4Z7WB

T316 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
187
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 180
sequence length 187
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7wB01
4XRCA 3AROA 3VFGL 3MLXH 2B4CC 3MCG1 4WUUA 4OFKA 5IF0A 3FOLB 4OB5L 4IBLT 1EEUA 3U2SA 3S88L 3W2DH 2PTVA 2L7UA 4NZUL 1K4CB 3O0RH 3QDMD 1T22A 3GJEB 2HN7A 4WHTB 1KN4H 4ODWA 1TENA 1MREH 2CIIB 4LCWA 5MEOA 4YDLB 5JOFB 4UV4L 3PE9A 1I3VA 1Q9OA 2CRMA 3MLUH 3MV8A 1YMHB 1W0WA 4GG6B 4R7DA 4PB0L 2EXYC 4KQ3H 4PJ7E 4Y4FA 2PR4L 4E0RA 4QRRE 3WFEL 1IGCH 2GITB 4XNZC 3ROOA 3D3VE 4NQDD 1BZ7B 3ES6B 4BZ1H 1D5ZB 1FO0A 1S7TA 1FVDB 2VTFA 2JELL 5DYOB 4WDIB 2R0WH 5J13B 3EJZC 1K8DA 3FO1A 3KPRD 2ADJB 3L95B 4YDKL 4RISL 5DMKB 3KPOA 1R3KB 3VMOA 3FQTA 3H7LA 4FRWA 1HH6A 4JRYD 4S11A 4F58L 3HNTH 1JGLL 3QI9B 4Q9CA 3M8OL 1P4LB 1CD0A 1TJHH 2CKBL 3ZDXF 1CN4A 5CWSB 4KRLB 5GRUH 1D5XB 2BHUA 3C6SB 3EYQD 5ALBH 2WUCL 4QXTB 4PJFE 1UKTA 1UC6A 5E2UL 1BLNB 1EHAA 4K8RC 5DJZA 3TFKD 3C60A 4NQTA 2VDLH 1MHPH 4LNRA 2I9LB 4LSRH 1QR1B 4UT7L 1EFXA 4PGEA 1XGRB 4ODSL 2KL6A 4E42B 1RJZB 5DQ9B 3MA7A 3ZE1F 2AI0H 2BVOB 5FCSH 1ADQA 3CDFA 4PJBB 4X6BA 1BBDH 4LLVB 5LWYL 3DETD 4KI5D 1MSPA 5I2IA 3CSGA 4PJGF 4ZOBA 4P46C 5EZIL 3KS0J 4QGTA 2IADA 3DSFL 4JVWA 3HRZB 2EO1A 2APVA 3QNXA 3ZHLA 1WEJH 3CVHA 4PRAA 3MRGB 4PRPD 4FG6C 4LSUH 5DWUH 3HZKA 1YNKH 3TBTA 1A6ZA 4OM1H 4TTGA 3TJHC 3SGKA 2ZCKH 1Z9MA 4KMTL 4R4BB 2H26B 5GIRA 5D5MF 2CGRH 3RL2A 3QWOB 5J7CC 4HXAH 4W6WB 1KCVL 1JHTA 5K59E 4G3YH 1WCBA 3RVUC 4DQOH 3UJJL 3PWPD 3RI5K 3QQ9D 1CVRA 4GBXB 4UTBL 5I9QC 1A22B 2BY2A 4UDUA 4OD3L 3O3DA 3DV4A 4JY5H 4G8FA 1JNNH 2J1KA 1GL4B 3AY4C 3LQAH 1NCNA 1RZIA 3MGTB 4KRNA 5CEXA 4TUJB 4WW1A 5DUPH 1SMAA 2YUZA 4QHUB 5DJ8B 1A6WH 5EO9B 4OQ1A 4POYA 4I18C 1AI1H 2CPCA 4HX1A 5J57B 4BUGA 4MCZB 4KAQL 3VFNB 1V5JA 5CSZB 3TEUA 5JDJA 3BDYL 5DGQA 5SX5H 1IGIH 2Z8RA 4AIZA 3VMPA 1FNSH 5GS0H 4X83A 1OVZA 3S37L 2G75A 5JLZB 1MWAB 3MV9B 2VLRB 4YE4H 3JWNC 3TBSB 5BZDB 5BVJA 5KG9B 1ZS8B 5C07D 4QHKJ 2N1KA 4L4TA 1MLBA 1T1ZB 3KLAB 2DQHH 5IMLB 2BSTA 1A0QL 2XICA 4PY8J 3DO7B 4KQ4H 4QEGA 3NABL 5IBTL 3ULVC 2X4OA 3MO1A 1N4XH 4ETQA 4JFFB 5EU5A 4LMQE 4ZUWA 4UIKH 5EUOE 2W1NA 4MAYD 3LRGA 4PY7A 3ZKMD 4NJAL 5HHXH 3QNYB 4KK6D 5D96B 1P4IL 3PV6B 3AU1A 2XRAH 4XBPB 1EEZA 4D2NA 2IQAA 4F57L 1HN1A 4WU7A 3FCTA 5BV7H 3NZHL 2PYFA 1NGQH 3VD4A 3VFOB 5A43C 1RV6X 2NY7H 3RBSA 3WD5H 2WWKO 5GGRY 3CU1A 1G7PA 1WCQA 4GKNB 1QNZH 3O3AB 4JZJA 4PJAB 3VFPB 3WFCH 2IMNA 1N7ML 1XGPB 3IU4L 4A2LA 5I1JL 2DDQH 3FQWA 1QFOA 1RVFL 4MNQE 4O2CA 3SGDI 5GS1A 2EYTA 3N1FC 4OGAD 2QEJA 4G80A 2ATKA 5C0JA 5HGHB 1YY8A 4GW1A 4YH6A 5J89A 3CMOL 5DT1L 5HPMA 4R4FL 3B9VA 1HEZA 4XVUD 2Z31B 1R5WB 1MI5E 4JN1H 4HZLB 4NO0D 1D6EB 4L8SB 2I25N 3VWKB 4GAYB 1MAJA 3ET9F 2EDNA 1NMBH 5T33H 1X5GA 4NQEB 1KNOB 3GGWB 5E6IA 3ELAT 5JO5A 3OXRA 5F1IA 1IZKA 4BSVA 4ALAL 4CW1A 1KLGB 2DYPB 5ESQA 3LEXB 1A9BA 4Z5RA 5BOPA 4UV7L 3WE6B 5I1IH 5TPWH 3SDAD 5I76B 4K23L 3CFEB 4JFEE 2NZIA 1GVIA 3AUVA 1AO7E 4YZFE 3O45B 4X4XB 3IVKB 4OV6F 2IPKA 1KCLA 2FBJL 4LLAA 5D2LF 3G6AB 5C0CB 5CEZE 2HMIC 3PWUB 2DIJA 2X41A 5L2JA 5IVZA 1KEGL 4QY8A 3DIFB 2CD0A 3QCTL 2F19L 3JTSA 2NXZD 3PL6D 3ARBB 5CP7B 3D39B 4QOKE 1MF2H 2Y06H 2DBLH 4YBHA 5KOVC 5FB8A 1MJ8L 1C7TA 3LH2H 2C1OA 4XPGH 3U7WH 3VFRB 3IDJA 2VN7A 5ACMA 4JFQB 2JIXD 2G5RA 4YGVA 5JDSA 3TV3L 3T3ME 2HFGH 1Q9KA 3CUPA 3VH8B 4L3EE 4PJIE 3ZL4L 4D8PB 5C0ND 5D7JD 2M2DA 3BPLC 1YEKL 1MCSA 2OJZH 3HE7C 4MNGB 4MA8L 3U36A 2YD3A 2JLLA 2UY7A 3DX9B 3V8CA 1WTLA 5FA3B 5TDOA 1GZPB 2XZCH 3H2WA 2IANA 4I0PA 1TDQA 5T3ZL 4XBGB 5F9WB 4XCNB 3V7AE 2E6PA 4F7CB 1G6RH 4PTTB 5HYQB 2AEWA 1XFPA 1FQ9C 1T03L 2LABA 4PJ5E 5F8QC 5DHVA 1LP9E 3QUZC 4CVXB 5GRWA 4GRWE 1ZKAA 1CL7L 2VLKE 1PSKH 4Y4HC 5A2JH 1UGNA 3UXFA 1G9NL 1AD9A 1KT2A 3WCYA 5MENB 5EZLB 2J4WL 2WIIA 4QKXB 5I1LA 4ORGA 5F88B 4RSVA 1UT9A 4V1DA 3LY6A 3PHSA 4QRPB 2X4TA 1HXMB 3X3GL 3TBVA 3T0DA 2V7HA 1QBAA 1G9MH 3WN5C 3CFKA 5T1DH 7FABL 2W65B 1QRNE 4UT9H 4N0FB 3T3PE 3AB0C 4Z7VA 2DLFL 3B2VH 2NY2D 1QKZL 1F3JB 3IAPA 3MNZB 3O8XA 5ID1A 3TNNB 1FYTE 4IDLA 1JE6A 1WVZA 3S5LB 5TE6L 3W9EA 3VI4E 1BBJB 2KQNA 5HGGS 4POZC 1DE4A 3OKNA 1I9JL 5CUSH 5F7MC 3U0WH 5CSBA 3GK8L 3SO3C 1BPVA 1XGUA 2NY3C 2JF1A 1LK2A 3T77B 1RUQH 2DQDL 2N4IA 3OZ9L 5H94A 5HDBE 3EO9L 1U0QA 1NGZA 2YUVA 4EBQL 3U7YH 1MLCB 3GRWA 4MDIB 1DL7L 5IG7B 4KRPD 1OTSC 1PKQB 1FNGA 4HK3J 3H9ZA 3MRBA 4K3DL 5E08H 5T3XE 4WEBH 5ALCL 3QFDA 4HC1A 5AWNH 3PF2A 1RIHL 1QSED 4Y1AD 4I5BA 5EIVA 1N64L 1H3PL 5F7DB 4Z7WA 1DCLA 1NC2A 2OYPA 1I8LC 4C56B 5CAYB 3UTZA 1KG0B 1VCAA 1S7WB 4LVOB 4M9PA 1JZ4A 3CFDA 4Z0BL 5IB4A 3I75B 1FDLL 2ID5A 2BNRA 2B5IC 1R5IB 3KXFA 5EWIH 4LHQB 5CGMA 2EXYD 2X1XR 5BV7B 3MUY1 4HT1H 2GTWA 5I6XB 5ITBH 3O6ML 1CXEA 3E6HB 2QQQA 1TCMA 4YHOH 2CK0L 3E8UH 3QEQE 3MMEA 1A1OB 3EJZD 2FL5A 1QSFD 3HE6C 5LBSH 4XVJH 2XA8H 5FUCE 3EW3B 1QPPA 4LLMB 5IB5B 5I73B 1S7VB 2VXTL 3HZMA 1DUZA 2LAGB 4B0MM 4CN4A 5FHAL 1JGEA 3S96A 4MX7B 2X1PA 1N0XH 1HI6B 5D2NE 1MAML 4JO1H 4PJ7F 1TCRA 1MCPH 1N6QH 2YR3A 5GRVK 2AK4E 3V6FB 1YPZA 3CFCL 5I18H 1VGKA 4Y19D 3NZ8A 5CJOL 4K3EH 1RJYB 1IC7L 4G8GD 3SGKC 4UT6H 3OB0K 1CWVA 5FYKU 4JANA 5JPNB 1FLRH 3IB4A 4JO3H 3I6LE 3T1WA 3V2AR 5B4MC 1ONQB 3GMRA 1I8MB 3UTQA 4G6FD 2OZ4L 5DRXB 3HMXA 4B7LA 5GJSH 4HDIB 4P46D 3FQXA 4K9EL 1N8ZB 1F6FB 4G9FB 5D2NA 5I1KH 5MEQA 4Q9QL 2DLHA 2EH8L 4M7LH 1CE1H 4XP6L 3V7MA 3ARPA 2RQ8A 1U8PB 5CBEA 2FIKB 4PJFF 2XFXB 5J6HA 5EU7C 5E1HB 3MFFA 3QIWB 3RGVC 4N9GB 4Z7NF 1RJCA 1F4WH 4HHAB 5FYKH 4P57A 1TPXB 3B9DA 1U3ZA 2PNDA 5TQ2L 3DXAD 5FO9A 3FO9A 4YPGB 4JLRA 3RVUD 3HNSH 1GIGH 5H2BA 5AZ2H 4IMLA 2LU3A 1X5FA 4F7TA 3VD5A 3VWJD 1F4YH 1RK0B 4F9LA 1X6NA 1XIWC 3WUZA 5IFHL 2XN9A 3BISA 3W11C 2HT4C 1G9EA 4XGZA 2NY1B 3A67L 1IAKA 5HHNA 3UMTA 4NM4H 2E27L 3AVEA 4TQEL 3ZT6A 5DZOA 3LDBB 3KR3L 4YHIB 3V95A 2R1XA 3B6SA 5HGAB 1EJ6A 1MHCB 1IEHA 5D8JL 1B0WA 5K59F 3GMPB 4NQCD 1Z6JT 2WMPA 4PGBA 4PRID 2R0LL 3CZJA 3M07A 3O2DH 3QIUB 4OM0H 4XAWH 1RIVL 2HRLA 5MEPA 2HFEA 3V5KB 1D9KA 1CXLA 3TYFB 3QG6B 1NAMH 5DC0A 3QR2A 3IDGA 1QA9B 2VLJD 1A3RL 4OGYL 4WFED 3GSOA 2DQEH 5KSBB 4LQFH 1BEYL 3NA9L 1CFTB 1JCKA 4HV8B 3SCMA 1KF9B 5FIEA 3SY0B 3OKYA 3QUKB 4U1HA 3QUMH 3VXUE 4NKMB 3BKJL 3QNZB 2KH2B 2J12B 3TO4A 3FL7A 1UM5H 3ULVD 4M5YL 1IFHH 2EIBA 4F3FB 3VGAC 1F42A 5GS1C 2AV1A 5HHOE 2NXYC 3C6LA 2EYSB 4J4PA 1DQML 2VLMD 5J56B 4MJ6A 3JVGC 2IAMD 4PJDE 4YFEA 3S3JA 5EU4A 4M61A 2B39A 2XZAL 3HPJB 1S5HA 2KPNA 3QULB 3D85A 2ZSVB 3H7BA 1T1WB 5IR1B 3FOMB 4HUVB 4WW2B 1PVHA 4OIIH 4PJHB 5EUOF 3KPMA 1WTGT 1CD9B 1WBZB 2J88H 4OCRH 3FRPG 5KANG 1T83A 4OFPA 4OFDA 4U1JA 4PJCE 1BVZA 1I1AA 1YN7A 3G5XB 3O3UN 5HYSB 4XWGH 4CN6A 1MWAL 4BH8B 4LVHC 1CDIA 1CICD 2G5BA 1JBJA 1C8PA 1S9XB 1VFUA 1OP5K 1E4JA 3F58H 2MHAA 2Y5TA 3WFBH 2R2CA 4O58H 1NCCH 1S8DA 2AV7A 5IM7B 3WLWC 1FZMA 4DK3A 5HI4C 5T1KD 1XEDA 1BVKB 3FHAA 2EIZA 5GGUB 2DL9A 5CZVL 4D0CB 5DRZA 3JWOH 4Y2DB 4FFWC 2G9HA 1Q0XL 1LE5B 1CGSH 1KCRH 4J6RL 3G6DL 4ZUVB 4HS6A 4OZIB 3OJVC 4HKZB 5DQDL 4NKDB 4NC1C 5IOPA 1JYVA 5FKAA 2XWTB 2A9ML 3CH8A 5HJ3A 1Y0LB 1EO8H 3OSKA 4WV1C 4KK9D 1G0DA 1UCBH 2H32H 4YEEA 2HMID 3P4MA 5DK2A 3A6OA 2VDNL 2VISB 1HHJB 4JDVA 3EYSL 2R2BA 1FV1A 4Q97A 5KJRH 1Y18B 5GISH 1J8HB 1WZKA 2GFBA 2VRAA 4BH7B 2ED7A 2P5EB 5CINL 3RX8A 1OP9A 2AJYL 3QFJB 4BSWB 1A7PL 4P5MB 4Z0XA 3DHJA 3ARFA 3G5YB 4WI3A 1KELH 1SY6A 4HJ0C 1IKFL 4PS4L 4LARH 4I0PC 4H5SB 5ICXB 3GHBH 5TDPB 4YZFF 5IHLB 1IAIL 2ESVE 4JQXC 1ZHNA 3CLFH 4M7KL 5IMMA 2GI7A 2WBJC 3L3HB 3K1DA 5FUOL 1KENH 2E6QA 1LO4H 2AJSL 3SKJL 2R1WA 2XTJB 4Y5VA 4CADB 5KVEH 3BGFB 3VFSA 2ZPKH 1PLGH 3HE7D 4G6KL 3TZVB 4X7SH 1PG7W 2DRUA 5BW7A 3DVNB 4PR5A 1IZJA 2FJGB 1KSRA 1CE6B 3O2WL 1MH5B 4J23A 2A0LD 2Q86A 1JK8A 4ZNCD 3IGAA 5EOCH 3DX6B 2GTZA 3LPWA 3T3MF 1U8HB 3O0RL 2PXYD 4PJIF 4U1MB 4YHKH 3QUZD 4G7YL 5J9PA 4I3RL 1KN4L 3M17A 2YS4A 3OXSB 1MREL 3CPLB 4Y4HD 3BP6A 4HULB 3MLUL 3O8XC 1IC4L 4JFDA 3RY6A 5K9JH 1YA5A 1IGMH 3VFTB 4HWEH 3O6FA 4KQ3L 4Q6YA 5AUMB 2WINB 5T1LA 1IGCL 5I66B 5F44A 1M6OB 1KB9K 3SKMA 4MSWA 1NBZB 5KS9A 4AZ8A 2GAZA 5DMIH 1T66C 2R0WL 5JORB 3Q0HA 4ZOCA 3RWFA 4OF3A 5T3ZE 4PRHD 4UIMA 3VXRD 3KNBB 5D7LE 1LP9F 3EDEA 3HNTL 3DTXB 4GRWF 1E4XL 2GJ6E 4ZQKA 4ZXBC 1NAKH 3QHFL 1TJHL 1F6LL 2I9TB 3GUTA 2DQUH 2GY7B 3BQUA 5E4EB 5DA4A 1ES0A 3GSQB 2AEQL 2A83A 3UBXB 3GNMH 3LB6C 2R56H 2O61B 4POZD 4OLVL 4UOJA 1F45A 1AE6L 1FG2B 4DZBA 3OKDA 4LSRL 1KPVA 1EAPB 1ZA3A 2EDHA 3ESVF 1KJMB 4WUUD 1AJ7L 3PNWA 1HHGB 2NY3D 2AI0L 2M1KA 2Q20A 1DQDH 3T3PF 1JWMA 1BBDL 3CAFA 5K9QI 4NQVA 4YXKH 2GSGA 3AS0A 3K4AA 3IF1B 5EB9A 1FC1A 3VH8G 3BT2H 1I7TA 1ZMYA 3QUXB 2GJJA 1R0AL 3CJJA 1NAMB 4LCWD 1WEJL 1OTSD 3MV8D 3VI4F 5E8PB 3QDMB 4LSUL 4FZ8L 5DWUL 5FO7A 3T0EA 4P5TA 5C8JA 5HPOA 1KXQE 1X4YA 4OM1L 2ZCKL 2F5AH 5INDA 4C4KT 1WITA 4KJPC 1O7VA 2X09A 3TT1H 1A6UL 1FZKA 1FRGH 3ARQA 3GMNB 4U6HB 4QT5A 1JNLH 4Y5YA 4NQDB 4DQOL 1GGIH 1HH9B 3B9KA 3EYFA 3SDXF 3TBWA 3OL2A 4LLYB 2JB6B 3KPRB 2E7MA 4N0YH 1PD6A 3QIBA 3UROR 3NIDE 3OKOA 5CBAA 2UWEA 4DN4H 4JRYB 2LVEA 2YHGA 4KUCF 1JNNL 4N8VB 2Z8SA 2FJFB 3S8WA 1L0QA 4WNQA 4P2OA 4N8PA 3P73A 3IFNL 3TNMB 4GRMA 1A1MA 5DUPL 2P8LB 2ZUUA 3C60D 1D5MA 1EFXD 2YEZB 4NSKA 3HZVA 1NUNB 4NNYA 2O26U 1AI1L 3KPLA 4OZGB 3VXPB 3WHE1 5HVWA 3DGGA 4FQ1H 4H26A 4AL8L 4U1KA 1IGIL 1UKQA 5IBUG 3GBNH 3REWA 2ZG1A 1FNSL 1NUDA 4ELME 4FQQB 4PUBH 2BSSB 4YIQA 3CXDH 4PRDB 4HUUA 1CCZA 1UACH 1M71B 2B1AL 4DKDC 2W60B 1DQLH 1U8JA 5J1AA 2X70A 4N5EC 4KQ4L 4JGMA 4PRPB 3VW3L 4K2UH 4LSVL 3EHBC 3QXTA 1AHWB 1XR8B 2QR0B 1SBSH 1VFBA 4OZ4B 4Q6IC 2VAAA 4JRXE 1ZT4B 2OL3H 4OGXH 4UIKL 1G84A 4JFHE 4CAGA 5EOTA 5EULV 3MRNB 4PV9A 1DDHB 5HHXL 8FABB 3MJ9A 3IFOA 1BQUA 1YEDA 3PWPB 5BV7L 5DFVC 3EYVB 3ZSSA 4JM2A 1NGQL 4MVBD 3HHRB 4LRNH 1QNZL 1QQDB 1KJ2H 2H32B 4Z95H 3U4BL 1DEEA 1QBLH 2VKXA 4RAVB 4WEMB 5BS0A 1AH1A 2MQCA 3L3JB 4NQSA 2VIRB 1I4FB 2YPLD 1S7XA 3CFBA 4W4OC 4IEFB 1XGYL 2H2SC 3DYOA 1P7QA 3EO1A 3FZUC 3BOVA 4H20L 4C83A 5C0BA 5SWZA 4KZDL 3C8HA 3Q3GB 4UOW0 4HJGA 4J3OC 2HT4D 3UYPA 4IRSA 1QFWL 5L2KA 4GG6E 5ANMA 1PFCA 4LSPH 4EI6B 5LXGH 5KVGH 4MJ4A 4HF5H 1GPOL 5MP6L 2C7UB 1J1PL 3OKLA 1E0OB 3C5ZA 4JN1L 3SCMC 3MREB 4HK0A 5IMOB 5EA0H 5HHQB 2EDTA 5EU6D 2JCCB 1NMBL 5T33L 5B39B 2B4CH 5C07B 3GJEA 3IDXL 5ICZB 4WHTA 4NZRH 4KKAD 2H9GA 1A9EB 4MNHB 4WI6A 1F4AA 5TPWL 5MHSE 3GSWA 4J4PC 1BQHG 1ZLUH 4MAYB 3BN3B 4YJZL 4H1LB 2A6JA 2BRRL 5KVFH 1EPFA 4GLRH 3QO0A 2NY0D 3ILQD 5JA9A 5EIIB 3GSVA 4JG1H 4ONGL 5FV1L 1MRDH 5DMKA 4XCCH 4PJBE 1LK3H 2WAHA 1VFOA 2ZJSH 3MRPA 2D03L 1EFQA 5F1NB 3RDTC 1FYHB 4MJ5B 4S0TD 3DX8A 3KYAA 1CU4H 1MHEB 2NXYD 2DBLL 5GSRB 4OLEA 1ZWIA 5CWSA 4HUWA 5DJCB 2QLVB 2MKWA 5HD8C 4XPGL 5C08E 3U7WL 3MJ6A 4QXUH 4EDWH 1T7ZA 1ZANH 2VC2H 1BFTA 1RZ8B 5DJ0A 1NGYA 3VGBA 2MQ3A 4OCNC 4I8DA 5JTWA 4E9LA 2HFGL 3LKNB 5HDLA 2F8VA 5I75C 1VEOA 3MACL 1QR1A 3IJYA 4E42A 1ETZA 3FN3A 5BZWB 2Q3ZA 1LD9B 4K8RH 5ADOL 3ME0A 5JPMA 5DK0A 2Q8AH 4NO0B 3CDCA 3I84A 5E6ID 3E2HB 4G5ZH 2XZCL 1R3IH 1KPUB 4ZTOH 4IHOB 4MA7H 1NSNH 4JY4B 4PJDF 1CQYA 3CX5K 3MRGA 1IMHC 1LVEA 4PFEA 1R3LA 3CDGA 5J3HD 4YNYB 5E1AA 3F6IA 2B2XL 3GMMB 1MNUH 3MUHL 3F5WB 4WFFD 3SDAB 2R39A 4Y5XC 4OLZL 4EVNB 4QRTA 1UH3A 5DJ6B 1VEPA 1UA6H 5HI4D 3FQRB 2R15A 4G43A 4ZD3H 3S97C 1MY7A 3VXOA 2J6EA 1C16A 2CLZB 4D9RD 4FFWD 1A4KA 2AJXH 3P0GB 4PJCF 1EEQA 5EBWB 1G9ML 3UYOD 3IFPA 4JFPB 1JYWA 5EO1A 1MOEA 4HKBB 5T1DL 5E8OA 1KCSH 4XB7A 3AFLA 2GIYA 4P3WA 2P5WD 3RWIB 2NXZB 5DD1H 1DBKH 3PL6B 3WUWA 4UT9L 3MV9E 2VLRE 4I4WB 4F7PB 5IROA 2V7NB 3BDBA 2Q8BH 4RAUA 4QHUA 4ZYKA 2DMKA 3O4OB 4P4KC 1QP1A 2JIXB 3FT2B 4JFFE 4DKFL 1JHKH 4PJ9C 4QGYA 1KBGL 2BVQB 3V0AC 1ED3A 2FLBT 3FT3A 5D7JB 4HJ0D 3U0WL 3QDJA 3H9SB 4I0PD 4JEGB 2NTFB 2Z93B 4OLWH 1OQXA 1QYGL 1UZ8B 2HJKA 5I1CL 2FATL 4FN0A 4U05A 3TBSA 3WIIH 5BZDA 5KG9A 1LO0H 4PJAE 3M1BA 3VFMA 2HA1A 3KLAA 4RGMB 3U7YL 1PYWA 2QSVA 1M7IB 3NA4A 1RUMH 3B4NA 2J8UB 2K3TA 3IDNA 2Z4QB 4JFFA 4OQTA 4QHLB 1X5YA 4L3CB 2AJZB 2BFVH 4JG0H 4V1DD 4Q9RH 1WBXB 2EKSB 1KIPB 4XT1C 3PV6A 1AGFB 3ULVH 1EAJA 5HYSG 3CH1B 4NT6A 3ARYA 4NNPH 3VFOA 2LTQB 1P5UA 2OL3B 4K71C 4Z76A 3C8DA 4CU7A 4O4YH 5TDNA 5CKAA 3VFPA 1U9KA 3D0LA 4JPIB 3O8XD 3ILPB 4GXVH 1MVUB 1NCDH 5E8EB 1UVQA 1S3KL 3BEVB 1S78C 4JPKL 2NY2B 5ITBL 3EOBB 3DHMA 1KJ2B 1T66D 1U8LB 2ADGB 3N1GC 1HKLH 5IKCB 5LBSL 4XVJL 2XA8L 1V7NH 1J0KA 2Q76A 3WNLA 43C9B 1JFQH 1M05A 3MOAH 4ZXBD 4LBEB 2ORBH 5I74C 4L8SA 4FP8L 3EJYC 5C0CE 1D5IH 1ZHKB 4JO1L 1IM9D 1RY7B 5C9JB 5ICYB 5DEZA 2ZNWA 2SEBB 4ONOA 2W0PA 4XMKH 4NQEA 1N6QL 4EN3A 5I18L 3LB6D 3VGHA 2XG4A 5AD0B 3LAFA 3T0EC 1SEBA 2DYPA 1IGFH 2WP3T 3OKEB 2YBRA 3D39E 4K3EL 3LEXA 4PJ8C 4ZSOB 2XT1B 1GHFH 4KRPB 5I76A 5FDWB 1FLRL 1EBPA 4G9DA 5D6DC 4MA3A 4ZTPH 1JPFB 3DVGB 2DKUA 3OKKB 2EE9A 4LVNB 1BJ1H 1NC2D 1MJ7H 8CGTA 1QSEB 4NPYB 5DI8A 4Y1AB 5I1KL 3PIQB 2H6PA 3BKMH 3LD8B 1OOAA 1CE1L 1IE5A 2BNRD 4GAGH 4M6AA 5JOPD 4U4BA 4K7PY 1JRHI 3OF6A 3F7QA 1BZ9B 2OXHA 4MNGE 3CC5A 4LHUG 5CIPH 1ZHBB 2VZOA 2YRZA 1F4WL 4J3VA 2YC1B 4GXUN 5FYKL 4OCLC 4N90D 4GAJL 4AEHL 1AKJD 1JZ6A 4BM7A 5H8DA 3MSPA 4H0GA 1F11B 1T2QL 4KUZH 4J12A 2BSRA 1GIGL 3Q6FB 3P0YH 4JFQA 1WK0A 5AZ2L 4H8WC 1A6VL 3SKNA 2ZUQC 1F4YL 1H3GA 3KPPB 3PGDB 3RJDA 3UTTD 1QSFB 4KK5C 1M4KA 3HC3L 2A9NH 4TUKH 1Q9WB 5MENE 1G7JB 2Q7YB 5KW9H 5EU3B 2W59A 5LVEA 4WTZA 4XPHL 4NM4L 5KTEL 1FNFA 4JREB 4QRPE 4L29B 1KB9J 4Z9KB 2A2QT 4KPHH 3FN9A 3I6GA 4XBGA 3KYOB 3QDGA 4M9OA 2DTML 3V4VH 4F7CA 3TIDB 2OK0L 3O2DL 4Y19B 4NQXA 1UZ6E 1MHHB 2Y7QA 1TTFA 3O9WB 4OD1L 4XAWL 5IP4A 4M6OL 1B90A 1N6VA 1DSFH 3I02A 2DMCA 4G8GB 4WGVB 3ZKSD 1Z9LA 3NIDF 3F7YB 5JXAH 1XR9A 4CGTA 4ESKA 1HHKB 5DJDB 5E56A 1MPAH 4G6FB 3MA9H 2VR9A 4LQFL 4P46B 5CMAB 3UBXG 3EGSB 2NZ9C 2DQTH 4JM2C 5DEGB 2NX5A 3NOIA 2EIDA 3S37X 5FEBA 4I2XA 5FOJA 1FVCB 1XF5A 3EHBD 1UM5L 4P2CG 3WNNA 1TZIB 3SN6N 2CMRH 4Y4KC 3ULSB 3WIFB 3DXAB 3FFCA 4ELMF 1B6UA 4DGVL 1FN4A 5DSCA 4XXCC 5FA4B 2WBWB 2J8HA 2EDQA 3O4LA 3LVEA 4QRSA 4FTVB 2NCMA 4NM8H 5DFVD 1LE9B 2XN9D 1PKQE 3HR5B 1HHIA 4IRSC 3VWJB 4U0RB 4U6VH 2IPUG 2FSEA 4B41A 4AM0B 3U7AA 3MCKB 2HLAA 3PHOA 2L4OA 4LKXB 3QCVL 1V7MH 4C56E 4NZTH 5I1GH 5IMKB 1S7QA 2J88L 3FZUD 1PQZB 3KJ4C 5IVXE 1NKOA 3EDKA 3L5HA 4NQCB 4PRIB 4ODHH 5DRNA 1D9KD 3INUH 5DJYA 4MDIA 2R4SH 4R90H 1J1OH 4RX4A 2IC2A 1PKQA 1RZFH 3HG1D 5CILH 3DBXB 5TFSH 4PLKC 1JN6B 3BUYB 4IIQC 2JJWA 2IGFH 3LMJL 1IC1A 3QZWA 4E41D 3SCMD 4OCXL 1QD0A 2QSCH 4UILH 3WFBL 4ZMAT 2VLJB 4O58L 1NCCL 2PYEA 4BZ2H 2WWMC 1L9MA 4PG2A 4WENB 3R0NA 2IH3B 5LGJA 1KLUA 1I7ZB 4U1IB 5FV2A 3TO4D 3RWGA 2X42A 3WKMH 1KG0A 4KTYA 4ONFH 4NHCL 5E95B 9CGTA 5HHPA 4RA3A 4S1QH 1FO0H 2XG5A 5T5FH 3MLYH 2ICEA 1KCRL 1KJVB 5D71L 4GG6F 3NCEB 3SPVA 3C6LD 5MI0C 4J4PD 3NGBC 3AAZB 1WFOA 3LZFH 4Z7UA 4ZUUA 5C70A 1H5BB 3WXWH 1EO8L 3BH8B 1MCDA 1P84K 4GW5B 2W0FB 2IAMB 3VDBA 3D85D 2Z91B 3F7PC 5KJRL 5EFIB 1T5WB 4LLMA 3IJHA 3P9MA 5IB5A 4RMVA 5FYLD 2VXQH 4G9FE 3PQYA 2EDBA 4ZS6C 2DICA 2ZSWA 4S1SH 4UB0L 1I1AD 3GHBL 1PKOA 4FQJH 4K07A 4OFIA 3ARVA 3VMNA 2AS5M 5IGXH 4O2EB 3H9HB 3CLFL 1HE7A 2H2PC 2YD1A 4EXKA 2IALB 1XGTB 4KDWA 1UEYA 2BCKB 3QUYC 5E2VH 2X6MA 4PJBF 3CVHH 1CICB 4H88H 5KVEL 2ADFH 2CUHA 1PLGL 3S4SB 3I6KB 4YC2B 1FL5B 4A6YB 3MLZH 4LQ1A 3BGMB 5E9DE 1A6AB 2K7PA 2X44D 5T1KB 2FEDC 4XWOC 5B8CB 3SDDA 2XFXA 2FB4L 2X40A 3HUJB 4G6AC 4QRQA 3IU3A 1U8IB 1L7IH 3QIWA 1UCTA 4YHKL 1VACB 2ZOKB 1WZ1H 4F9PA 1S9VB 2QKIA 2EE3A 2H3NA 4YPGA 1GGYA 1TQBC 1IGML 3OB8A 3AM8A 4OF6A 3MROB 3AMLA 5D1ZC 3KYNB 4JO2H 5CIPB 4NP4L 1RK0A 1LEGB 3UEZA 5IQ9A 1RZKL 3TESA 1U8QA 3QHZH 1MFDH 3B5HA 4OCYH 2ICWB 3OJ2C 1CFVL 5CS7A 5F93C 5EZJB 3VXQB 1U8OA 5KSBE 1EGJH 1MCEA 3ZYJA 4AENA 4H1LG 2NW2B 4PIRF 2PCPB 3ECBB 3C5SB 5BOZG 1NAKL 2YD9A 1ORQA 2BZDA 2FHBA 1MHCA 1BD2A 1GAFH 4KKLC 4ODXB 4YX2H 1ZGLA 2DQUL 2VXUL 4I9WD 3IDIB 4HFWA 4YBLC 3GNML 3LKRA 2JJUA 3EYOB 2O5ZL 4X0KA 3QG6A 3BPLB 5GSVA 2E9JA 43CAA 2RB8A 4U1LA 4XAKE 3HE7B 1G6RA 1IBGL 5EO0A 4F2MB 3V6OE 1DQDL 3P4OA 4LFHD 3TJEL 3SY0A 1MCQA 1FPTL 2CRZA 1T4KB 3BT2L 3QNZA 3BZ4B 2P8PB 3GSXA 4DCQB 1GOHA 1U6AH 1EEYB 2VZ3A 2ZUTA 5F3HB 3I85A 2PXYB 1MAKA 2D4FA 4XCFL 3QUZB 4PJEE 2VDKH 3O6FD 2R1YB 2XACC 5T1LD 4Y4HB 3TGXA 4AH2B 1T2JA 3SE4A 4OV5A 3TT1L 2CUMA 3WMSA 1FAKT 1F8TL 2DMBA 3F12B 1FRGL 2P47B 3DVFA 5BVPH 4PLNC 2FRGP 1T0PB 5BO1H 4X6EA 1GGIL 3CX5J 3F62A 3HPJA 2HT3C 3BKCL 3H0TB 4TNVF 2UVEA 3WN5B 3X14A 2V17H 4L3AA 4PRHB 3QULA 4N0YL 3D18B 1ULVA 1X5ZA 3VXRB 4DN4L 3UZQA 2PF6A 3AB0B 4PJHA 1NGWB 1UQSB 2JJTA 3BQUD 3X11B 4X6DF 4Z77A 4YDVA 1I3GL 4P9MH 4LCYA 1DBAH 2Q7NA 3QWRA 3AREC 1HSBB 1LILA 3G5XA 4OAWB 4OZIE 4PB9L 2P7TA 1OAZH 1S9WB 1SJHB 1EZVX 4X8JA 4XRCB 4HPOH 4WUUB 5E8DH 5EORH 2NY6B 3EJYD 5IF0B 3SO3B 2NY3B 1NGPH 3SE3C 5SWSA 2MOVA 3U2SB 3A0OA 3STLA 3CXDL 3Q2CA 3B3IB 2DLIA 1J8HE 1OW0C 1U41A 4L4VD 4D0CA 1T22B 2P5EE 4NCC2 3T0ED 2HN7B 1DQLL 4P5TD 3TO2A 5C0GA 4PJ8D 3QFJE 4ODWB 5JMRA 5I19H 4I0CC 4LCWB 5MEOB 1SJVA 3DV6A 3MV8B 4HUMB 1W0WB 4CDHA 4R7DB 2VSCA 3T08A 4E0RB 4TNVK 2P1YA 4EDXA 3ROOB 2OL3L 4OGXL 2ARJQ 3B9KD 1INDH 1FO0B 1S7TB 2R0ZH 4U6XA 5C92A 4UAOC 3TH2T 2JJSA 1K8DB 3FO1B 1HHJA 1JYNA 3GSNH 3QIBD 2XTJE 4GRLC 3FQTB 1HH6B 1IJ9A 3RL1A 2JB5H 3QBTB 4LRNL 5KSVA 4P2OD 1KJ2L 4P5MA 4Z95L 1BAFH 5DMGC 5C2UB 3BW9A 4OZHB 4XNXH 3DJ9A 4H5SA 1P6FA 4LNVA 3I3EA 1P7KA 3ARXA 1B4JL 5DJZB 1LQSR 4F15B 4WHYH 2D3VA 4KJQC 3C60B 3L3HA 5TGBA 4LNRB 1KCKA 1EFXB 1UEMA 1I3UA 3MA7B 2XIDA 4X6BB 3ARSA 4LSPL 5I2IB 5KVGL 2I27N 3MZGB 3TZVA 1KN2L 4QLRA 4L9LA 2X4UA 4ODBD 1AXIB 1FFOA 2DKSA 3RX7A 3ZO0A 5FYKE 2IADB 1P9MC 3L1OH 1UWXH 4P5KA 5E2WH 1XMWA 4HEME 1X5AA 3QNXB 1KEMH 3WIHL 3CVHB 4PRAB 4O5LH 1DZBA 2B4CL 1YEJH 2FO1A 3HZKB 1FFQA 2VXSL 4ONHB 4XC1H 1A6ZB 3TBTB 4NZRL 1OAUL 4J3WA 1HYRC 1OSZA 3TPUA 5GIRB 5CJXA 2P45B 1TTUA 3RL2B 4KGLA 1JHTB 1YJDL 1WCBB 3LQZA 2BMKA 4PBVC 2YD8A 4JM2D 1GSMA 1I1YA 5JIKA 4YBQC 4JG1L 5KZCD 4UDUB 3O3DB 3DV4B 3VFVA 4G8FB 1UZ6F 3HC0A 5BS0D 4KV5F 1YY9D 1F2QA 4XCCL 3GI9H 4AG4H 1ZA6B 3TH3T 2NY5L 1CU4L 4R2GD 1P7QD 3QEHA 1U8NA 2PO6C 1AP2A 4EXPX 5C0BD 2YPLB 5SWZD 2I24N 5E70A 3A6CL 4ZFOA 4EDWL 3QDME 4MXQD 1DLFH 1Z3GH 3OMZA 4IRSD 5L2KD 3SDCA 1B2WH 2O61A 3ZZ1A 1RURH 5C6WH 2B8OT 3C5ZD 4BYHA 5IJVA 3BHBA 1QO3B 4AIZB 1HHGA 3GRWH 2G75B 5SWQA 4MQ7A 4NQDE 25C8H 2XKUA 3TA3A 4JQVA 5BVJB 4G5ZL 3KPRE 1MLBB 3DVIA 1R3IL 1NAMA 3ARGA 4RQQA 4HBQA 3TM6A 2BSTB 1NSNL 2YKLH 1ZLSL 4JRYE 4CJ1A 4MHHG 2X4OB 2BHZA 5EZOL 3MO1B 3V4PH 5EU5B 4PLKD 4NDMB 1B4RA 2DQJL 1YDPB 4ODVH 2P24A 4PY7B 3QUMA 3OJDB 1D5BB 1MNUL 4L8BB 5I15H 4EUPH 1A02N 4X5WA 3AU1B 1EEZB 2IQAB 4WU7B 3QEGH 4ZD3L 3FCTB 5LGHH 1I8KA 2PYFB 4OZGE 2NY0B 4P23C 5CP3A 1T6VN 2VH5L 5IVXF 2F53A 2JB6A 2ICCA 1BFOB 1ZGLM 2F15A 3FQWB 1KCSL 5FDYA 4N8VA 4BFBD 4KI5E 1CTOA 2IBBA 5JW4N 1T7YA 1DBKL 3EO0B 3LEYH 5GS1B 1UWEH 2EYTB 2NXYB 12E8L 3MZTA 3UJTL 2P4AB 3S7GA 2BVTA 4RMUA 2ATKB 5LGKA 4HWZB 5C0JB 1YY8B 4GW1B 2UZXB 4PRPE 5SX5K 2BOBA 5GHWH 5C09A 5HPMB 1JHKL 3VD3A 3ARTA 3B83A 2BNQA 3P9LA 4DN3H 2F58H 4ZS6D 3TT3H 1O5DT 3MR9A 5TQ0L 4ODTH 4TSAH 2BSSA 4OLWL 3RUGB 3QRFM 4NNXA 4YHNA 3SDDC 5E6IB 1A7QL 5JO5B 3OXRB 1ZV5A 3HMXH 5F1IB 3WIIL 4BSVB 4AQ1B 4OUOA 1LO0L 4CW1B 1E27B 1GGBH 2J8OA 1K2DA 5ESQB 1A9BB 4DEPC 2BX5A 1OGAA 4Z5RB 1C5CH 1F4XL 3NCYP 3QUYD 1A47A 1IT9H 4LVHB 3O3EA 1AHWA 4K3JH 4LDEB 5TE7H 1Q94B 4HIXH 4JG0L 5DRWA 1VEMA 2VLLA 2FEDD 2DWEA 1F6AA 4DOHB 4K3HA 4RZCA 3PWPA 5L2JB 4G6AD 3EYVA 1R5VA 5IVZB 4QY8B 4ZO7A 4LIQL 5A40E 4NNPL 5FUCC 5L6YL 3GMOA 3JTSB 2OI9B 3ZTNL 2X4PA 4N0UB 1MCWW 1QQDA 1U92A 1YYMH 4LCCA 5FB8B 2HLFC 2P5WB 4HIHB 2BVYA 3CSYA 2C1OB 4GXVL 1R6VA 3MXWH 1NCDL 2JCCE 4WV1B 5D7SH 5DVLA 5DFTA 3IDJB 5D1ZD 4YGVB 1Q9KB 3CUPB 1QHOA 4HXBH 1JUFA 1HKLL 1VB9A 3L9RA 3QDJD 4OLXH 4ZAKA 4N0CD 3NN8A 3NFPA 5DZLA 1JFQL 3MOAL 2XYCA 3RAJH 2ORBL 3MREA 3P3YA 4M1GL 1I8IA 4N5UA 4XNYH 5TDOB 3UAJD 5IQ7H 4I0PB 5E6ZA 2R69H 1D5IL 1P84J 2IFGA 3B43A 5B39A 1REIA 4QCIA 4BZYA 5C07A 3BPCB 5ICZA 2VZSA 3PV7A 2AEPH 4HZAA 2HTLD 5DHVB 2WW8A 4MQTB 4A6YL 1IGFL 1HOCA 4FOMA 2Z92A 4ODUB 2XKSA 1AD9B 1KT2B 3GEWB 5KSBF 1JNJA 4YUEH 2WIIB 1C12A 4ZTPL 1MIEH 1A64A 2OM5A 3ISWA 5I1LB 1FSKC 3KGRA 4V1DB 3K0WA 1MJ7L 2X4TB 4N1CA 3TBVB 3KDMA 5DMYA 4FQIH 3IYLW 3BKML 3CFKB 4NUJB 4AT6A 1YUHA 1DLHA 4HS3A 4GAGL 1FBIH 2PUQT 1PX3A 3S4SG 2AKRA 4EKXA 1Q0YH 1CGXA 4MJ5A 4Z7VB 3SKUD 4YHZH 2EH7H 3O8XB 5ID1B 5DUMH 2FEEI 3FB6A 2X4SA 2VDML 2AJUH 5FYLH 3AGVA 3P0YL 3W9EB 3L6FA 1HZHH 1X5HA 3GMLA 3OKNB 1R3HA 1ZVSA 4P9HL 4TUKL 4WW2F 5FOBA 3VA6A 1T3FB 4KZEH 3OGCB 4PJEF 1LD9A 4XPBH 5KW9L 1LK2B 4ZXBB 4Q9BA 1NGXA 1SQ2N 4EN3D 5HHMD 3QO1A 3KLHD 1NGZB 1IM9B 4KPHL 4IHOA 1DFBH 2K1MA 1NANH 1J88A 3V4VL 5D1XC 2D7MA 2YA2A 4RFNB 2YRLA 1NEUA 1FNGB 3MRBB 3EUUA 3K2UH 4KXZH 4CVZA 3AS3A 5JXAL 3KYKL 3QFDB 3SDAA 3BRFA 1RUKH 1EJOH 4XVSH 4I5BB 2Y36H 3FQRA 2XI9A 1MPAL 4Z7WB 3MA9L 1NC2B 1MFCH 1ZTXL 3UTZB 5DJ2B 2CLZA 3BAEL 3RVWD 5FM5M 2DQTL 3OF6D 5A1AA 5DC9B 3CFDB 4FZEH 1B6DA 5IB4B 4OZIF 4EUPB 5L0QB 2BNRB 3EFDH 2AJVH 2E7HA 5TF0A 3H9SE 3F7VA 2L7JA 1WV7T 1YMMA 1I1FA 1FIEA 5JR1H 5F97E 2Z0BA 1C1EH 1R24B 4X6CA 1AKJB 3MMEB 5I8EA 4IM8A 2HH0H 2FL5B 3D48R 1OT1A 4X7TB 1QFPA 1CD1A 1TITA 2J8UE 1EERB 1BQSA 3H42H 4WHCA 3EJJX 4GSDL 3HZMB 4QHNA 3UTTB 2YD4A 4Y16C 4LDLB 1JGEB 1F3DJ 3S96B 1JZ3A 1MI5D 3GM8A 2VZTA 3HI5H 2YPVH 2X5PA 4CN1A 3QDGD 2NTFA 2RBLA 1TCRB 2I60L 1YPZB 1V7ML 4NZTL 1VGKB 1OB1A 3NZ8B 5I1GL 3CVIH 5ESVB 1CDUA 1E6JH 2KBGA 1M7IA 3FRPA 1MQ8A 1MCCA 4ODHL 1UH4A 1NMAL 2R4SL 4JANB 5I1HL 1AGEA 5EN2B 1RZFL 1L9NA 5DUBB 1UG9A 5IFAH 3ZKNC 5J4MA 3UTQB 2EDYA 3FQXB 2RCSH 4OBSA 3RRQA 3BEWA 1WBXA 4UILL 5MEQB 2NX5D 5CEZD 4LPVA 5CBEB 1A7OH 2MNUA 5AEAA 4E5XA 4RWYH 3WKML 3MFFB 3PHQA 4ONFL 3HMWL 4S1QL 1FO0L 4P57B 3NFSL 4YHLH 1NBYA 3MLYL 3GBMH 3GO1H 5FO9B 3U4AA 3FO9B 3UPRA 1KFAH 3O4LD 1FL3A 4HUXB 3B5TA 3MFGB 5KVDL 2XNAA 4XPFH 5H2BB 4F7TB 4CL7A 4LAQL 3SDCC 4YBQD 1EMTH 4ZSOE 2ADGA 3LKSA 5HTSA 4MJ2A 3TC9A 4L3ED 3MUGB 4R0LA 2XN9B 1KUMA 1AD0B 4LKCA 4XGZB 1IAKB 1G1CA 5HHNB 1OAKL 43C9A 1KB5A 1SBBA 4LBEA 3TA3C 4M7ZB 4K7PL 3ZKQD 4JQVC 2VXQL 2R1XB 3B6SB 3NFNA 5TJWK 3SOBH 3W0WA 3JBG7 2OMNA 4G8IA 4S1SL 5C9JA 3RVXC 5C0FA 2SEBA 4IJ3C 4GW4A 2DI9A 1ADQL 1BWWA 3E3QE 5GS0D 3MJ8B 4RX4D 4EIGB 5F7HA 5D7IE 4N0RA 4LRIA 3DGCR 3IDUA 3OKEA 3P0VL 4PJ5D 5MEPB 1D9KB 1K5NB 4G7VL 3BIKA 3WS3A 5E2VL 3HG1B 5K9OA 2PYED 3CVHL 1J05A 1AGBA 3GSOB 3OX8B 1J10A 1J1XL 3S36H 4E41B 3SCMB 2D0HA 5ADPH 3VDAA 3EDDA 2CIKA 1QSEA 1RJLA 4U1HB 5L9DH 1T1XA 4Y1AA 3MLZL 4X6DA 1BFVH 1QSFE 4OJFH 1JV5A 3QPQC 2BRQA 5BXFA 4DK6A 3TO4B 4M6NH 3EZ8A 5DD5L 5HVGB 4P48A 3MV7A 4OI9A 4FABL 1YN6A 3V0WL 3WNMA 1ZHBA 5DFWH 2FECI 4GMSH 4OF5A 1WZ1L 2AV1B 3C6LB 1JL8A 3N06B 3TYGL 3T8XA 4HCRH 3WKNA 4EJ1C 4P59H 4MJ6B 1CK0H 2I5YH 3M45A 1G9NC 4Y19E 1DBML 2NNAA 3Q6FA 1FORH 2BNUA 4L8DA 4P23D 5EU4B 4M61B 4KHXH 1JGUL 2D7OA 1S5HB 3O6LH 2QSTA 3D85B 3QHZL 3H7BB 4N68A 1PZUB 4NO5A 4OCYL 4RMWA 4OSUH 2VABA 5H35A 1NPUA 1SYVA 4H8WH 4OLUH 4PV8A 1A7RH 2W91A 3GMQA 4CVWA 4MD0A 3K4ZA 4MAUH 1W72H 4HQQH 3WXVH 1OAXH 1VPOL 5HYJA 3O41B 1ZVHA 4U1JB 3VGEA 1I1AB 1EIBA 4H0HB 1YN7B 2HFTA 1XT5A 1NCWH 2DS4A 5HHVH 2DF3A 3DPBA 1TNNA 2G5BB 4M6MH 5I75B 3C87A 1GGCH 4G8GA 3LOWA 5JW4Q 1KC5L 4YHPA 2Y5TB 2APFA 5E2JA 2AV7B 1FZMB 4FTVE 4XBEH 2J5LC 4OF0A 2OCFD 3SDDD 2EIZB 2NY4D 5CMAA 2XQBH 1MIMH 3EYUL 4HIIA 5DRZB 3ZLQC 1NDMB 2G9HB 1PAMA 3C5JA 3MJ9H 3ZE0F 3RA7H 2G60H 3X3FH 5IOPB 2VDKL 5HJ3B 3WHE0 2HKHH 2ZUWA 3DXAA 3MRFA 2IEPA 2AK1H 2R29H 4HGWA 4NHUA 4QYOA 4RGOL 1MRFH 4NQCE 3VJ6A 1MFAH 4PRIE 2FX9L 4JDVB 4ZO9A 2YD5A 4ELKB 5GZNC 1FV1B 4XTRC 3B2UD 3V0VA 2GFBB 1AR1C 2VXVH 3WDJA 2RFXA 2VERN 3FRUA 2ZCHL 3MBEA 1FCCA 2O5YH 4MQXD 4YR6A 3X17A 2V17L 4AM0A 4Z0XB 5CCKH 2VLJE 5IHUH 4IRZH 2HLFD 3MCKA 4WFEE 4U1NA 3LKPA 3H3PH 3RIFF 5JHLH 1BD2D 4GLRI 4P2QA 4XC3H 3BMWA 4PGCA 4LEXH 3JUZA 2EDDA 1WWCA 1MFEH 1ZHNB 4YFLI 5JNYB 3CCHA 5IMMB 5CZKA 4I18A 4NQCA 4XPTL 1DBAL 4FQ2H 4PJXA 2A6IA 2BK8A 2R1WB 4Y5VB 4U31A 1J5OL 4C4KO 2X1WL 3BUYA 3I6LD 4JJ5A 4LPTA 4HPOL 3B9AA 5DD6A 1WICA 1INEL 5E8DL 4TSBH 4PR5B 2VLME 4HJJH 5FK9B 5C0EB 2E7BA 1GZQA 2JCCF 4Q7DA 4U1IA 3RU8L 2Q86B 4PRNB 4OZFH 1OY3B 3IGAB 5TF1H 1XCTA 2F54E 2GTZB 5KSAC 5HYIA 5J9PB 5IWLA 5GRJH 5HDQH 3M17B 5I19L 2HAZA 4M1DH 3ROLA 3G5VA 2VDPH 1I1RA 2Z8VC 3BP6B 4RFOL 4P3CH 5DD3H 5EOQH 3O6FB 3QHTC 5I30L 5FUZH 2NMSA 5T1LB 1JZ8A 1U2CA 3SKMB 4MSWB 1INDL 2R0ZL 4BK5A 5KS9B 4X9BA 2GAZB 3QJHB 1S5IL 3U1SH 3RIFK 5ISZA 4K9EC 3RWFB 4DFHA 1DQJA 2Z91A 3VXTA 1XGQA 1PZ5A 4UIMB 4YDLC 2DI8A 1AY1L 4K71B 1K3IA 3OB0H 4NKIH 2JB5L 1PG7H 2RGSA 1NBVH 1NKRA 2AQ1A 1YEFH 5B22A 1WWBX 1AQKH 3IJSB 1BAFL 3GUTB 1RPQA 4XNXL 2YMXH 4OLYL 3BQUB 3HUJE 3QWRD 5INCB 1ES0B 1AIFA 4RMRA 4KY1L 1KXVC 1JI1A 2FX7L 2HJLA 4HS8H 2I07A 3BESR 3RZCA 4DZBB 1TLKA 3OKDB 1KPVB 1ZA3B 3QI9C 2X89A 3UTSE 5I8CB 5SWSD 1EA9C 2LAAA 3D6GA 1JWMB 4NQVB 4XCYA 1N6UA 2BY1A 1HKFA 3NAAH 2MPAH 3FTGB 5CJQH 1H9VA 4M93C 2VWEE 4FFVC 5J8OA 1G7IA 1IGJA 1RK1A 4L4VB 4KTEH 5FO7B 3T0EB 4M7JH 1YEJL 4P5TB 5C8JB 5DVKA 1K6QH 4NN5C 4DUVA 4XP4L 4PJ8B 3BVNA 3L3IA 4M02A 1VACA 2ZOKA 3B8SA 5INDB 2LV4A 1VKXA 1T0NB 2AABL 1FZKB 1MFNA 5EDXA 4MYWB 4QT5B 4X9GA 2DWDA 3CU7A 5DJXA 4DW2H 1IEAB 3B9KB 3EYFB 4NFCA 5KSUA 3TBWB 3VGDA 3DLQR 2N7BA 3QIBB 5I8OH 3OKOB 2UWEB 1JPSH 4HIJA 3PG2A 2HT2C 3VXQA 5EZJA 3GI9L 3KPNB 4WNQB 4P2OB 3UYRH 5FHBH 4AG4L 3ECBA 3P73B 1TNMA 3QEUB 2B20A 4GRMB 1A1MB 2EE2A 4GKOA 3V7AG 2VDRH 1KULA 4GBXC 4ODXA 5D2LB 3MRLA 1KCUL 4NSKB 5J1TC 2VDOH 3K80A 3HZVB 2DN7A 4NNYB 1WLHA 2FD6H 1MUJB 1BOGA 3IDIA 2F8XC 1B2WL 1CDCA 1JRHH 1W72B 2CR3A 4Q74A 1RURL 3ZE2E 4H26B 1NEZA 4U1KB 5E5RB 1IRAY 1AR2A 2CDEB 4OD2A 3REWB 3GRWL 3RVVD 5BQ7A 1SJEA 4F2MA 4HUUB 3U9UA 1WC7B 3DUUB 4C54A 4OQTH 25C8L 3JTTA 1QACA 3UO1H 4L1HA 1U8JB 2AQ3A 4HC1L 2ENSA 4PRHE 4XNQA 1QBMH 2WUBL 2VKWA 4HIEA 5J1AB 2J8UF 3IXAA 3SKOA 2X70B 5D7KD 2FDBP 3MRIA 2APTA 2HFFA 1FG9C 4BKLB 4EI5A 3V4PL 1VFBB 2VAAB 3S9DB 1H8SA 2QQLL 4DKEL 5EPMB 1KIQA 4Y4HA 4PTUA 4I3GA 5EOTB 4PV9B 5I15L 2FHFA 1HILA 1L0XA 2Q3AA 1Q1JH 3TIEA 1J86A 1IC5L 5C0DA 4YDJA 3QEGL 4S1DC 1YEDB 3HZYA 4R0LC 4JM2B 3IFLL 1S9YB 2DJ4A 4AMKH 5BMFH 3REVA 3WN5A 4WUUE 2Y4SA 2ED9A 5KZCB 3RFZC 1BOYA 3VXRA 5DLML 1DEEB 4TVPD 5BS0B 5SX4I 1OP5H 2V9TA 1XCQA 4LCIL 1XF2A 2GUOA 5D96C 3BKYH 3I50H 2R9HC 1CYGA 2AERT 3CFBB 1S7XB 5I17B 1OGTA 1L6ZA 3LEYL 3X11A 2EDWA 1UWEL 2AGJL 4R2GB 1P7QB 1Q38A 3SDCD 1EX0A 4C83B 4LRIC 5C0BB 5SWZB 3T1FA 4LCWE 3MV8E 4HJGB 3UC0H 1YYLL 4IRSB 3MODH 5L2KB 2AXHA 4M48H 2IG2L 4LSSL 4C57C 5HI3C 1J87A 5GGTH 3OKLB 4PREA 3TA3D 3C5ZB 4FXKB 2ICWI 4XCEA 4DN3L 2F58L 1IQWH 4HK0B 3K7UA 4WFGD 3D69A 4ERSH 3TT3L 5IB2A 4TSAL 3RVXD 1UFUA 3ARGD 3B3IA 5JIHA 1KIRB 3OJMB 2LQRA 4U7MA 1VGEH 3HMXL 4QRUB 2BHYA 2CXGA 2F5BH 2Z31C 5CEYA 3WFDL 4AJ0A 2H9GB 5AZEH 1C5CL 1YEHH 1IT9L 4NIKB 3GSWB 4IIQB 4PLJC 3VWKC 2D7PA 2UV3A 4XP1H 4K3JL 4YXHH 3EOAA 3MV11 2A77H 2MWCA 2A6JB 3QO0B 3F65A 4J8RA 2W9DH 2F53D 3GSVB 4ZOEA 3HCVB 1JMXA 4I48A 1I8LA 4LOUC 5T3ZD 5D7IF 5JUEH 3GI8H 2Y6SC 3MRPB 1BX2A 1FHGA 2E5EA 3KHQA 4YFLF 3DX8B 5D93C 3RI5F 2D2OA 5MI0B 3VXSA 1ZWIB 2CLRA 3NGBB 4X5XA 4HUWB 4OZHA 5B38A 3Q5TA 1S7SA 4KROD 3MXWL 1CIDA 2CH8A 3D5OF 2Y07L 4ISVB 5DJ0B 1W2KT 1NGYB 5AYUL 1Z5LA 5FM4A 5C09D 3BP7A 1JTOA 3HE6A 4HXBL 4WTXA 3IJYB 3ARBC 4JE4B 4YWGH 3W5NA 1WT5C 5JQ6L 2BNQD 1ETZB 3GJFA 3QRGH 4OLXL 5JPMB 5DK0B 1CG9A 4RNRB 1BFSA 3S35L 4XNYL 5LQBH 1DR9A 3BZFB 1SYSA 5EU7E 4UINL 1QFUH 1OGAD 4JPVH 3QG7H 1R3LB 4ONHA 3CDGB 1OPGH 2AEPL 1H8NA 5E1AB 5F70A 5CEZH 1ZLUK 5IHZA 2LU4A 1YEIH 4PPTA 4QRTB 4XNUH 1JZ2A 4LEOB 1OAYL 4YUEL 5DR5H 2YPLE 4G43B 4W68A 5F9WC 1MIEL 3IXTA 1H3WM 3VXOB 2VSDA 1C16B 3KPTA 5FXCH 4HLJA 1A4KB 5IVNA 2WBKA 3MBEC 3IFPB 5EO1B 5E8OB 3MLRH 5DQJA 4M43H 3RGVA 1H0DA 1FBIL 2H1PH 1KIUA 2Z35A 3RWDA 3WUWB 3CK0L 1MRCH 2EDEA 3PABB 1ZA6A 1Q0YL 4LHUA 3VCLA 4YHZL 4KTDH 4RAUB 4L4TE 1SVCP 4X9HA 3PP4H 4ZYKB 3CFJA 5GZND 2YPLA 3T09A 3W9DA 1TJGH 2AJUL 5D1ZB 1EGJA 2WP3O 4JO4L 2HJFA 3PGFH 1ED3B 1XIWA 5DS8B 4ZAKD 1HZHL 3OGOE 3FT3B 4GKSA 1RUAH 1OM3H 1QO3A 3DUSA 3QDJB 2VZ1A 4XPBL 3RVTD 1WZLA 3QXAA 3L5XH 2HJKB 1T2XA 5F9OL 1GC1C 3SE9H 1FNHA 4GRWH 4F33A 3M1BB 3VFMB 3K74B 1PYWB 5EU6A 2EICA 5IWLC 3HAEG 1QTYT 1QFWM 1BGXH 4Y88A 3IDNB 1U3HA 2R0KH 4UMGA 1EO5A 4NDMA 1YDPA 3VRJB 3OJDA 1D5BA 2P8MB 1F4HA 4L8BA 4MB4A 4KVNH 3LSOA 1RUKL 4AEEA 1EJOL 3QCUL 3GHEH 3NH7L 2Y36L 3P4NA 2FGWH 4NT6B 2XTLA 1MFCL 2W0KA 1M7DA 3SQOH 4Z76B 2B1HL 1BFOA 5TDNB 2ILLA 4FZEL 3D0LB 4DGYL 1I7RA 2AJVL 1CS6A 1A3LH 1E4WL 1JJUA 1UVQB 3EO0A 5F6IC 5JR1L 4LLQA 4OFVA 1C5BH 1MCOH 4JR9H 4X80H 2VQ1A 2CJUH 3QQNA 4M8QB 3RZWA 3JVGA 4HWZA 2HH0L 3VG0H 1SY6L 3RZCC 4R96B 2BXYA 3FB5A 4PP2A 4AY0A 1BIIA 4WFHE 3FO2A 3ZTJH 3PXJA 3N50A 2Q76B 1M05B 4HMDA 4WFFE 5I6XC 3E6FA 1JZ7A 1UM6L 5F7EH 3HI5L 4JHAH 1R3JA 2DTSA 4DOHE 3RUGA 5IV2B 4EN3B 5HHMB 1L0YA 4D3CL 5K9QG 4N0UE 1SEBB 1E27A 2YBRB 4ZNEA 4NN6C 3SE8H 1PEZA 1L7TH 1YQVL 3LS4H 4G9DB 5L88H 5C6TL 4MA3B 2GKIA 4YXLH 2ITCB 1Q94A 2RAMA 4KMLB 3T65A 5DK3A 5DI8B 5D6CB 1OLZA 2RCSL 3QQ3A 1T89A 5BRZA 4M5ZH 2VE6B 2H6PB 2NLJA 5HGBA 4UDTA 3HUJF 3G04A 1A7OL 5IW6B 2OR8A 4RWYL 1AGCA 1A6TA 3CC5B 3ULUC 3MNVA 1YMMD 4N0UA 3VFGH 2ITDA 1CI5A 4YHLL 1KPRB 4OB5H 1U3YA 2IANE 3GBML 3GO1L 5AG8A 2P5WA 4HIHA 3MRCA 1G7QA 3GSNA 4WI5A 3RQ3A 3S88H 1KFAL 4TYUA 4WV1A 4RFEB 2BSRB 1QOKA 5CGTA 2GK0A 4NZUH 5C08D 1D3CA 2VYRE 4QHKI 4UAOB 4QF1A 3OWEA 3U83A 2E6JA 3SKNB 5IBLC 1EMTL 3NIFE 4HWUA 4PB0H 2EYRA 2PR4H 1NFKA 1F13A 3QH3B 4V1DE 1CFSA 4PBXA 1MI5B 1UJ3C 3SJVA 1FFPA 2X1OA 2YRPA 2JELH 3FFDA 3VD9A 3I6GB 2APWA 1CLOL 3QDGB 5C2BH 3I9GL 4RISH 4JQXA 2A74B 2XWJA 4LF3A 4LK4A 4NQXB 2Y7QB 4P4RA 3BPCA 2WBJA 2XWBA 2XY1A 2NY1C 4EI5C 3I02B 4Z7VE 4Z8FL 4M03A 3OHXB 1XR9B 2CKBH 1P2CB 4ODUA 4Q0XH 3FMGL 1OHQA 4HWBA 2O5XL 2WUCH 3S36L 5E2UH 3V4UH 5IVOA 5ADPL 3QIUC 1DVFA 5L9DL 2NX5B 3P77B 5IB3A 4BA8A 4WGWB 1BFVL 5IEHB 4UT7H 4OJFL 4I2XB 4NUJA 1XF5B 5LWYH 3QSKB 2WM0A 3LN5A 3ZE2F 5DF0A 1TZHA 4J3TA 1OARL 2X4RB 3FFCB 4GMSL 4PP1C 4JKPL 1G7MA 1RZJH 3DSFH 1FN4B 2YD2A 5DSCB 1UXSA 1A2YA 2YN5A 3O4LB 2XV6B 4QRSB 4ZPTA 1I9RH 4JCMA 3ZMRA 2I5YL 3DURA 4TTDC 2QSQA 1HHIB 2R8SL 2ADIA 2LU7A 1U91A 1F90H 2FSEB 2GK2A 3O6LL 4L3EB 4AEIL 4KMTH 1YC8A 2HLAB 3WNOA 3PHOB 2O93L 1G9MC 1T3FA 3W0WD 5LKNA 4OI7A 3OGCA 3ZT7A 2R9HD 4KRMB 1KCVH 4R9HA 4BSJA 4Z7WE 3QA3A 1CBVL 4F7EB 4OLUL 4ZXBA 4WY7L 3UJIL 4U33A 3UJJH 5F7LB 4MAUL 1S7QB 4HQQL 4QTHA 1IM9A 1OAXL 4UTBH 4PD4K 3WXVL 2ZUYA 5IB1A 2ATPB 5DRNB 2BNRE 5JOPE 5DJYB 5CD5C 4MA1B 1PJ9A 3KXFE 1CFNA 3Q1SL 4WW2C 3AS2A 4M6ML 1GGCL 3QZWB 4N90E 2EDFA 4DVBA 3C8KA 2PYEB 5LGJB 1KLUB 1TMCB 5CHNA 1ZVYA 3RWGB 5DJ2A 3U6RA 2XQBL 1MJUH 4KAQH 4ZS7H 1MIML 5KOMC 5HHPB 1RIUH 3MV7D 4ZFFA 4MJIA 1S7RA 4FQCH 5CJBA 2ICEB 4EUPA 1J0ZA 3BE1H 4JFZL 2OSLA 3MJ9L 3SPVB 4HMEA 3S37H 4OGZA 4PLJD 4HUNB 5AAMA 2X10A 2C26A 2DAVA 3X3FL 4HBCH 4ZUUB 3OV6A 4Z7UB 1YPZE 1R24A 2V2XB 2QTEA 1F00I 1BF2A 2HKHL 4K3GA 4KVCL 1AKJA 4F80A 4TOYH 2AK1L 4G8EB 4Y2DC 1MRFL 4X7TA 1A0QH 1MFAL 3O3BA 5K9KA 5JZ7C 4LOUD 1NMCB 5IBTH 3JZ7A 3V6ZA 2Y6SD 3IJHB 3P9MB 3LQMA 1BJ8A 1A5FL 3UTTA 4X4MA 2HRPL 1JMZA 5D9SA 2CQVA 3FB8A 3OG6B 3PQYB 4IMKC 5IHUL 3MUZ1 2ZSWB 3H3PL 5HYJD 1BIHA 4F57H 4QXWA 3NZHH 2LVCA 1VSCA 4XC3L 4GS7B 1MFEL 4K8RD 3SDXB 1J11A 4IRJA 3OAYK 3OKMA 5ESVA 3MLSH 1N7MH 5F9JA 1NCBH 3JV5A 1QLRA 1RVFH 5EN2A 3BPNC 1ACYL 5DUBA 4HSQA 4ZODA 1PY9A 4YO0A 4TSBL 4OKDA 2APBA 2XN9E 3SDDB 4CMMA 4D0DA 2NY4B 3CMOH 4FG6D 5DT1H 4QRQB 5F7KC 3IU3B 4R4FH 3ARDC 1N59A 3BGFC 3TJHD 4DEPB 5CZXC 3DRQB 4J3UA 2BC4A 5GRJL 3U4EA 2QKIB 5IJKA 4NN7C 5I8KH 2DD8H 1TVBB 2H3NB 2XKNA 4Q6IA 1RULL 4RRPG 5DD3L 4HUXA 5EOQL 2XPGA 5FUZL 3DARA 1CZ8L 4KDTA 2R23A 5F96L 4TVPH 3FQUA 3T0WA 5IQ9B 2QADC 3MBED 5DMJB 1U8QB 5ACZA 3MUGA 4FQXC 1AD0A 1EXUA 1IEBA 4K23H 1U8OB 4PG9A 4ZUTA 4X7EC 2ARWA 3OTTA 5E5MA 4NKIL 4AENB 1TZGL 3G6JA 1XZ0A 4P2QD 5C0AA 1NBVL 4ACPA 5L7XH 2ZKHL 1ORQB 3OG4B 3OAZK 1AQKL 3PP3H 2P44B 3MLTB 1BD2B 4ENEC 4W4OA 2DQFA 1ZGLB 1G1YA 1W0VA 3MJ8A 3VXMA 1KEGH 1PY4A 2F19H 5HSFA 3BH9A 4HFWB 1U3HC 3LKRB 4RBPH 5IIEA 3NCBB 3W5MA 1K5NA 3GDBA 4X0KB 3WHXA 1MJ8H 2DI7A 5GSVB 3HG1A 43CAB 4U1LB 1G6RB 5EO0B 3OX8A 1WAAA 1V3JA 3P4OB 4E41A 3U79A 2KUTA 2XOTA 5E4EC 3CLEH 4DTGH 4F7MB 1NFDA 2IF7A 3FN0H 3TH4T 3NAAL 4GH7B 4HPYL 2MPAL 2EECA 5CJQL 5A16A 1PGRB 3GSXB 5GXBB 3JWDL 2KQMA 5ETUA 1CFQA 3VA2C 1CLZH 4J1UB 2AXGA 1YEKH 4HLZG 1NC4D 2J6EL 4M7JL 5CP3H 4MA8H 5HVHB 1O0VA 1FAIH 4LPYA 2R4RH 4JQIH 5F7YC 4OV5B 3S3PA 2DJSA 4LLDA 5T3ZH 1NLBH 2IFFH 3UPCA 3QUXC 1AGDA 2HYMA 2A6KA 5ISZD 1Y6NR 1H15A 4DW2L 4U1SB 1FNEB 1DUYA 2GCYB 4X6EB 1OP3K 1BM3H 1T03H 1MJJA 4X6FA 5HBBA 3FQNA 1V8HA 3X14B 1CLYH 3CX2A 4P2YA 1CL7H 3ZT5A 2JKXA 3RDTA 5J11B 2R2EA 3O11B 3UZVB 1J9CT 4Z77B 1Y6KR 4YDVB 2IJ0C 4Y89A 1VADA 3O41A 1KTRL 4LCYB 3RZCD 1J18A 2GSIA 2VDOL 2X89D 2IQ9L 2P7TB 3NVQA 2WZPD 1K4DA 5L8JB 4X8JB 4O9HL 2DLFH 4ZO6A 1JRHL 3VE0B 1QKZH 3P4LA 3MGAA 5D70L 2BDNL 5SWSB 3T2NL 1G7HA 3RJQB 1T89C 4OTXH 3EAKA 3STLB 4OQTL 4DFIA 5TE6H 5FKPA 1CGYA 5EBMA 1TETH 3UO1L 1W8NA 1NDMA 3TO2B 5C0GB 3PJSB 1U8MA 3DV6B 1DANU 3HKFA 4UQ2A 4CJ0A 1J7VR 4JDTH 3HFMH 3S98A 2DQDH 3SBWC 4EDXB 3OZ9H 4QXGH 3EO9H 3TWCL 1CT8B 4PJGA 4Y5XA 5GS2D 4U6XB 1EHNA 1E6OH 3GIZH 3LS5L 4ELKA 2VO5A 4I9WE 5FF6A 5H37G 2C1PA 2WV3A 3VFWA 3RL1B 3ULUD 4AMKL 3W82A 1TJIH 5KSVB 5D72H 1FCGA 1D6VL 3BW9B 2DKMA 5D5MA 1N64H 3JV4B 1H3PH 2ZCLH 5E6YA 2AW2A 3I50L 1FFNA 1LDPL 1P7KB 2OTUA 5JNYA 3BXNA 4NZDA 1HSAA 3QQ9C 4KJYB 5IBLD 5TGBB 4LCUA 4P4KA 2OR7A 3BGAA 4JFDE 4PJ9A 3S6CA 3MODL 3D25A 3ABZA 5F6HJ 3L3OA 4P49A 4OUUB 5F89A 4L9LB 2X4UB 1FFOB 3MLXL 5KS9E 5FK9A 5C0EA 3HI1A 1DVFC 1IQWL 5DURD 4ERSL 4O02H 4P5KB 3DMMA 5E9DD 5HY9A 3KVQA 4PRNA 1FH5H 1JGVH 3W2DL 4K7PX 5I16A 3NIFF 4EI5D 1CF8H 5FHAH 4KHTH 4M62H 2EDRA 4K94C 1OSZB 3TPUB 1MAMH 1YEHL 4Y8DC 4P2RA 3MCLH 4YXHL 3LQZB 3CFCH 2BMKB 2A77L 3QIUD 4Z78A 4BZ1L 5CJOH 4KKNA 1I1YB 1NANI 1OWWA 4ZFGH 2W9DL 3QJHA 3I2CH 1IC7H 4LPWA 2FX8H 2EDOA 1JIBA 2W0LA 1NBQA 3VFVB 3HC0B 4KXZI 2C3XA 3GI8L 4Z7VF 5CD3A 4X98A 4N8CH 4W6YB 2VJXA 2CKNA 2W92A 1AQDA 3IJSA 2WLZA 1PX4A 3QEHB 4KK6C 1U8NB 4FHBD 5GRUL 1AP2B 4UU9A 5CJ8A 1XF1A 4U49A 3LIZH 5ALBL 4L4VE 4ZFOB 5INCA 4BFIB 4TTDD 4ZFZA 5DVOA 3T0EE 3SDCB 3X13B 1HYSC 2VDLL 1MHPL 3DROA 4OCWH 1F97A 5TQ2H 5IJVB 3BHBB 1RZKC 3C09C 5I8CA 3GZKA 4OIAA 4PYGA 5SWQB 4MQ7B 1CQKA 4XAKD 1ZLVH 3TA3B 4NGHH 4JHBA 1UWXK 1ZLWK 4YAQA 3FTGA 2F74A 5LQBL 4D9LH 3ARGB 4O00A 1B88A 4RQQB 3LKOA 2NW3A 4WHDA 4JGUA 3PWVA 2UWEE 5CD5D 1T0MA 5C6PB 4K55A 4L4VA 4WTZG 3A67H 3QG7L 3QXUA 1YNKL 4PJ8A 4XVUC 1OPGL 3WJLA 4TQEH 4O51A 2P24B 1H3XA 3QUMB 3KR3H 1T0NA 3BSZH 5D6DA 2CGRL 3IT8D 4FFYH 5D8JH 4X5WB 2N7AA 1WFNA 4BQ6A 4HXAL 5DR5L 2X9YA 4G3YL 3JV0A 1IEAA 5HDBF 1I8KB 5DC4B 2Y1VA 4D9QE 1O7SA 2F53B 1N2RB 1NL0H 1MCNA 4DVRH 4NKOA 2FH8A 4HCRA 4LPCA 3VXSD 1A3RH 4JY5L 1MCIA 3MLRL 4M7LT 1J0HA 4M43L 2H1PL 5M94B 4WIQA 4RGNE 3KPNA 3LQAL 1MRCL 3QEUA 2FCBA 3GIVA 2HVJA 4S10A 5E5UB 3BKJH 5D1QA 4IRJC 2E7LC 5D2LA 3HE6D 3Q5YA 4KROB 1A6WL 1OD7A 3WO3B 1TJGL 1WGOA 1T04A 1X4ZA 4M5YH 1MUJA 2BOBB 2OQJA 5C09B 2BJMH 3BD4A 4UBDC 3PL6C 1W72A 4CDGC 5ILTH 4V2CB 3BWAA 2EZ0C 1F3DH 2BNQB 1RUAL 3P9LB 3AXLB 4UQ3A 2CDEA 3S5LG 2ICWJ 5HGDB 3MR9B 5GS0L 3N9GH 3BPOB 1WC7A 1YPZF 3DUUA 3MYZA 4NNXB 2EDKA 3L5XL 4YHNB 1LO5B 3SE9L 4YE4L 4XPAH 2A38A 4NZJA 4NC0B 1GXEA 2DQHL 1K2DB 2FYYA 4JY6A 1OGAB 5BS0E 4WO4A 5DZNA 2IBZX 5D7JC 3MJ7A 1BGXL 5IJKC 3O3EB 3L5JA 4BKLA 1N4XL 5B4MD 3GFUA 5EPMA 2NYYC 2E7CA 4KDTC 3T0XA 3UTPD 5DRWB 5C0BE 5SWZE 2VLLB 2ZNXA 2XRAL 2DWEB 3GHEL 1F6AB 4PD4J 4RZCB 2FGWL 5ITFB 4XX1E 5L2KE 4MDJA 2BY3A 3NCJH 1MWAH 1R5VB 5ANME 1KGCD 1A4JA 3ARDD 3BUTA 4IS6A 1S9YA 3RGVD 3GMOB 2NY7L 4FXLA 1E4KC 3QZWG 3WD5L 2MSPA 2X4PB 1QLFA 5CZXD 2Q6WA 2CO6B 1U92B 3L5WB 3WFCL 4LCCB 4LHUD 1RQ5A 1NCTA 1TXKA 1CFBA 4JFYA 2XQYG 2H41A 2DDQL 3CSYB 3NTCH 3FO0H 4Y4KA 5I17A 4MXWH 2BVUA 5CZVH 2PETA 4JR9L 4XXCA 1KB5H 1FGVH 3L7EA 3VGFA 2QADD 1XIWD 4JDZA 1Z0NA 5GGQH 4XZUB 1JUFB 3G6DH 3L9RB 4FQXD 3W11D 5KVMC 4YK4C 4WWKC 5DQDH 4R3SB 1H3TA 1S7UA 3DRTA 3ORJA 5LG1A 1NDGA 4ZAKB 3NN8B 1K8IA 1X6LA 3NFPB 1UXWA 3VG9B 3G08A 4FXKA 2FWOA 1I8IB 5J6GA 2VDNH 3EYSH 2YD6A 2YWYA 1KIRA 4R97B 4QCIB 2VL5B 1U3HD 2QHRH 4QRUA 5CINH 1YQ2A 2HP4A 2X4QB 4YDIH 1CDHA 4CUCA 1HOCB 3DX7A 2Z92B 1L7TL 5I1IL 5L8LB 3V5DA 3MRKA 4IIQA 5L88L 4OZFA 1C12B 4YXLL 5I71C 3ZTJG 1IAIH 1UB6A 1UH2A 1AXTH 3IDMA 2WSKA 5EUKA 4OI8A 3KDMB 4M5ZL 2XA3A 5FUOH 4WI7A 3HCVA 1ZGLP 4AT6B 1YUHB 1A1NA 1DLHB 1QSZA 2AXJA 3IAGC 3VRIB 4HS3B 4KRPC 2YSSB 2WLYA 4NC2B 2AKRB 4G6KH 4AK1A 4LVNC 1MF2L 2Y06L 2PW2A 5GZOC 3QXWA 2VUYA 3P2TA 1JF1A 5ENWA 3O2WH 3QUXD 3NMEA 3LH2L 3FB6B 3LD8C 2X4SB 2J2ZA 4ISVA 1A7NH 3MLWH 3E3QC 4K7FA 4OKVA 3TVMA 1YJDC 3L6FB 5IESH 4G7YH 4I3RH 3GMLB 1R3HB 3ZYOA 1ZVSB 5FOBB 1FZOA 1IC4H 3HS0A 2OJZL 1H3UA 2ENYA 2UZIH 4KJWC 1NGXB 3QYCA 4RNRA 1JWUA 1V3KA 3QO1B 2CLVA 3BZFA 4KC3B 1UB5A 2NY5C 3ALPA 1DANT 5C2BL 1G6RL 3OR6A 1RHFA 2FGZA 3OPZH 2CUIA 3NCYS 3TN0A 3NPSC 5D4QA 5DA0B 3W39A 1E4XH 4CVZB 3QHFH 3QUYA 4JREC 3T4YA 3P30H 2CDFA 1PSKL 3WLWD 4Q0XL 5BRZD 3MUJA 4LEOA 2OTWA 4PJ7A 3ZHDA 5AAWA 4QRRA 2PTUA 3T4AA 3D3VA 3QP3A 3KYMB 3RX5A 3V4UL 2AEQH 4ZO8A 4OLVH 4M93B 3O9WC 1AE6H 4Z7NE 5E7FA 1AJ7H 5FAAA 3QDJE 2EC9U 3F7VB 4NN5B 1YMMB 3HTLX 1I1FB 4LP5A 3PABA 3O2VH 3B2VL 4X6CB 4TVSa 1RZJL 1R0AH 5I8EB 3JV6A 2OX5A 1CD1B 1I9RL 5C08B 5D1ZA 4FZ8H 4PJFA 4JFXA 4QHNB 5DS8A 5DXWA 1F90L 5CUSL 1MCRA 1YC7A 3SJVD 1A6UH 3WBDA 5EC1A 5DTFA 5KAQG 4POUB 1CGTA 3MJGX 3DMMC 1RUQL 1ZHLB 2YPKB 4QWWC 5GRYA 1OB1B 5IEKA 2YXFA 2ED8A 3VWJC 2WBJD 3GKWH 4U0RC 1MCLA 3F7RA 1ORSA 1IM3A 1YZZA 3D2UD 4ZUSA 4S2SA 1GC1H 2C5DC 1AGEB 1LNUA 3WNKA 4NQUA 3VRJA 3IFNH 3QWQB 3QJFA 3L7FA 5E08L 2P8MA 4WEBL 1I3RA 3BEWB 5AWNL 1DVFD 4OBRA 4MCYA 3MNWA 4E5XB 1OTTC 1XF4A 3PHQB 4ZS7L 1MJUL 4WI8A 1KTDA 1RIUL 3PWJA 3FAXA 4AL8H 5GGVH 3BX7C 1NBYB 4FQCL 4JKKA 3BE1L 5EWIL 2IBGA 3H3BC 3UPRB 1FL3B 2HG5B 4NQEE 4HBCL 4HT1L 4Q2ZB 4U6YA 5HHME 2XNAB 2B1AH 1ZT1B 4LSQH 2EEDA 4YHOL 5KS9F 5IK3A 1E28A 4TOYL 3E8UL 4XNMB 1BQLH 2RIKA 4M8QA 3FAWA 2V5TA 1J0JA 3LKSB 2X9WA 4I77H 4R96A 4R0LB 3VW3H 5JW5A 4MMZC 1AC6A 4LSVH 4U6TA 4LKCB 3V52H 3EZJB 1T1YA 4UZGA 3V5HB 1QR4A 1KB5B 1FZJA 1H5BC 3G5ZA 1N0XL 3NFNB 3W0WB 4G8IB 1EH9A 5C0FB 1X5JA 4GW4B 2IAMC 1MCPL 5IV2A 1RZ7H 1JWSA 4U3HA 2D7TH 5GGTA 1HYSD 4WI9A 2COQA 5J12C 3AREA 3WJLC 3MLSL 3U4BH 3BIKB 4UT6L 3WS3B 4CMHB 5K9OB 1NCBL 1Z0MA 3R06A 1J05B 4JO3L 1AGBB 5SX4H 2ITCA 1AXSA 2P46B 2JJVA 5EUOA 1XGYH 4KWUA 5GJSL 2CIKB 1RJLB 5D6CA 1T1XB 3SE3A 4D94A 5FGRA 4H20H 4X6DB 2VE6A 4PGZA 1JV5B 2PTTA 4KZDH 5BXFB 4M7LL 4ZDHA 4MJID 1OW0A 5IW6A 1QFWH 4PRBA 3S35X 1CICC 3MV7B 5GS2H 1YN6B 1GPOH 5MP6H 1J1PH 4YC2C 4KJPD 4DZ8A 1KPRA 3DNKA 3T8XB 3QDGE 4BELD 5I8KL 2DD8L 4HKXA 4RIRB 5D1QC 4XNZB 2D9CA 4MNQA 3ULUH 1URLA 3HNSL 4RFEA 2A1WH 5B8CC 2NNAB 3J8F7 2BNUB 4L8DB 4MB3A 4URTB 5DO2C 4NO2A 5FGCB 3IDXH 3LN4B 3O81A 1YNLH 4TVPL 2UWEF 1OTUC 2IPTH 4GRLA 1X7QB 1M1SA 1BMGA 4NO5B 3MBXH 5E0QA 5DDHA 1U42A 2DM3A 2VABB 5H35B 4ZFOL 1SYVB 3QH3A 4PV8B 4WVRA 2BRRH 3GMQB 4HH8A 5D93B 4MD0B 1MI5A 2C3VB 4KK9C 1NFIA 5L7XL 2NX5E 2MJWA 5HYJB 4IRJD 4YFDB 4JZOA 4ONGH 4I2XE 5C0RH 2VWEC 3CGTA 5T1MA 4I13B 5DJAA 2A74A 4WO4C 2YA0A 4OM0L 2D03H 3N85H 4UBDD 3FFCE 2EZ0D 3IAQA 3OHXA 4YHPB 5JOEA 1P2CA 1NAML 3O4LE 5FGBC 3RBGA 1L6XA 4JFEA 2DQEL 4P9HC 4TPRH 3ZDYE 1AO7A 4NO3A 4DTGL 3CLEL 3IRPX 4HIIB 3SQBA 1P9MA 3FN0L 3P77A 3QUML 4TN9A 4JCLA 2UUDK 3MACH 5IEHA 3C5JB 4OCSH 4N5ED 4XMPH 2VNCA 4WEUD 5JHDD 1IGYA 1CLZL 4S0SD 3MRMA 1IFHL 2X7LA 3H9SD 5ADOH 1IAOB 4U1GC 1WIOA 4RWHA 2NYYD 3VI3E 1FAIL 2R4RL 1V3MA 2X4RA 4QOKA 4JQIL 3MRFB 4NBXB 4HGWB 4NHUB 4QYOB 1NLBL 3VJ6B 2IFFL 3MRHB 1ACZA 4LMQI 2A0LC 4JM2F 3V0VB 1BM3L 2RFXB 2MCG1 2PXYC 5I9QB 3FRUB 3MBEB 4Z6AT 4L8CA 3BD5A 4L3EA 4PJIA 2IMMA 4YR6B 2B2XH 3QB7C 1CLYL 2BERA 5C0AD 2E3VA 4O2FB 2PYEE 4OLZH 4U1NB 3LKPB 1WBYB 2GT9A 3L3GA 1PDKA 4V2BA 4KKCC 4OIIL 4F7EA 4P2QB 4PGCB 2H2SD 1QEWA 5GS3A 3KPQA 3VXMD 3IKCA 2CO7B 2PO6A 3CCHB 4OCRL 4I18B 2ATPA 4PJXB 2A6IB 3QQ4A 4N8VG 4WWKD 4JPWH 4XWGL 3MLVH 1U3JA 1XF3A 1D7FA 4TSCH 1AC0A 1XH3B 4JAMA 4JJ5B 4PJ5A 4Z7UE 2UYLA 2FR4A 4JRWA 1LP9A 5DD6B 3F58L 3RNQA 2VLKA 3GBLA 4UNVA 1BHGA 4JB9H 1ZE3C 5IBUB 1GZQB 1IAMA 5JA8B 4OTXL 2FLRT 1G7LA 1XCTB 2FEEL 4DKFH 1OF2A 3BJ91 1KBGH 1OLLA 3JWOL 1TETL 3KJ6H 4WWID 5CJ5A 2VB5A 3U30C 3VFUA 1CGSL 2YZ8A 3PQYE 2IBZY 3G5VB 3ROLB 5JIIA 2NY6C 3LN9A 4U7SA 1NC4B 4KDVA 4NOFA 1QRNA 4JDTL 1QZ1A 3HFML 1QYGH 5CLTA 4QHMB 5I1CH 1C08A 2FATH 2V2XA 4QXGL 3SDXE 1UCBL 1Q9LA 1FYTA 1B0RA 3TVMC 4G8EA 5ISZB 1E6OL 1WF5A 2EDJA 3GIZL 3RNKA 1DQJB 3VXTB 1XGQB 1PZ5B 3MYJA 4P23A 4DGIH 5ID0A 5GISL 3U46A 3RDTD 1GYAA 3ZYZA 4Y4FC 1TJIL 5D72L 5GZOD 1KELL 3N0PB 4LARL 3GJFH 5HD8D 5F6IB 2ZCLL 1P5VA 4BQ8A 5F3BA 2FO4B 1JPTH 1AIFB 5J06A 3RWHA 3SDXA 1EBAA 5F1SA 2HJLB 2I07B 3TN0C 4M00A 3MRDA 1CXFA 1EK3A 3RZCB 5IVXB 1KENL