1PL3A

Cytochrome domain of cellobiose dehydrogenase, m65h mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAHNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical and Structural Analysis of a Novel Heme b Iron Ligation in the Flavocytochrome Cellobiose Dehydrogenase.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Oxidoreductase
molecule keywords Cellobiose dehydrogenase
total genus 35
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1pl3A00
1D7BA 4QI3A 1D7CA 1D7DA 1PL3A
chains in the Genus database with same CATH superfamily
4N2OA 2EIEA 3BZ4B 4QHKI 4XPAL 1AGBA 4ZW7A 3DHJA 4D3CH 4WHYH 4OLEA 4PD4K 3WIAA 4AMKL 4O2CB 3HZKA 4UDUB 4K71C 3THML 2BNQE 3MA9L 5EZJB 3MRPB 2IAND 3ZKMC 1BEYH 4JKWA 1ZLWK 4WTZG 4U3SA 4JHZA 5AAMC 2WGNB 3I50L 3AT9A 5E0FA 1DL7L 4AL8L 3CDFA 1QO3B 4L9LB 4QRRB 5GGSY 3EFFA 1N6VA 2CA3A 2KC0A 1L9QA 5C0DA 3X1BA 1OM9A 2H9GB 3Q1SL 3GSRB 3F7RA 2XYBA 4W9KC 5EC1A 4CDGC 3EYSH 4PGDB 3D39A 4IOFC 5IGXH 2X5PA 1IBDA 2OJEB 3F5WA 5EH1A 3FYIB 2BS71 5HHVL 2KI6A 1DBAL 4Q9BA 2IANE 4RIRA 4TVSa 2DYSB 2XQBH 1OAJA 1J0HA 2QV2A 5DD0H 5EOTB 4ZO8A 3BQUD 2OMZA 4P0DA 1QASA 3V0EA 4F3FA 4DF9A 3WTXA 2X4QA 3VTAA 4HHAB 1FL5A 4PS4L 5E56A 5ITBH 1YEGH 2YD7A 1TYRA 3K1KC 1OE3A 2WSDA 1O5PA 3II1A 3EH1A 3OJDB 5I24A 1NLDH 3FUJA 3HRPA 2IFFL 4JDVB 4LIQH 4Y2LA 2IAMD 2IVFC 1KPVB 1MCOL 3NCBB 1YMMD 2JJSC 5I1LA 4X42A 2GVYA 3HE7B 1WFNA 4PRPB 4O02H 2H1PL 4AEIL 4F7TB 4WEBL 2MTPA 2WQRA 3U6XS 1VACB 3SDYH 4W9CC 2XXGA 2IV9A 5L8JB 1UJ3A 5HVHB 3ARFC 4UU9A 1T1XB 4OLXL 3ZT7A 2CIKA 3E9UA 2GIYA 3X1NA 5IVXB 4MJJA 3ALWA 5C8JA 4Z7VB 5CJXA 2UWEB 2MSPA 1RSFA 4U6VH 4EI5A 5FFLA 1NCWL 2OI9B 4M9PA 2W0PA 1Z9MA 4Q89A 3EBAA 3D2UA 2DMKA 3VXSA 4P4KB 5CSBA 1NGZB 5FM8A 4FN0A 1KIRA 5CN2A 2V9TA 4YVUA 4B50A 1J0ZA 4LSRH 1S2EA 1AR1C 1NC2B 4UQ3B 4OCLC 2K7QA 1KZQA 3MPCA 1T66C 4NXKA 2VXVL 3MCG1 3WHXB 1M7IA 3VD1A 2JKRM 5FWRA 3DX9A 1XV8A 3MX0A 3UPRA 1BQKA 4TTDD 2GBAA 4XNAA 1WT5A 5E0QA 4MJ4A 3WNJA 2BP3A 4ALAL 5GGSA 2NY1D 3CFDA 1FJ1B 2JCCA 5CHNB 2VL5B 4RRPG 1F86A 3PWLA 5DF0A 1SEBA 3OJVC 4ZMQA 1DJSA 4L3EA 4Z5RA 3SE8L 1RV6X 2CSPA 3HHSB 3OAYK 3X12B 3UEZA 1UM4L 4H0HB 3WNKA 4EI5B 1M6OB 1BPVA 3QIBB 4K3JL 3I75A 1NJ9A 2NY3C 4MXWL 1WP6A 1VSCA 3HN3A 1DVTA 4QXUH 3ARWA 3RL2B 2EIBA 2XWTA 5J11B 3RZCD 2R2CA 1PW3A 3CHSA 4IU2A 4J3UA 3CZJA 1R4XA 3QIWD 4XPBH 4NNPH 3DPBB 1PFCA 3IMBA 4AQAA 3RL2A 2ZD0A 1PZCA 3PHQB 12E8H 2WAHA 3U0PB 1HK6A 3WFHA 2BXYA 4B53A 2JLPA 5CZVH 2EECA 2ZWKA 3ARXA 3BUPA 4RDQF 1N7MH 3RWFA 5AB0A 3PG2A 4K3DL 2GI0A 2ITDA 5EN3A 1H5BC 4PV9B 5G5DA 2JH2A 3GLDA 3T8MA 3ZDYF 4PBXA 4EBQL 1JBJA 4ELKB 4ZNEE 1IEAB 4JG5A 6PAZA 1HCZA 3VAEA 4N2NA 2IMNA 3VWKC 2D03L 3DUUA 2QPDB 3APFA 5HJ3A 5CEZE 4WF7A 1OV8A 4N2GA 3T4YB 5CF3A 5LGYA 4PWEA 1FLRL 5FKAA 2RFXB 3A47A 4CRPA 4EI6A 4TM9A 4PJEF 5LXGL 4HXBH 5CSZA 3MUGB 1NMBL 3K4DA 4LIQE 4KQ4H 3C8HA 2B39A 1S9WA 3D09A 1I7ZB 2AC0A 3QUZA 6FABL 4X6DF 4FZEL 3P2BA 2IEPA 2QKIB 3Q43A 4R2GC 3WNOA 2NNAA 5L2KE 1SJHA 5D1ZC 3A67H 2DQTL 1F41A 3WFBH 4Q9QH 1JF5A 1AH1A 1YECH 4GS7B 1ZPUA 2FNBA 3ULAB 1M1XA 1T83C 3EAKA 1NGXA 3P3YA 3CSPA 3IXTA 3KXFD 4S0TD 3OMNB 2FJGA 4PJHA 2NYYD 4POZD 1S7UB 1HEHC 5BRZD 3KYMB 1MCWW 1UT9A 2VN3A 4YL4A 1E4WL 5A2KH 2A6DA 1HQ4B 2IGFL 4XNMA 3CE1A 1P9MA 3K72B 4P3CL 2R29H 2CXKA 5CSZB 3PQYE 2PW1B 1REIA 4BFFA 1IGCH 5E8EB 4JX0A 4LEBA 1BZ7A 5D2LF 3UZQA 2C34A 3LXUX 3AB0B 4OZFG 5KVGE 2DJ4A 5CD3B 1PZ2A 5CZVL 3ARZA 3TH2T 2BCKB 5DJAB 3L9YA 3UAJA 3D8MA 2BOBB 3STLB 4ODWB 3V0WH 2PCFA 2J25A 5F7NC 2F1EA 2YRLA 1LE5B 3CC5B 1Y18B 4O51B 1KJMA 3LAFA 1UC6A 4ZX4A 4FYTA 2E76C 1SHSA 1S9VA 3SDDA 1FG2B 5DQ9A 1A0QH 2DLTA 4YBHA 4P2OC 1A9EB 2X87A 3FAWA 2XXCB 2P4AB 3MRCB 5LQBH 3LHAA 3QZBA 3KBPA 3MV9A 1ZE3H 4UUJA 4OZIF 4UBDC 2OL3B 2GTWB 4K2UL 1KCBA 2P8PA 4XNMB 1A7NH 4PUBH 4LVEA 4HA1A 4KXZH 5T1KB 3W11D 3C12A 2I9LB 1E9PA 5I8EA 3LNIA 2B1AL 4JKPH 2BVOB 4UTAL 3ME0A 1B9ZA 2J71A 3GSNH 4ZOCA 1L9MA 4D9QD 5DJYA 4Q9RH 3GJFA 4LB8A 4RMQA 2P48B 2YQBA 5ID1B 1GJWA 1TQUA 4R8WH 1JF1A 4UF7C 1SVCP 2A7BA 3EF7A 3MLTB 4JHAL 5DYOA 4FLQA 2P8LB 1LO2H 1U8PB 3LYRA 3B9VA 1BF5A 5JMRA 4HUWA 2F1AA 1ZLEA 1T7WA 1SXSA 4PLJC 3FONA 3C5XA 3ARTA 1MQKH 4AY0A 5C0EB 4H40A 1KZYA 2EEAA 4CADB 4XOEA 5IFAL 2GC7C 1KTDB 4QTHB 4LAJH 3LH8A 2A6KB 2OMVB 3KHQA 4EOWL 3VSTA 4I7ZC 4PAZA 3ULUD 4PY8J 3R4RA 3VWJC 4G7SB 2ZTBA 3G5ZA 3VA6A 15C8H 3TNMA 2XX1A 5GIRA 3RWDA 2R2BB 1S7VB 3CSTA 5HD8C 4R3SA 4F8PA 4HZLB 1T89C 4AQ1A 2D2OA 4AYGA 2ICEA 2FSEB 3S37H 4EXPX 4NC1C 1N2RA 4H25B 1TJGL 4XI5D 4YH6A 1E7VA 3HRZC 1WBXA 4TNWK 4BQ9A 4E0RA 4JFED 1P84J 3PIQB 4URTB 4I4WB 2IADA 1OTUD 2D3NA 5BV7L 4Q56A 4LHJB 1JCKA 3F04A 2DM3A 3T2NL 4KDTC 3KPSA 1T5WB 3RGVB 3PIQA 4Q58C 1YEKH 4FQQA 4KJQC 4XNUL 1VCBC 1DFXA 1O7DE 4NKIL 1U2HA 1DVSA 2BP0A 3QARA 1ZWIB 4HOMA 1KB5L 4WWNA 4YBLB 4F7PA 1WLHA 2QKSA 4HEMA 3RNQB 4XB7A 4YSSA 3RIFF 5IUSA 3H9SB 3AQDA 3FQXB 4N9GA 5D6DC 4BCZA 3T0WA 5BV7H 1FYTA 1I7RA 2WP3T 2Z4TA 1IC7L 5IESL 4PB9H 4LXFA 1JFQH 2VN6A 4UU9B 2UZYB 5ID0A 3SBQA 1LHZA 1MFNA 4RGND 4RVBA 3ZZLA 4PB0H 4PRDA 4J4PA 1XT5A 1UZ6E 1W80A 1MJ7L 4XAWL 3X14B 5TFSL 5AVSB 2CR6A 4XAKE 2XPGA 3CZLA 4BSJA 2Y3NA 2BJMH 5BVPL 5JOFA 2IANB 4DSYA 1ZGLA 4AM0B 1FIEA 3W56A 1OGTB 3DKHA 5CINL 3LEVH 4F9PA 1NCDL 4PJBF 3QDME 3KWWB 3FL7A 4L1DA 1QNIA 2KKQA 3CFNA 4MX7B 5DRXA 2DM2A 1K2DA 1XF1A 3SJVB 1CXIA 2IALA 1RVFH 4CBZA 2X89A 4CVWA 2VC2L 2F18A 3NTCL 4JRXA 3RNQA 1U8IB 3QIBC 2R1XA 5D1XE 1BWWA 3FK3A 4KC3B 1M7UA 3NJNA 2CMRH 1PAZA 4NSKA 1QLEL 4XO8A 5ISZB 1FJ1A 3JVFC 2C7FA 4M8VA 2EXSA 4PY8I 3OG6B 1SJVA 1SJEA 4E9RA 5C71A 4FERA 2Y9RT 3ARSA 3JT2A 4LRNH 4JANB 4W9HC 5EOCL 3QFJD 3IU4L 3DRQA 1O7SA 5J6HA 3V0HA 4NKDA 1OAYH 1RQ5A 5FF6A 1TOXA 3OKEA 4IBTA 25C8H 3VH8G 1ZT1B 3KZ8A 1GAFL 2W95A 2B5IC 1VENA 4GW1B 5E5UB 4GMSL 4AGNA 1AR1B 1YMMB 3PU7A 3S36H 5T5NF 2DQIH 5I9QC 3R7QA 4X6CF 1SOKA 1IGML 1T89A 4QCIB 1JXFA 2J55A 1IC0A 5A2LH 2VDNB 4P4KC 4RFEB 4LF3A 4N3TA 1WFTA 1FYTE 1X5GA 4JFPB 1F3JA 4NHUB 3VH8A 4XTRC 4R6UA 3QWQB 2AI0L 3ZBMA 1NCJA 5HHQB 4MKTA 1H0DA 5J7CC 4PG9A 2HXAA 1R3JA 3VG9B 3HNTL 4KNQA 3S2CA 4F7EA 4K94L 3PDOB 5CR1A 3WU1A 2XVGA 3U48A 2XDHA 4P4KD 5K69A 2H3KA 3GSWB 2BSDA 1NICA 2AAAA 1XZWA 1TQTA 5DEFA 3BT2H 3ML9A 4IGBA 1A4CA 3BD5A 3MRDA 3AQZA 2FJFB 1P7QD 3TZVA 3PDOA 5TDOA 1DVYA 4AV4A 1R6VA 4P4KA 4PJDF 3DDGA 4NJAH 3GLZA 4IS6A 3FCSA 1CT8B 5IMOA 5J12B 3IAQA 1P5VB 5EOTA 1YJDC 4IEFA 3KPRB 3EJTA 1IV8A 2ZUXA 1E2WA 2BMKA 4RA3A 3S35H 1WD8A 5LO7A 4MS8C 4IS6B 2X3BA 2HJFA 2CHZA 3WKML 1VERA 4K5OA 5INCB 2EEXA 3TP4A 3VMOA 1R24A 2XBTA 4WI7A 1KBKA 2J43A 1H9DA 1UM6L 3ZYJA 4YBQC 4L4VE 3NJXA 1CFVH 4LCUB 1D5BB 1S7TB 3NSDA 4QI3A 3FSZA 4OFKA 2ARJA 3QHFH 1BQHB 3R8BB 3C6SB 1I9JH 32C2B 4P5TA 5F7DB 5KBNC 4HXAH 3TWCH 3FB7A 1BM3L 1MHEA 3HZVA 3S5LA 1PSKH 5FXCH 3BUYA 4GBXD 2NT0A 2V2WA 5KVDE 5TQ2H 4MA8H 3MJ9L 3MUJA 1P69B 1E30A 2NUPB 1AXTH 1MVUB 3LKNA 1F2QA 4MZRA 5I16A 4C56D 2VQUA 4ZW8A 4IMKC 1F4HA 1VGKA 2E59A 3KH3A 4WW2B 4DAGL 4LU5H 1WBYB 4I48B 5JORB 4FL4C 1GGCH 4ILDA 3AXHA 5BZDB 3KDMB 4QLRA 3E2HB 3NCYP 5DHVA 1NOLA 4PJAE 1R34A 4I2XE 3SCMC 1CD9B 4WGVB 2HVBA 4KMTL 5DUPH 3KMDA 2HPOA 5AFAA 3QXAA 4H8UA 2IGLA 1ROCA 4MFHA 3EOYG 2X4TB 3VYOA 4LGPB 4EKXA 3IDXH 1D7DA 4J27A 3IDIA 1YNTB 4JQIL 3V6OC 1ODAA 3IKCB 2G9HB 5D7JC 4LQFL 4BH8B 2BVOA 2IWFA 1TQCC 2DLIA 1A1MA 4HUMB 4PCTA 1MI5B 3DETD 1QFWI 1QNZH 1Q9OB 1A4JB 4WW2F 1OCZB 2EXWD 4XI5C 3N1MC 3SDXB 1LO0H 3TH4T 1IGCL 3ABLB 1XGUA 1QSED 3B9KB 3I9PA 2WWKO 3TV3L 4NKOB 3NSFA 4CGUB 5EDSA 1LWJA 2R0ZL 3QPXL 2EE2A 2VDLH 3RVXD 2ZICA 1RU9H 2OR9H 2MJWA 1XX9C 3QQ9C 1XF3B 4L4JA 4L8CB 4ONOA 4FZ8L 1ZLUH 4U0RC 2FIRT 4IRSA 5D70H 3T9WA 3VWJD 4A66A 1TSHA 2VMCA 1E40A 3QEHA 2F74B 4YLBA 1HDMB 2MTAA 4GP5B 5E9DB 4YLCA 4OM1H 4L8CA 1WWAX 1FV1A 3DUUB 1M57B 3AWEA 4B3VA 5GZOC 1J8HE 1GGYA 1EXUB 2DWSA 4JO1H 5EUKB 4QGYA 5H37G 4DO4A 3RIKA 2QVIA 4I13B 1F4WL 3H53A 1TJHL 5BUAA 4X6DB 4TQEH 1OIOA 3NH7H 1I7ZA 3DO4A 1DQQB 4L3ED 1ZXQA 4M6AA 4UM8B 4KJPC 1I3GL 4MNQD 1KIQB 4WCYH 5JPMB 5D1QB 1NEPA 2CCVA 4Y2DD 2EDYA 1FLRH 3GRWA 4QRPD 3PP4H 4KVCL 1QUNB 3WS6C 3BP7A 3RX7A 5DHVH 3L5HA 3RWJB 3IRZA 4K7FA 5CLZA 3AXLA 2HRPL 3PHOB 4EIZC 1XSKA 4WK4B 1YHPA 1GMEA 1E8WA 5DRWA 2DQGL 2EH8H 3REVA 3KE0A 3FCBA 3FQRA 3TT3L 3VXNB 1HH6A 2LAGB 3UTSD 3ZHLA 1PEWA 2EH7L 1X9RA 2LR4A 4XXDA 4DGIH 1JD7A 3N3EA 4PLKD 3MRLB 2JKLA 3VXRB 2V8LA 4QJ5B 3ZOAA 1FNHA 4ES9A 1ZS8B 5ID0B 4QTFA 1HH6B 1KT2A 2Q9OA 2BSSA 3K2IA 4X5WB 4L8BA 5HDQH 4YXLH 3KWTA 1OL0A 4FNQA 4JAMB 5JUEL 3MNWB 4JK0D 4GSDL 2BCKA 5BOPA 3HBGA 2VW4A 2DQFB 1AS7A 3BPLB 3OB0H 4ZAKA 2ZUQB 2EKSB 3RJQB 3TEWA 1U36A 4DCQA 4JAMA 3Q8CA 1S7QA 3AG2B 4RZKA 3ZQ9A 1BREA 1RHHA 5I17A 3UGEA 3ARQA 3VXTA 5FC9A 1T21B 2W88A 4C56A 4ZW3A 1U8QB 4QYOB 4C4BA 3KPSB 2NX5D 2EKSA 5E2UL 5TE6H 3RWDB 4HUVA 2QDWA 2EDMA 4NAQA 1QRND 4P46B 2QEJA 3BE1L 1SEQL 4GBXA 3HE6C 2DQHL 1EUTA 2GHWB 5D1ZD 2Z6FA 4XO5A 5J1SC 5D96B 5FO9B 3AAZA 3O4OB 2PN5A 5F6HJ 1OP3K 4N5UA 4QF1B 1MZZA 3B9EA 2HRLA 2NSQA 4QHKJ 2X1WL 1WWBX 2E6PA 2ZSVA 1A7OH 5J06A 1V8HA 2ZAHA 2RAMA 1OT4A 2OZNA 3BE1H 1SY6A 2X6AA 3QUXC 1BFSA 5F7MC 4DZBB 3FFDB 4RX4A 3QNYB 3DMMD 2LHAA 3U6RB 5GRVK 2ADFH 1JZGA 2UXGA 2V5YA 3MO1A 5D7IA 1WFUA 2OYPA 5CEXB 4X6CB 1INEL 1G7QA 4LMQI 4GW5B 3PGDA 4H1LA 4PJFE 3CUPB 4JDTL 1MCOH 3T6WA 2VUKA 4B9ZA 3MBXH 4EN3D 1NLDL 2EDOA 3NJHA 4YPGA 2DH2A 4P2RB 1TKWA 3WFBL 2CGRH 5I0VA 3WKYA 3STZB 3JTBA 1URLA 4NCC1 2NX5E 3FN3A 5AW7B 2CM5A 4MSWB 5FPIA 4OGQC 3EBGA 3QUXA 4NP9A 5DEFB 2DYPD 1OE2A 2Y22A 1E9OB 3KR3H 1YN6A 2O26U 2B1OA 1SQMA 5IHLB 4HCRL 4ZS6D 1NFIA 2XVBA 4B0MB 1S5IL 4R0LA 4MQ7B 2O5XH 4EMZA 4XWGH 1F4YL 1QBAA 4WTWA 1ZV5A 3SKOB 2OJEA 1DBJL 5EEWA 2EDBA 1CD8A 4YHIA 1T5WA 4E9YA 1FNAA 4U05A 1UM6H 1A6TB 1R33A 1Q9WA 4LL1A 3LV3A 1P9MC 3BD3A 4NSKB 1V3KA 1N0XL 2DMGA 4TTDC 4U3SB 1KCVL 5GS0L 1BEYL 3QG7L 3OB8A 1CI3M 1RUPH 2VR7A 3GI9H 3VXQA 2PWGA 4J5VA 2KL6A 1CDYA 1AR1D 3VDCA 3D39B 5F7DA 3DJRA 4NENB 5SWQB 4LPWA 3VRJB 3D4ZA 1ZANH 1CDJA 4Z95H 1F4WH 1HC1A 1FFNB 3ZE0E 2YD6A 3HKFA 5IEKA 2C9SA 2P24A 3MNMA 2QQLH 4HX1A 4K3JH 5JOEA 5C0AB 2A74B 3SDCB 4D0DA 5CP7A 3TBTA 2QHRL 3TF4A 2PLTA 3MJGX 2B9BA 3A4AA 1TMQA 4GAGL 2YK1H 3X3FH 5C9KA 4QRTA 5DHYB 1FO0B 3O41B 4Z3HA 1BVZA 4QHUA 1IJNA 5ADOH 2MQGA 4OF3A 5FYKD 1PZAA 2FHBA 2VDKL 2WB7A 2IAMC 3PWPE 1AD0A 2VLKE 2VM4A 4HLZH 3TT1L 1Y1DA 1B0IA 2KS0A 4AIZA 2Z91B 3U7AA 4ELKA 5DHEA 4WSGA 1DE4B 4Z7VF 5SX5K 1H3PH 3VFNA 3SYQA 3V5HA 3HC4L 1S7TA 2JQMA 1ORQA 5H8DA 3K6NA 2F5AL 3DIDA 2A4CA 1ZA6A 3HOGA 1ZLDA 3N0PB 3WEOA 32C2A 3H9YA 4P5TB 2DRUA 5E4EB 2YS4A 3ARBB 5HDQL 3L95A 1MI5A 4A63A 2W59A 3DXAA 4K9EH 2LLLA 3T0DA 5INDA 4KKZA 1J0YA 1ZRUA 2HN7B 1GZQA 4JFVA 4BGDA 4IOFD 4JQIH 5GRUH 5MP6H 2WINB 3C6LC 1NJ9B 4XPHL 5CGYC 1TNNA 4F2ME 2VLKB 2VRKA 1QKZL 1R24B 4OCNC 4HBCL 2AHIA 1H3GA 3CHQA 1PZ5A 2JF1A 1MY5A 1DQLH 4XVSL 1LNUB 2PW2A 3U36B 4G43B 3K6DA 3N6YA 2XVLA 5C6TH 2JCCB 5IT2L 2E9IA 3OZKA 3W39B 4HIHB 1UUSA 2W65B 5G4NA 2QL1A 3BO8A 3FSOA 3K4ZA 4MWFA 4WW1A 3QDJA 5CP3H 4YSRA 5TPWH 4YUEL 1OP5H 5JA9A 1S78C 1CFQB 4HFUH 4FTVB 5HDOA 4OZIE 1P4BH 2VMJA 5AZEH 3DSFL 4IGBB 1DJWA 2VKWA 1E5CA 1T0NA 1NPNA 5KYWB 3FTUA 3M45A 3K5RA 1FN4B 4GSUA 4RGMB 1ZLSH 4G9DB 2NY5C 4G6JH 2VWEE 4I5BB 4XBPA 3L48A 3BWAB 2NZ1A 2JB6B 2P9RA 3GEWB 5IJKC 4ZFZB 3VFWA 4FI6A 2YBRA 2TSBA 3D0LA 2JK5A 3SO3B 1KB5H 4PCKA 3FN9A 4B96A 1XGUB 4MA7H 3WEXA 1T22A 3CFUA 3WTSA 3KXFE 3CJJA 3RVUD 2KQNA 4FQHB 3NQIA 5F3BB 1N4XL 3QRLA 3GTVA 3RTLA 1YY8B 3SSGA 2P26A 2J8UF 4PJ7E 4MA1C 3J7HA 4LKXB 2RACA 1DCLA 2W60A 1L0QA 4QXTA 1ZDSA 3VFSA 2QBWA 2Z35A 3IXAA 1JFHA 3SD5A 4JL2A 3PPSA 1L9RA 3L3KA 1CFMA 2AJYL 3BFWA 1Q0XH 3RY6C 5MEQA 3FSVA 1EEUA 3C75A 4L48A 4OCMC 5ESAB 1V7NH 3RP1A 1GCFA 3QJFB 1HHHB 5AVRB 1TFPA 2AKRA 2HX9A 3LKSA 3EO0B 4JRYB 4X6DA 1OCWL 2M8XA 3QZNA 3F58L 4CSTA 1S8DA 1FDLL 3BX7C 4MA7L 4GLRH 4G83A 1IFRA 4LSSL 5EC2A 1SOQA 3OKNA 5I17B 3E8UH 4LL9A 2CO1A 3PHAA 4XN7A 5C08E 3UIZA 1B6UA 2J5LB 2G2NA 2I60L 4CW1B 3S36L 3J27A 5JHBA 3KGTA 3RWJA 5T33L 1X9QA 1E6OH 1YNTF 4RAUB 3EJYC 1FVCB 3AM8C 3OTTA 5GGVY 3DUSA 4M5ZH 4W1TA 2CLZA 5C0CD 1ZA3B 1BAFH 3K72A 2H3NB 4ODTL 4GMSH 4AQ1B 5J13C 4L1BA 1I31A 4HJJL 1B0RB 4NQEE 2OZ4L 3GUFA 3AZUA 4NFCA 4K5NA 3OMIB 4FULA 4OGYL 2WGXA 4DH2A 4J28A 1RMFL 4E41D 3G9VA 1DBML 5C0BB 2Y7OA 5DZOA 3ARFA 5IB5B 2R4RH 3SCMA 3WNNA 2ENJA 3CDZB 2F53D 3T8XB 4OJFH 5C3LD 5C92A 5MI0C 1AE6H 3CSYB 5B22A 2XN9E 4RQQA 4HKBA 1WS7A 1MHPH 3GSUB 3ULUE 4HS3B 2PR4H 5SWSA 1WA0X 2NY2D 1A8JH 3BP4B 1FVCA 3EYVB 4XRCA 4OH2A 3RLSA 1E28A 4Z9KB 4XNBA 5AW2B 3X17A 2HZHA 1EO5A 1U4FA 3RKDD 3ZHDA 4NQDD 3DROA 3W3BA 4QRRA 1BZEA 4Z7NF 2F53E 4JRWA 3C5ZA 1KBVA 1R5WA 2F5AH 4JFDE 4JM2D 1NEZB 5EUKA 3KD4A 3JQOB 2DAVA 5SX4H 3RWCB 3OAUH 2WWNA 1W0WB 4QHLA 5I74C 3RG1C 2VZ1A 3SKMB 3MV7D 3KPSD 1C9SA 3O81A 5EF2A 1C12A 1HHGA 2IQAA 3C2AH 4WY7L 4YHLH 1NBVL 5CIPA 1IZKA 4P46D 4G8GE 1AE6L 5I0XA 3W82A 4LVOC 4YHZH 1KIPA 3K4AA 1IMHC 5I6KA 4HJTA 4XPTL 3LX9A 1A47A 1UZ6F 5EF3A 2VLRB 1AGEB 3LPGA 3WLWC 4P2QE 3F2LA 3WS3A 5AL0A 4TSAH 3ALPA 5D55A 3T2OA 1BSIA 2ZG3A 1JPEA 3LZPA 3WY3A 3TBVB 2P44B 2QGCA 3BHBB 5EZOL 5GIRB 4LLAA 4HJJH 4KKBC 2AEOA 2EE0A 1DVFC 2DQJL 4G6AD 2AK4E 4AV0A 3VRLF 1NUDA 2AS5M 4K0OA 4P2QB 2CXGA 1WQVT 5IVNA 2NY5L 4NQSB 4PV8A 3CV5A 2IH3B 3DJ9A 4NKDB 2AJUH 3C08H 1MW0A 1OAYL 3BGFC 3GMOA 3DX0A 3HZMA 2NY0C 1JXGA 3MV01 4U1JA 4W4NA 4TQIA 3H0TB 1P4LA 4RIRB 3S34L 5CJQH 3ZTNH 4FABL 1FG9C 4BRJA 4NNXA 4AM0A 1NLBH 2BSBA 2AQQA 3X2QB 2GITB 1RJZB 1AZRA 1ETZB 4I3SL 4Y4KB 4NUQA 1BV8A 2L04A 2NY4D 3DX9B 3UPRB 1YC7A 2H47C 1PQZB 3BH8B 3MACL 4OM0H 5FYLD 1A3RL 3EUUA 3EGXB 3GJFH 5DFVD 5BOJA 5C0DB 1J87A 1M7XA 3DRTA 5JHAA 1IFGA 3GHBL 5K9QI 7TAAA 4K8RC 4Z7UB 1TLMA 1LEKB 2WUCL 1UZ8A 3OC5A 2HLAA 5DJDA 3MRKB 3KW7A 4UQIM 4WKZB 3BQUA 2EYTA 5L6YH 1QSFD 3X12A 2C3GA 5GZND 2J8HA 2D0HA 3U9PL 1A7NL 2NQDA 3M7OA 2X3CA 3S96B 3AWFA 2P80D 4FL4B 4GG6E 4UTAH 2JFCA 2O6DA 4OD3H 2VLMD 2HN7A 4ZOAA 3V55A 5IESH 1IM3A 3WXWH 5HI4C 5LCVA 1FFRA 2NR6C 1U8OA 4YPJA 4NQED 1KFAH 1JS4A 4CAGA 5GZOA 3CIQA 3GSQA 3NCMA 1EZUA 1U42A 3MLWH 3EDEA 4NN7C 4Z77B 2HRGA 1PQZA 3OKMA 4S0HA 1AS6A 2VH5H 4F15B 4MTMA 3D48R 3BKYH 1I9IH 2B3IA 4NENA 5SWQA 2B16A 2X42A 2CM6A 3X3GH 3PHSA 3TPUB 3BZEB 2H5UA 1AOHA 3O4LB 1KCRL 4N0FA 1NCWH 4FG0A 1IQWH 3FB8B 2Y23A 5T1KD 4ZW5A 4W9ZA 4NO5A 1FA4A 3WJLA 2X4UB 2TRHA 2WLLB 1G6RL 3CFQA 3NCEB 1E50A 3JSSA 5EBWB 3FU6A 2C9XA 2MPVA 5EF1A 3TJPA 4IBQA 3QHZL 1TU2A 3EHBD 3S97C 4ZFFB 3PYCA 4HIIA 5LAXA 3ARBA 5JLZA 3NFPA 2CA4A 1NCNA 1IM9B 1FVDB 4QHPA 5TDOB 1O7DC 4AGQA 3CFKA 3BKML 2NW2B 1RUPL 1GCYA 5D1XB 3GS4A 2F19H 3MZGB 4TUOB 3RI5F 4XGZA 2O6CA 4XX1G 1F90L 2B4CH 2Y1ZA 4ZTPL 1CXEA 1TNMA 4QO1A 5C09E 4AIZB 3QJSB 3SQOL 4PJGF 1TSRA 3LOWA 2Z65C 3CN3A 3Q9PA 1MHPL 2PWHA 1I8UA 3F84A 4JB9L 4L5FL 3ZQWA 5M7QA 3GXFA 5LVEA 1IGYB 1ASPA 3V4PB 1UD2A 1FNFA 1O0VA 4NX0A 3VI4A 4YXLL 5CCKH 5I28A 2XIBA 4MNGB 2G60L 4G7RB 5BUGA 4JQVA 5FYKL 4LSVH 3CFMA 3CX5J 1D6VL 1JGVL 2D8KA 3JV4A 3L95B 4HJIA 3TONA 5KYUB 3QUML 5I5MA 3RB5A 3BGAA 1UCBL 5A6LA 3ZDZE 3FQ1A 4FTVA 4JHWH 1KGUA 4YC2B 3FRPA 3IMTA 4J8RA 2APWA 2ORBH 3NSXA 4Y4FA 4OFDA 5JA8B 4AQ1C 4MZ2A 1RCYA 3WE6A 3LKSB 2R1WB 2J2ZB 4K73A 4LLUA 2MH4A 2CK0L 2QHRH 1BG9A 4UT9H 4PRHD 2TAAA 5E2TH 3U25A 2I60H 5JMOC 4MDIA 3SPGA 2K8QA 4W93A 1AANA 1FHNA 2L7JA 3V7AE 5FCUL 3DOSB 2ARJB 4KX7A 5BZDA 4Y1AE 1GKEA 3QWRA 4N25A 3GGWA 4BWWA 1Q4NX 3FB6A 3C5SA 1YY8A 1AD9B 1QFWM 4A38A 3QUYD 2JCCE 1MFEH 3PWVB 2QPSA 4HMEA 4NO0B 1ZA6B 3LS5H 3R8QA 2QLYA 4HGMA 4X6BA 2VSKB 4HIJB 4JFDB 1G0XA 4LLDB 3ZKNC 3WXWL 3WO4B 1T1YA 1A7QL 2EDQA 1URZA 2FGWH 4HETA 2WNKA 3RVWD 3AACA 4GOSA 1RUKL 1G1CA 2V17H 5EEYA 1TIUA 2OXHA 1FPTL 5LGJB 1OTSC 4MXQD 3OKDA 4Q4EA 3V5DB 2UY6A 4CN6A 5TE6L 5ETUA 5J6GA 4JJHA 1BVKA 1D5RA 3PJSB 4L0PB 5TQ2L 2NSXA 2VDNH 4L18A 4XCFH 2QT6A 3LEYL 3SJVD 1PY0A 5HYJB 2ZXGA 4PWJA 4UQ9A 2ICEC 1EFXD 3S48A 1XF2B 1BYNA 4YHKH 2FO1A 3KJ4B 3BRFA 2F5BL 1NH6A 4YVNA 2CR0A 3A0OA 2CDGA 5C09A 8PAZA 2COQA 5A16A 4N0CC 4HLZG 2YFOA 4WFHD 3GMLA 4IW4C 2G5BB 1R3HB 1ZSDA 1R5WB 1ZANL 3K0YA 4PGZA 3CVBA 4HS6A 3AS0A 5IMLB 5DJZA 2DLGA 2NZ9C 5E8DH 3EO0A 4G72B 3RFZA 5GPRA 1B3IA 3JZ7A 2CJSA 4MXQC 1OTSD 4TV3A 1WBXB 3SN6N 3VI3E 2BIIA 4URKA 2YOAA 3TOPA 2KBGA 4WDIA 4BK8A 4P06A 4XMKL 4YHYB 2P43B 2Y2WA 2YSSB 4Y1AA 1CJYA 3BCFA 1MNUL 5I23A 3WNIA 4LSQL 3L5JA 3DLQR 2NY6C 4JQVC 2X9ZA 3W38A 2ADJA 4UQEA 1KB5B 4CW1A 3BPNB 4KTDL 4I1PA 4FQQB 3PLYA 5E2VH 4B9PA 4MAYB 1Z5HA 1AZCA 1PY4A 3OXSB 5E9NA 4KUZH 1HE8A 5EPMB 1KB5A 1CFSB 2Y0SA 3BXNA 4NRZB 5ANMA 3FO0L 3NSCA 3SKNA 4JUTA 4C47A 1L9SA 3UAAA 3QZOA 3KWUA 3PHOA 5CU5A 5ABAA 4HCRH 1PDKA 2DQHH 5EIIA 2APXA 1X4YA 4BSWB 1WICA 4JDEB 3UJJL 1AQKH 3DSNB 5KAQF 4QXUL 1RERA 1WZKA 3V0DA 2PXYA 2CAKA 4HFWA 3BDYL 2H0PA 3F64A 2VDQL 3SY0A 4Z7IA 2WO4A 1TR7A 1MREH 1WAAE 4YDJB 3ZX1A 4CU6A 3EO1A 3MROA 1LE9A 2AXJA 4J6RL 3RQ3A 2Y36H 2NXZC 5DJ2B 3MXVH 3TO4A 4D9RD 1MKFA 1UKQA 3TTSA 2V6HA 1SLXA 1GC1H 2VT0A 1L5GA 1QWNA 2AJVH 2QSVA 2E9BA 2YC1B 4FQIH 5EO0B 3UTSE 4A2EA 2X4SA 4PJFA 1M4KA 2E7MA 3B2UC 3FT4B 3UCRA 3HG4A 3O2WH 2GJ6E 5AKVA 1BZ8A 2J88H 5F7YC 1FNGA 1J8RA 1FYHB 3QJTB 2FEEL 4HG4K 5DJXA 1ZWIA 1GPOL 1YDPB 1KYFA 3BUTA 2WK2A 3QJHB 5EIIB 2EH7H 5KYXA 2H3NA 3H9SA 3ESNA 4AC4A 3OR6B 3IFLH 4KUZL 3MLXL 4LVNC 1Z9SA 4J6IA 3T2PA 1I1FB 4LVNB 5IK3A 1BFVL 2VZVA 2HJLB 2BS9A 4OGYH 2WTPA 2OSYA 5MENE 4R5TA 3MLPA 4MBOA 3BAWA 4BFRA 1DQDH 3I84A 4HU2A 2Y69B 3DVFA 1JZ5A 3QEUB 4C56B 5C0EA 2PYED 4PSRA 2CO3A 1OHZA 3K7UA 4JPQA 1SUHA 4WUKH 4JG0H 2BW5A 5E7BA 2RCSL 4NWTL 4NQXA 4C4UA 1DDHA 3E9TA 1DQVA 1MVYA 2J5WA 5GGQL 4AL8C 5KJ7E 4C83A 1MH5A 5A3IC 4PB9L 4BFIA 3MRFB 3FOMA 3QJHA 3V6OE 1O6VA 1TEFA 5F1IA 1PKQB 1DDHB 1P4IH 1XCTA 3AT0A 3WXVL 5C0RH 1WGVA 1WUZA 1OARH 2V9UA 1IIKA 3OKOA 5EF0A 1N18A 1E6JH 4IMLA 4XO4A 2FR4B 3WS6A 1VACA 2WXOA 2KLRA 3ZN6A 5D7LA 5I6XC 1CD1B 3LMJL 1A1OB 1CDIA 3DRQB 4XPTH 4EE2A 4FJZA 3LEYH 1YLBB 1IE4A 4XXWA 3WN5A 4Y4KD 2Y4SA 4BRVA 1DLHB 2BIMA 2Q7NA 4P2CG 1X7QA 5DRNA 1MY7A 5HI4D 1RFDL 2VE6B 2VW6A 2X41A 4G71B 4IJTA 3HR5A 2XTLA 4QXVA 2NW2A 3O2VH 1FPTH 2R59A 2XKUA 4ZBJA 3U4KA 1KJ3L 3OLEA 4AL8H 4A2LA 1RZ8B 1FGNL 4GIAA 1RUKH 5D4JA 4OJEH 4MJ6A 4Q0XH 5GZNC 4HLEA 3OAUL 3J2PA 5FW7A 3W0WD 4NAJA 2W0FB 2F53A 2GC4C 1T7XA 3N40P 4K8RD 2YD2A 3VD3A 4ZAKC 1PJWA 5FYKU 3QUKA 1FFQA 5B3NA 1IVTA 3GNMH 1XIWA 2P3YA 1NEZG 3KNBB 3MCKA 4N8VA 5TF1L 5KVMC 3B9DA 2GSMB 4YHYC 5AENA 3HNVH 5L9DH 5IW6A 4C4KO 1HILB 4ZOEA 1KV3A 1SJMA 1YJDL 5KOMC 4JZJA 3MRJB 4TQ8A 3BKCH 4YSQA 1ZK5A 1XGTB 4ONGL 5I6PA 4I0CC 5DUPL 4N8UA 1Q72H 5DS8B 5SX4I 1AIFA 1AI1H 2YGOA 1MW1A 1SN5A 2NY0D 3O3EB 3C6EA 4HUUB 3IWUA 3NRPA 4TNVF 5L7XL 3JVGA 2UZIL 3U9PH 3SJVA 1W6WA 1T5KA 1IM3D 3B7SA 2Q7YA 5BRPA 1KNOA 1ADQH 1YMHA 5HVFB 3UPAA 3TZVC 1U3NA 4XPFH 3QZWA 2BP8B 3AS2A 1ICTA 4ERSL 2MFNA 4ODTH 2IDCA 3V6FB 5EU5A 4BFOA 4JFFE 3FUNA 3MV8B 1QLEH 1M7IB 5DUJA 4WO4D 3MI6A 2YSTA 4OM0L 3ZIMA 4HIHA 3CSFA 1IM9D 3HG2A 2ZF9A 4FG4A 2UWEA 3BAKA 2CNZA 43C9B 1HEJC 1DE4A 1JZEA 1TPXB 4WLCA 3G08A 4Y9EA 3H6JA 4F58H 5IVXF 2RHEA 1OP4A 3AGWA 1BMWA 2AQPA 3GINA 1OPGL 2UWEF 1FDLH 1F3DH 1YQVH 3MMEA 4K3EL 4LSUL 1RK1B 4GT7A 4DKAA 2W07A 4M8QA 4QT5A 1OOWA 4PJEB 4TPRH 5GS1A 3O41A 4LAQH 3DXAB 3QIUA 3OZLA 3NIDB 2XV2A 4HPOL 4YX2L 2WYZA 1Y1UA 1CR9L 3FC8A 3N44B 4X7TA 4JR9H 4DKEL 3OHXC 1TVBA 5L2JA 4UYQA 3DPBA 1T3FB 4XCCL 3LQAC 2WW8A 1CK0L 4NI6A 3WIIH 2F1BA 1MHHB 2AERT 4PJGE 3FQNA 4W9EC 5DLLA 1HDMA 4MAUH 1SMDA 2NXZB 1RIHH 2ZOKA 1S7UA 3PUUA 4PV9A 4WJKB 2J57A 2KZ1B 1GYWA 3O4LA 4HOZA 5E8OB 1CF8L 4BZYA 2W91A 3UTTD 4NYLA 2UZPA 1ZY9A 3G08B 1E5YA 4LHUD 3MN8A 3T3ME 2ZOKB 3F7PC 2D7QA 3L3KB 4ZO6A 4ZNCD 1NBZB 4XPGH 5DFWH 1F11A 3GI8L 3RDTC 2DQCH 2VDRL 1XB6A 4AW4A 5IOPA 1HESA 4UWQB 4M02A 4MMXA 1FVDA 4AG4H 2AXWA 1A0QL 2OP4H 4AQAB 1BVLA 3NPZB 4D9QE 1AGDB 5EZIH 3CZFA 5DVMA 4U1HA 2ENPA 5C0CE 5C08A 3NN8A 1LD9B 5F7BA 2AZUA 3LRSA 5B7EA 2JCWA 1H8NA 1KJMB 5HJGA 1BAWA 3RB7A 2WKOF 4MB5A 3H56A 2J1ZA 2ZUUA 3WTWA 4DQOL 2IJ0C 5I18L 1IKFL 2MPAH 5HVGB 1EJ6A 3U4BH 5CBEB 2WC7A 2NY7L 2YFNA 1D5MA 4QOKD 4EN3B 3PGCA 3BT0A 4L4VB 4EOWH 3C8KA 3QO0A 1G9EA 4RESB 3CZEA 5GS2D 2EO1A 1S3RA 4BFJA 3C8DA 2OLDA 2VO8A 4K71B 5B1CA 5AYUL 1ZSDB 3C09C 4GW4B 5B8CC 3MJ6A 3L3GB 1W72H 4Y16C 4I3GA 1S7RA 3LRKA 4LCCA 3PQYD 3GUTB 4LNRB 1MRCH 4WNQB 2VN4A 3OZ9L 1UD8A 2MCG1 4YQXL 2BRRH 1B4LA 4B5ZA 4Q9QL 1UVQA 1HCVA 2BINA 1DSWA 4LCWA 1VB9A 4UB0L 2BOBA 1KJVB 3H9HA 1HI6A 4UOW1 1IFHH 3STLA 2HMID 4GXUM 3Q7JA 3QIUD 3E2HC 4XNYL 1ZHBA 5D7IF 5I0DA 1NKOA 1RD6A 1SY6H 3MDJA 3MUUA 5D5MF 5BQ7A 4PWKA 2NTFA 2VAAA 1NUGA 2WJ5A 3MRHB 4G3YL 3P4NA 4NUPA 1LK3H 3SKNB 4EKJA 4W9DC 4AJWA 2NQ3A 1Y0LA 5D4QA 2ADFL 4B0MM 4R5XA 5BQ7B 2Z31C 3C5ZB 3AABA 1UXWA 4QTIL 3VACA 1E2VA 2ZNXA 1TQBC 3KLAA 1C8PA 4X99B 1QOKA 4NUGH 4BK5C 3FHQA 3B2MA 4MAYD 3ESPA 4JFQB 3TJEL 4ZUSA 4P4RB 2HRHA 4Z7NE 2DM7A 4HDIB 1QUNA 3TA3D 4G7YH 1UVQB 3JZYA 4LMQE 2MCPH 1PIFA 2UY6B 4J3OC 3UMTA 1P6FA 6CGTA 2C3VA 4P48A 5DYFA 2JJUA 4HKJB 4ISVA 4OF5A 5F1NA 4OFIA 5KBMA 2ZSWB 2I07A 3LIZA 3VXNA 2YA0A 4KZEH 1S78D 2VRQA 1UG9A 4RNRA 4Z6AT 4ZODA 1T20B 1JXDA 2ZSWA 1RZ7H 2NDGA 3B6SA 3FULA 2AVGA 4GY4A 5M95B 2X6CA 2XPYA 4CC0A 1RSYA 3HI5H 1GW0A 2WVVA 1I4FB 5BRZA 1QRKA 3QXWA 3QEGL 4P4RA 1UEMA 5B1KA 2YMTA 2WVVB 3C6LD 1R46A 4P3WA 4YWGL 1K4DA 4PRIA 4BD4A 1JYVA 4LBEA 4C4KT 3KYNA 2WOBA 1S4IA 3N43B 5FOBB 1CE1H 3N1PC 2XOTA 1N5AB 4UQ2A 4Z3TA 5ANHA 2ARJQ 3RYMA 3Q5TA 3LH2L 3RDTB 1QSFE 2K3HA 1UH2A 4Q74A 4WI5A 5AZEL 4N2LA 2VXUH 4MB4A 4JDVA 4MS6A 2X88A 2AK4B 3FTSA 2DI7A 1KOAA 4FFZA 5EULV 3EH4B 4OZIA 4JY5L 5BS0B 2P28B 4FLOA 5ANME 2E8ZA 1G1KA 4FQJL 2DWDA 4HSQA 4YJZL 1FP5A 1KSRA 2R29A 1M9SA 2NXYD 1ES0A 1MAML 3L4VA 1VIWA 2Q3AA 4O2EA 4XP1L 5DK3A 5EBMA 3WMPA 3ZMRA 1UT1A 4AXWB 4NQDA 1EHAA 3FXIC 1QG3A 3OM3B 3MCLL 3CFIC 5F7WC 4YDIH 5ACZB 5KVFH 4C58B 1OSZA 3LB6C 4DK5A 4KRPB 3LHPH 3PV7A 2N7BA 4D0DB 4GQQA 4ZUTA 4ANUA 1G84A 2WQAA 1A6ZB 2XG5B 3LN5A 2MQCA 4KRMB 5G4MA 4ONFL 1DJXA 4OZ4A 5D2NE 1F1AA 3MRMB 1RZIB 3QH3B 1BJ8A 5FA3A 3LPWA 5JW5A 5ECGA 2ICWI 3H0TA 2OULB 1HN1A 1PKQA 2KZBA 4YGVA 1PZSA 2BO0A 2J88L 3DK0A 3NZ8B 5DJXB 3AS1A 4AH2A 5MI0B 1AKJA 2Y07L 3PAVA 5B38A 3LEVL 3TPKA 3KLLA 1OK8A 4XCFL 4ZS7H 1JDDA 4WJ5A 4YGVB 5C1MB 3LQZA 5HGDA 4QF1A 1MCDA 4W9LC 3D25B 4F37F 4YDNA 1GOHA 3I6LE 5GHWL 1B0WA 3TZVB 4QAWA 3L3JB 3W0WB 3BOVA 1FUNA 4YHIB 1EJOH 2JJSA 3CN0A 2ZCLL 4UT7L 3KWWA 3SB3A 3GPEA 2XZQH 1YAIA 1QNZL 2CBOA 3GS0A 3D3VA 3N06B 3OGCB 2FIKA 4JFHE 1UD6A 3HG1D 3HLAA 4TOYL 5GISL 3RNKB 3A22A 3KPRA 3BWUF 4YXKH 3SDCA 4DUVA 3EH5B 5LHDA 1WIPA 2BZDA 4DTGH 1PY9A 2GITA 5EORL 2OTUB 4YBLC 2MKLC 4JHUA 3QT2A 3C09B 3BH4A 2YHGA 3T6ZA 1Y6KR 4DGVL 2BVYA 4NCC2 3CLEH 1CPUA 1FAIH 3QG6B 4I18C 4X8XA 3PJLA 3BUQA 4DP7X 1TKWB 1ESOA 3BAEH 5DC4B 1YN7B 1MAKA 4Z0XA 4LIQL 35C8H 5BO1L 1U95A 4OLWH 1NDGB 1ZJAA 1O9VA 3LD8C 4KKPA 1CD1A 4DAGH 2A9MH 1VPOH 1NCCL 1P5UC 2XRAH 1F11B 5EU7E 4BSVA 3U82B 1NDGA 1AXIB 4KK8C 1OF2B 4QHMB 4DT2A 1DBKH 2Z4QB 3QIBA 2YWYA 3QUXD 4GUPB 3BWAA 3QAQA 4ZUWB 3MTRA 3ROLA 5HYEA 1YMHB 1KNOB 5J9PA 1RZ8A 1ZIAA 4V1DE 4Y1SA 1MCHA 3A6CH 4O4YH 1BM3H 1IAII 3CGTA 2X1XR 4G7QB 5C0JA 2ADGB 2NNXA 1IQDB 1J88A 1E3FA 1JTTA 1J48A 2Z7YA 1YYCA 3OLIA 1J9QA 1MFAH 1XH3B 1AMYA 4FA7B 2SODB 4LVOB 4XXCA 1DVZA 1RJCA 1MJUL 1AGCB 3FO1B 3ZSSA 2W60B 1FZMB 4BGLA 2XZAL 3U9UB 1JZFA 5GHWH 4M5YL 4V1DA 5ISZD 2H1XA 5K9OB 4ZUUB 1OPOA 3DOIA 3FCGA 2F7QA 3FOLB 2ZP8A 1RU9L 2IOOA 4H8WL 2RFXA 2XBDA 3QVAA 3ZO9A 4ODSL 4ZT1A 2HFGL 2VXVH 5JZ7D 3S3BB 4RMTA 4YIQA 1I3VA 3FYEB 2ITCA 3GQFA 3LPFA 4GUOA 2NXYC 5AOLA 3FNKA 1PZ5B 5F97E 3BJLA 3WJMB 5AB9A 3MV9D 1T3FA 1IGFH 1KYDA 1UXMA 4GQPH 1KPRA 3V0VB 1LWRA 1XB8A 3P0VH 4DGWC 4HC1H 4MMZC 4EVNA 1Q8MA 1A6PA 4PGEB 1MZYA 5EWIH 2R7EB 2VOTA 1QBLL 2QADD 3VXUA 4ACTA 5HPOA 2EVJA 3ZDYE 3F83A 1QZNA 1J9SA 1TJHH 2WTRB 2WZ0A 4TULL 3PL6A 5DMGC 4I2XA 1T80A 4KJYA 3FJTA 4XNQB 3N1FC 2CJTA 1VA9A 43CAA 5D5MB 4KI5E 1Z9NA 3LKPB 2CQVA 1VLXA 2YGVA 4HV8B 1DDTA 1EJOL 1EJ8A 3PGCB 5KJ4A 5JIHA 1B0RA 4QD2E 2E7HA 4KKNA 1IAKB 3HEIB 5CFAA 5J13B 2WD0A 4ZX3A 1IZJA 3V4UL 1XSIA 1A1NA 5FCSH 3ZSTA 4F37K 3L1OL 1PG7H 2N0MA 1KB9J 2EABA 3ZKSD 3KPLA 3WV0A 5J6SA 5I30L 2Z8SA 4WEEA 2JCCF 3VGFA 1NGQL 2XWXA 3AW5A 4M5YH 5K9JL 1KTDA 3ISWA 3B2XA 4QRFA 3WTVA 5CBEA 2YXVA 2W92A 1CFTA 2CGZA 3TWCL 3WMSA 2QELA 4XH2A 1BMZA 3PJSA 2DQTH 2BDNH 5DQ9B 3W81A 5EN2A 1SLWA 4BFGA 2BSCA 2DQGH 2EH8L 3AITA 4QY8A 4ABQA 5JW3H 5K5YA 1KYAA 5FDYA 2F74A 1RHFA 2JJVA 4N2IA 1T0NB 2B14A 3QZWG 2XTJB 3K8KA 4OSUL 3TA3C 3QQ9D 3O11B 1JJUA 4MAYC 2H1PH 2DI8A 1H19A 2X1OA 5I15H 1IARB 2BWIA 5LN4A 4APQC 2Z31D 4PJIE 5E6RB 1AGDA 4M7JL 1KWGA 1I1AD 4JQXC 2EXWC 2APBA 5AW0B 1DQJB 2IPTH 3WUWA 2GBVA 4K9EC 3DETC 4ELMF 2WLZA 3TO4B 2J6WA 4R5VA 1MHCA 3T6XA 1OM3H 4XPFL 1H5BB 1CTOA 1HXYB 2VDPL 2E46A 2JQAA 4ANVA 2FJGB 3QIUC 1SYVB 1RUQH 2H26A 1FBIL 3D06A 4FTDA 4ZUVA 2OYMA 2UZIH 5MEOB 5SWSB 1L9OA 1FAIL 1I3UA 5CLYA 1XF4A 3MNVB 4BELD 4NNPL 1UD4A 5IF0B 3IDMA 1I9EA 5EZPA 2ITEA 3SCMD 3VM5A 3QS2A 4R3SB 5AOKA 3D85D 1HL9A 4R7NB 3DROB 1CXLA 1BZ7B 4OCXL 3G9AB 3HPJA 4IRZH 2WKLA 5HHOA 2VISA 3Q0HA 3NT0A 2WCPA 4AENA 4JFXA 3NUKA 3ZZQA 4AEHL 1MG2C 4HFWB 5E23A 2PCFB 3HAEH 5E1IA 2W9EH 3R0MA 4JRLA 4AYBA 4W4OC 4PREA 4JRXD 1JWSA 1KLGA 4OFYD 3WKMH 4EXKA 2OMXB 2DQFA 4GBXC 3HI6L 3MLYL 4BK5A 5BW7C 1UYWH 1XGYH 1VZHA 5C2BH 4ZUVB 2OSLB 4P9MH 2QJDA 1HXKA 3V0GA 2BP0B 3LSOB 1FSKB 4Q6IC 5HHPA 1JERA 4Q6KA 3BZFA 4LHUG 5IVZB 4KK6D 4HUVB 1UKSA 3K80A 2FT6A 1G1YA 3L7FB 3L17A 4MQSB 2ZXWB 3KPMB 4WUUB 5E5MB 5EU4B 4JRXE 1S7XB 1MWAB 4D9RE 1JZ7A 5HHOB 1U9KA 4QEGA 1KELH 4D9LL 4YXHL 2ERJC 4Z3FA 4Y8DC 2EIZA 4KAQH 4QTIH 3RDTD 1EEZA 2WYHA 2XWRA 4P9ML 5SWZE 4HKXA 4MCZA 1T03H 5ACLA 1NFIB 2HYMA 3MCLH 1HS6A 2JB5H 3RBGA 1TENA 2VLRA 1ZK9A 3L3OA 3PWNB 3KVQA 4AI7A 4DK3A 5AOMA 1UFUA 2OMXA 4ANKA 3D30A 3S88H 2XIDA 2X4SB 4KXAA 4BZ1L 5I8OH 4IK7A 2E4FA 2VZTA 4Y2DB 1PLGH 4LSPH 3O0RH 5DD5L 4PRHB 4HGWB 1E8ZA 1LWHA 3APDA 5FM5O 4YC2C 3QEUA 2PP9A 4CMMA 3LSOA 5EUOA 2K4WA 1T1WB 1HAWA 4X6EB 2OMYA 1Z3GH 3CFJB 4XNXL 2ZUQC 3LQAH 3WFDL 5E6YA 2GIXA 3NCXA 2X4OB 3CXFA 1Z9SB 1I8MB 4JFWA 3UTZB 1RZJH 4U1LB 1DYZA 3QZPA 1WITA 2D7OA 4NGHL 4ZJ9A 2VXSH 4U31A 5LDUA 1QFUH 1JCVA 1ODUA 3GTNA 2NY6B 2XTJE 1AACA 1OM3L 1SM3L 2GUOA 5JW4Q 5DDHA 4ORGB 5D1XA 5ADPL 3V2AR 5CEXA 1QW9A 4B3EA 2DMHA 3GIVB 2H2PC 2K3TA 1U21A 3WIHL 3IGUA 2X4NA 4Y1AD 1D5XB 3ILQD 4QO1B 1TLKA 3TGXA 4H0IA 2ZIDA 3WHXA 3VXPA 3ZE1B 3TZVD 2H0EA 1QAWA 1QO3A 4L9LA 4WJ5B 3OKOB 4E5XG 4H1LG 1QI3A 4GRMB 3WENA 1BGXH 4PJ5D 4F91B 3I6GA 2VZSA 1G94A 5E6SB 5JPMC 4I0PC 5IQ7H 1X7SA 4AVIA 3QIBD 1GS8A 2FX7H 3JV4B 5HYSG 1ES0B 1SEBB 2NQCA 3NP4A 4NZTH 1PFOA 2H4EA 5IFAH 1BZ9A 1U3HD 4NN7B 43C9A 2F54E 1FIGH 1NOAA 2XFXA 4OCYH 1M7DB 4FXGA 1GC1C 2FIKB 2FJFA 5DHMC 1CICA 1RMFH 3QBTB 3IRCA 3QFJA 2XWTB 4X5PA 5EUOE 1V55B 1JV5A 1A6ZA 3GBEA 3K6SB 4GXUN 1AQDB 4OD2A 2DQUL 1BXAA 2A6JB 2KH2B 2PTTB 3P9LB 2Y5QA 4HCIA 5FGSA 3X13B 5CUSL 3US9A 3VW3H 3IE4A 4GRWH 3SE4A 1BQRA 1TJIL 3UX9B 1KXQA 1OCRB 1IC4L 3HFML 5AG9A 3U1SH 2ZKWA 4PHZA 5KS9A 4TNEA 5KVEL 1LNUA 2PW2B 3UTPE 3HJEA 3HMXL 4ZMPA 4R0LC 1F58H 3NCYS 2CBTA 5I1IL 4U1IA 4HWBA 4AGMA 3QDGA 2WCSA 5BXFA 4HK3N 5C8JB 1Q1JL 3IKCA 4HVBA 3SE3C 4M5SA 1YJDH 2VC2H 4TL5A 1MEXH 1R3IH 3GMPB 4KJQD 2OJZH 1SOXA 3DIFB 1K6QH 4Y4KC 4ZQKB 1MRCL 5IB2A 5C0AA 5LGHL 3I02A 4QRPE 1CLOH 4I9XA 1IAOA 3MUGA 1OTUC 4OKVB 4FQ1H 4KXZI 2K70A 4UNVA 2V4LA 1VCAA 4OUOA 3CPLA 1NC2A 4UQ3A 4M3JA 3D4YA 1JHLL 5CJ5A 1ET8A 2ITCB 4JFPA 3RAJL 3ZU8A 1F13A 3BSZH 1JAEA 3FUHA 4QKTA 4PCSA 2FECI 3DWTA 2YN3A 4FQXB 3F00A 2GJZB 1AY1H 2ZKHL 5A40E 2XY2A 3ULUH 3SGKA 1BZDA 4NC2B 5HGHA 3WELA 1I1CA 2VL5A 1TFHA 5AW6B 2Z8VC 4LEEA 3L4TA 5ENWA 5HD8D 5LDSA 1EX0A 3HW7A 3VI3F 4LKXA 3L2LA 4FFVD 4Q9RL 3BPLC 3MVSA 4YAQA 4L3CB 4S1RL 3GXDA 3SBWA 2G5UA 4WWKA 2CDFB 3GMLB 2WQVA 5IG7B 4BYHA 4I2XB 3T0AA 4DETA 2GBUA 3VVVA 1VADB 4MWFB 1BVOA 4CC4C 1PG7W 3I02B 4JKKA 3TTYA 4YAQB 2V7NA 4E41E 4OI9A 2R51A 2D4DA 2APFA 3GMQB 1FORL 4PLJD 4Q52A 5IOKA 4M8QB 4QT5B 4LVHC 5GGTH 1FNSL 3GHPA 4S0SD 1FC2D 4TUJA 3SQBB 2J4WH 5D1QA 2WUBL 3DJZA 3V52H 2Y7LA 4KPHH 3QRGH 4Z7WA 2XIIA 3MJ7B 3SY6A 1GL4B 2ITDB 5I1AA 3WTYA 3Q05A 3OSVA 4YFEA 1C8QA 2Z8WC 2JK5B 2Q6WB 2C26A 25C8L 4JPVH 4F24A 4NXSA 1ZTXE 2ZUVA 1D6EB 3RI5K 3QIWA 3W11C 3MSPA 2JKXA 1J7VR 1PX4A 3MR9A 4YZWA 2DBLL 3BW9A 2WVUA 4WWKB 4KY2A 4U4BA 5F3BA 3DIVA 3L5XH 4JO3H 4FQ2H 1XGZA 2RGSA 4HMDA 5J1AA 4DUXA 3JWNE 3L3HB 1BBJA 1YMME 1UASA 1JI2A 3O8XD 5AAWA 1VEMA 4KKAD 4DP9X 2QGBA 1YO4A 4EN3A 4A04A 1SVZA 3ALXA 3EOTH 3L16A 2YD0A 3QO0B 4ZFZA 3QDJD 3V5DA 1DBAH 2CHDA 2WLIB 3OBAA 5FHAH 2BW4A 2XZAH 1M2OA 5DVOA 5EU6E 4PTTB 4OV6F 3O6LL 4KKRA 1NCTA 3LRSB 3CDZA 5DZLA 4WFFD 3T8XA 1E5UI 3T65B 2BNQB 5HGAA 3O2DA 2VLKD 2A4EA 4JY6A 3TNNB 1KGJA 4FKEA 4Z3JA 1SDDB 1S9KC 1AJ7H 3B9AA 5I1DA 2OMTA 1JN6A 3EYUL 3L45A 4R26L 2MEJB 1X4XA 2WZ5A 1MCCA 3CIAA 3WFEL 1L0XA 3B9KC 1RZ7L 2QMKA 4FFYA 2AMUA 4POZC 2XWBA 1XCWA 4Q6YA 2NYZA 5ABZA 1I1AB 3G6AB 5FO9A 5H37H 3WI9A 3ZKXB 5E6IB 2D03H 3JWDL 4L0YA 1ZV2A 5AW9B 4UIMA 1AKPA 1OAZH 5ABDE 1IBYA 3VFTA 1KMGA 1OCCB 5HDRA 5HI5D 3Q8AA 1A7QH 1ACCA 2YKLL 5C3TA 5B3JF 1HSAA 1YG9A 3GUTA 4HH8A 1WO2A 4XCEB 3VTMA 4D0CA 4A7SA 4DERA 4FFZL 5ID1A 3EOAB 2BWQA 1FVEA 2YLHA 4AENB 2FZ3B 2YO3A 2DIJA 1VAHA 4FI7A 4FXKA 4XCEA 4D0CB 1NDTA 4JJOA 4RETB 3QYCA 2C1OB 2E0PA 4JO8A 4X7CC 1NSNL 1TQBB 5AKTA 3D85B 4MGXA 4PRHA 3F3HA 3OF6A 4RGNB 4U1SB 1BJ1H 4QYOA 1HXMA 4KGLA 4FOMA 4OQTH 4O58L 1LK3L 5E2UH 3JTTA 4HS3A 5F88B 3S4SB 2HH0L 4OZIB 3K2MC 4TN9A 3VXME 4MSWA 4JPKH 3UJIH 4KH9A 1JPSL 1TZIA 2X4OA 1O75A 3EYUH 4A68A 3QGVA 1O6SB 1JNHA 1PBYA 4PJ8D 2VDML 4FXKC 5T8IA 2ORBL 3NSJA 3KVDD 3ZKND 3HG1E 3ULUF 1XF5A 4KOCA 3QIWC 2Y6SD 5KVGH 3WEBA 4BV1A 3AY2A 5IK3B 4GG6F 2IANA 2NYKA 4FLRA 1ZGLB 2X6VA 2X09A 4HXBL 3VXMA 4OZGF 5A7EA 3MODH 3O2DL 1MJUH 4F80A 3FS9A 5EO1A 2YPLB 5HHPB 2YQGA 1SYVA 1JHTB 2VJ8A 5IHBA 1YDPA 3WL9A 2H6PB 5E2VL 5C08D 5C70A 2R2BA 4PEEA 1FL6B 3ZE0F 2VDOB 5IWLC 4F7KA 3MNZB 3H3PH 3MJ8B 3M07A 4L29A 3FT0A 2G2PA 3IDJB 1ZXKA 3RWCA 2OMYB 3C5JB 1JK9B 3CFJA 3LS5L 1ZS8A 3QI9B 4DQOH 4OLYL 3UTTB 3P3UA 3UADA 3PGFL 4O58H 1AZUA 5E6ZA 4PN6A 3ABMB 2J3SA 5IMKB 2DTMH 4DN3L 1IKNC 1K4DB 2GKIA 2XNAA 3PWPB 2Q8AL 1RZPA 1I75A 1B4RA 3FUDA 5GJSL 1WTLA 2VITA 4JG1H 1F8TH 3FRUB 1UXSA 2R0LH 1R75A 3BCDA 4NZFA 5I1GH 4XP4H 3WIFB 3HI1B 4DO5A 4B5EA 4AEEA 2CO2A 3DTUB 5JIPA 5F2FA 2O4EA 3X3GL 1KPUB 4PS8A 4F5CA 4G7YL 1OE1A 1KGCE 5D6CA 5GQBA 1EEQA 4MJ5B 1QBMH 4WU5B 1F3JB 3VH8B 1L6ZA 2H6PA 4MX7A 5FO7B 4ELMA 3ARFD 3HI1A 5I6NA 3ARBC 4N8CH 3TESA 1P7QB 2AXFB 3DVIA 2VLJB 4X7DC 3ABGA 1T1ZA 3VFMB 3QRFM 2IQ9H 2J20A 3US1A 2PO6D 1H3VA 1ZCRA 5IB3A 1PG7X 2IH9A 1XSJA 3NZHL 2MRYA 5JOPE 4ZFQA 2OM5A 1YEHH 4LBAA 3DVNB 3GHEH 2J5LC 2AJZA 3EHBC 4XCCH 1T04B 1V3MA 4JANA 3OHXB 2IOMA 3QAZB 3ZRFC 1B6DA 2CLVB 1WEJH 4P49A 2MNWA 5C07E 2F58L 4K7PY 5DUBA 1M7DA 3CVDA 4M8UA 4YL9A 5D2NA 1JPFA 5FW8A 3NIFB 1U6AL 4MHHI 1IU1A 3G5VB 3VXSB 4XPAH 3AJ7A 3GO1H 1YMMA 2AP2A 4JO5A 3LJ3A 3A6CL 2A6JA 5ES4B 2OJ1A 2VLRD 4D8PB 4GRMA 5I0WA 1TPXC 3NEEA 4WEBH 2X7LB 1XIWB 3O6KL 5FGRA 4H2AA 4P9HC 4NQDE 1HEZA 1X5JA 1NL0L 2D2CC 1DSFL 3W39A 5B39B 1L9NA 2KDYA 3QNZB 1CDCA 2HKAA 1P53A 4NZ8A 5I8KL 5DQJA 4KO7A 1A7PL 4IOIB 2BY0A 1T83A 3ZKMD 2W94A 1OAQL 1Z6JT 4P2AA 2I27N 5GRZA 3V0AC 1XVSA 3T0EC 4WJG3 1V5JA 3E1F1 3WFCL 3NAAL 3KS0H 3RKPA 4JW3A 5T1MA 1KUMA 5IJVA 4KPHL 4Y5XA 3FT9A 1BIHA 3SYOA 1D7FA 2RTTA 4NQCE 4WAFA 1LDPH 2X05A 2L4OA 4PJXF 2J2ZA 1WZ1H 5DT1L 4OZHF 1EEYB 2CCWA 3MLWL 4U1NA 3VWKA 4XVJH 4XN4A 1P4UA 5F1SA 2B0SL 3WEXB 1S9XA 1XL4A 3CFKB 1U58A 5BZWA 1OAUH 3II2A 3QQ3B 2W0FA 3JWNG 4HC1A 4EVNB 1FGVL 2F7IA 5BRZE 3DI2B 3M6DA 1NMAH 2YEQA 3C87A 1E8YA 2BWDA 2AGJL 4YHOH 1KYOJ 2QKIC 4AQOA 3FB8A 4A2FA 2PP8A 3VSQA 3P11H 4L4VA 3F7LA 3B5TA 2F8VA 5DJ0B 3P9WB 2HUEA 5MHSD 5MEQB 1GTFA 1ADWA 4ZMTA 2KPNA 3OPUA 4ZS7L 1TQVA 5L2KD 1NBYB 1JZDC 3QEQD 4QRPA 1EMTL 4H8HA 2FO4B 4QRRD 3FT1A 1WS8A 2FGWL 2Q20A 2V7NB 4KXCA 2EDDA 5C9JA 4FP8H 3RHWF 4OLWL 4YOKA 3SDXA 3VWKB 5FS5A 4KO5A 4MVBC 2EDLA 1N8ZA 4LEOB 4PJCE 1VFMA 3AS3A 3CC1A 2A9DA 4JFUA 3RY4A 1EHLH 1UT2A 4G6AC 1KENH 3NJKA 4F7CB 2VTFA 3CK0L 1BVKB 4W81A 1PGRB 2YGPA 4H8WC 4NT6B 4AEFA 5ENWB 3DV4A 1MW2A 1V54B 4HKZB 1G7MA 5E2WH 1K5NA 3D18B 1LK2A 1U8MA 1XQ4A 3ARPA 3HG0A 4HQQH 4MD5A 5DJ8B 1U2CA 3P0YL 4ZXBD 3RGHA 3SBPA 5CHNA 1CLYL 3BN9D 2WBWB 5AQ0A 4XH2B 2C9VA 3WFDH 4NT6A 1P4IL 3IGAA 4E41A 3HMXH 4XOBA 5GGRB 3QXAB 4L3EB 4Z5RB 4Z3IA 2VR5A 4DP1X 4KX9A 5BS0D 1LEIB 1Q1PA 3HLKA 4UT9L 1ACXA 1XGQB 4N1EA 2VXTH 3NIGE 4P46C 3O4LD 5GGQH 1A3LL 1II4E 4XBEH 4IBUA 3S3JA 1TQWA 2CKBH 4B6ZA 5DJZB 2RR3A 2XWCA 4LCIH 1CIUA 5M94B 1KLUB 2ATKB 2G75A 3HE7D 4PRPD 1P4BL 4G8GD 1RK1A 3VD0A 2AEIT 4UB0H 4P2OA 4JFZL 2WHVA 4RGOH 4JM2C 1A4JA 1TDQA 5KANI 1XR9A 3F8UB 5AUMA 1UATA 3AY4A 2D7PA 2WXMA 2Z92A 3ZDXB 4R7XA 3P69A 4P04A 3QFGA 4XVOA 2V37A 2I24N 2PYFB 3D18A 4MD5B 2ITFA 3DBSA 3MTXA 4RFOH 4ZSOA 4XN5A 3CZSA 5DFTA 1HXMB 2P7TB 4IBLT 1W0YT 5T1LA 4HPYL 3A6BH 2RIKA 5CO1A 1OWWA 2WP3O 3L9BA 3FF8A 3MUY1 3I50H 4M7KH 4EI6B 2GTWA 2NSMA 3FN0H 4UV7L 1ED3B 1J1OH 3QZMA 1KGWA 4OB5H 1UURA 2XN9D 2RBLA 3NMEA 3HC0A 4BA8A 4WO4A 1O6SA 3HI6H 1ZTXL 4JNXA 2NW3B 2PXYB 5IOPB 1CBJA 5JQIB 4XXCC 1TZGL 3QQ4B 3OKLB 1RZJC 2YBRB 4PIRF 2X1QA 4LK4A 2CD0A 2NNAB 3QCUL 1YEIH 5J0BA 5HDWA 2PYFA 4PIBA 4EZLA 2GHZA 1VEOA 3BP5A 2X3AA 1BVNP 1J1XL 1RPKA 3JYBA 3UP6A 1QLRA 4CN4A 2DIAA 1V05A 4FQHA 3QJRB 2I69A 3DTXA 1A6WH 2QR0A 4X9YA 5EN2B 4PH8A 1GA2A 2C1OA 2EEBA 5GRYA 2CDGB 3FFCE 4GAGH 3X3FL 2X10A 2V3DA 2A6KA 2OMVA 4H20L 2XV3A 3PP3K 1EIBA 1HWGB 1Y0LB 3Q5YA 4HD5A 4Y5VB 5KUMA 1RZJL 3DTXB 4XZUA 2QPEB 3QISA 3B3BA 3LKRA 5ICZB 3F7YB 5DURD 1H6UA 2QQLL 2QTEA 3ETBJ 5MEOA 1XO8A 2XA8L 4YWGH 5EU7C 3TCTA 1TZHA 2C1PA 4PHXA 1QD0A 4O2FB 2VXQL 3GF8A 3UTTA 4AKQA 1IJ9A 4JVUA 3PXLA 4M43L 4N0YL 1OSPH 3BPNC 2ZKHH 5ICYB 4QRSB 2A4ZA 4H7VA 4FGMA 2Q86B 2WLIA 1E4XI 1HHKA 3FTGA 3VB8A 4LCVA 4L8BB 1I7TB 2E7DA 4J3TA 4AM0Q 3MV9E 1JGLH 4YGAB 3VDAA 3QCVL 3VMPA 4HFUL 3AG1B 4FEIA 4LSSH 3MO1B 5D7IB 4G6MH 1MVFA 4RMSA 1OPGH 4K3EH 5I1DB 3IFOA 1FF5A 2Z1PA 3EIFA 2XUWA 4XOAA 3CBKB 3UOAB 1FQ9C 2WMPB 4N4YB 4RZCB 5EO0A 3RVUC 1YNKH 2OMWA 1MEXL 2F9BT 4G9FE 5D7JB 5AOZA 4BEIA 4GXVH 3TBVA 3I6KA 3ZQXA 1BBDH 3WEAA 2BDNL 5E95B 3NJIA 4OT1H 2ESVD 2XWDA 4X6CE 3KJ4C 2DL9A 2EDTA 2DWDB 4GIOA 2VUOA 1T4KA 1BF8A 2VLJE 1YYMH 3BVWA 2UVFA 3N85L 4PRNA 1IVLA 2J1KA 2VZ3A 2YPLD 3QHTC 5I6LA 4JHAH 4LP5A 5TDNA 1TTCA 4I8DA 3VW3L 3WXVH 3AREB 5C0RL 3BIKB 1I1FA 2P5EE 3KLSA 2XPGB 5D4IA 5TQ0L 1JTPA 2CRMA 5JHDB 1KGXA 1QTSA 3B2VH 1JNNL 3GZOA 3T0ED 3V4VA 1USQA 2DQ6A 2OXGB 3ATBA 1LQBC 4XP6H 4BCYA 3MV9B 2O5YH 5F7HA 1R1CA 4WWID 5FFGA 2R1YA 4OCSL 3G04A 2CHNA 4ODVL 3BKCL 4PJDE 1AG6A 1Z9PA 4LCWD 3L3IA 4HWZA 4R4FL 3BN3B 2CKBB 2QSQA 2VSDA 3D0VA 4MD4A 4U7KA 1WUNT 5HI3D 5AVWB 1CE6B 4TSAL 4TKWA 3IMWA 4MA3B 3DX8B 5C0AD 3HE7A 4PRPA 1S7XA 4RMUA 1ID5I 3UERA 3QWRD 3EO9H 4F9LC 5CGYD 1LQSR 3QRBA 2A6IA 4M00A 2OI9C 5JYMA 1A7OL 2VO5A 2HSIA 3STZA 3IJ7A 2BHYA 4IMKA 1EEZB 4HEPG 4JZJB 3L6FA 1JOIA 2EYTB 3FO2B 4ZFGL 3O0LA 4X6DE 4WI0A 3MYZA 1XF5B 1OF2A 1L0PA 4ODXA 4QHMA 2HTLD 2IADB 1PS3A 4KTDH 5JHDA 4GAYB 3L6FB 3A6OA 2EQDA 2W80C 3VX1A 4O9HL 3M1OA 1MG3C 4MJ5A 1SOSA 3BAXA 3ETSA 3FHAA 4WU5A 4Y1TA 2VWEC 5HXMA 5T1JA 1S5HB 2PTTA 2WQUA 5FK9A 1QVOB 2CO7A 1MN4A 4RFEA 3HHRB 4AUUA 3ES6A 4EUPA 4BFIB 3ZTJH 4YPGB 4JEGB 5A7BA 5FYJL 3S4SG 5CN3A 1RIUL 1NMAL 5FYKH 2ZCKH 2V7HB 1DHKA 3G7TA 5DRZB 4BXVA 4D0BA 4N24A 5T1DH 1G6RB 4NQQA 4IBVA 3VXPB 4PJIA 5ALCL 3ARBD 1N3NA 1TZ8A 1DANT 1T04A 4J3VA 2OBGA 1YPZB 3T0XA 1N67A 4Y5YB 2C4FU 4NQSA 3CHRA 1Y7VA 1QSEE 4U1MB 4AJVA 4HUNB 4PJIB 4HOWA 3C60B 1CIDA 3PWPA 4WSKA 4MMZA 3P4LA 4JG0L 3ZDWA 1RXLA 3IK2A 4OI8A 2APSA 1HINH 1MELA 3QWNA 4NZUL 5FGBC 4RFNC 4HIIB 4TRPL 4IOSA 4JN2A 4GMTL 1RIHL 4ZUWA 1RUMH 5KBKA 1JZ2A 1SLVA 5E99H 4GIPD 1MF2H 3G5YB 1R5VA 4GSXA 1QBML 3DV4B 5DQJB 4AJYV 3V9FA 4B9GA 4ELDA 4RX4D 4WHTA 4X8JB 3ECUA 2BNRD 1AI1L 3HA0A 5DQDL 2VN5A 5EOQL 4EAEA 5EIIG 5EB9A 2ATAA 5IW6B 2FX8H 4FHBD 1CTMA 2A9CA 2Y7NA 2YKKA 3BLBA 4GI9A 3LPPA 5CZRA 4JGJA 2RMNA 1D5ZA 1FFNA 4RH4A 1B4TA 3LDBB 3U4AA 3B4NA 3U83A 4W9IC 1EV2E 3H9SD 5I8CA 5DS1A 1NAMA 4ZS6C 3IMVA 4N3UA 1B2YA 2PCYA 4W9JC 1VZGA 3BLPX 3ECQA 4I5BA 3QC5X 4N5ED 5I26A 2BOCA 3EGDB 5EOQH 3UG4A 5I1CL 4UTCA 3Q2NA 3QULA 1BDYA 3HAEG 5AUMB 3WAJA 1X6NA 3DX6A 4YHKL 4U1HB 1C5BL 2K9FB 5ITFB 1Z0MA 4G42B 3PHQA 4S1SH 4Y9GA 4X7TB 1W0VB 1NZRA 1K9TA 2R0ZH 3QPXH 1UADC 2GPZA 5FF6B 1HL5A 3BP6A 1BYOA 1JDAA 3KG5A 4KY1L 2WBJB 3D07A 2EC9U 3D6GA 3HZYA 4APQA 2O5ZL 5F70A 4OY9A 3VFVA 4F5CE 2A77L 4ZQKA 4UT6H 1JPTH 4WUUD 2ZWNA 1ZIBA 3IF1A 4FQCH 5I19H 4XWOC 2DS4A 3G6JA 3QJOA 1U41A 3LZLA 4TUKH 2V3FA 3FU0A 3SQOH 4ICWA 1KBPA 1BD2A 1XAUA 4OGZA 1I7UB 1QMUA 5B1AB 1CDHA 4YR6A 1BX2A 4O4YL 4DGIL 4JMXA 4XGZB 4MASA 5CIPH 2WKOA 1IB5A 2WV3A 3EUDA 3NJVA 4Y4HB 3CHPA 2VZUA 4YDIL 4NAMA 2ZXCA 3UGUA 1N8OE 2WXHA 3ZY7A 4KJWC 4I89A 3ZUCA 3QHZH 1XH3A 5IMMB 1ID2A 4G1MA 4JS7A 4QRQA 4YNYA 5TE4L 4NN6C 4B9IA 1TTFA 2K6ZA 2XQYK 2WXQA 4NYLB 1GSKA 1S3KL 3EG9A 1ASQA 5C0BD 5KYUA 1XAKA 2I5YL 2YMXL 1JPTL 3MZTA 4JDEA 1TZHB 2C1PB 1AHWB 4AX3A 3BWUC 3WMQA 2VDOH 2SEBA 3JWDH 3QK0A 3D3VE 5D7LD 1BVLB 3HNSL 4PI2A 5IROA 1DCEA 1FNSH 2NY2B 3TYGH 1NBCA 5EORH 1E43A 4PPTA 4W6WB 2WWOA 2C4FT 5JIKA 4KKAC 3WO3B 3M86A 3O8XC 3DO3A 4NKMB 2OYLA 3WUWB 5I74B 3S36X 4NKQB 1QI5A 4YDVB 4QNPF 1T7ZA 2TSAA 3WY4A 3GSNA 4NRYA 2H2SD 1KDIA 3DNKA 1CGSL 2CR3A 5DR5L 2DYPA 3I6KB 3O6FA 5D5MA 3E3QC 3HC0B 3PWJB 4LLMB 1KB3A 4KJPD 1TTRA 4AZ8B 1UOKA 1MWAA 1M6UA 4QYAA 3F7YA 1SF3A 2VDOL 7FABL 3QUGA 5JW4N 3IWVA 5T1LD 1KLUA 2ATKA 4R90L 2FB4L 3RX8A 4I48A 4HH9A 5L4MA 5DO2C 2F15A 3ROOA 3AG3B 2J73A 4F20A 1EK3A 1A4BA 3CHXA 4NN5C 4Y19E 3SGEI 4DW2H 2WXKA 3VQ2C 2BC4B 2DMCA 3IJSA 1MXGA 3CZKA 2JI2A 4LRIC 1KJVA 2CBQA 2WJ7A 4MAZA 1G43A 1TETH 4WTZA 4FXGC 4ZPTA 3KLHD 2WXFA 2HVJB 2N7SA 2VERA 1HQRB 1BD2D 4GMTH 1P6WA 2QVTA 3CBRA 5CZXD 1J9CT 1KJ2A 2HG5B 3IDIB 4XP1H 4HK0B 4ODVH 1F1DA 2ED6A 1CGSH 1MH5B 4PYHA 4M62H 2BH0A 2EDFA 2IF7A 1A21A 3NH7L 4WK2B 3D0VB 3CQPA 1DZBA 4ONHA 3RVXC 1BAGA 4FTVE 1IGIH 1ONQA 4J1UB 1LLAA 1PAMA 1NKRA 3BZFB 4FQJH 5EU6A 1DEEA 4LLQA 4AOFA 5LXVA 4JVPA 1RP9A 1RZKH 4YHNB 1MFAL 2HVKB 3N50A 3NZUA 3DVGA 1A3QA 4NC1E 4JFHD 3MV7E 2DL2A 3TL5A 3GMOB 5ILTH 3U0WL 3FQTA 2PWEA 4QHNB 3MOAH 5D7JD 3RIFK 4K9JA 3GTTA 4HAKA 4J7RA 1UWGH 2P5ED 3U0TA 4RZCA 3KBEA 2HUHA 3DGGA 3OAZK 1QHPA 1AGFA 4TS6A 3QEGH 1IGTA 3F7VA 4Y5VA 4KK9D 1NCDH 4S1QH 4G6ML 4EEEA 1MNUH 4JM2F 1IC5H 3HI5L 3Q2LA 4TXVB 3STBA 4NLHA 1G5AA 1IBBA 1LEGA 1B9KA 5F1IB 4L4TD 3N91A 1KIUA 2YQ3A 4IDJH 4UDTA 4Z7NB 4Z7WE 2R0WH 5AOJA 3QRGL 3HVDA 1VGEH 4KTEH 4FXGB 3SBWC 3OL2A 3S96A 1A14L 3HKZA 3T71A 2FH8A 1GMIA 1DJZA 4HG4J 6PCYA 4TUKL 3WN5B 1RUAL 4QRAA 5FCUH 1LTXA 2WIIB 4N68A 2EDXA 2FJHA 5IREA 3HUJB 4OLUH 1WAPA 3FSAA 2A38A 2C9AA 4WHCA 1U3HC 5F96L 5GJTL 2IV8A 2VITB 1YCSA 2VR4A 3V4LA 4LP8A 4B9FA 3U46B 3N43F 5J11C 2QGDA 1EANA 3MCYA 4IJ3C 4K23H 1W15A 4P3DA 1SJXA 3ATFA 3P30L 4RCAA 1IGTB 3TBWB 5HHQA 2E7BA 1A6TA 2EE3A 2WMPA 2ZKMX 4KVPA 4OF7A 3UZEC 4MNQB 1BXXA 2P5EA 5D1QD 3V6FA 4BBWA 1LO5A 3D4GA 1DLFH 4IBWA 3MXWL 4FKKA 4NBZB 4XMPH 4RBPK 4BZ2L 4RRPM 4F8OA 3L7EB 1EFQA 1BQLH 4MS8D 3VXQB 2XLLA 5C09D 3SHSA 1TO4A 3MRNA 4LRIA 4CNIA 3H42L 4JE0A 3BSZL 4XVTL 2NPLX 1AKJB 3EHBB 5FKPB 2H2PD 1HT6A 1HNGA 1T1XA 5C07B 5IVXA 3DO7B 3IVKA 3UFIA 2FWOA 1TZGH 4MQXD 2GJ6B 4M29A 5D8JH 5E03A 4NM4H 5J6HB 2B2XH 4G5AA 4M4PA 1EGJH 3ILPB 4TPRL 2HKFH 4F9LA 1J1OL 3VDBA 1RI8A 1F4XH 4F57H 1EERB 3IETA 1KIRB 5FV1L 1I9RH 2B4CL 1T5XB 4UYPA 3EJUA 1CQKA 3LHPL 1MCPH 4I3RL 2AXFA 2G4GA 1G9NL 2DDQL 4OTXL 5CFHA 5EUOB 5KSBA 4KROD 4OZHB 2MHAB 4QHUB 2ZWYA 2YD9A 1OK0A 2AXGA 3MRIA 5D8JL 4CC4A 5HYQA 1ACYL 5EBLB 4XTRD 1XHHA 1IGYA 3QYMA 5KSBB 1WTGT 1DBMH 1BM7A 1JYWA 4JPWH 5LBSL 1PPIA 2E47A 1GHFH 1K4CA 4AQZA 3MLRL 5FO2A 4Y4FD 2I32A 3POHA 4C54A 2LW3A 2FD6H 2LV4A 3CN1A 1F42A 2GEEA 3MXWH 4XMPL 4GG8A 1HX0A 3FRPB 1DLHA 3L4YA 4UZSA 5DRNB 1NUNB 2YAHA 3OV6A 5GRWA 4Z78B 5IEHA 2X44D 2FO4A 1C08A 3EF4A 3MKKA 1HFUA 1LDSA 4UTBA 4GRWB 2XKNB 2X4QB 4GRLB 2B20A 2Z7UA 1P5UA 4KU1A 3BWZA 3ZK0A 1BA9A 2AI0H 4OCXH 4PJEA 1HZHL 3GB7A 1X4ZA 4AKOA 1NBVH 3NFSL 4UT9A 3OJDA 3QG6A 1NGPL 1MRDH 2X70A 2BVQB 5IV2B 1AHWC 2XCMC 2PP7A 3SPJA 1WFIA 4N6RB 3EDDA 4HQQL 1GY2A 5E1HB 1EXHA 3JWOL 2HT2D 2L7UA 5FYJH 2Y7QB 1T7VA 2HJKA 3CN4A 3T1WA 4JQIA 5C7ZA 2JJWA 2YAMA 3K91A 1RUQL 1JF6A 1YPZE 2M2DA 5CU9A 1JZJA 3DX3A 4ETQA 4ZO7A 3T2NH 4PJEE 3TV8A 1NIBA 5DXWA 4MQ7A 2FD6L 4DVRH 4CVUA 1ZV9A 3DGCR 4R7LA 3N85H 1OGAD 2WUCH 3T4YA 3IJ8A 4BWUA 1TU2B 5F3HB 5IG7A 4Y4HC 4GW4A 2P24B 2EC9T 5F93C 1QBBA 4ZUUA 2O6EA 2FT7A 4L1HA 4HIQA 3V4PH 3CSBA 5AALA 4G11A 5I73B 2GTZB 3I3DA 5GRXG 4PW9A 4I3RH 3D9AL 5BVJA 2K0RA 4ZD3H 2E9WA 2XXFA 4PTTA 1A8ZA 5GSVB 4GUCA 1YNKL 1YQVL 1CVSC 3D7PA 4PJGA 3LNGA 2CH8A 3CZFB 4MB3A 4NI3A 3FN0L 3MX0B 4YDVA 2VCOA 5KS9B 1NCAL 4LOEA 5D93C 1UQSA 3OQRA 1Z3GL 1FNEA 4XNXH 2ZF8A 3QDAA 4I9WD 5DHDA 5FW6A 3I9IA 3QEHB 4F58L 3OHMB 2CRZA 2IG2L 4RISH 2FJSA 4XOCA 3K5SA 3UBHA 1PLGL 4LSPL 1CL7I 3GGWB 3D2UB 3L4UA 5D2LB 1XWVA 2M26A 1CYWA 1TVHA 1QR1B 1ZS2A 4IRJC 1JHKL 1PZDA 1I1AC 5AZ2L 1ILSA 3TO2B 2OK0H 1FCGA 4YR6B