAK 1KIRB 1YEIL 3HI6H 1OGAB 2RB8A 4GUPB 3OAUL 2GAZA 4LEOA 4HC1H 1E6OL 4ZUWA 1AGFA 1Q9OA 3DRTA 4PJ9B 3RL2A 1YEDB 2H45A 3BKML 4JKMA 4S1DC 2ICEB 5LVEA 4P2RB 3C60D 4ZTPL 3ARZA 5BOZG 2AK4B 2GJJA 2AKRA 3O2WL 4JGJA 1C7SA 2DLIA 1XGUA 3WL9A 2F8XC 4Z77A 4OAWB 4G6KH 3SGKA 4AMKH 2P5WB 5I1CH 4NPYA 3GB7A 4GKZB 5DLMH 1EO7A 5CBAA 3SDXE 4NO2A 4URTB 5KZCB 2XZCL 2H2SC 4ZD3L 5I76A 4XPAL 3ZTNH 5C07B 4DZBB 4KH2A 4L5FH 4LCCB 2KZ1B 3RWGA 3GMPA 1MY7A 5HYSA 1J8HE 4YFLI 1QFWH 5KOVC 1Z9OA 3I84A 4IRJB 1NUGA 3TJEH 4NHUB 3FQWB 4GRLA 5FYKE 1IC7L 4MNGB 2YMXH 4LOUC 2Y6SD 1GGCH 1ZMYA 3U82B 4PJFB 2MFNA 1K4DA 1YEGH 4FP8L 1I8LA 5TGBB 1IAIH 3PGDA 4JFFE 1ZGLB 4X7TA 4FG6D 1E28B 3FFCE 3RUGF 3IFLH 4R4ND 3MREA 4XMLL 1QLEH 1ZTXL 3D39A 4N90E 5TF1H 1AQDB 3QIUB 3PWVB 5GGRB 1VESA 3TIEB 2HJLA 3WO4B 5TQ2H 4LASH 1UXWB 1JTPA 4D9QE 5J11C 2MTPA 1NBVL 2WBKA 4RGNC 3DURB 3W11D 5CJ8A 3OJ2C 1U8QA 1Q0XH 2AJZB 2XV6B 3MRMA 5TDPB 4X6FA 4G7YH 4HUVB 3MR9B 3B8SA 4LGSB 4YBHA 1ZEAH 5IT2L 2XKNB 1MPAH 2ZNXA 4RCAA 4F7TA 4ELMB 35C8H 4KJPD 2Y36H 3DGGA 1BVLB 4MMZC 2AK1H 4P5TC 4XVUD 3BSZL 4RGMB 4JRYD 1UKTA 2VC2L 3VE0B 4M48H 1FLRL 3MUGA 4CNIB 2R0WH 5GGUB 4X5WB 4HFUL 3HR6A 2BNUB 4JRXA 1KG0A 4NO0D 4LK4A 1KJ2A 1S7RA 3VFSB 4U3CA 3AUVA 4KK9D 5C09E 3V5DB 4KZEL 5CMAA 3FO2A 4F7MA 1QHOA 3GJFK 4L4TE 4NQTA 4PS4L 1XF5B 4WUKH 4GQPH 4UNVA 4XCFH 2FX7L 3IDMB 5TQ0H 4YLQT 5H37G 3P77B 1HXYA 3O6FA 1YDPB 1Z5LB 4XB7A 1RJZA 3IETB 1U8PB 2XWJA 3GSOB 2P8MA 4L9LA 4I18B 4XVJL 2BMKA 3LRSB 4R7DA 4BZ1H 4HXAH 4GAGH 3AAZB 5KVEH 4ZO9A 5I8CA 2HWZH 2XKSA 4YHZL 5T3XE 4OFDA 1VFMA 4GMSH 4CN4A 3IJSB 4A6YB 5B38A 3P30H 4NOFA 3OAZK 4HIHA 3A67L 1DN2A 1N0LA 3X3GH 4WW2B 1AHWA 1OGTB 4OM0H 2X40A 3QO0A 1QR4A 5I19L 2EDWA 3REWA 3LN9A 4NCC1 4I3SH 4IOFC 2YD8A 4X7FC 2QQLH 1U8LA 4FNLH 4QRRB 2HJKB 3TT3H 2R29L 4NJ9H 3UO1H 5HGBA 2YKLL 5TE7L 1WIOA 3CUPB 4K8RC 2A2QT 3LKOA 4AZ8A 4KJQD 4LLYA 4IRZL 4TVPD 3HPJA 3W5NA 4J3SA 3GMOA 3KJ6L 5GGQL 3TNNB 1LK2A 5IMLB 4JHAL 1F8TL 3LS5L 4N8CL 4KHXL 5EOCL 4RAVB 3PHQB 3C9NB 4WFGE 5DUBA 5D1QD 3EYOB 4W4OC 1FN4B 1UB6B 1RZJH 1TJGL 2DYPA 3AM8A 2JB5L 5EBGA 2HRLA 5F96H 1QRNB 1J1OH 3QQ3A 1LE5B 1CFNB 2VWEE 4MQXC 4BZ2H 4H1LB 4Z5RA 3QXAA 3T0AA 3QG6A 3C5ZB 4XP9H 4D0DA 4PJBB 1AP2A 1OTUC 2QLVB 4W6YB 1HH9B 5GXBB 5C0FB 4M00A 4QXTB 3VFOA 4O51A 2OZ4H 1FFPB 2BY3A 4PJHF 4UQ2B 5AYUH 5F7UA 3OXSB 4QRPD 1X5AA 2UV3A 4JGMA 15C8H 2F54E 3P0YH 1WV7T 3HNTH 4KKLD 4LSQH 4HFWA 5I66A 4N8VG 2D9CA 1PSKH 3P40A 5KVFL 1IEBB 2NXZC 3VMOA 3QDMB 1FH5L 1NC4B 2VERN 3W9EA 5I1GH 5KTEH 3UBXB 3QXUA 2I9TB 3RX8A 2QQQA 4GMTH 1NSNL 1U58B 1MJ7L 2DIBA 3VG9B 5CINH 4OI9A 3C87A 1HILB 4L29A 4ZFFB 4HZLA 4WI9A 3NACH 3WFZA 2X10A 4NM8H 1IGCL 2WUCL 3KPOA 1AXSB 4HGKC 4QHNA 1U42A 4NWUL 5BS0E 3ELAT 4X6CF 3QIBA 5CAYB 1KJ3L 3Q6GH 3K0WA 5GS0C 5DJYB 2W9LA 1MI5E 4O58L 1P7QA 3R0NA 4PJXF 5FGCE 1H5BB 3D5OF 3HRZA 3ILPA 4K3DL 4QCIA 2Z4QA 2A9NL 1X5JA 3ROOA 5IM7B 3BP5A 3UAJD 3EOTH 4ZXBC 3QUZC 3FOLA 4JY5H 5HHOD 5DYOA 2OP4L 5J1TC 1HWHB 1CU4L 3CX5K 4GG6A 1NAKL 4F8QA 43C9A 1QSED 3HZYA 1ZWIA 3QUXC 1DBML 1MRCH 3WSQH 4TRPL 3D18B 4WUUD 3VG0L 4UUJA 5E2UH 3I6GA 3S88H 2AJ3B 3GJEA 3SPVA 1IRAY 1UWEH 3QDGB 2VNCA 4LHUG 2B2XL 4J3OC 4GXVH 3GSVA 1W0VA 2J5LB 5F6IB 2A6JB 4JE4B 1DQJA 4XHJC 4CU8A 4B7LA 4XPBH 3T3ME 4FQXA 4IDLA 4DUXA 3RWDA 3MV8B 3FT3A 1ZLWH 2CLVA 2YD7A 2ZCLH 5DD3H 5GS1C 1OGAD 3CSGA 1BREA 1MQKH 5IEHB 5IQ7L 4CU6A 3UTSA 1J0JA 5FGBC 2CH8A 3LN4A 4KKNA 4Y2DC 2ARJA 3MCLL 4MA8H 3KPLA 1T0MA 3UTOA 3CMOL 3TZVA 2GJ6B 2PF6A 1K2DB 4P2RD 1HXMA 3LMJH 2AK4D 1OT1A 1OQOA 3STZB 3MRCA 1DLFH 4RISH 5FF6B 3T04D 3L9RA 3V4PL 4EDWH 2QHLA 1UWXH 3S96A 3CGTA 25C8H 1J0KA 4O2FB 4FN0A 5E6YA 5KZCD 4GG8A 4QOKB 3UJJH 1EJ6A 1RU9H 1U8NA 4S1SL 5C07D 5EO0A 4IM8A 2QQKH 4UTAL 5FHBL 5ID0B 1F3DJ 4OCLC 1B0GB 5LXGH 4HC1A 3TFKD 2H1PL 2WLYA 5JHDA 4IRJD 2H3NA 4R7NA 3CX5J 1S9VB 4TUJB 4Y89A 4KUCF 5HYJE 3BUYB 2JK5B 2RHEA 2MCG1 3I6LD 4Q7DA 4OFVA 1JUFB 2CDGB 4K71C 3MNWA 3PWLA 3WHXA 5L2JB 3BKCL 3H2WA 4M6OL 3L7FA 3QIUD 5EULV 3BIKB 1QRKA 2ZPKH 1UG9A 1XIWA 1CD8A 5K9JH 4Y1AB 2EDRA 5IW6A 1IGYA 3FZUC 3REVB 3Q3GA 1JPSL 3WHE1 4HK0B 1T1XA 3ZE0F 5EU6B 4JKWA 3ZT6A 4YWGL 3ZT7A 4JG1L 1OAKL 4X4YA 1NDGB 5EBWA 3UMTA 2UZYB 1T66D 3DOSA 4JM4L 1RUQH 5EUOE 2DKMA 3VFVB 2QQNH 3FQNA 4JZJC 4IRSB 2YPLA 4PJAA 1R3IL 2O5XL 5J1AB 1KT2A 5D70L 3EZJB 4RMTA 1JGEA 4PJGA 1KN4L 2NY5L 5E94B 4UOW1 3MRRB 4YBLC 3D25A 3QUKB 3MV7B 3NA9L 4R97C 1I1FA 4UINL 3BHBA 5KG9B 4UI2A 5KS9B 5ICZB 3LY6A 3QJFB 5E95B 4LLMB 2FGWL 3IKCA 1I7RA 1TZGH 4ZG1A 3B2VH 4ZUSA 5TJWK 2PYFB 3ARFA 4YO0B 1YEKL 5DRZA 5F7HA 2R0ZH 4LQFL 1GOGA 4M7LT 4XZUA 2AABH 4I3RH 4HIXL 2VR9A 1X6LA 3EJJX 4GAJH 3U4BH 3MLZL 4J4PA 4OZHB 3UTQB 4Y16A 3GDBA 3KLSA 3QFJE 5FUOL 1PZ5A 1S7QA 1R0AL 1QEWA 3GSQA 3QEQB 1IEAA 4MLSA 3RWHA 4UILH 1NJ9B 1DQLH 3RFZC 3KPQA 1OARH 2OL3B 1LP9F 1WLHA 4R0LC 3SDDB 2BHZA 3EOAA 1ZKAA 1WZKA 4ZFOA 3FONA 4P46A 3VDCA 3IFOB 4ODSH 3QUML 5B21A 4FTVA 4LSTH 1IFHL 3AU1A 2AW2A 4C57C 3HNVH 4H5SA 1Q38A 4J7RA 4ZDHB 1HIML 2X6MA 4NQDB 4ZPVA 3S35H 5C8JA 2AJVL 1QPPA 1E0OB 1INDL 3HC0A 1BAFL 4DTGH 5C2BH 5DUPL 2DAVA 4QRRD 4HS3A 3O4LB 1JL8A 3UPCA 3BPOB 4MWFB 4X99B 2W92A 4MVBD 1ROWA 5FAAA 3HG1A 1I8KB 4X9FA 1LO0L 1VSCA 5DSCB 4KHTL 5DD0H 1D5ZB 1JJUA 2BVOA 3CDCA 4ONHA 4ENEC 3ULVD 3DETC 1A6PA 4JB9H 3ZYZA 4MA7L 2WP3O 5EORH 2VTFA 4OCYL 5I1HL 4CL7A 4NQCE 5IVNA 1S9WB 3BPCB 3SKUD 4R2GC 2CK2A 1FRGL 4DQOL 5IBTL 1QRND 3IDXL 1T21A 3WUWB 5DD1L 3KS0H 3MJ6A 2H26B 4Z7UB 3QEUA 3TT1H 3QCUL 5DT1L 1UZ6F 3C5ZD 3KWWA 1U8KA 1J1PL 2BDNL 4R90L 1QFPA 4YGAB 3V2AR 4IEFB 2Z31B 1LDPH 4XCYB 3SDXB 1G7PA 2BVPA 3S3SA 2E6JA 1N6QH 1BIIA 4HWEH 3W39B 3NCYS 4NQSA 3L5XL 4DZ8A 1J8HB 1U3JA 2YBRA 4U1IA 2VIRA 5GRYA 4WWKC 3AREC 4P2QB 2GSIB 4L1HA 1KGCD 5EA0H 4FQIL 4Z7NE 1GAFL 2JJVA 4CADB 5JORA 3BEVA 3TN0A 4OGYL 3QDMD 4JFFB 4LCYA 1ZLUH 2JJSC 3T3PF 4LFHG 3FFCB 1E6JL 1NFIB 5F88B 2XG4A 4I5BA 5EU4B 5EUKA 4U2ZA 2OS7A 3LZFH 3QCTH 2XPGA 1ZANL 5EPMA 1Q72H 3IFNL 4KTEH 4FQ1H 2OZ4A 2HTLD 2OR8A 3I50H 2FO4A 3BW9A 4F7PA 5I16A 5JA8B 3SDAB 1AGEB 4KQ4L 2KZWA 3H42L 5TDNA 2DBLH 1FJ1A 4WHTA 5CJOH 4JRYA 4NIKB 2ZUTA 4GRWH 4NRYA 3I3DA 4L1DA 4NT6A 4BELD 3DNKA 2GTZA 2ZCKH 3IGAA 4JPWH 3WJJC 4G3YL 4NO0A 4BH7B 1OB1B 1Q1JL 1VPOH 5K9OB 4KK5C 2IGFL 2NXYB 2XTJB 5EG6C 5F89B 5BJTA 1JI1A 3A6BH 3O6LL 4X9IA 3MJ9L 1N4XH 1AE6L 5T1DL 4G8IA 4DKEL 4XC3L 2P7TA 5C09B 3QNYB 4NKMB 4UT7H 4LPTA 1I1AC 4KDTA 5FV2A 5F1KC 1JGLL 4DEPC 5GIRA 2VRAA 5MP6L 1NCAH 3FFDB 4S1QH 4Y4KB 3VXNA 3MV8D 1HHJB 3GKWL 1DLHA 1I9IL 4POYA 1FDLL 1HE7A 5IOPA 5JUEH 4P3CL 2E9JA 3MRPA 1QO3B 2A6KB 1G84A 3CDFA 3LDBB 3QQ9C 2HFFB 3DSFH 1ZHLB 1JNJA 3VXUE 4OLXL 1MJ8L 5GGVY 5BZWA 2EXYD 4H8WH 4NDMB 1A6VL 3ULVH 1WF5A 4Y4FC 1A1NA 1ZV5A 4PGEB 4BM7A 3Q6FA 3ZSTA 1WWCA 4CW1B 3TWCH 1I75A 2J6EH 5DJXA 4J1UB 5A3ID 3GSNL 4HJGB 1TQCC 5E5MB 1ED3B 3VI3E 1JGDB 3MLUH 5B8CB 2HVKA 3TBSB 3MSPA 1NLBL 2YK1L 3EO9L 2GEEA 3SE4C 1NLDH 1DDHB 2WM0A 5CHNA 4H1LH 5C0DB 5C0EA 5JW4R 4QOKD 3R06B 5IB1A 5EO9B 2PTVA 4XMPH 5GRZA 1ZA3B 2NY6B 3DPBA 4L8BB 1L4IA 2R4SH 3T0EA 8FABA 3N1QC 4UU9B 1NGPH 4JFDA 4LHUD 3IDIB 3D3VE 2C3GA 4CMMA 4X6DA 1MHHB 1LEKB 1K8IB 4G6FD 4EI6A 3KGRA 5DF0A 3FN0H 3O3UN 2NY1B 3B8YA 2R4RH 1CTOA 3FKUS 3ZKNC 3VFGH 1J8KA 4PV9B 3OJDB 1PEZA 3EJZD 2WZPD 3IDYB 5IMOB 3G5ZB 1KV3A 5D7JC 1GIGL 3DX9B 1KJVA 2R0KH 5DJ0A 5KSBA 3CK0L 3MNVA 1FNGB 2PCPA 5GHWH 2PKDA 3BKYL 4X4ME 2J7LA 5T33L 3GSRB 4NZRH 5EU6D 3QISA 1BBJB 5DS8A 5DJ6B 1E4XL 3WEXB 5EIVA 5M95B 1SBSH 4E5XB 4EEEA 4JY6B 2XICA 4QRPA 3G08A 3IAPA 4IRSD 1FFOB 3RVVD 3S7GA 3WLWC 1PG7X 1QLRB 4KXZH 3IVKA 3JWNC 2R1YB 5CEYA 4KK8D 1HKLL 1JF1A 2C4FT 3SGEI 3GJFB 2F54B 3CVHB 1LO4H 2VAAB 3HS0B 2H8PB 5E00B 2CK0L 2BK8A 4W4NA 2DMBA 3WDHA 2DQCH 2IH1A 4EOWH 1N64H 1I7TA 4LRNH 4NP4L 4YR6A 4OZGF 3MRBA 2UY6A 2D2OA 2G9HB 5D7IE 2NNAB 3QEGL 4M5YH 1CG9B 4LBEB 4WI4A 3VXQB 1EDQA 3SE8L 1NGQL 4O4YH 2F5BH 2X89A 1TVBB 4PJ8B 3LH2L 3UEZA 5CEXA 5I15H 5JPMB 2WANA 3VH8G 2P8LB 3ZKQD 3ESVF 3RNKB 1CL7I 3MLPA 5D1XC 3EZ8A 2NTFB 4MA1C 4OFYD 4MJIA 4HCRH 3QEQD 5DJ2B 2VXVH 1MI5B 1RZKC 1TIUA 4P2CG 1NBQA 1S3KH 1U6AL 4JPKH 2H2PD 2XZAL 3L3DB 2DM2A 5D71L 2AQ3A 1BOGB 1IEHA 5HHOA 3SDDD 5EOTB 1LVEA 5IROC 2I60H 5MENA 3V0VA 3T0BA 3OGCA 4Z95H 4HWBL 2AEQH 2P48B 4C4KO 4X8JB 1CDUA 3W9DB 4JCMA 5ITFA 4NQDD 4HW6A 3MA9L 2X4NB 5HGHA 1OW0A 1TLKA 4HT1L 3ZDZF 1A14L 2ENSA 4ZO8A 1VFBA 4FQCH 1OGAA 1SEQL 4YXKL 4XVTL 3O4LD 4GUPA 4JN1L 1VENA 1PYWA 5I30L 4PJ9A 3SDCB 3GI8H 1YEDA 4PJCE 1JFQH 2CKNA 2P45B 4EI5A 3SCMB 4QY8A 3MLSL 4P2RA 5I8OL 4Y5XB 1EGJL 2NY3B 1N5YL 2BJML 2ATPB 1P1ZB 1L6ZA 1BFVL 3QQNA 1GHFL 4Y19B 2HRPH 3U7WH 2HFEB 4XWGL 1N26A 4OAWA 3P4MA 4ZQKB 2VUYA 1IVLA 2P5WA 3OG6B 3L1OL 4GKZA 2I26N 1Z9LA 1YUHA 3Q2CA 3OF6A 3MCKB 2VLRB 5M7QA 3LN5B 3HC4L 4LCUA 3UTPE 4I77H 2Z31D 1T5WA 2UWEE 3OHXB 4X7CC 5E2WH 3NAAH 5E7FA 5EZJB 1PJ9A 4NHUA 3FQWA 2HMIC 4EUPG 3RJQB 1PY9A 4MNGA 4M9OA 1J8HD 1X4YA 1HWGB 3QXVA 2YA1A 5B22A 4P2QD 1AGBB 4KQ3H 4XTRC 1INEH 4AT6A 1CF8H 1XF4B 5TGBA 1ZGLA 2W60B 4OT1L 2L4OA 1P6AB 5HYJB 4XNQB 5JTWA 3DYPA 4IDJL 1N2RB 3D69B 3R0MA 4GO6B 3QIUA 3PWVA 5GGRA 1OAZH 3TIEA 3GHBH 4K7PY 4RMVA 3FFCD 1T2QH 2X1QA 1UXWA 2B1HH 4N90D 3FQTB 3DMMB 3DURA 1UH2A 3IRPX 3N9GH 4JKKA 2AJZA 1E4KA 3IYLW 5TDPA 5F7EL 3MR9A 5LKNA 3TGXA 3SDAD 3BH9B 2XKNA 2JELH 4X4XA 5DRWB 2X1XR 2BSSB 1SQ2N 4M7LH 4ELMA 1BVLA 5AWNL 4JKLA 5JA9A 4JFQB 3MJ8B 3HZKA 5EUOB 1F42A 4PGDB 2YR3A 3DLQR 3HE6B 1P53A 2BNUA 3MXVH 3VFSA 4N0UE 4KGLA 2XTJD 2I5YH 2OL3H 3HFMH 5DK3A 3T8XB 5I73B 5GRUH 1HCFX 4M6AA 4WI2A 3ZHLA 1M05B 4JFEE 3UYRL 2DQIL 1A3QA 1NMAL 3GBNL 5C09D 1EA9C 2J8OA 1A4KB 3IDMA 4MNQA 2HT3C 3P77A 1L7IH 1YDPA 5FM5O 3QXDB 2DIAA 1Z5LA 3RP1A 4WV1B 4Y4KD 3WIIH 3IETA 3EDFA 1OM3L 1A2YB 2HT4D 3GSOA 2J88L 2KBGA 4QHUB 4ISVA 4I0CC 4I18A 1WWWX 2CUHA 1XZ0B 4OIBA 2O26U 3AAZA 1CGSH 4Z0BL 3OKNB 2VDKL 5F71A 4GQ9L 3P9WB 1CFBA 3I02B 3DO7B 3FB7A 5JHLL 5C7XH 1KCRH 1MHCB 4XWOD 4WW2A 5DFVC 4W81A 4YDJA 1OGTA 3OPZH 1RZ8A 4F9PA 2KH2B 4KKBC 1CR9H 2X4SA 3Q0HA 3MROA 1IMHC 2EDTA 4QRRA 2HJKA 5E2JA 4OQ1A 5EIQA 1RMFH 3CUPA 5AZ2H 1VGKB 5A2IH 1IC5H 4JY4B 4JPVL 1QSFB 1SEBB 1UENA 1YEEH 5FXCH 3CXDL 3L3JB 1C1EH 1OTSD 1QFUL 4S2SB 3TNNA 5BVPH 2NY1D 5IMLA 6FABL 2AV7A 1EBAA 3S34L 2J6EA 4HMDA 4ONFL 2IH3B 5FYKH 1PGRB 4RAVA 3PHQA 3C9NA 2ARWA 3EYOA 1FN4A 3UDWC 3DUHA 3DUUB 4P2OB 3L3KB 2VITB 4PLKD 1QRNA 3ARDC 1LE5A 4WFGD 4RFNC 4NQCB 4YHOH 4H1LA 2UUDK 3VMNA 5AAWA 2HFGL 1G7JB 3C5ZA 4PJBA 5DD6B 4KAQL 1HH9A 5C0FA 4KMTL 4QXTA 4OKDA 3SKOB 2FATL 5DWUL 1FFPA 4BUGA 2B1AH 2NX5E 2DM4A 4UQ2A 3ZO0A 5F7MC 1ODAA 3OXSA 4U1MA 1VEPA 1UFUA 4XP4H 4LSSL 2M8XA 4ALAL 4OBRA 3KYOB 4PJDF 3OJMB 1YNTA 3QWOA 3S37X 4K8RL 4BZYA 1P6FA 4XPHL 5HI4D 3EYQC 2F54D 1IEBA 3NCMA 2GI7A 1NC4A 4KC3B 2DQEH 4QTHB 3UBXA 4HD9A 2I9TA 3DVNB 1ZLSH 1KELH 3GBML 1I1CA 1AXTL 4RZCB 4V1DA 4HG4K 2YPVL 3CFDB 3ZL4H 2FR4B 4NZJA 4BQ9A 3ARWA 1HILA 4NCDA 3LKSB 4ZFFA 2K7PA 5I74C 5TDOB 1GSMA 3FT2B 1AXSA 1AFVL 1C7TA 4C58B 1BQHG 4WRLA 2XY1A 2VXSH 4ZSOE 1BWMA 3RWFB 2IQAA 2V9TA 3DIFA 1MI5D 4G8GE 1DQMH 1BLNA 2P8PA 3RPIB 3LQMA 3O3DA 2FD6H 2CDEB 4XCEB 2D7TH 3MV11 3VRLE 2GYSA 2X4QB 3BUTA 1QFWI 2MPAH 3D18A 1CDCA 1ZK9A 2XN9A 2DQHH 3OTTA 5T3XH 2MOVA 3QZWB 4TUKH 2AJ3A 3ARTA 3KLDA 2Q87A 5BVJB 1UWGL 3PDDA 3BT2H 3HUJF 3QDGA 3NIDE 4HDIB 1YN6B 4NC1C 2DLEA 4ODHH 5T1KB 2FGZA 1IAII 2F53E 1WAAE 4LPVA 1NCCH 4ZUUA 1VKXB 3MV8A 3MODL 1RIVH 4DGYH 5IEHA 2BNQE 5LGHH 1MIMH 4LLUA 4HCRA 2G60L 3FO9B 2APBA 2ZOKA 4EDXB 1NCNA 3GHEH 3SDCD 3U0WL 2VL4A 5FGSA 1JNHA 3P4OB 3QYCA 2GJ6A 5GS0L 3FMGL 1BQHB 3TVMB 3SCMD 3BQUA 2NY3D 2Q6WB 1GOFA 1MQ8A 3L6FA 2VR5A 5ILTH 5D5ME 1JPFB 4Y19D 3MGTA 3LQAC 1RK1A 5HDBE 1DZBA 1WBZA 1EVUA 3JWOC 3F7YA 3BN9C 4O2FA 5I8KL 3O2DL 2VLRD 3HE7B 3VFWB 2EDOA 3CCHB 1KUMA 3VD5A 5ID0A 3O11B 1B0GA 4D3CH 2HG5A 2ZCHH 4M6NH 5JIKA 1ORSB 1DVFB 2FJHB 2IAMB 4FFVD 5SWQB 1WFOA 1S9VA 4TUJA 3UZEA 3KAAA 1FIGH 3SGKC 1GH7A 3BUYA 2JK5A 4GKOA 4Z7QF 5KJRL 2AS5M 3NCJL 1G9NH 5GZND 1YEFH 1JUFA 1S9XB 3D3VB 2VDNH 3SGJA 4NFBA 4M02A 3TO4B 3K8KA 5HYJD 1WBXB 3BP7B 2P5EE 3BDYL 3ZE2F 4D9RD 2BY0A 1IGFH 2YA2A 3CVHH 4X6EB 5T5FL 1CBVH 3BIKA 2LVCA 3BGFC 1RVFH 2X9WA 4Y1AA 1H0DB 4Q9BA 3REVA 3ARQA 1II4E 1MREL 3DMMD 4GRLC 4YPGA 4HK0A 5FA4B 2QR0A 3T0WA 3NPZB 1X5YA 4PV8B 4L3CB 1I8LC 1NDGA 3ARVA 5E6IB 3V5HB 1RZGA 5IGXL 5ACLA 3ZDYE 3O9WB 4HJJL 3VFVA 1P84J 2NY4C 2X1WL 4IRSA 2PN5A 5J1AA 5GRXG 1OAQL 1V7MH 3E8UH 2NY0B 1V3JA 3HE6D 5E94A 4IIQC 1FV1A 2AJXH 1ONQB 4D9LH 3QUKA 4RX4A 3MV7A 2YD2A 3V95A 1X5HA 1OQXA 3PP4L 3X3FH 5KG9A 1D6EB 5KS9A 5ICZA 3QJFA 3EYVA 2VXTL 1GPOH 5IVXF 5FYJL 3LKPB 5SWSE 1MUJB 4JLRB 2X4TA 1LDSA 1V3KA 5FEBA 4UAOC 2PYFA 5CILH 4CN1A 2AXJA 1MNUH 4XP5L 5DJZA 5C6PB 1DSFL 5D7IB 4OZHA 2A0LC 3UTQA 5HPMB 2EH7H 1YYMH 2VDML 2R1WA 2IANE 3T77B 3QEQA 1T83A 1OCWL 4JQVA 1S9YB 4NFCA 3QG7H 4NSKB 5E8OA 3UXFA 3VJ6B 2OL3A 4WY7H 5E2VL 3QWQB 3SDDA 4RNRB 3O6FC 4IJ3B 2FB4L 3MBEB 3EFDH 3NABH 4XT1C 3IFOA 4Y5YA 3FT4B 4HXBH 4BH8B 4HPYL 3CX2A 4ZDHA 3WJLA 3VXOB 1EV2E 2AJYL 4HS8H 4LPXA 1S8DB 1GGYA 3V6FB 1OWRM 2YS4A 3BAEH 3TF7C 5EWIH 4U4BA 1MLBB 1E6OH 3MBXL 1WIPA 2D9QB 5F70A 4K9EH 1G6RL 3VWKB 3FOMB 1FVEB 1F11B 4MWFA 2IQ9H 4L8CB 2V5SA 4MD5B 4X99A 1I8KA 1QSFD 4MB4A 5DSCA 4ZTPH 3QUMB 4EQ3A 5D1ZA 1PKQA 2JIXB 4W70A 1TZHA 1FNSL 2QSQA 4O5LL 3QA3B 1V3MA 4JO3L 5I1EL 2C1OB 4Q9RH 4PJCB 4UDUB 5HTSA 3T2OA 5FM5M 1S9WA 3BD3A 4OBSA 3I3BA 5FB8B 4P2OD 5DJCB 3RTQA 1FGNL 5HHPB 5D2LF 4I4WB 3WUWA 3RUGE 4MAYA 4NQCD 4MXQC 1MCFA 4FXGB 5IWLC 1F6LL 2BRRH 1RJLB 5L7XL 3TO2A 4X7EC 3I9GL 4P9ML 3SO3B 1G7MB 2ESVE 2EDFA 2Z31A 4XNZB 4XCYA 3SDXA 2RJMA 1HDMB 1H15B 3BZ4B 1BEYL 1U95B 4HAGA 3P4NA 2F74B 4FP8H 1W72B 3AM8C 1JK8A 1U8JB 2VOTA 1J8HA 3OKKB 3HC3L 4Z18A 1RSFA 4JM2B 2RGSA 2GSIA 4LLQA 1F3RB 2W9DL 4JJ5B 4QF1A 5C3TA 3HMXL 3PWPE 5EU5A 3O4OB 2B4CH 4WFEE 3BISA 4D0CA 4JFFA 4YHML 2VDOL 4GG6F 3FFCA 5F88A 4AIZB 3M17B 4B41A 3WIFB 3WNOA 2WBJA 3S5LB 1HHGB 3SBWA 4ODUA 2X05A 5CZVL 5CSGA 5F21B 1CGXA 5FHAH 4TTGA 3BMWA 3SDAA 2YA0A 1F4XL 1WCQA 4OV6F 5T1MA 1TETH 1AGEA 1IL1A 3HZVB 3MCG1 4K23L 1FNHA 1U41A 1YYLL 2GK0B 2GW5A 5ALBH 5FDYA 4OIIH 2VR4A 5J12C 1CZ8L 2C5DC 4MXVE 2YD9A 4BH7A 2FJFB 1KENL 5K9OA 3P9LB 2ICES 4IOIB 2E6PA 5F89A 3B9VA 3LV3B 3FO0L 4X7SL 4N0UB 4PRDB 4YDVB 4U3HA 3C08L 1DQTA 2Q8AL 4U1JB 1DQDL 5C09A 4TUOA 3QNYA 2F9BT 3BZDA 2VLKE 1FG2B 4H25B 1A6ZB 2LAAA 5T1KD 3HNSH 1QFHA 1MAJA 4XVJH 1C5CL 2C3HA 4L4TA 3E2HB 4ODVH 1T1YB 4K94C 4Y4KA 5L2KE 3N50A 1HHJA 3EDEA 5CLTA 1A7PL 4N8PA 1CICC 3CNKA 3HPLB 1QO3A 2A6KA 3T0DA 3KYAA 4X5XB 2HFFA 2LABA 1ZHLA 2E3VA 1EHNA 1LE9A 2BY1A 4NDMA 2NQCA 3MJ7B 3PP3H 1NEZB 4JR9L 3MX0A 5ESVA 3BRFA 1UM5L 2E7BA 4J1UA 4FQXC 4OZFG 4WJ5B 4HJGA 1AIFB 3ARGB 5E5MA 2VQTA 1JGDA 2CRIA 4KU1A 4FABL 3ALWA 4M43L 4JN2A 4Y4HD 3SGDH 2YUZA 3MUY1 3TBSA 1QVOB 5C71A 1EEQA 4NC2B 4MX7B 3PXJA 4KVNH 1UEYA 1DDHA 4TTDD 1IGIH 5GJTH 2IBZY 5C0DA 4FFYL 4PRIE 3VXRE 3Q1SL 3R06A 5EO9A 4EZMA 3TZVC 1GRWA 4KTDH 4RQQB 3LEXB 2EEDA 1OVZA 1JWMA 3EUUA 4UU9A 3G5XA 1IGML 1ZHKA 1DVFD 2IAMD 4GW5B 3IDIA 5BRZE 4JHAH 1LEKA 1K8IA 5AG8A 1UXSB 1AD0B 4PJAF 3TIDB 3D3VD 5T3ZL 3TO4D 4PJGF 4PV9A 3PG2A 2D4FA 1AC6A 4AG4L 2GCYB 1EJOH 3CU1A 5JZ7C 5IMOA 2X7LB 5DZLA 1QBLH 1X5LA 4Z78A 1DR9A 2FEEI 4GBXB 2V2TB 3C6LA 5CEZE 1CLCA 3M1BB 1MCPL 3U46B 3K8LA 3LEVH 1PD6A 4XNYH 3GSRA 4OZFB 1BBJA 4YHPB 5DHVB 5D7KE 5DJ6A 4G9DB 2AGJL 4RAUB 1OPGH 2MCPL 2VQ1B 4YDIH 5E6ID 3P3YA 3MLYH 5E99L 3SEPA 2C7UB 1G9MC 1ZT7B 3WEXA 3O9WD 4F7CB 4QYOB 4JY6A 5BXFB 1FFOA 3B3IB 3S4SG 5KVFH 1XIWC 4NQXA 2D31B 1QLRA 3TJHD 4LVHB 4EN3A 4ZOBA 2NX5B 3OB0H 1G0YR 4K2UL 4FQQB 1FO0L 2OTUA 4PJXE 1NSNH 3CVHA 2VAAA 3HS0A 2H8PA 3D9AH 2P1YA 5E00A 1F2XK 1YNLH 5B3JF 1GGBL 5DUML 1UJ3B 1KLGB 1JIBA 2CKBB 2RFXB 3OZ9L 1EAPB 2L7UA 2ZOLA 3R1GL 3V6BR 2NR6C 1FAIH 5MEQB 1UB5B 3O0RL 1KJ3H 4G9FE 4PJ7F 1XF2B 4H88H 2G9HA 5GRWA 2NNAA 1C5BL 4LHJB 1CG9A 4LBEA 5SX5H 3HI5H 2NPLX 5HVGB 5BW7A 3H3PL 5JPMA 4PJ8A 1QBML 1Y0LB 1FIEA 2ED8A 2Y07H 4QNPF 1XFPA 2FJGA 1A4JB 2P8LA 3RNKA 5ACZA 1K3ZA 5BS0A 3E6HA 1UC6A 1T80A 4KKAD 3H3BC 4HGMA 4ZS6D 1MI5A 2C3WA 4ZSOB 3BO8B 4I1NB 5HVHC 2G5BB 2DKSA 2DRUA 3L3DA 4JQIL 1BOGA 1IC4L 3GMRB 1C5DB 4UQ3B 5LAXB 1N0XH 3C8KB 2VN4A 5EOTA 3MBED 4G8GB 1KIPA 3ARFC 5EIIB 1IAKB 2ZG1A 5F9AC 3C5JA 4J4PC 1KTLB 3MRHB 5GJSH 4MD0A 3MRKB 4Y16C 2FX9L 5ERWB 3W9DA 5IBUG 4BK4A 1RZIB 2OI9B 3NZ8B 3P0VH 3KPTA 5E08H 3CFJB 3ILQC 2JJTC 4EBQH 2QADB 5EC2B 4PGBB 4DKFH 5C9KA 1BM3L 3WYRA 5SWZE 1S7SB 3VWKD 2F53B 1R5WB 3JV6A 3CMOH 1MFDL 4P46C 2W0LA 4AL8L 3KXFB 5D7LD 5C6TH 5C0RH 1TZIB 4FRWA 4LRIA 1TQBB 4C59B 2BNQB 2DJUA 3SDCA 4K3JH 4EQ2A 5HYEA 3G04B 2WWMC 3IXAB 1NAMB 3QSKB 3SCMA 4JZOB 2OMBA 4Y5XA 1FL5B 1AI1L 1S5HB 2G75A 3NCFB 2ATPA 1JYVA 3MFGB 2W59A 1IBGL 1RZKL 1Z3GH 2HFEA 5DFTA 1JF6A 4XP1L 2WV3A 4S0TD 2FBOJ 2IWGA 5D5MB 1UA6H 1HNFA 3C09C 2BOBB 1JPGB 3U9PL 1RUPH 3QWRA 3LN5A 1RUKH 1DBAL 4ODTL 3TLRA 1U3HB 3VRJA 2VN7A 3TEUA 1T0NA 5JIIA 4G8FB 1MVUB 3OHXA 4BJLA 1EUUA 2FX8L 3ZE0E 3UTPD 1XF1A 3VGHA 1RIUH 4JKPL 2KUTA 3KPRE 3MLXL 4M6OH 3RA7H 2RQ8A 4JM2D 5E4EB 2DI9A 3WLBB 5AUMB 3GNML 3QHZH 5L6YL 3VA2C 1YMME 3FL7A 1E27B 1JI2A 4DW2L 1C8PA 5HYJA 3B9KB 5DVLA 1N2RA 3D69A 2CGRH 1BJ1J 2AJSL 4MA3B 3MACL 3ALPA 3OKDB 4LMQI 3FTGB 4HGWA 1UH3A 4YWGH 5ID1B 1OAKH 3QH3B 4HMEA 2A1WL 1D6VH 1JV5A 3FQTA 3S3PA 3DMMA 1K8DA 2BNRB 4HJ0C 4N1HB 4O9HL 5T1LB 3WFEL 3ZTJG 5EH1A 2Y6SC 5H35B 2DQFB 1KSRA 5CZKA 3AXLA 4LEXL 3IU4L 4POZD 1JNLL 3BZEA 2EIZB 3QRGH 1KOAA 4OJFH 2Q76B 3VFMB 1EVTC 4FG6C 4WHYH 3BKJL 1LK3L 5E8DL 2FHCA 3BH9A 3RGVA 3CDGA 2BSSA 3TN0C 3KJ4C 1KFAL 5IMKB 3BEWB 1OP5H 4JFQA 2QSCL 3WFCH 2R1XB 5EUOA 1Q94B 3B2UC 3HE6A 1KXVC 5BQ7A 3MLWL 1VADB 5FUCE 4NJAH 4UINH 2VDPL 5CP7B 4WCYH 4CVZB 4DFIA 4NNYB 4U1LB 3B6SB 4GLRH 1M05A 1N6VA 1L6XA 2O61B 3WIHL 1QQDB 4MXWL 2VISB 4LQFH 4MZ2A 3FB5B 2A83B 4HPOL 5F1IB 1A4KA 4OZ4B 5EOQH 1SM3L 43CAA 4YX2H 1RUAH 2JF1A 4MAUL 3WFDL 4GS7B 3FRPA 1R0AH 2Q1EA 1AJ7L 3PGFH 2X4UB 3F5WB 3P0GB 5H2BB 5C0ND 5SWSB 3H9HB 1A2YA 4JCLA 3QCVH 1KBGL 5EFIB 3RDTB 5K9QG 3UBXI 1OAYL 1JHKH 4JFPB 4NN5B 1XZ0A 1OAXL 4XHQA 5D2NE 3T4AB 4F9LA 4J12A 3OKNA 2J4WH 3QFJA 1MEXH 1OSPL 4NBZB 4KDTC 1IFHH 4J6RL 2IANB 2EYTB 4FA8A 4NBXB 4L4VB 4ONGH 1IGTB 1RHFA 4AYFA 3ARGD 3O6ML 2AJVH 4Z7WE 1INDH 2M26A 4PG2A 3LKRB 4FQHB 1BOYA 2BVUA 1YC8A 4RGNB 4KXZI 4NZUL 5DUPH 1EK3A 3DROB 4KDWA 4MNHB 1KCSL 1NFDE 4K55A 3ABZA 4WW1A 5I18H 5KSBF 1DEDA 2OJZL 1UM4H 2BSRA 1KJMB 2DI7A 4PP2B 2XXCB 3BYYA 1MCJA 2Q86B 5KVGL 4UIKL 2A73B 2EDYA 1S7TA 2ED9A 4OCXL 5MI0C 4MA7H 4HUUB 3P9MB 4P5TB 4JY4A 1SEBA 4MHHI 1W72H 3KHQA 4S2SA 3J7HA 3QQ4B 5EU7C 3E3QE 2QJDA 2FZ3B 4EVNB 2IH3A 4DQOH 4ZPTB 5DD1H 5A40E 2EO1A 1TVHB 3NZHL 3CJJA 3GRWH 4XBEH 3KYMB 3T0EC 3L3KA 3W81A 2ICCA 3NIGF 2LQRA 4F33A 1S5IL 3JWDH 3LS4L 4NQCA 2D7OA 2X4RB 4GBXD 3L3HB 2ZUYA 2ORBH 1KC5H 5A2FA 3SKMB 1CVRA 3RUGB 1Q9WB 5FGRA 1ERNA 4D8PB 3Q5TA 2BRQA 3SKOA 4PBVC 3GEWB 1G7QB 3NGBB 5L88L 1DUYA 2DLTA 4U2YA 2ESVB 4F37F 2AXFB 4QHKI 5ICYB 4FQIH 1XEDA 1GAFH 3SKJH 1MVFA 5FCUH 1JYNA 4J2XA 1UADC 5CIPH 1MFEH 1MCRA 2Q20A 1E6JH 1AY1H 4OLYH 1D7FA 4BQ8A 1AD9B 4ESKA 1NUDA 2HH0L 4YZFF 4Z7VF 1KACB 1T7XA 1ZANH 1A9BB 3S35X 3IFNH 3X12A 2FR4A 1HI6A 1PLGH 1T1WA 3INUH 4YNYA 2MMXA 4WU7B 1CGYA 3LKSA 1OHQA 3QXTA 3H42H 3TCLB 4E42B 2XA3A 3FT2A 1EMTH 4J3WA 5CJQL 1IAOB 3N1MC 3TV3H 4MD4A 2DQJH 4RBPK 5FKPB 2NYYD 4UNUA 3QJHA 3VGAB 5DR5L 5K9KB 2AI0L 1PDKA 4GAFB 3MJ9H 1K6QL 3RPIA 1NGYA 1B0RB 3K1KC 4XCEA 1YQVL 3QR2A 3QEHB 1WC7B 4WEBL 2E9WA 4H26B 1X5GA 4HUNB 3QZWA 5J56B 3O45A 4PJEE 4P9HH 2KKQA 3EAKA 1CIDA 4HDIA 5CLWA 1YN6A 1LO2L 2V9QA 2VZTA 4P3CH 1NGZB 1T7WA 2O5ZH 2QADD 1NCBL 2J12B 1VKXA 5E8PB 1CQYA 1J9CT 4R4FL 1MCSA 4Y5VA 1MJ8H 4OLVH 3S3JA 4DGVL 1NMBH 2XZZA 4UT9L 4M1CC 1I4FA 3FO9A 3KXFD 5GZOD 4JHBA 4EDXA 2V7NB 4BFIB 4GFTB 2EKSA 3A6CL 3TVMA 2X70B 4LQ1A 2IPTH 3VXUA 1J1XL 5D6DA 4O2EA 5IFAH 5J3HD 2Q6WA 2NXZB 2Z35A 4DVRH 2YK1H 4MJ6A 5IW1B 1JPFA 3VD7A 5IB3B 3C2AL 1S78D 4O2CB 4UB0H 4PJ9C 3MXWH 3JTTB 3U79A 3HE7A 5BO1L 5JW5B 3VFWA 1UQSA 3CCHA 1HYRC 4EI5C 3DYOA 3AB0C 2VDRH 5IB5B 5DHVH 5LGKA 3O11A 3VCLB 4PRIB 1PZUB 5E1AA 3ZDXF 4OCNC 1ORSA 2GIYA 1DVFA 2FJHA 2IAMA 5SWQA 4ZS7L 2DMKA 4MLIA 4ELMF 5JOFB 4Z8FL 1TJIL 1S9XA 3D3VA 4S0SD 5BRZB 5I1JL 3TO4A 2R9HC 3QUZB 1WBXA 3CFCL 4TVPE 3ZYIA 3BP7A 1HHHB 4WTXA 5EZOL 1KYOK 3QDAA 4X6EA 5T33H 2DQDH 5KANG 1R3KA 5CBEB 1WQVT 4PB9H 2CKBH 3BPLB 1H0DA 5LG1A 5IKCB 1CGUA 2BNRD 5T1LD 5E5UB 4LIQL 5FA4A 1FBIL 3WS3B 2VAJA 5TFSL 4L3CA 5E6IA 3V5HA 4X4MA 3RWEB 1XMWA 7FABL 2CRMA 5GS1B 2NY7L 1BQLL 3O9WA 5ESQA 3JWOL 1CLZL 5GGVH 1A7BA 5CUSH 2R69H 3QIUC 1HKLH 3NN8B 3WO4C 4ZFGH 4Y2DB 4NKOA 3H0TB 4GRWF 4JREB 5CCKH 3S37L 2YSSB 2CK0H 4S1DD 3UX9B 1LEIA 1HZHL 1YEJL 3RHWK 2KDGA 4G80A 1DN0B 2E8YA 1A3LH 1E4KC 2JLLA 4J23A 2X5PA 5DMGC 4NP4H 1T66C 4PJXB 5GS2D 1D6EA 2CIKA 3OQ3B 4AH2A 3GMQB 3RBGA 1MHPH 3LKPA 2DJSA 2H2SD 3SDYL 4JLRA 1JPTH 4KK6D 1NKRA 2VQUA 1EEUA 2GY7B 3G6DH 4HIIB 5D93C 1HH6A 5DQJB 2PO6A 4G9FB 5D7IA 5HPMA 2DM3A 4XRCA 4YXLH 3KNBA 3RDTD 1IQWL 4LOUD 4MB5A 1QNZL 1KYOJ 1S9YA 3U2SA 4XX1G 4NSKA 3VJ6A 4K71B 3QHFL 3WFBH 1NAMH 1P9MA 1CL7L 2LU3A 4RNRA 3SOBH 1MCNA 2ADFL 3MBEA 3LIZL 1HEZA 2ITCB 4L4VD 3T09A 2WQ8A 5GISH 3FT4A 3VXTA 1Y6MR 1NMCC 2IADB 2EH8L 3VXOA 4RGND 1S8DA 1E4WL 3CD4A 4R8WL 3CLFH 2IC2A 4GT7A 4FQLL 1PVHA 5DJAB 4LCWD 4WUUE 5C6WH 4RA3A 3ROLB 4MDIB 5CGTA 5FYLL 2VB5A 1EIBA 1FCCA 3E6FB 3FOMA 5MEOB 4L8CA 4MD5A 3MLSH 3QIWA 4P5TD 3V8CA 2F8OA 4WW2C 3OR6B 5F9WB 2JIXA 1KJ2L 4ZFZB 4YHYB 4F9PC 4PD4K 1CXEA 4HLZH 4LSRL 2C1OA 2K1MA 2I25N 3V4UL 4N1EA 1R5IB 2GSGB 2ZKHL 4PJCA 3MOBL 1F6AB 1W0WA 5IHUL 5FB8A 4R97B 4FMFA 5DJCA 3AVEA 4KI5F 2PXYA 3HC4H 5HHPA 1RIHH 3I75B 1ETZA 4MVBC 2ZUQC 1G6RB 5CWSA 4FXGA 2FIRT 1A7RL 5HY9B 1VA9A 2AK4E 2GTWB 3ULVC 1RJLA 4TOYH 4M7JH 3GM8A 4HF5H 4YXHH 2N7AA 2QKIB 4EJ1C 1G7MA 4GW1A 3HAEB 2Z92B 1BZ9B 1EEZA 3DWTA 4C56D 1OTTC 1DFBH 1HDMA 3O3BA 1H15A 4TNVK 5I6XC 3BZ4A 3EJYC 1SYVB 1U95A 2ITDB 2F74A 3NCEB 2ESVD 1X9QA 2C1PB 1W72A 2UWEA 1RULH 4JAMB 1URLA 1ADQH 3OKKA 5IEKA 5C07E 5KW9L 4JM2A 3ARPA 1HYSC 3VGEA 5F3BA 4JJ5A 3C5ZC 3T4YA 5HHXH 1ORQA 2WIMA 3GRWA 4XVSL 1T1ZB 2HJFB 1IZKA 1YMMB 3BPNC 3EYFB 2Y9RT 4PJFE 4I0PC 4AIZA 4QT5B 3WIFA 5I1KH 4WFED 4OFPA 5J6HB 3ARBB 3QXWA 4HUXB 3S5LA 1HHGA 1BBDH 5L8KB 4XC1H 4IOFD 3IRZA 2R8SL 4QHLA 3TCXA 4Q2ZB 5HJ3B 1IKFL 4JZNB 5D8JL 4YQXL 1EERB 1LO3L 4I13B 3P11L 5MERA 2FECI 1FL6A 3CIQA 4PD4J 1NEUA 2VE6B 2ZUVA 3BGAA 4K8RD 4KJYB 3HZVA 2EC9T 1CK0H 3L3GB 4LPWA 3SJVE 2APVA 3FQXB 5CIPA 5IHZA 3HCVB 4DUWA 2FJFA 2OSLB 3P9LA 4IOIA 3WD5L 3UYRH 5KSVB 1NMAH 2HTLC 3FCTA 1HQ4A 4N0UA 4PRDA 1WZMA 2F5AL 2CD0A 4Y2OA 3WXWH 4JFZL 4MQXD 4IS6A 1MCWW 1CIUA 1O0VA 4HWZB 1JZ7A 1FG2A 1LP9B 1A6ZA 1WFTA 4H25A 4PRNA 4JFEA 3TYGL 2X44D 3VWJC 4XAWL 3MV01 3GIZH 1OTUD 1T1YA 5CJ5A 1WBYA 1HK6A 3HPLA 3L5HA 4Z0BH 5DD5H 4X8XA 3MJ9A 2HYMA 3PL6A 3MLRH 2ZNWA 3LHPL 3RL1B 1KNOA 3MJ7A 3PV7A 1TTGA 4OCWH 1NEZA 3UYOD 3AGVA 1BFOB 3LOWA 4K7PH 4N9OB 1T7VA 1B2WL 1B6DA 5D2NB 2NXZD 1OF2A 3L95A 2FBJL 4UTBL 4HS6B 1TJHH 3ARGA 2X4PB 4KGJA 4ELKB 3RWJB 2B39A 2OYPA 1CE1H 1QVOA 2VLJE 2UVFA 4MX7A 5LWYL 4JHZA 2DMCA 2I24N 3A6OA 1YPZE 3QI9B 4K7FB 4JPVH 1TNMA 4M7ZB 4RQQA 3U1SL 3LEXA 2NLJA 3BQUC 5ITBL 5GS0D 4PRID 1MJJA 6FABH 4GW5A 3S34H 4G7VH 4ZO6A 4G6MH 2CMRH 4K94L 1OP9A 4YHIA 1D3CA 1AD0A 5L8JB 3TIDA 5BRZD 4ZXBD 1LWRA 3QUZD 5GPRA 1E4JA 4PBWD 3OMZA 2DQUL 2GCYA 3GMLB 4JO2H 3C5SB 4PJDE 3VXPA 2W0FB 4N0YL 1I9RL 2FEDD 4KAQH 5TPWH 4JFXA 4GBXA 4LP4A 2FATH 3M1BA 5KS9F 1I1AB 3U46A 4PYHA 1Q9LB 4DEPB 5CD3B 4XHJD 1H3UA 4YHPA 5DK0B 5DHVA 1BIHA 3C60B 3SGJC 4G9DA 1XGPB 4RAUA 3STBA 2VQ1A 5LBSH 1FVDA 4XCCH 1F90L 4YUEH 1ZT7A 3EJZC 4QYOA 5BXFA 1GVIA 2OR7A 4OZHF 4Y2DD 2XOTA 2Y23A 2NX5A 1C08B 4FQQA 3OSKA 4OF6A 4XNUH 2YEZB 5IUSA 4G6JH 2EYSB 5IIEB 1TQCB 4H20H 1UM6H 2CKBA 5IMMB 5JXEC 2RFXA 1EAPA 1A6UH 4NCC2 5MEQA 4IRSC 5JQHC 1NPUA 1KGCE 3GGWA 1UB5A 2LTQC 3HI6L 2IG2H 1XF2A 2KQNA 1ES0A 3QDME 5CSZB 4KK8C 4P3WA 2RR3A 3HUJE 5DGRA 4G9FD 5F1SA 4TNWK 2DI8A 3MRDB 1INQB 4NZTH 3D0LB 4ZSOA 3BO8A 2G5BA 1S7WA 4BSVB 1G9ML 1ZVSB 3GMRA 1CDYA 5LAXA 4MCZB 4AMKL 3C8KA 5I1CL 4G8GA 2AXGA 3L5WB 3V8OA 3RZCB 5EIIA 1IAKA 4FFZH 1EO5A 3MRGB 4MDJA 5I17B 1KTLA 1U8HB 3MRHA 3ZTNL 3AS1A 3MRKA 2CDFA 4I2XE 2R56H 3FZUD 5I0DA 5ERWA 4L5FL 1JE6A 1AR2A 1XGYH 3SHSA 2H9GA 3NZ8A 4M62H 1T83C 3OV6A 4XNXL 4JQVC 1QFWL 3JTSB 4J8RB 4PJEB 2G60H 1MWAB 3TJEL 5KSAC 4PGBA 2H2PC 5C0GB 2YMXL 5SV3A 1S7SA 4J3VA 1GGCL 1MELA 2F53A 5IQ9B 4KFZC 5F97E 3BP6B 3MO1A 1YEGL 3FN9A 3FMGH 4RFEA 4TSBH 1R6VA 4Y5YC 1IAIL 1BFSA 1YC7A 4OTXH 2BNQA 3C8DA 3IFLL 3MC0A 3WJLC 1QLEL 2FNBA 3G04A 4KJWD 1K9TA 1NAMA 5TF1L 4MJ2A 2K7QA 4JZOA 2GUOB 4N1CA 4LASL 1FL5A 4Z7QE 3O2DH 3G5YB 1EX0A 3FQRB 3RU8L 4G7YL 5SV4A 1JPGA 5D1ZC 2VYRE 2WMPA 1IM9B 1MCQA 1QKZL 2OLDA 35C8L 1KPUA 2AK1L 4M4PA 1U3HA 2Q3ZA 3NFPA 1EHLL 4G8FA 4I48B 5KJRH 1MVUA 5CEZH 1VACB 4M48L 1A5FH 4ZOAA 2GITB 2R0WL 3LKQA 4OF8A 4MA1B 3RTQC 4QOKE 1GC1C 3GUTB 4MAYC 3WLBA 5AUMA 2VH5H 1JGVH 2XQYK 5LQBH 1E27A 4ZFOL 1IILE 3ZYJA 3B9KA 4L4JA 2CIIB 4FQJH 4M7KL 2APTA 1MREH 3K80A 4MA3A 3OKDA 4WUKL 4XPFH 1ZT4B 1YMMD 4XCFL 3FTGA 2W0PA 5TQ0L 3QH3A 2P5EA 4HMCA 1I85A 4X0KA 4YK4B 2ATKB 1VGEH 3ARBD 4GKSB 5T1LA 5I1AB 5H35A 2DQFA 3I2CL 4GSDH 3EO0B 2EIZA 3QPQC 2Q76A 3VFMA 4U6XB 5D1QB 1QPXA 5IVXE 4BZ1L 4HXAL 4GAGL 5AD0B 5KVEL 1ADQA 1FZJB 2HWZL 3BEWA 4E0RB 2B0SH 3SGDI 1ZT1B 3TA3A 5EU6E 5I1DB 4GMSL 4HEPG 5FFLA 2R1XA 4NM4H 4G5ZH 4ENED 3DETD 1Q94A 2F58L 3P30L 3H9SE 1QYGH 4UDTB 3V0AC 3DX8A 2WBJC 1VADA 3QPXL 3SBWC 1JZ5A 5CP7A 3X3GL 4CVZA 2Y06L 3TBWB 4OM0L 1G1CA 5DMKB 4M8VA 2VXTH 3SDAC 4B0MM 3H6JA 4R2GD 3B6SA 3CFBB 4I3SL 2VDQL 1A6AA 5HDOA 2O61A 2VISA 2QQLL 3FB5A 2A83A 4FNLL 4DCQA 4ETQB 3TT3L 4NJ9L 3UO1L 2V7HB 4IHOB 1AQKL 3JUZA 1CFVH 1NL0H 4MJ5A 3O3EA 4OFKA 4D2NA 3F5WA 2NXYC 2ZSVB 5SWSA 1OCWH 2O5YH 3MNZB 3MUJA 3U0TB 4AK1A 4DOHB 4WWID 3RDTA 3CPLA 5E2VH 5HYQA 2FB4H 1FG9C 4QRSB 3T4AA 2AV1B 4EXPX 2IANA 2EYTA 5F96L 2C3VB 1J1OL 4Y4KC 4NO5B 1UCBH 1IGTA 3RVWC 2CXGA 4XP9L 4HBCH 4FQHA 4OZIE 1TPXB 4ODWA 3G9AB 3LDBC 3DROA 4MNHA 4JO4H 1MCOH 5IV2B 1DUZB 1KJMA 5D2LE 4PP2A 5AYUL 1ZVYA 2Q86A 4RRPA 4KY1H 3SE9L 2A73A 5INDB 1B0WA 15C8L 3HAEH 3P0YL 3HNTL 4O5LH 4WUUB 1CXFA 4LSQL 2V5YA 4KVCH 3P9MA 4NQDE 5I1EH 1PSKL 4XWOC 4U1SA 5DRNB 3LPWA 1Z0MA 3QQ4A 2A6DB 4YH6A 3F12B 5I1GL 3O4LE 5KTEL 2FZ3A 1FGNH 4EVNA 4R26H 4ZPTA 1KPVB 4GMTL 5DO2C 2NY6C 2DDQH 5CINL 5HDQL 4AQOA 3ARUA 2FLBT 4LKCB 4NM8L 3RPKA 2X4RA 3QB7C 3L3HA 3MOAH 1OTSC 1PG7W 1M7XA 1FP5A 1UKSA 4L8DB 1I1AD 3Q6GL 1R5VB 3SKMA 3RUGA 1Q9WA 2E9IA 3GSWB 1RY7B 2AAVA 1L0QA 3SKNB 4Q6IC 3HC3H 4BSJA 3MJGX 4Z7UE 4HX1B 2ESVA 4LLWB 5C08D 3CVIH 1F58H 2AXFA 1X5IA 3IDYC 3EOTL 1HHIA 2PNDA 4LLDB 4D0BB 1BECA 3DRQB 4YDLB 4MQ7B 1K3IA 5JMOC 32C2B 3C6LC 4K3GA 4Y4FD 4YHMH 1MRCL 1I8MB 4PGCB 5E2UL 4PTTB 1N5AB 5AEAA 3S88L 5HI5C 2VWEC 2BVTA 1XR9A 3U6RB 4GXVL 3PWPA 5HSFA 4P2QE 1AGDA 4PR5B 2V2XA 4XPBL 4QRTB 2QEJA 2L0DA 3EYSH 1G9NC 4WU7A 1F4XH 1Z9SA 4EN3C 1J05B 1MQKL 3TCLA 4FOMA 1P7HL 4E42A 1IAOA 4HHAA 5FDWB 4GW4B 3ZHKA 5FKPA 3H9ZA 2VUOA 1A7NH 4MA8L 3MRJB 1P69B 1U8MA 3LMJL 4YE4H 4RMWA 5BV7C 1DANU 3IU3A 1DLFL 4X7SH 2EDKA 4JDTH 4NNXB 4EDWL 1B0RA 3SJVB 1FZKB 3VD9A 2ZG3A 4HV8B 3QEHA 1WC7A 5L9DL 1MCEA 3RZCD 3HI1B 4PJ8C 4H26A 25C8L 3UJJL 1OWWA 1RU9L 4MGXA 4RFNB 3N1PC 3G5VB 2QL1A 1MLCB 2QQKL 2XTJE 1LGVA 3L7EA 5LXGL 1SMAA 3C2SA 1J12A 1BVZA 1IQDA 4M1GH 4TULH 1PQZA 2VLKA 5EZLB 3WS6C 5E8PA 4BFEA 1YECH 3EDDA 5KVDH 1NCWH 2DQTH 1RZ7H 1JBJA 3TESA 5DC0A 5L2KA 2V6HA 1XF3B 4P23B 1A1MB 5C86A 3WLWD 1FAKT 3H3KA 3VXME 2V7NA 1KLFA 1QSZA 3BRGC 1QZ1A 3GMMA 4BKLB 3HZMA 5TE6H 4NHCH 2XFXB 1P2CA 4Q97A 2X70A 2ZPKL 3D2UD 3T1FA 3IAQA 5K9JL 3VFUB 4GH7B 1FORH 3FO1B 2F15A 1A22B 5IW1A 5C0CE 1TTFA 3Q1SH 2GJZB 5IB3A 4O2CA 2ZJSH 1Z0NA 2BVQA 3TYFB 2R2BB 4LRIC 5EZIH 4RFOH 3RX7A 1RUQL 1IM9D 1IGMH 1MFAH 5F8RC 5IESH 4XBPB 4Z7OF 2VLJB 5B39G 2P4AB 8CGTA 5IB5A 4Y5XC 1ZE3C 1RK0A 3VCLA 3X11B 2A74B 1YPZB 9CGTA 2NY3C 1I3RB 1PEWA 3BWAB 4PRIA 3VXRA 1EEYB 2D7QA 5ENWA 3IXTA 4GLRI 1AO7E 1FFNB 5D1XD 1SJHB 4QGTA 2XXMB 2MKLC 4G6AD 5JOFA 2XYCA 4AG4H 1RV6X 2JJWA 3U36B 5BRZA 5EUOF 1RFDH 1R24A 3QUZA 1WGOA 1OD7A 1DBBH 4GAYB 4K9EC 3O2DA 1HHHA 4PGJA 1TZGL 2VL5B 5CBEA 3S8WA 1FFQA 4FFVC 1U2CA 4P5MA 5F6HJ 1N7MH 4PJDB 2R0ZL 4OLWH 2X9XA 2AABL 4I3RL 2CQVA 4GAJL 3U4BL 4WNQB 4OUUB 5DHYA 3FJTA 1BX2B 2Q7YA 4XI5C 4F57H 3DUSB 4ORZC 1B4JH 1C16B 4ZO7A 3RWEA 5GS1A 2FEEL 4DFHA 4UILL 3DV4B 4C54A 4NKIH 1DQLL 1U91B 2XKUA 5F7FA 4PJ7E 1U3YA 3NH7H 3NN8A 4ONOA 3RAJH 2W38A 4M6MH 2CRZA 3H0TA 4JRWA 4CDGC 5HYSG 2GT9B 3DMMC 3RY6A 3BGMA 4ODSL 5JPNB 4LSTL 2ARJQ 1DN0A 1ITCA 4RDQF 5KSUB 4PTUA 2EIBA 3KPSD 4XNMB 4Q9QH 4PJXA 3S35L 3LRHA 3RGVC 2V2WB 2GAZB 3MUZ1 3QULB 1C5BH 5C2BL 1FVCA 1Q9OB 5F93C 2Y7QA 3MRQB 4JJHA 2EZ0D 5A2JH 4FQ2L 1EZVY 3SQOL 3HE6C 1WITA 4JEGB 4HIIA 4HKBB 1MWAH 5DQJA 2B4CC 4DAGH 3LCYA 4JB9L 1XGUB 3WL9B 2HMID 3N85H 2JCCA 3EIFA 5EORL 1HQRB 1TNNA 3HUJB 2FL5A 2OR9H 4O00A 4PUBH 1AGCB 4XTRD 4NN7C 5CBAB 3K3QA 5I76B 1F6FB 2FX9H 5C92A 2ITCA 4LVOC 5HYSB 2DLHA 3CZFB 2IADA 2EE9A 2YXFA 3O3AA 3RKDD 1ZLWK 1LDPL 1BM3H 4M93B 2HLAB 4I2XB 4F9LC 1N6QL 5DJAA 4HWEL 3PGDB 4LSVH 4MDIA 4NGHH 3O8XA 1QFWM 3E6FA 5MEOA 3D39B 2IFFL 3QO1B 3BP4B 2NY4B 3GK8H 4PG2C 5SWZA 1EFQA 1JGUH 1V8HA 3OR6A 4N8VB 1NQBA 4ZFZA 2OK0H 4IIQB 1IAIM 1IBGH 1X5ZA 1K4CA 3UPRB 4UBDC 1R5IA 2GSGA 1T6WA 1UWXK 3MRMB 5I1LB 4X6FB 1F6AA 5JQ6H 1Z9MA 1IE5A 1T4KA 3MRFA 3LZFL 3AY4A 3QCTL 4F7TB 5ISZE 1P5VA 4NZDA 3QDHA 1DBAH 1Q72L 3DGGB 4ODTH 4KTEL 4OD2A 5B38G 2XWBA 4FQ1L 4TVPH 3I50L 1WZLA 3DX6A 3ORJA 2JB6B 3ZKSD 2HT3D 2FX8H 3BDXA 4Y19E 3OB8A 2ED7A 2UYLB 1KG0B 1RURH 2DBLL 3OKLB 1KJ2B 1S7RB 2Z92A 3HAEA 1BZ9A 3EYUH 1I8IA 3MLXH 1SYVA 4YAQB 2ITDA 3F7VB 1LO5B 4JPWL 2C1PA 1BGXH 2VLRE 3UC0L 3MV9E 1VPOL 2Y25A 4JAMA 4WTZA 5CMAB 3FO2B 4OLUH 4OCSH 2AJSH 1GGUA 1N4XL 2VLMD 3GM0A 2A1WH 3KPRA 3O6FB 1FPTH 1T1ZA 1YMMA 4UT7L 3F8UB 3SE3C 4LHUB 4LDEB 2XWJB 5DFVD 4XXCA 1RHHB 2E27L 1NCAL 5J6HA 4G6FB 3ARBA 4HUXA 4WFFE 1LK3H 4P59H 4KKBD 1ZLVH 4F37K 5CD5D 4PJ5E 4D9RE 1KFAH 5JUEL 1PG7H 4JZNA 2W0KA 5ICXB 1GGTA 3DSFL 2QSCH 4HKXB 4D94A 5IG7A 2XIDA 4RSVA 5J13C 4WVRA 2VE6A 5B38B 3JBG7 4QXUH 1CXLA 4HIHB 3ULVL 2QHRH 5J4MA 5EU7E 2LU7A 5IVXB 5D6CB 2J6EL 3HCVA 4P5KA 4WFHD 4OLZL 2OSLA 3SJVD 4TPRH 3H9SB 4M5ZH 3WIHH 4MXWH 5HI3C 4BQCA 4RMSA 1PFCA 1QFOA 1U8LB 1JHLH 2DICA 5KVMC 4HPOH 1NLDL 5F3HB 1KXTB 2BXYA 2OCFD 1ZGLP 1GOHA 4XMPL 2XQYG 3BMVA 1BP3B 4YGVB 4HWZA 2R4SL 4NN6C 5DC4B 1T89C 3IT8D 4LCIL 3VI3F 4M1DH 1NGPL 4JFHE 5J89A 2UZIH 1KN2L 1P4BL 3FN0L 5J6GA 3LKNB 3HA0A 2R4RL 4YFLF 4PY7B 4P23D 4HH9B 3LPFA 3RL1A 3BI9X 4OIAA 1CD1B 4Z5RB 3DECA 1BFOA 3S36X 1L0XA 4WO4B 1F97A 3EYQD 2R0KL 5D2NA 4DKAA 3U9UB 4KRNA 5GHWL 3VFOB 2HKHH 4O51B 4Y5VC 4ELKA 3RWJA 1KEGL 4NZRL 3KR3H 3LD8C 4B50A 2AJUL 2GK2A 4Z7WA 2CR3A 4LF3A 4OZIB 3H7BA 3NIGE 3QI9A 1SBSL 4L8SA 2ADGB 1J0IA 1FQ9C 2VLJD 3TVMC 1HSBA 1NFDA 5D6DC 4TSAH 2I07B 5D2LB 2GY5A 1I7UB 4YIQA 1N59A 5ADPH 5KN5B 5FECB 1LO4L 3KDMB 4KKCC 3WJJA 1TITA 4HWNA 4L29B 3IKKA 1MFBH 3HE7C 1S5IH 3KHOA 4PRAB 3KPOB 4XXDA 1QSFE 4LRNL 4B53A 3GMLA 3C5SA 2FO1A 1SY6H 1G1YA 1GZPA 3ULUF 3V4VH 3ZYOA 1A7QH 5EOCJ 4N9GB 2IAMC 4M5YL 5FO9B 3P4LA 4O4YL 5FUZL 2F5BL 5I15L 2Z4QB 4TYUA 2Z91B 1Q9LA 3ROOB 2BFVH 4OGXH 4Z7VE 5E2TH 4YHLH 3C60A 4GXUM 1XGPA 4QTIH 3TO4C 5JDSB 4OI8A 1NGWB 3FOLB 3H7LA 2C9AA 1CICB 4HCRL 1UJTA 4GG6B 2VXVL 2LFGA 2VLLB 1EPFA 3VFTB 4UUJB 5I75B 2LE9A 5IF0A 4KMLB 3O2VH 2ICWB 1CGVA 1MF2H 1ZLUK 2HH0H 3KPPB 1KCVH 3GSVB 2I60L 2YEZA 4Z95L 5E8NA 1NBZB 5B3NA 4PREB 2EYSA 5IIEA 4FFWD 4M3KB 1OP3H 2YD1A 5IMMA 1QP1A 4HUWB 2OX5A 1CGTA 3UTSB 4OD1H 2DWEB 3RIFK 3RWCA 3DTXB 3RY5A 4U33A 3W5MA 2A77L 3BN9D 4BK5A 5DGQA 2X09A 2NY0C 4F58L 3PABB 1YY8A 2EE6A 2AI0H 4H0GA 4PJIF 3NBNA 2BHUA 3ULUC 3GI8L 1JFQL 3L9RB 3MRDA 1INQA 4L9DA 4PB0H 3KS0J 3D0LA 1J88A 2VSCA 2JJUA 1ACYH 5IFHH 4F3FB 4BFGA 1JCKA 2EIDA 1ZVSA 3L3IB 3U7WL 1WFUA 4GG8B 4MCZA 1OLLA 2BX5A 3L5WA 3RZCA 2YWZA 3MRGA 1G0DA 2PO6C 3BXNA 5I17A 5JW4M 1KIQB 1U8HA 5AZEH 2NY2C 2ERJC 4KKAC 5JW4Q 1M7DB 4I77L 3H9YA 4AEHH 2W65A 4DGVH 4ZMAT 1WZ1H 5E2WL 3NAAL 3JTSA 2XA8H 4PJEA 4PRBB 1MWAA 3PNWB 1T03H 4NC0B 2HT2C 3QT2A 5C0GA 1P9MC 3MBEC 3PWLB 1IKNA 2J3SA 1CFSB 5IQ9A 3D39D 5F7DA 3L7FB 5F72S 4A6YH 3BP6A 3W2DL 4KQ3L 1INEL 2NY4D 1CF8L 5I0ZA 3U4AA 1IGYB 4CAGA 1V7NH 2WWKT 2PW1A 1S7VA 2UWEF 3Q3GB 1OAZL 3PWUB 2GUOA 5DEGA 3VXMB 5FIEA 3C2AH 2B1HL 3X17A 4YDKH 3B5TA 1BWWA 3N9GL 3G5YA 2J8HA 3U0PB 2H6PB 5IJVB 5FYLD 3QIWC 3NTCH 5C0CB 1A6WH 4PJAB 3NMEA 5IVZB 5H37H 1KT2B 5FA3A 1IM9A 2JELL 1FNEA 3CSYB 4M7LL 4MJ4A 4N5EC 3F6LA 4I48A 1VACA 4LSPL 2A0LD 1TJIH 1SYSA 1M71B 2PXYC 5DMJB 2PYEE 3HFML 2I5YL 2OL3L 3GUTA 1QOKA 2DTSA 5HVHB 5GRUL 1AO7B 3IKCB 5JO5A 5GSVB 1LD9B 5DURD 2CIIA 3O6FD 4C83A 3SO3C 1D5IH 3ARFB 1ZT4A 4XZUB 5DMIH 2VXUH 4Y16B 1L7IL 4ZYKA 5TE4L 1RUMH 2F19H 3ULSA 4GKSA 3WIIL 3GSQB 1IEAB 2NY7H 4KTYA 5DA4A 3JWOH 2ADIB 3KPQB 4JM2C 1L0YA 1NCTA 4YEFA 4U6XA 5D1QA 3MLTA 4NQEE 2IBBA 4APQC 2OXHA 1GGIH 1CGSL 3FONB 5AD0A 1HZHH 1YEJH 4P46B 1FZJA 2B8OT 4JHWL 2NZIA 1ZT1A 3JWDC 4FTVB 3RNQA 5I1DA 4O02H 4H5SB 1TFHA 3TH2T 1U93B 2Q8BH 4PJ7B 4UDTA 4I3GA 4OD3L 5C7XL 1Q0YH 4WEMB 1KCRL 1KB5B 4XCNB 1QSVA 1AH1A 3OPZL 3TBWA 3H9SD 5C0JA 1GC1L 4HS3B 2DF3A 3U7AA 1CR9L 3CFBA 1BQSA 1P4IH 2HVJB 3GFUA 3M07A 3QDJE 1MOEA 3BE1L 3C09B 2OBGA 2ZSWA 1U36A 4FZ8H 4ETQA 4ONHB 5DRXB 5AZ2L 1IGJB 3B9EA 1IC5L 5FV1L 1IQWH 1YEEL 4YHKH 4BUHA 4U0RC 2ZSVA 5EBMB 3T65B 5C70A 3MNZA 5BVPL 3QHFH 3PWJB 4ZOEA 5FYKL 2PTTB 3BDBA 4QRSA 2BCKB 3QEUB 2AV1A 1U8KB 3WIHA 5I71C 2C3VA 5K59E 3V52H 4WO4D 1ZGLM 3E2HC 4YHOL 1ZSDB 3WV0A 4R8WH 5C0NC 1FCGA 4XBGB 2BVPB 1MJUH 3MPCA 5TH2B 3WKNA 4HUMB 2HTKD 3JUYA 4NQSB 3PL6C 1X6NA 2YBRB 1MH5B 5IV2A 2VIRB 2B1AL 4KI5E 4U6HA 1CYGA 4NNPH 4DK6A 5AAMA 5B4MC 5LCVH 1GJIA 1RJCA 5INDA 1O5DT 2DLFH 3F58L 4XP4L 1QSEA 4N5UA 5FCSH 3D87B 4WUUA 1WCBA 3K4ZA 3QNZB 3AMKA 3ARGC 1UGNA 3HLAB 3V4UH 4P9HC 2CUMA 1JRHH 2Z8VC 3KPMB 3MOBH 5JR1H 5DRNA 5EUKB 5BZDB 2DL2A 3WE6A 3D85B 3F12A 2DQEL 2HAZA 3TBVB 1SJVA 4OM1H 2XPGB 1ZLSL 1KELL 4UT6L 4AENB 1KPVA 3ZKMC 1KIRA 2DN7A 3RKPA 1MCDA 3V9FA 5D7LE 4F7PB 2D03L 5I16B 4LKCA 1A3RL 5INCB 1P7QD 2VSDA 4WHTB 1CI5A 1I7ZB 1A7OH 1D9KB 4L8DA 5ISZB 4BFBD 1R5VA 2ICEA 2XQBH 2VXSL 3GSWA 2GTZB 3KLHC 4Q9CA 4LVEA 3VH8B 2VMFA 5HPOA 2AK4A 2F8VA 1DBKH 1CICD 5KW9H 2CPCA 4HX1A 3DV6B 2IALB 3MLVL 4LLWA 1DQML 4QHKJ 2FD6L 1CLYH 4G8IB 1DBJH 4D0BA 2D7TL 2VZVA 3OAYH 4XVSH 3DRQA 4NFDA 4MQ7A 5JW3H 2MPAL 2OM5A 3MV9B 4PGCA 4P4KB 2DQHL 4OQTL 1RQ5A 5T3XL 5C07A 5M94B 4DZBA 1WWBX 1N5AA 2Z8SA 3OKEB 4LCCA 4TUKL 1JWSB 1SY6A 3G6JF 5AG9A 3BT2L 3U6RA 2J8UE 3HB3C 4ODHL 4IRJA 2R8SH 3AROA 3UTSD 3FRUB 4PR5A 4QRTA 5D96B 3VRLF 1BZ7B 4PJFA 3RVTC 1RIVL 4GJTB 4DGYL 1J05A 4MS8C 3OKMB 1XCQB 3RY4A 5FDWA 3RVUC 1E28A 2FHFA 4GW4A 3K2MC 2Q7NA 3Q6FB 1PX3A 4PJ5B 4X9BA 1AQDA 1D5XB 3GHEL 3NIDF 5DJXB 5JOPE 3MRJA 1B90A 3O81A 3RHWF 4JVWA 4F7EB 2K9UA 3M45A 2FECL 3MMEB 5ILTL 1J86A 1UACH 4NNXA 2XZQL 5CHNB 3SJVA 2F5AH 4HUVA 4HV8A 4JFZH 4QXGL 4AEIH 1IM3B 2NYYC 4XPTH 2QV2A 1T7ZA 5EO1B 4JO1L 5JZ7D 8FABB 1Q9KB 4F8TA 5JHDD 4JFDB 4XP6L 3BZFB 1H3VA 3VE0A 1MLCA 4EI6B 4CNIA 5GGUA 4X5WA 4D3CL 2ZCHL 4M6NL 1FZMB 4QWWC 3WNLA 5IBLC 4OLEA 5EZLA 5A16B 5JNYB 4EUPB 4LLVB 4P49A 5EDXA 3WO3B 1G9NL 5EU3B 1YEFL 2VDNL 3V5DA 3KVQA 4P23A 1A1MA 1IT9H 5BMFH 5DJ0B 5F7NC 3WN5C 1XF5A 3MNVB 2PCPB 5DEZA 1IGFL 2XFXA 3CVHL 2I9LB 1CBVL 3T1WA 2MWCA 3LAFA 3VXMD 3WXVH 1M7IB 1RVFL 4RMRA 3IS1X 5DS8B 3UJIH 3VFUA 4LFHD 2AEWA 3EHBD 4GOSA 3FO1A 4WU5B 1U8PA 3MOQA 5BV7L 3DI3B 3EDKA 1N6UA 5L8LB 2NR6D 3G08B 3LRSA 3TYFA 3GI9H 4CDHA 5C0CD 3V6OE 3IDNB 2EDLA 4CMHC 5ITBH 3T2NH 4X80H 1R3HB 1TMCB 5DQDH 2HFTA 4XBPA 4E41E 4Z6AT 2VLJA 3IJSA 1I9EA 4A6YA 1YPZA 3BWAA 1V7ML 3E8UL 1FNLA 4H0IA 1EEYA 2ZWLT 3MRLB 1LMKA 4OB5H 1RZFH 1SJHA 3UTZB 2AJXL 4YBQC 4D9LL 4LAJH 1AO7D 4N0YH 5ANME 1K85A 1XGTB 1CLOH 2EDQA 4R4BB 3CDYA 5DI8B 5ADOH 3ARFD 2HLFC 1U3HC 4MYWB 1GPOL 2APWA 1UH4A 1M1SA 2VL5A 4Y16D 1T22B 5CILL 4PJDA 1MNUL 2EDDA 2XRAH 1F90H 4TNVF 1CN4A 4WNQA 3ILQD 3EOYG 5E4EC 3ET9F 2H32B 1BX2A 1YYML 2EH7L 4LU5H 3D6GA 3B9KC 2W9EH 3F6IA 3EKCA 3IFPB 4Z7VB 2MHAB 1UB6A 4P46D 1HSAB 4WY7L 5MENB 4FTVD 4G43B 3OGCB 1CFNA 1I85C 3ZHDA 3NABL 3EFDL 2GT9A 2PR4L 4K7PX 1F4YL 3CH8A 2Y5TB 5ITFB 5JPNA 4HXBL 1JZ6A 5HGHB 5KSUA 4RWYH 4XNMA 4HS8L 1VFBB 2A9ML 1ZS8B 4IMKC 3CAFA 1HNGA 2V2WA 1PKQE 3BAEL 1YQ2A 3QULA 5EWIL 1PYWB 3HG1D 3TA3C 3S97C 4K9EL 3MRQA 4UNTA 4GRMB 2R0LL 2IQ9L 5IFJB 4EI5B 4QY8B 3AB0B 3RQ3A 4HKBA 2DTMH 4X4ZA 3UJTH 4ZUVB 3QDMA 3CMGA 3ZKXC 1TCRB 3CH1B 3W0WE 3WFHB 2WIIB 1I3VA 1G9MH 1M4KA 1HQRA 3HUJA 1OAUH 3CSBA 1U58A 3P4MB 4Q9RL 4TQEH 1YUHB 1AGCA 3TPUB 5CGMA 2IJ0C 2SEBB 3ZZ1A 1WICA 1LHZA 4LCUB 5HD8C 4KK6C 4GS7C 2R2EB 2V17H 1T5WB 3O41B 5DJYA 2BRRL 4XNXH 4LSUH 3CZFA 5DZNA 3RDTC 3QBTB 1H5BA 4HJ0D 4RGOL 5IM7A 4HK3J 3LB6D 4KV5F 4NN5C 4QKXB 4LARH 2HLAA 4I2XA 3J8F7 1CDHA 4AT6B 1UVQB 3V5KB 2WUBH 2DD8H 3F7QA 2FYYB 3K74B 4YC2B 1CE6B 3TN0D 3QO1A 3BP4A 4Q0XL 5C0BE 4U6YB 4DN4L 4LAQH 4N8VA 2DB8A 3B2UD 2B4CL 4IIQA 2A6JA 3D85D 3RBSA 4JVUA 3UPRA 5I1LA 3RU8H 2C4XA 3ARXA 3KXFE 2Y5EA 1G7IB 5CJXA 5J7CC 4X5LA 1GL4B 2A6IB 1HCVA 2B5IC 2NW2B 4X4XB 1QKZH 3S98A 2X2YA 4NUGH 4S11A 5FHAL 2CLRB 1EHLH 1MCBA 2JB6A 3HZKB 2HN7B 3NFSL 1D9KD 5ISZD 1TETL 3VDAA 1XR8B 4HG4J 5F9OH 1K2DA 3O6KL 1YEHH 2UYLA 3OKLA 5D93B 1EXUB 3OKYA 5ALBL 3STZA 2DQGH 5FF6A 4OIIL 4YAQA 3KLAB 3F7VA 1FE8H 1LO5A 2V5TA 2LVEA 4Y4HB 4M7KH 1M6OB 12E8L 4QOKA 3MV9D 1F45A 4MNQB 4ZUTB 4P4KD 2PYEB 1KB5H 3AS3A 3C8HA 4JG0L 1AXIB 3I2CH 1WIUA 2W07A 3NGBC 1NMCB 4LHUA 4MXVF 3HNSL 3ARYA 3IDJB 4GRWB 4ISVB 1RHHA 3AS0A 3T08A 4ODVL 5C9JB 3DI2B 3MZTA 3QUYB 1NGXB 2CDGA 1JYWA 2D0FA 3THMH 4ZNEE 5HYFA 4AEEA 5ICXA 5I9QC 2HA1A 4H1LG 4WFFD 4HKXA 3ZE1E 5L2JA 3BWUC 2XT1B 2F58H 1W8OA 1YNKH 2DLGA 3GJFH 4PJ5D 4P99A 2BNRE 3FB7B 5CKAA 1T20B 2OQJB 3QPXH 4G8EB 5AYQA 4KPHH 3K1DA 4NQEB 4XMKH 4YDJB 3L5JA 2Y06H 5IVXA 5D6CA 2AEPH 5HDLA 1RZ8B 3DSNA 4HIEB 5EU6A 3PIQB 3K2UL 2NZ9C 4CVUA 3VGGA