1PL3A

Cytochrome domain of cellobiose dehydrogenase, m65h mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAHNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cellobiose dehydrogenase
publication title Biophysical and Structural Analysis of a Novel Heme b Iron Ligation in the Flavocytochrome Cellobiose Dehydrogenase.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 35
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1pl3A00
1D7CA 4QI3A 1D7BA 1D7DA 1PL3A
chains in the Genus database with same CATH superfamily
2ICWB 5I1KL 3DYOA 3FPYA 5EBMB 5DMIH 5AOKA 3BKJH 4JDEA 4YGAB 2RALA 4R3SA 3ROLB 4AVKA 4RMBA 2B4CH 5H8DA 4AH2B 4XNZC 4IK7A 1TYJA 4HUUA 4EZLA 1V27A 1MCHA 5KSAC 3EUDA 4OZIB 4F37K 4K5OA 3E6FB 5LGHL 5CEZE 3H7BB 1JYVA 4K2UL 3ZZSA 3AZUA 1KXVC 3O2VL 4Z7VB 4QJ3B 1BW8A 4ZUVA 3A6CL 3MYJB 2YZ8A 1NC4A 4M7LH 5D71H 2EDBA 1JFQH 3FTZA 3SKOB 5IHHA 4MD5A 1B4JL 3QIUD 1GZQB 3IDXH 5MERA 4HLZH 3UJJH 2EXYD 3BVDB 1A9EB 1G5AA 4BK8A 2Y22A 1I1RA 2F5BH 4LFHG 5DJZB 3SDYL 4CDGC 1P5UB 2GK0A 3K74B 3X13A 4NRYA 5T3ZD 1FNHA 2A9CA 4P99A 5K9JH 1OTUD 2X5PA 2VZVA 1VJSA 1TYRA 3MJ7A 1SXCA 1I4FB 5SWZE 4FG6C 1TQCC 3TEZA 2QKIA 2MKWA 3GTNA 3NZ8B 5A40E 4JR9L 3EHBC 4X8JA 2PWDA 1VRSA 1A6WH 2HRPH 4EZKA 3VWKA 4BFEA 3RVWD 5AG8A 3B7UX 4LAQH 2DEWX 2FX8H 4YSQA 4ZPTA 1BWMA 5BRZE 1IKNA 3T2LA 2V33A 2G5BA 3BFOA 4APQA 1CICD 2CCVA 4HK3N 3MYZA 3IDIA 1T2JA 5JR1H 5EBLB 2HCZX 3WEXB 3FFCB 3NSFA 4JFZH 1PBYA 4KQ4H 3WI9A 2WNKA 2ZWLT 4UOW0 1QLEL 4DCQB 1T4KA 5IQ9A 1IGIH 2EDNA 2XACC 5B1CA 1LP9B 3MLXH 3AXLB 1MJJB 1R1CA 3QIBC 2EYTA 4JY6A 4F15B 1J5CA 1P7QB 2AANA 2XG4B 2YJQA 4LSTH 4U6YB 5DHXB 5ES4B 5IW6B 3U46B 3D87B 1J9QA 3MOBH 1E5ZA 5E95B 5HGAA 3TO2A 2QHRL 1CE6B 1INQB 2K9UA 4JO2H 5IMKB 2CRYA 1EXGA 2UWEB 5CGTA 1JNNH 2FNBA 4RVBA 4X7SH 3VGEA 5KVDH 2WXLA 3QUZA 1C12A 4H1LA 2NNAB 3ARSA 1JPSH 1NCAL 1ORQA 1QSED 2AV1B 4CSSA 4GP8B 3S37H 3VI4F 4ZW5A 5FCUH 3NEXA 5JPMC 3CMGA 2OMZA 4OF3A 3F64A 4K23H 3SQOH 4EZMA 2HVJA 4WW1B 3RPIB 4AQZA 3SHSA 2WUCL 3EDKA 4Z8FH 3SPJA 1WFIA 1U95B 4L1TA 3QFGA 5GRUH 5IMMA 5C07A 4XI5C 2VW4A 4ENZA 4IOSD 3IKCB 4XP6H 1H9DA 5LNDA 5FYLH 4BH7B 4EI6B 3SQBA 2XUWA 3T4AB 4I7ZC 2BS71 3HG1B 5LN8A 2WN3A 2ZOKB 3GPEA 4OQ1A 5FC9A 4Z9KB 4W9KC 2VL5A 5J06A 2ORBL 3IFPB 2ZZUT 4PRNA 2Q7YB 2O5YH 4L8SC 3W5NA 1LWJA 1N0XH 1A4CA 4KNTA 4YHPB 1F11A 1GTNA 9CGTA 3PP3H 2H2SD 3RGHA 2XICA 2UY7B 3QEGH 3MBED 4UT6H 4NRZA 5TE6H 5L2KD 1OGAB 4MQ7A 3L3OB 3BFQG 1SLVA 4P2CG 4S1RH 5AWNL 3QUXC 4H1LG 4JPSA 2J6EL 4IRJC 1CFNA 3QH3A 4XOBA 3QFJB 4GMTL 4Q4IA 1JG9A 3BPOB 4AYEC 2FWOB 2R83A 4N90D 5HHQB 2IV9A 2R2HB 2YD4A 5I76A 1AGBA 1LD9B 4NNXB 4HKJB 4PJ7E 2EC9T 1NSNL 1KIQB 2YWYA 4B7LA 2A7BA 4HEPA 5KW9H 2H9GB 3OAZK 2Z65C 3REWB 4NWUL 3D85D 5CGYC 6FABL 1FNEA 3BPCA 4Y2NA 5CU9A 5EEZA 4YE0A 5I2IA 3A21A 3OGOE 5D7LB 1IFHL 3TX4A 1UB6B 1DJYA 1RUKH 4YH6A 3B34A 3CK0L 3FCGA 4R2GC 2HT2D 1T0NB 1K5NA 2XKSA 5F89A 4XNBA 1ZIBA 2ZUQC 5C0CE 4NZDA 4A68A 2E46A 5IB2B 3GSQB 5ADPL 1M1SA 4XN9A 5IMLA 1VFBB 4A2LA 2UUDH 1U4FA 1HVXA 1U8CB 1XGYL 1DR9A 1SBBA 2CLZA 4MX7B 4XP5L 4AL8C 4IU2A 4YSCA 3SOBH 1SJXA 5EWIH 1A14L 1HWHB 1MCCA 1D5ZA 1E90A 1VGEL 2DEXX 5DHYA 4GSDH 1F4WH 4JPVL 3I9PA 2ARWA 5FOBA 3NZSA 2LLLA 1MHHB 1SXZA 1XGUB 1RZ8B 3RBSA 2EUWA 1J8HD 3Q2WA 3Q6FA 1MHCB 1SFHA 4GS7C 1ANUA 5KOVC 4APXA 5LAXA 2XTJC 3CHPA 4UUJA 4HLZG 4HEPG 3RI5K 4EXPX 1BEYL 3CLEL 3R1GL 5CBEA 2LVEA 3MNMA 5DD1H 1OP5K 2Y06L 1HHKA 4JFPA 3P11L 3QDGB 4M02A 4KX8A 1IEBB 4R7DA 2DWEB 4EPSA 1Q9KA 4JUSA 5J6HA 4FXKC 1E9QA 5KS9B 3TYFB 5IHZB 1OT1A 2XXMB 3LHAA 3CN4A 4DTGH 2X9ZA 3O4LB 4R5TA 1NCHA 2VQUA 1UQSB 1E5AA 5DVPA 1UYWH 1HXYB 2C5DC 2OLDA 4GUPA 1K8DB 4JY5L 5CJQH 2L0DA 35C8L 4PRHD 4L0PB 3H9HA 3G6JB 2VLRA 1W2KT 3BQUD 2NX5B 3IRZA 3IBEA 1WAAF 4ZYKB 3PL6A 3SCMD 3D4GA 3CLWA 4AEHH 3CFMA 1AQMA 4PJBA 3HMWL 4AMWA 3L3KB 3GI9L 4PY7B 4WTZA 1KBBA 4QAWA 2PTVA 1DBMH 3L4XA 1XBRA 1T0MB 4Z1PA 1TCRB 3A24A 2ZXCA 5C0DA 1KCLA 3STLB 3HFMH 2DIBA 4G1EB 3IDYB 5DUJA 3QB7C 1RJLB 4GXVL 2MQ0A 1SYSA 2EKJA 1JIBA 3GNML 4IBLT 2IANE 1WE5A 1PZAA 3NCEB 2F54E 5I17A 1I9IL 5HHNA 5BQDA 1MJ7L 3MFFB 1NLDL 1AHWA 4M6MH 4RAUB 2HT3D 4HQQH 3WO4C 1D9KC 1NC2D 3QIUA 3GSXA 3RWDA 3VFMA 1CS6A 4QNPF 1JZ3A 1HU8A 2PP9A 4JHWL 4UT6A 1OIOA 2VDRB 3BVNA 3I2CH 4GSRA 1DVSA 4HWZA 4WEEA 4X0KA 3B2VL 4DN3L 4XH2A 3E38A 4N0YL 3ZIYA 4M3JA 4LK4A 1GKOA 2E9BA 1PG7L 3MRJA 5HHOB 2G3ZA 1ADWA 1HDMB 3LDBC 4PWGA 1QTSA 2LU5A 3ARFB 3QC5X 3UC2A 4NZUL 2HFGH 1LO0L 3HNTL 4WTWA 4J8QA 1MFAL 3JWNH 3MC0A 1IGJB 1ESOA 1U8KA 4QXGH 4WTZG 3AB0B 1GPOL 5DO2C 1QFUH 4Q14A 1ZHLB 2VQTA 2A4CA 2MFNA 4XC3L 3DO7A 5A6IA 4P2YA 2G2RB 1EFXD 1IBHA 5EF1A 1NDTA 1RZGA 4UTBL 3VA6A 1YNTF 2NXYC 2Q3AA 4AC4A 3G6AB 1Z5LA 5TE7L 1S3KH 2R56L 2YMOA 5HJBA 1HXMA 4CSZA 4NM8H 5HVHB 4LLVA 1UA7A 1MJ8L 1YMMB 3ORJA 1BZOA 4FNTA 4TRPH 4DKEH 2EC8A 5JUEH 5D1XE 4TSAL 1CUOA 5E6IB 1U8IB 4OSUH 1FORH 3FQTB 4YHOH 5D96C 2EILB 4ZS6C 1CXHA 2XVKA 3LB6D 4OM1L 5B38A 2GB2A 2WB1A 1BYNA 3T3MB 2YSSB 5ESVB 4KRPC 4UTAH 3RAJH 3MBWB 2JTDA 3MACL 4H44C 3BSHA 4J6RH 1TEFA 5IEKB 5KYYB 1RUMH 1QSEA 1DJGA 1OWRM 1CO1A 5CP7A 2Y7QB 3MLVL 4AM0B 4XCEA 5A2AA 5DVOA 3TPUA 1I7TA 4OCXL 5CSZA 5TQ0H 1ZANL 1I1AB 4FQ1H 3BKYH 4L4VD 1A3LH 1NZRA 1X5FA 3NT0A 5ESAA 3RWHB 1I7ZA 1OAXH 1OTSC 1IE5A 1QYGL 4AIZA 1ADQL 3UYOD 4PGEA 1EQWA 3B6SA 3R4DA 4G8GD 4OGAC 2NY3C 2Q7AA 3GHEH 1TJGH 3GLAA 4Y7OC 3KVDD 5I0WA 2D03L 4KTDH 3AG1B 1MVUB 1YEFL 1ZK9A 3ME0A 4F5CE 4LKXB 1O9VA 3BGAA 4PGDA 1I1FB 5GGVY 3GSWA 2XWBB 4M00A 4N2DA 4EIUA 1X9QA 4A63A 1EJ8A 4WKZB 5B38G 1QR1B 1N4XH 1LDSA 1Q1JH 2RFXB 2WNGA 2JIXB 3MBEA 1OCWL 2K78A 3OLIA 4OKVA 3JV4A 5GGTL 2J73A 5L2KA 4JGJA 2DLGA 5GJSL 2YGOA 1LK3L 2NTFB 4NI3A 4K7PX 5KVEH 2OW6A 5AW5B 4DKAA 2B8OT 2R0KH 4F7CB 3NIDF 3IJHB 5D7KE 1NIEA 5ESVA 3OAUL 3L13A 3QYMA 4KY2A 2NY6B 2GJJA 2NY0B 2VERA 4MSWA 3ZUCA 2EDMA 1SYVA 1YDPB 2EDHA 8CGTA 4Y2OA 3DMMA 4LIQL 2N1KA 2XWRA 1D5RA 2DQFB 4XPGL 1R3HA 3L4UA 3M1CA 4FFYA 5DMKB 4EDWL 4PGJA 1QLFB 4UQAA 1ZA3B 4KDTC 2D2OA 4P2OD 2IGLA 2YC1A 2ZKHL 5DZVA 3PGFL 4JRWA 3HFFA 4ZX6A 2BNQB 1E3FA 3D9AH 1WS8A 3FS9A 1KLGB 2NQDA 3BH9A 4TVPE 1MEXL 1K2DA 2TSBA 4PJHF 5GRJL 2H8PB 2Y9RT 4ICXA 3JYCA 2B14A 3GMRB 3DSNA 3M1BA 3NEEA 5ITFA 3Q2CA 3FT9A 3CUPB 2YBRA 3BPLB 3GSVB 2NMSA 2X4TA 4HAKA 4PRBA 2P5WD 4ZDHA 5B7FA 1P4IH 5FDWA 2AQPA 4Y16D 2CHWA 2BVPB 3W1ZA 3B2XA 1RULL 3QJHB 1BDYA 5I16B 1S9VB 3EUUA 1KT2B 3BP4B 3Q05A 5CCKL 1G9MC 2ZAHA 4GO6B 4GAFB 1ETJA 2DIJA 1FGNL 3TBWB 3UTTD 4HKXB 1S9WB 5GZNC 1PLBA 4XAWH 1AO7D 5JOPE 3LKNB 1O9ZA 1FCCA 4H20L 4CMHC 4UQBA 1TJXA 2QMJA 4GKZB 1I8MB 2OMTB 1R0AH 3AG2B 3K2IA 4OLZH 2FJHB 3G08B 4AYDC 4ZMNA 2OJEA 2VLKD 3C60B 3B7SA 1I85A 3GSNH 1DUZB 3DV4B 2PPDA 4XO3A 4YL9A 1W8OA 4UTAA 3US9A 3MLRL 2R0LH 2IH9A 5JO5A 3QDMB 4FNUA 1HKFA 3JWNG 3O3AB 4PRHA 4WI4A 1HZKA 3RJDA 2ZXGA 2ZF9A 1IM9B 2CKNA 3BQUA 4HHAA 3UFIA 2XN9E 1DJZA 3SPIA 1FZMB 1R47A 3EZJB 1CFSB 5TE4L 4FP8H 4N8PA 1KELL 4J28A 4WWID 3DECA 1JV5B 3BSZA 3ZYZA 4XMZA 1JNHB 1CTMA 4H8WC 5T3XD 1HNGA 5DJ6B 4XBPA 2JMRA 5F1SA 3KBPA 3KEDA 4WUUA 4ZUSB 3VQMA 4KJWD 2A4ZA 1IMHC 3DHMA 1XZ0A 4E9XA 4N1EA 1QPPA 4PAZA 1JCKA 3K1KC 4YDJB 2FCBA 3LX9A 1U21A 1EHLL 3KW8A 3DX9B 5MEQB 3L95B 5C7XH 2WSKA 5DMGC 4KRMB 2QKIC 3QA3A 1RUPL 3RVXC 4AENA 5MEOA 2ICES 4P9ML 3U2JA 1ICTA 2Q86A 4ODWB 1X44A 3TIEA 5HPMA 2IBBA 3B2UC 5K39A 4G8EA 3ASWA 2P26A 1AD0B 1MREH 1U8MB 2AXGA 4PMEA 3RZWA 3PDOA 2EEAA 3GIVB 1IKNC 1QTPA 3U30B 4ANUA 3RL2B 4APQC 4MZIA 4BQBA 1N7MH 1GMEA 1T7WA 2DQCL 3WBDA 2DLEA 2CGRL 4FQQB 3HZYB 2EKSB 3TBVB 4XMVA 1AI1L 3D3VB 3VB9A 1BWWA 3CSTA 5I1HH 3I9GL 3RY4A 1K6QH 3I02B 1HHHA 4FNLL 3RU8L 2JCWA 1NJ9B 3QT2A 5I6KA 4R6UA 4HUXA 2J71A 4NQVA 3VW3L 1PLGH 1UB5B 1VGKB 1A6VH 3JWOC 4Q97A 1EIBA 1EFXA 1RZFH 2BERA 3UGEA 3VFUA 3NAAH 3OJVC 5HI5D 4LRNL 2VDLL 4ZSOE 4Q9QL 2O6CA 1SLUA 1U3HD 3E6HB 4JM4H 5LO7A 2Q2EB 3Q5TA 3HS9A 4CJ0A 2FATL 5JXED 1A21A 2GCYB 3GLZA 3QUZC 3HNSH 4V2BA 2A6DB 1OSPH 1USQA 4QTHA 2WLMA 2EXTA 4DOHE 5C0JB 2H2PC 4N8CL 3LRLA 5EIIA 4L5FL 4M93B 3F6IA 5L7XL 4X8CA 2FJFB 2C3HA 4MQXD 3UTSE 3R4RA 1ZVYA 2AS5M 3FQWA 2IEPA 1PZ5B 3OB0K 4FC3E 3U82B 4HWUA 1ZCRA 4ONHB 4ORGA 1F02I 4P3CL 2YMXL 3MROA 5DJAA 4N3TA 3U6XA 4EUPB 5L2JB 5D1ZD 4CSPA 4NZ8A 5JHDD 5D1QD 2LTQB 4KUCD 4I9WE 4QRQB 1A1OB 3K6OA 4QT5B 5KJ4A 4PWEA 3L1GA 3LKPB 4RNRB 1G7IA 1KCRL 2J12B 1SM3H 3D25B 3KL5A 3L9RA 4K7PY 5E0QA 1IM3B 1IC5L 1YEEL 2B4CC 3BVWA 3GSNA 1YPZA 3WXVH 2ODIA 1ZHKB 4JPWL 5HYSG 2V17H 4X4YA 5JQ6L 2V7HB 5JW3L 1ZMYA 3HE7B 4KZ0A 2ID5A 3BW9B 3QXAA 1ZGLM 5I6PA 4L4VA 1BQRA 4UNTA 2WYTA 3CV5A 1DVQA 4FL4B 2ISDA 2XOTA 3PHOA 2A1WH 2JCCA 1Q72H 2H0EA 4G8GA 1N6VA 5EIIG 2YAQA 1E3ZA 5HTSA 3DK0A 5DHEA 4X7CC 5CGBA 2X2HA 4RX4A 5SWZB 2BSTA 4Z7OF 4HG4J 3W9EB 5J11B 3W82A 4I77L 4IHOA 5GS3A 3MRRB 2EE0A 4R0LB 5L4FA 1T6BX 1A4KA 2BIPA 2BZDA 3CPLB 2I9LA 3N0AA 3OKKB 3LRSA 3UDWA 1JVLA 2YUXA 1E27A 2CBTA 3M86A 1M3JA 3PHQB 4PWIA 3C5ZB 3DTUB 4U33A 1JMZA 2OTUB 3ILDA 4IIQB 5BRZB 2G4GA 2WTRA 2KERA 4LEXH 4P2AA 5E9DE 4X8GA 2Q5BA 3N91A 1NMCB 4NO0D 4O9HH 2IALB 2ZXDA 2OX5A 3ZLQC 3TT1H 1V3JA 1JWUA 1Q9WB 3HRPA 3BCFA 1FL5A 4G42B 4JN1H 3I6GA 4IM8A 1INEL 4RRPA 1CFBA 2CO6B 4M6OH 1N3NB 5BO1H 4PJFA 3NOIA 3MRIA 4PWJA 1NL0H 1FV1B 2WOYA 5ERWB 4WJ5A 5DFVD 4RRPM 5BJTA 3ISYA 2P3YA 4MJ5B 3HJ0A 4PPTA 4KK5D 3WV0A 1HOCB 3L3GA 4NQCD 4PTUB 4FQIH 2Q6WB 4HZLB 4EIBA 4EI5D 4YR6B 5TH2B 1TVBA 4HUMB 3EF7A 4OCSH 2QQKH 2J8UA 2YFOA 2ENJA 1AG0A 1FFOA 4QHLB 2P5WA 1FJ1B 2WBXA 3IBOA 4Y16A 2DQHL 1MZYA 4PJ9D 3LNFA 4XMLH 5F7AA 3SDDB 2R1WB 5EUOF 4R96B 5DD3L 1N12A 4GAYB 5EBWB 2ADGA 3FNKA 1V3LA 2ZOUA 4DP0X 4XHJD 4NQDD 4AKOA 5IB1B 1ZGLP 1A7RH 3EYSH 3DUUA 4HGWA 3KPMB 4LSVH 4RRPG 4FN0A 4FNQA 5I1EH 1AO7A 4N2IA 5KVGL 2A9NL 3PL6C 1F3JB 1JGIA 2OBGA 4QHPA 1JWSB 3QPXH 2ZAGA 4XN7A 2WO3B 1AQHA 1RZIA 4GRMB 3S96B 2BCKB 5GS0D 1T4WA 2BVQB 3L4CA 4KKCC 5C2UB 2FBOJ 2FO4A 2GSMB 4LP8A 4P9HH 4K15A 4MJ6B 3QYCA 4FFVC 3OC5A 1A2YA 4KWUA 2HZHA 3FN3A 4XODA 2H3NB 1ZV5A 1AJ7H 4FHKA 3A4EA 1AHWC 4WAFA 3KPLA 3OHXB 3P2DA 5EO9B 1CDCA 1BOYA 1UZGA 3QIUC 4XNXH 4PJ7B 5IK3B 4ATWA 4PJXF 4JLRA 1L6XA 2KH2B 2LU4A 1CBVL 1MCSA 3CBJB 3IDUA 3SDAD 3EYOA 1D6VL 1QBBA 4BEIA 2VAAB 2FGWL 2ERJC 3GXPA 3VXRD 3MRMB 1L9TA 1LQSR 1MDTA 3MMEA 1G1YA 3ES6B 2DWYA 3FCUB 5DDHA 4XNYH 1A65A 1HYRC 3F2LA 1L0PA 2A6IA 3GKWH 1OTUC 4P3DB 1C1EL 3VJ6B 5I73B 2H32H 1XVSA 1MCNA 1DBKH 3NFSH 1MCIA 1ZT1B 3UP1A 5SWSE 5C0CB 4RISL 4FLOA 4P04A 2OTWB 4BQ8A 1JPTH 2ARJQ 4ZUWA 2D4DA 3OM3B 5CAYB 3Q8BA 2F19L 1LK2A 1CQYA 2NW2A 2HWZH 2Z31D 1HH6B 3HKFA 4OCRL 4ONGH 4A7GA 1Z9PA 2AJXH 2WP3T 3ARZA 5TFSL 3WGUB 1BAFL 5E4EC 5IB3B 3GHPA 1IQDB 1U3ZA 2BY0A 5AVSB 5F9DC 2E27L 2XPGA 4PJ5E 1M05A 5EV7A 3CZJA 2A83A 1HOEA 3DIFA 1WPCA 5GS1A 4IS6A 4NKDB 3B9AA 3PNWA 3QO1B 3LV3A 4Q7DA 1G7QB 4MWFA 5I1KH 4ATTA 3MNVB 2DM3A 4HWBL 2YAMA 1G7LB 3GSUB 1WITA 4W6YB 2PCXA 4XCYA 4XX1E 4U1JA 2DWSA 3VFTA 3D5OF 1MWAL 4L8BB 5DXWA 5AVRB 4K5MA 4G5AA 1R3KA 1NPNA 3C5JB 4EDXB 2O4EA 5IV2A 3AS2A 4ZOBA 3DXAA 1X5HA 3LN4B 3S97C 3O2VH 1YY8A 4M7LT 3DTXB 4RFOL 1OL0A 3A6CH 3VRLF 4NSKB 5BV7H 1PAMA 2A9ML 2AQSA 2JJSA 4NN5B 2I9TB 3X3FL 3QPQD 3WS6A 3ZE2E 1DQTA 2J1WA 4U2ZA 1E4HA 1WCBB 4G6JH 4PW4A 2ATAA 4LBAA 2D31A 2J6WA 5GS0H 5K59E 2WXFA 5LBVA 2XTJE 4BFGA 4ZXBA 3UEQA 3GF8A 4GRLB 5K93A 3H54A 2AQNA 3LAFA 3MRGB 5C0BD 3EJUA 5CCHE 3CCHB 5D1ZA 5JHDA 4YGVB 1NBQA 5D1QA 5I8EA 2QMKA 3GMLA 5IWLC 1PZSA 2N3JA 2IANB 3O9WA 4CC4A 4UZUA 1YAZA 2F54B 3O3BB 4LHQB 3TBYB 4JR9H 1NGWA 3FO2B 3VFWB 5ACZB 3F7VB 4G7YL 3ZR6A 3CSBA 2L7JA 2O5ZL 2BSCA 2WUBL 1H6UA 1XF3A 3MRQA 5SX4I 3MBEC 4Z7UF 2VDKB 5ALCH 4N9GA 2X9XA 4LPYA 1NTDA 3C5SA 4HOWA 2WCPA 4W9CC 2NSXA 4JFEE 4OD3L 3P73B 4OF8A 4TNEA 4TULL 3WIIH 2EDKA 3I6KA 1G6RB 4PI0A 4EOWL 3VXQA 3ZKMD 3IE9A 4WWKD 4X4XA 3QI9D 5E2VH 3WENA 4W4NA 2EO1A 1XQ4A 2XV6B 1F8TL 1NDGB 1HL8A 3DMMC 4GKNA 5T1MA 2FQEA 1F2XK 2OXHA 2OL3H 5IKCA 5JOFA 2Q76A 3EYFA 4TNVK 1KJVA 3LNEA 5DYFA 2V5MA 1FG9C 4HIXH 3W9DB 2R7EA 2HT2C 1UUNA 4ORZC 3AWGA 3PV6A 1JPST 5DHVH 1D5MA 4NO0A 4YWGL 5JLZA 5FO7B 1BZ9A 1OV8A 2FRGP 3JWNC 2FIKB 4FABL 2XWXA 5JORA 3FU0A 3FO9B 3QJFA 3QEQD 1WZLA 1NCBL 5EUKA 2CJTA 1XL6A 4AYMC 5EZLA 3U6RA 1I1CA 3EO9L 4PS7A 4ZNEA 4R90L 5D1XB 1L5GB 1OF0A 2WUCH 5EU5A 1NIAA 3J27A 1JD9A 5F9JA 3HZKB 1IL1A 3WFHA 4MCZA 2HX8A 2I69A 3WKPA 1IJNA 1T03L 4JZOA 4M56A 1UM6H 1PZCA 3CN1A 3Q43A 4ZUUA 4PHZA 1Y1DA 4L8DA 4NQCA 5DUBB 5F7BA 2JQAA 2JKNA 4EI5A 4KKRA 4PD4K 2MHAB 3MLZH 5PCYA 3ZTJG 4G70B 4XGZA 2CLVA 2DJ4A 2K0RA 1MVFA 3VG9C 4NC2B 3MKGA 3FMGL 2O6EA 2ORBH 5TTRA 1U8QB 1CG9B 1N6UA 3DYMA 3B8YA 1Q9OA 1I85C 3QZWB 5GGRY 4PJ9A 4KJPD 4ERSL 3WY2A 1DO6A 3D1MC 3QQ3B 4OLXH 3TNMB 1BVLA 1EJFA 4YO0A 2VR4A 2W1NA 5BCAA 5AWNH 1JXKA 4BD4A 5HGHB 4NQDA 2V2WA 3TNNB 4GMTH 5FKAB 5LG6A 4WI0B 2IPUG 1JTTA 1XBDA 2GJRA 3BQUC 1X7QB 4U7MA 1T7ZA 1AKJD 3NFPB 1ZRUA 1BECA 1H3TA 4H8PA 4GRWE 4D9RE 3C6SB 2PP7A 3HKZA 4D0DA 2CDGB 2APSA 1ZPLA 3NCCB 5BRQA 3BRDA 1KDJA 1YNKH 1AGCB 4NWUH 1UFGA 2P8MB 5AL0A 6FABH 4XX5A 4TTDD 2DYPD 1G0YR 3KAAA 1IFHH 3BJ91 1R34A 1CDJA 2E9WA 2WWKO 5DRWA 5DI8B 4UMSA 5DRNB 1FG2B 1PQZB 1QLRA 1WG3A 2P24A 5AB0A 1JGLL 3L3JB 5ADPH 3VYPA 3KYKL 3ZKSD 2HT3C 4XE0A 5AOLA 3IMVA 3V4PA 5B8CB 5JHLL 3QRGL 5C6TH 1QTYT 3FQNB 3ESUF 5DD0L 1BREA 1DQLL 1ET7A 2WQXA 3MLWL 4KXZI 4WENB 3SDAA 3ECBA 4LMQI 2OMUA 3UTQB 1NFIA 1CT8B 3FU9A 4LCCA 4NZFA 1ZSDB 4WK2B 2CIKA 3VXRA 2GBUA 4QRRD 2YXVA 2ZXBA 2R4RL 4OBSA 2FJSA 3I75B 4TLKA 3BIBX 1IAKA 3ZKND 4JPQA 1XF2B 2FGZA 1MAML 4EN3B 4OZFB 5M94B 4O51A 1OB0A 2QT6A 2F61A 1XD1A 1UUSA 5I6XB 2GJ6D 2CM5A 1OP4A 1BEYH 1MIML 3CLEH 1TJIL 4FQHB 2VKWA 4CVZA 1MXDA 5AD0B 2OL3A 1J9TA 1IC1A 2C3VA 2Y06H 4OUOA 3P11H 3V0FA 3FTGB 1PKOA 2QSCH 2Z31A 3RBGA 3L1OL 4O5LH 1ZT7B 4P49A 4JMXA 5EBGA 4DFHA 2YD7A 2VMCA 3BUPA 3KGUA 4O2CB 1PDKA 1TNMA 3FN0L 1IU1A 5HI3D 3RNKB 4DKDC 2VDPL 5IY5B 5K9QI 2L7QA 3QNZB 2RIKA 4ZFOL 1X4XA 2FL5B 35C8H 4LNRB 5E00B 4OB5L 3IETA 5D7JB 2HTLD 1XSIA 2I32A 1X5MA 1MCOL 2PNDA 4Y2DA 2OZNA 3KCWA 4QTFA 5E8EA 3EH2A 3S35L 3VDCA 3VI4E 4NUPA 1OSZA 3VM7A 1LGVA 3MLUL 2H0PA 5H2BB 4FDWA 5ICXB 4BH8B 2Y1VA 2YD5A 3HMXH 5HGGS 1QSZA 5LWYH 2BVOA 2B0SH 1OAKH 5IQ7L 1NWOA 1DBJL 1PZUB 1HK6A 3LB6C 4RZKA 2B59A 2YRZA 2W07A 3BVXA 2W80C 3POHA 2P9RA 2VIRB 1JYXA 1JHLL 4GXVH 4AQOA 5HVWA 4ESKA 3GNMH 2UVFA 5EDSA 3DRTB 4NNYA 2V2TB 3BSGA 1I9IH 4WU7B 1JZ4A 4DZBA 1E4WL 2YA2A 3SKMA 4QRPD 4F8QA 1MCLA 5IJDC 2XN9B 4P5MB 4HA1A 3L7FB 2MIZA 1Q0YH 2XWDA 5TQ2L 3ZTEA 1QSFE 2MKLC 3DURA 4RBPH 4N8VB 4RLDA 4OI7A 3FB6A 2ADYA 1GH7A 3QZMA 3ZZ1A 1G7HA 4DN3H 5GGUB 4GH7B 1F4YL 1KYUA 4N0YH 2AJ3A 4H8VA 4XPFL 3QWRD 3K2KA 2X70B 1PG7H 3INUL 4CGUB 1D7DA 1Y6MR 2IPTL 1LO0H 3TBTB 5AYUL 1MFAH 2R69L 7FABH 1FP5A 3R19A 4MGXA 4XO8A 1B2WL 2ED9A 2NZ9C 1KJ2L 4ZFZA 1XTLA 4ZRGA 1OGPA 2G3XA 1MAKA 4K5LA 4Q0XL 4AEIH 1M6UA 1E9PB 1FF5A 2XZQL 3UDWC 4OLEA 5ESQB 3DVIA 2ITFA 5FS5A 1Z7JA 2G0KA 1ETA1 1WK0A 2MTPA 3OAYH 2GJZA 2PF6A 4LKCA 2R56H 1CIDA 2FBJL 4L1HA 4DAGL 5L0QB 4YN3A 3EOYG 1FZOB 4MXWL 3H1ZA 4W9GC 4WWKA 3SZKC 3QI9A 4ZOEA 1ZA6B 1AFVL 3CXHJ 1E7UA 1EMTL 4XRCB 4PJDA 4DGWC 1DLFL 2AEOA 4AQAB 5EF2A 2VC2B 5I1GH 1WRFA 3FOMB 4DGVL 4N6QA 1Z9SA 1P7HL 1GS8A 2CPCA 2AQ1A 4TUOA 3CH1A 4L3AA 3ZE0F 3KPNB 2MH4A 1NLBL 4ZSOB 4ICWA 1BVZA 2JI3A 4QLRA 4QKTA 2YD3A 5GGRB 2EEDA 3NCWA 3G7TA 3QEQA 3BHBB 4DOHB 2A2QT 1TETL 2KC0A 3GHBH 4MXQD 3I9AA 1QA9A 4JE0A 4AK1A 4W4OA 3P3YA 4LVEA 3SIKA 1NGQH 2ZG3A 3GJEA 1HCVA 4Y5VA 4Y16C 2ALAA 4PJIA 4M3KB 5F7YC 1GZPA 2MCMA 3UTSB 1FO0L 5EG6C 2EP6A 4D0CB 3IVKA 2UVEA 7TAAA 4X4KA 3ABMB 3DI3B 3ARDB 3KYNB 2I07B 5DYOB 1GAFL 5AKTA 3CDCA 4LSRL 1J88A 2BHZA 4U1GC 3MGTA 2DBLL 3T3PF 3THMH 2CA3A 3WE6B 4GQZA 4CVUA 4I0PB 5IIEA 1I8KB 3T8XA 4DGIL 4V2CB 3HMXA 3OG6B 1IGFL 1QW8A 4X80L 2X4RB 4JVUA 5DQJB 2A6KA 4WJKB 4Y4HB 2ETWA 4JG0H 2UX7A 3IMUA 3B3IB 3DX8B 1SDDB 4J3TA 3RWJA 4D9LH 3S2AA 3FQ4A 1B90A 3DVNB 1RUQL 1RZPA 1FHGA 5I66B 5BVPL 4AYID 3P9MA 3UL4A 1O7SA 3V4UL 3UZVA 4KQ0A 1XF4B 2X4UA 3FO0H 4B5EA 1AKJA 3CZLA 3DOIA 4L37B 5C09D 5C07E 1B3IA 3IXTA 4KRLB 3GSOB 4H2AA 1TENA 1B0RB 5E1GA 4XNZB 4CU7A 2VISA 1VAHA 4AXWB 2XVBA 4UIKH 1C7SA 5KSAB 4NQED 3DSFH 3ZT7A 4C58B 1WUZA 1T21A 3QZOA 5DFAA 4X2UA 5FLVA 2ZKHH 4XMKL 3PGFH 1NGPL 1HYSC 2R1XB 4LCUB 2E4TA 4FZEL 3ARPA 2BM3A 4FULA 3ECVA 4LSQH 1MEXH 4GQ9L 2DQJL 1T1XB 2FH6A 3TJHD 5E9DB 4XOAA 2CSPA 2FZ3B 2JFCA 5AW6B 3IE4A 5KJRL 4FS0A 3S3JA 2FYVA 1RPUA 3X12B 1NMAL 1WZMA 2NYYD 4XNMA 5ALBL 3WHE1 4U2YA 5JIMA 5DZLA 4GQRA 1Q94A 2VXSL 5MENA 4AITA 3X14A 1RULH 3PABA 3O3UN 2ITCA 4QOKA 3NYKA 1TQCB 5HHVL 4HEMA 5EOQL 4GO9A 2V5RA 1RU9L 3PU7A 1UWEH 4JDTL 4W70A 5CCKH 4HHGA 3JTTB 3V5KB 3EHBB 5GS1C 4L8CA 3OSVA 3QVAA 5DTFA 5F7FA 4F7KA 2GJ6A 3L5HA 3ZRCC 4H20H 4DFIA 3CSYA 3I6LD 1HKLL 1KIUA 4KH9A 3OR7B 2E5EA 1DL7L 4X99B 2HKAA 2PCFA 2MNUA 3H2WA 4U7KA 5H94B 4JB9H 1QUNB 2CDFA 3K5SA 3QXWA 2X2YA 1XGQB 2RTTA 3RKPA 2AXFB 5EEXA 3KL0A 4PJDF 3RGBA 5HI5C 1OGAD 3AG3B 3NMEA 2NT1A 3MLRH 4UZGA 3OHMB 3HC0B 2BINA 5C08D 5K9KA 2BSED 1CLYL 1KBPA 4I8DA 1EEYB 1VZGA 2O26U 4UNVA 4D0BA 1LM8V 4ANWA 1MLCB 5T5FH 3HHSB 5TE4H 4EXKA 2ZUUA 2JJSC 4N2EA 2I24N 1AVAA 3GRWL 2DRUA 3WS6C 4MQXC 1MCJA 1I9RL 1YVLA 4CA4A 1IBGL 3L4YA 1AIFA 5KOMC 4KGJA 2IBGA 3KPOA 5D1ZC 5E94A 3TBCA 5JPMB 5D1QC 4OU3A 1AGEA 4UDTB 4XNQB 1XF5A 4CC4C 3O9WC 4G6KL 1SN5A 3AT0A 3PWVB 4A66A 4QRPA 4GMSH 3SKJL 3VU2A 4HGKC 4GI9A 5SX4H 5KVDE 5F9WC 2NR6D 1KPVA 4P9HC 1J1PL 2YK1L 3LQZA 2VLRE 3TJPA 3FO1A 2K6WA 2D4FA 4I18A 5C0IB 3CFQA 5HSFA 3QWRA 3EH1A 1BOGA 1NM9A 3BAWA 2DQCH 3BWZA 3K5RA 2CO1A 4PJBE 4XN8A 1U8LA 3NIDE 3HA0A 2PYFB 2A9AA 3I9GH 5L9DH 1GC1H 5EZJA 2NZ1A 4FNLH 5B1KA 4I88A 1YNLL 1DYZA 3ATAA 5B1BB 5H35A 5SWSB 1W6WA 3VU1A 1A7NL 4N2FA 2OZ4H 4XO9A 5EOCJ 3PV7A 4AEEA 4MVBC 2UZYA 3QUXB 4GKLA 3U9PL 4UBDD 2H1LM 4IRJB 5IJVB 2EUXA 4LPCA 2VDLH 4NAMA 5DLMH 5F6HJ 1ZDQA 3S4SB 3DVGB 4KMTH 2OR9H 3JUYA 4PJ5B 3CVHL 3VXOB 5J13C 4N8CH 4YPGA 1FIEA 2NX5D 2AFNA 3MREA 3P9WB 4KNUA 3QXTA 5L7XH 1TU2A 5T3ZE 3JV6B 3BQVA 4R2GB 1MXGA 5AOZA 4PB9L 1TJHL 4L4TA 2X3AA 3QG6A 4LBEB 3UG4A 2CBQA 1K8IA 4FLRA 4GNKB 4OIIL 3C8KA 3R8BB 1WT5A 4KK5C 4M4RB 4P3CH 2YMXH 2LAAA 4QHMA 4EI5C 3EH4B 2Y1AA 3M6DA 1S7WB 3X3GL 3MJ9A 3ZDZE 2OSYA 5T5NF 5INCA 3LNIA 1ASQA 4QYOB 5D4IA 1MELA 1RPQA 3ROOB 4Z7QE 1XZWA 4J3XA 1YEEH 3BEVA 2FSDA 1XGRB 4NPKA 1NCCL 1J0HA 4CW1A 4JPWH 4PJ9C 4DUWA 2B1OA 5JW3H 3T2OA 3GS7A 3ZE2B 3UTZB 3HBPA 3I3EA 4Y4FD 4N2KA 1UENA 5F7DB 4GS7B 1E43A 4AVJA 4H8HA 5CCGE 1L7TL 1A3RL 1FL6A 2XTJB 5I75C 4GIPD 1J11A 1C7TA 3OKEB 1KEGL 2SEBA 4Z5RA 3V5HB 1U3NA 1USZA 2VE6A 2H0JA 1WUNT 3ARFD 1QVOB 5T5FA 5BV7C 1Y0LB 1PF3A 4FXKB 3AU1A 4EI0A 2ZJSL 2J21A 4ONOA 3FU5A 3GMNA 3IDJA 3MO1B 1LEGB 1DEEA 2EH7L 5GS0C 4JFYA 2O61A 4DGUA 3B56A 4IJ3C 4J2QA 3VYOA 1IAOA 5EU4B 1QSEE 4OZ4A 1ZXQA 1CI3M 4CBPA 2V0AA 1I7RB 5B39B 3UO1L 1KN2L 4X6FA 1AGFA 1MAJA 5C6PB 1IFGA 4N87A 4UU9A 4XP1L 4YUEL 4JFEB 4CVXA 2FWSA 3BUQA 4KI5F 3CBKB 3QXDA 4QEGA 4A1RA 4G9FD 3Q5YA 1C5DA 4XVUC 5C09A 4DWHA 3MCG1 2Y23A 1V3MA 4M48L 5F1OB 3FCTB 4AYSA 1ZS8A 3UBXB 15C8H 1TQTA 4YAQA 1J7VR 5A16B 2BSSB 3BPNC 3SDAC 4GT7A 2OS7A 1YC7A 4NQEA 3CIAA 4LCCC 4AZUA 1U92B 3GWJA 1QBML 5AUMA 3ULSA 1HSBB 4IRSD 4V33A 1IO4C 2BHFA 4HH8A 3CHSA 4C83A 1A6PA 2LLGA 1UD6A 4C56D 2BXYA 3ASOB 3WO4B 1D9KB 3ZE1F 2XA8L 2FJGA 5L2KE 3TCLB 2OZ4A 1MFDH 1JHTB 4UQ2A 2O6DA 4QWWD 3WMQA 3V0HA 3OZ9L 2NY7L 4RMSA 5I26A 2Z31C 1RHHA 4IHBA 4JE4B 3CDGB 3FQXA 4N90E 4PJEA 5GIRB 2DQHH 3S37X 2G3MA 3LTVA 1IAIL 4AGNA 2ICEA 2Y5TA 4WSGA 1H19A 5HYIA 5DD3H 5IBTL 1BJ1J 3WFBH 3FB8A 1J8RA 3NCFB 4PRAB 3CFKB 4AG4H 4NHCL 3ZOAA 4Y2DC 4RMVA 2VDMB 5CD5C 1A8ZA 3OG4B 5E8DH 2FECL 2WV3A 3U83A 1CDBA 3X1GA 1HINH 1KGYE 2NXYB 3Q44A 1T1WB 1WBYA 1CCZA 1MCBA 1UXWA 2KL6A 2DDQL 2X53A 5CHNB 5FYJL 4X0NA 3DX7A 2PR9A 4KO5A 2R15A 2NOYA 4NI6A 4QF1B 5I1LA 3JWNE 5GISH 5FXCH 1BVOA 4MMZA 3HB3D 3KWTA 3KS0J 3WKML 3N44B 1JWMB 4HGMA 1BCIA 1PPIA 5C08A 1E50A 3FUMA 3N6YA 4H5SB 4U6XA 1S5HA 2OJ1A 3CQFA 3ABGA 4L4JA 2HRGA 1B0GB 3C5XA 5D96B 3DBXB 2KBGA 1VSCA 2PMZA 1ZVSA 2XQYA 1KCUL 3PWPD 3LKQB 2Z1PA 3QPQC 4GRWB 3AT8A 1RFDL 2ICWJ 4KOBA 4KRPB 1KLFA 1D6VH 4DPCX 4GUOA 2VDOL 2JJUA 1F1AA 4WF7A 5KSBA 4YFEA 1C1EH 2PTTA 1TTUA 5K9OB 5DZOA 4AMXA 4GBXA 3GMPA 5FHBH 1ETZA 1A7PL 2DTML 1XMEB 2EIEA 4Z7OE 1Q0XL 2VOTA 4HFUH 2XZZA 4NPYA 1HS6A 1MFBH 4PRHE 1KF9B 3NJNA 4OCRH 3V0GA 3BO8A 3L2LA 5TFSH 1BFOA 4DQOL 1BAFH 5KANI 3NJKA 4QKXB 3SPVB 4MJJA 5E2TL 1G84A 4WLCA 2FO8A 2NY3B 2X4SA 3US0A 2E27H 4WFFD 3HG3A 4C4UA 2X1WL 5FA3A 4PG2A 2EVJA 3U1SL 4NKOB 4U1KB 2N56A 4P5RA 1ZHNB 4GUCA 3ZKMC 3IJ8A 3G5XA 4IKLA 4WWKC 3X1EA 1T80A 3QI9C 4WUUE 4NRXB 5AVWB 2XQYG 3CFJA 3KPSA 4R26L 4F2MA 2HJFB 2E3VA 4HCGA 4P2RD 2X9YA 1RVFL 2AERT 1LO4L 4NO3B 1FGVL 4OY9A 1PSKL 2XVGA 3MR9A 4X7TB 1MWAH 1U58B 4NWTH 3U0WH 3QFDB 1GJUA 1WV7T 3QDMD 3ALXA 3NDYE 4FHBD 1Z32X 4L3CA 4HIPA 3AW5A 3Q3GB 5GRYA 3HBQA 3LH8A 2HLAA 4U1LB 4RFOH 1MF2L 1KEML 4P4KD 4QD2E 3SKUD 2E9GA 5KVEE 4W4OC 3RPKA 1FNAA 2IV8A 3EGDA 4YBQC 1SRDA 1TCMA 3VI4B 4Y5VC 5KTEH 3D0AA 1HL4A 4B97A 3IGUA 1PZDA 4P5SA 4S1DD 3T0BA 1EZVX 5FYKU 25C8L 4Q9RL 3OMIB 1OF2A 2JF1A 5E8NA 4OV5A 3ARGD 2WQRA 1NDMB 3BP6B 1E5UI 5DA4A 4ZXBD 4MCMA 4MAUL 2A73B 5FA4B 4MDRA 3AAZB 5J1SC 4Z7AA 3AM8A 2DL2A 2OK0L 3FT2A 3PWJA 2EDQA 3X17A 2F68X 2J3SA 3VH8G 4QHUB 4Q9CA 4G7YH 1SJHA 2WXHA 1SBSL 4QGYA 1J12A 4M8QB 4NP4L 5KVFL 4KJPC 1FUNA 2WUBH 1R3LB 5AW1B 3SKNA 4Y4FA 1QSFB 4PVLA 1A02N 5CILL 1T22A 3PGCB 3RYMA 4P3WA 3MOAL 4FLHA 2EO7A 4TULH 1LJMA 4CMHB 2QVTA 5ICYA 3D3VD 3U4EA 5ACLA 5C9KA 3HN5A 3NJGA 4JDEB 4R3SB 1N2RA 4S2SA 1FHNA 1F8TH 3WLBA 4H88L 3TP4A 3DGGA 3VFVA 4J39A 4HUUB 5K9QG 1QZNA 2FHFA 1VFMA 3ECQA 5DD5H 2JWYA 2B9AA 2YN5A 2FWUA 2OM5A 4GAGL 2NW3A 4K7FA 4ZUVB 1EXUA 3WTXA 1A4BA 2YR3A 1NC4B 2IOIA 1HILA 3CSPA 3BFWA 4G9FA 1YPZE 4MD5B 5FO9A 1J1OH 1UOKA 5MERB 1YYMH 2HAZA 5KBKA 5EZOH 4JHUA 1SJVA 1RP8A 3C6LA 2K3TA 2P8PA 4GW4A 4L4VE 4N2AA 3X2QB 4EZJA 1XF1A 3P4NA 2XN0A 2GK0B 2JCCE 2QL1A 4G8GE 5E6RB 4NRYB 2ENPA 3X13B 1NA8A 2EC9U 3V0JA 3HZVA 4JVPA 2WXPA 3MJ7B 3ZKNC 2QKIB 1UD2A 1GOFA 1M71A 2L7UA 4C56A 4X8JB 3G5WA 4KQ3H 1ED3A 3VWKB 5GZOA 1K9TA 1HZLA 1G0XA 4IU3A 4RETB 3V55A 2DYRB 5DEFA 4ZD3L 4B96A 2DIEA 3APCA 3CH8A 3D50A 4HIIA 4ZPTB 2EVIA 1SEQL 3PAYA 2JJTA 4I1PA 2G5BB 5CIPH 3WEMA 4APQB 1LNUA 4OW6A 5E6SB 3WSQH 5D5MF 4ERSH 4LARL 4RZCA 4U3HA 3PWLA 4PJAF 5IGXL 4J3UA 1T4KB 3VGGA 5IQ9B 3EG9A 3KLHC 3V0EA 4PJFE 3I6SA 1FZJA 3DV6A 2HTLC 4XTRD 1OAYL 2EYTB 1VACA 3NACH 4JY6B 4X83A 1K4DA 4Z78A 4N4YB 3NZUA 3TO2B 5HGAB 5J1TC 5IW1B 4B0MM 3B9KD 2K9FB 4KI5C 4WY7L 1RIVL 1B2YA 3QUZB 1C12B 1PNDA 3N41F 4H1LB 4M1CC 1PD1A 1AXTL 1ORQB 3AREC 3MLYL 3P2TA 4Z3HA 3HRZA 2J8UE 4HT1L 2OMZB 2P5WE 2HVJB 3D2TA 4X9YA 1JGLH 3U4BH 3KYKH 3N42F 6CGTA 3L4ZA 5J6SA 4BCXA 3CFIC 3PWPA 5IMMB 1DQMH 4PI2A 5F6HI 5C07B 3FQUA 5KN5A 3MLWH 5EOTA 4LVHC 4BKSC 3UTTE 4LP5A 3MV7D 5E2WH 4JPIA 1KY7A 3NGBB 5FR3A 1AO7E 5D2LA 4I18C 1HAUA 1M42A 5E1IA 5F96L 2ZX7A 2PWHA 2VL5B 1JV2A 1MAMH 4WEMB 4MXVF 1V3KA 4PRNB 3UPRA 2VLJD 5C0RL 2P7TA 2OQJA 3KDMA 4AV0A 3H85A 5HVGB 1F11B 1MIMH 1N5AA 4F7TA 5EZIL 4K0OA 4NRZB 4ALAH 1U8JA 4MQ7B 1ETB1 1CR9L 4FKEA 3MBXL 1CFNB 2A0LD 1RP9A 2VH5L 1OQXA 1NBVL 1RERA 5F72S 4NLAA 2N1TE 3FN0H 1IAII 2A9BA 3EYUH 3VUAA 5I76B 4FKHA 1AGBB 4PSPA 4NHUA 5T3XE 1TLMA 1IT9H 3ERXA 4KC3B 4OB5H 3LHPL 2HP4A 1P4UA 3T8MA 1F3DJ 1E67A 3S35H 1FNEB 3BPCB 4JG1L 4P2RA 3HS0A 5E51A 5I2IB 4PGBA 3MLUH 1G7JA 2FECI 3IDMA 4KTYA 12E8L 5F3BA 1COBA 1K5NB 5D7EA 2A77H 3UO8B 1GGYA 1DBJH 3I9IA 1KBKA 5F89B 5KTEL 1URLA 3O6KL 4KKLD 2W92A 5JPNA 5CJXA 1WT5C 5IMLB 4BBWA 3ATBA 5ADOL 2CLZB 2WZ0A 1LO3L 1H3XA 4HC1L 3CHOA 1LTXA 4OJAA 3ZQ9A 3RWGA 4P46D 3QQDA 4P4KA 1D5ZB 2LGNA 3MNDA 4MXQC 1QPKA 3IDNB 1SFDA 5CIPA 5DHYB 4EIGB 3LRKA 5FOBB 1JZHA 4ENED 3P9LA 2VMFA 4YVUA 3PYCA 4FXLA 1U8NA 3Q6FB 4HS6A 1WP6A 1NGZA 1LE9A 4AEFA 3V4VH 3MRCB 5G4OA 3H53A 4APXB 4LVNC 5LAXB 1F4YH 1TXKA 4UUJB 4HV8A 3SE6A 1AY1L 2X0WA 1BXXA 5AB1A 1GOHA 3OMAB 4KHXL 5CBEB 1HHKB 4JFPB 4BK5A 2XVLA 3CWGA 2IPTH 5F88A 4R7DB 4G82A 1MWOA 4NNPL 1Q9KB 5J6HB 3BESR 1E9QB 4NUQA 1AZUA 1B2WH 2D9CA 4Q0XH 3DXAE 3EOBA 1W72H 1M3IA 2ZWNA 2CDEA 4ODXA 2AC0A 1XH0A 4GUPB 3HUJA 2VXTL 1NCIA 1ZLUK 4KDWA 1HCFX 3QJQB 2ZP0T 3BE1H 4GG6A 3N04A 3MLPA 3H9HB 4B9KC 1F4AA 2VLRB 4R7NA 2J8HA 2FBJH 2MQ3A 4WZ9A 4DAGH 3RWEA 1G9NH 1FH2A 4MXWH 1WWAX 4P2QD 1MFEL 4PJBB 2V4LA 2ZIDA 1AFVH 1YEDA 3B9VA 4XNDA 5JIIA 3NIDB 2VDRL 3MSPA 1J1XL 2APXA 5C0DB 4FNSA 2Z0BA 3KVQA 3RPBA 3IFLH 4FA8A 4BHUI 1HJBC 4DGVH 1JFHA 2QFPA 5D1QE 5JHDE 3BD5A 1SYSB 4XVTL 2P5ED 1AR1C 1NKGA 5CUSL 1U8PA 2BRRL 5I17B 2VZ3A 5HHNB 5J5EA 2G3NA 3KLKA 3F84A 1INDL 1AHWB 3E1F1 4N86A 5LGYA 2WC7A 3CVIL 3TJHC 1GC1C 3QIUB 3GSXB 3RWDB 4PV1C 3FULA 3VFMB 3S6CA 3NCYS 2NSMA 1OP3H 1AS8A 5GJTH 3BVNB 1TETH 1GS7A 1IZJA 1V54B 1AIZA 2IH3A 2DQGH 4MQSB 5I0YA 1YEHH 4HWZB 4IW4C 4X0KB 4EQ2A 4B9GA 4WWPA 2AQ2A 4XH2B 2NYYC 5I0XA 4HUWA 3S3PA 1CC3A 4HVBA 4N85A 1I8LA 1A3QA 3ESMA 3CFBA 3MRJB 3BVUA 3FBQA 1CU4L 1CVRA 1ZTXH 1U8KB 1H8LA 3O2WL 1UD3A 2K6ZA 1G1CA 2ICWI 1U8OA 2DBLH 4F7EA 4M1GH 3DO7B 3HAEH 4W1TA 3I84A 3ZDXE 3LKOA 3VE0A 1ET5A 1RZGB 4UILL 3ZDZB 3WGVB 4DGIH 5E4EB 5I1JL 1Z5LB 1A0QH 4NO2A 1JMXA 4Z7QB 4UV4L 3QWOA 4WSJA 2TSAA 3G5YA 1HXMB 4MMZC 2FT6A 5I8OL 4LLVB 4Z7WF 3MKKA 1UA3A 4R4FL 2Z4QA 3SN6N 5JYMA 1RUQH 4ZNEE 5BVPH 3JT2A 5DFWH 2GC4C 5CFAA 1FRGL 4Z3JA 3EXLA 3ZTDC 2X10A 5AQ0A 4G7SB 1EH9A 5B38B 3AITA 3B9KA 4NQCE 3GK8H 5DURD 2HLFC 3G5VA 2GHZA 4M7KL 4NOBA 3V4VA 3LKRA 3EOTH 2V3EA 4BZ2L 1DBAH 4FFZL 4KV5F 4LOVA 4OLWL 4E9QA 1NGPH 1QSEB 4BFNA 3QWNA 5AOJA 4FZEH 2AK4D 3R06A 5HHPA 4DO6A 1S4IA 1YJDH 4N0UA 2I26N 3V0WL 1JZGA 2OW7A 5CP7B 1R75A 1DDHA 3MV8D 4GBXC 3ULVL 4XCEB 5KJRH 2DI9A 2WYIA 3T71A 1I7TB 5CSZB 1W72A 3Q9QA 3RA7L 1KCWA 1QRND 2LR4A 2F08A 4NQDE 5ESAB 4AM0Q 1I7ZB 1I1YA 1NMAH 4AIZB 3MV7A 3HI6L 4PGEB 3B6SB 2W60A 2Z93A 1EJ6A 2Z8RA 1GCYA 3CN3A 1DJSA 5AW7B 2IDQA 1R5WA 4I3GA 2JV6A 5IUSA 4LSSL 1WDAA 1MZZA 4PG2C 5HHVH 1PY4A 5EOQH 4H8UA 4TV3A 5IHWA 2Y7LA 2ZCHL 1QFPA 3ME0B 4F93B 2CUAA 1A6ZA 5H37H 1W80A 4MZ2A 5L4JA 3OC8A 4K9EL 1VADA 2VLJA 4GG6F 2OJZL 2VZUA 3QO0A 3GSWB 3QW9A 3BAJA 2JVUA 3MBEB 2EDOA 1DL7H 2FEDD 2FUQA 4OKVB 3JV4B 3MRKA 3OGCA 5L2KB 2JK5A 5DWPA 3P0VL 2PP8A 1SXBA 2IQAA 3DVFA 4G83A 4UBDC 4NZJA 4ADGA 4S1SL 2DWTA 3V9EA 1PG7W 4WI5A 5FFGA 3P0GB 1N6QH 2Z3FA 1PZ2A 1KCVH 1CXEA 1F1GA 3UG3A 2EDXA 1OLZA 3ZE0E 4WFGD 3DMMB 1SHXA 3VFRA 3ARUA 3N1PC 1KFAL 3FU6A 3VXRE 4ELMA 3D85B 1KB5H 1ZT4A 3ETTA 2I5YH 3VXNA 1U3JA 1ZLDA 3GLDA 3GDBA 3H9ZA 3N0PB 1IGCL 2YC1B 4K3DL 5E5MA 5BW7A 3GRWH 3EBHA 3EYVA 2NUTA 1TR7A 3BH9B 4RSYA 5FM5M 1K2DB 3FSVA 2R2BA 2WNWA 4U6VH 4R4ND 3B7RL 1IBGH 4UINH 5FX3A 5HDLA 3DSNB 3M1BB 5ITFB 3WD5L 1SJEA 2YBRB 3AM8C 3P30H 2X4TB 4PRBB 1T0PB 4V1DD 3AY2A 4ZDHB 5FDWB 3D69A 5D93C 2F8OA 4XB3A 1PFOA 3SKJH 3VD3A 2FB4H 2QQNL 3IJEA 5BZDA 4PR5A 1TQBC 1SLXA 2FH8A 4Y4FC 4WHDA 1A4AA 4TXVB 2BSBA 4JZJA 3QQ4A 2NXZD 2YS4A 3UJIL 3VG9B 2XDHA 4H0LC 4YXHH 3DHJA 4LOEA 1L7IL 1RK1A 2OJEB 1DFBH 1IC0A 3GSRA 4OTXH 4GW5A 5CWSA 1DQQA 1A7NH 3E2HC 3VXUA 3H9SA 1CGSL 4Z7OB 3IDGA 5IFJA 1SDYA 3HVDA 1TQUA 5JO5B 4MBOA 2GSGA 1MSPA 3VD9A 5CS7A 4PRHB 2XXGA 4P23D 2DQMA 2IBZX 5B4MC 1B3JA 5I8CA 3BQUB 3MAWA 4HHAB 3U2SA 4BJLA 4DK5A 2H47C 3QRFM 2AEQL 1SUHA 4LLAA 2DI8A 5BVJA 4DQAA 1CF8H 2ESVA 2AI0L 2F7RA 3DC0A 3MCLH 4PS8A 1WFMA 3QORA 4G11A 4XBPB 3C6LC 3NSCA 4WUUB 3TJEL 4PP1C 1IBYA 5CNHA 2QR0A 2WLHA 5EORL 1UT2A 1XZ0B 2JH2A 3VGHA 3VSUA 4IIZA 2IWEA 3AS0A 1FDLL 2P5EA 3DJSA 3DX2A 3H2PA 3QA3B 4FQCH 4UIMA 5H37A 5ICUA 4KNSA 4WEUD 1NC2B 2Q86B 2VUYA 3ULUL 3TIEB 3WNNA 5GZOC 5HPMB 1CD8A 1QP1A 3X3GH 3VVWA 3PP3K 5K39B 1F6AA 1UEYA 4G8EB 3VDAA 5KYXA 4A7UA 2AXGB 2XN9D 4QWWC 3RX5A 4B53A 3DI2B 5B3NA 2NNXA 3PDOB 2JJTC 2NDFA 3TV3L 4L1DA 2VQ1A 4UDUB 4TQEL 4KTEL 1SXNA 1NCCH 1ZS2A 4JFWA 4PJ8A 2H6PA 1CDHA 3HEIB 4KI1A 2CG9X 3VMPA 3UPCA 3QIWD 4PJDE 1N9PA 4YHIA 1L7TH 1A3RH 1S7VA 1TTRA 3LD8C 1HHHB 3S48A 1CIUA 1OE3A 4HUXB 2ZCLL 4NQVB 4U1SA 3NJLA 5FYKD 1HXKA 4F27A 1GGBL 1KB5A 4RMTA 2VLME 3FUKA 1EFXB 1L9RA 2XQBL 3VFUB 1YECL 2FE0A 2AF2A 5FV1L 5F1NA 5HYSB 2MCG1 3T65A 2EH7H 4E5XA 1CDUA 1T04A 3U7WH 4WK0B 5DVNA 2CH8A 3HB3C 3BKML 3QEQE 1XGZA 5H37G 4QTHB 5I28A 5CEZL 2UUDK 5EIIB 1PX4A 1KN2H 2IXQA 5EOCH 3HRZC 4GSXA 4XP1H 3S9DB 2WLYA 4U1NB 3AUWB 1X5AA 2ZX8A 3D2UD 4KITB 2XY2A 1RURL 4YXKL 1AH1A 4BSVA 1OTTC 3BH8A 4PJIE 4JJOA 3NABH 5IJBC 4M48H 4WHTA 5E5LA 2JI2A 1YEWA 3FQWB 5CEYA 3WFCL 5LAPA 2WN2A 1EAPA 4ORGB 2DM2A 5DJAB 3MROB 1ES0A 3B43A 1J5HA 1YA5A 1QBMH 5IM7A 3RVUC 2X87A 4PBDA 2AK4A 5I5JA 1KC5L 3N3EA 3QNFA 3FF8A 1VEOA 5JZ7C 5DT1H 3MXVL 1G7IB 4H7VA 4L2LA 3L9RB 4ZAKD 3MV8A 3TYGL 1OAUL 2X6CA 5D72L 5L6YH 3GSNB 1YPZB 2CR3A 4X4YB 4ZMQA 2AQ3A 1L0YA 3MV01 2BP3A 3QXAB 2JJWA 3WLWC 4E5XG 4NQXA 4L4VB 3OZ9H 2DM7A 4U1HA 1J9CT 2ADFL 2EACA 5IW3A 2Y5EA 3ETBJ 3PHOB 3RB7A 2JCCB 4KVCL 4G8GB 3UERA 2C9UA 2BVYA 3A4AA 1IAIH 3OXSA 5ENWA 1X4YA 1T20A 5F7KC 4JZNA 2BSTB 2WQ8A 1NAKL 4LQFL 1KBVA 1N8OE 3ARDD 4IHOB 4LL4A 4WEBL 5E6UB 3ZHKA 2I9LB 1DVTA 4HKZA 1YEGL 3HS0C 3UAFA 5BMFH 3LRSB 1WGOA 5CXPA 2EVHA 1E27B 4K94H 2DDQH 4OCYL 4XNUH 2HMID 2WTRB 3BLPX 3MJ6A 4LASL 4ONFH 4NGHL 5JPNC 5CJXC 4NJ9L 2YEVB 3AQYA 1JWUB 1FL5B 3I6GB 4O58H 3ZDYF 3RILA 3UTPD 4IMLA 1H6TA 2WKLA 5F7HA 3V8OA 1IC4H 2W8CA 3Q01A 4PJFB 5FYKH 2J2ZA 4P4KC 5DJXA 4F57L 3MRIB 3IS1X 3K6IA 5MENE 5AZEL 5GS2D 3ZTNL 4QOKE 4WJ5B 1KCUH 4HEME 5BJTB 1EWHA 1RFDH 2AJUL 2VITA 4S1DC 5B21A 1EZUA 3L3GB 4TSCL 5FUZH 3O41A 2BY3A 2GJ6E 3TESA 1BAWA 3NUKA 1EDYA 1TVBB 4MA7L 3FW6A 1CYXA 4BK5C 2C1PA 3TVMD 4L3ED 2J8UB 3RWFA 1GJWA 3CFUA 1FFOB 3DBSA 3L54A 4V1DA 5BO0D 2P5WB 2X1XR 4OIFA 4DEWA 1SMAA 4Y16B 2DPKA 2IBZY 1YEKL 1YN6A 2OPCA 4OD1L 3BEWA 1Q0XH 3RIAF 4XMWA 1UD5A 2I60L 4JPKH 1I75A 1FA4A 5IQLA 2R39A 5A2KH 2ADGB 4P0DA 2FT7A 1BYOA 3MCKA 4MB4A 4DQOH 5DR5L 3UTTB 4YHML 3DUUB 4OGYL 4HGWB 1ZLVK 1FFNA 1YEIL 4FG6D 4U1GB 2ZYRA 3BT2H 1AO7B 3U1SH 4AQEA 2CHXA 2DD8L 5MHSD 3IWVA 4CADA 1WTLA 2VZSA 4KI5E 2CK2A 1RZIB 3Q0HA 1A5FL 3BUYA 3QDAA 4JFDA 4NT6A 4R26H 4YSOA 1BJ1H 2FO4B 4Y8AA 1IIKA 1LO4H 4X9BA 4UCFA 4MDJA 5ITBL 3QYNA 3DX1A 3HTLX 2RCSH 4G8IB 4UT7L 4QCIA 3P77B 1PSKH 5E8OA 4P23A 3OX8A 3TXAA 1A2YB 2XWEA 4KHTL 4QRPE 4WO4D 1GR7A 4U1MA 3BZEA 1N5YH 3KPLB 1E8XA 3LQAL 5IREA 2VXVH 4Q6IA 5DC9B 4X9HA 4NXSA 3VFSA 4X6CF 2I27N 3QIBD 3NSXA 3IF1A 4JLRB 3KS0H 3N5AA 4P5TD 1KEMH 4M1DL 4ACTA 1GGUA 3EYOB 4ALAC 4GPVA 3IGKA 1DQKA 3L5XH 3MMEB 2YPKA 3GMMA 3MZGB 2EEXA 3RX7A 5AENA 5DDHB 4JRFA 4F58H 4Z95H 2R8SL 2A6IB 2OMVA 1I8LC 3QUMH 1U4EA 5CZVL 2F1AA 25C8H 3B5GA 4XP9H 2DWXA 3I3DA 4K5PA 2KMWA 5CF3A 1ZVNA 2FEEI 4IYKA 3SE8L 2AABH 4EBQH 2ZCKH 4MAUH 2D7OA 2HVKA 1IAIM 4MZ3A 3NIFE 1FBIL 1CE1H 1LK2B 2NW2B 2N7BA 1I9JL 5HJDA 4K8RL 4NQTA 5F8RC 2Y5QA 5GS2H 3B9DA 4OBRA 4XI5D 4MMYB 4TOYL 1DSFH 4ZZFA 1CYGA 1SBSH 2XPGB 1M05B 2X4QA 5LN4A 3S3DB 3WFDL 1S5IL 2VM3A 2A83B 5EN2A 4K7PL 5A7BA 3DIFB 1WFTA 5GS1B 3L3IA 3QIWA 4IS6B 3T1WA 3CVCA 1S7RA 3PNWB 5FPIA 2ZXAA 5CSBA 4P06A 2OCJA 4MWFB 4HJGA 3FUIA 4Y0GA 4XTRC 2FT8A 5LLIC 3B2DC 4L4TE 4CU6A 2VR8A 2B16A 4XBEH 5SWSD 4H88H 1KB9K 1PG7X 4PWKA 4XCYB 4U1JB 3VFTB 3RWCA 2K45A 1VCAA 2IFGA 3B9KC 1U3HB 4NLHA 4NKIH 3OMZA 1R3KB 4UZSA 2QPSA 4E9VA 5IV2B 5I71C 3DXAB 3T2PA 3C09C 5J8OA 4X5WB 5E24E 1CXFA 1YY8B 4GAGH 4DK3A 3ZYOA 5HHXL 3DLQR 4F37F 4ZX3A 1OAQL 4K07A 3D2UA 1UGNA 3Q2LA 4PJ5D 1NANH 3D09A 2P4AB 2FSEA 3MUJA 3RNQB 2VRQA 5GSRA 1OCOB 1T2QL 2HX9A 2D31B 2VDKL 4OF5A 5ANMA 3WKNA 3U4KA 4FYSA 4S0TD 3DUSA 4ZX5A 4M29A 1LWRA 4QXVA 2DJMA 3SGEI 4OR1A 2HTKD 5D1ZB 1G6RL 5JHDB 5D1QB 5I8EB 3GXTA 3GMLB 5DWUH 2CU9A 1G9NC 2VUOA 3K4AA 2F0CA 1NGWB 3D30A 4N6RA 4ZAKA 1G9EA 1T5KA 4GQPH 5F9WB 4ODHH 1XF3B 3D48R 3MRQB 3EFDL 5A3ID 5I8KL 1JTOA 3FONA 1MW3A 1SY6L 4N9GB 3C5SB 4CN6A 2E76C 4PSRA 2AQQA 5DQDL 2A0LC 3DHPA 2L8AA 2BCMA 5F9OH 3I6KB 2EE3A 4CJ1A 3VXQB 3ZMRA 5C09E 1DE4A 4X4XB 2ZUVA 2CO4A 7PCYA 3FOLA 4G1MA 4AJVA 1W0VA 2N7SA 4JCMA 4MJID 1ODUA 4GKNB 5T1MB 3UGUA 4M7JL 4NQEE 1OAYH 2OXHB 2WZ6A 1ND0A 1DVFD 5IKCB 2BNRD 3EGSA 5JOFB 3EYQC 1CYWA 2Q76B 4HOXA 3GO1L 1JDAA 1T66D 4YSEA 3ZDXB 1FN4A 3N1GC 4OFIA 2LT9A 3N85L 1NOAA 2R7EB 2H41A 3QUMA 4Q9BA 1HC1A 4WY7H 3UBGA 5I30H 3PV6B 5SWQB 4I3RH 1GGIH 2A3TA 1S7TA 2JE8A 3PF2A 4KKLC 4NO0B 4QXTA 5JLZB 4M62L 1BZ9B 1NCWH 5J13B 1T1ZA 1AXTH 1RZJL 1Z9MA 5JORB 1OOWA 2ICWA 3LSOA 3QJFB 4OCMC 5EUKB 3K6DA 3OLEA 4HCIA 4IDJL 4CNIA 3LY6A 3U6RB 4HT1H 4X4ZA 2QDWA 2QDVA 4PJEE 3WG7B 3O0RH 4W9ZA 5F9JB 4AH2A 3WFHB 1IL1B 1FLTX 2X1PA 4MCZB 1ITCA 4JCWA 5BUAA 1TFPA 3HCVA 4JZOB 4ENEC 4OZIA 4ZUUB 1UWGL 1CGTA 2CHNA 3D0VA 4L8DB 4NQCB 2BVUA 2CAKA 5E2UL 1KGWA 1WJ3A 3LEYL 4EI5B 1FC1A 2EYRA 1KXVA 4G7VH 1P4BL 3I6LE 2ZUTA 3WTSA 2G60L 3UACA 4GI6A 4XGZB 2CLVB 3HLAB 5F96H 5GSVA 3SQRA 2EUVA 5AZUA 1L9OA 3O45B 2K70A 2XXCB 5F7MC 3TVMA 3G04A 3QCVL 4L3EA 2XQ0A 3P3UA 4QTIL 3EFOA 4E0RA 3RIFF 2VN4A 3H4FA 5C0RH 5FV2A 2G9HA 1Q9OB 5JQ6H 1PEZA 2C3WA 4PJ9B 4FMKA 2EZ0D 3RHWF 3L16A 1BVLB 3SYCA 4YO0B 4BQ9A 1SVZA 2ADJA 1HSAA 5C08E 5E08L 2YA1A 2GVYA 3BZ4A 5KG9A 2IO5A 4NQDB 1AANA 2V2WB 2AJSH 3TA4D 2VH5H 1WVZA 4NFCA 5SV3A 2MOQA 1YJDC 5A1AA 5IOKA 5BV7B 1F90H 3I50L 3W38A 3RWIA 3RURA 2YAPA 5I6MA 3GTTA 3LZRA 3AMKA 4FOMA 4OLYL 3QORC 4JHZA 2MSPA 4OLUH 1QEWA 1YYLL 2B2XL 4IJ3B 1KWGA 1QRKA 4AJWA 1N8ZA 2KDGA 5KSBE 2O5XL 3QGVA 5DRWB 1W8NA 1L6PA 1X7TA 2IGFL 3IU4H 3QZLA 1T5XA 3VSTA 1B9KA 2B39A 1RMFL 3FAWA 4FXTA 3IAPA 3O6KH 4TVPL 4WO4A 1QLRB 2P24B 1BAGA 2IH1A 3V4PB 5ADOH 2YQ3A 4HC1H 3WMPA 3BH4A 4JVWA 3QIBA 3ZE0B 3ZL4L 2AV7A 1IILE 2WLLB 2BFVL 4P5TA 3S34H 3BPNB 3SDAB 3ECBB 5AW4B 1DQDH 2OMUB 3UZQA 1AR2A 1NFIB 4LCCB 4U1IA 3VXRB 2CIKB 4ZS6D 4LLMA 3K8LA 3KEHA 2YJLA 1XT5A 3MLSL 1MG2C 5CJ5A 5EULV 2A6JA 3HR5A 4PJ8C 4XPBL 3DA0A 2AV1A 3KPSE 4O51B 4TUUA 4F2ME 2EDEA 1AY1H 1BV8A 4LLYA 2OAAA 4YNYB 4JFQA 4KHXH 3WE1A 2DQDL 2OL3B 2C3VB 5L4MA 1CK0H 4K5NA 4NNPH 2Z31B 4N0FA 5E7BA 2GI7A 4HIJA 3WEOA 1F6FB 1U41A 3SBPA 5SX5H 2VW7A 4LL1A 3VI3A 1PDKB 5TDNA 3U1QA 5TK2A 1GYAA 1OTSD 2J8OA 3ASNB 1VA9A 3HC3L 2VXTH 2VDNL 3HG1A 3F7YB 3FRPA 2GSIA 3IETB 1H3GA 4NX0A 1RJZA 2CUHA 4Y2DB 4JO3L 4XXDA 1WD9A 5E8EB 1C16B 1QACA 2KZKA 1MFEH 1OSZB 1CXLA 3Q7JA 5DJYA 5DVLA 2WWKT 2E7LA 1HTYA 2CKBH 3CG8A 1O6VA 1KYOJ 4HBCH 4KZEL 3ISWA 1M2VA 2BVOB 1JGUL 1J1XH 2VDRH 2YN3A 2WXKA 3C9NA 2BIIA 4XVSL 3PP4L 2B59B 2WSPA 4G8AC 3FYEB 2D7PA 4HSAC 5F0PB 4G5ZL 3MVSA 1F3DH 3PFUA 4F8LA 4XVTH 1T0OA 1FFRA 5T1DL 2KPWA 5CR1A 3GIZL 5CUSH 4NNYB 4BFKA 4OZIF 3K8KA 1INDH 3SKMB 5L4IA 1IRAY 3CVIH 4CC1A 1HEHC 4Z7VF 1EPFA 1NOLA 1IB5A 2BSDA 2QEJA 1KCKA 3DURB 4UMGA 1UB6A 3FB6B 1UZ6F 5TD4A 1G7HB 3JTBA 4PV9A 1W6LA 2AJ3B 2HPOA 4HF5H 3FRPG 1P2CA 2F5AH 3CC1A 1N64H 2FYYA 5BOZG 2EIZA 1VLXA 3MU3A 3COOA 4HIEA 2OYLA 1MRFL 3VXPA 3W0WD 1QSVA 3T1FA 3O6FD 2VC2L 4ZFZB 1T7VA 1UACL 3VTTA 2RAMA 3BUDA 3SODB 4E9WA 2QV2A 4N2GA 3AGWA 5I1JH 5L8KB 2YAEA 2WQSA 1O0VA 2JTYA 1EBAA 3KD4A 4LKCB 2GJZB 4JAMA 2CD0A 4G9FE 5D6CA 2X0VA 4IOIA 4LPUA 1X5JA 1E6JL 4HMCA 4WWKB 4KY1L 3QI9B 4B27A 5AVVB 1TDQA 5GZND 2EO9A 1L4IA 4R4FH 2WQAA 4PJDB 1ITBB 2KQNA 1PX8A 4FZ8L 4M5ZL 1C5BH 4MJIA 2C4FU 3JV0A 1DVFA 1SVBA 2J88L 5IHZA 5JQHC 1BLIA 1FRGH 2BNRA 3N43B 2X7LB 1MQKL 1Z9SB 3TA3A 3O4LA 3Q6GL 4J2XA 5D4HA 1S9YA 4TUOB 3CH1B 4Z0XA 4C56E 4OQTL 2CXGA 4M7KH 4NQSA 4BZ2H 5EO1A 2W95A 4OLWH 4M7ZB 1CWVA 3D4YA 3QEQB 3VYNA 2IPUK 4XO5A 2RMNA 5FB8A 1ZVHA 4Y1AD 3AQZA 1QA9B 4HSQA 3F7QA 2V37A 3MNZA 3BP7A 3GJEB 4Y5VB 4EVNA 4PJGA 4PJIB 3M46A 1GZPB 5AW8B 4H0GA 3H3BC 4N2BA 3IVKB 3DX6A 4JO8A 4YJZL 3U7YL 4A2EA 3JTSA 2Z0UA 4E42A 1JGVL 3CZUB 2ZWKA 2EE9A 4LCIL 1HWGB 1OQOA 4ZS7H 3MGTB 4KAQL 3NJHA 1BIIA 5IIEB 3T8XB 1ID5I 1QFWL 1NCDH 4Y5XA 4DVBA 2CKBA 2SODB 2NDGA 1R9FA 4K9EH 3B1UA 4F92B 3FH7A 5ISZD 4DP5X 4LLQA 1IQWL 1QNZL 2A6KB 2EEFA 2AAAA 1FPTL 4LSUL 4XMPL 4LDCA 3G6DL 2YD9A 3RWJB 3P0VH 3BI9X 3BISA 4AUYA 4S1SH 4ABWA 4RGND 1CBJA 1E40A 4P23C 2EVFA 1JAEA 3P9MB 3UZVB 2X4UB 3CZSA 1AKJB 5IOPA 3PWPE 3IXTB 4I48A 4Q6IC 3ZQXA 3ZSTA 1UA6L 5JIQA 3BIAX 2VISB 3K91A 4RFNC 1KFAH 1XCTA 1MDAA 3BWUC 5E23A 3STZA 1LE5B 5D2LE 3KR3L 2OTPA 2EEBA 1T21B 2JKRM 5AKSA 1DCEA 4K3DH 4JFHE 4RQQA 2WCSA 4G6ML 5TPWH 4S1QH 4GJTB 4EJ1C 3TCXA 2ED6A 2X4OA 1AE6L 1YMMA 3WIHL 5IB5A 4CL7A 3S3CB 3WD5H 4FXGA 4U4IA 2JB5L 3EZ8A 3GGWA 4D9QD 4XNMB 1KBGL 1EANA 2CLRA 2AEPH 4Y19D 3ZHNA 1Q94B 4K94C 5FCSH 2QQNH 5C07D 5MENB 3EDEA 3LCYA 3X14B 3PABB 4XCNA 2ITCB 5CINH 4QOKB 3NH7H 1GS6X 3VTMA 2XX1A 3N1MC 3M7OA 3KLSA 3EO0A 5FF6A 5IBUG 2Y07L 5IQOA 3QIWC 4L8CB 3T0AA 3UJTL 1MCDA 5FW8A 2ZAIA 1RQ5A 4P2RE 2YQ2A 5DTFB 4YMPA 4OD2A 1MJUL 2GJ6B 1Z9NA 3UJIH 4OUUA 5EU6D 1VZIA 4F3FA 3TH3T 3CSYB 4MHHI 4ZMAT 1JPEA 2PCFB 1R3JA 2CDFB 1L7IH 2X28A 4OZHA 5LG1A 2WWNA 1THAA 1P84J 5DJ2A 1BHGA 2DQIL 3ABKB 1CGSH 1H3VA 2YPVL 3S8GB 1CJYA 5KS9F 2Y2TA 4N1HB 1KDIA 2G75A 3FTUA 1NQBA 2DLTA 2YUVA 2D7TH 1OVZA 3M88A 1BM3L 1AHKA 5J0BA 3FT3A 1K72A 2NYKA 4HPOL 4D0BB 1EA9C 1KTRL 2FVNA 3V6OA 2D7NA 2AEQH 3FXIC 5I1CL 2IG2L 5LGJA 2XHNA 1HI6A 3W5MA 2AI0H 3TM6A 1GHFL 3G6JF 4Y9BA 5JA8B 2YD0A 1QR1A 4FJYA 2RFXA 2KZBA 3FCSA 3ML8A 2BMKA 4FFTA 3QC6X 1NUNB 1IKFH 4DNLA 1ZOXA 3SGEH 5LCVA 1L9NA 2CNZA 4L1LA 1KMGA 2AXHA 1AIFB 4MQTB 3N9GL 2QQQA 3KPOB 1FDLH 1MHEA 3HS8A 3PJLA 4H4NA 5E94B 1AGEB 3QXVA 1TG8A 2FJUB 1XF5B 5C9JA 1B9ZA 4MNQD 3N40P 4QRPB 3VGFA 3WEAA 4ZAKC 5E9AA 4XT1C 4ZFGL 2QLYA 2JKIS 3KCPA 5EB9A 4OGXH 3ULUH 1X5XA 3BN9D 2EVGA 3JSSA 3HUJE 4XCCH 2E75C 1KPVB 1SPDA 4LVHB 2Y1ZA 4GG6E 2AJYL 3V0DA 3LQZB 4ZO8A 3FO1B 3S5LA 2WPGA 3U48A 3FCBA 1KLGA 4I18B 5CLWA 3K80A 4KTEH 3UXFA 1BOGB 1F6LL 4OZGA 4JRLA 5C8JB 1GXEA 4HX1A 5C2BL 1U8LB 2ATKA 5I18L 1FFQA 2UXVA 3GBDA 4Y7MA 5EZJB 3W0WA 3KJ6L 3ZTCC 2PLTA 3GSVA 5H35B 3FU8A 3O6FA 4JKNA 2CBPA 4Y2LA 3A0OA 1OOAA 5A2LH 4ZOAA 5C0GA 2PWEA 2P8LA 3NIFB 2UZYB 3E1ZA 4PVNA 5JW4R 1KJMA 3WFEH 3H6JA 1S9VA 3N06B 4DEUA 1BVNP 1KCSL 4R8WH 1QQDA 4YQXL 2FO1A 2C8NA 3N40F 1GGTA 3NCYP 3W37A 2HMIC 5A2BA 4YHNA 5A6MA 4ANXA 2F74A 4AL8L 2PWGA 3BKMH 4YPGB 2VLRD 3TF7C 3MREB 1X9RA 4LPTA 4Q52A 1D7FA 5E0FA 4CILA 3PL6D 4HHWA 1TU2B 4Y88A 5B22A 1Y7VA 1OT2A 3S5LG 2BJML 2K1MA 2AQRA 4KKCD 4L4TB 4H26A 4AIOA 3QG6B 5FYLD 1CLOH 4OJFL 4N5UA 3WFCH 1K8IB 3Q5OA 3O6ML 3C8KB 4BINA 4NC1C 3O3AA 2X38A 5M7QA 3SYQA 2IMMA 3PDDA 1BFVL 4U6HA 4FFVD 4PIBA 3DJZA 4XP4L 5HHME 4ZMOA 4QHMB 4QXUH 4G7QB 4HJ1A 4I89A 1FZMA 3T3MF 3SGDI 4W9FC 3TZVD 4FTDA 1HEZA 1ZSHA 4HXAL 5INCB 4Y1AA 1JNHA 3MXVH 4FQLH 4MDIA 3TVMC 1Y1UA 3ZT6A 1CQKA 3TYGH 2Q3ZA 3BEVB 5D72H 4BXSV 4DKFL 5DZJA 1WWWX 4CW1B 3OZLA 1QBLH 4UV7L 4IBYA 2XXFA 3MHZA 2Y1YA 3NQKA 2ADFH 4UOZA 1CI5A 4LVNB 2J56A 1M56B 2XKNA 2R0ZH 4NUMA 4KVCH 3GFUA 2WD0A 4OZHF 4LCWD 2SEBB 1PAZA 4Z5RB 1E9OA 5GGQL 2VE6B 1MIEL 1B4RA 1M7DA 4LQFH 1IBDA 2BP8A 5G4MA 3AU1B 3B9EA 3GMNB 4WEBH 1CMOA 3CX5J 1TMCB 3IDJB 5ISZA 2B3RA 1DEEB 2UXGA 2O61B 4JFYB 4ZQTA 1CFMA 1IAOB 4OZ4B 4OFPA 1KZYA 3JVFC 1FSKC 1DN0A 3RGVA 4N0UE 1ACZA 4X6FB 1AGFB 3ZRSA 4AVHA 2QZ5A 4UU9B 2XFXA 2C9RA 4CVXB 3LIZL 3RVVC 3QXDB 1KTLA 4WO4C 4NGHH 4NJ9H 4HS8H 4YDLC 5E03A 3SZ6A 1C5DB 5A2JH 5FGCE 5C09B 4OJDH 3V7MA 1ZS8B 1QHOA 4YAQB 4WCYL 3MV7E 2ZWSA 5C97A 4RBPK 4P5TC 5F9AC 3S36H 2DMKA 4NQEB 4AJ0A 3BWAA 1H3WM 1GOGA 5JXAH 5AZEH 4K73A 4P59L 3T6VA 3ZTNH 1A7QL 5AUMB 3ULSB 4YEFA 5B3JE 1AR1B 4G72B 2H1PL 1WAAA 5EEYA 1NKRA 5D8JL 4C83B 2QELA 2NRDA 4LEBA 4FNRA 1A1MA 3RDJA 1YN7A 1XIWD 2CPUA 2VLJE 3MRPA 4M61A 4AK2A 3B8SA 2CJUL 3O6LL 4YDKH 3EJYC 2FJGB 4BFIA 2VDML 3A67L 4MA7H 2FJFA 3FKUS 4OZGF 4UQ2B 5IVZA 4ZX4A 1XAKA 4K3JL 1RHHB 3QP3A 3J07A 4W9LC 4Y19A 1DN2A 3FQXB 4P57A 4ODVL 1BBDL 3BMWA 4KXBA 4FX5A 4PJEB 4XCFL 1I3GH 4OD1H 2ICEB 3OAYK 2Y5TB 5A43C 5A7EA 3VG0L 4ELDA 4BQ6A 4JL1A 2LABA 3FB8B 4YE4L 2X2JA 2I85A 4YHMH 5JIPA 5KVMC 4ELME 3F58L 3KE0A 4OGYH 3KM1A 4UM9A 5EU6A 1IGTA 4ZTPH 1V7NL 1FNLA 1PLCA 2E7LC 2ZX5A 1QFWI 3OPZL 4E2OA 1WBYB 1FIGL 1UXWB 3KHOA 4R5VA 3IT8D 4J3OH 2WK2A 2ZE0A 3DX7B 5F44A 5I1LB 4ODUA 1ZTXE 1YAIA 3HBGA 1T3FA 3B2MA 3LZFL 4MMZB 3TL5A 3UC0H 4PLKD 1BZQK 5ITBH 5D4JA 1FNGA 3FUNA 4UT7H 1EEQA 1S78C 2YKLL 5C08B 2GAZA 2IDTA 2JKSA 4U6XB 1S5HB 2KLTA 1NIDA 1XGPB 5E2JA 1KB3A 4ABVA 4D7PA 1YNTA 4PIRF 4F1ZA 1ZVSB 3DMMD 4NYLA 5LBSL 2NNRA 4NN7C 4PCTA 1OWWA 4M5YH 1J5OL 1KLFB 2DH3A 3CC5A 4M1DH 5AB2A 2NTSP 3DPBA 3UADA 3JWDC 2YGQA 2DWDA 3MLTA 1R46A 5HP5A 2HTKC 2R8SH 5KSBB 2PTTB 2BX5A 4EIZC 3S35X 1MLBA 4YZFE 1X5LA 3FBKA 3UMTA 1TQSA 4MNQA 5D2NA 4GBXB 4WGWB 1WHPA 3GMPB 3GEFA 3Q1SL 3VXUE 1ETZB 2VXQL 2W91A 3RTQD 2AGJL 2BDNL 1U6AL 3A6OA 4LCYA 3ENEA 4ZG1A 2X6MA 1FBIH 4NPYB 4RDBA 2WKOF 2Z8SA 3V6BR 1QX1A 5A3IC 4K8RH 2M1KA 4TTGA 3BO8B 1BFOB 3K2MC 5JNYA 3EW3B 2Q8BH 2ZOOA 4TOYH 1M9SA 2X4SB 5F3FA 4FD0A 4P2QE 1IAMA 4WUKH 5FA3B 3WFDH 2ESVE 1S5IH 2Z4TA 3BD3A 3P4OA 2Q6WA 4WWNA 4KK8C 4A7VA 3G5XB 4PCKA 5FUOL 1JDCA 3KPSB 3CFJB 4F2MB 2J57A 5HGDA 2V6HA 3E9UA 1DVFC 2PWFA 3VH8B 2P5EE 3TH2T 5FO8A 2R29H 3AACA 4UF7C 8FABB 3TA3C 3UPAA 1T66C 2LVCA 3QR2A 3ULUF 4CC0A 1VFUA 2JQZA 2NY2D 1OZUA 3MR9B 5IR1A 1NOFA 1WS7A 3LMJH 3MV9D 4L3CB 2WP3O 3OKLA 3ARBA 2J4WL 4BIKA 2A38A 1YQVH 3LOWA 3C08L 3T0VA 2F2HA 1OP9A 2AMGA 1MN4A 4JG5A 1OAQH 3BAXA 2QVIA 4A6YH 1BQKA 3LZPA 2XYCA 1BQUA 3EGDB 3LPGA 1ORSA 3PHAA 2CUIA 4J3VA 1FNSL 1OZTG 1J0JA 1G9ML 1U93A 4WUUD 5EEVA