4HLZH

Crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPWTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a classical broadly neutralizing stem antibody in complex with a pandemic h2 influenza virus hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
total genus 46
structure length 211
sequence length 211
chains with identical sequence J, L
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH01
5IMMA 3L3DB 4OZIE 2VTFA 2VABB 4J3UA 5DURB 3RWFB 5MI0B 1S7TA 5F3BA 2YR3A 4HPYL 1VACA 1FFNA 4I5BB 4Y8DC 2XFXA 5LWYL 1BFVH 3X14A 4WCYH 4PJGB 1EHNA 3TWCH 3LKNB 3ZTJH 1ZK9A 4FQPA 4LHUB 4F9LC 3BWUC 1Q0YH 2DTML 2JLLA 1KJ2H 1IAIM 5ESVA 4IOFC 3VRLE 2UZIH 4QHUA 1H8SA 4P5TD 4OTXH 1B88A 2Z35A 3WHE0 2MJWA 4YE4L 3RU8L 3V7MA 3SCMB 3E1F1 3BQUA 3ALXA 1KIRB 1EGJH 3P4LA 2VL4A 4O2EB 4GKNA 1JYNA 4NNPL 5FYLL 5A2JH 3PWLA 2OSLB 3DUSB 1UB6A 3BP5B 1F4AA 2BRRH 3GHEH 3LQAC 2CH8A 4XXDA 1JFQH 2R29H 4XPGH 3GMPA 3FT4B 4OFYA 1DE4A 4RMRA 5BOPA 1QRND 4MD4B 2X4OB 1ZGLM 2PW2A 5FYJE 3AROA 5KJRL 4FFWD 5FUZH 2VDOH 4P5TC 4UUJA 1FAIL 1FJ1B 1HN1A 4DTGL 3BPCA 1EFXD 3NCCB 5EWIL 4R2GB 1JRHI 3WDJA 3QJHB 4UMGA 1RZGA 4JO3H 3NFPB 5JR1H 2F5BH 1MRCH 3DX8B 5EU5A 1N59B 1RZJH 3GSXB 5HYJB 4F15B 4OAWB 3G9AB 4Y4HA 3UCRA 4NGHH 1YQVH 4KROD 1OW0C 5J3HD 5BZDB 4HKZA 4N90D 3WLBB 5DJ6B 2VERN 2Z8RA 3DXAB 5I16B 3QQ9C 3GUTA 4GJTB 2ED8A 1I8KA 3TJEL 4D0CA 5FHAH 4KAQL 3O2DL 3DSFL 4I0CC 5D6DA 1CBVH 3VXSD 1J0KA 2JJTC 1KUMA 4NJ9L 4O00A 4OZIB 3LKRA 2KKQA 4ZUWA 3FB6A 3DYPA 3EHBC 4NBZB 3KJ4C 1S7UA 2A9NL 4NKDB 4JN2A 4P4RA 2W9DL 1HXYB 1UADC 5ETUA 4G8FB 4HJGB 1TETL 4JM4L 2UY6A 5A3ID 4QRUA 1IGIH 1NCAL 4X6FA 4ERSL 5CCKH 1Y6NR 1CFSA 2VDML 4NCC1 3DI3B 3MRNB 4KKCC 4P2RE 5BJTA 4OZIA 2A83B 5IBUB 4GMSL 4IS6A 4ZFOB 4M7ZB 3VDCA 4X7SH 3DMMD 1KPVB 1FZOA 2EDJA 3L3GB 4LASH 3ARGA 3RDTB 2RCSL 4MAUL 3TZVC 4NNPH 3S36L 1RUMH 2C1PB 5IFAH 4DKDC 2FZ3B 5F1SA 5IESH 5JW4Q 4TQEL 4P2RA 4TUJB 4LLAA 3MZGB 4NQXB 4DKAA 4LVNC 4ZUTB 1QSEA 3VI3F 4S2SB 4XZUA 3HE7C 1A6PA 4CADA 4Z7WE 2EYRA 2D7QA 5EOCJ 4H25A 1VA9A 3FFCA 1MCOL 1HQ4B 1Q1JL 3CSBA 1K6QH 1BF2A 5KSAA 4FNLL 1U91B 4X4XA 4PRBA 4AENA 5I2IB 2FR4A 2XZQL 3JZ7A 4H88L 3E0GA 1PG7X 4FFZH 3QIBC 4O9HH 1T5XA 1TTUA 3PP3K 4NQEA 3CLEH 2DBLH 2X1XR 3C8KA 4XGZA 3C6LD 2FSEB 3OKKB 5DVNA 4IDJH 3ARDC 2X4NB 1KC5L 4JQXA 2R39A 4Z0BL 4NQVA 4EQ3A 3CCHA 3EOTH 5AD0B 3TZVB 1E6OL 4QGYA 1FFPB 4G9FE 3EO0B 3GMRA 4WUKH 4E42A 4H1LH 1R3HA 1TQCC 1NQBA 3TH3T 1D6EB 1YEIH 1PZUB 5JOEA 3CFKB 4ODTL 5CEZL 1BZ7A 5D93C 4UDUA 5EZIH 5IJKA 3K4ZA 3PXHA 2CLRA 2VDQL 1ADQH 5I17B 5E9DD 3TN0C 1BREA 1F90H 4DGVL 3BZ4B 5E4EC 3RHWK 1T0PB 2EICA 3JTSA 4K94C 4H0HB 3BOVA 4Z7UB 4CMHB 2XY2A 4Y4FD 3DRTB 1VPOL 3TESA 3WUWA 2VITA 4MS8D 3HFML 3EOBA 5I71B 2VXQH 1BZQK 3OX8A 3CXHK 3OKDA 3OR6A 2GJ6A 1YYLL 4XBGB 5JLZA 4JO4H 3WXWH 2DQGL 1A9BA 3MLYH 4X4YA 4JKMA 2AJUL 3JXAA 4X6CB 4KAQH 1WF5A 1FLRL 1QLRB 4MJIB 1S78D 3RUGA 5IMMB 4P57A 3HE6B 2R69H 3DHJA 5FK9B 1I8LC 4JHBA 2Y07H 2A73B 1H8NA 4X5WA 1H5BA 3GMMB 1LP9A 3CVHH 3IFNL 3KR3L 5GGRA 1N5AA 4QKXB 2C4FU 4X6CA 4V1DE 3W11C 2HP4A 4L4VD 1L6XA 4JZOB 1TVBB 4XVTL 1U2HA 5EA0H 3VXMA 3OX8B 4R8WH 4FQCH 4JQIH 3S37X 5F7YC 5C70A 4JG1L 1CQKA 2BVEA 4WEBH 4JHZA 1AGBB 4ZPVA 4U1IB 4TTDC 3T3MF 4OGAD 1MWAA 5C0DA 5D7IB 3RVTC 4MA3A 1D5ZB 5FIEA 4UIMB 1F6AB 1H3UA 4HQQH 5I30H 1D5XA 5T3ZH 4LRIA 2JB6A 2HT3D 2A9MH 1FNHA 4GMSH 4ESKA 1GGTA 3T8XB 2JJWA 3BKYH 1D6EA 5DWUH 4UV7H 4K8RH 2V5MA 4DK3A 5AG9A 4PRPA 4Q9CA 1OGAE 1IVLA 2QQKL 3QDMD 4IRZL 4OZ4B 2DBLL 4YLQT 1U58A 2VLKD 5TQ0H 4QTIH 4G6ML 1LO4L 2F53D 2VL5A 1GIGL 1CVRA 4KY1L 3BZFB 4K94L 2XN9D 1OB1B 4HKXB 1J0JA 5DYOA 1A7NL 3TBVB 4HBCH 2B5IC 3VWKD 4NQDB 1U58B 4Y8AA 3RWHA 2QLVB 1EIBA 3V4UL 1RZ8A 1HKLL 2WBKA 4N9OB 4JFZL 3HNTL 2XTJB 5IROC 1RZIA 3RRQA 3HR5B 3PHOA 3LHPH 1LO3L 2XKUA 5C0GA 2GI7A 1CFTA 1JHLH 3FTGB 1EUTA 4X4ZA 3TBVA 2VAJA 1TJHL 3RKPA 3GI8L 3M1BA 1TJIH 3RIAF 3KPNA 4IMLA 1J5OL 3DURA 3EYSH 5BO1H 5EPMB 5HY9A 1GGIL 1LK2B 4GRWE 3EO1A 1OY3B 4XVJL 1CL7L 4TVPH 1CXKA 4X6FB 4MDJB 2J5LB 4EI5A 3MYJB 5IW1A 4MA3B 5DFWH 3D9AH 4G8FA 4GG6F 5DZLA 2GSGA 2J8UF 3BP4B 1OTTD 3MBEC 3QEUB 1MFCH 3IDIA 4H0IA 3RDTD 1NAMB 2A77L 4NYLB 3D69B 3T8XA 4G9DB 1UH3A 3W11D 1YDPA 1WC7A 1EERB 2IC2A 4M00A 4D0CB 2HT2D 5A2LH 4OUUA 5D71L 3LPWA 2ZSWA 4Z6AT 3BRDA 1T1WB 1X5FA 1MCSA 3ZE1E 4EUPH 4NO5B 1A7NH 2VDNH 3MOBL 2J8HA 3AM8C 2VLLA 1TPXB 1AGBA 1X5ZA 3DROB 3QZWB 2HN7A 3FCTB 4APQA 5DA4A 1GRWA 3V6FB 1HWGB 1KPUB 2F53A 1KEML 5EIIA 1REIA 1AP2A 4DGYH 4PB9L 1AGCB 2BC4A 3GSOA 3NZHL 5EBWA 1T20B 3Q1SH 1RZGB 4M4PA 2CMRL 2CQVA 5EBLA 1QFPA 4DK6A 4P2OB 4D0BB 4EUPG 3T3PF 1SVCP 2WSKA 3C60A 1MCHA 1MFAL 2GAZA 3VXSE 5HHXH 4QHLB 4J7RA 3BEVB 3G6JA 4XWGH 4YHPB 5I76A 1Q0XL 1E4WL 4MJ6B 1T7XA 3BZ4A 1QBBA 5SX5H 2PTTA 3H8NA 5KJRH 3GIZL 2VZOA 3ZE0E 4QLRA 4XBGA 1YN7A 5JLZB 5CZVH 1CD9B 3SPVB 2LFGA 3FT2A 3BKMH 3O4OC 4ORGA 4KMQA 3VFTB 1NCBH 1RURH 1ETZA 4GBXB 1GL4B 4IDLA 2QKIB 1NEZB 3BW9A 3QEGL 5ADPH 3SDYL 1F8TH 1IAIH 5A16A 5GPRA 1C5BH 3CMGA 3BZEA 1YY8A 3EYVB 4UINL 1MEXL 3QRGL 2X4NA 4GKOA 2XTLA 4IOSD 1KLUA 3U0PA 4KK6C 2FB4L 4EI6A 2NY0C 1QBMH 4R0LC 1YMHA 3VFTA 3SGKC 7FABH 3FQWA 1CGWA 4UT6H 4OIIL 3QXDB 5I1JH 3P9MA 5ELIA 1GZPB 1QSFB 3T3ME 2M1KA 5DJCB 1BZ7B 5F7KC 5J12C 3OL2A 4XNUH 4L9DA 2PO6A 4Y5YB 1T1XB 4MAYD 1X5KA 4JFHD 5JW3L 3HE7D 5EG6C 3TIEB 1V7NL 2XZZA 3A6CL 4O02H 5HGDA 1RFDL 3W9DA 1KN2L 4B41A 4YXKH 4PP2A 4F7TB 4K3HA 3MRCB 1HCFX 3G5VB 1TPXC 1MY5A 2XA8L 4LARL 4S2SA 5GGTL 3A6BL 1WK0A 2B1AH 2NX5D 1YPZA 4QHNA 4Y4KB 5FA3A 4DN3H 5JUEL 3AB0C 4NQEB 1MIMH 3NGBC 5D5MA 1IAOA 3BIKB 1R3IL 1P4LB 3BT2H 4LVEA 4LLYA 4P23C 1T20A 3L3GA 2BC4B 2PO6C 1LO5B 5E2UL 5KN5A 4FFYL 5F88B 1NL0H 3MRHB 3OAYH 1RHHA 4OQTH 4EN3D 2VDQH 5CJ5A 4MHHI 3UTSA 3EO9L 3MRRB 3OXSA 1I75A 3KDMB 5DA0B 1O5DT 4MA8H 1WV7T 4M8VA 1QOKA 3T1WA 1G0DA 2X10A 2BX5A 4NO2A 4Q9QL 2R0ZL 4Q9QH 5AUMB 3QEGH 2AXHA 1YA5A 2GHWB 1R24B 5JHDB 1LE9B 5ABDE 4IJ3B 3TT3L 4UQ2B 2ZSWB 4ONFL 3ZZ1A 3VFNA 3QFDA 2A6JA 2VDPL 5D70H 5GJSL 1ZLUH 1HHKB 2DLEA 4N8PA 1F90L 5B39G 3LMJL 4DGVH 3V52H 3D3VB 4LSVL 4RX4A 4QYOB 3QULB 2BSTA 4OCXH 2QHRL 5KOVC 3L5XH 1NBVL 4HS8H 5T1KB 2YD2A 1KIQB 1T6VN 2ICWJ 3QFJB 1KENL 4KKLC 1BMGA 4EXPX 3MC0A 5J13C 5CJQH 2R9HC 4YDLC 5B38A 4IOIA 5DHVB 4AQOA 5GS1C 1IGMH 2F9BT 2XN9B 1SYSB 4RDQG 1LK2A 1TFHA 3BPOC 1C5DB 1CU4H 4WI7A 2PXYC 3HAEA 4JZNA 5FYKE 1T21B 5HHOE 1OAUH 3ARGD 3ZDYE 3M1BB 1CR9L 5F96H 2P5EA 4X8JA 4FFWC 4Y2DC 4P2RD 1ZHKA 4M43H 2APWA 4R90L 6FABH 3GSNB 3ZMRA 5KW9L 4GBXD 1FJ1A 2X2YA 2ADGB 1YNKH 1XF3A 5L2KD 1BF8A 2DQHL 5HPOA 1SY6H 5DD0H 1UYWL 4U1HB 4RFNB 3ZT6A 3IDGB 1BM3L 2IH1A 4HF5L 4JHAH 1ZVYA 3SCMD 1KCUL 4X9FA 2E7BA 2V9TA 4RAVA 3G08A 4S1SL 1A8JH 3BGFB 3BZFA 4MQXD 2G2RA 1UENA 5DWUL 4QF1A 2NY6C 3C8HA 1I7ZB 3D2UA 3LEVL 4LCWE 4E0RA 3O8XB 1ZMYA 3UJJH 3OKLA 3JWDC 4M3JA 5D7JD 4F2MA 1A7RH 5HD8C 4FTVB 5CEZE 4YHNA 3X11A 3OMZA 5SWZB 5JIHA 5SX4H 3CAFA 4Z0XA 2VZTA 4GXUM 1DDHB 1DTUA 2R56L 4P3DB 3Q48A 4K2UH 4JM2C 1G7LA 4GW1B 3BX7C 2VLRA 2IANE 3E2HC 3LRSA 1G7QB 4LP4A 5DUPH 2VC2L 3GSWB 1TZGH 5IJVB 1MH5A 3IFOA 3N85L 4J1UA 1I1AA 3FQUA 4P2QB 3V4VH 4DGYL 4M1CC 4HH9A 3QAZC 1DQDL 1CU4L 3RKDD 4E5XA 1DQDH 3RNKB 5DK2A 1XH3B 3CFEB 3F5WA 5D7IE 1UKQA 4YHPA 1Q9KB 4ZUUA 4M03A 1UWXH 3MV8A 4XAWL 1IZKA 4NDMA 2NYYC 3QQ3B 1LDPH 2IMNA 1F6FB 1U8LA 2AXFB 4PR5A 3BQUC 5GRUH 1IC1A 4I4WB 1MPAH 2EKSB 4EBQL 1MAML 3S36X 2NTFB 3L7FB 4LSVH 3LN4B 4K3GA 4JZJA 4PUBL 4LDLB 4XP6H 3H3KA 1TMCB 3IDJA 2AK4E 4FS0A 4AIXA 2ZPKH 1L0XA 4LPYA 3GMMA 4QOKB 5B8CA 3X3FH 3QQ3A 5KVGL 1LNUB 2UWEF 5ADOL 4OLWH 3DROA 3WL9A 1J86A 1OWWA 5F7LB 1TTFA 4L8CA 4JVPA 2HKHH 4LP5A 5JA9A 4QOKA 4Y16D 3MNVB 2BVOA 2N7BA 1LK3H 3JSSA 4UV7L 3ZKMD 1A9BB 3V6OA 1EEYB 4O2FA 3U2SA 4BQ8A 4AEIL 4Z95L 1FL5A 1Q9WA 2Y06L 3GIVA 5F1OB 4M5YL 5I8KH 2VLMD 4OKVA 3KPSE 1Z9SA 2DTMH 1T0MB 5I18L 1X6NA 2NY2C 4BJLA 1HSBA 4PJDB 3UYOD 1R3JA 3DX7B 1JBJA 3SHSA 1MH5B 2EC9U 1KTLB 4P2QA 3SDAB 3SGJC 1KN2H 3O3EA 5FYKD 1UXWA 2FEDD 3OAZH 2BOCB 4P9HC 3TT1L 3MR9B 5EPMA 1PQZA 4LGSB 2VLRB 4XWOC 3VD4A 3C09C 3AREB 5MEPB 4XCNB 1VFMA 3STBA 2H26B 5B21A 4P9HH 2K3TA 3TZVA 1M05A 2OK0L 4HK0A 2YBRA 2VSDA 2Q76A 3KPSA 1RZIB 2UY7A 4C83A 3VWKC 1X6LA 3HPLB 4KJYB 1QEWA 3ZT5A 3AY4A 5H35B 1XF1A 5E5UB 4LVNB 5T1MA 2ADGA 3NPSC 1UZ6E 3O2DA 1T5XB 1FZKB 4FQJL 1I3RB 4HKBB 3C5ZC 4JREC 1YEFL 4N9GA 4HFUL 4HUXB 2XQYG 2AI0H 4PJIE 2Y36H 5DI8A 1LMKA 4O51B 5F1NA 2AXGB 3KHOA 1B0GB 2YOCA 1MRFH 4TULH 3U9PL 2EDQA 3U7WH 3IDGA 1XF2B 1C7TA 2E7CA 1I7UA 3FAXA 3FRUB 1NGWB 4YZFE 3FJTA 1FZKA 5MHSE 4CADB 2XWBA 4EZMA 1PJ9A 4CMMB 4R97B 1SJVA 5B38B 1NAKH 4EKXA 5JMRA 2X41A 5C09D 5IB5A 4JY6B 1ORQB 2OQJB 1M05B 1UXSA 3L5WA 4OZGB 1N6QH 3EYOA 4B5EA 4RRPA 4Q9RH 1RZJC 3ZDZF 5CEZH 4PLJC 1J1OH 5GIRA 4J3TA 1WEJL 1ZLSL 3VDBA 1FFRA 4HEME 5DQ9B 3MRNA 3NIGE 5ALCH 2DTSA 5IFJB 2I07A 2MFNA 1G7MA 1JGEA 4HJ0D 4HHAB 5EO1B 5DJXA 1OP3K 5ALBL 1ZVHA 1KB9K 1BQLL 5D7LE 1U8JA 3CK0H 5GRUL 1UCBH 3RPKA 5DZNA 3GJFK 4LLWB 5MHSD 2HJLA 1FL3B 4I3RH 3HG1E 3MO1B 3NTCL 5GGVH 5TDNB 1T03L 3QG6A 1UVQB 2I9LB 3KPQB 2C1OB 4JO4L 3WXWL 4LLYB 4UINH 4Z78B 1N5AB 4J6RH 3DMMB 1RIHH 2FEEI 3OKOA 1S7SB 3FRPA 1TZIA 4CDHA 1RURL 3FL7A 1IZJA 1PAMA 4P9ML 5MP6H 4Y4HB 4PP2B 3QJFA 4NZUH 4HCRL 1AR1C 3DLQR 5KN5B 5DEGA 1LO5A 4NN5B 5JTWA 3ES6A 4M5YH 4HZAA 5JMOC 3O81A 2NTFA 3NFPA 1FNEA 1II4E 2WWMD 4E41B 3RWCA 1WISA 3HZMA 2YD4A 4Z95H 4NRZA 1XF4A 4HC1L 4JQVA 2WIMA 2E7MA 5HHXL 4QHNB 3ECBA 3MLRH 2PW1B 3SKJL 3QG7H 1INDL 4ZUUB 1A9EB 1YY8B 1CFVH 3EYVA 3L3IB 3SDXE 1ADQA 4IDJL 4CJ0A 2JIXA 3IU3B 2XWJA 4JCLA 2O93L 4ZXBC 2ESVA 2Y5EA 5K9KB 4QT5B 1EHXA 4UIKL 3NFSH 4XXCA 5EOTA 1KIRA 5HYJD 4PGBB 3P4OA 4ZO8A 3MUJA 4PJCF 2XWJB 1DVFB 4MD0A 3VXOB 4LKCB 4W68A 5HGHA 3GBNL 3B5GA 2CRZA 1X4XA 1R5VB 5EC1B 4D8PA 4WTXA 2ZOKB 5L9DH 5D71H 3MSPA 3VMPA 1XF4B 4GAJL 4GW5A 2D03H 2GTZA 5AG8A 2EDBA 2X42A 3SPVA 5IESL 3WLWC 1DQML 1FC1A 3MJ9A 4QOKD 2XFXB 2DJSA 3H2WA 4D3CL 1ZLWK 1I1FA 1KENH 2R1YB 4UBDD 3C5JB 3CZJA 2WUCL 2NXZB 2W1NA 4IBLT 2GK2A 4APQB 3IGAB 4MJ6A 3UAJC 1YEJL 2FGWL 4TVPL 1QPPA 2AV7A 2HLAA 4YHML 4X7TB 5ICZB 1HH9A 2Q7YA 1E4JA 6CGTA 3WFEH 4LLMA 2BY3A 3W5NA 2F8OA 1EO8H 1IQDB 1EO8L 1TJHH 2B20A 1YUHA 3BPLB 5BS0E 4OQTA 1MI5A 5H37G 3U83A 3KLHD 2HN7B 4L4VA 2F8VA 1YEHH 2R0WH 4U6YB 4KV5F 1G9EA 3D0LB 3K8MA 1SYSA 1DLFL 1FNFA 4OGXL 2GSGB 3BP4A 5C3LD 4Q6IC 3RL1A 1X5JA 3WSQH 2C5DC 2CO6B 5D2NE 1XAUA 4XI5D 1CCZA 4FQHA 4OUOA 4U2YA 3QUKB 5HTSA 5JO5B 5CGMA 5EOCL 3MLSL 1EEQA 3QDMA 5T3XE 3MRKA 6FABL 5TFSL 1AO7A 4HFWA 1E4XH 4HMEA 4NRYB 1JWSA 1L7TL 1N2RA 3MUY1 3P30L 3CFJB 3WUZA 4HXBH 3AC0A 5IHZB 3BH9B 3QDMB 4R4FL 1Q9LB 1U42A 1Z9OA 1OGAD 1IC4L 4JFYA 3OG4B 4LIQL 5IV2B 3ZL4H 5EWIH 5KG9A 1WBXA 5IG7B 3O6LL 5DD5H 2X4TB 1FGNH 1IGML 4FTVE 2ZCHL 1NGZA 3RP1A 3VMNA 4JY5H 4XTRC 1J05B 3CH1A 3IDMA 4G6MH 5IGXL 3LQZB 3P4NA 4LNRB 4PG2C 1IEAB 4D9RE 3UJJL 1CIUA 4NN6C 3S7GA 1U93B 4K8RC 4JZJC 1HI6B 1NMAL 5C09B 4WUKL 5CEXA 3QUYA 1UA6L 3GRWH 2H2PC 5IVNA 3TH4T 2Y72A 1TVHA 4R7DA 3HPLA 2PYED 2FJFA 1G7HB 3JWOL 4LLVA 3QO1B 2PCPB 3MLZH 5AWNH 3UYPA 4Z7UF 5K9QI 1LE5B 2GITA 1OAQL 4LLUB 3TO2B 3OAUH 4ZNEA 2MKWA 5C0AA 3OJVC 1MLBB 3TV3L 1OTUD 3SE9H 4R90H 1FCCA 1ZWIB 4PJ8A 4NM8L 3SEPA 3QCVL 1K4CA 1QA9B 5E8EA 3QUYC 5JIPA 2D3VA 3O6KL 5TDPB 3HZYA 3MCKA 3RY5A 2OXGA 4HGKC 2ICWI 3KJ6H 4GSDH 3VU2A 3E6HB 4U6TA 4L3CA 5FYLE 1QSED 1VESA 3PJSB 3RTQD 1NEZA 3BW9B 4TQEH 1BJ1J 4P5MB 5ACLA 4RIRB 2AKRA 3GIVB 3ULSB 2NY4C 5I18H 5GRXG 3NN8B 2KZWA 2P8LA 1VCAA 1B0RB 1D9KB 3SE4A 3S37H 1RUQH 5FDYA 4NKOB 1FLRH 1M1SA 5BMFL 1A9EA 4XBPA 3X12B 4ELKA 2KH2B 2MNUA 3ECBB 4M7LT 1MCNA 3PDOA 3B9DA 2VE6A 3QEQE 3THMH 5TH2A 5I19H 5F9JA 3I6GA 1VGEH 3VA2C 3UC0H 2IGFH 3LN4A 1BIIA 4TRPH 2NX5A 4PJEE 3D18B 1CLOH 1F11B 4KXZH 1NAKL 4PTUA 2H2SD 1WBZA 1CYGA 4LSSL 2R23A 1S5HB 4D2NA 2D0HA 4NDMB 5DMJB 3NIFF 2R1WA 3ARVA 4PFEA 5AYUH 1JZ5A 1L7IH 4NKOA 1FGNL 1NDGA 3UJIH 1NC4B 4PJIB 3ROOA 1NCCH 1UWEL 2DQTL 2ATKA 2H9GA 4JDVA 4W6YB 4HV8A 2BNRE 3BGMB 4KROB 1QSVA 3OAZK 3ZKSD 5C6TL 3P30H 5EZJA 2PYEE 4UU9B 1DANT 4KK9D 5JHDD 1M7DA 1OAYL 3M45A 4QRQB 3KVQA 1K3ZA 1I1RA 5E8NB 2FO1A 3UTOA 1EMTL 4MDJA 3JV6A 2DL2A 5E8PA 4AEEA 3IJHB 2EC9T 5GIRB 3EFDL 2QV2A 3W82A 1I85C 5LQBL 3FN0L 5C86A 3RWIB 2WBJC 4YIQB 1CDJA 3MRLB 5AZEL 2WV3A 2Y25A 4G8GA 4JO1H 3D5OF 4W70A 4IIQC 5IB5B 4AL8L 3MBXH 5C8JA 1CG9B 1TQBB 4OLUL 1QFHA 3WD5L 4XVUD 3RWHB 2Z91A 2ZPKL 1D6VL 5C09A 3FO1A 4V1DA 3RFZC 3DWTA 4X4XB 2DQJH 1AGFA 1L4IA 2A6DB 2AQ2A 2BCKB 4OFKA 4HW6A 3GSUA 3REVB 5F1NB 2AGJL 4GRMB 2Q8BH 1NBQA 3P0VH 4ZTOH 3CNKA 1WZKA 1AD9B 3GM0A 5SX4I 5JQHC 3RTQA 4CVXB 1DQJB 4F57L 2QEJA 3H0TA 2IAMA 4M6NL 3SDCD 3GJFB 2NY3D 2YC1A 2OR7A 4PJ7E 1KYOJ 2Z8VC 1WITA 3PP4L 2GJ6E 5F93C 4HK0B 4FXGB 5FHBL 5TE6H 2MTPA 4YUEH 5EULV 1XF5B 3G6AB 1LEGA 2ITDA 3UDWC 1S7WB 4WFHE 4XPBH 3UTPD 4NRXB 1S9YA 2HMIC 3VA6A 4PJGF 5DO2D 5DR5H 2NR6C 5I16A 3RGVD 1BEYH 1ZT4A 1ZLVK 5KTEL 1MJUH 5C0CD 5JDJA 1R3JB 4GQPH 4KK8C 4GMTH 4HJGA 2BNRB 4BK4A 2IMMA 1HK6A 4U1IA 5HPMB 5I19L 3FONB 4WHTB 8FABA 2BXYA 1G7PA 2WMPA 4Z7WB 3IDYB 4BFIB 3O2VL 5EIVA 1CFVL 2IQAA 2FX9L 3VXTB 1TJGH 3VFGL 2J2ZA 1AGEB 1INQB 5E6IC 5F7EH 5FUZL 3HRPA 4G42B 1XR9A 3RBSA 3PDDA 1FRGH 1PD6A 5DGQA 2O61B 1CF8H 2E6QA 1HINH 3SDDB 4XAKE 5C0BB 4MVBD 3O6FA 4U1KA 4MJ5B 4MX7B 1KJMA 1T2JA 1HH9B 3SJVA 1MJ7L 5JPNA 3MRCA 4O58H 4K07A 1DQQA 1Q38A 3TPKA 3MLPA 3K81A 3MA9H 1OAYH 2A1WL 4JG0H 5BW7C 1DUYB 1FZMA 4C4KO 1QLRA 4KK5C 5E1HB 2XICA 4YXKL 2CGRL 3WO4C 4QO1A 4MAYB 2PYFB 3OXRB 1MHCB 4PY8J 1QHOA 4X6BB 1R3KA 1RHFA 4IRJB 3HLAA 3PABB 4L3EB 3UJTH 4RRPG 4K7PX 3QIWB 4UILH 1CDIA 4Y5XA 1FQ9C 2C7UB 1AD0B 3PL6A 1FSKC 5I1GH 1Q9KA 2E3VA 5JW4M 1NANI 1WT5A 3CUPB 2Z31D 2VR5A 3RNKA 3QQNA 1Q1JH 2Q8AH 1ZGLB 1P4BH 2V5SA 4ONOA 4RMQA 1I1AB 3FQUB 4M7JL 4W4OA 1UB6B 3GM8A 5KSAC 1A7QH 3IJSB 2NY1C 2XA3A 3V6OC 1MIEL 3TVMD 5EU7E 3T0AA 2FHFA 5BS0B 3VFMA 3ZDXF 3KNBB 1MCRA 3DVNB 3EJYC 1S9VB 2P42B 3UX9B 1VACB 4A6YH 1JGUH 2GTWB 3VFOA 4AEFA 3ARDA 4JFQA 4QRPE 2J1KA 4NT6B 3X11B 1LO2L 1DBKH 1T22B 4U1JA 2P24B 5D2NB 1HINL 3OGOE 1FNGA 3A0OA 1N0XH 1ROWA 2YMXH 4JM2A 4XNMA 3VGHA 3CD4A 4AH2A 3MJ9H 2F74A 2FATL 3P11H 2Y7QB 3RWGB 2WP3O 3D85B 3T1FB 2AJXL 3RWCB 4X0KA 3JV4A 1P4IL 2YD5A 4I2XB 5DUBB 1V3MA 2FJGA 4NQSA 4S11A 1QRKA 2O5XH 3QUZC 3FFCB 3FHQA 3BISA 4OCYH 3FO9A 1MJUL 4R7DB 5HI5C 5BMFH 4OBSA 3RGVB 2V6HA 4R26L 2EXWC 2N1KA 4LVHC 5DT1H 4K7PY 4U1NB 4K23H 3LEYH 5I8CB 5DTFA 3ARGB 3LEYL 3UBXG 4OUUB 2B4CL 1RVFL 5D5ME 2XZQH 3QG6B 3E3QC 3PV6A 4M5ZH 3MLUH 2IG2H 4KVCL 3VXTA 5IFHL 2IQAB 2HJLB 1IGFL 4HUMB 3NCYP 5C0CE 4KJQD 5C09E 3KLDA 4XX1G 2VIRB 3JWOH 1MCWM 1RI8A 3SE3C 1JP5A 2QADD 1VGKB 3BJLA 1A3LH 1T1YB 1V7NH 2X1PA 4B50A 1KB5L 1I3VA 3OZ9L 4MYWB 2JCCB 3QFJA 1BD2D 4BUGA 2ADIB 1AXTL 1I9EA 4AEHH 4G8GE 1NCBL 1F2QA 2IBZY 3DRQB 1S9YB 5E7BA 1G1CA 1L9MA 2A38A 3AUVA 2HTKC 3FKUS 4MB4A 3SQOL 5I75B 2K1MA 1DUZB 1KNOA 1XZ0B 4OV6F 4PJ7F 1G1YA 1X5IA 4X83A 4IRJD 1YNLL 5D1ZD 4MJID 1I8KB 5HJ3A 1QFWI 1ZVSB 2ZCKL 25C8H 1JGUL 4JKKA 1KF9B 4F7EA 3AM8A 3IS0X 4XP4L 3N0PB 2BHUA 5TPWL 3B43A 2PYEA 3FRUA 1UQSB 4WU7A 3RU8H 4YGAB 2CDEB 5D4QA 1DN2A 3DHMA 3QUXB 4M9PA 1U3ZA 2A6KA 5IKCA 4J2XA 1WFOA 2X44D 4FQIH 5HHQB 2X4QA 2HTLC 4QTHB 2A6DA 2GUOB 3ZHLA 4U31A 4Z7QE 1Q0YL 3DGGB 1EPFA 3CC5A 1N8ZA 1EMTH 4XP9L 5C3TA 3B8SA 3AFLA 5H35A 3LRGA 5TQ0L 5C8JB 1XEDA 4BSVB 2EE6A 1NCNA 1U6AH 2X5PA 5CSBA 4F7TA 3BRFA 3C5ZA 5KVMC 5J11C 1FYTA 3DV6B 3EGSB 1PKQB 3UPRA 2DLHA 1P9MA 4PJEB 1R0AL 3HTLX 3MLRL 5J8OA 1IL1B 3HUJA 3T1FA 4HWNA 2BVQA 3C6SB 4OD2B 1NFDE 5CP7B 4NIKB 4YK4B 2R2BA 2DD8H 4X7SL 3MLWL 5DDHA 4C4KT 4OF3A 5IVZA 4RSVA 2Y4SA 1P84J 4X7CC 4O2CB 1S7VA 1H8OA 1CL7H 4J12A 4Y1AE 4Q97A 3QDAA 5JW4N 3HC4H 3OB0H 3BP7A 2WM0A 3P4OB 4PJBF 4PRDB 1IC7L 2BJML 5JNYA 4RGNC 1FL5B 1G9NC 5B3JF 2X9XA 4YHLL 1NMCC 4OLUH 4KTEL 3MGOA 4M6ML 2HFGH 4JHWH 3ULUH 2ZUXA 1EEZB 3EYQD 1J7VR 3JVGC 1FH5H 2J3SA 2MPAH 4LCCB 1H5BB 3EO9H 5DR5L 4QNPF 5I76B 4L8CB 5T5FL 1UM4L 4JHAL 4N0UB 3CVIL 4ZPTB 3TO4A 1ITBB 1Z9LA 3EFDH 1AD0A 1LNUA 3KPOB 2XXCB 1RVFH 3GMOA 4FXKB 4Z76A 2VLRD 1UB5A 3DIFB 1G7IB 4YUEL 4L3EA 2VXTL 3D18A 1JGVL 1S9WA 2C4XA 3SY0A 5KSVB 2A2QT 1XGUA 3ARRA 4XNZC 4MQSB 5CHNB 1G7IA 3HZKA 1UB5B 3EOBB 4TYUA 3B9AA 3FRPG 3TVMA 5I73B 1MVUB 5CSZA 5D72L 5E4IA 4XPHH 2KQNA 1KJ3H 5B39A 2CD0A 3LKPB 1IGTA 3DRTA 3ZHKA 2I5YL 5DUPL 4P2OD 2VLLB 5FOJA 3N1QC 3KYKH 3PG2A 4NC2B 5B22A 4EI5C 4YJZL 1JF1B 3DMMA 1VEMA 2A1WH 4MLSA 3TFKD 5ECJE 3GKZA 3EDJA 3FQXB 3UPCA 1DBJL 4I0PC 4L8SB 4V2CB 5JHLL 1VFBA 2QBWA 4WRLA 2A9ML 3EYQC 3OG6B 3WIIH 5IVOA 1YEDA 4RWYH 5DJ0B 5EZLA 1QR1B 4TSCH 4DZ8B 4Z7VB 5SWQA 1FFPA 4FMKA 4P0DA 1QSEE 1X5HA 2F54A 4K8RL 5FKAA 3QHTC 2HRPL 1INDH 2FL5A 3E6HA 3VJ6B 4P9MH 5MP6L 1TJGL 1X5YA 2FBOJ 3MRMB 4NJAL 3DVFA 5IHUH 4HUWB 4YPJA 4Y19E 1MCLA 2H8PA 3B83A 3TNNB 5E7FA 3VXNA 5HY9B 4N1EA 4WFEE 4ELME 3B2UD 2CRYA 1CD0A 2V17H 1A0QL 3DTXB 1KB5B 2YRLA 4PV9B 2DJ4A 5CEZD 2F53E 4ZSOB 3VI4F 2R8SL 3HR5A 2DQIL 3WKMH 4OSUL 3VDAA 5FDWA 1QUNA 3TNMB 1C12A 2NPLX 4CMMA 5LXGL 4XC1H 3V5HB 4MNGA 3RTQB 4CVXA 1KULA 3FB7A 1I1CA 5C0JA 4KTDH 5TQ2H 1DEDA 1KCLA 3H9SA 3H7BB 1AHWB 4ZFOA 5C0JB 3GMQA 5EOCH 3HFMH 5FB8A 1OPGL 4HKJA 3V5HA 3MFFA 2GFBA 3TYGH 1U8QA 4XT1C 2YD8A 3ORJA 4XNQB 1I7TB 4HAFA 4IOIB 5M94B 2ZJSH 4LHUG 1AY1L 1NH6A 3BZDA 2F19L 4JN2B 4ZSOA 2XWTA 2Z93A 4I77H 4Y1AA 3GB7A 4WWKB 3U9PH 4D3CH 3L1OH 5FYLH 5MEOA 5DD1H 5K9JL 3IXTA 4BYHA 1JYXA 4DVRH 3OV6A 1QRNB 4OGAC 5C0EB 4LRNH 4FABL 4WW2B 3JV6B 4YHKH 4FQJH 3MRPB 4OTXL 3MGTA 4JFOB 2MHAB 5BRZD 3QDGE 4F58H 4H20H 3QA3B 4TVSa 5F71A 3BT2L 4D9RD 1KBGL 1P7QD 1M7XA 3TCXA 5FKPB 1SEBB 4G9FA 1J1PH 2IADB 4G8GD 4G8EA 1KCKA 3VWJC 3PV6B 2B1AL 2G60L 2DICA 4JRYD 4KJQC 4Z0BH 3MRGB 3MJ8A 3ARFC 5C0RH 2R2HA 3QIUD 2X4SA 5ICYB 1LEKB 3D39B 3EAKA 4NFDA 1QPXA 3C60C 2R1WB 1QNZL 3C2SA 4HBCL 3RGVA 1AH1A 4XNUL 2A0LD 4GG8B 2DQIH 4NM8H 2P48B 3QG7L 4JFPA 5GGRY 2CIKA 4P2CG 2OK0H 1HYRC 2ED9A 4MJIA 4XPFL 2Y9RT 4WEMB 1L7IL 2EDDA 2KL6A 2BY1A 5HI5D 2BVTA 2FJGB 3LDBC 5K9OA 3P2TA 5DRZA 1KT2A 2B8OT 2QHRH 3OKDB 3OR6B 3U0TB 1A6ZB 2NNAB 4Z76B 3WV0A 1XGRB 4UV4L 4QHKJ 5CAYB 1KLUB 2V7NA 1X5XA 1NSNH 1UC6A 4TSAH 4BZYA 2OTPA 1NC2D 1U8KA 2A77H 4KKBC 3QPQD 3U0WH 2L0DA 2H45A 1MFDH 4P46A 1JGLL 3ZSTA 4ZUSA 5L8JB 3D9AL 3B4NA 5CMAA 4M93C 4QRRE 3B9KB 1X3DA 1FE8H 4KRNA 3MA7B 3RZCB 4YFEA 5HYQA 4OLEA 4P46B 4NSKB 1LEIB 5DJYA 5D7LA 4QOKE 2VLKA 2Q86A 5D96C 1OAUL 4F2MB 3KLSA 4KJPD 3CIQA 4FQCL 3AS3A 1E28B 4P4KC 3WJJA 3PP4H 1R0AH 2OR9H 1UZ8A 2OR9L 3UTQA 4P2OA 3NVQA 3HRZA 5ESAA 5MERA 2BNUA 3QPXL 5T1DL 4RISL 3BD5A 2DYPA 4F8TA 5IP4A 1FFOB 5ITFA 4XNYL 4WJ5A 2LU4A 1G7HA 3O6FD 2OLDA 3REWA 3OPZH 5I8OL 4GRLC 2BSSB 1YEHL 2R0WL 3DX9A 4P5KA 1AJ7L 2J88L 5IBLC 3EOAA 4JCMA 1M6OB 5GRJL 1KELL 1KB9J 3OJMB 3OKOB 1EHLL 1QFWM 3VRJB 1TCRB 3L1OL 4XB8A 1DL7L 4DEPC 4ETQB 5ISZE 1FZOB 3ARSA 5KZCB 2ARJB 1JTPA 2W65A 1UJ3C 3HC4L 4YHMH 1N0LA 5EC2B 3CFBB 2OMNA 1KPRB 4AT6A 1EO5A 1PG7L 3WFCH 4WUUA 3SDDD 3GBLA 1MCIA 1BVKA 4OD3L 1C1EL 4ZOBA 4J4PA 4PPTA 1MRFL 4TULL 3CX5J 2QSTA 1S7WA 3QHFH 1T7VA 1U41A 2C26A 1J8KA 1G9ML 3I75A 5GGSB 1P84K 2ZZUT 5L88L 5DVLA 4C59B 4M1GH 1F6LL 3TT1H 3RQ3A 2Z93B 4UQ2A 3STZB 1AQKH 1TCRA 3SOBL 1B9ZA 5JO5A 1NUNB 4Y5VA 5J6GA 3QR2A 5D7JB 4PJCB 5AUMA 5KAQF 1HYSC 3GJEB 4EXKA 1EJ6A 3QCVH 3ZKNC 3VXPB 2XXMB 4HSQA 4HKZB 3U9UA 4P4KA 4CU6A 1QSZA 5C07A 1U8QB 3VD7A 3MFFB 1B6DA 1O0VA 4L4VB 1DQJA 3GSXA 4WNQA 2X70B 2IPKB 5TE7L 1WFTA 4JVWA 3GSRB 5C0BD 3ZE2E 4BZ1L 3EOYG 1OSPL 2QQLH 2P43B 1DSFH 5EO9A 1PY4A 1XGQA 5GS2D 1IAOB 3BIKA 4U1NA 1CE1L 5HVWA 3TCLB 3BKML 1EDQA 3OWEA 4NNYB 3DGCR 2HFGL 1MCEA 4JHWL 3SDAD 4PRAB 3U6RB 4HGWA 4TNWK 4PRPB 3REWB 2Q86B 4HS8L 3SDCB 5D7LB 4U1LB 1OF2B 2PF6A 2VWEC 5T3ZL 3TF7C 1MJJA 1DEEA 4M6OH 5BQ7A 4XC3L 2AK4A 1S7XA 3BKJL 3Q0HA 32C2A 1N6UA 4NO3A 1A64A 1XGYL 4N1HB 1LILA 4JDZA 2YN3A 4FFYH 5E6IA 3HRZB 4U0RB 1BFTA 5DD5L 3V0WH 3QIBA 4AH2B 2IPTL 5IJKC 3O3EB 3MLWH 2RJMA 2Z35B 2H32A 3IFPB 1YY9C 1KCRL 4I18B 4PJ5B 1B2WH 3DX7A 4I8DA 2Z92A 5ICXB 4R8WL 1P7QB 4U1SA 2CLVA 5EC1A 5D7IA 3P3YA 2VLKB 1S7QB 3EJZD 5A16B 3K4AA 3Q6FA 1A21A 4OCWL 1YEFH 2ICWA 3ARBA 4IRSC 1BJ8A 3DVNA 1MQKL 1L0YA 4GFTB 1A2YA 4PJGA 5K9KA 4HV8B 1VADB 3EW3B 3O6KH 4KZDL 1XGTA 3H3PH 4KC3B 4EN3A 1HCVA 5IR1B 1TXKA 2V7HA 5CILH 3MFGB 2G5BA 1CVSC 2X7LA 5B4MD 1TDQA 3RX8A 3ZTNH 2A73A 2X4UA 3HNSH 3RA7H 5DHYB 4PLKD 5ID1B 1X5GA 3HC0B 1YN6A 4UILL 1FO0H 4U6XA 1T89A 2VKWA 3P0YL 1JGDA 3MJ7A 1U3HC 1E6JL 1U92A 5F21B 5ADPL 1MFCL 2CGRH 2XACC 1G0YR 1ZANH 4E41A 3SE8L 4CJ1A 5ANME 4APQD 4ENED 5KSVA 4JG0L 3LS4H 4HWZB 1TZHA 5KBNC 2GJ6B 1FHGA 5F7FA 1N26A 3PDOB 2GJJA 1FVCA 1V8HA 1XCTB 2ZCKH 4JFPB 1BD2E 2DKMA 1BQUA 4U3CA 1IKFL 1VSCA 4J3WA 4N0UA 5DK3A 3IAGC 5E2WH 4QWWD 3LEVH 2D0GA 2OXHA 1JYVA 2AJ3A 4NO5A 1PEZA 3B9KD 1U3HD 3MBXL 2QHLA 1Y18A 1R6VA 2ZUQB 4FQLH 1NCAH 5I6XC 5BRZE 1LVEA 1T7YA 4UDUB 4YC2C 4PIRF 2E8YA 5HYSA 4O4YL 1T0NB 3QEQD 4XPHL 3TIDB 4FP8H 1G7PB 3QI9C 4LPUA 4FG6D 5INCA 4ONGH 4NUGL 4XMLH 2MHAA 2FO4A 4BA8A 3MYJA 5C92A 4IRSD 3OKLB 3CFDB 4XNYH 1X7QA 5T3ZE 1MCKA 1J0ZA 4NRXA 3DVGB 2R0LH 5C0BE 5TF0A 4A6YA 1A14L 4FQIL 1P1ZA 4AENB 1ZWIA 4CUCA 4IEFB 1MVFA 4YHIA 1UM4H 5D1QD 2YPKA 5F9WB 3I2CL 3CU7A 1RZKH 2RAMA 5DJZA 1DEEB 5BQ7B 1ZEAH 3SO3C 3DV6A 3EDKA 3Q2CA 4OGZA 3SDCA 3V4VL 1ORQA 4HWBH 3TT3H 4M6MH 4MNGB 2UVEA 4F57H 3TA3C 4IMKA 3QDGB 1F2XK 5D1XB 4KUCD 1N8ZB 1UZ6F 3VFPA 3VH8G 1A7BA 1FRGL 1XGQB 4OCXL 1I7UB 2C1PA 2VDRH 3HG1B 1BQHB 1XGYH 3K1KC 1G6RA 4KHXH 1DN0A 1AHWA 1WFUA 3DTXA 4PV9A 5A2FA 1IGIL 4XC3H 4BH8B 1QLFA 2BVYA 2DD8L 2BRRL 3GHEL 2QADB 4LCUB 2QJDA 2ZUTA 5TJWK 3DARA 3OSKA 4Z7OE 4EVNB 4DKFL 3LZFL 1C12B 1NGZB 4RZCA 5BV7L 1PLGH 3N9GL 5IIEA 2ZWLT 2DMBA 2YBRB 5TE4H 5GGSY 1ZVSA 5FGCE 3DSNA 3O41B 3S88L 3NA4A 4EBQH 4XCNA 1LDSA 3CFJA 3GKWL 5DJ0A 5J1SC 2B4CH 1KJ2L 1ZLUK 3VXUA 1IILE 3GHBH 2BSRA 2CDGA 3QH3A 2FEEL 4P99A 1JWMA 2PNDA 3VFNB 1FNLA 1KLGA 2MQ3A 4DN3L 4WCYL 3UMTA 3C5SA 5E8NA 4NO2B 5GZNC 3OTTA 4M7KH 2HTKD 3T09A 4WUUB 2OJEA 2AEWA 4O02L 1SVZA 1T0MA 4OKVB 4NJAH 3TVMB 1FZJB 4OQ1A 1JIBA 1OGTB 2EYSB 2HH0H 4HPOL 1JHTA 2EO9A 4QRRB 2CRIA 2HRPH 5GGQL 5CJBA 5FYKL 3L6FB 1KYOK 4XCEA 5T3XD 1UACH 1GIGH 5DTFB 3T0VA 3U4EA 5C08E 1D6VH 4NCDA 2ZUQC 4XPAH 1MCPH 1YNTB 4H26A 2ERJB 3KPOA 1M6OA 1YEKL 2V5YA 3HPJB 4DOHB 2FJHA 1CXFA 4Z18A 1LO0L 1YN6B 3G5VA 5E08L 4L9LC 2VDMH 3GMPB 1BHGA 1MVUA 4TRPL 4P2YA 4KVNH 2VNCA 1CK0L 2VLJE 2R1YA 4XP1H 3D3VD 3UTZA 43C9B 4XHJD 2A6IB 1YZZA 3Q1SL 5JZ7D 4LLQB 1I8MB 4HBQA 1FO0B 5ESAB 4F9PA 2EKSA 2VLJA 5JNYB 4GAFB 4NJ9H 1BWMA 2Y7QA 3IF1B 1HKFA 4LVOC 1CQYA 1JRHL 4MXVE 4M7LL 5GRJH 1ZV5A 2HT4C 4LSUL 1T6WA 3OHXB 5EBMA 1F13A 4X6EB 4M5ZL 4WO4C 3GMNB 5DK2B 1HOCB 3T2PA 2NXYB 3W0WD 1C08A 2QQQA 3UEZA 4RISH 5EFIB 2R2BB 1IC4H 5JOPE 3BGAA 1HDMA 3CFIC 4LNVA 5DRWB 3BN3B 3CVIH 4ZS6D 5ILTL 5D7IF 5ISZB 3WXVH 1QO3B 2OYPA 4NZJA 5DRWA 4JKPH 2A6IA 1QYGL 3NACL 5HHPA 5I1AA 3JBG7 4Y4FB 1RUML 1D5IL 1C08B 1I4FB 2YZ1A 1SM3H 43CAA 4G6KL 3X13B 3L3JA 3DO7A 1GGUA 3B6SB 2B1HH 4H26B 3IF1A 4GKZB 4NRZB 2DL9A 2J6EL 2PTUA 3EZJB 4M6OL 1JVKA 1ITCA 4Z7WF 3CSYB 4AJ0A 1MLBA 5EBWB 1C5CL 3N1FC 1EHAA 5D1ZB 4ZQKB 5IM7A 1TETH 5CEYB 1FIGL 3V0AC 5M7QA 4XH2B 4BZ2L 4J23A 1CFBA 5E1AA 3BIBX 1OGTA 2DDQL 4GO6B 1SJHB 3O9WC 4F7CB 2EYRB 4OV5B 1CGSH 1BEYL 2LU7A 5JPNB 4QRTB 4Q6IA 4YE4H 4ZFOL 4F7EB 5GRVK 3IDXH 4Z7NF 4U1KB 4UNUA 1ZAGA 4FQXC 4U3HA 1T3FB 1MAMH 2XV6B 3QT2A 1SQ2N 4ALAL 1EFQA 1SY6L 4ZDHB 5DJ2A 5T5NF 3BDYH 1T83C 2P46B 3MRQB 5DJAA 5ACZA 1NLBH 2CDEA 2DQUL 3MODH 1DUZA 5DZOA 4CVWA 5HYFA 3VG9B 1A47A 1E6OH 3HB3C 3IDIB 2DKUA 3QEUA 3ZKXB 5D1QA 2OR8A 3GI9H 1ZT4B 1KTDB 5T3XH 5DHVH 3C08L 4K9EL 4BFEA 3QDJA 3CLEL 2I07B 3D48R 3UTTA 4N1CA 5D1QB 4X6DA 1UWEH 2DQTH 1SBSH 3BWAB 3NCFB 3X3GH 1XIWC 3SKJH 4DKEH 3F7YA 4OCSL 2ATPA 4XP9H 1EVTC 1G84A 1QBML 3VXUB 4ODBD 3NBNA 5DD6B 5DJ2B 1G6RB 3O41A 5D7KD 1SBBA 2IBBA 3F12B 1A7PL 2YPLB 4F8QA 4WTZG 3S5LB 4LPCA 4F7PB 5D1XA 5IIEB 3BN9C 1KEGH 3NCBB 2VIRA 4RMWA 1W0YT 1FC2D 1NGWA 4YHYC 1VGEL 1UJ3B 3PGDA 3MRHA 1X44A 2OL3H 4BSJA 3G6JF 3QUML 1D9KD 4LCYA 5D1ZA 4ZQKA 1CLCA 1EVUA 3JV4B 4MA1B 2W38A 5CIPB 4Y5VC 4JPKH 4OLXH 1QACA 2OTUA 3UZEA 1N6VA 4UAOB 1PW3A 4ERSH 3TP4A 5BO1L 3MRJB 1O7SA 1OM3L 1ZANL 5T1DH 5I1HH 4U1JB 2P5WE 5E56A 2Q76B 1SM3L 4TVPD 4S1RL 4XVUC 5EH1A 3NIGF 5ILTH 1LEIA 5B3NA 5HYQB 4ZAKB 3H9YA 4PGDA 3AREA 5MEPA 4C56D 3UTSD 5DVMA 5CBEA 4MQ7A 5IHBA 5T3ZD 3MXVL 3HNSL 1EZVX 2G5RA 3JWDH 1K85A 1MRCL 4A6YB 5SWSA 4PV8B 1A02N 4D9QE 5CD5D 4NCC2 4BH7B 5JW3H 4OLVL 5L7XH 2A74B 4F58L 2FGZA 3CUPA 1J0IA 1JN6A 1JHKH 5INCB 3V52L 1HNGA 1A6TB 1MAJA 3ARBD 5HGHB 4X5XB 5EZLB 3WHE1 2OI9B 3VW3H 3HMWH 3BAEH 3RZCC 2IEPA 5CFHA 5HYSB 3RVWC 1ZLSH 4KK9C 3E3QE 1YEGH 4GAGL 4XP5L 4OD1L 5FUCE 1JZ7A 4X7FC 4X5LA 2COQA 3T77A 2VISA 1SJEB 3LQAL 4U7KA 1MUJA 4ZD3L 2VZSA 2DKSA 3BKYL 25C8L 2FATH 3D85D 3MJ9L 4U6XB 1MIEH 3FZUC 4HIIA 5I1IL 3L9RA 4EI5D 4XMKH 3S96B 4PTUB 1QP1A 1FIEA 1OPGH 3OR7B 1H3TA 5EBLB 5DFVC 1TJIL 1TZHB 4OFYD 4JY5L 3LDBB 4Y2DA 5E2VL 5D6DC 5F44A 1SEBA 3EOTL 2VE6B 5EU3B 4JLRA 2XT1B 2WLZA 4JRYA 1CS6A 3GI9L 1XIWB 4I9WE 2AJYH 4OKDA 3RPIB 4YX2L 2D7TH 2WP3T 1U3HA 4NO0A 1P4BL 4GRWF 2V2XA 3MRPA 3WKML 4FFZL 3JV0A 1BJMA 3NAAL 4RQQB 1BVLA 2AP2A 1YC8A 5CLTA 1XGTB 5HYEA 2BSRB 2CDGB 4QTIL 2Y07L 2CPCA 5ESQA 4OD3H 1CF8L 4F9LA 1WQVT 4HC1A 4RFEB 3QNXA 2NY3B 3EO0A 2P5WD 1OSZB 4ODXA 3U6RA 4TNVK 3LQAH 2GK0A 3MA9L 3LZFH 4U6VH 2Z8WC 5TDPA 5E8EB 3SGKA 4JFEA 5D7LD 5JXAL 4NO3B 1NFIA 3Q3GB 4C56B 1H15A 4ZUVB 2NY6D 3M8OL 4U1LA 1ORSB 3DO3A 1LK3L 2DOCA 2XY1A 5C0CB 2BNRD 5CZXD 3GSVB 4WFGE 4WUUE 2VO5A 1FN4B 1T66D 3HUJF 3FFCD 3GJFA 3FFDA 1CLYH 3UPAA 2YPVH 4QXTB 3O3BB 4HXBL 3VRLF 2APFA 3QEHB 4G8GB 5DEFA 1QD0A 4KV5E 5BS0D 3HZVB 1J12A 1TZGL 4NQTA 2BDNL 1S7RA 4PRHA 3D3VE 5C08B 3QIUB 4L8BA 3C8DA 2HTLD 2Q6WB 4NC1C 3VXPA 2CIIB 7FABL 1BLNA 2P7TB 5DQJA 5T5FH 5F89A 2FL5B 3VJ6A 1T2QH 4G7YL 5EU6A 4M7LH 5T1KA 1T7ZA 1OSZA 4ODXB 1K8IB 1B0WA 2EC8A 3FB6B 5K59E 5EZJB 3QULA 2VXQL 2V5RA 5JW5B 5ACZB 2ARJA 4OFDA 2FX7L 5IEKB 4FZEL 3U0WL 3N50A 1U8OA 4X99B 1KXTB 4PJ9B 4NQCD 4O5LH 2WIIB 5GRWA 4ZOCA 4FQLL 4G80B 4HS6A 5HVHB 1NKOA 4HJJH 4V1DD 5DJ6A 4HJJL 1T7WA 4RWYL 3O11B 1CFNA 5E2WL 5KSUB 1UKTA 2BSSA 4U6YA 5EC2A 1S5HA 3PQYE 1RHHB 5FECA 1YNKL 1FFOA 4JJHA 5JXEC 3RVWD 4I48A 2AW2A 1QQDA 2HFFA 4PY7A 5IM7B 4TSAL 3QNZB 4PGCB 4FHBD 4HFUH 4MJ2A 3I6GB 2HWZH 2MOVA 5L9DL 5T3XL 3INUL 3MNVA 1E6JH 1NFDB 1YJDH 3RL2B 1NBYB 4WI4A 4MNHB 2AV7B 2HLAB 4WWID 1ZHNA 1WT5C 5I73C 4MMZC 3TJEH 5I9QC 1MUJB 5C1MB 3IJYB 3D87B 4GRWB 4N0CC 3MLUL 2QQNH 4FOMA 4XNZB 1NBVH 2OCFD 4D9QD 4UBDC 4ISVB 1DLHB 4P5MA 1U8MB 2DJUA 1HH6B 3ARBB 3ILPA 1KN4L 1SYVB 4S10A 5E00A 3WLWD 4D8PB 1I8LA 2FDBP 3GMNA 4G9FD 2E9BA 5DD1L 5K9JH 2X4RA 5I1CH 5CGYC 2EE3A 3ILPB 4NSKA 3I9GH 4HH9B 2GIYA 1N4XH 5D1XD 2H32B 1J10A 3IFPA 4I18A 1DBAL 1FAIH 5E5MB 1N6QL 1FO0A 3BVNA 3S9DB 4MQTB 2DYPD 1KT2B 2EKJA 2DQJL 4TSBL 4MQ7B 4BELD 5DK0A 2GITB 3FO0L 1MCQA 5CCKL 2GSIA 2AK4B 4HX1B 4N0FB 4Z9KB 3TBYA 4CN1A 1BBDH 1S7TB 5F3BB 4PJBA 2H6PB 4YHZH 3BHBA 2VABA 4MMXC 4ZS6C 4HLJA 3ZDYF 4NZDA 3EDEA 4HT1H 4L3CB 3WS6A 1ZA6B 2Q1EA 4PJEF 5D1XC 4J6RL 3L3HA 3OKKA 1F3JB 2FSEA 2VXVL 2CKBB 4U3XA 4MA8L 1U8PB 3LHPL 3I84A 4GAJH 3CGTA 2FIRT 2Z31C 3D39A 4CVUA 4QF1B 1UJTA 4KUZL 3VXSB 3U4EB 1HI6A 2GUOA 4YEFA 1RUQL 3I6LE 4RFOH 1MJ8L 3W39B 1UGNA 2IADA 5IB1A 5TGBA 1IRAY 4KDVA 2IH1B 3WEXA 3WMSA 2J8UA 1GHFH 4Z7VE 3L3KA 4ODHL 5EIQA 3U4BH 2ZOLA 4OF5A 1QSEB 1LO4H 3SE3A 2FLRT 1S7SA 4UAOC 4KI5C 3U82B 4D0DB 2IBGA 2UZXB 4RA3A 1C16A 4Y5VB 3OBAA 5J6GB 3ARXA 1P7HL 2UUDH 4F33B 4MA1C 2VC2H 3MBEA 3RWJB 1WTGT 5I74B 1RK1B 4MCZA 4YDIL 3WNNA 3SDYH 3QH3B 2YK1H 1X4YA 1VKXA 1JZ6A 3OQ3B 3KPSD 4N8CH 3P4NB 4CAGA 1Z5LB 3NIDE 5IBTL 2P8MA 4WDIB 4XB7A 5F9OH 5IOPA 4TPRL 3OAUL 1CGTA 4LASL 5I6XB 2VYRE 1CD1A 2VB5A 5JXED 2AV1B 5FV2A 2X4TA 3O9WD 5AWNL 1AI1H 2CLZA 4LOUD 3ETBF 3HI5L 3V6ZA 2AV1A 3W9EA 1CD1B 3BPNC 4QCIB 1DL7H 1S3KL 2KDGA 4KK8D 1PKQE 4L4TE 4A6YL 5EN2A 5IW3A 3RY6A 3GMQB 5C0ND 2IGFL 1KXQE 3SGEI 5DQDH 2NQCA 1MFBH 5CZVL 1RIHL 3P4MB 1A7QL 1HHIB 2WNGA 3HNVL 2VRAA 3GUTB 4XCCL 4BFBD 3MREB 4RGMC 4P59L 5F6IC 3TH2T 4MHHG 1YEEH 3EOAB 2BNQB 2LU3A 3QPXH 4QRRD 2J7LA 3KR3H 3MV11 3MRRA 5DRXA 5I1GL 5D9SA 1E27A 1TLKA 4OZHB 4Q2ZA 5HYJA 1B0GA 3VGAC 3SGEH 1MCOH 3CPLB 5DJZB 1YUHB 2W9EL 4ACPA 2CR6A 1WZMA 2C9AA 2PUQT 3HHRB 4R7NA 1WWAX 1VFOA 4U49A 3VGAB 3V7AE 5D72H 2L7UA 3VXSA 5JHDE 1HHGA 4NKQB 4LQFH 4Z7QF 3CSGA 4AZ8A 4TOYL 4OI9A 4F3FB 1OVZA 2Q7YB 1ES0B 5E8OA 2WQRA 1WCQA 3P40A 2OZ4L 4QHKI 4JY4A 2DQEH 1T66C 1JV5B 4ZMAT 1OHQA 3H9HB 2AGJH 4CW1A 1EAJA 1PG7H 2VDOL 4JFXA 3STLA 5FYJU 4U0RC 3T2OA 3VD3A 1EBAA 2W91A 2WK2A 3TBWB 1CGYA 1RJLB 1XR8B 3IJSA 5EZIL 4KDWA 1JFQL 3BPNB 4HUWA 4TVPE 2BERA 3EYFB 4GRWH 4EDWL 4EEEA 2JIXB 4POYA 3IU4L 1MFDL 5KS9F 4IHOB 3WIHH 2HKFH 1OP3H 1I9IL 4KH2A 5DUML 4NZTH 3X3FL 3ALWA 4IIQA 5ESVB 3C87A 4K3JH 2D03L 3HNTH 2OMBA 4GXVL 4LGPB 4NWTH 3VW3L 1RZKL 2LABA 4MNGE 1DVFA 3ALPA 4UV4H 4XNXH 1WWCA 3FQNB 1GXEA 5C0FA 3FT2B 2R4SH 3BSZL 4G8IB 4HIJA 1J87A 4OZFG 1NEZG 3BGMA 3HC3L 3NABL 1I8MA 3O45B 4FFVD 5IMOB 5J4MA 1I9RH 5DRZB 1NDGB 4JR9L 1T1ZA 2E7HA 4ODSL 2WANA 4G5ZL 4C54A 1BWWA 3VXQA 5LGJB 3BEVA 1CR9H 3NFNB 4AIZA 1IGTB 1ACYH 3I85A 1AQKL 3SOBH 4Y16C 4PBWD 4OF6A 5AZ2L 5C0BA 1YNTA 5AZ2H 2OBGA 4LSTL 4PB9H 2G5BB 3MV7E 3HZMB 1P7KB 4YDVA 3ARUA 1L7TH 3GSOB 4ALAH 3EDFA 1QQDB 1VADA 2AJVH 2HFFB 3D25B 3MJGX 5DVKA 4NNXA 3PUCA 2FECL 5SWZE 4FXKA 1XMWA 2B0SH 4OZHE 4ZTPL 4L9LB 3BP7B 4LAQH 3QO0B 1A6TA 3R1GL 5HPMA 3KS0H 2YHGA 4XMPL 5FM4A 1Q9OB 4H20L 1V3LA 4G43A 5EB9A 2CLVB 4E5XB 1VFAB 4FQXA 2BFVL 5F7EL 4NOBA 4PJ5A 4LRNL 2D7OA 5C0EA 1KLGB 4U33A 4Y19A 4P48A 2X6MA 5H94B 4WENB 1WAAE 3WHXA 5T33H 2B1HL 2SEBB 5ADOH 4LSDA 4E42B 2AQ1A 5HGAB 5KTEH 4Z0XB 2DF3A 2X4PB 3CJJA 4HIEA 4WFED 4LSQH 1NGQH 3QXTA 5CZXC 3QRFM 5EU6B 3RZCD 3DUUA 4HCRH 5IW1B 3G5ZA 4NZRL 1ND0B 3T0ED 5ERWA 1JPTL 4POZC 1ES0A 5IFJA 3VXRD 3HZYB 1Z0MA 3D2UB 2O5YH 4OD2A 2DLFL 4WEBL 4OLYL 5IF0A 1OLLA 1O7VA 3A67L 5C08A 3DURB 3NZHH 2OJZL 1YY9D 5CD5C 1MIML 4ELMF 1QLFB 3PNWA 3QIWD 2YSSB 3P77A 3KYMA 2CDFB 3ZE0F 1F4XL 2DN7A 2OQJA 3VI4E 3QXVA 1NC2B 3NA9H 1T5WB 2Z31B 1B2WL 2H41A 3U9UB 2LVEA 4R3SA 2EH8H 4PP1C 1F45A 3NZ8A 2XKSA 5ACMA 2IH3A 4L29B 2WUBL 4NQDA 2CUHA 5DRNB 3KPSB 1CXEA 3TV3H 1PYWB 3IDXL 1HXMA 4LSRH 4HIXH 3KS0J 1A22B 3SDXF 5I8EA 2P47B 1F5WA 4ZUVA 3V5DB 1QFWL 3T0EE 2EDYA 2A6KB 5IKCB 2HVKB 4ONFH 1VHPA 1PQZB 4M3KB 3LQZA 3B9KC 3TNNA 2BRQA 4JAMA 4JPIA 4K7PL 5KZCD 3DPBA 3IJHA 5DXWA 3MMEA 3JWNC 4NM4H 4YAQB 5ITBH 3V6ZB 2VLRE 3UBXI 4NC0B 4PJCE 2AJZB 2J4WL 1VGKA 2FO4B 5ETUB 4JFYB 3K0WA 4LHQB 4XVSL 2N56A 2K9UA 1A5FL 2AEPH 3BH9A 2R9HD 4TSCL 1AXIB 1KACB 3WBDA 4DZ8A 4JGJA 1HHJB 5C6PB 3ULVL 5E03A 5ESQB 2YPLD 4KMLB 2XPGA 1IM3B 1MHPL 1XZ0A 4S1QL 3MR9A 1JHLL 5I8CA 4DW2H 4PJXF 2CXGA 2XA8H 4LARH 5GGTH 1ZTXH 2ADJB 2YS4A 3W0WB 1XIWD 4UTAL 4PJDA 2WWKT 2W60B 3N1MC 4RBPK 4GRLA 5E5RB 2R2EB 1URLA 4F7CA 4HIHA 2J8UB 1CFQA 4OSUH 2BMKA 5E2JA 5HHOD 3HZKB 2R8SH 3ARFB 5ID0A 3R4DA 3HB3D 3VD9A 5FF6B 1J8HD 2ORBH 4KUZH 4WIQA 4Y5XC 4LSQL 3VFWA 1CZ8H 5L0QC 7CGTA 4Y19D 5HBBA 2CKBA 3KPPA 4P23D 1S9XA 4EDXB 5LGJA 3L3JB 1W0WA 4KTEH 2HVJB 4M61A 2FIKB 4RMUA 2DM7A 1QFOA 5BW7A 3IB4A 1I4FA 3F8UB 3KXFB 4PTTB 5GS3A 1GGCH 3IDJB 3BP5A 5DK0B 4K7PH 2RCSH 1B0RA 4KHXL 4YWGH 3GIZH 5J57B 3SO5A 3S3SA 4O2EA 5IEHA 4GMTL 4DWHA 5HYIA 1LWRA 3UTZB 2Y06H 2ILLA 2AEQL 5FGSA 1ODAA 1V3JA 1DDHA 5FHAL 4OZFB 4Y4KD 4PRNA 5FYKH 2P24A 4XPBL 5F72S 3SJVE 2HH0L 4HPOH 4NT6A 2HJFB 2NY0D 3ROLB 4X6EA 4OLVH 4OZFA 2W9DH 3RUGE 3UO1H 3QEQB 4J3SA 4PJHB 3TJHC 2NW2B 3QIWA 1IGJA 2L7JA 3U30C 3VD5A 5DURD 1F4WL 1TIUA 2ZUYA 4M7KL 2G2RB 5FA4A 4JEGB 5ANMB 3FB8B 1I3GL 1AR2A 4WW1A 3WNOA 2D4FA 2P49B 5A2IH 3QO1A 3A6CH 1DUYA 1H9VA 5C0AD 4OGYH 3G6DH 1V5JA 4PRAA 5GS2H 4QHLA 3NCYS 1OP9A 4I18C 4BSWB 5TE6L 4O4YH 1IAMA 3QUYB 5TE4L 4B0MM 4EOWH 4ETYA 1GAFL 1K6QL 2DBJA 4HMCA 3VXUD 5C0NC 2DQGH 3CZFB 5TPWH 3HMXL 1Z0NA 2B39A 2QQKH 4GAYB 4YHLH 1IEAA 2IJ0C 4L5FL 1KPUA 4Y0GA 5B8CC 5JZ7C 2Z0BA 2AVGA 2GJ6D 5DGRA 4ZFGH 5J06A 1CT8B 3EFFB 2XN9A 2HA1A 3O11A 1RZFH 1T2XA 5E94B 4MJ5A 1EEUA 4MX7A 2NLJA 5KVFH 1JE6A 3CLFL 4UOJA 3GSQB 2HJKA 1IEHA 3LIZH 2EDFA 4FQQB 3IFLH 5SWSE 4G42A 4LFHD 1HIMH 2VH5L 4YO0A 3T2NH 2D2OA 1EFXB 1NGPL 1LEGB 3SKMB 1A3QA 2FD6H 4WTZA 4X6CF 2OI9C 3F7YB 3BMWA 2EIZA 2HT2C 4I0PB 2X89A 8FABB 4QCIA 5F96L 2AABL 1OW0A 5TDOB 1HHHB 1U3YA 5HHME 1NGXB 3MACH 3VI3E 5LAXA 1ACYL 3QNYB 4HG4J 2EIZB 3UJIL 4L1HA 1H3GA 4QYOA 3SQBA 2IPUG 2JCCF 3PGCB 4ODSH 4LIQE 1EX0A 2P5EE 4UT9H 1MI5B 3L95B 3HZVA 3B2VL 2UWEB 5IT2H 1DN0B 3DUHA 1IQDA 3O8XD 2FECI 3RWJA 4FQQA 3QEHA 3BYTA 5DEFB 3VCLB 4NHCL 4KJPC 2O5ZH 5IB4A 4U7MA 4U1GC 1DQTA 3B3IB 3LMJH 4Q6IB 1RZJL 1H3VA 2ICEB 3CVHB 1FIGH 4EDWH 1EV2E 3IDNB 3W9DB 1H5BC 1JCKA 1HEZB 3LSOA 4GUPB 4L4JA 3BKJH 4DEPB 4PLNC 5GSRB 4I1NB 2VSCA 4RX4D 5MERB 1A6WH 1L9NA 1P4LA 1FVEA 1I1YB 1VFUA 2J6EH 3P9MB 2VZ3A 3UTQB 1MREL 1MFEH 2VAAA 3DVGA 4ZFZA 4OF8A 3AMKA 4F7MA 5IQ7H 1ND0A 2ZOKA 1YC7A 4PP1D 2FLBT 2NXZC 4HX1A 4N0FA 4WEUD 4XBEL 5EUOF 1FAKT 4H0GA 2OSLA 2YKLH 3LKSB 2ADFL 1JK8A 4FQ1L 4N0CD 2X05A 5C7XH 1QSFA 4X9IA 5ISZA 3BESR 3LPGA 5H94A 1BM3H 2VWEE 5E8PB 1XGPA 2GKIA 3MV9A 4EI6B 3NAAH 3SKNA 4RNRA 3U1SH 4ZAKC 2HG5A 1Y18B 3IXAB 4FN0A 2HT3C 4Y16B 4WO4A 3RPIA 3BZEB 3UJTL 4ZPVB 5KSBA 3T0EC 1BBJB 3DETD 3PL6B 1SEQH 3S4SA 3T0WA 1RAMA 4LLDB 3T04D 3QHFL 2VQ1A 3BFOA 5CHNA 3ROOB 1DJSA 3G04B 4PLOB 1AGCA 1KXVC 2Q20A 5DQDL 3JVGA 5MENB 3IJYA 1OP5K 2VUYA 2D31A 4YHYB 1ZA3B 4XBPB 1MFEL 2BOBB 5J1AB 5E9DB 1N64H 3U46A 5B8CB 5EORH 1LEKA 1AGDA 5KANI 5HDQH 1T1WA 3F58H 1H3XA 1YMMD 3OKNB 5CS7A 2YWZA 1FGVL 3BH8A 3NN8A 5IBTH 4NN5C 2H2SC 3L5JA 3RZWA 4HULB 4GQ9H 5B38G 4G9FB 3D69A 3S4SB 4HUNB 4PRID 2CMRH 4GLRH 1I1AD 4XP5H 4QRPB 3NH7H 4PD4J 1WAAA 3U7AA 3BQUD 1S7VB 2W60A 4JVUA 3GHBL 4NHCH 3VWKA 5F6HI 2JELL 5DJXB 3MGTB 2V2WB 1AXSB 3WFZA 4RNRB 5EUOB 4MB5A 5JPMA 1FG9C 3ZKXC 4PUBH 3GMLB 3P73B 1RJLA 1XR8A 2EXYD 5DFTA 4Z8FL 3MOBH 5LWYH 3KLAB 3STLB 3OJ2C 2AKRB 5C0AB 2YKLL 1OGAA 1U8NA 2PN5A 1NAMA 4NYLA 1PKQA 4KDTC 1K8IA 3L5WB 2UYLB 3HCVA 4OZGA 3CCHB 4C55A 3OKEB 5CD3A 2V2TB 3MLYL 3PHOB 1TVHB 3IVKB 1BBDL 1WICA 2OM5A 3IETB 5DMYA 4X6CE 5HI3C 3ZYZA 4MDIA 1OAXH 4S1RH 1U0QA 3SKOB 3DYMA 4RGMB 3U7YH 2CSPA 4LCUA 4JRWA 2VDNL 3PWPB 4HWEL 3G5XA 2LV4A 3E6FB 3V5DA 1V05A 4OIIH 4CNIA 4WI3A 1HEZA 2UV3A 4OFPA 1MRDH 5HI3D 2G9HB 2JB5L 2X70A 5IMKB 3G5XB 1A6WL 4V1DB 3VFGH 5DRNA 2ZNWA 4W81A 4G3YH 1CL7I 1NSNL 1WZ1L 2WQ8A 4MNQD 3R06A 4NQXA 5L0QB 3RNQA 4PJCA 1EUUA 1KOAA 2J8UE 5IB4B 5LQBH 5KVGH 4JO1L 5DC4B 1LO3H 4L8DA 3JWOC 2L4OA 2NZIA 3BYYA 3RDTA 5KSBE 1LP9E 4KGLA 2Q87A 1AHWC 4DQOH 1OB1A 3P77B 3MTRA 5DMGC 1NFIB 4GKSB 4YHOH 3TFKC 3VXUE 5L8LB 3M17A 4RAUB 1P1ZB 1NPUA 1JNLH 4YNYB 5I74C 1RIUH 1JNLL 1UM6L 3DRQA 3ZDXE 3QDJB 4XCFL 1HZHL 1T04B 3VFVB 1WLHA 2NXYC 3VWKB 3UBXA 2B4CC 5A43C 1MWAB 1HHHA 5C0DB 4Z77B 1DP0A 3TM6A 4PGEA 1KPRA 4RCAA 4U1MB 1LHZA 1G9NH 1RUKH 2ED7A 2AJSH 4CBPA 3C08H 2SEBA 1OGAB 3C09B 1IBGL 5DFVD 1JWSB 3KLAA 2YPVL 3WHXB 3VXMB 3H9SE 1FL6A 2EDKA 4D9LH 3ULVD 4X6DF 3TPUA 3BH8B 2W9LA 4LMQI 5BVPL 1D5MB 4N8VB 2D0FA 5EUOE 4UIMA 1KGCE 5CJQL 3MX0A 2JB5H 3L3OA 4JFED 5I8KL 1G9MC 2DM3A 3O0RH 1YMME 4PJAB 4S0SD 5C2UB 4JGMA 4JQXC 3UC0L 2DDQH 4EIGB 5ISZD 5J3HC 1MAKA 5K93A 4WI2A 5E95B 2MCG1 4L8SC 3GZKA 3MXWH 3VRIB 5DEZA 5IK3B 3VGEA 3GMOB 3GDBA 3B6SA 1EBPA 3IDYC 3PWPE 3MRDB 5DD0L 1F58H 1OWRM 3QXUA 3H3PL 4P57B 4HQQL 4JPWH 5I30L 4KI5D 2X4UB 5KAQG 2H6PA 4CU8A 4UI2A 2WINB 1EEZA 3SO3B 1ZLVH 4X9HA 4X4YB 3IS1X 5HHPB 5I1AB 2FH6A 4WW1B 4PB0H 5F9WC 5DJ8A 5JA8B 4OJFL 5FA4B 4RGNE 3CMOL 2BDNH 5E5MA 1G7LB 4R26H 3WUWB 5EFIA 1CIDA 4H8WL 4OCRL 5KSBB 4Z7UA 1XCQA 5BZWB 2YA1A 5JR1L 2B2XL 4N0UE 1SYVA 3P9WB 5E2TH 1CLYL 3KJ6L 1F97A 3WNLA 5DVOA 4XGZB 4ODVL 3EYFA 3CDCA 5AAMA 3MUGA 3KPRE 4ISVA 2BVQB 2V17L 4PGJA 4PGBA 3JTTB 4NUJB 5CUSL 4DGIL 2NNAA 3TBWA 2FR4B 5ALBH 1MLCA 4YC2B 4JDZB 3QFJE 1N64L 5CJOH 4KY1H 5GSRA 3LKSA 4YXHL 4AMKH 3TO2A 5I1EH 2FNBA 2VLJD 4DVRL 3EGSA 3RJDA 1F02I 4LPWA 4M61B 1RUAL 4NM4L 3V4PH 2IFGA 1U36A 3LN9A 4AL8H 4MNHA 2PW1A 4BZ1H 2GAZB 4MD5A 1YEIL 2X40A 1AKJB 1M71A 4ZFZB 1DANU 12E8H 1IKNC 2N4IA 3ULVE 4WO4D 3CC5B 2XG5A 2O61A 3WO3B 2FZ3A 1QFWH 3QXAB 4FZ8H 3AAZB 1JI2A 5AAWA 2NZ9C 4PJ9C 4WHCA 4CDGC 1AGEA 1AFVL 1T83A 2XOTA 4AQ1B 3TYGL 1MCDA 1OAKL 4HUVA 1QSFD 4H25B 4GG6A 1FV1A 5D2LB 1WFNA 3MLXL 5L6YL 2AJYL 3U36A 5E8DL 1AR1D 3WFDL 4ZFFA 2AI0L 4LKXB 5DMIH 2AJSL 2BHZA 3S98A 1FNAA 5DMIL 5K33A 1NCDH 2EIDA 5CP3H 1I9JH 3MOAH 2KZ1B 5HJ3B 3HN3A 2R0KL 3QI9B 4I0PA 4YBQC 4PJ9A 3LKRB 4YBQD 5MEQB 3QIUC 3ARFD 1NGYB 3BEWA 3MO1A 5EU6D 1OLZA 4KFZC 5MEQA 5EN2B 5I1JL 2H1PL 5BJTB 3BPOB 3BWAA 2DWDB 3VXRB 1CFSB 3RIAK 3QUKA 4I2XE 1OQXA 3IKCA 4YDLB 3H7LA 2NLJB 4UOW0 3V4PL 2OTWB 1IAKB 1HXYA 4OCNC 3KDMA 3U4AA 5DQ9A 1VENA 5I1DB 4GAGH 1FV1B 2BVUA 3DXAD 4HJ0C 1YJDC 1S7RB 2NR6D 4GAYA 1PX3A 2MWCA 2FWOB 2MQ0A 1J1XL 1MWAL 2A9NH 4HUXA 3MLVH 4OLWL 3BP6B 1J18A 5FM5O 4WGWB 1QFUH 3WFEL 5E0QA 4XMPH 1AKJA 5JIIA 3AS0A 3LY6A 5SWZD 3PE9A 1NL0L 1CDBA 1Y0LA 1RIVH 2BK8A 3NA9L 4C83B 4OAWA 5E2UH 4MD4A 3IGAA 3S97C 4ZNCD 3GGWA 4G6JH 4NFCA 4JB9L 1KCVL 2DS4A 1PZ5B 3MRLA 4NKMA 3DX8A 2YSSA 3PNWB 1W2KT 5DUBA 5FHBH 2X1OA 3CSYA 2O5ZL 2E7LC 3PWJB 3QJHA 5CGYD 2NY4B 5CIPH 2G75A 2PKDA 1ZEAL 2RQ8A 1YMHB 1NJ9B 1W72B 4WGVB 3SE4C 1QVOB 4JANA 4LGRB 4IRSB 4Y4KC 2EH7H 3W2DL 2DQUH 3IRZA 3MODL 1AC0A 5F6IB 3C5ZD 4WY7L 4BQBA 4KJWC 5KVDL 1F4YL 1W8OA 3FT4A 2X09A 2DLFH 5CKGA 3WNPA 2UYLA 5CD3B 1BGXH 1I9RL 4LKCA 1X4ZA 5EU6E 4OGXH 2R56H 3PHQB 5D2LE 1T0NA 1YQVL 4Y5YC 3FB8A 3INUH 4ORGB 5CSGA 3HNVH 3LS5L 3BVNB 5F7MC 5GGUB 1BAFH 3T0XA 3HS0A 1YN7B 4O2FB 4GW4A 3QEQA 2WBJD 3SGDI 3B5HA 3O4LB 4CVZA 2V2XB 4DUVA 2IFFL 35C8H 3F7VA 1RD6A 5HHOB 1NGPH 2FEDC 3L3DA 5I66A 2EYTB 4LAQL 3HG1D 1RJYB 1ONQA 4OF0A 1K9TA 4F37K 4D0BA 4MNQE 3VXRE 4EOWL 3F7PC 5GGTA 2GY5A 4XPGL 2ZUVA 1R3KB 4IRJA 3A6OA 3FT3A 4JZJB 5H37H 3OXRA 1SBSL 5DEGB 3G6DL 4H8WC 5GJTH 1GPOH 1P5VA 3LCYA 4I0PD 3PL6C 3MJ7B 3QCUH 3T0EB 2BOBA 1G9NL 1FO0L 1RUKL 1NCDL 3PHSA 3MV8B 4GRLB 5DHYA 3UROR 1UWGH 3ULVC 1BP3B 1QKZL 3O4LA 1UYWH 3RHWF 5IR1A 1FCGA 3J8F7 4XRCA 1KLFA 3G04A 1E4XL 3L7FA 2BHYA 3L6FA 2VQUA 4PY7B 5H2BA 2XRAL 5GHWL 5JW4R 1EK3A 4LPVA 1DQLL 4MA7H 1T03H 4GW1A 1JHTB 4WY7H 2EYSA 2IG2L 4KVCH 2XPGB 1FL3A 4OLZH 2Y6SD 1GVIA 1K2DA 1U8IA 3LKQA 3FONA 4WHTA 1GGYA 4F37F 1BQLH 5F7DA 4Z77A 5J89A 1WEJH 4M02A 3VFSA 5FO8B 5I17A 2VN7A 4BZ2H 2CLRB 4JANB 3L7EB 2DIJA 2WIIA 3MMEB 4PV8A 4JFEE 4PJHF 4KVNL 2F5AL 4Y1AD 5E6IB 2EDRA 1Q8MA 2F19H 5C08D 3BKCH 4MCYA 2ZKHL 3THML 3T4AB 3PHQA 2ZG1A 1PZ5A 3WCYA 1OD7A 4QNPE 1HXMB 2DQFB 2Q7NA 4U6HA 1MCPL 2NY4D 4LLVB 1K8DB 1GGIH 2AK4D 2EECA 1UACL 2P45B 3ARBC 4IRSA 3C8KB 1JJUA 1QVOA 1MI5D 2FCBA 3N06B 4U1GB 1RZKC 4OF7A 4QHMA 3GK8H 5IVXE 1WUNT 1M7IB 3V6BR 4M48H 3LKOB 4MLIA 1OSPH 2P8PB 4ODTH 4CNIB 1E4XI 2AK1L 5IHLB 3HAEB 3ZDZE 1NAMH 1P9MC 2P8PA 2XQBH 4MQXC 1WTLA 5I9QB 3LKOA 3GGWB 2Q8AL 4LPXA 1UKSA 4R9HA 2KBGA 1PY9A 4JN1H 1E27B 3OKMA 2FBJH 5IF0B 4JQVC 4GSDL 3BUYB 3OGCA 3TA3A 3O3AA 5F1IA 5FXCH 4ZUTA 4P4KB 4KPHH 3IETA 1T5WA 2Z31A 1I3UA 2YXFA 5SWSD 5E6ZA 5GS1A 3MV7A 4K94H 2YPLA 5DMKB 4QRSB 5LG1A 2EXYC 3OB0K 5IHZA 3AU1A 3VH8A 1KPVA 3L95A 3D3VA 2APVA 1YYLH 3ILQC 2VXUH 1AO7B 5E2VH 1Z2KA 3VXNB 2CXKA 2O5XL 1BZ9B 4Y19B 4TNVF 2P4AB 5FOBB 1T1YA 4X80L 4ZNEE 3DUUB 5HVHC 4WI9A 1HSBB 4LCIL 2F54B 4XTRD 1JF5A 1S3KH 1M7DB 3SJVD 3BN9D 1W8NA 4UU9A 3O9WB 1MNUL 2MSPA 3GO1H 4RFEA 2W65B 4ENEC 2BZDA 5K59F 4Q74A 4JRXB 4TUOB 1MEXH 3QRGH 3KYNB 2JIXD 4KZEH 1VKXB 4NKIH 1DR9A 1F8TL 1IAIL 4TPRH 3TYFA 4A2MA 4XWGL 5D5MF 3ULUF 2R2CA 3BKCL 4XRCB 1F3DJ 5F1KC 3S3PA 4U7SA 3AAZA 4I3SH 1Z6JT 3DXAA 2XG4A 2KUTA 3O6LH 1AIFB 2HKHL 1UEYA 4QRPD 2ZSVA 3CFCH 3NFNA 4LSRL 5LBSH 4AIZB 1LD9A 3F62A 2BP3A 5B39B 3CMOH 2VXTH 1EHLH 4WJ5B 2X1WL 1HQRB 1KIPB 5GRVL 5L7XL 2Z8SA 2DYPB 4KROC 4OGYL 3Q5TA 4Y5YA 4L4TD 4UT9L 3ZLQC 1JTTA 1JGVH 3CZFA 5DJCA 2NW3A 3RTQC 5FO7A 3VWJB 3U30B 2WWKO 1CDUA 1A3RL 1NAML 3I6KA 4JKWA 2VXSH 5LCVH 2PW2B 2YD1A 3ARTA 5ALCL 4UDTB 3MRBB 1WZ1H 1KEMH 2CJUL 2EXWD 3N9GH 3V0VB 3PGFL 1OTUC 2QKIA 2X7LB 5IWLC 2GSIB 1B4JL 1G6RH 4HH8A 4MXWL 1S9VA 1A1MA 5CINH 4GW4B 3O45A 1QO3A 5JOFB 4QEGA 4LF3A 4HIJB 1BQSA 4JFXB 3TGXA 4KI5F 4PJHA 4WWKC 3I3DA 3KWWB 5E6YA 4ZUSB 2FX8L 4H1LA 1ZHBB 4E41D 1ZGLA 5AD0A 1MI5E 3S3JA 4O2CA 5E4EB 4P4KD 4PRNB 3G6JB 4ZFGL 2QR0B 3HAEG 4BH7A 1HH6A 1IT9H 3C2AL 3FMGL 4LHUA 3RY4A 1D9KC 4P3CH 4CN6A 1IGYA 4Y5XB 3TBSB 1KSRA 2JK5A 2EDEA 4JGUA 4LBEA 1FNEB 3HLAB 3PABA 1ACZA 1A7PH 1U91A 3QWOA 1CZ8L 1VERA 4RMSA 4S1SH 4MAYA 4X4ME 5K9OB 1TQCB 5FUOH 2QQNL 2Q3ZA 3TN0A 4I0KA 3TVMC 3O3DA 1HYSD 4X4MA 4YH6A 1BD2B 4NHUA 5J6HA 1RUPH 2ZSVB 2C3GA 2DWEA 4D9LL 1TZIB 1F4YH 1CDHA 4FNLH 4HWUA 5FYKU 3VFWB 2R4SL 3BSZH 3SDDA 4W4NA 1N7ML 1OL0A 1ZHKB 4N8VA 3SGJA 3VRIA 1XR9B 4PRIB 3P4MA 4K3DH 5FF6A 5HHQA 4X98A 5F9DC 4G8EB 2XTJD 4PJBE 1PBYA 2PTVA 1YDPB 3BI9X 4JRXA 1YYML 4XCFH 3EJJX 4LOUC 3RX5A 1UQSA 4WU7B 3RI5K 1XFPA 1H3WM 1U8JB 4K2UL 4EUPB 5FO9A 3CH8A 1D7FA 1RU9H 1BFOB 4LSSH 4WFFD