4HLZH

Crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPWTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a classical broadly neutralizing stem antibody in complex with a pandemic h2 influenza virus hemagglutinin.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
total genus 46
structure length 211
sequence length 211
chains with identical sequence J, L
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hlzH01
5B38B 1DN0A 4UOW1 1EMTH 5I1AA 4Y8DC 1WC7B 1A4KA 5GS0C 5JLZA 1PZ5A 4PJXA 4YBLB 1JN6B 4XMPL 3TBSB 2MJWA 1AXTH 3QRGL 1A6WH 4NN7B 3A6BH 3H8NA 3HC4L 1UH4A 3HZKB 3INUH 4PG2A 1J9CT 3BUYB 4U7MA 4XBGA 5EZOL 3G6DL 3FT4A 4J3WA 5D1XA 1H3XA 2QSCL 3K2UL 5I66A 3MROB 1UCBL 1DBML 3HZYA 3RWEA 4XNMA 4NNPL 4Z76A 4KVCL 1HN1A 5IW1B 4WFHE 4OM0L 4F7PB 3X3GL 4KKNA 5IFHH 5HHOE 4JLRB 4NZRL 4NC0B 4RMRA 1XF1A 2CGRL 4TPRL 1NQBA 2M2DA 3DTXA 3TYFB 2IG2H 2H1PH 3RZCD 4HX1A 2A6IB 5FGCB 1ONQB 4DFIA 4JGUA 3QEGL 1CL7I 4R7NB 5HHVL 1UXWA 1MQKH 4NKQB 4WHCA 5F1SA 2DWDB 1I9JL 4YE4H 3LHPH 4ZDHA 1P6FA 3EIFA 3H9SE 4Q9BA 1UM5L 5IVXE 2AEWA 1UCTA 2BY2A 2FX7L 1TVDA 4GG8A 1XGQA 9CGTA 4WU7B 3MNVB 2W07A 1GPOH 4MXQD 1CGSH 5I0ZA 1E4JA 5E2VL 1J0HA 1FPTH 3TO2A 3ARFA 1KJ2L 3QAZC 2YKLH 1DBBL 2Q1EA 5E6ZA 5HHQB 4EXKA 4Y5YB 3NH7H 3VFUB 3MJ9L 1EGJL 4WO4A 5T1KB 3EYSH 3QFJB 5E2TL 3EDEA 1NDGA 1A7PH 1IGFL 4HLZH 4XX1G 3RNQA 3T04D 2ZUSA 1T03H 1OP5K 3ESVF 2DQFA 5MP6L 1J0KA 1QD0A 4J8RB 4NIKB 3SGJA 3T4AB 3TZVC 4AQOA 3QQ3B 2A1WL 3MRJB 4JFXB 2PN5A 3E6FB 1HQ4B 3IXAA 2F54E 5GS0H 3D9AH 3VFMB 4U33A 3I9GL 4TTDC 3OR7B 4HFWB 4HKZA 4QHNB 4C4KT 2B1HH 4JM4L 2VDOH 5GGSB 3WYRA 4U1IB 4JY6B 4PRBB 4FFWD 5HSFA 2ESVA 2WP3T 2FYYB 1QFWH 1IEBB 3LKNA 3QCUH 1NGPH 5C0JA 4AEHL 1FCCA 1XH3B 4C58B 4Z7OF 2YK1L 5I19H 4FQLH 3W5MA 1ACYH 5EG6C 2BERA 1H3GA 4YHML 1U3HC 1OB1B 1CF8H 3IDGB 4ENEC 3WN5A 1DLHB 5JTWA 4P49A 5EOCH 1RJYB 1DQTA 2CUHA 4P4RA 5GS3A 1JV5A 3OKDB 1M1SA 5GGRA 2EXWC 1JUFB 3CFEA 2J6EL 3CPLB 1KCUH 3HG1E 2FCBA 3VFTA 1QNZH 1ZLSH 4X98A 4HIJA 3QBTB 3DOSA 3MLTB 4F3FB 3RVWC 1INQA 4FFVC 1Q8MA 3C60C 3MA9H 3DYPA 3VW3H 4RAUA 3AXLB 3SDXE 2IGFL 4BFIB 4OZHA 1MEXL 4QEGA 4YBQD 1I9IH 5CGYD 5D7JB 5H37H 3K8KA 1T5XB 1INEL 1NL0H 4LLYB 2YPKB 3CXHK 3DV6A 3CVIL 4OZGA 4K7FA 2VWEE 5TPWL 5CKAA 5J3HD 1QSFB 2VIRB 3BDBA 5CD5C 5BVPL 1UT9A 4HSQA 3BKJH 1N0XL 4KJWD 4G8FA 4XCEA 1I1CA 3WSQH 4GSDL 4EEEA 3B9VA 3T0WA 1SEQH 3W39B 2XY1A 4GAJH 2ZJSL 1BOGA 1OQXA 3CLFH 4Y16A 1CWVA 4KJYB 5T1KD 4HMCA 4GW1A 2XNAB 4ODWB 3S4SA 4P5MA 2AI0H 4Q9CA 3O6ML 1K2DA 2A6KA 4XH2B 4LLAA 3BW9A 4LDLB 1UWGL 3TWCH 3H3BC 4IIQA 5F9JB 2HVKA 3TC9A 1IGCH 1RVFL 3ILQD 4KROB 1EXUB 2PTUA 4L9LB 4JO1H 1QLFA 4Y2DA 5FGBC 4GG6B 2XWTB 4F57L 4JPWL 3ABZA 1CDJA 4LQFH 5BW7C 4WI2A 2X9XA 1S9YB 1FLTX 1RVFH 1T7XA 1IVLA 1CE6A 2UWEF 3HE6A 3OKNB 3FO1B 4KDTC 1AO7D 2ADGA 3ROLB 1NFIA 4R4BB 3GBNL 2Z91A 3NA9H 4LOUD 4PJGF 3JSSA 2CKBB 3P0VL 2NY0C 3CFBB 3B9KA 1L0YA 1U58B 1C16B 1NC2A 4RFNC 3IDIA 3GRWH 1DFBH 3V6ZA 2X44D 4ALAL 3M17B 3OGCA 5ID1A 1UACH 1R3IH 3RWFA 1J1OH 1IAKB 4NN7C 5CUSL 2YUZA 4MSWB 3U4BH 2EDWA 2NPLX 3PIQB 4G8GA 5GGUA 1KJ2A 2BVTA 2GSGB 3MACL 2D03L 5DDHB 1DSFH 5J11B 5E2UL 3SDCB 3JVGC 3CX2A 4O4YH 2YUXA 3GSRA 5D7KE 1CLZL 4XWGL 4J4PC 2C1PB 2DM3A 2NTSP 5JOEA 5F1NB 5DI8A 4TQEH 1T04A 1S7TA 2BJMH 2HRLA 4S0TD 2AV7A 2DQHH 4M6OL 4KK8C 2ORBH 4RIRA 3HPJB 4PBVC 1GYAA 1AR1C 3MV9A 3R4DA 2QLVB 3SE3A 4JPVL 4MAUH 4ZUVB 2FJFB 1ZLUK 1MFCL 1M7DA 3JTSA 3U7WL 4KVNH 4JQVA 2VXVH 1KB5L 3A6OA 3JUYA 1HWGB 3E1F1 4LPTA 2E7CA 1OAXL 1EJ6A 1CS6A 1OLZA 3VXMA 1ND0A 5LAXA 4JZOA 2EDOA 4RSVA 3QAZB 2A83B 2PYFA 3QHZL 3HNTL 3RA7L 1I9RH 3FB6B 4AEFA 4I0PC 4O58H 1U8NB 1P2CA 3ZTNL 3JWOL 5DJYA 1WGOA 3BGFC 4BSVA 4L4TA 2EDYA 3KYNA 3BWUC 3FQNB 2R9HD 3RVTD 4FN0A 4K7PX 4YAQA 5I8CB 1BD2E 1HHHA 1MY7A 5H94B 4K2UL 4RA3A 4WENB 4JFYA 4ODHH 5CIPA 2E7LC 4ACPA 4Z7QF 4ZFZB 3MRBA 5IM7A 3HE7B 4GOSA 3BP4B 3RNKA 5JXEA 5E8EB 3EO1B 4HKXA 3LS5H 3QHZH 2R23B 4CVWA 1N0XH 2O26U 1YPZF 1UQSB 2Y72A 1PLGH 2XQBH 5IKCA 4XWOC 1A7RL 1SBBA 3VFRA 5ESAB 3FKUS 3MBXH 3EAKA 4MB3A 4CMMA 1JPST 4KI1A 4MNGA 1A7RH 2J4WH 3O8XA 5ADPH 1FZKA 4KTDL 3ZHKA 3O4LE 4IOIA 4HIHB 1WVZA 2M26A 2YD6A 1PY9A 2AGJL 2BK8A 4YIQA 5IWLA 2VLRD 3ARDA 4BQCA 2MHAA 5K9OA 2BVUA 3OBAA 2EKSA 3QCTL 4XP6H 1J0IA 2Z31C 5ETUB 3BKCH 2EDEA 1SHMA 2P42B 1I1FA 1MFBH 1JGDB 2AJUH 4LF3B 4R8WL 3HC0B 4P2OC 3T4YB 3SDDB 3QH3A 3TVMC 2MCPL 1NLBH 3QEGH 4BZ1H 3SDCC 4B53A 2DQEL 5HI5C 1TXKA 2QR0A 3TESA 4PP1C 4WEMB 4ZO6A 4BZ1L 5KW9L 4NKMB 4OFDA 1V7ML 1HSBB 1A6VH 4BH8A 3MLYH 1T1YA 3NZ8A 2VDML 2W38A 2DL2A 2CUIA 5C86A 1FSKC 3SKUD 2NY6D 3WUWB 5D1QD 4LLMB 4EI6A 4ZXBA 3UZEA 4N5UA 3WNPA 2P4AB 1CE1L 5IMOA 2FECI 5ISZA 1E4KC 4KK6D 4HULB 1RD6A 5DD5H 4HPYH 3QUXB 3F5WB 4G43A 5AZEL 4WJ5A 5F3BB 5I76B 4YUEL 2BVPA 1AI1L 4XRCA 4WW2F 3LZFH 1B0WA 4FABL 1TJHH 3PNWB 1BBJB 3AS1A 3P9WB 1WIUA 4OZFB 4OV6F 4I48A 4K9EC 4PJGB 4ZPTB 3BISA 2D7TH 4OM1L 3KYMB 4I2XE 4XVJL 3VCLB 2F74A 4JZJB 3U30B 5FGSA 4UB0L 1G6VK 3NCJH 1LO4H 5JPMB 2HG5B 3M45A 4I18C 4L8CA 4L9LC 3J7HA 3L7EA 2IANB 3Q5TA 5FF6B 5JORA 4GRWH 1UYWH 5MERA 1U6AL 2VR4A 4F9PC 4AIZB 1EJOL 3FB8A 3X13A 2RAMA 2IBGA 2YRPA 1KIRB 3QJHA 1RJCA 2XRAH 3HE7C 4LPUA 1J18A 1IGJB 2E6JA 3KXFA 4TUJB 25C8H 4PB0H 1H15B 4JN1H 1TMCB 4NHCH 1UXSA 4A6YL 4F80A 1IAOB 2F8OA 1S5IL 1WTGT 4LRIA 1KTLB 1RJLA 1G7HB 3ARZA 1T2XA 4AENB 4CN6A 1E27A 5KVMC 3DUHA 2WP3O 4YPGA 3ZKND 5FYJU 1AGFB 3CSYA 4LBEB 3S96A 2WINA 1AO7A 1CLZH 4XWGH 4DEPB 5FK9A 5CD3A 1U92A 1R5IA 4KTEH 2GK2A 3EGSA 3VE0B 3WD5H 3DX7A 4X6DF 3QDGD 3MRIB 1Q9WA 3HI6L 4P3CH 1ZT1A 4LVNB 4Z7NE 5IFJB 4FXKA 5F96H 3GIZH 4UZGA 4JQIL 1E6JH 4NT6A 1YYLH 1A6ZB 3TV3L 3JWOH 5DJDB 4XMPH 5KSAA 3MMEB 1DQQB 1WITA 3HG1D 3CC5A 4YXHL 4P2OB 3UEZA 3TVMB 5F9WC 1EO8L 3C09B 4NYLB 1ZHLB 2VABA 4KV5F 4PJ8A 3QIUA 4ZYKA 1CIUA 3QNZB 2CRYA 1BZ9B 5DC0A 5TE7L 2JK5B 3VFNB 4WUUB 4ORGB 1WV7T 2X1XR 2XZAH 4KY1L 2OJEB 1XGUB 4I77L 3REWB 3FB5A 5HI5D 3ULVE 3S35H 5J1AA 4YHYB 3U2SB 4M7KH 3QDJA 5C08A 1RUQH 2PO6A 3ZE0F 4XVSH 4ORZC 1AD0A 3V5DA 5KS9B 4HUVA 3DGCR 2FSEA 4HJJL 4XHJC 5JMOC 3ZDZF 4CN1A 4Z8FL 1QYGH 3NFNB 5I30L 2Y6SD 4R2GC 3SQBA 4Z5RA 1JTTA 3O3DB 3A6CH 3VXRD 3H3PL 1G7IA 4NNYA 3BKJL 1FL6A 4LSSL 4PJCF 2PXYB 4G6ML 4CDHA 2Y23A 2YKLL 1T2QL 3UPAA 1G9NL 4HIXH 4Y4HB 4OD1H 3PHQB 1U93A 5D1ZB 5JW5B 5IHZB 3O4LA 2ICCA 4OT1L 1E4WL 3JV6A 3MLUH 2WWMC 4PGDB 5DHYA 5L9DH 2AI0L 4FQ2L 3PHOA 3V5HB 1OAQL 4MX7B 4YBHA 3MYJA 1UB5B 5KSAD 4JANA 5CLWA 1DUYB 3FQTA 5D5MF 1X5LA 3GSNA 5HD8C 1IC5H 1H5BB 4NGHH 3TBVA 1GGBH 1SYVB 1T22B 4U7KA 1RZGA 1KEML 4RA0C 3C5SA 3UZQA 5DJCB 3VGDA 1XF5A 2Z31B 4W81A 4WI8A 3HFMH 4XI5C 5FHAL 2R4SL 1WZLA 4NC1C 1BQUA 1MIML 4I13B 3K0WA 5T33H 4WV1B 1JRHL 1NGQH 4J6RH 5SWQA 1DDHA 1SQ2N 3GK8H 3L1OH 3PP4L 4RMVA 3LKOA 4JFZL 5INDA 2IBZY 5ALBH 4GXVH 5FYLL 1TDQA 3BIBX 4NZUL 3LEYH 3HC3L 3PWNB 4URTB 5C0IA 3QIUD 5L0QB 2IPTL 2FJGB 1SYSA 4U1GB 4MXVE 4S1DC 3WXWH 2FLRT 5HVHC 3FT2A 1WFNA 5TE6H 3VXME 5KSUA 1JPGB 1DR9A 3BZDA 1XEDA 3KJ4C 3QIWA 2BCKB 3TIDB 2YMXL 1MI5E 1NKOA 1CR9H 1BBDH 4R0LC 3VXSB 4YR6B 1FHGA 3C09C 3EFDH 4OCWH 4DGIL 5KVEH 1R3KA 1RI8A 4MD4A 4P2QA 4YUEH 2Q87A 2QHRL 5F6IB 4P9HC 1NFDE 4JFEA 3U0PA 3DO7B 5EFIB 1N4XL 4R97B 4Q7DA 3VXMD 4JKLA 5CGMA 3ILPB 4UIMB 3GMOA 5F44A 2A73A 5DEFB 1R24B 5DVMA 4PJDB 1BREA 1BLNA 3MLWH 1NBZB 2YMXH 5I71C 1T1ZB 4WFEE 1F11B 1WF5A 2FJHB 1DBJH 1VGEH 4JKWA 3I02A 2E5EA 3BH9B 1FFOB 3P9LB 1N8ZB 4JJ5B 2C3WA 1KNOB 1RU9H 3B4NA 4RWYH 1TZHB 5ESVB 3PL6A 1MRFL 5IQ9A 3GIVB 8CGTA 1XAUA 2DF3A 4Y4HD 5ANMB 1ZGLP 5HHOD 5LVEA 1CZ8L 3G6AA 1F4AA 2G9HB 2X4PA 1YN6A 3HS0A 3CUPA 4C56A 2H41A 1LDPL 1JGEA 5E6IA 5F89B 4H1LH 4NFBA 4UINH 3MV7B 2X4RA 5D1ZC 3FB7A 3U46A 2LTQB 1A7QL 5IT2H 1BZ7A 3VFGH 3D87B 1QA9A 1T83C 3JV0A 2QQQA 4X99A 5IIEB 4DZBB 4MXVF 4G6FD 5H2BB 5C0GA 3O3AB 1U3JA 1JHTB 5DRXA 2IAMB 4NQTA 1ZA3A 5IG7B 1REIA 2UYLA 1DL7L 3HHRB 2DD8L 5TQ0H 2N7AA 2VLRB 4JFPB 4RMQA 3WIHA 3PQYB 1NGWA 4XAWL 1F02I 3HNSL 4N0UA 1VEMA 5IEHB 3AROA 4JKMA 4OCYH 1PBYA 3GBML 3DURA 4X6DB 1LD9B 5D2NE 4XTRD 4KKAD 5I1DA 4YNYA 5DYOA 2LFGA 2R39A 4RZCA 3S5LB 2R8SH 5DF0A 6CGTA 5E2VH 1TLKA 1NBYB 3NACH 4QRPA 5DS8A 3RU8L 1ES0A 3MXVL 2BSRB 3L3KB 5J13C 2YUVA 1C08B 1ADQL 3JTTA 1HHIB 3T0EE 5FO7B 3LRHA 1SY6L 2MFNA 3DBXA 1NANI 2VQTA 5HYIA 3KLAA 2YD2A 4JGMA 1KB5A 3IJYA 3P11L 2WWKO 2CK0H 4QRQA 1JFQL 3G9AB 1HOCA 3OXSA 1MI5A 5DUML 3FT3A 3TA3C 3QEUB 3TT1H 3D2UD 4PJ5D 1K8IA 2FB4H 3GUTA 1G6RL 4G6FB 3AB0B 5FXCH 3GGWA 5F7EH 4UTAL 4TSAL 2G5BB 2A9NH 2VUYA 4ZFOL 5DHVH 1BWWA 1Q1JL 2DICA 2YD8A 4RGND 4XZUA 5DJ2A 4O51A 5F71A 2R2BA 1IJ9A 3MV8D 1R3JB 2AJZA 3IRZA 1TZIA 1L7TL 4WY7H 1FLRH 1L6ZA 1MLBA 4PJ9B 1MLCA 2KH2B 2Q7NA 4FZ8H 4NN5C 5I8EA 1PFCA 3UBXB 4RNRB 4F33A 3BE1H 1A7OL 2ZCLL 3IS1X 3V4VH 4HGKC 4YDJB 5C2BH 1QFWI 5F9OL 1MFAL 1OGTB 2BC4B 3AREB 4IS6B 3GMQA 4G9FD 4K71C 3H7BA 4OI7A 2MQCA 4L5FL 5FIEA 2AXGB 2CO6B 3QZWG 4RWYL 3RDTA 4PLJD 4KUZL 3RGVA 3UTZB 3U1SH 1WT5C 1AJ7L 4GRLD 3TN0C 4JQIH 3UTOA 5HYQB 3SGDH 5CBEB 5FO9B 5EBLB 3DURB 4X6DA 1OPGL 5D7LE 3RUGB 1RUPL 3CSBA 4LSRL 5EO9B 3UTTE 4XP9H 2CSPA 1YDPB 4PP2B 4W6XB 4Y4FD 3T2PA 4A2LA 2MOVA 1MOEA 1A64A 4HC1A 3HUJB 4OFIA 4LIQH 4YHPA 1H8OA 2DMBA 4HH9A 4CUCA 3O8XD 2IH1B 3H2WA 2PO6C 3O11A 1FN4A 3PJSA 1KXVC 4UT6L 1DUZB 3KS0H 5DJAA 1QRKA 3U36B 3O41B 1A8JH 2ZSVB 1YNLL 5EO0B 4FABH 3QWRA 3P11H 4GG6F 2F19L 4YC2B 3CUPB 4PG9A 4C56B 5E24E 1MHPH 4ODTL 3LPFA 2BMKA 4LIQL 1C5DB 1KYOJ 4LVOC 5DJ0A 2DYPA 2YPVH 2GAZA 3FFDA 2I26N 3W0WE 4JRWA 3CGTA 5C08D 2FX7H 5EU6A 5D71L 2UWEB 5IROA 4G6KL 3MXVH 5EN2B 3BH9A 4U1JA 4OUOA 4Y5XA 1ZHNA 3LEXB 1ZA6B 1T1ZA 3BN9C 1MCLA 4U1NA 3X12B 5E94A 4ELMF 3NTCL 4WW2A 4APQA 4X6CA 2DQJH 1C12A 1G9NC 1U8IB 4KRPD 2BVQA 1LP9B 5JQHC 1OW0A 1WIPA 2QADB 3DO7A 2J4WL 3QUKA 1GVIA 4W68A 4P5KA 2ADIB 5ERWB 3DVNB 2DQUH 3EJYD 1Q0YH 1GGIL 5EBMB 3SHSA 4G42B 4TNVK 4YR6A 2NY0B 1ZEAL 1J1XH 5JZ7D 3BH8A 3DVGB 5L7XH 3VRLF 4GS7C 4X6CE 3IDNB 4OLUH 1WAAF 3FT2B 4HJ0D 3QUZD 5IB3A 4JKPH 1QPXA 1WZ1L 2C3VA 2ADFL 2DQHL 1FBIH 2FJGA 1QR1A 5DD3L 1CGVA 1JRHH 1NGQL 3C60B 3I2CH 3AREC 3QXWA 4H8WH 3F58H 1A1OB 3KPMA 5DEZA 4OCLC 2YXMA 2DLTA 1PG7W 5H35B 5DRWB 5EU6E 4YDLB 4PRAA 5A3IC 5DZOA 1DLFH 3PV6A 1NGZB 3W0WA 2DMKA 3DPBA 4PLJC 4HHAB 4ZD3H 4CKVX 4WV1A 1JZ4A 4MA1B 3UC0L 5I2IB 4LVHB 2B1AH 1FIGH 5C0BA 1GZPB 5DUMH 4ZUTB 3QT2A 4PYHA 4LSTL 4LLQA 1NC2D 5J0BA 3VD9A 2HLFD 3HAEG 3WS3A 1UJ3A 3BP6B 1YEGL 5CJOH 1SYVA 2VSDA 4KK9D 2APBA 1FQ9C 3VXTB 2NY6B 3ZLQC 3L6FB 1I8LA 4M6OH 1ZS8B 4AK1A 1IGTB 4LASL 1TZGL 3MRGB 3EKCA 2CKBH 1MJ8H 3CDFA 2HT2D 1BIIB 1OPGH 2XPGB 4JR9L 3IKCA 3MJ9H 3KR3H 5J11C 3MYJB 5DHVB 4OV5A 2P5EB 4XBEL 1EK3A 2R1YB 4U6VH 1QBMH 5DHYB 1CFSB 4UAOC 2C3HA 1MRDL 4P9HL 1GPOL 3I6LE 4CADB 4WHYH 4UU9B 4YDIL 1WSST 3DMMB 2R0KH 1RZIA 1T4KB 3QUZB 2QJDA 4HJGA 2Z35A 1VERA 4YPJA 3C6LA 3QFJD 4OV5B 5CINL 1V7NL 4JO2L 3O0RL 4K23H 4NM8L 5FUCE 4RDQG 1YEIL 3ZKMC 4Z5RB 4YLQT 5CJXA 4DN3L 4OQ1A 5HJ3B 3VH8A 3LDBC 2WQRA 5L6YL 3ECBA 4DN4H 1YA5A 1ZS8A 3HI5H 1NUFA 1GGCH 4Y4KB 4WUUD 4U6VL 1T66D 3TNMB 3I3DA 2V2TB 1F58L 3ETBF 4RFNB 3BP6A 4NN6B 5CFHA 1EAJA 4HEME 4PY8I 4PY7A 3WKMH 1VSCA 2D2OA 4KMTH 2VLKD 3UJIH 4NRXB 1XZ0A 4PGCB 2BVOA 1BGXL 2B4CC 5EZJB 1AD9B 2OJEA 4JFQB 4DW2H 4LQFL 3PV6B 1OTUD 4JO3L 5FYLE 3UDWC 4KK8D 3BEVB 4YC2C 3SDCD 3JV5A 3SKOA 4WU5B 4YFDB 1QR1B 2UZIH 5HI4C 1UH2A 4N1HB 1G9EA 1H9VA 1NCUA 3PGCA 1ED3A 3GMMA 3QJFB 4PD4J 5DQJB 4MNGE 4W4OC 1I8MB 3IDNA 4JFZH 3CLEL 5DQJA 3B9EA 1DQML 3FOLB 3PGCB 5JZ7C 4P9ML 3LD8B 2A38A 5TDOA 4LQ1A 3CVHB 4ZS6C 5JQ6H 4DUXA 4YEFA 3SKOB 4NWTL 5EH1A 1R5IB 5DD6B 2D03H 5D7JD 1AO7B 1FFQA 1JIBA 1DVFC 4Q2ZB 3DLQR 3Q1SH 2AV1A 3TBWA 1Q9OA 1MY5A 3BGMA 2O61B 2P7TB 3WHXA 1C12B 1W0WA 5IBLD 2FX9H 5SWSD 2R4SH 4X5WB 1GOFA 4MJIE 5DK3A 4IBLT 3MO1A 2FECL 4WW2B 3PF2A 1MWAB 4LLDA 2J7LA 4QRPE 5D93B 2JB5H 4PY7B 4Z0BH 3LEXA 4Y5XB 43C9B 3MYZA 2OTUB 2Z31D 5ITBH 2ZJSH 1KT2A 2UWEA 1H3WM 3LRGA 5I1LA 5DMIL 5HJ3A 5CCKH 4FZEL 3P2TA 3STLB 1UZ8B 1XF3B 5DR5H 1JWUB 4M4PA 4CU6A 2DYPB 5DJ0B 4N0UE 4G5ZH 3BPNC 3C6LB 4HT1L 4ETYA 5C0CD 5EC1A 1Z0NA 5HHNB 4HJGB 1MFDL 5T1DH 2VWEC 1TENA 2ZSVA 5JW4M 1EGJH 2AK4E 4CADA 3O41A 2BSED 1IAIM 3GI9H 4LEXH 4MLIA 4PJFA 1YYMH 3BHBB 2PTVA 2C1OA 4FP8L 2ZUQB 4MYWB 5KSVA 2DDQL 5E6IC 4L3CB 1RAMA 4D94A 4I48B 5GS2D 4NBZB 3V52L 2P5EA 1QHOA 5AZ2H 2DJSA 5IVXB 2V17H 5F7UA 1U8QA 4HKBA 1INDL 1LP9F 2GTWA 4JFHD 2HT4D 1BIIA 4YHPB 1LO4L 1DFBL 3GRWL 2VRAA 3O6LL 4P2CG 3EDKA 1Q0YL 3CU7A 5CSBA 1SJHA 1QFUH 1DANT 3LSOB 4NKOA 4DVBA 5MENB 3VXTA 4JM4H 2VE6A 5IMOB 4HW6A 1Q38A 1T66C 4G8GE 1UJ3B 4LHUD 5DMGD 4Y4FB 1NMBL 5E5UB 3MLUL 3UXFA 5CBEA 2WZPD 1WZ1H 3EZJB 1OY3B 3QPXH 5I2IA 5IFHL 5C7XH 1T1YB 3NZ8B 1A22B 4I9WD 3HE6C 1RZ7L 3ULVD 2I9LA 5I19L 5CJ5A 4JY5L 3EFDL 2DYPD 4OGZA 2G75A 1NGYA 4DVRH 1OP3K 1FDLH 1A7NH 3AS0A 5GSRB 3RL2B 1A1OA 3H7BB 3MLRL 1OM3H 3KDMB 1MFEL 4OKVA 4HCRA 3DYOA 2X89D 4I3SH 1NFDA 4KUZH 3S8WA 1MF2H 5D2LF 3WFBH 4O02L 4PJHE 2EDBA 1JYXA 3V0WL 4W4OA 2C5DC 3D39D 3V2AR 4KJPC 4BELD 4PJAE 4JRYB 4G6JH 1CFQA 1QRNA 2CR3A 5E1HB 4G42A 5I6XC 1CD0A 2V7NA 4LPXA 4N9GB 2AJZB 1U8JA 3S88L 2DM7A 2R2BB 4JFDB 4HIHA 3EDJA 3OR6B 1LP9A 5E2TH 4WTWA 2HLFC 3O8XB 1JFQH 2WANA 1R0AH 3QO0B 3RIFK 1GOGA 5BQ7A 1IRAY 3ZYZA 3HMXL 1T80A 3GUTB 1OOAA 5IKCB 4ZXBD 4U1NB 4WGVB 1YQ2A 4QXUL 1ZA6A 4NQDB 3HKFA 4I18B 1MVFA 3GSQA 3CIQA 2SEBB 4ONFL 3WDHA 2VLJE 5FGRA 4X5XA 1BVLB 3MV01 1FFPB 1LEGA 4MA3A 5E99H 2JJSA 1NCCL 3MRBB 3DBXB 3EYUL 3V8OA 1MCOH 2D4FA 4XPBH 3UTPD 4MA3B 3V7AE 1LEGB 4E9LA 3DROA 3C6LC 2XZCL 3QDHA 2BSRA 5T3XD 4Z7UF 2KQNA 4HS8H 4TULH 1T7YA 4U2YA 1P2CB 3UO1L 1QSFE 3S5LA 4WI6A 4JG0H 3FB6A 2J6EA 1HILB 1FH5L 1JHKL 5DJAB 5DC9B 5I1DB 3PJSB 4TSBL 3WLWD 5E4EC 4NQEA 4RGNB 1S3KH 2IC2A 3DRQA 4EN3A 4P2QD 3KPLB 2VL4A 4PV8B 1BQSA 4HS3A 2LU4A 2VQUA 1NAMA 5IEHA 4DEPC 3TH3T 5GRVK 1NGWB 4LLVB 1G1CA 4X7TB 4QYOA 4QYOB 3QPXL 4NQED 1TTGA 5F7KC 1KFAH 4PP2A 1CFQB 5IG7A 1A0QH 1YDPA 1NAMB 4LSRH 2IH3A 1EO7A 5H2BA 3RUGA 2PXYC 4NQEB 4CBPA 5EBLA 4OLYL 3SDYH 2WSKA 1DQMH 3BO8B 5FYKE 1F6LL 1HILA 1F3DH 1VHPA 5BCAA 4Y1AD 4GXUM 3C6SA 3QCTH 5GSRA 1T6VN 2NY4D 3RL2A 5JOPE 1CD1A 4B7IA 3MLSH 3PGFL 1IQWL 3DROB 5DRNA 3D0LB 4L9DA 4XNZB 1KJVB 3AREA 3MODL 4NHUB 4WO4C 3WHE0 1KSRA 1DBKH 2HT2C 3I3BA 4QHUA 5DVLA 3MNZB 3PL6B 5ESVA 3BN3B 3ARFC 1YNLH 3EOBB 4D8PB 3P9LA 1NC2B 5F6HJ 1NCAL 2VE6B 3I02B 1MLCB 3LKSB 3DECA 1FLRL 4FFZL 4NQDA 5HI3D 1JZ8A 4CAGA 1MCBA 1WEJL 3LEVH 2HH0L 4TUKH 3IDXH 1BLNB 1Z9OA 2GJ6E 2Z91B 4M1GL 3GMOB 2Y06H 2V5SA 4GKOA 5I8KH 4JQXA 5F6IC 3ULUD 1JJUA 1HIMH 4ZODA 4M1GH 1XGYH 5IVXA 2G5BA 1D9KB 4S1QL 3O4LD 2Q3ZA 4Y2DB 2X05A 1T0MA 3ARQA 4PJFB 4OLXL 4WFFE 3RL1A 5AYQA 1K8IB 5BOZG 3E6HA 5GISL 2CDFB 3BPLB 5A16B 4P5MB 3DETC 4DGYH 1BQHB 3RZWA 1Z3GH 1JTPA 1KB5B 2B2XH 5KSUB 4HFUL 3DSFL 5K9JL 1GGTA 1G7JB 4JO1L 4ONHA 1V3KA 3CDYA 5SWZD 3SE9L 5FO7A 4MB4A 2EC9T 1OM3L 2VDQL 1T5WB 1MRCL 3A6CL 1B2WH 1NLDL 3O3UN 4OLVL 3KXFE 4FRWA 4QRRB 3VWKC 1ODAA 2NZ9C 2ZOKB 4OGYH 4QLRA 2VIRA 4JFFD 5CGTA 2NX5E 1S9VA 3QI9D 4PJXE 3DV6B 2Q3AA 2X41A 3BQUD 5IW6B 4LLYA 4KRLB 3WKNA 5DHXB 2E9WA 3ARBC 5DJCA 3BGMB 2X4QB 4TVPH 1Q9LA 3ZTJH 5E70A 2AV1B 3DNKA 4Q2ZA 2BFVL 4KJWC 3K4ZA 1MJUL 4AEIL 3VJ6B 1PEZA 4BFIA 4NKOB 3LSOA 3PQYA 3HRPA 5KVGL 2A6DB 3RTQC 3CVHA 3KHQA 3UBXI 4HMDA 1EVTC 2GTWB 4YFEA 1JNJA 5DFWH 1ZA3B 4JZNA 2IAMA 4RFOL 3P3YA 1U8QB 1YEJH 3VFTB 4JANB 4ZSOA 2DL9A 5A2LH 4LGRB 5E8DH 4L3CA 3UYPA 4LP5A 1JV5B 3OKDA 2C1OB 1ED3B 2HFTA 3GMMB 5KSVB 3CK0H 4KPHL 1WT5A 3NZHH 1CDYA 1CLYL 1H3TA 5ISZE 2ZCHH 3BPOB 1DLHA 3ZDYF 3PHQA 4YXLH 2YUWA 2EDFA 3DARA 3QUYB 3SDXF 5DLML 5CP3A 4LMQE 4PLKC 1FO0B 3WO4C 2IQ9H 5SWSB 2AEPL 4JFQA 3UZVB 1ULVA 4NNYB 4WCYH 5EZJA 1JWUA 4KJPD 1P9MA 3U48A 1XZ0B 1J12A 1UZ8A 4TVPE 1OGAD 3GIVA 1W72L 2QKIB 1PD6A 3NACL 4PRBA 5ISZD 3I6LD 1IM3A 4PTTB 3EOTL 4LSPH 3VI4F 2O5ZH 3OR7A 4HFWA 4HKZB 5I1KH 4LCIH 3WUZA 3GZKA 3FCTB 5C08B 1Y6MR 1WWAX 1NEZG 4JB9L 5C9KA 2NY3B 4XNUL 2P7TA 4ONGL 3WHXB 4J8RA 3MUZ1 4WCYL 1A3QA 1E6OH 2JK5A 4LGPB 4P2QB 1HHGA 2ARJQ 2VABB 2DQGH 4WO4B 3ESUF 1HCVA 3MCLH 1I7TB 4ZOBA 4YWGH 5B3NA 1K6QH 4X7DC 2R1YA 3FOLA 5KSAB 5HHXL 4QXGH 4MCZA 2APVA 1KPUA 1JPGA 3TZVD 4OZHF 3FAWA 5SX5H 4ZSOB 5GXBB 4WU7A 3PHSA 3QJFA 4ERSL 4JZNB 5IFJA 4MJID 4XPHH 5L9DL 1Q9WB 2A6DA 3DX7B 5C0IB 1IGTA 2DWDA 5EOCJ 4PJGE 1FBIL 1AFVL 4PV9B 1Q9LB 1AGFA 3CSYB 1ONQA 3PWLB 3DTXB 5KG9A 2X7LA 1KPRA 4H25A 4N90E 5KG9B 4L4TE 1T89C 3P0GB 1CGXA 1IAOA 4B7LA 4XNMB 5A2FA 4PRAB 3T8XA 4QRRA 5C0BD 1HWHB 2EEDA 4Y4KA 4OKDA 1IGJA 3MA7A 3KLSA 2ZCHL 3S35L 4KRPC 1KIRA 2QQNL 3RJQB 5JR1L 4NZRH 4ONHB 4I3RH 2NY0D 4FQXC 4HWNA 1WC7A 5D8JL 5JORB 3SE3C 1KPUB 2Z35B 1BQHA 2IANA 3CU1A 1T4KA 5ACMA 2CPCA 5FF6A 1RZIB 5A16A 2YR3A 5KTEL 4L8CB 1JK8B 3FN3A 3JV6B 1I7TA 3E6HB 4K3DL 5F1IB 1A5FH 5I1GH 1EO8H 1QYGL 1Z2KA 5I30H 4JZJA 5IHZA 1Z0MA 1T0MB 4XTRC 2BOBB 2EDRA 4NBXB 3GB7A 1KLUB 1D9KA 2BVQB 3B43A 5DHVA 1U8IA 5K93A 2EYTB 3QIWD 4NWUL 3ARTA 2DTMH 2J88L 3M1BA 5CHNB 2DQJL 5C0EB 3ARXA 4NM8H 3FCTA 3L6FA 4FNLL 4DAGH 2B20A 3LKSA 4MMXC 5HHMD 4PTTA 3BX7C 4QRRD 3UO1H 4NQDD 2APWA 3EOBA 4XP1L 3GSNH 4EI6B 2MQ0A 3QI9A 1ZOXA 2APXA 4ZUTA 5I1JH 5F70A 3C2SA 4NHUA 1J10A 1KJVA 1C5DA 1AGDA 3D0LA 5DRNB 1FO0A 4NKMA 1NMAL 1BZ9A 4MQXD 3EYSL 1YEHL 1U8LA 3QUYA 3BIAX 3KPMB 1KB9J 1F3DJ 1RV6X 3U36A 1JZ3A 2XG5A 4OCNC 2C3VB 1K3IA 4CVXB 3BO8A 5ALCH 2ZP0T 3CNKA 3SJVE 3WE6B 1I1RA 4YXLL 3VMNA 1C8PA 2IAND 2IH1A 2DQGL 3ARDB 1DQJB 3HC3H 2QL1A 3S4SG 4HH9B 4RRPG 1U36A 5D2LA 5I1IH 3HUJA 4H88H 4EJ1C 5EBMA 5A3ID 4G6AC 4ZOEA 5FK9B 5SWZE 4P5KB 5DURB 3OAYK 3DX8A 1PLGL 5JW4Q 1FZKB 3Q48A 1KIUA 3V6OA 1NCWL 5E5MB 5HYQA 1B88A 3RAJL 4CMMB 4AENA 4LCIL 3U1SL 4XWOD 1KTLA 1RJLB 5D6DC 5J7CC 4OZGE 2W9DH 3RDTB 2ZOKA 5EN2A 4U0RC 4TUJA 1S7VB 2HP4A 4IS6A 1CDHA 3KJ6L 5GGSY 3OMZA 5INCA 2FHCA 1KLFA 5B22A 5EULV 1IGMH 1G7JA 2VKXA 1F90H 3L9RA 3X3FH 2UVEA 2HTLD 4LFHG 4NZTL 3GSQB 4PJ9A 3BD5A 3RI5K 1PKQE 1RU9L 5JPMA 1IAII 2CDFA 3DIFA 1U8NA 2R0WL 2MKWA 5HYEA 32C2A 2EH8H 1QP1A 1FN4B 3QO0A 5EBGA 3T09A 3EJJX 1LILA 3KPRE 3PNWA 3K80A 5T3XH 4U3HA 4CVUA 1DVFA 4TNWK 4M48L 3OR6A 1ND0B 4JFDA 3VXMB 5TQ2H 1MCFA 4WJ5B 4N9GA 1A6WL 1X5XA 1DZBA 3QEQE 5IBUB 1I8LC 4R0LA 5K33A 1QRNB 3VXSE 4PUBL 5HI3C 4WWKC 4Y16D 4WEBH 4D8PA 3K8MA 1I7RA 3IJYB 4HWEL 3MV9B 2RCSH 5LCVL 3KLAB 4LLMA 1KELH 4QHUB 2PO6D 5GGRY 2AV7B 1RZFH 1O0VA 3U6RB 1HSBA 5IVOA 1TQBC 3BE1L 1C08A 2VLJD 3VWJD 5F1NA 4PJDE 3C60D 2PR4L 1CD1B 2AQ2A 3RVWD 4JY5H 1JNNL 2BVYA 3GMQB 1LVEA 4JFFE 3U6RA 4RZCB 3T4YA 3PIQA 3OWEA 2BC4A 4YNYB 1OGTA 4HXBH 2B5IB 4DW2L 1FE8L 5HD8D 1QO3A 5I8EB 3UBXA 1I7RB 2IH3B 4Y4FA 3V8CA 1AIFB 2MHAB 1RZFL 5DD0L 5GZOC 5C0CE 1RZ7H 1CXFA 5LWYL 1SJHB 4DVBB 2AK1H 35C8L 3TO4D 3MUHL 2AXHA 2NYYC 3AVEA 4KRPB 5AAMA 1P9MC 3GBLA 4S1DD 4HKBB 4G7YL 4JRYD 1JHTA 4OCWL 5DRXB 1DVFB 4Z7NF 4HS3B 3RBGA 3KPLA 4PV8A 1MSPA 2NZ9D 3F7PC 1YMMD 4KJQD 32C2B 4J3OC 2EE2A 3VFRB 1EAPA 3QEUA 3DIFB 2GQHA 1D6VH 1SM3L 2P43B 4G6JL 2HKFH 4QRQB 3RU8H 2VLRE 3AUVA 3QPQC 2R23A 2XNAA 3PQYE 1YN6B 3HS0B 3NZHL 1KN2H 4KQ4H 5B3JF 1UEYA 2G9HA 3BP4A 3HE7A 4ODVH 2QHRH 2IAMC 3KXFD 5F72S 5GZOD 2DOCA 5IQ9B 4AMKH 3OQ3B 3RHWF 1A7BA 5JMRA 1HHHB 1R0AL 1S7VA 1BVLA 3JXAA 4HPOH 1KT2B 3P30H 4XPBL 1P6AB 1TNNA 4MXQC 5DS8B 2SEBA 43C9A 3CSPA 1F11A 2YWZA 2BZDA 2NX5A 3SO3C 2D7PA 2PYEE 2FB4L 1NBZA 3AS3A 1CL7L 3LKRA 1IFHH 4NJAL 5DYOB 1QG3A 1H3UA 2W0KA 4UIMA 5E5MA 5BQ7B 3QYCA 1C1EH 1XMWA 1G9ML 1SBSH 2O61A 3BZFB 3U82B 4QO1A 4I0CC 5LAXB 4UIKL 3D85A 4WO4D 4JO2H 1BM3H 2VLRA 1G0YR 4JFPA 4AYFA 2OI9B 2AK4D 4FQ2H 3S5LG 5TDOB 3JTSB 3SGEI 2UYLB 5GGVH 5IQ7H 4HIJB 4JRYA 3TH4T 1AKJD 5DO2C 5C0GB 3CPLA 1JUFA 4DZBA 1NANH 1LO3H 3ORJA 3LN9A 1QA9B 2Q8AL 3EHBD 3FN0H 4QWWD 4X5LA 1BZ7B 1QOKA 4EDXB 3WFZA 3F8UB 3KDMA 4WU5A 5KAQF 4ZOCA 2WUCL 2R0ZH 3BEVA 1NGYB 4ERSH 1BHGA 4IRSB 2J6EH 3LKOB 3SDCA 4Z7QE 3D3VE 1J8HE 2I9LB 1AGDB 3G6AB 2GSGA 2AJXL 2VLKE 1YNKH 3QEQD 1QTYT 5ANMA 3L3JA 2NQCA 5GGUB 2DD8H 5I8OH 2B5IC 4JKKA 3QI9B 2FYYA 3RWFB 1XF5B 2Z31A 4G7YH 4ALAH 4MAUL 5F7FA 3C5SB 3FN0L 4JJ5A 3IDIB 3TNMA 4M00A 4QHNA 4QOKE 5MENA 5GJTH 4JEGB 3VH8B 1DBMH 1R24A 3RIAK 2VDNL 3BKMH 3EYOA 3N9GL 5D71H 1NAKL 4XMKL 2DLFH 1YNKL 1CE6B 3HE6B 1UB5A 1RIHL 3Q1SL 1KLUA 4F57H 2O5ZL 4JFEB 5K59E 1YECH 2DI8A 2BOBA 5C2UB 5E6ID 3BHBA 3C6LD 3QFJA 3RUGE 2PXYD 3DYMA 4ZO8A 1VFMA 4DGIH 3ALPA 3Q5OA 3SOBL 1L9NA 3VXNA 3VXSA 3VFPB 5F1IA 5LJYH 4Y4HA 5CAYB 5MP6H 3T3PE 3S4SB 4ODWA 5HHNA 3QIWB 2PXYA 3AM8A 3E3QE 5TFSL 1A7PL 1IGFH 1LWRA 1BOGB 1V5JA 2AQ3A 2EDQA 4QRUB 3ME0A 1XF3A 4XMKH 4KGJA 1SYSB 2ZUYA 5I1LB 3MRGA 2XTJD 3B83A 3MA7B 3HB3D 3SE9H 1UEMA 4BM7A 1E4KA 3T8XB 2FSEB 4JPWH 2VNCA 5KS9A 3V0VA 2Q8BL 1VESA 3NCCB 5A43C 5KSBE 2WBWB 4PRNB 4KK5D 5KVEL 3TYFA 2NW2A 2VDLL 4DN4L 1NGPL 4I3GA 4LLQB 5J1AB 1JF5A 1YMHB 4H25B 5C0BB 1KPRB 3FB5B 1OLLA 2X7LB 1I1AC 1W0WB 4QNPF 5H8DA 4F9LA 2EKJA 4RGNC 5GJSL 5K59F 2I24N 4HHAA 3PWLA 1NGZA 3W0WB 1Q9OB 4WUUA 4PV9A 1J1PH 3VFNA 4QXWA 2IBZX 3DSNA 4ZYKB 5DRWA 5ECJE 3MROA 3I75B 5C1MB 2VDKH 4IMKA 5DUPH 2MPAL 4P2OA 3HZKA 3Q0HA 4Y19E 4F3FA 1HKFA 2FNBA 3FQTB 2Q8BH 1S5HA 3UYRL 4K23L 3MMEA 5IB3B 3CFEB 4OLUL 2QSVA 4NNPH 1I8MA 2BY3A 4MCZB 5FOJA 1BQLH 3QQ9D 5B38A 5ACZA 5F9AC 4KI5C 4AEHH 3GRWA 3QSKB 4PGDA 3BH8B 1LP9E 4YXKL 4YFLI 3O4LB 3I2CL 1MJ8L 5D1ZA 3EGSB 1U93B 3VE0A 5JW5A 3WN5B 2W9DL 5EZIH 2XOTA 1I3VA 1HHGB 2FGZA 5D96C 2ADIA 2VN4A 2A9ML 5ERWA 3PG2A 3T0DA 3WLWC 5CZVL 1E6JL 4YPGB 1S78D 4TN9A 3O8XC 3SDDC 3MOAL 5C0JB 3L5WB 2BVOB 1AHWC 5I15H 4NRXA 2DQDH 5DQDL 4GKSA 4YHKL 2XI9A 3NFNA 3T0AA 4PJ9D 2DQIH 3RVXC 4PB9H 5GGSA 4KVCH 3CVIH 2V2TA 4U1JB 4HCRL 2HAZA 4BK5A 1J7VR 5EPMB 1IM3B 3FMGH 2QKIA 3E6FA 5IUSA 1AE6H 2GCYB 1QFOA 1X5FA 1I9IL 3REWA 4DUWA 3WDJA 2UVFA 2JJTA 2DQFB 4KDTA 4NUGH 3PXHA 5SWSA 4WFHD 1X5AA 1CD9B 4R2GD 1ZTXL 1PY4A 1L0XA 3QUZA 5EO0A 2P5ED 3DMMA 4KKBD 2HG5A 4UU9A 2V7HA 3LQMA 4LRNH 1IGIL 3LIZH 3U7YL 1PYWA 3NCJL 4KUCD 1WWCA 3FO0H 2AJSL 2F74B 2NXZB 4K07A 1MJ7L 3VGFA 3BDYL 1U3HD 4UDTA 1DQQA 3RHWK 5E4EB 5FYKU 5D1QC 5DJDA 4OZFA 2RCSL 5LCVH 4CJ0A 4OLWH 1UM6H 4ODSH 4NT6B 3IKCB 3GM0A 4GG8B 2XPGA 3E8UL 4PUBH 3OKEB 1MCRA 5SX4I 2P5EE 5MI0B 2VZUA 2W9LA 5F3BA 4ZDHB 3NTCH 1KN4H 3QUXA 4M8QB 3OJMB 2EZ0C 2ITCB 3VJ6A 4EUPH 1JYVA 2H2SC 4A6YH 1DEDA 2V6HA 2CLVB 5F9DC 1VPOH 1A1NB 3EOYG 4LL9A 1OAYL 4NM4H 5EB9A 4ZS6D 5EO9A 1F6AA 2X4QA 1D9KC 4LCCC 1OAKH 4HG4J 3LB6C 2ZG1A 1ZLUH 5IW6A 1JE6A 3WUWA 5DC4B 5DXWA 3OKYA 5GGTH 2NX5D 5KVFL 4JLRA 4HKJA 4QHLA 2AGJH 4TNWF 1JF6A 3RGVB 1S9VB 3P73A 4QY8B 1CU4L 3RWEB 4H0IA 4WRLA 5H35A 4FQCL 4CU8A 5T1MB 5D1XB 2FBJH 3LQAH 1T5WA 1IC1A 3C60A 1VCAA 3QH3B 3QJHB 1GL4B 4QHKJ 3S36X 5CEZL 4J3SA 3PL6C 4L4VA 4S1SH 4I5BB 2FRGP 1I3UA 1OAZH 4FFYH 4RNRA 4P46C 5LBSL 2EKSB 1AQKL 4J3UA 1NBVL 5K9OB 1QZ1A 4BA8A 5LBSH 3BT2H 1JGVL 5CSGA 2VH5L 1TZIB 2X9YA 4NQCE 2HH0H 1R3JA 5C0AA 2VLME 4GQPH 3E2HB 3KYMA 4OM0H 3RL1B 3WN5C 4GFTB 4PLKD 3DVNA 3KPSB 4DKAA 4PJGA 1QKZL 4ZPTA 4Z7WE 3QUKB 1BWMA 4K3EH 3MGTA 3RVVC 5BRZE 4F7CA 3UROR 4K3EL 5J1TC 3GGWB 4Y2DC 4MNGB 4M9PA 1NEUA 5I76A 2I60L 4X4MA 5E94B 3X12A 2VYRE 5FM8A 1ACZA 5ELIA 3OXSB 1HOCB 3E0GA 1MHPL 3BT2L 4ODTH 3KAAA 2QQLH 1MQ8A 3JZ7A 1J5OL 6FABL 1J8KA 4LCWD 3MNZA 4WUUE 3LD8C 4XVJH 2DQIL 1MFAH 2GAZB 3FFDB 3IDUA 5BO1L 5CIPB 1NUNB 3ZZ1A 1HHIA 5I8CA 4YAQB 2BMKB 3JTTB 4X8XA 4OI9A 3UTQB 1ES0B 1JGLL 4MA8H 4QRPB 2DBLL 3UTTD 4NOBA 3C6SB 3AMKA 3ZTNH 5KS9E 5DGRA 4GRWE 1JGDA 4LF3A 5HGDB 1DUZA 1FFNA 5DJ8A 3O11B 3VXUD 4NC2B 1LD9A 3H7LA 3GSNL 3HB3C 3ZKMD 2PF6A 2GJJA 5BO1H 3GFUA 3OXRB 4OF5A 2F53E 3WS6C 1S8DA 3KPQB 1NFDF 2HRPL 3RTQD 3QG7H 2Z0BA 4X7TA 4LLVA 2DQDL 5CMAA 3MRHA 3Q2CA 3O3AA 5HI4D 3V0WH 2YN3A 1X5GA 3DRQB 4EN3B 1A14L 3HPJA 4X99B 5DA0B 5IIEA 5FO9A 3SQOH 4XAWH 1YQVH 4DTGH 1PAMA 4PRPD 2A77L 4Y89A 1S7TB 1OTUC 5HGHB 3UTZA 2WK2A 3MV7A 4RGMB 4U1KB 4R90L 4WUKH 1KG0B 4NM4L 2I5YL 1MHCA 4M6AA 2C1PA 5CP3H 2NY2C 4GBXC 1KCRL 2EH8L 1JHKH 3EO1A 2N56A 3WJLA 5IVXF 2E6PA 5DDHA 2ZG2A 4BK4A 4NP4H 4PG2C 1TITA 15C8H 2YPLD 2AVGA 4JFYB 4XXDA 4JO4H 1TZHA 2VXUH 1FFPA 4RFOH 2XA8L 4F33B 4B5EA 3M17A 4X5XB 2FDBP 3T2OA 1N8ZA 3HE7D 3KYNB 4JREB 1U58A 4I18A 1VFBA 1UJ3C 4HT1H 1JPFB 4OF6A 5E8NB 1RULL 2VDRH 3TFKD 4XI5D 4GSDH 4YDKH 4PJ5B 1I8KB 4XZUB 2H2PC 4NJ9H 3ILPA 5DJ2B 5F93C 3T08A 2B1AL 4QHMA 3QUXD 2EDTA 3IU4L 3Q6GL 1JWSA 4PJ8C 2O5YH 4GRLB 2WWKT 3F7RA 1U8JB 2V7NB 3NCYS 1BMGA 2BSTA 4JRYE 1Y18A 1JNLH 2BX5A 3FT3B 1MI5B 3M07A 1K2DB 2YD5A 2FJFA 3TIDA 4O5LH 1PG7X 3NH7L 4KJYA 4IJ3B 5E2UH 2YA0A 1HNFA 1NFDB 4JKPL 2D0GA 4WFGD 5C07B 4OKVB 5J56B 4G8FB 1N0LA 3MUGA 4LAQH 3L3KA 4P4KD 4HLJA 2G75B 5INDB 1RHFA 3GSRB 3GKWH 4K7FB 1VEOA 1O7SA 1PKOA 3K4DA 4OLEA 2CXGA 2IPTH 3AU1A 1C1EL 3TO4B 3BEWB 5C0DB 5A2IH 3OGCB 3V6ZB 4PJ8D 2BRQA 3QNYA 3TBVB 3RAJH 4Y5VB 5DMKA 4FQIH 1HEZB 2BY1A 4RX4A 3QQ9C 2X4SA 2JELH 1B6UA 4R4BA 3F58L 1NDMA 1NFIB 3OKLB 5J9PB 5A2JH 5LG1A 4F9PA 3RVUC 3WKML 5FHBL 2IWGA 5EO1A 3M8OL 3V5HA 4LHUB 4L9LA 4LVEA 1EXUA 5DVOA 2XQYK 3TV3H 4KJQC 5D7LD 1IMHC 4LMQI 3FB7B 2X4RB 3U46B 1OT1A 4IIQB 2R69H 1CL7H 2XZAL 1JGEB 4GW1B 5TF1L 5EC1B 1W2KT 2EZ0D 4X8JA 5J6HB 4Y16B 2NNAA 3QDMA 2F15A 5IBTH 4F2MB 3O3DA 3UTTA 3S34H 1GJIA 3STLA 2F5AL 3WNMA 3O3EA 4NQEE 1IKNC 1ZLWK 2OTWA 3ARWA 1KNOA 1IAIL 3OGOE 5J89A 1FFOA 5A1AA 2OTUA 1CICB 2PW2A 3EDDA 2E9BA 4LCWA 1YEJL 3QDJB 4LLDB 1MWAA 5GS0D 1R5WA 2WUBH 3MO1B 3MRJA 4X5WA 4M93B 3C5ZC 1XGUA 4KHTH 1CICD 1URLA 4JFED 5C0FA 1RPQA 1T5XA 4F8TA 1YY8B 4AG4H 1RIHH 4TSBH 3VGAC 1FO0H 5EFIA 3TBWB 2VDOL 5FYJH 1WZMA 4OIAA 4PJ8B 4MD4B 5DD6A 4UT7L 5T1KA 4OBRA 3ZDYE 2D4DA 4OLZH 4R4NC 3TVMA 5CSZA 3CC5B 3IYLW 4Y5YA 3HUJF 4FXGB 5EOQH 4DOHE 4JHAL 2BCKA 3ZHLA 3TO2B 4X9GA 1T03L 2GJ6B 4FQLL 1FC1A 2NW3B 4EDWL 3PP3K 1ZT7B 3ES6A 4KKCC 5D7IE 3GO1H 5IWLC 4G6KH 4P4RB 3OJDA 4P9MH 5C8JB 4IMLB 2KPNA 5EOCL 3S7GA 4Z95H 1FE8H 2VL5B 5I1EL 3IDGA 1BM3L 5CD3B 3S96B 3BRDA 4OJFL 1BAFL 3P0YL 3P4NB 1UWEL 4KAQH 1FYTA 2A6IA 4NRYA 1AD9A 3TCXA 1HK6A 1T1XA 3NFSL 4PGCA 2YRLA 4K71B 3CX5K 3C8KA 1IEBA 1DCLA 1FNEB 2A77H 3BDXA 1A6PA 3TA3A 4Z0BL 3VU2A 4N8CH 2VZTA 1DBAH 3MRRB 4IEFB 1MCPH 3T0EA 1UXSB 4N1CA 1BP3B 3HZYB 5TE4H 2VC2L 5BV7H 1QQDA 4PS4L 3VFMA 5I66B 3ZE2F 3KXFB 2QSCH 5KW9H 1NL0L 3ECBB 3FT4B 3GSNB 3MRCB 4M3KB 1AQKH 1WJ3A 4L5FH 2O5YL 3QQ3A 3KLHD 5GRJH 1MF2L 3FB8B 4HD9A 1N5YL 4AIZA 4BFEA 4Y2OA 1BECA 5T3ZH 3T0BA 1IGML 1WQVT 1GHFH 3LCYA 5DD0H 1KN2L 3ZKSD 3PHOB 2CR6A 1CGUA 1NDGB 4NCDA 4FFWC 3WS6A 1OP9A 4HMEA 1FVCB 1YEFH 3QB7C 3I3EA 4I0PA 1CFSA 1DBKL 4X6CF 3VCLA 1EJOH 4LSDA 2DI7A 3R0NA 1C5CH 5FA3B 1F97A 3KNBA 2EC9U 2ESVD 1NUGA 1JGVH 1DQDH 3HUJE 1FL6B 1G7IB 1XGQB 3LN5B 3MLVL 2UY7A 2BVPB 3U9UB 4YO0B 3F5WA 5C3TA 3SJVA 1IT9L 2FEEI 4PB9L 1UXWB 3GI8H 5ISZB 4HUVB 1MVUB 5IHLB 3WS3B 1XF2A 3R06A 4HX1B 2IG2L 2PO6B 2P24B 4ZXBB 3U2SA 1MH5B 2E9JA 1KENH 1GZPA 4C56E 1U42A 4G8EA 1F58H 1CTOA 3K81A 1BEYL 2ICES 1BD2D 2QQKL 4L4TD 1FC2D 4ORGA 4X7EC 3O9WD 4QGYA 1DJSA 4ODBD 4Z76B 3NCBB 3QIUB 2PR4H 2QR0B 3JVGA 3WO4B 5IHUL 3ALXA 1ZHLA 1OHQA 3QG7L 5EA0L 5IEKA 1JPTL 5DGQA 5CINH 4KRMB 1NMAH 3HC0A 3PWPE 1I1FB 3WHE1 3MACH 5D2NC 5ETUA 3C08H 1A4KB 2EDLA 3JUZA 5EORL 5I1AB 3MZTA 3DVGA 4NQCD 3QDGA 1MCDA 3B9KC 2J3SA 1KULA 1T0PB 2YBRB 4P23B 5FUZH 4YHYC 3I85A 4OTXH 2XZQL 4GS7B 4P46A 1U92B 4HWBL 4AY0A 1P7KB 3PWPD 4M3JA 1JRHI 5EA0H 1P69B 5I73C 3QCVH 4IRSC 4LBEA 4LSQH 3GSVA 2VITA 1N59A 4U7SA 5EIQA 3QCVL 1FORL 5EZOH 2PKDA 4X6CB 2FIKB 4APQB 4W4NA 3RX5A 3PABA 1G7HA 4IIQC 4IHOA 1ZV5A 1T1WB 1XIWC 4UV7H 4NWTH 1ZHNB 3F7YA 4HS6B 1A6AB 2KZ1B 3RWGA 4Q9RH 4X0KB 3WNLA 5HPOA 3O4OC 5EU6B 5KAQG 3RNKB 4FQ1L 5IBTL 2WWMD 4OFKA 1AQDA 4LSUH 5MERB 1QVOB 2C3XA 3RWDB 1JTOA 1V7MH 4HPOL 4PG9B 3O6FB 3OAUL 3FQNA 4HWZA 2ZNXA 3P4MB 4FOMA 2WLYA 3V52H 1UA6L 4DKFL 2E8ZA 2FO4A 2YSSB 2FATL 4D0CA 1CGSL 3PGFH 1B0GA 2HKFL 3OJ2C 4WI4A 4DKEH 2ITDA 4JZOB 4LCYB 5F3HA 2RBLA 4RQQA 1P53A 4XRCB 5HYSB 1OAUL 1EBAA 1J11A 1B4JH 4L8BA 4QRSB 1A6TA 3SBWA 3O2WL 2IAMD 4G43B 2AJVL 3X14A 3QUZC 1RSFA 4LOUC 1HI6A 5LQBL 3KHOA 5HVGB 1M7DB 2QQLL 4S2SA 1WK0A 2FD6H 2FLBT 5KVDL 4WFFD 4ZUVA 4AL8L 4KZDL 1A3LL 3BXNB 2JCCF 5AZ2L 2P5WB 3SPVB 3QO1B 4ZPVA 3MV9D 3ZMRA 1NCDH 2G60L 5JA8B 3QWOA 3MUY1 3GKWL 4P2RB 5DK2A 4BH8B 1T04B 5K9KA 2X89A 4GKZA 4JDTH 1R5VA 4YWGL 3OX8B 3FJTA 5L88H 1N3NB 1P4BL 2AXGA 1GC1C 2IADA 4Y5YC 1AP2A 1IBGL 3QQNA 1RZKC 3MODH 4K3GA 5BS0A 1KJ2B 4LARH 1UB6B 4PJBF 4E0RB 1N64L 3VRLE 3LS4H 3QHFL 5I17A 5L8KB 4YDJA 3MRPA 4M7LT 3T77B 3AMLA 5T33L 2R2HA 5GRVL 4PJ7B 3F62A 2F54D 4KMTL 2D7OA 2ZUXA 3K74B 1WZKA 1MLBB 2FR4B 4U05A 2OR8A 1DSFL 2NY7L 3T0XA 3K46A 2APFA 2HVJA 3R8BB 2CKBA 4NDMB 1KB5H 1P84K 2NTFB 4O51B 1W8OA 1UM4L 1RZKH 5EIIB 3MJ9A 3OKNA 4BUGA 1S9YA 3C2AH 2IPKB 1OSZA 2X1PA 2XWTA 4GG6A 2Y07H 3CCHB 2G2RB 2AJXH 3DUUA 3PP4H 3NIFF 4GW5B 1EZVX 3RVVD 5ESAA 3FO2B 2WBJA 4XXCC 5DLMH 1Q94A 3BW9B 1FG2B 2BRRL 4MHHG 4JFOA 4PGEA 2I9TA 1U95B 1U2CA 3WLBA 4APQD 4YXHH 5E8EA 5SWZB 1G1YA 4MCYB 1AO7E 3MLYL 2FO1A 5HGAB 2JCCE 4X9FA 5DT1L 4ZFZA 4TULL 3MLVH 5DK0A 3WFEH 4HG4K 1RIVH 2DRUA 4XCEB 5CJQH 1CR9L 1WICA 2E6QA 2I07A 5FM5O 1IKNA 4BSVB 1NBYA 4P5TA 4OZGB 4U1SB 4S1RL 3BPCA 5AUMB 4E41D 5JOFB 3BPNB 3I6GA 1OSPH 1DL7H 4WW2C 2PYFB 2A83A 4QOKD 4K8RH 1ZTXH 5AWNH 2FD6L 5T3ZD 3IFOA 4Q9QH 3CX5J 4M62L 1XGRB 4UQ3A 4ISVB 2NMSA 5IMLA 1MAMH 2GEEA 4H20H 4N0UB 2XKNB 5ITFA 5F7HA 1MHEA 4OZHB 4O2FA 5IROC 1I3GH 3OF6A 4R3SA 4NGHL 3TNNA 4HDIA 1AGBA 4U0QB 3AS2A 3AY4A 4BYHA 2K9UA 3MLTA 1CVRA 4N0CD 2AK4B 4X98B 4FG6D 2JIXB 2EDKA 2F58H 3MV8B 4X7SH 5E5RB 5HPMA 2ADFH 3EYFB 1CZ8H 4RIRB 5HDBF 1X6LA 1H3PH 3AAZA 3KPRB 4P23C 5DI8B 4ZNEA 5E6IB 5F89A 1G6RA 1F2XK 2Y9RT 3VD7A 2X4PB 3MBEC 2BNQE 1C5BH 4K9EL 4G8GB 1A2YB 1IKFL 4MSWA 1X5JA 4UV4L 3P9MB 2ESVB 1I7ZB 4U1IA 1YPZE 1XIWB 3GSUB 1EFXD 1GSMA 4Z77B 5EU6D 1N5YH 2FJHA 1K5NB 4N5EC 5TJWK 1A21A 2Z92A 4N8VA 4PJEE 3KG5A 1YC7A 4X6EA 4JFXA 2VDPH 4PJDA 4FG6C 4AT6A 2A73B 5DEFA 2NYYD 3ROLA 4D9LL 1TZGH 2ADGB 1RULH 2VDRL 2GY7B 1U3ZA 3FO1A 3L5XL 4W6WB 1TQCC 4KK5C 2CD0A 3U0PB 2EEBA 3VDAA 3RNQB 5I6XB 1ZWIB 4X6BB 4PJCA 1R3KB 4PBWD 1CFTA 4AL8H 4OZ4B 4PJHB 1GGYA 2HVKB 2J12B 1HIML 1LMKA 4PJAB 4Z7VB 3B6SA 3RFZC 4Z6AT 5C0CB 3WJLC 2ZUUA 5HHQA 1ZSDB 4UB0H 1DQLL 5GSVA 4OZFH 5T1LB 4JFDE 4GKNA 2W1NA 1NCCH 1MCQA 1V3MA 1TJIH 3MRDA 3PWNA 1YMME 3ARUA 4P2RD 4XP5L 5HXMA 1L7IL 1L6XA 3CMGA 4HJJH 3MJGX 5BXFA 1DDHB 5SWQB 1LEIB 4N0FB 3D25A 3K1KC 4NOFA 3ZDZE 4X80H 3MLZL 2VLJB 3O9WC 3QFDA 4OCXL 1E0OB 1CQKA 1JBJA 3CFCH 1UWXH 5CS7A 1S3KL 3TGXA 3RDTD 1BF8A 4F7PA 1RJZA 3ZE0E 3BKYH 5D7JA 1A6UL 1RZGB 4KI5F 4YDVB 5F88A 1T22A 3QR2A 4KKLC 4AM0B 5FUZL 4U6YB 1AR1D 4WHTB 1TJHL 5HGGS 3AXLA 1H5BA 1A47A 3NFSH 3BUYA 1KFAL 1JZ7A 3T3ME 1DUYA 1HCFX 1MJUH 2PYEB 3O2DA 3ULUL 1VA9A 2O93L 5JLZB 3C5JA 2ZPKL 5C71A 4MX7A 2F5BL 4UI2A 5GGRB 2YHGA 1DN0B 2VAAA 5IMKA 4RGNE 3V6OE 1KJ3L 3QULB 4D2NA 1XR9B 3MLRH 4RRPA 4B41A 3ULVL 1J1XL 2J5LB 2WNGA 2DLIA 3IF1A 4ELMB 2WQ8A 1D9KD 4GRMA 1CFBA 3KYOA 1ZMYA 3LRSB 1W0VB 3L95A 5ESQA 2ATKB 3ULUF 5HYSG 4EQ2A 4O2CA 5IOPB 2PCPA 2R69L 2EC8A 3KPSD 2VTFA 3EYQC 2E27L 5EUOF 1XH3A 3TBYA 4ZFFA 3W2DL 5C9JA 4QNPE 1KEGH 5BZWA 3LKNB 2MCPH 4OZIE 4MQTB 2CRIA 4I77H 4OCYL 3M8OH 4JY6A 2DMCA 3IFPA 3L1OL 4P0DA 3SKNB 2OCFD 3WXVL 4I9WE 3SDYL 3L7FA 5E9DD 2UUDH 5C09E 3V5DB 1AD0B 1RY7B 4CNIA 4OCRL 4M5YH 1NMCB 4M6ML 2C4FT 4L3EB 3GSWB 5CZXD 2ERJB 5F7MC 3CZFB 4G6AD 3T1FA 1J8HB 3D3VB 3BZ4B 3T4AA 2JLLA 4EXPX 3I9GH 3TA3D 3IRPX 1FPTL 4O9HL 4ZAKB 5I1EH 3QNZA 2NY2B 4GBXB 1JGLH 5F96L 5DFVC 5T1LD 4LU5L 1T7ZA 3A67H 4NYLA 2VISA 3ARED 1H8NA 4NO5B 3WFCL 4PR5A 1ZLWH 3VFUA 1S9WA 3DI2B 1MCOL 3DX6B 3MBXL 4KKLD 5CZKA 1LO0L 5DRZA 3FRUA 4NPYA 3ARFB 5C0RH 3P30L 2X4OB 1I3RB 1A6ZA 3VWJA 4FZEH 1NAMH 4FXKB 1I7UB 5HYJE 1ZT1B 3TZVB 5T5NG 4U3CA 4MNQE 3MRIA 4GW4B 4JFEE 2XKSA 5CILL 3NABH 3SCMC 3IDMA 3EJYC 4YHIB 4PJFE 4F58H 3VDCA 3BKYL 2M1KA 2WINB 3WNNA 2NLJB 4NRZA 3Q3GB 2H32H 2P5WD 1QFPA 3IDYC 3NA9L 2A6JB 5ADPL 5FGBA 2EXYD 1F8TL 3BZEB 4EZMA 1E27B 4HUKB 1YQVL 4DTGL 4X6FA 4JFHE 2ARJB 1GC1L 2P8MB 5IW1A 5IJVB 1E28B 4UDUB 4IRJB 2L0DA 4EQ3A 3RWIA 1H15A 4IJ3C 2H3NA 3SDAA 1IQDB 1G7LB 1OAZL 4FFYL 4QRRE 5JO5A 2B4CH 1MAJA 2CLZB 4XBGB 4F37K 1ITBB 2JF1A 4JAMB 4O4YL 2ADJB 3MLPA 3X13B 2IMNA 5CJBA 4ONOA 3HNVL 1PZ5B 4PJXB 3TBSA 3L3OA 1XCTA 3K2UH 5JXED 1M7IB 3GSOB 4QT5B 3L7EB 1QKZH 2RIKA 5MEPA 3LS4L 3QHFH 3LKPB 1N26A 2G5RA 2KBGA 4EI5C 4GXUN 1CFNA 2OL3B 5DD5L 2P8LA 5FDWB 4TTDD 1RURH 1OL0A 3S37H 5M95B 4Y19B 1BBJA 2NR6D 2VDNH 1I1YB 1VACA 1IAMA 3DVFA 3HNVH 1O7VA 4M5ZL 3RKDC 3BI9X 1NCBH 3HG1A 3W11C 5C6TL 2D7TL 2R2EB 3QUYC 5IJKC 5E56A 4PRDB 2BDNH 5DR5L 6FABH 3MREA 5B38G 4RMSA 3EOTH 5JIPA 5EU5B 3K8LA 4OGXL 4Z7VF 4CVZB 4K7PH 2OR9L 4C83A 4QXUH 3TCLA 4PRPB 1N7MH 2LVEA 3RP1A 5MEQB 3IT8D 5BZDA 3GJFB 1KPVB 2HFEA 3MOBH 3P0VH 4H5SA 4NFCA 3CLFL 1QSVA 5F7DB 3VMOA 3S6CA 5DJ6B 3OV6A 3QWRD 4KVNL 1SEBA 3RQ3A 2Q76B 2V17L 1LK3H 2E7BA 5FO8B 5HDOA 5T5FH 1NFKA 3UJJL 1CT8A 3SDDA 4LK4A 2W91A 2AXFB 1NJ9B 5C08E 1ZHKB 4NZJA 1YY9D 2MPAH 4FQQA 4MDJB 4ODSL 1MFDH 4UT7H 2GFBA 4YGVB 1I1AA 1RZJH 2DLHA 1U91A 4ZQKA 1KELL 4YIQB 1F3JB 4Y5VC 2HJFA 5DURD 3GEWB 2LV4A 5E4IA 2X6MA 4HH8A 3SCMB 2K1MA 2GK0A 4IOIB 7FABH 1W72B 5GRYA 3QUMA 4Y88A 2ZWLT 4RX4D 4NZUH 3EO9H 5JIIA 1HH9A 1B6DA 1KGCD 1AXSA 2HFGL 3L3GB 4ZSOE 4GJTB 2WW8A 2R56L 2R2CA 2NXZC 1UQSA 3VFVA 2NZIA 2R15A 3MJ7A 2DQTH 3AM8C 3W11D 1LNUB 3P77B 2EXYC 1LEKA 5HYJD 5KSAC 1DE4A 4PJDF 2HJKA 4HKXB 3MRFA 3DI3B 1MCKA 2EDDA 4UTBL 5IM7B 4CMHB 1AFVH 2GY5A 4L3ED 1U8HB 2V9TA 4KROC 2V9QA 3KR3L 5H94A 3WSQL 4XGZA 5E9DB 2XYCA 4PGJA 1DQDL 2C3GA 1LK2B 3X11B 2BHYA 1C5BL 1S7QB 4KFZC 3FZUD 4L4TB 5E0QA 4FP8H 1I9JH 1ORSA 4YE4L 1ZLVH 4L3AA 5DJYB 3CXDL 3B3IA 4K2UH 1P1ZA 1MWAH 5D7KD 3QZWB 4WW1A 1IL1A 5HVHB 4YDIH 5ICYA 1XGYL 4Q9RL 3VDBA 1VFAA 2MQ3A 4NQXA 4CGTA 1FZMA 4BSWB 1ZVHA 4JRXB 5A40E 1CDBA 5C6WH 4G6MH 2NCMA 1KTDA 3P4OB 3CFJB 1WISA 1CXKA 1MI5D 4JR9H 1MCWW 3VXPA 3OKMB 2DLEA 1HZHH 4Q0XL 2L7UA 2CIKB 3ARDD 3TJHD 2VZVA 3H9HB 1B9ZA 2OSLB 3BGFB 4Y2DD 1VKXB 4MXWL 4NQCB 5IB1A 3KPSE 1K4DB 4Z7WB 3UJJH 2RGSA 5CEYB 5GRXG 3UPRB 5BRZB 4XT1C 4ZO7A 1DN2A 3L5IA 4E5XA 4EI5B 2W92A 4GT7A 4U6HA 2YD4A 5EORH 4K3JL 2KL6A 3FQRA 1FZJB 4JHZA 3VH8G 4YHLH 1YYML 1H0DB 4BQ8A 1TVBB 4EIZC 4HGWA 3RY6A 1F4XL 4Y0GA 3CFKB 3TVMD 2OM5A 5I75B 1Q0XL 5GRZA 2FX8H 2DAVA 3LN4A 5FHAH 1IAKA 2BSSB 2Y36L 2BNRA 4N0RA 1A0QL 2CDEB 4FQIL 1WBXA 3CLEH 1ZGLA 1U3HB 3BESR 4MS8C 5ID1B 3RGHA 1X5ZA 1U0QA 4L8DA 1C16A 4R26L 4H20L 4GLRH 3B9KB 5JHDD 4OUUB 3CFBA 5E08L 4TOYL 1R3IL 4NCC1 4ZXBC 3WMSA 2PYED 4XBPA 2EYRA 4DK3A 2AKRB 5JHDA 4XB7A 3LQAC 2Z4QA 3OKOB 3MGOA 3RIAF 3F7QA 4QTIL 3ULVC 5E8OB 1AJ7H 4ZUSB 3MRNB 1N5AB 3RTQA 3SQOL 1QLFB 3CDCA 1SVZA 4JM2A 2FL5A 4PRIE 4M6NH 4U1HA 3MZGB 5F9JA 4AIXA 2OZ4A 4Z7UB 3HRZB 4UBDC 2DQEH 2A6KB 3IETB 4XH2A 3BVNB 2DKUA 2VAJA 4YHMH 3VXQB 2ORBL 3VFWB 5C07D 3H3KA 2FHBA 1EX0A 1RUKL 4HXAL 1BF2A 2FHFA 5AWNL 3S3PA 3L5HA 1QRND 3W39A 2OXHA 1JF1B 4ZUWA 5D7LA 3H42H 2WV3A 1AR2A 4ZS7L 5GGQL 3VWKA 4MD0A 3GMLB 5E00B 4O9HH 2VSCA 1T0NA 4L4VD 4JPIA 2I60H 1QSFA 2KKQA 3IU3B 4ODXA 5DFVD 4ZMAT 1BJ1J 3GIZL 4YHOH 3UJTH 3BP7A 4XP9L 1LDSA 2JB6B 2NY4B 1CLOL 4UILH 2YPKA 3MOBL 3CJJA 5JIKA 4YHZL 2X5PA 3FQUB 3FRPA 3WFHB 5J6GA 5HHPB 1BD2A 4U0RB 5M7QA 3QDAA 2KDGA 4KUCF 4RAUB 4X80L 3QUML 1CFVL 3BAEH 4XPTH 5I1CH 2HFFB 3PV7A 1INQB 1PKQB 3ROOA 1WCBA 1AH1A 1ETZB 1UKTA 5JDSB 5TF0A 5EIVA 1BVZA 4F7EA 4P4KA 4LNVA 3GJEB 5D6CB 5EBWA 1RJYA 1JZ5A 3SY0B 1X6NA 3NAAH 3ZKXC 4CW1B 5I18H 5L2KA 3OKKA 2AJ3A 1OB1A 4NO2B 1I4FA 1RUMH 3D6GA 4DQOH 5FEBA 4JDZA 4J4PD 3D5OF 3QEQB 3VXRA 2GYSA 2IFFH 1QRNE 3MCLL 4OFYA 2XWBB 4QRPD 3V79C 5CBAA 5C92A 4R7DA 3MNWB 3FFCE 4V2BA 3LH2L 4H1LA 3MV9E 1IGYB 4D9RE 1K3ZA 1MJJB 3WBDA 3MBED 5ILTL 3HN3A 5HGBB 5B8CB 2LABA 4PJXF 1F8TH 4Z9KB 5ILTH 2IALB 4U6XB 5IB2A 3FOMB 1UFUA 2BXYA 2YC1B 1HQ4A 3IXAB 1KEGL 1PSKH 1P4LB 3HR6A 4ZAKD 3THML 5KN5A 1T20B 4CDGC 1EEYB 3DHMA 4J1UB 3T1WA 2IFFL 4OBSA 2R0WH 3EBAA 1AXTL 3QPQD 4JFFB 4XVSL 1BFVL 1TCRB 3S97C 3O6FC 1OTTD 5D7SL 4KH2A 1CGYA 3VRJA 4M5YL 1XCQB 1T21A 2IEPA 1WLHA 4U1LA 4XC3L 1HE7A 5IB5A 3ULUE 4FMFA 4M1DH 3G5ZB 4YBQC 4XCNB 4C54A 2DWEB 3GKZA 3GMRB 4G5ZL 4IOSD 5TE7H 2EH7L 3QA3A 1OT2A 2VUOA 3O2VL 2XA3A 3REVB 1FCGA 3MNVA 2D9CA 5CEXB 3JV4B 1WWWX 3O3BB 4JDVB 2HKHH 1ZAGA 1JPSH 12E8L 3FN9A 1B4RA 4LCCA 1BJ8A 4RAVA 3GSXA 4MDIA 3QDJD 3ZYIA 4R7NA 4U1MB 4HIEB 4M6MH 1JNLL 4FZ8L 1CQYA 4D9QD 3EZ8A 1GGIH 5GQBA 3LQZB 4HUXB 1GHFL 2BOCB 5BJTB 4AEIH 4HUUB 1A4JB 5FCUH 1EERB 4MGXA 5CILH 1I1AD 3U9PH 1N7ML 2XY2A 3MFFB 1YEKL 2NY5L 5JW3H 2VMFA 1MCJA 1TJIL 1NMBH 4MJ2A 2E7HA 2B39A 3Q6FA 3RZCB 4YZFF 5DTFB 1P7HL 1KIQB 2BY0A 3QISA 4DAGL 3O2WH 4M7ZB 4D9QE 2QADD 1CVSC 4QF1B 1JN6A 4JHAH 4AH2B 1CD8A 2XZZA 1LE5A 4MJIA 5ICXA 4A2MA 3W9EA 4DVRL 4DCQA 2NY3D 3HC4H 1HYRC 1WBYA 4OCSL 2ICWB 1G7MA 2CUMA 1H5BC 3KPPB 4I4WA 1Z5LB 3H42L 4H0GA 5MEOA 3IXTB 2CJUH 4CRPA 2CO7B 1IC7H 3D2UB 5FKPB 4QRTA 4JFDD 4UT6H 3DMMC 2HTKD 1N2RA 4EVNA 4I3RL 5D7IB 1RUAL 1S9XB 4ELKB 5JNYB 3ARYA 4UILL 4XHQA 5I1IL 5DUPL 1HYSD 2GUOA 1CTNA 4MHHI 4XMLL 2W0FB 3MJ8A 1IKFH 3IDXL 5AG8A 1D5XB 5EUOA 3O2DH 1RFDL 1KF9B 5ENWA 1KLGB 4NKDA 2VLKB 2EIZB 4ZS7H 1U8MA 5FKAB 3ZKXB 4YXKH 4G9FA 3DXAA 3V4UH 2A0LD 3RWJB 1QBLL 5EU3A 1FJ1B 4MA7H 1IM9B 2UUDK 4FTVB 3UYOD 1YEDB 1D5MB 4WIQA 4E41B 4PY8J 5BVPH 4HIXL 1SJEB 3V6FB 4QOKB 2NY4C 4LDOB 1KB9K 4TUOA 5JPNB 4L8SB 3ZKNC 3SDAD 3GI9L 4HUWB 4OQTA 2XZCH 2GKIA 5IQ7L 3ARRA 1GAFH 1HH6A 3S35X 4MQSB 4JZJC 4DQOL 4Q6IB 3C5ZA 3W9DB 3DV4B 2IQAB 4P57A 2XIDA 4H8WC 1JPTH 3L3IB 5I16B 5I1KL 1U8KA 3G5YB 1IGIH 3S9DB 8FABA 3MC0A 4OD2A 1X5IA 3U0TA 3FFCA 1FRGH 1EA9C 4OLZL 3DRTB 5FOBA 3FQWA 4N9OB 3BRGC 1YEIH 3UTSE 1C7SA 1BAFH 3P0YH 5GIRB 1VGKA 2NY1C 4EI5D 1E6OL 5MEND 2F9BT 4Y4KC 1D6EA 5GS1A 3T2QA 2KUTA 1UC6A 1X5HA 2RFXB 5T3XL 3MBEA 4X4YA 3BN9D 3EYVB 4E42B 1PG7L 5IV2A 2FWOB 3HI1B 3MGAA 2P49B 1DP0A 5E08H 2O5XH 1G6RH 2HJLB 2PW1B 1JWMA 2C7UB 1NC4A 4H88L 1S7XB 4C55A 5KSBB 4GRWF 5DJXA 2AEQH 3OHXB 1UVQA 5GRUL 4NO3B 4PYGA 4PTUA 1TTFA 5C0BE 4X9IA 3WUWG 2R9HC 3RVTC 1F4XH 3P4LA 5HHOA 2Y7QB 3G6JA 5DSCB 3QQ4B 5DZLA 4I1NB 1LQSR 1OGAB 2E8YA 3GK8L 3KWWA 4A6YA 1F4YL 3LQAL 1EUTA 5I9QC 1AKJA 2MWCA 1FDLL 3CD4A 5FECB 5EWIL 3MLXH 1CF8L 5HDQL 4KWUA 3C9NA 4WDIA 2HT3D 4YH6A 5AD0A 1IEHA 4LKCB 1OTTC 5D96B 5FYLD 4M5ZH 5CEZE 3QNXB 4J3TA 3PWVB 4UV4H 2QEJA 1G7QB 1CG9A 2CKBL 4UTAH 3UX9B 1WFTA 4PRHE 5HYFA 3T65B 1MAKA 1HXYB 1UADC 1M71B 3G9VA 5J13B 1S78C 4LKXA 4PJBE 1DBBH 4J12A 4FHBD 1R3HB 4ZFGH 2IGFH 3TIEA 2MKLC 2J88H 3ET9F 5EWIH 4CL7A 3UP1A 5EUKB 4BQ6A 1ZVSB 2EDNA 5IP4A 3OAUH 4AZ8A 4PJCE 4PRIA 1UM5H 1A1MA 3QXAA 3QXDA 5CJXC 3SKJL 5D9SA 5DD1L 2AJSH 3RGVD 1RK1A 3VXSD 3WV0A 3BSZH 5IGXH 2VDQH 4S11A 4NCC2 5DQ9B 5LGKA 3WFDH 1WAAA 1YEKH 2NY5H 4G80B 4O58L 5FYJD 4G9DA 3BQUB 3NGBC 4MNHB 4JN2A 5HY9B 5HTSA 4RGOH 3ZYOA 4POZD 1J86A 2L4OA 3DX9B 5D1QB 4G8IB 1N6QL 1NCWH 4XP1H 1XIWD 2GJZB 3N1GC 2A1WH 4KXZH 3N0PB 2X9WA 3NIGE 2R29L 1FL5A 1T3FA 4NN5B 3A6BL 1Z9MA 5MI0C 3VD4A 2VXQL 1ZANH 3VXUE 4ZNEE 1M4KA 4DZ8A 1BIHA 1SBSL 3F7VA 4RDQF 1WTLA 2RJMA 2DBLH 1MRCH 1P5VA 2FBOJ 2AEQL 1A9BA 1BX2A 2BNUA 4U2ZA 2C4FU 4N0YL 2K7PA 4NO0B 3C08L 3X3GH 3RWCA 1B0RA 5E8DL 2YK1H 4MJ5A 2H26A 4IOFC 4OF0A 1SJXA 4Q6IC 5FB8B 2CIIB 5EU4B 5I71B 3S34L 2EYSA 2OQJA 5MHSD 5D7SH 3FTGB 2JJVA 5L8JB 1PVHA 2X40A 4HZLA 2OL3H 2R4RL 1FG9C 1JNNH 2HLAA 4JM2F 1HQRA 5FAAA 5L2KD 5FYKD 3HMXH 4WFED 5DO2D 4LNRA 2LVCA 2YRZA 4M48H 3O6FD 5I1HH 3E3QC 5FM5M 1S7SA 1AY1H 1SJVA 4UTBH 4P3DA 3IGAA 4Y4FC 2NXYD 4TSCL 4YFLF 3WIIL 1X9QA 2NY1D 3QEHB 1O5DT 3ARGB 2H1PL 3BP5A 4PJ7E 2VZ3A 1DVFD 2CK0L 3BJLA 2QBWA 4HWBA 4BSJA 2PTTB 4L8SC 4O2EB 2V5YA 4M62H 1QUNA 4PJBA 1V3JA 4XP5H 5L2JA 2NXZD 1Y0LA 4PRHA 3PWUA 3I50H 3IJSA 1X4YA 4R96B 2J8UA 4NJAH 3NPZB 1ZEAH 1LO2H 4P2YA 2VQ1A 4OZIF 5DWUL 1FYTD 3KGRA 2DS4A 1M05B 4QWWC 1U6AH 1S7RB 4EUPA 5HHXH 1VADB 1KCVH 2J2ZA 3UTSD 3DHJA 3HPLB 3SE4C 4OLVH 4D9RD 1I9RL 3VD5A 4R96A 3I6KB 5J12C 5HHME 1EEZB 2HWZH 3LZFL 1RHHA 3KPNA 2BNQD 2NY5C 1JHLH 1KGCE 1JNHA 4XBEH 4K8RC 5K9JH 1KIPB 2HN7B 1ORQB 2JCCB 1QEWB 3ILQC 1ZHBB 5F9OH 1VEPA 5D70L 5GJSH 3G6JE 2N4IA 3IAPA 4H26B 2LU7A 3CFCL 5B4MC 1VENA 4ZTPH 3MX0A 1MREH 2H32B 1MFCH 2AABH 4RFEB 4DJMA 1NCDL 2G60H 4GAFB 4Y7MA 2GSIB 4ZUUB 2NY2D 1YUHB 2V2XA 4G3YL 1GGBL 4GBXD 3BRFA 2ATPA 3TH2T 4GRWB 1AGEA 1NEZA 1BFOA 2GT9B 4ODUA 5D2NA 3CAFA 3LV3B 4EBQH 3B8YA 1Q9KA 3D39E 2AK1L 35C8H 1OVZA 4PJ7F 1S5IH 2F53B 1ZT4B 3GMPA 4LHUG 4EN3C 3ZDXF 5T3ZE 1HINH 3UTSA 1K85A 3TN0A 1ADQA 1NGXA 4MNQD 3LPGA 3QXTA 2Q6WA 3S37L 1B2WL 3PP3H 1ZK9A 3C8DA 3BWAA 2D9QB 4X7FC 1OP5H 4XCYA 2YPVL 4KDWA 2HT3C 3H0TB 4HCRH 4KI5E 2AQ1A 1R3LB 2LAAA 3LY6A 4MA7L 1HHJA 3VG0H 3F12B 1EFXB 3WIFB 2EEAA 3EOAB 3TBTA 4JY4A 1IE5A 5F6HI 2AJYH 3IDJB 2W65A 5E1AA 5FA4A 1S7UB 4UUJB 4AIOA 1FVEA 3C5ZD 4FFVD 1BVKB 2GITA 3DGGA 1RUQL 2J8UF 2Q86A 5D6DA 2VLLB 3DX9A 2IFGA 5D1QA 5EU7E 1L0QA 4V2CB 2ICEB 1YPZB 3DXAE 4JN2B 3CH1A 3VG9C 2GTZA 2PUQT 1IZKA 1IT9H 1VFOA 3NCFB 3OZ9L 5EUOE 1WWBX 3OL2A 3B5HA 3A67L 3NFPB 1CLOH 4LLWB 4HIIA 2QHLA 4PJ5E 4J7RA 1HSAA 1X7QA 4IDJH 1JI1A 2X1WL 1UM6L 3BQUC 3NGBB 2X70B 1MPAH 1H8SA 1U3YA 3CSGA 4OIIL 1TVHB 3TPUA 5ID0A 4X9BA 1ZVSA 3HR5A 3LIZL