4Z7WB

T316 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
187
structure length
180
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Determinants of Gliadin-Specific T Cell Selection in Celiac Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 180
sequence length 187
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z7wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4z7wB01
1TJIH 1INDL 4FFZL 5C9JA 5FAAA 4DTGH 2WBKA 1I1YA 3OF6A 1NFIA 2XKUA 3GSUB 3H0TB 3N9GH 4GQ9H 4KK9D 1YEIH 3N1GC 3PWPB 4ISVA 4NC1E 3ARYA 3V5HB 4I5BA 2DQIH 3WFEL 4Q0XL 1TJGL 4K9EL 5CS7A 3QO0B 3DOSA 5JDSA 3KPRD 4OGXL 1YN6A 1ED3B 3BQUB 1PY4A 3UO1H 3HUJA 3T2PA 3ROOB 3L9RB 1J0KA 4WTWA 2NXYC 1TITA 3MRHB 5JW3L 1E0OB 2HJFB 5BVPH 4U6XA 1F4XL 3QG7H 5IB1A 1E6OL 1UADC 4JFPB 4JDVA 5CGTA 1D6VL 3HNVL 1B90A 1WBZB 4X80H 5KG9A 1A7NL 4NM8L 5CP7B 3C2SA 2W65A 3SE9H 5IB5A 3KYMB 3HB3C 1GPOL 3UJJH 5KAQF 5JORB 1NDMB 3LN5B 4KI5D 1BHGA 4I3RL 3SGKA 4NJAH 4WW2C 2HTLC 1TCRB 3EFDL 5HDOA 2WNGA 5HYIA 5ESVA 3ZMRA 5M7QA 3VD7A 4CU8A 1JIBA 1X5JA 4JO1L 2K1MA 5CBAA 4JN2A 4P46D 3KLHD 1KCSH 1B0WA 2C4FT 4JRXD 3FTGA 4POZC 3G5VB 1U9KA 4ZMAT 7FABH 4DW2L 4KDWA 2XY1A 2NY4C 4FXKB 4GW5B 1TTGA 5KVEL 5C0BD 2C5DC 2ESVB 2NY2D 2IH1A 5TE7H 4ZAKD 2IANE 2A77H 4GAJL 1ADQL 3ZHKA 2AQ1A 5ANMB 2ZCHL 4N5ED 2DIBA 5MENB 5INCA 5CP3A 2HT4C 1XCTB 4WTZA 4HIIB 3ABZA 3OJVC 3BRFA 3BO8A 2W60B 3MLYL 4NQCD 3MOAL 5DGRA 4JPVL 2IQ9H 2DQUL 1QSVA 4UNUA 5C0AE 2LVEA 4JVUA 2FHBA 1IGCH 5D2LF 2NY0D 4WU7A 1T83A 4GRWF 3QDMD 3BPNB 3O9WB 4YPGA 5CJOL 3MLVH 1K5NB 4MS8D 3SE3C 1J05B 3M1BA 1YYLH 5CZVL 2JJTA 3CD4A 4LU5L 2AV1B 1P7HL 4TOYH 5IBTH 5HVHB 2HJKB 4FZEL 3CK0L 1C5BH 1Q1JH 1MEXH 1A1OA 3E2HC 3BVNB 3BEVB 1TVBA 5GGSB 1FRGH 3QIUA 1HNFA 3OAYK 5DRWB 4LLUB 3TP4A 3MCKA 2J6EH 2VJXA 1Q38A 2VQ1B 4L3ED 4XBPB 3C8KA 1HH9B 4R97C 2XQBL 3MFFA 1J8KA 1KSRA 3LRGA 2HRPL 2F5BL 1MAML 4KRPD 1SY6A 5I1IL 4R4BA 1CZ8H 4KJYA 4OZIB 2AK4B 5D1ZA 1OCWH 3GIVA 3QUZA 4TUOB 1MRFH 1BVLB 5L8JB 3CZJA 1MFBH 2RIKA 3HAEH 1EMTL 4HS3B 4PP2A 4BUGA 1INQA 3TBWA 3MCG1 5TE4L 4Y4KD 2Y07L 4HC1H 1H15A 4OFVA 5ETUB 1HWGB 4ZXBB 4KJPC 3H9SA 5IB4B 3FZUD 3IDMA 1KLUA 5EFIA 4YHOH 4PRHE 1HHKA 3VFWA 4FQCL 4XNZB 1F90L 4AENA 4KRMB 5BMFL 5ABDE 2ITDB 5IIEB 4MQ7A 4RMWA 1JZ6A 2YN5A 4I9WE 4H8WC 5EDXA 5T1KD 3PL6B 5DEFB 2A9ML 1RZ7H 3MA7A 1KPUA 3NCFB 4P57B 1QLFA 2VDML 5IW6B 2XRAH 3C6LA 3PG2A 5E2WH 2QR0B 2E7HA 4JFZH 4OIIH 2CDEA 2L7JA 3QDGD 4NKQB 1IGYB 2XNAA 1KPRB 4FA8A 1YEKL 1IEBB 2UWEF 1I7UA 1NGQL 2AQ3A 5C0JB 1KCRH 1U8PA 3UTQA 4KKAD 4OKVB 4P5TD 3KR3H 4XC3L 4JM2F 5D7JA 4ZDHB 5J1AA 1ORSB 2K9UA 1BFVL 4DN4H 1VGEL 4KVCL 3MRGA 5HD8D 4UTBL 3A0OA 2NNAB 4WFHD 2Y06L 3FRUA 4IDLA 4KRNA 1KPVB 4DKEH 3WFDH 5KSAB 3D3VA 4IMLB 3FFCA 1D5ZA 1HHJA 3RPIA 3KPOA 4MA1C 1BEYL 2R0WL 3QULA 2BK8A 5AD0A 3IFNH 4WHYH 1E27B 1ZWIA 5ITBH 5B3JE 1QBLH 2VLMD 3QI9A 4QXWA 4RWYL 3Q6FA 4GW4B 4YDLB 3KLDA 3INUL 1VSCA 3QISA 4N8PA 2D0GA 1I1YB 2FHFA 3SDDA 5FOBB 3B9EA 4IS6A 2X9YA 4CAGA 2QQQA 2YPLB 4OJFL 4HWNA 1WAAE 1AR1D 1ZVSA 5FUZL 5C08B 4X6CF 4KUCD 2MPAH 5D2NA 4KAQH 1A7RH 4XGZA 4PLNC 2X1OA 5HHQB 3Q2CA 3VD4A 2VXQL 1CFSA 1T1WB 5F7DA 3O6MH 5JW5B 4RRPA 1S3KH 5KAQG 1X5FA 1FFQA 5H37H 2ARJB 4U6XB 3UZEA 2P49B 1JPGA 2SEBB 5IB1B 2ED9A 1PG7X 4OZFH 1KGCD 2Y72A 5DD6B 3WJLC 4C55A 3VE0B 1A1NA 4HK0B 3V6OC 2OL3H 4J6RL 2W65B 2YD5A 1NC4A 5DRXA 3ZTJG 5C0GB 5IEKB 3QEGL 3B5HA 3MLTB 5CJBA 5B39A 1RIVH 2AJZA 4MJ6B 4LDOB 4YQXL 4YZFE 4ZOBA 2FECI 4LSSH 4P0DA 1LD9A 3OKOB 5ENWB 4JN2B 3PIQA 4WWKA 1OGTB 2Z35B 5BJTB 1ZTXH 1CGTA 1QRNB 3CXHJ 3TFKC 4L5FL 3MLXL 5DJAB 4D3CH 4WGWB 3EOTH 2AEQL 2VLRE 4LVEA 4ZS6C 1I3GL 1VFBB 1G1CA 4P9HC 1RFDH 1CD1B 2W1NA 5E5MB 1KIQA 3EYFA 3A6CH 1LK3L 1A9BB 3F6IA 5C7XL 3MLRH 5T1MA 3LOWA 1JHLL 4PJBE 4KI1A 2WLYA 4R96A 3AREA 3OAZH 3OX8A 2O5YH 2Q7YA 4WU7B 3WEXB 3MFGB 4OQ1A 4GRLC 4HLZH 3ZTNH 4L8DA 3KXFE 4NYLB 1XEDA 1YMHA 3I3DA 4YPGB 4AIXA 2Y25A 4WEUD 1M7DA 5E6IA 3VWJA 4HBQA 1P4BL 2RFXA 3ZDZF 4LAJH 4M48L 2W9EL 3D0LA 2EDLA 3GI8L 2E7CA 3P0YL 1X5ZA 3HTLX 4H88L 1Q0XL 4FQ1L 2PYEB 4ODSL 2FX9H 1QHPA 1Z5LA 1HIMH 2DJUA 1NAMA 4S1DD 1H3PL 2B1AH 4DOHB 4LLAA 5F3HB 1LP9F 4KJQD 3T8XA 3WE6B 1HCFX 4LHUA 1MFCL 4MJ5B 2EH8L 2AJXL 2BNUA 1IKNA 3QPXH 4OZHE 1T5XB 5BV7L 2XTJB 3O3AA 2Z93B 1RZGB 5GGUA 4XVTL 4FQJH 1K3IA 4JHWH 5DFVD 3PL6C 4EUPG 5IB3A 3JVGC 3MRDA 4RNRA 4LK4A 4GG8B 1AHWB 1NFKA 1CK0H 2X5PA 4JKPL 1RURL 3GIVB 1IBGH 4MAYC 4CNIB 3MV8E 3MRNA 1U8LB 4Y19A 2VN7A 1L7IL 5DFWH 5J13B 4U7KA 5FYJU 2YK1L 4PP2B 4PJAE 1INQB 3BUYB 3TCLB 5SWZD 4U1SA 1HNGA 4NQEA 2AP2A 1J1PL 1U95A 4H20L 4P4KC 2HVKB 2XG4A 4TUKH 3QUYD 5I1KL 3IDMB 4RFEB 1KLUB 4MA7L 4M7LT 2GT9A 4TNWF 3HI6H 3FT2A 2YD1A 1JZ7A 4L8CB 1BAFH 2CKBL 2Z31B 4OFKA 3RZCA 4BM7A 4KROC 3EO1B 4NWUL 4HJJH 2DQGH 2NY1C 3CVHB 2XN9A 1UFUA 2NX5E 4U7MA 4O5LH 3SEPA 1FZJB 3LQAL 4Q2ZA 4X6BB 3C6LB 3BW9A 3FONA 3VCLB 5L2KA 2V7HA 1EO5A 1KIUA 3F7VB 3EJZD 4Z8FH 4KRLB 4JFFE 4NKDB 4R26H 1BJ1J 1RMFH 3IFOB 1J8HA 5BW7A 1II4E 3UTQB 3CH8A 4F7TA 4EQ2A 2E9IA 4Y16A 4JO2H 2YD3A 2VO5A 2XIDA 3PWJA 4M5YH 4JQVC 3EYQC 2PCPA 2VUOA 5IKCB 5LGHL 5IP4A 4LCUA 4ZFFB 2R2HB 4HDIB 3FRUB 5EOQL 4HPYH 1DZBA 1OGAB 1KTDA 5EU5B 4Y2DC 3MGTA 2A6IA 2MOVA 5I1DB 3WLBA 5FYKD 1T89C 1D5ZB 3NTCH 1HHJB 3FO9A 3TLRA 1MCFA 3KPOB 1PDKA 3O0RL 3ARGC 1W0WB 1YNTB 4HWBA 1ZWIB 4ZPVB 4NRXB 2FZ3A 4NZTH 2OP4L 5GS0L 2DM4A 5HDQL 1A47A 3F58H 1IT9H 1S9WA 4URTB 2LTQB 4LCWE 4ELKA 5EUOE 1RK1B 1YNLL 2BY1A 3K2UH 2H2SD 5D1QC 5DYOB 1KG0A 3UJTL 2VUYA 3T2QA 4ZNCD 4HKBA 5HYEA 2VR5A 1MCWM 3S36X 1AGCA 4M7LL 5LXGL 1CFSB 5J56B 1UJ3B 1VCAA 3HI1B 3D69B 4IRZL 1FGVH 4PJDF 1OQXA 3RWDA 3W9DA 3UZQA 2WUCL 4I0PA 4FTVB 3SDCC 1FYTA 1PSKH 3B43A 1RY7B 3TA3D 2E7LC 4WUUE 4PGBB 3KYNB 3HLAB 1TCMA 3CH1A 4UQ2A 1NGYA 4YH6A 1Y18A 1UH3A 4L9LB 4RGNE 1H9VA 1ZSDA 3H7LA 3ARVA 4R7DA 2AJZB 3MA9H 1HKLL 1D5IH 4FQIH 4PB0L 3QPQD 1AO7D 1DFBL 2O5ZH 5CAYB 2COQA 1HQRB 3QQNA 4YK4B 1WLHA 2XZZA 3ES6B 3V8OA 3PIQB 5E2TL 4WWKB 1CGYA 2BSSA 4HS8H 1UWEH 3RVVC 4TPRH 1MCCA 1OAXH 1VHPA 1GRWA 4NHCL 3V4PL 2E6QA 3VXPB 4GLRI 4MQXC 2O61A 5F89A 2LE9A 1K2DA 3LH2L 1PZUB 4PRIA 2V7NA 4OCMC 3VGHA 2VITA 1HXMB 1CLYH 2YN3A 1MJUL 5F97E 5ALCH 1NANI 2XTJC 1HH6B 1NEUA 5DZOA 3H42H 3Q3GB 4XPHH 2MJWA 4M3JA 4PREA 5JLZA 1CXKA 1JPFA 1E4XI 4WUKH 4PJ9B 4HW6A 2NY6B 1NCCH 2EECA 3PDOA 5DDHA 5T3ZD 1QFWH 4JRWA 1AHWC 3SJVD 2B0SL 3IDJA 3MLPA 4L8DB 3PWUB 1F4WL 4X6DB 1KB5B 5ACZA 1YEFH 4MLIA 4OCSH 2RFXB 1G6RH 1BD2E 1OAZH 4M03A 5D1XA 4YFLI 4DTGL 4U1GC 4JZNB 5DQ9A 1EGJH 3N9GL 5GGRA 1YEIL 5AWNH 4GKZA 5KVGH 1NAMB 3LRHA 4QRPE 3KPSB 2ICES 4HFWA 2CRYA 4FMFA 4ONHA 1V7NH 3FB5A 3T0EA 2MQ3A 5I1AA 1CIUA 2AXFA 2P5WA 5HHPA 1EZVY 1LMKA 2CRIA 3PQYD 5DS8A 1A9EB 5IR1A 4PGCA 2VKWA 1XR8B 4ODXB 1TNNA 1T5WA 1P5UA 1JTPA 4P23B 3ZDYF 2DTSA 2KDGA 5D6DC 5BZWA 4NNPH 1WCBA 3LQZB 2GFBA 3IGAA 5IEHA 3RNKB 4M9OA 1LDPL 5HGAB 1I8IB 4CADB 5GJTH 1ADQA 5D7LB 4Y19B 4TULH 3TO2A 1P53A 2Y6SD 4NKMB 5CKGA 1IC1A 1SVZA 4Y4HC 3SE9L 2A1WL 5EU6B 1NCWH 3K8LA 3UJJL 4U1SB 4GG6B 3LCYA 2BDNH 2OS7A 4PY8J 4ZD3H 5F9WC 4NJAL 4OCNC 5L8LB 1EZVX 4M7JL 1A7PH 5C0CE 3VU2A 1BBJB 3C8DA 2NPLX 2XZAH 3FT2B 4XPGH 3BJ91 3RX5A 4XC1H 1KCSL 1X5LA 2G60L 7FABL 1JI1A 4MB4A 3VXMB 2R23A 1JYVA 4Y2OA 1KELL 5TE7L 4BSJA 3QQ4B 4B53A 2ZCLH 3FONB 3W5NA 4OI9A 1GHFL 1PG7H 5IVZB 2P5EE 5J4MA 2DQCH 4HUUA 5DO2C 1NEZA 1KXTB 4L4TA 4MNQA 5JW4R 2JK5B 3MLWH 3HAEG 2EICA 1C08A 4OBSA 4LEOA 1XF4B 4JAMB 4U6YB 4ELMB 2CRMA 4ZUUA 2EIBA 4JREC 1H0DA 3IU4H 4JY4A 1EJOH 2EDHA 4GAYB 4K94C 1CI5A 1M7XA 4JFQA 4C56B 4Y4FB 5C8JB 5CGYD 2IH3A 1OARH 2ZP0T 3VI3E 3N06B 4X0KA 3OJDB 1DVFA 4EIGB 1KTDB 1DBMH 2X70A 3ZYOA 1T6WA 1EEUA 1FFNA 3WLBB 4KKCC 3ARZA 4JHAH 5DMGC 4TOYL 3VXUA 1ZLVH 3S5LG 3UYOD 4Q6IC 4J1UA 4U6TA 3V6FA 4JFHE 1YQ2A 2DKMA 3CFCH 1QSEE 1FFOA 2R8SL 4LQFL 2NR6C 4PB9H 5DUPL 1S9WB 3FQUA 4PJCE 3WNNA 2ZUYA 1S7WA 1R0AH 1U8MB 3L3HA 4Z7QF 5BQ7A 5A2IH 3QEHA 3PV6B 2EDTA 4L9LC 3B2UD 1RZ8A 4XTRC 1CZ8L 4Y1AE 2ZCKH 1OCWL 4PP1C 1UT9A 5I1JH 3DUSA 2IEPA 1NMCC 2GCYA 2D7NA 1F11A 1FZMA 2VLJB 1AGCB 4BSWB 2A74A 3HMXH 1VPOL 3FB8B 1EEYB 1MFBL 3RU8H 5JPNA 1UCBH 1ODAA 5DJDB 1ZS8A 4LHQB 4HC1L 3P0GB 3GUTA 3S98A 3RHWF 1FYTB 3SY0B 3UROR 3P40A 4YHOL 4QT5B 2OQJA 3O4LE 5D4QA 3BZEA 4LVNC 1A3RH 1NGYB 1OPGH 1QSFA 3PP3K 3OWEA 5L88H 1UB6B 4FOMA 3KPTA 1ZSDB 1RZ7L 4OD3L 4PJ9C 3E8UH 2XRAL 4YHMH 3BAEH 5E2WL 2X09A 3U46A 2B2XH 1S78C 2ZSVB 4JFZL 1F2QA 2F58L 2KUTA 4OIIL 3WD5H 2FX8L 4W6WB 1GGTA 3QEUA 3HN3A 1KCRL 4LAQL 4WI2A 3SGDI 5JR1H 3MRMA 5H37G 5AG8A 4J3UA 1FORH 1KFAL 4CN6A 2V7NB 4OZFG 2VITB 4R2GC 5HGDB 1NBYB 3WUZA 3DX6A 4DKEL 3WKML 1YY8A 4YNYB 2D4FA 2FD6H 2RR3A 4YC2C 1TZGH 4YGVB 5J11B 3R1GH 5I8EA 1H3UA 4N8CH 3LVEA 5GZOC 12E8L 4K71B 3IFNL 5ITBL 3HZMA 1QBLL 5HDLA 3UTSA 3C2AL 2O26U 4YHYB 3WXWH 1EFXD 5CD3A 1KCLA 5D1XB 1IM3A 2AEPH 5DQ9B 4X7EC 4APQB 4PRPA 5GGRB 2D31A 3UXFA 5FV2A 1T2QL 2BNQD 4OF6A 5EORH 5CJQH 2MPAL 5FECA 4KAQL 4MD5B 3T0EB 2VZVA 3ZKXC 5I1AB 1FIEA 5F7LB 5CKAA 3NPSB 3OKLB 1L0XA 1RZIB 4B5EA 3HCVB 4PJ7B 2ADIA 3O6ML 3KWWB 1S3KL 1T5WB 1XGRA 4UAOB 1QR1A 3U30C 3LMJH 3B9KA 1XIWB 3AXLB 1WCBB 1T3FA 2GFBB 4JJHA 2AK4E 4C83B 4F7EA 4PJGE 1U91A 4Q58C 1KTLB 1YEJH 2G9HB 2OMBA 5EU4B 1ACYH 5MHSE 1ONQA 3OXSB 1AGDA 1GVIA 5SX4H 4JZJC 4QRRA 1T6VN 1WZLA 2FRGP 3D5OF 4PJ5E 2AXGA 2OL3L 2DOCA 3ESVF 3FN0H 4N8VA 1JYNA 1G7IB 3HI5H 4OAWB 4DZ8A 1FG2B 4DEPB 3GGWA 3TZVD 4F37K 1UM5H 3EBAA 1RIVL 3NFSH 2ORBH 3HKFA 4GRLA 3RGVB 3VFNA 4WI7A 3S36H 4G42A 1DQMH 4LSSL 4Z5RA 3PGFH 4Y4FC 1RUQL 4EDWL 1CWVA 1R3KA 4KKLC 4HUNB 1FSKC 2XQYK 3T4YB 1GAFH 1S7UA 3MRCB 4M1GH 1K6QH 4D3CL 3GMLA 1TENA 5C3LD 3MTRA 3UAJC 2DJSA 1ZT4B 4NHUB 1HINH 4PV9A 2CK2A 2BZDA 4ZO7A 2BMKB 4D94A 1RFDL 3TBYA 3TO4C 4HUUB 1DQJB 3A6CL 1ES0A 3ZLQC 1NEZB 2ADGB 2KKQA 3MLRL 1C08B 4YHIB 4ZO8A 4LEOB 3IDIB 5D8JL 1JNHB 5HYSB 3VFGH 3VXSE 3JVGA 1FO0H 1F4WH 4XX1G 3LN4A 4NCC2 4JY4B 1OD7A 3OL2A 4GBXA 4JG0H 2YUWA 4FZ8L 3QXTA 3ZTNL 1HSAA 2W07A 3UTTD 5JPMB 1JK8B 3HNTH 5HHOD 4XP1H 2HJLA 4P2RA 3B3IA 4NRZB 4N68A 3TBVA 4U1NB 3W0WE 4HK3N 1IAKB 3NGBC 4FQ2L 2AABH 3WUWB 5SV3A 4YUEH 2FX9L 3D6GA 3JWOC 1KIRA 3I3BA 3OHXB 2B1AL 1WAAF 2GAZB 2YSSA 4KK9C 4JM4H 1E6JH 3GJFA 3V6FB 4YR6A 2BSTB 1ZEAL 4JFXA 1U8OA 4NT6B 3IETA 2I07B 5MERB 4OLXH 3QPXL 3P4LA 4HUVA 2WWMD 4MHHG 1GOGA 1F45A 2P47B 4FQJL 5DJXB 1IL1B 5TDOB 4LRNL 3GNML 1B0GB 1BIHA 1RD6A 4OD2A 4HXBL 3IJYA 5ESQA 2P8PA 1CK0L 1HHGB 2PYFA 4DUXA 5HGBA 1GOFA 4M7KH 3PABA 4FABL 2HN7B 5K9OA 5SWSD 1A7OH 3VRIB 3BN9D 1MCPL 2F53D 3HUJE 2ENYA 4FFYH 1CDIA 1XGQB 4HAGA 3IDGB 1ZS8B 3WNMA 3IDNA 3NAAH 5I30L 4N0RA 4MJ4A 4JQVA 5C6WH 4TUKL 1H5BC 3O6FB 3QEQA 3HI6L 3IVKA 1UXWA 4XP6L 4L3AA 3BZEB 5HHVL 4E5XB 3CDFA 4Y2DA 3O3UN 4GRMA 3HC3H 4UIMA 2DDQH 4WW1A 4HJJL 3NIDE 1H8NA 4FNLH 5GRWA 1T89A 5T3XD 2DQGL 5DI8A 4M6AA 2ICWJ 2P46B 2UY6A 5B4MD 4P46C 4OCRH 5J11C 3BIKB 4G9FA 4LSRH 1UWXH 4WCYH 2IQAB 4JPKH 3CFEA 5TQ2H 4GT7A 5J9PB 2NY2C 4XPTH 2ERJB 4Z8FL 1ZGLA 4HS6A 2QSCL 4YHYC 5I1EH 3GMNA 5CJ5A 1FG9C 1GC1H 1I8KA 4N5EC 3TT3L 1NCNA 3OXRA 4AQOA 1WWCA 3KPNA 1UVQA 4PJBF 1MCEA 1TETH 4APQC 3F12A 5CGMA 1SJEA 3MRMB 3MRQA 2B5IC 4IMKC 2GSGA 1IEHA 3EKCA 3FN9A 1JGUH 5BRZD 3IRPX 4WEMB 1IGTB 2N56A 2XKSA 2NY0C 2DQFB 4HPYL 3PWLA 2YD4A 5C6PB 1YECH 4F7CA 3SKNA 1VGKB 3DWTA 5ITFA 3ULVE 3SDCA 4UAOC 3KYOB 1W8OA 3O2DH 1WWBX 1YEGL 1IM9A 4MJID 4NZTL 4JR9L 3V5DA 3P73A 3GFUA 2GJ6A 3F58L 3QHFH 1XGPA 1IT9L 2FWOB 3RA7H 1YMMA 1MI5D 5FM4A 1FL5A 1S9YB 5IGXH 2FLRT 5JW4M 3QUXD 4P5MA 2E3VA 2WWKT 3K2UL 4HPOH 4DEPC 5HDBE 2ITCB 4FG6D 2E7BA 1KNOB 4KRPC 4TSCL 5FECB 2H6PB 1PG7W 3O11A 1VACA 3RIAF 1JPTH 1W72L 5HYJD 5BCAA 1UQSA 4S10A 4LRIC 1EBPA 5EBLB 2DKSA 1FGVL 1J0YA 4PRAA 2ZOKB 5TH2A 5DHVA 4FQQB 4HIHB 1EVTC 3GO1H 3GSQB 3GSNH 1ERNA 1PSKL 2L4OA 4Y4KC 1QPXA 3U36A 3IXTA 1QLRA 4I2XB 5DK3A 3MNZA 1HI6B 4WHTA 1AD0A 1UACL 3BEWB 4DVRH 3KJ6H 4OFDA 4YAQA 2XACC 3SDXF 2CDGA 1LO4H 4PD4J 3G6JA 3WXVH 2VL5A 2Z91B 2OJEA 2F74A 3L5XL 2CRZA 4Z0BH 4MX7B 3H9SE 3MA9L 3I6KA 2ZUUA 1U8HA 3LQMA 4RAVA 5IMLA 1BOGB 4GMTL 5CHNA 3O81A 2FH8A 3WIFA 1SYVA 2NY3D 1UWEL 3A6BH 3TVMB 3PDDA 4TPRL 2BX5A 1YY9D 5E00B 4FQLL 1DEEB 1S9XA 3QDJA 3S35X 3RWFB 2OI9B 1S9KC 3QFJD 1Z2KA 3MXWH 1KJMB 4KKAC 2ZUXA 4P5TC 1T66C 4JN1H 1OP5K 3BP4A 2APWA 3I75A 4K8RD 4BQ8A 5BV7B 5HD8C 2BNRB 4OUUA 4XPHL 4G8IA 2QADD 1S7QB 1MIML 5JO5B 1F3DH 3LEXA 3D0VB 3VFTB 3NCJH 3CFDB 4G6FD 4PG9A 4BKLA 3BMVA 4EI6B 1NUGA 2X2YA 5D2LB 1WC7B 3DETD 4OLEA 4GRWB 4ZFZA 1YEFL 1AKJB 1Q0YL 1G6RL 4NQDB 1T04A 4Y4HA 3B3IB 1LE9B 1OAYL 2EXYC 3D3VE 5DZLA 3TBVB 3QZWA 3FFCE 3EDEA 5E8OB 5AWNL 3A67L 3S37X 4YHZH 1AE6L 3V2AR 3H9HB 3MJ9L 5EUOF 5HI4D 4N1CA 1MCQA 3U9UA 4KK5D 2YSSB 4FQHB 1MFEH 3HR5B 3RWEB 1IE5A 2IBBA 2WUBH 3HG1D 1WIPA 1U8OB 5LAXA 1KIPB 4NJ9L 1AR1C 5IF0A 3SO5A 3ZZ1A 4PS4H 4GKSA 3OKEA 1QTYT 1YDPA 2CKBB 2EDWA 4HZLA 2QEJA 3BN3B 3BH9A 2RJMA 2ZUSA 1RQ5A 1KT2A 4LP5A 4L4VB 5ESQB 1S7SB 4P2QB 2JJSC 4U1KA 4X83A 1J1OH 2D7MA 2PYFB 4MMZC 5D2NE 3RWCB 1CXEA 1TTFA 5GJTL 1KJ2A 2NW2A 3PABB 4R0LB 4TULL 4XZUB 3AS2A 4AIZA 3KDMA 1GJIA 4UUJA 4TQEL 4EBQL 4XNMA 5HHMB 1NCWL 4HBCH 5LVEA 1AJ7H 2YA1A 2OCFD 3IDNB 3JWNC 4NKOA 2ZG2A 2EDBA 3L3GA 1BQHG 3PGDA 4ZD3L 4IRJA 4L9DA 1A7PL 4DK3A 2VXSL 3GSWA 4XPGL 2ZZUT 1UXWB 2NZIA 4HXAH 4S1RL 3EHBD 1JV5A 4GRMB 4UIMB 1EX0A 4WRLA 3CJJA 5DI8B 1P2CB 3DPBA 4PJEA 2BVEA 1RULH 3ULUD 4N90E 2D7PA 4XCFH 4Q6IA 5C2BH 2ZCLL 5E24E 1PG7L 2W59A 4QEGA 3OKDA 2R1WA 2X4RB 4XNYL 5GJSL 4DGYH 4GKNB 4HS6B 3ZYIA 3GMNB 1JPSH 3MLWL 3EJYD 1T7YA 4Z0XB 2UWEB 3F12B 1TVHA 3IU4L 4PBXA 5ALBL 4A6YH 3BDXA 3DXAB 3RTQD 3N1QC 4NIKB 4JM2B 3FMGL 5EZJB 4RMUA 3P77A 3GSOA 2H32H 5EIIB 5B38A 1W0VB 2F8OA 6FABH 1DBML 4ZUSA 3DROB 2YA0A 4D0CA 4TRPH 2ED7A 2XI9A 5JOEA 4F7CB 4Q74A 3SKNB 4JHAL 5ITFB 3DO3A 4GXVH 2DLFH 4HC1A 5F7WC 5F1NA 1C5DA 2F19H 1IM9B 2VLLA 3HE7D 2ZSWB 3MACH 4JANA 1RIUH 4ALAH 3CFCL 5IT2H 2AW2A 4S1DC 1Q9LA 2YS4A 3GSXA 4QF1A 2HYMA 4PB9L 3VWKD 1R0AL 4KJQC 1YMMB 5F7EL 1U8IB 4E41A 2APXA 3ULSB 4PR5A 4PUBH 1NPUA 3L7FA 4JDZA 1Y6KR 2ZCKL 4F9LC 4OCWL 2WM0A 5IK3A 5DFVC 5IVXA 3LKOA 5CIPB 5I75C 1N8ZA 4NO0A 2W0LA 5ISZA 5I8KH 4R8WL 4BZ2H 4TTDD 1A14H 3RU8L 1J86A 2X1QA 1P7KA 3KJ4C 4I4WA 4NZUH 5DHVB 5E03A 5FHBH 2WINB 1CBVH 3P11H 5ADOL 5E2JA 4XI5D 4OZGA 1OL0A 3DRTA 3VFPA 1QLRB 3GHEH 1U42A 2XFXB 4Y19E 2APBA 1Y6NR 3QUYC 4NUGH 3LV3B 5GRXG 5SX5K 1A3RL 4YX2L 3CIQA 4OLVH 1AD0B 3P4NA 3RIFK 3V9FA 1XF2A 5KSBA 3TN0B 1TJHH 1YEDA 4ONGH 4H1LA 5EPMA 4NQEE 2VMFA 2OJEB 4G9DB 3BAEL 3PNWA 2B2XL 1GZQB 3BGMA 1U8HB 2E27H 3GMOB 4XMLH 3QJHB 4D0BA 5EU7E 4G8GB 4HT1H 3EW3B 5GGTL 3WIFB 4LDEB 3EJZC 1MCJA 1T1ZB 2R69H 3BWAB 5JR1L 4ONFH 3UP1A 1JMZA 2XN9E 3WYRA 3QDAA 4HULB 2VLKA 3O4OB 5L2KE 3AAZB 2DBLL 3VI3F 3MYJB 3HFMH 4PIRF 1SBSH 1A7QL 2DAVA 2FD6L 4G8IB 1J8HE 2OYPA 3TH3T 5IWLA 1TZGL 2FYYA 5MEQB 1HZHH 4X7CC 2A6DB 4Y5YA 1DQTA 1ZA3B 4E0RA 4BKLB 2YUVA 3ZE0E 1D6EB 3DMMD 2ADFH 4WGVB 1G7PB 1C7TA 4AH2A 2QL1A 4JZJA 5DA4A 3WXWL 4FRWA 2WV3A 5I71C 3GMQA 4D0DB 4NO2A 1T2JA 2WBJD 4IRSD 4NN7C 1WBYB 3WHXA 3VD9A 3Q6GL 1YC8A 5TPWL 1HILA 1YYML 1KEGL 3VXRE 3O45B 1GGUA 3QIBD 3BP6B 4YEEA 1DDHA 5CJQL 4XCYB 5JIKA 4XP5H 5LAXB 2J4WH 2BJML 1ZANH 3U1SH 4ORGA 1LP9B 3D39A 4YHLH 4UT6H 5CP3H 4QCIB 2E9WA 4M5ZH 4ODBD 4BQ6A 4OF5A 1YDPB 3O8XA 5DJCB 3RY4A 2DLEA 2OTUB 3OBAA 1F3DJ 3MLZL 2AXJA 2JF1A 2CSPA 3TPUB 1E4WH 3ULVH 2ZNXA 4UDTA 1NCBL 1CIDA 3LKPB 2CR3A 4OLWH 3RI5K 3S88H 1WK0A 1YEJL 2BVPB 2GK2A 3TO4A 1ACYL 1NMBH 4LLMB 4ODWA 4S2SB 4G3YL 4MAUL 4YEFA 3QNXA 3GHBH 3KDMB 3VG0H 4KHTH 4WO4A 3KPLA 3DVGB 3N85H 4PFEA 4Z6AT 3D85A 5K9KA 3PGDB 4X9FA 3T2OA 2MCPH 4IRJB 2ORBL 4YBLC 4UT9H 3S36L 4JM2C 1DQML 2YRLA 5I1GL 5B21A 5C09B 3BGFB 3QPQC 5GGQL 3NBNA 4ZSOA 3VRJA 3CFBA 4F7MA 5E2UH 4QTHB 1GAFL 4M1GL 1G7JB 2YMXL 1RZKL 3OKKA 1JF1A 1K6QL 4N9GB 2R4RL 2VAAA 3X3FL 1SY6H 2NLJA 1HINL 3DX7A 5F1OB 1C1EH 2BC4B 4K3DH 3VH8B 5DUBA 1QPPA 3B8SA 5IROA 3KPRA 1RI8A 1MRCH 5MEOB 3P3YA 4O4YH 4M9PA 1A6AA 1P1ZB 5FA3A 3U2SA 4P4RA 3VFGL 4JEGB 2ICEB 4AL8H 1YN7A 4BSVB 1FO0L 3MV9B 3ZHDA 4XVSH 4ZPTA 5M95B 2V5RA 2AJ3A 4JG0L 1DQQB 3RKDD 5DJZB 4PRIE 3WNOA 2WP3O 1V7MH 2NTFB 2W9LA 3HNTL 4XP1L 5LQBL 3SDYL 5F70A 3G5XA 2ARWA 4I3SH 4BK4A 4D0CB 3S35H 3HAEB 3QXAA 3P9LB 3ARFD 4YUEL 1KLFA 3LKRA 1H5BA 4YBQD 4F15C 2EDXA 4JM4L 1E6JL 2VLLB 1HQ4B 4GLRH 5C0EA 1XFPA 1MWAH 4N0FB 1A6UH 4OLXL 4QRUB 1MUJB 1AD9A 4JRYD 2R2EB 1CICD 3F62A 4YE4L 1OT2A 1Z0NA 1MSPA 1JUFB 1F5WA 2PO6B 4Y5XC 3EYOA 4POUB 4P46A 3O41A 1NANH 1FVCB 3Q5YA 4JRXA 3AROA 2A6KB 5CEYB 1E4XH 1UYWH 5L0QB 1JE6A 5C0BA 5IVXB 2YPKB 3OR7A 1YEEH 4ZAKA 1N8ZB 3OAYH 5EO1B 5F9JB 2P5WE 1BZ7A 1A7OL 3CDYA 5ECJE 5I18L 1ROWA 4FFYL 3DARA 1EO8H 1D5XB 5EH1A 1NJ9B 2Y6SC 3T4AB 3S37H 4O2CB 2Q86B 4L8BA 4JFEB 4OT1H 4NQCA 4PJDB 5TDNB 1F6AA 4JKLA 3SGJC 1T0PB 1CDCA 3DRTB 2C1OA 32C2B 1MHEA 3WIHA 3IYLW 3QDMA 3QG6A 2JIXB 3H6JA 5EUKB 1CS6A 3P4NB 1DLFH 1IFHL 3SPVB 1GIGH 3AVEA 2AK1H 3HB3D 4P59H 5CLWA 3QWOB 4HUKB 4N5UA 4OCRL 4XCEB 4LSRL 1QFWM 1MHCA 4WCYL 1L7TH 4NDMA 2HTLD 1VEMA 5A43C 2R2CA 1F97A 4XPTL 4PRBA 4P99A 3QXDA 2BSRA 3GMRB 2R4SH 2ILLA 1D9KB 1A0QL 3QA3B 4X4YA 1Q72H 4XH2B 2H45A 4GAGH 4POZD 2Y9RT 1HYRC 1CQKA 1U58B 1J1XH 2FIKB 4P3WA 4KTDH 2VKXA 2BHYA 4KH2A 4RCAA 3EO0B 3UTPD 4UILL 4RMVA 3PV7A 1DR9A 2FX7L 2HT4D 3O3DB 5JIIA 3GKWH 1N3NA 4L4TE 4MNQE 3RUGA 4XXCC 2X41A 3MRJA 1M1SA 1WF5A 5GSVA 4LRIA 1W72A 5CGYC 1MNUL 1YECL 1OAQH 2RCSL 1NSNH 1JYWA 3PHOB 3CDGA 4Y5YB 3HRPA 5D70H 4E0RB 4JB9H 4LLWA 5E5RB 5HJ3A 5CBEB 2YOCA 4Y4KA 1Z9MA 2Y5EA 1VFOA 4U31A 2F54B 3LIZH 2V2XB 1AC0A 3U0TA 2ZUVA 3QHFL 5AZEH 3ARSA 3QP3A 3RA7L 4NO2B 4OZFB 4LGSB 5IGXL 4MA3B 1QP1A 3K0WA 3HE6B 2OL3B 4QOKD 5FO9A 4PJXA 3FO1A 3W2DH 3BYTA 4PG2C 5FUOH 3OR6B 5T1KA 3VXUE 4V1DB 1KUMA 3CX5J 4Z18A 3T2NL 3N50A 4KMLB 5DD3H 4PJIA 5T33L 4RZCB 1CGSH 1JPTL 3QXVA 1PX3A 1BOYA 3SCMD 3O8XB 3B5GA 4ZS7H 3HUJF 3QDGA 4HMCA 3MBED 2O5XL 4M93B 1BLNB 2UUDK 2HVJA 4M61B 3KHOA 1I1CA 4R3SA 1I7ZA 4DK6A 3HS0A 3GSNL 4YHPA 4P5TA 3BXNA 3QQ3A 1XAUA 1FJ1A 2B20A 4D8PB 1ZAGA 3DV4A 4MCYB 1HK6A 3KJ6L 3LSOA 1D5MB 3NIDF 4RGMB 2EDKA 1K4DA 2M26A 5ADPH 1XZ0B 3WXVL 3FO0H 3TYFA 5K9KB 4WHCA 3U6RA 3Q1SH 4Z0BL 5EWIH 5EO9B 5IJKA 4JG1H 2DM7A 1ZT1A 2F8XC 1NLBL 4IOIB 4JZOA 5E08H 3D2UD 5KVMC 3CMOL 5JMOC 4X98A 1DBAH 3VFRA 2EYSA 3A6BL 5TFSL 4L8SA 1G6RA 1QSFE 5E8EB 2B4CH 5LBSH 5ILTH 5DR5H 5H94B 3L5WB 4KHXL 1AP2A 4LARH 4CRPA 3MJ9A 5FKAA 3C6SB 5TQ0H 4JN1L 5GS1A 5IJVA 5GISH 3KPRB 4EQ3A 4MXWH 2BXZA 5F72S 2Z9TA 3P4MA 2WAHA 3TIEA 1OTUC 4BZ1L 3IT8D 4QTIL 3NCJL 3PWPD 5FO8B 1KLGA 5I8CA 3ULVF 2JJSA 4JPIA 3K4DA 5E8NB 4PTTB 4HKZB 5L0QC 2IALA 4MNHA 5KANG 4KPHL 3EDJA 1JPST 3VXTA 4QY8A 4LSDA 3BQUD 1A3QA 3CU1A 1JGDA 4IIQA 4M6MH 1X6LA 3DNKA 1JHTA 3IB4A 1X5XA 4MSWA 3HZVB 4YHZL 2WLZA 3SGDH 1GZPB 4HH8A 4XAKD 2WUBL 5GSRA 5HDBF 3UTSE 2ID5A 2FB4H 1ZMYA 3F5WA 2NW3A 1AD9B 2D7QA 3PHSA 3FOLA 4PS4L 4LF3A 4OGAD 4J3TA 3V6OE 3PJSB 4PTUB 4QXGL 5FM8A 4KTEL 1TPXC 4JHZA 4PRPE 3O41B 1FAIH 1TDQA 3RJQB 1CDGA 3I6LD 2BFVH 3OB8A 3VFVA 2D4DA 2BVQB 2X4NA 5GIRB 1J1OL 3PWVB 5IESH 4KV5E 3OR7B 2D3VA 2C9AA 1DBBL 5JUEH 1MIEL 4FQXB 1NCDH 2GTZA 1BZ7B 1XGYH 3K1DA 3L95B 4XXDB 3FQNB 3D48R 2XA8L 1HN1A 4HBCL 1I1AA 5IM7A 1AJ7L 2OSLA 3SBWC 2VDPH 2FEDC 4L8BB 3CFKB 1VESA 2VZSA 3QO1A 2ESVD 4RX4D 1FCGA 3IAPA 3KYAA 1PEZA 3EDDA 1YPZA 5MEND 4UBDC 3MRBB 2HFGH 5I16B 2R1YA 2APFA 4QRRE 4KDTC 1T0MA 1I3RA 4X5WB 4HIEB 3RVTD 1FFRA 2WWKO 3T0DA 1FVEA 4NDMB 5DT1L 3REWB 4NGHH 5A1AA 3S3PA 4CW1B 1V3KA 4ODVH 3R4DA 3CPLB 1RJYA 2IANB 3VDBA 2IPTH 1JPSL 5EZLB 4WFFE 1DE4A 4X4YB 4ZTOH 3BKYL 3EGSB 3DBXA 3C5JB 3OGCB 4M7ZB 1AI1H 2P8MB 3TFKD 2RHEA 2AV7B 3V0VB 3QCTL 3MJ7A 3X12A 2Z4QB 2ICWA 4NCDA 1S7RB 3DVIA 3V7AG 3P9MA 4J4PC 4PY8I 5DA0B 2ZUQB 3AY4A 5C0AB 4RA3A 4JO3L 3V95A 2P43B 2FECL 1T7XA 3MRJB 6FABL 5E8DH 4DKAA 5DD1L 2X9XA 2VDKH 5E2VH 2MSPA 4TRPL 4JJ5B 3DYPA 4HJ0D 4YFLF 3IU3A 1U2HA 3FQRB 3W39A 3NZ8A 4GXVL 2W91A 2DLFL 1IAOA 5L7XH 4PGZA 5SWZA 2IWGA 4GXUM 2ZWLT 3MACL 4JLRA 3VGAB 1RIUL 3JV6A 3NIFF 4AT6B 5BZDB 4CVZA 2ICCA 5IT2L 5I66B 5J1TC 2YRPA 2EKSA 4PY7A 1F58H 2CLVA 4AEFA 1CQYA 4P2RE 2DQJH 1X5YA 5F9OL 4OZHA 1XGUB 4ZUVB 4FFZH 1AY1H 4M6NL 3SE8H 1DUYA 4RGMC 1NH6A 3O3BA 4GKOA 5A2JH 1KXVC 4HQQL 4M8QB 1U6AL 1JP5A 4ZXBD 5DRZA 4CUCA 5C6TL 4NQVA 25C8H 5FFLA 5I8KL 4Q0XH 1TJGH 1UCTA 3MV8A 1CG9A 1A14L 5GGTA 4D9RE 1UKSA 1GGIL 3ARBB 4NZUL 3CZFA 3HS0B 3PL6D 4PJAA 4CKVX 3JZ7A 2H3NB 4JY6B 3UBXB 1HSBA 5DUMH 1TZIA 3BXNB 4RQQB 1NUFA 2DF3A 1C5CH 3QAZC 3FFDB 3O2WL 1MJ8H 3BIBX 3GHEL 4HHAA 4TSBL 3DV4B 4PRHB 4OLVL 2OR9L 4KDVA 3LSOB 1TJHL 2NXZC 3HNVH 5T3XL 4NM8H 1ZHNA 4O02L 4LPCA 5F9DC 4HUWA 1QQDA 3TYFB 1IKFH 4P4KD 3V52H 1LGVA 2NY7L 1GPOH 1WT5A 5B4MC 2J5LC 4XMLL 3BIAX 4LKCA 3QEQE 4HT1L 4JZOB 2JB6A 4LVHC 3EFDH 5DVLA 1PYWB 4L8SB 3DVFA 4KXZI 1G6RB 4JO1H 1NAKH 3S4SB 3E0GA 3ECBA 1CT8B 3RWGB 4K7FA 4U1MA 5JXEC 4G9FE 3U79A 5C3TA 2AGJH 3CFJA 1ZLSL 2Q76A 2JTDA 1EDQA 5GRUH 4P48A 3AS1A 1NFDE 1CXHA 4GAJH 5GS1B 3P30H 1N5AB 1SBSL 4LPWA 5C0DA 3UDWC 1KTRL 3QWRD 1VENA 5I6XC 1HZHL 5DMIL 1KLGB 3RWJB 2YPLD 1QUNA 4LSTL 3MLYH 4N1EA 3EYQD 3KPMB 1HYSD 5C08D 2DQUH 2IALB 4MNHB 3V5KA 3EZJB 5HPMA 4V2BA 1MHPH 1V05A 3DECA 5E94B 1P9MA 3TA3A 3WS3A 3Q48A 4FQXC 1A6VH 2GJZB 1FCCA 2CIKA 1JWUA 1N26A 4TVPD 1JGDB 5CJOH 1WWWX 3TBSA 4F80A 1JHTB 3GM0A 3MNVB 5F1IB 1DSFL 4EN3A 3ARGD 1P84K 4LKXB 3QUXC 5CZVH 4LU5H 3BWUC 3DURA 2GW5A 2J4WL 2BCKA 3MGOA 3SKJH 1ZANL 2GJ6E 3STZA 3U1SL 3WN5B 4FZEH 4UT6L 2X10A 4OCYH 3VRLF 1AO7A 3FB6B 3GMMA 2VZ3A 1HWHB 1U8QA 4G8EA 1AGBA 5IOPB 3MRLB 2D7TH 1Y0LA 1I7RA 4XMPH 2IG2H 3VFVB 1E4WL 5D1QD 1UH4A 5BVJA 2CUHA 2HRPH 3NCEB 2F5BH 1VA9A 4OLWL 4OIAA 3S88L 3DUUB 4NNXB 1NMBL 4DGIH 2V2WB 4RDQG 1SYSA 2EKJA 2GTZB 3D18A 4HIJA 4LCCC 2DYPB 1TZHB 3VXOB 3VG0L 2H8PA 4OQTA 1QRND 4M4PA 1I1AB 3EDKA 2OSLB 3WMSA 3NA9H 3N85L 3RDTC 1EMTH 4QRSA 1G7QA 3V4UL 2MCPL 3C08L 3L3DA 4UT9L 3PF2A 3MRRB 5AZ2L 2VXVH 4S11A 2A6JA 3SJVA 4KC3B 1SVCP 2BXYA 2R1YB 3RRQA 2EDEA 2X89D 1AGEA 1F90H 4Z7VA 1HKFA 5E2UL 5BMFH 3IFPB 2VABB 4H8WH 3G6JE 2EYRA 2NY3C 5JMRA 2UZIH 1YY9C 3EOBB 1SY6L 3V7MA 5J1SC 1I8MB 1BQHB 3ILPA 1C1EL 3VGAC 1JZ3A 1UEMA 5C0IA 5CEZE 2VLRB 1EERB 1RJCA 1OLZA 2PF6A 2EDFA 2YBRB 1WBXB 3RVVD 4BELD 3PQYA 5IG7A 5MEPA 3QDJE 5FF6A 1F8TL 4K8RC 2ICWB 2Y7QA 2PYED 2X4OB 4PJBB 1L4IA 4XVSL 1T03H 2QADC 3CUPA 2G5RA 3EYSH 3TNNA 3ZE0F 5B8CB 1UXSA 1RHHB 1ZHBA 1C8PA 1V7ML 3EFFB 2WSKA 5ELIA 1BFVH 2QV2A 3TNMB 4KVCH 1OB1A 3CGTA 2XTJD 4UTBH 1NGZB 5A2KH 2Y06H 1OF2A 3S35L 4DCQA 5JZ7C 3IU3B 1BD2A 1FL6A 3JWDL 3ARBC 3SGJA 3IJHA 5I76A 5GRJH 4Z77A 1A6ZB 1MWAL 1A6UL 4W68A 3S3SA 5CEZD 2EKSB 2EXWD 5C0RL 3SDAB 2CLVB 4MJ2A 4RWYH 1NKOA 3FB7A 5FYKU 4OZHB 4TNWK 1Z3GL 3WNPA 4JFYA 2IFFL 3INUH 1JJUA 4RRPG 3G04A 1A21A 1CFQA 1UYWL 2EE2A 4MGXA 1RZJC 3MUGA 1MH5A 5DRZB 3QJFA 1YEEL 4RMRA 4PGDB 1Q9KB 3TH4T 5DVMA 2QSTA 5IBUG 3MV8B 4NRYA 5JHDE 2VQUA 2Z31D 3GMPA 3L5JA 4L3CA 1EO8L 4AM0B 3E6HA 5FDWA 3MREA 3CZFB 3FT4B 3S37L 3TBTA 3OKMA 2MTPA 4PJAB 4OT1L 1LILA 2RAMA 1QYGH 3RY5A 3FT3B 2F15A 1L6XA 1TZIB 1N0XH 2YD7A 4EJ1C 3SN6N 1QFOA 3B6SA 4KMTH 2DQHH 3KLAB 4UTAH 3DO7B 1T22A 3IAQA 2D2OA 1DLFL 1GIGL 3W9EA 5K93A 2X7LA 5A16A 5I15L 4D9QE 5DD5H 3K8MA 1WQVT 2AK1L 2ZUWA 2X4QA 3EHBC 4U1HB 5HGHB 3ULUL 5FYJD 7CGTA 4UV7L 3T65A 2NX5B 1K8IB 3ULUC 3QEGH 4D2NA 4JQXA 2JB6B 3WO4B 2R4SL 1N6QH 3PUCA 4YQXH 1KCUH 1PZ5A 3LS5H 1Q72L 1OGAD 2HWZH 5HY9A 3U9PH 3U4AA 3WNLA 1KB9K 1WSST 4GAGL 4JFFB 1CE1H 1IQWL 4PG2A 2IFGA 4PJEE 5I73C 1J1XL 3UTZB 3X13A 3ECBB 2ZOLA 4EVNB 3IKCB 2UYLA 1QO3B 2OM5A 2GUOB 4L5FH 4HX1A 3MLXH 1S8DB 1OP3K 2Q76B 2AEQH 3GSRB 3RTQC 5CZXD 3DX9B 2EE9A 3DUHA 1L0YA 4W70A 5DURB 2Y36H 3VXNA 4ZO9A 1I8LC 3Q5OA 4X8JB 1LK3H 4OM0H 5IFJA 1EK3A 3RJDA 2P44B 4JB9L 3V4VH 1A22B 5E0QA 2HH0H 3G6AB 3GK8H 1UWGH 2R0ZH 2D0HA 1X4XA 3HE7C 2AJVH 2PXYB 2ATKB 3MUJA 3U0PB 3LHPH 3NN8B 4HMEA 4GW1B 5HI5D 1P4BH 1PLGH 4PJCA 3VWKC 3AMLA 4M48H 3KPQB 2W9EH 4YDJA 5FUOL 4EN3B 1ZHKA 3NFNB 4FTVD 1F3JA 4ZUWA 4ZUTA 4NO5A 5KVDL 4PBVC 1A2YA 1MJJA 4XVJH 1Q0XH 4FQ1H 4N0UA 3FQTA 5DD3L 2Q7NA 2VR4A 3QXUA 3T1FA 5FA4A 1H3PH 2DLTA 3ZKNC 3NACH 2DICA 1MFCH 1AQDB 3BPOB 2EH8H 2AJXH 3E3QC 1UZ8B 4G8EB 4ZS7L 5D7KD 4E41E 3UPAA 2VIRB 4TTDC 3BZFA 1ZLWK 4AEIH 2BRQA 4P2OB 5E9DE 4XTRD 4XVTH 1I7TA 2VISA 3LB6D 3EYVA 3L3KB 4IEFB 4PP1D 4CMMA 2C3XA 2P8LA 1ZXQA 5IVXE 3W82A 1UM6L 4U1JA 1CTNA 4JKPH 4RAUB 5ISZE 4XI5C 3GB7A 4WUUB 1C12A 3I02B 3MRPB 4WWKD 4HWEH 3ZKMD 3VMOA 3O4LA 3VFOA 1L7IH 4JFOB 1DBJH 3JTSB 5DRNB 1T4KB 5ADPL 2YK1H 5F7YC 3FQXB 1LEKB 4JKKA 1ND0B 4PGEB 3ARPA 2O93L 5EWIL 1FO0B 4RGNB 5IW1A 4OZGE 1J1PH 2IADA 35C8H 3GJFH 3S5LA 2A6JB 2JCCA 2DQEH 2XV6B 1U8JA 5IB2B 5E08L 5I1KH 1LEGA 2YD2A 3L1OL 2FL5A 1F6LL 1C16A 1DBAL 1TQCC 5CSZA 1EFXA 5KSBE 3M17A 2B4CL 3QBTB 5LBSL 1WEJH 1PGRB 3T77B 4H26A 4E42B 4IOSD 3Q0HA 4NWUH 1A6PA 4XRCA 5E9DD 4Z7WA 1P5VA 4PJ9D 5FOJA 2NY6D 5EZIL 2EIDA 4LARL 3SO3B 1LO3L 2GSIB 3D1MC 3REVA 1O5DT 4WV1C 1PQZA 5TQ0L 3L5HA 5GISL 5DQJA 4MXWL 1EHLH 4YFDB 5IMOA 4OGYH 1BF8A 1KEML 5FF6B 2I5YH 4Y5VB 4F7PB 2WZPD 3CUPB 2VLKE 2DB8A 5DJ0A 3KPSD 4MD4B 2EZ0D 3BHBA 3L6FA 4BH8B 4NFDA 3DGGA 1DN0A 1CFVH 1MRDL 2FR4A 3TJEH 3LY6A 3G08A 3SBWA 2A9NH 1BD2B 5ID1A 2Q6WB 3S7GA 2WBJC 4P23D 3IJHB 1Z9LA 2BHZA 4HH9A 3R8QA 1LEIA 2J8OA 4U6VH 1MLBA 3TZVA 3O0RH 3OAZK 4QRPB 2GK0A 3QIBC 5D7LD 4U6HA 3DIFA 4LNRA 4R4FL 2OP4H 1VKXB 5AYQA 3V6ZB 4DZBB 3WS6C 2QJDA 4F3FA 4JFYB 5T1LB 4OLUH 5EU6D 3AB0B 2VQTA 1R5IA 2BFVL 1EA9C 3G5ZA 3BISA 2XKNB 3I3EA 5IESL 1MH5B 1YNLH 5F1KC 1IEAB 1SEBB 3QIWB 5ESAA 5JUEL 4QGTA 4EZMA 3D39E 1NCDL 4X99B 3WKNA 3BP5A 1XGYL 1IQDB 5KS9E 1JRHL 4WNQA 5ICXA 2WIMA 3VXMD 3LD8B 3TBTB 3OKMB 2CLRB 4HD9A 3HZYB 4G43A 3ILQD 5DVKA 5IMMA 3HRZB 2G75B 4IRZH 4K2UL 3RWIB 5BXFA 2V6HA 3BPCA 5LGKA 4UI2A 3ROLB 3BKCL 5GPRA 4LSVH 5D5ME 3OKYA 3UTTA 5C0CB 2XXMB 2X7LB 4UOW0 5DHXB 5HHOA 3PHQB 5LG1A 2VXUH 3X17A 43CAB 5IFHH 4EI5B 4F58H 5CWSA 1JN6A 1FZKB 3DLQR 3GBNH 3VDCA 4C56D 4HAFA 4Y4FD 1U0QA 2XZQH 3UZVB 3MRKA 4NN6C 4KKLD 2P5EB 2DS4A 4PB0H 4MD0A 3F6LA 4ZTOL 4ZSOE 1AI1L 1V8HA 2V2TB 4PJHE 4NO3A 1EH9A 3U7YH 4NUJB 1MCOL 2C1PA 3UAJD 2UYLB 1QZ1A 4RFNB 2FJFA 3DTXB 1QVOB 4NHCH 3V4PH 4HCRH 5SWQB 5J12B 3RKDC 3KPRE 2BOBA 1BP3B 3LH2H 5IHUH 2VDKL 5SWSA 4KKNA 1WTLA 4GUPB 2D9CA 2BRRH 2F53A 5IQ7L 5J7CC 2NY5L 4P2OC 1RUAH 2VE6A 4XB7A 3VW3H 3GSNB 5H8DA 5CJXC 4YDVA 2VLJD 1AH1A 3RHWK 5CEZH 1U93A 2RB8A 5FGBA 2B0SH 5B22A 2FSEA 2KH2B 1J9CT 3WFZA 1QSEB 1BVKB 3RL2A 3G6DL 4Y0GA 1AY1L 4PJCB 2FCBA 3G5YB 3SE8L 1CICC 2LQRA 4J3VA 1ZHKB 2VXTH 3L3IB 1F3JB 3DHJA 1FYTD 4NO5B 2BVOA 4G6KH 1IC7H 1MHHB 3FQTB 4KI5E 5CMAA 3T1FB 4KV5F 25C8L 4Y1AB 5FA4B 3M8OL 3STLB 1QLEL 4Q9CA 1U92A 1U3HB 4TSAH 2APTA 4R7NB 5E4EC 4LSPL 2VSCA 3NFPB 4JRXE 1BFOA 4MVBC 4CJ0A 1NCAH 3I9GH 5DUML 1CE6A 4QHMA 1C5CL 3QNZB 5C0BE 4U1JB 1MJ8L 4LQ1A 3DGCR 5BRZA 4HKJB 1LDPH 1C12B 2X4SB 1EAJA 3O3EB 1CDUA 3KNBA 1B0RA 3O4LB 1Z9OA 1FV1B 3FCTA 5EO0B 5F6HJ 2R1XA 1IKFL 2A1WH 4L29A 2CLZA 4NQCE 4WI3A 2B1HL 3V52L 5IW1B 2PW1B 3IJSA 3QSKB 3C60B 2ADJA 1AGFB 4MJIA 3QDME 2MCG1 1NEZG 3S96A 2FL5B 4M7JH 3HZKB 3MRIB 1R5VA 4I18A 1NAKL 1JWSB 1A4JA 1MI5A 5BS0D 4QYOB 3MYZA 1VEOA 4H26B 4EOWH 2GITA 4ETQB 5HYSG 1OWWA 3KPPB 3QUXA 2BVYA 4H25A 2G60H 3DV6B 2AGJL 4XBEH 2HG5B 3NCYS 5HYQB 2YWYA 5KN5A 5JNYA 1CDBA 1KELH 1J0HA 1DQDH 1LNUB 1SEQL 5GRUL 5F7MC 3UYRH 1KJ2H 3P30L 1I1RA 1KCKA 1GHFH 5MI0B 3V8CA 5D1XD 4O51A 5C86A 5HYJA 1IARB 4APQD 4CN4A 5GQBA 5CD5C 2HFFA 3CXDH 3G9VA 4L3EE 3WUWG 1QFHA 3KS0J 4NPYB 4QNPE 4W81A 4K94H 2QHRL 3BHBB 4M6OH 1BGXL 1PEWA 4ORZC 4TUJA 1MHPL 3MUHL 3T0ED 4LCCA 2P1YA 4OCXH 3RUGE 1NDGB 1A6VL 1RK0A 2PUQT 1YA5A 4TNVF 5JOFA 3BP7B 2DWEB 2OLDA 4LLQA 3O6LL 3VA2C 1XF3A 3DRQA 4IHOB 1FL3A 2PTTB 3UEZA 1M7IB 2IAMB 3W5MA 4PPTA 1XIWD 2EDQA 1Q9WB 2DM2A 1CCZA 3MJ8A 4HH9B 3O2VH 1X5AA 4NM4L 3SKJL 4O00A 2UY7A 1XR9A 5I17A 2YPVL 4U6HB 1Y6MR 4OCYL 1E28B 4LNRB 3MO1A 2R8SH 4LQFH 1F4AA 3DVNA 2D7TL 3C5ZB 1FPTH 3FKUS 4NQSB 5DUPH 3CCHA 3KLSA 4PJXE 4XMPL 4NNYB 5E8PA 5J6HA 2IG2L 5F8QC 3SCMC 2JE8A 4WU5B 4L4JA 1FVDA 3MBEC 4AY0A 1CL7L 4QRQA 3OKNB 4LSUL 3L7EA 3RGVD 3QFJA 4M1DL 4PJIE 4DGIL 5F88A 3DX8A 4PJGB 5IQ9B 3ZT6A 4F33B 4CVWA 3D25B 2GTWA 3R06B 3CFIC 5F96H 3U4EB 3QDGE 1VPOH 1UGNA 1RVFL 3NA9L 4PJ5B 2I9LA 1BJ1H 1B6DA 1X7QB 1QEWB 4HWZB 3T08A 5I9QB 4X4XB 5I19H 4A6YB 1NC2B 1U8KA 2VXVL 1G7MB 2DQDH 1S7VA 2P7TA 1Q94A 4ZNEA 2H32B 1KC5L 4WFHE 3GSVA 4Z7NE 4H8WL 2XWBA 1JMXA 3WFCH 4GFTB 3MR9A 2UZIL 5I1LB 5EC1A 5DZNA 1JHKH 2D0FA 1G7LA 1I4FA 4LCYA 1LK2A 4OD3H 3U4BH 1BZ9B 1YUHA 3HG1A 2VLME 1MWAA 2EO1A 1MVUA 3TIDA 2F58H 4JHBA 4XP4H 2FX8H 4IDJH 4PJ8B 2C7UB 5JW4N 1LO5B 1CLOL 2QQNH 3ARDB 1A3LL 3F7QA 4JVPA 3NMEA 4RGOH 1T03L 3IF1B 4LAQH 3EYSL 3VXSB 3B9AA 1NGXA 5C0FA 1T66D 5EBGA 1OY3B 4I3GA 3FOMB 1KFAH 3HR6A 2BOBB 4EDXA 2XG5A 1U3HC 4QHKI 3K7UA 4ZFOL 3S34H 5HPOA 3IDUA 3BQUC 3WKMH 4H1LH 1BECA 3W0WB 5GRJL 3NCYP 4NFBA 4YO0A 2W9DH 4HKXA 1PBYA 12E8H 4HGWB 1FNGA 1G6VK 4B7IA 2FO1A 1E4KC 1VDGA 2LVCA 3MJGX 1FN4B 1R24A 3C2AH 2HLAA 1ZHLB 2EXYD 1BIIA 3CU7A 3MGAA 4G7YL 1KGCE 1EIBA 4FP8L 5C9JB 4OGAC 5DMKA 2K7QA 1HDMA 4YXHL 1X6NA 1NFIB 4ISVB 1UB5A 3MRFA 4I5BB 5A3ID 5CMAB 3O6FD 1T2QH 4P2YA 4K3HA 1H3WM 2VDRH 5JDSB 1FFPA 1FNEA 1YN6B 1T80A 4N8VG 3HUJB 5GS2D 1U3JA 1QYGL 1SMOA 3LKSA 5TF1L 4HF5L 1N0XL 4QHMB 1S5IH 4KMTL 2CUMA 2DQHL 4UTAL 3QH3A 3FQWA 1JBJA 2W0FA 3ZSTA 1BREA 4JDVB 4QXTA 1J18A 5DD5L 3F7YA 5KG9B 5EA0H 3STBA 3T0WA 3G6JF 2EE3A 5IB5B 4YPJA 3IJSB 5FGSA 3RVTC 5CEXA 5L6YL 2E5EA 1J0ZA 1I9RH 1YPZE 1N6QL 1KCUL 1WZMA 3LS5L 5ESVB 3U9PL 1ZT7A 1KV3A 2HWZL 2RQ8A 3BPNC 1RUQH 3O9WC 1R5VB 3VWKA 4EDWH 1CE1L 4I18B 1A4JB 5CBAB 3HPJA 4U1IA 2IAMC 3FTGB 4QWWD 3K4AA 4WI6A 5CCKH 2VDOH 5KN5B 3MX0A 3TWCH 2IH1B 4NZDA 4P9HL 2H9GA 5HVHC 1T1XA 4GJTB 4CVXA 2XWTA 5INCB 2Y36L 3TV3L 4G6JH 4OM0L 3RIAK 3C5ZC 3BO8B 5KJRL 4G8FA 3BX7C 3V4VL 4MXVE 3QUKA 2HH0L 3GK8L 5D8JH 1UWGL 1MPAH 4HJ0C 3RKPA 1FE8L 2R0ZL 2R29L 4ZYKA 3BRGC 4FZ8H 2AJVL 4OSUL 5I2IA 2EDJA 1HCVA 4JO4H 3LHPL 2X44D 2ATPA 4LLQB 1CLCA 5KSUA 1PLGL 2N4IA 4YIQA 2VR9A 3M1BB 1X5GA 5CFHA 3JWOH 2CDFA 5SWZE 4FQ2H 3MJ8B 4XVJL 1X5KA 2DWDA 1YC7A 2K3TA 1XR9B 2F9BT 3RNQA 3VFMA 4A2MA 5JQ6H 4ZXBC 4ONOA 4X7SH 4Y89A 1A1OB 1T7VA 1ZEAH 3NACL 4XBGA 1I9IH 3FO2A 4DFHA 1TVBB 3MLSL 4RBPK 3QIUB 2Z0BA 1I9JH 4XNZC 4MA8L 3MCKB 5EBWA 3VD3A 4AEIL 3C8KB 4WI5A 3MFFB 4DUVA 4LRNH 3GNMH 4DVBA 3T0AA 4HXBH 4R4BB 3B9VA 4KJYB 5T1DH 5D1ZB 1ZK9A 3QUZB 1IAMA 4UIKL 4U33A 4BFGA 4FN0A 4HWEL 4FABH 3TVMD 2X42A 3WL9A 4O58H 4PJ8C 1DBJL 3VJ6A 1MCPH 3ARDC 3MC0A 3TBWB 3RX8A 3WJJC 5TJWK 1M71A 35C8L 1H15B 5I30H 3GKZA 2YD8A 2LU7A 2DQEL 3H9SB 3DMMA 1S7VB 2P42B 3I50L 1M05A 2H26A 5EFIB 1HHKB 3VFWB 4AENB 2BNRD 4QRTA 3GSVB 4XP6H 5HHVH 1JZ5A 1WEJL 2WBJA 3A6OA 4MQ7B 4QLRA 3VFUA 4IRSA 3RZWA 1HXYA 4PJEF 5KSAC 5FYKE 4XCCH 5EU3A 5IW3A 3MA7B 1KPUB 1I4FB 1QLFB 4N0YH 3QIBA 1LK2B 5FKPA 1EAPA 5IV2A 1AKJD 1EHLL 3TIDB 4UZGA 4PGJA 5L2JA 4MHHI 1BF2A 2CDEB 4NQDD 4OGYL 1JGEA 2Z8RA 2QSCH 3T1WA 5TDPA 4YDLC 2I5YL 2XNAB 3JV4A 3TT3H 1MCSA 1I7UB 1U8PB 2FHCA 2A83A 3BT2L 3BH8A 4F57H 3IXAA 5IVOA 4ZTPH 2A0LD 5D7JB 5C0FB 5J1AB 1CFVL 3WIHH 1HYSC 5FB8A 3MRGB 3TJEL 5FIEA 2AEWA 4TVPL 2QQLL 2A9NL 3C9NA 1W2KT 1S9VA 5C07D 2NQCA 4KXZH 3D3VB 3FFCB 4L4VD 4P2QD 3RPIB 3QULB 4U6VL 2QKIA 1MF2H 4HKXB 3CC5A 3VXRA 1FNGB 5AD0B 2NCMA 2WW8A 1YEGH 4RIRA 1BZQK 3QI9B 4JR9H 4LLDA 2HLAB 1HHHA 3Q6FB 1JZ4A 5HHMD 3BYYA 4Y88A 2DL2A 4OLUL 2E6JA 1BQLH 3SDDB 2FIRT 4IS6B 3R0NA 2OTWA 1MQKL 4G80A 1N2RA 2DJ4A 1ZVSB 5IVXF 2OJZL 2FO4A 2F8VA 3AUVA 1OSZA 5FK9A 3SGKC 4BA8A 4TSCH 5D2NB 1AO7E 1FNEB 2R39A 5HHNA 4XGZB 1QBMH 1W72H 4ENED 1G0YR 1PX4A 1OWRM 3FRPG 5F7DB 4OV5A 4LPUA 4Z78A 1R3HA 3RPKA 4OZGF 4JPWH 1WFNA 1CDYA 1JPGB 5GS3A 4LSVL 3QDHA 5GS0D 5J6GA 5IBUB 4W4OA 1N64H 2AJUL 5JIHA 4OD1H 3H3KA 3CMGA 3F7YB 5KSBF 4LFHG 2VXUL 5GXBB 1A1NB 1UACH 3GZKA 5IFHL 4OCLC 4F58L 1NC4B 1JZ2A 5DRXB 3NABL 2NYYD 2FDBP 3ARFA 3DXAD 4BFIA 4JM2D 5CEXB 3GBNL 1DUZA 4OFYD 3ULVC 2EYTA 3L5XH 5T3ZE 2XZQL 3NPZB 4X6CE 1JF5A 3SJVE 5B39B 1T83C 4MB3A 1RAMA 2PETA 1ZT7B 4Z7VE 2DL9A 1LD9B 1CICA 1G9NC 4GMTH 1RUML 3FAWA 1XH3A 5D9SA 3U7YL 5F7UA 1EFQA 4FQLH 4HCRL 5HVFB 2P4AB 1U8NA 1ACZA 2EO9A 2MHAA 1UWXK 3KYKH 1BBDL 5IHUL 4C57C 1NGWA 5D93B 1KIQB 1R3LA 2JLLA 3EYFB 5DC0A 3PQYE 2J8UA 2BRRL 2P24A 3QZWG 5DLML 4Q9RH 4HJGA 4G8FB 5T1MB 2IMMA 1RUAL 1MIMH 4R96B 3AREB 3VW3L 1MLCA 2X05A 3OX8B 3LKNA 4X6FA 4ZYKB 3KVQA 1CYGA 2Q7YB 5CEZL 5D1ZC 3QUZC 1T21A 1YMHB 1P4LA 1I1FA 1M7DB 2EXWC 1IAII 2ZJSH 5E6IB 3VWJB 5D6CA 1Q0YH 5GZND 4YIQB 1OAYH 5J13C 1S5HA 4HFUL 2WIIA 2VXTL 4B7LA 3D0LB 2CDFB 4G6KL 3A67H 2DWDB 1AE6H 1IC7L 1Z5LB 3GDBA 3MJ9H 5ICYA 4WW2A 1MY5A 4NC2B 4TSAL 1O7SA 3T8XB 4LHUB 4NJ9H 2AVGA 1JL8A 2BNUB 5ID0A 2V5YA 1N4XL 3TN0D 2Z31C 1CVSC 3O3AB 3CVHL 5GGUB 3PWNA 1NCAL 3I9GL 3IAGC 4DVBB 5IB3B 3MRDB 4RNRB 3U0WL 3WFHA 5CSBA 4G8GD 1KTKE 3C6LC 5I74B 1A7BA 3MRNB 2Y5TA 4MWFA 2FBOJ 1B4JH 1J7VR 4FS0A 4PJFA 4TQEH 4EBQH 5DEGA 4XT1C 1DP0A 4MYWB 4NQEB 5DJ8A 1TTUA 5A2FA 4Z7UA 1U95B 3AC0A 3VH8G 3JUZA 5D7JC 5K9QG 3JSSA 4AMKH 2H26B 1JNJA 1X5HA 2GT9B 2VXSH 4QRTB 3SE3A 4S1RH 2DKUA 1BX2A 3M07A 1GGCH 3RZCB 4EOWL 2BY3A 2HP4A 2PW2A 2IGFL 4QOKA 1VFAA 4QHNA 4XBEL 5EU3B 2XN9B 2MQCA 5CSGA 4Q2ZB 1DQDL 3MJ6A 5E99H 3BW9B 3UYRL 4K23H 1KJ2L 5L2KB 2V7HB 1MELA 3QI9C 1H3XA 4XNYH 5GJSH 5F3BA 1ITBB 1I9EA 2DM3A 5CZXC 3SCMA 5D7SH 3CXDL 3JV4B 5DK0A 3HHRB 5C70A 3MBEA 2LTQC 1J8HB 5D7IA 3GJEA 2X4UA 4ZQKA 1H3GA 2OR7A 4LPTA 4K94L 4AYFA 4F7TB 5ERWA 4Y16B 4M6OL 3GBLA 5KSVA 3PWJB 5ALBH 3MV7E 1T0NA 4NBZB 2PCPB 1OTSC 3FMGH 4OCXL 1ZA6A 3BD5A 1X44A 4M1CD 4LCUB 1CGXA 4OTXL 4DAGH 4X7DC 3HC0A 1FLRH 1UJ3C 3MGTB 2A6IB 5FUCC 3ZE1E 5HI5C 5DJ6A 2C3HA 2Y1VA 1PAMA 3MV11 3FO9B 1XF5A 3O2VL 2FATH 3VXRB 3CC5B 4XVUD 3IS1X 4KI5F 2J12B 1AXSA 2FZ3B 5T5NF 3UPRA 3BPLB 4TN9A 3D2UA 3I85A 2YC1A 4YXKH 3SKMA 1FPTL 4BFBD 3EAKA 4X7TA 2M8XA 5F7EH 1BQUA 4ELKB 2JJWA 4WDIA 1G9MC 4LOUD 4XCNA 4N0UE 4YHKL 1KG0B 2XWJA 3LB6C 2Q8BL 4LL9A 4OCWH 3P4OA 4HKBB 3MV7D 1OSZB 2UZYB 5FK9B 5C09D 4R90L 2CPCA 5F96L 1CFNA 4R8WH 2B7DT 4YK4C 2HT2C 2OXGA 4H1LG 4WWKC 1VFUA 5F93C 3ZKMC 3H0TA 1EJ6A 2OX5A 3GSUA 3PWPA 3ZTJH 5I19L 3RWDB 3W9DB 3V5HA 4KQ4H 4I0PB 2KPNA 2DQDL 4WHYG 5ADOH 4G6ML 3GI9L 3QO0A 1SJXA 2IPUG 5F6IB 1TMCB 3CVIH 4G7VL 3CH1B 1ED3A 3BQUA 4YX2H 1UC6A 3ETBF 3WFCL 4UQ2B 4ZFOA 3MV9D 3L9RA 4NWTL 1Y18B 3ARTA 1JHKL 1DUZB 1E4KA 2HJFA 3U4BL 4R7DB 2JCCE 2NY6C 4HSQA 4BYHA 2C26A 5IUSA 4JFPA 4XP4L 4JFDE 1DTUA 4IDJL 5GGTH 1WBZA 2QQNL 1XH3B 5E6IC 4RISL 5CP7A 2BSSB 4RGOL 5IHZA 4Z7WE 5DSCA 3KYMA 1SJHA 3ME0A 3RAJH 5FCSH 4QNPF 4GO6B 2O61B 1NDMA 5A40E 3LN5A 2BNQE 5F89B 1A1MA 1TCRA 1K2DB 2EZ0C 5KW9H 4PRIB 3LEVL 3RUGF 1R3LB 2DBLH 4I77H 1OTUD 1IKNC 4CJ1A 2PO6D 3S34L 5FCUH 4P49A 4HJGB 2QQKL 1A7QH 2NXYB 1YJDC 3G5VA 1KJVA 4PREB 5JLZB 5FYKH 5DJ2A 1JPFB 3ZKQD 4YJZL 2W9DL 4FXKA 4G5ZL 4GW5A 4P23C 3LKNB 4RX4A 3PDOB 5DDHB 1UENA 4YDIL 4N0CD 3IDJB 1T21B 1X3DA 2R0LH 5MENA 3WJLA 2R56H 4JFDD 5ACZB 1JRHI 3ZE2E 3V6OA 4HIIA 2LAAA 2UVFA 4PJXF 2W60A 2WIIB 4JFED 3Q6GH 1ETZA 5LGJA 1ZE3C 3LEYH 4KKBC 5TPWH 2BHUA 1YYMH 4GKZB 1KEGH 2E8ZA 4EUPH 1I75A 4MQTB 4PJIF 4DN3L 1MJ7L 2A38A 4HFWB 2JIXD 1JGVH 2VDRL 4ONHB 1O7VA 3FB5B 2BJMH 1K5NA 1GGBH 2AXFB 2P5WB 1W0YT 4PRDA 5HHPB 3MZGB 1A6WH 1J05A 5DS8B 3RZCC 5IR1B 4JDTH 4PGCB 4YDKH 1WICA 4WFGD 2NY4B 3MLZH 2AV1A 1S5IL 5BZWB 3ILQC 3WNKA 2HJKA 3T09A 4I1NB 3IGAB 4CU6A 1NCBH 5IEHB 4HLZG 3SGEI 3BVNA 1D9KD 5GGSA 1CDJA 3NCMA 4G3YH 4MXQD 4ERSH 3TO2B 1MCWW 3ET9F 1MCRA 5DRWA 4LLUA 4MAUH 2FEDD 5EA0L 1XT5A 2VQ1A 4LPXA 1HEZA 4XBPA 1HH9A 2KZWA 3EZ8A 5KZCB 4UBDD 1I9RL 5D96B 4OZIA 5E1AA 4TUOA 1SJVA 3TC9A 3UTTE 1RJZA 2KL6A 2DTMH 5I1GH 3CSGA 5HHOE 1P69B 5GGQH 4HS3A 2DIJA 4RSVA 2VOTA 5CCKL 2R23B 2VDOL 2YMXH 3RBGA 1RZKH 5MP6L 8FABA 2R4RH 4XHJC 3TWCL 2F54D 3X3FH 4ZXBA 5TE6H 1ZGLM 5IB4A 4KUCF 4XWGH 4G6JL 4L4TB 4MNQB 2PKDA 1SM3H 4KY1H 4OQTH 1KCVL 1BQSA 3ALPA 3HE6D 5DK0B 5IIEA 4R97B 1JF6A 5DQDH 3SKUD 3GJEB 1MPAL 4J4PD 4AZ8A 3PL6A 4ZUUB 5DEFA 4V1DD 2DN7A 3CAFA 4P57A 1H0DB 3QNYA 4MAYA 5IW6A 2QR0A 5T3ZH 1I3VA 5T5NG 4JFQB 5B3JF 4JO4L 2HTKC 2IH3B 3WDJA 4LBEA 4OLZH 4X0KB 1INEH 1DVFB 4RFOH 1CFTA 5SWSE 2F53E 3SDYH 5LQBH 2X70B 1IEBA 1FFNB 3JWOL 3AS3A 5DJ6B 1ZV5A 3ARRA 5KBNC 1XF5B 1AQKH 1AXTL 1T2XA 2ZPKL 3QCUH 4P4KA 3C09B 5HHXH 3B2VL 3VXUB 4ZDHA 4EXPX 1ORSA 4J1UB 3W11D 4X7SL 5JQ6L 1I9IL 4ODHH 1FFOB 1KYOK 1I9JL 3SKMB 1KPVA 3FQUB 1S7WB 1HOCA 3L3JA 4YE4H 3L3HB 2X1WL 5BQ7B 5T3XE 4IMLA 3F8UB 4WDIB 3QEHB 4XCNB 1RZ8B 5T1DL 3P4OB 3DUSB 2GCYB 1GGYA 4HUMB 4KVNL 1F11B 1FZMB 3QR2A 4O9HL 4GW4A 3VA6A 2A74B 1XMWA 3OB0H 3I84A 1CFNB 4O58L 4OF0A 5JPNB 5I18H 2CXGA 1FBIH 1H3TA 3RVUD 3QWRA 5FOBA 3QHZL 2YPLA 4XX1E 3GUTB 5J89A 1UA6H 4U4BA 1QKZH 1YPZF 5C08A 4CVUA 5BRZE 4OI7A 3BRDA 4YZFF 5KOMC 5HHQA 2OQJB 2NXZD 4K9EC 3LDBB 4H0GA 4Z7QE 1T1WA 5AG9A 1IFHH 5DTFA 1OOAA 1TQBB 1QSFB 4ZFOB 2V17L 5JW5A 4MA1B 4XCCL 1JGLL 4GXUN 3ARGA 1U36A 4N0YL 2ARJA 1DJSA 4K71C 2SEBA 3U46B 4MJIE 3X11A 2WMPA 4X4MA 2LV4A 1MVFA 1NFDA 5DD6A 3QEUB 1MI5E 3VE0A 3WLWD 2ZNWA 1A0QH 4HK0A 5D1XC 4PLOB 5IHZB 5JXED 2WK2A 5DSCB 1SJHB 5C0GA 4MXVF 1TIUA 3DSNA 5D1QA 4F57L 5IEKA 4ZTPL 5DVNA 3MLTA 3VI4E 3BKJH 2VC2L 4QKXB 4MJ6A 1A1MB 3WIHL 4UILH 3BDYL 2FX7H 1I3UA 3T0EC 1A02N 2ZG3A 2AS5M 1LE5A 3OKOA 5HYJE 3NPSC 1IZKA 3DX6B 5ENWA 1YY8B 1OGTA 2Z35A 5BJTA 1MNUH 1Z0MA 1QRNA 2FH6A 1KJVB 1LO2L 2RCSH 4KK8C 4DFIA 4KJWD 5DJ2B 1RJLA 5I8EB 1CL7I 5DJAA 1MF2L 2VB5A 5K59E 1XIWC 2YUZA 3HZMB 2E7LA 4FQXD 3UTSB 4WHDA 1VFBA 5E5MA 1CD1A 2QSQA 1N5YH 5E70A 5CD3B 1A9BA 4OZHF 2EEDA 2X89A 1IM3B 1A4KA 3HMWH 4YXLL 1BQLL 2EH7L 4J12A 4PRPB 1ETZB 5LGJB 3UBXG 2D31B 2DMKA 3HC4L 2FEEI 1RZFH 2IF7A 3WEXA 3S9DB 1JTOA 5D96C 3T2NH 1QG3A 3RGVC 1EUUA 4NYLA 2HMID 5T33H 1QBML 4PRDB 4LNVA 3Q5TA 5C2UB 4PJAF 2ADIB 2O5XH 1XGRB 3IRZA 1QR1B 1Z6JT 2PYEA 3B9KB 4HV8A 4RWHA 3QFJE 4JPWL 1T3FB 1EO7A 3BFOA 4HCRA 2IAND 5GGVY 4F7EB 4NCC1 1U91B 5F3HA 3WE6A 1KN4H 4NBXB 2EDRA 2XA3A 3K3QA 4MJ5A 1ONQB 1N64L 4OD1L 1AGDB 2GJJA 1T5XA 4QRRB 3IFLH 3RDTD 3S4SG 2AXGB 1ZLUH 2Z93A 1HEZB 1RZGA 4XNXH 4N8VB 4WY7H 4DZ8B 3MXVH 3GGWB 5C0AD 5J0BA 4GG8A 1AHWA 5E1AB 2K7PA 4GRLB 3VFNB 3LS4H 4CNIA 3LKQA 4ZNEE 4G42B 1RJZB 3IDXL 4Z5RB 5LKNA 1U8LA 1FIGL 1NLBH 3RBSA 1R3KB 3CMOH 1DVFC 5GHWL 5TFSH 4X8XA 1S7UB 3BUYA 3TCLA 3GMLB 5JA8B 8FABB 2R9HD 5LCVL 2VDLL 2HVKA 2AI0H 3C09C 4KHXH 4Z95L 3KYKL 1WZ1H 3HG1E 4PV9B 4RFEA 2XPGA 5HTSA 3BESR 3TBYB 2Y4SA 3TYGH 3UCRA 3DSFL 1ES0B 4L8CA 2Z31A 4Q9RL 3LPWA 4NP4L 3EO1A 4KFZC 5AYUH 1A6TA 4BZ1H 4F9PC 3CVHA 2MNUA 4MDJA 1OP3H 4QTIH 3U82B 5D6DA 1QFUL 1DANU 5L9DH 1RUPH 1FZJA 5BOPA 3LN4B 1NL0H 3QNYB 4MAYB 2F5AH 4X6BA 4GBXB 5IBLC 3VCLA 1HSAB 2AQ2A 4AEHH 3F7VA 4KPHH 4LBEB 2KQNA 2ZJSL 1CFTB 4HIXL 4NKDA 3WSQL 5F7KC 5JZ7D 2HJLB 4WTXA 3ARBD 4P2RB 1X4YA 1FGNL 3IFOA 4PYGA 3VMNA 3TT1L 4P4KB 1KIRB 1PKQA 4M43H 4JY5H 1GYAA 3GJFB 4YR6B 4JFXB 5IKCA 5A3IC 3IETB 4PRHD 3O6FC 4ZFFA 2R2HA 4HDIA 4HUVB 5JHDA 3NIGE 1OGAA 4KROB 1HOCB 3L3JB 3LDBC 4QXGH 5EU5A 2NY1B 1IC4H 4KTEH 5I1DA 1TQBC 4I9WD 3ULUE 4OD2B 2XTLA 3IJYB 1IC5H 1W0WA 2P8PB 1YNTA 4M4RA 4ZPVA 4NRXA 5HGBB 5EOCH 1DBBH 1MIEH 1B4JL 1C7SA 2ERJC 5K9OB 2LAGB 1CTOA 1ZLWH 2OK0H 4B41A 1K4CA 1H3VA 4A2LA 2XA8H 5J57B 4Z76A 5JHLH 4OB5H 1RK1A 1JWMA 5DYOA 4UNTA 2A2QT 4AMKL 5KANI 4WI4A 4P5KA 2HKHL 3QEQB 3GRWA 3IVKB 3FN3A 2YXFA 4Z7VF 3MZTA 1UJ3A 4Y2DB 4DKDC 1GGCL 1P84J 5DTFB 4WW1B 1BWWA 3HI1A 3D69A 3P9WB 2ARJQ 3ARGB 4DWHA 4FTVA 4G9FB 4QWWC 4LLVA 5E99L 5DT1H 3TCXA 3X11B 4K23L 3C5SA 3CFEB 4FHBD 1FNFA 4PGBA 2DMBA 4F2MA 3KYNA 3HLAA 1NFDB 2PR4H 4XNUH 1ZGLB 1EPFA 4GAFB 1WTGT 4K3GA 4Q9QH 5D7SL 1I8KB 2VRAA 3BKYH 3OXRB 1OW0C 5F6HI 3KPNB 1M6OA 1UVQB 4RAHA 3QCTH 4L9LA 1SJEB 5D1QB 3MRQB 1BFTA 1G0DA 3AGVA 2GSGB 3ALWA 3E3QE 2Q8AH 4JO3H 1HQRA 4DAGL 1LE5B 1MQ8A 2AJYH 3WV0A 3ES6A 2Z92A 2X1XR 1FLRL 1JNNH 3PWLB 3OMZA 5DD1H 2FNBA 2E9BA 2P48B 3LZFL 1DN2A 2VTFA 1N6UA 1RJLB 2HKFH 4M02A 2FATL 3SDCB 3VXPA 5EOTA 4LGRB 3B9KC 3LRSA 4LCIH 5FGCE 1H8OA 2YKLH 5I8OL 5HVGB 2EIZA 1MCBA 3V5DB 3P73B 2DYPD 1F13A 2GJ6B 4G6AC 2BSED 1HXMA 1IZJA 5FYLE 1XGPB 4YXKL 1KENH 1CLZL 1I1AD 1FL5B 1A4KB 3VG9B 1HH6A 5F9OH 3Q3GA 4E9LA 5CILH 4P5MB 2M1KA 3QYCA 4M6NH 5FHAL 1B2WL 5E9DA 4PJ9A 2DI9A 4HQQH 1K3ZA 1MREH 1QBAA 1UJTA 3ZKND 4B0MM 1U6AH 3O11B 2E7MA 2VWEC 2WQ8A 3PWUA 1VACB 4X6DA 5C6TH 4OF7A 1KB5A 3AU1A 3ZL4H 1UQSB 4JZNA 3AMKA 1GGIH 3TVMC 1FHGA 3OGOE 1U41A 2VDQH 4PRAB 5E6YA 5TH2B 4TTGA 1OP9A 2H2PD 4KQ4L 2OBGA 4HV8B 2OI9C 4NFCA 1KULA 3KPSA 2VN4A 2VLRD 1FH5H 3U36B 3O2WH 1IGMH 3IXTB 3CVIL 3MNZB 5FYLD 4TSBH 4WHTB 5I0DA 1F3RB 1A9EA 3QFDA 2OR9H 5BV7C 4YAQB 5HI3C 3NH7H 4GOSA 1XR8A 1DBKL 2CDGB 2CR6A 5T3XH 4ODXA 3G6JB 4O02H 2VL5B 4P23A 1X9QA 4OF3A 2F74B 2FBJH 1J0IA 2NY7H 3LQZA 1N6VA 3I6KB 3RNKA 3LKQB 4GBXC 2NMSA 5HGAA 1I8IA 3KXFD 4RAVB 4CADA 5D7LA 5IMLB 5CHNB 4ETYA 4U1GB 4NKMA 1SYVB 5DF0A 5T5FL 3WCYA 3ZKSD 1FDLH 5EU6A 1S9XB 1QACA 2AEIT 3QDJB 4GG6A 2XOTA 3RAJL 4ACPA 3N1MC 3M45A 2Q3AA 2XPGB 1ZLSH 5KW9L 3SDAD 4X5LA 2A0LC 1BBJA 3MLUH 1UG9A 3BP4B 4I77L 3I75B <