1PL3A

Cytochrome domain of cellobiose dehydrogenase, m65h mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
186
structure length
186
Chain Sequence
ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAHNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose dehydrogenase
publication title Biophysical and Structural Analysis of a Novel Heme b Iron Ligation in the Flavocytochrome Cellobiose Dehydrogenase.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Oxidoreductase
total genus 35
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1pl3A00
1D7CA 1D7BA 4QI3A 1D7DA 1PL3A
chains in the Genus database with same CATH superfamily
3TGXA 1IBZA 5FO8B 4PJFE 2H6PA 4EAEA 4FQJH 3OWRA 3P1VA 4ORGB 4R7LA 4N26A 3IJYB 2ADYA 2DWYA 3SYOA 4R4BB 1KGCE 3NIGB 3KPLA 3BW9B 3AABA 3QS2A 4WUKH 2DM4A 5F3FA 5CD5D 2K0RA 5AVYB 3S3DB 5JHBA 3BSZH 1TF4A 4X5XB 2WWMC 1VKXA 4I89A 1XTMA 4RX4A 4MA1C 4ACPA 4HPOH 4YLBA 5IHBA 4MA1B 4B97A 3GIZH 2VQ1B 3BVXA 1SHMA 3DGCR 4DKEL 1MCWW 4I3SL 3OR6B 5FW6A 4PQXA 3VCLA 1LNUB 3P69A 3KCPA 5GZOD 3S34L 4OCRH 3GDBA 2OV0A 2BZCA 3L95B 4MJ6A 4LVOB 3MJ7B 1FVCA 2WTOA 2YD5A 4JFDA 5AVVB 3ZTEA 2IANA 4L1LA 3LEVL 1IM3D 5DJAB 4ZI8A 4PJIF 5CLZA 5LGKA 1RZIB 1MWOA 1O6SA 4GPVA 3CQQA 3GWJA 3SQRA 3U4KA 4NO3A 1JYNA 3LB6C 1WLHA 3I50H 4IIQA 3TWYA 1NFAA 3KBHE 3STLA 4XGZA 1WV7T 1UWXK 4OZ4A 1KV7A 3BKCL 3EOYG 4YHKH 4X5PA 5D72L 1LDPL 4F2FA 1X7QA 4EIGB 5JLZB 1R3IH 4UAOB 4XZUA 3S7GA 2VLKB 3D85A 7FABL 4OV5A 3K5SA 2CO1A 3P3SA 1BQLL 1I31A 5BJTA 2APXA 4YHLH 3FTYA 4WJ5A 3VXRB 1ERNA 3SDAC 3GUTB 3WMPA 3SDAB 2BVOA 3I75A 4H25A 1I7ZA 2X2IA 4TF4A 2I07B 5CEYA 5DJ6B 5LGYA 3V4LA 2XWJB 3VW3H 5KSUB 1T66C 1CL7H 2KLRA 2H5UA 4PJHA 4GP8B 4WTQA 1HILB 3PXLA 1QD0A 4N2BA 4Q97A 3RFZB 1BVKA 4MCYA 1IIKA 1U3HD 3L2NA 4ERSL 1JK8B 2BP3A 1Y07A 2OCFD 2ZXEB 1H9DA 4N90E 1MREL 1AO7B 4YHPB 2G4EA 2IDUA 3E2HB 3NJNA 3WXWH 5J13B 2P8MA 3FAXA 4IRSB 3UFIA 3IDUA 4B9JA 4FHKA 1CVSC 5GRUH 1WBYB 4QGYA 4YX2L 3FUEA 3RQ3A 1X4XA 1XH0A 1OCZB 3AACA 3VGAB 4JPVH 4PLKD 3VACA 3BP5A 2XUWA 3L3JA 5J12C 5DWPA 4YHML 5EBLA 3TNNB 4ANUA 1DP0A 4P5MA 3QH3A 3PDOA 5DYOA 5IM7A 4I0CC 5KSBA 4K94L 3VXUB 3KLKA 1RUQH 5F88B 4HS8L 4WWKD 2JKWA 3QWQB 3QWNA 3OAZH 3MNVA 2BVPA 5EUOE 4G8IA 4GMTL 3AG2B 2MIZA 4H1LA 4PRDA 2D3JA 2NCEA 3CFKA 1H6FA 4N1CA 2B1OA 2Z3FA 43CAA 4G6KL 2CK2A 4XNZB 3DX9A 4AQAB 5FGCB 4ONGL 3TBSA 2F2HA 5JIPA 3WFHA 2C9XA 3HZYB 1ZLSL 1HAWA 5EU7E 3NRFA 5AUMA 4WY7L 4L29B 4PLJC 3JWNG 3QJRB 3E80A 3KJ4B 3KYAA 1SN2A 2HFEB 3O45A 2WLYA 4MQXC 2E9JA 3BZFA 4LRIA 4W4OC 3UG4A 1ED3A 5JIIA 3QZOA 4MMYB 4N4YB 4IYKA 4YL4A 2VLJA 2VR5A 1E40A 3WTXA 2JJTC 1LEKB 1WVZA 2Y06L 3CQPA 3FO1A 4Y5XA 4P2RA 4XVTL 4YDZA 1FBIH 1WJ3A 2WYZA 4QJ5B 3DHPA 3MNWA 1CFNA 2AV7B 1NLDL 4NLHA 4TRPH 2IJ0C 4KKQA 1DE4B 4EIUA 1OTUD 1U3NA 2CHDA 2EAEA 3K81A 3QFDB 4TNGA 4UILL 1JGIA 1GS6X 2B59A 3AM8C 2K9FB 3H0TB 4I0KA 3VM5A 4Y4HD 5I30L 1A8JH 2BPBA 2IOIA 1UT2A 3RUGA 2Y25A 4PCKA 2YQBA 5K1JA 1BPVA 3F64A 4UDUB 5EU5A 4DN3H 2DQJL 3KXFB 4OZIF 2QGBA 2YIHA 4KVNH 1H0DB 2O93L 4FTVD 1BZ7A 4NC0B 1UB5A 1NMCC 1QRNA 2X3CA 5D5MF 2LLNA 1YMME 3ZMRA 5IFHL 5KYUB 5IB4A 1LWHA 2JMRA 2FB4L 4NDMA 3WTWA 1Q4NX 1UZ6F 1YEKH 1F6AA 3K72B 3SCMD 1FH2A 2PNDA 4TOYH 4YPJA 4NFCA 3K91A 2IALB 5IVNA 1YUHA 2DQFB 1U2HA 3RJQB 4JY5L 1I8IB 3HNVL 1DQJB 3ARFD 1TJIL 4P4RA 3S4SA 3EW3B 1XGYH 1J05A 3BAWA 1TVHB 3AREA 4O4YH 4WFHE 5FA3A 5JW4R 4ECNA 1CTOA 4DGUA 4YXKL 4G7RB 2ZQKA 2EXYC 4YAQB 1XF1A 2FO4A 1I8UA 4W9IC 1NDMA 3GSNB 4JZNB 2QVFB 2DI8A 4YK4C 5HVHC 2Q6WA 4FHJA 2P42B 4YK4B 1S8DB 1BVZA 3UTSD 3B5HA 2CA3A 4LLYB 3NIFB 1DCLA 4P59L 2A83A 3GTNA 4M7JH 2XV6B 5DA0B 5BQ7A 3T0XA 1HYSD 1EEZB 1T2JA 1RMFH 5LAPA 4JZOA 1AQKH 1CFVH 1ZHBB 3D3VD 2KZBA 3VYPA 1EJOL 4MTMA 4YFLF 1AZVA 1QLEL 5C0RL 4Z78B 4GEJA 4NI3A 4U6HA 4HF5H 1BECA 4YNYB 4OI7A 4FFTA 1AZZC 3JQOB 4CSTA 3HAEB 4OZGB 4JFUA 4R7DA 5H2BA 1X5AA 3RDTA 5JYMA 3BKYL 1FVEA 1YN7A 4RFOH 1M3JA 4EEEA 4P5TA 4NQVB 3IJ7A 5C6PB 2CHNA 4OM1H 1AHWA 2F19H 3ABMB 3GMMA 3CXFA 1QZNA 3IDJB 3VFSA 3OSVA 1C7TA 3UJIH 2YMXH 3V0FA 1KPRB 3FN0L 1E2ZA 3DC0A 4GRLC 2ZUQB 4P23D 2W81C 1WTLA 3QIUA 1UWYA 2IQ9L 4GRLB 4PV8B 3LEYL 3QNZB 4Q6YA 3TEXA 2FO1A 3QUMH 2IGFH 2QADD 3I6GA 4AC2A 3V0HA 2BH0A 3CFBA 3Q8EA 4HLJA 4KNTA 4N8PA 3DDGA 4GBXC 4GKSB 3OMIB 2J71A 1A1OB 3VD3A 1QASA 1NH6A 2Z31A 3QQ9D 2RIKA 4NIYE 1RZKH 1OAYH 5CJOH 2CXKA 4JRYA 3PPSA 4FQ2L 4PFEA 2GTZA 2H1PL 4TL5A 1RZ7L 1FO0H 1L0YA 4PRAB 2GJ6D 2WWOA 3HKZA 2H0FA 5T1KB 4ONHA 4ONFH 4KTGA 2ZOKB 2G3MA 1OCWL 1ASQA 3KW8A 4UZUA 1U8LB 5F72S 4BK5C 1BGXL 5E2JA 3DJTA 1GGCL 5ACLA 4YR6A 3IGUA 4R7NB 5INCA 4HS6B 4D0DA 2FX7H 4JO3H 4BFJA 5FGBC 3UO8B 1TQCB 5ES4B 3BO8A 1QSEB 2CIIB 3VRIA 1L5GB 1NGPH 3TBYA 1OF2B 2NQDA 4HSAC 1YYLL 3PP4L 3TNMA 1JYVA 2EACA 3F65A 4ZTOL 1CC3A 4MS8C 4PGCA 1DQVA 2AQRA 2OZNA 3NCEB 1EGJL 4RA0C 4JFDE 4UT7L 5E2WH 3U9WA 1Z9SA 3GS4A 4U7KA 4GKNB 4XWOC 1M7IA 1SGKA 2MKWA 3N41B 4TTDD 5EBWA 5GRJL 1OLZA 1I3UA 4PD4K 4F7PB 5M94B 2OMXA 3B7TA 5JXAH 1XDTT 1M71B 5JXEA 1IGFL 2EH8H 3QRBA 5DEZA 3MV8E 1RFDL 5L2JA 3V6OA 1AMXA 1KNOA 3JWOC 1C5CL 4JE4B 1FPTH 2FT7A 5DD0L 1GMEA 1NC2B 4EQ3A 3EO1A 4U1LB 5TQ0L 2VLRB 1I1YA 3FFCA 3QJTB 5BW7C 5EPMA 4MDIB 4ZTPH 1TENA 3L17A 4C59B 3FDWA 4HZAA 2C9RA 5DMKA 1ES0A 2XZQH 2DJUA 3NJMA 3IFLL 1P5UC 1JD7A 1SMOA 1MCQA 2L4OA 4TVUA 5F7HA 3TCTA 3ZYZA 2OJEB 5JHDE 2O6DA 2IGLA 1FORL 3B8YA 3T2NL 4B9CA 5I6LA 4WU7A 1NPUA 3HR5A 3OKLB 4PJGB 3SE8L 3VTAA 1UUNA 2WSDA 3DI2B 3DUUB 1QQDA 1CJYA 3A4EA 1JE6A 5A2FA 1NGZA 4P5RA 2VDLH 3LNGA 1OT2A 2XWDA 4XRCB 5KWYC 4U6XA 1T3FB 5D2NA 1WK0A 4C56E 2RCSL 4X0NA 2PW2A 4F9PC 3ERXA 2F8XC 1E9PA 3W0WD 2G3NA 2NYYC 1FCCA 3INOA 1EHLL 4L3EA 1DJZA 3BAEL 5F1NB 4XCFL 5DTFB 4NZTL 4Y4FC 2X09A 4H5SB 4Y4FB 3TZVD 1XXDC 1JZIA 2XWCA 4BFBD 4L8CA 2E7HA 4PJ8D 1L9MA 4DFIA 3R18A 3O3EB 3POHA 1JPGB 1FVDB 5FUCE 4MD4B 3BH9A 5CAYB 1T21A 3HPJB 5CM1A 5KSBE 1OGPA 3EXJA 3LZRA 5IBTH 1EA9C 1WZ1L 3RNQA 4F3FB 5I74B 1H6EA 3FO0H 3GJFK 1OSZB 3VFGH 1S6NA 5MP6H 1E4XH 4NQEE 3RA7H 1JXFA 2VDKH 5EF2A 3WEXA 2WAQA 3WSQL 3S5YA 3AW5A 2BSSA 3HBPA 3RPIA 4ZZKA 4JDZA 4LLDB 5CZVL 3TIDA 2C9AA 5C0BA 4ODUA 1MFAH 2ZXQA 4GUPB 2FQGA 4MKTA 5HD8D 2H7WA 1GY1A 1BCIA 3ISWA 4GT7A 1QUPA 2WQUA 2A0LC 3MBWB 4I77H 5K9QI 1HNYA 3F84A 2Q86A 3KNBA 2XA8H 1WCBB 2ZXBA 4N6QA 4O9HH 3I9IA 1WC7B 2IQAB 4XNQA 2OXHB 2OMZA 4GIOA 5I19L 2H0PA 1D6EA 4M6NL 4MD5A 5KVGE 4HLZG 3DX6B 2EVGA 2VDMB 3G5ZB 1H5BC 2HT2C 3L4XA 1S9XB 2WBJC 4QLWA 5C0AB 1H5BB 1LTXA 3PV6B 2WBJB 2P9RA 4ZFZA 3FTGB 3OG4B 3QORC 8FABA 5HJ3B 1JWSB 3PXHA 3RWCB 5A6LA 1TJGL 5MHSE 4U1GC 4DJMA 4P46A 12E8L 3BP4A 5IVZA 4DQOH 3I9PA 2PTTB 5DUMH 1HKLL 1CE1H 4XMKL 4NLAA 3DV6B 1MCDA 1J1OH 5I73B 2HTLC 1R6VA 1EGJA 2GAZA 4D8PA 1X5XA 2MQGA 4KAQH 4HZLB 4JM2C 3GDCA 4HHAB 2ZG2A 5EWIL 3VXOB 1CK0L 3UAJC 4ORZC 5F7WC 5FC9A 5JDSB 3MFGB 1A7PH 1AR2A 1M7XA 4OLXL 1WYJA 1EXGA 3L4WA 2I24N 2QPUA 3O3BA 3ARTA 1PZ5B 3A47A 2NTFA 2RJMA 1X5ZA 4HUVB 2LQRA 1KG0A 3OZ9H 1I3RA 2ENQA 4KNSA 3NK3A 1XXFC 1IM3B 2OTWB 2VOTA 3GBMH 5ERWA 5FHBL 3ZTNL 4EN3D 5HYSG 3VFMA 5A2BA 1JFHA 1BFTA 1HKFA 1OCOB 1WTGT 4L5FH 1ZSDB 4PM1A 1B4JH 5L7XH 1JNLL 2GUOA 1TTRA 4QTHB 4FS0A 3U0TA 1TETH 2J8UB 3HMXH 3V4VL 1KYFA 1SJVA 4KMQA 3VGHA 2C3XA 5DUPL 3WY4A 5EDXA 1MDAA 1AD9B 4LSRL 4LEEA 2HLAB 2D7PA 1I8MA 32C2B 2ARJA 4XAWL 3BFOA 1KZYA 1JSYA 3KGRA 1OM3L 4Y19E 2OMTA 2GBAA 3C5ZC 3G5YB 2NW2A 2V9QA 3C5ZB 3U2SB 5FHAH 2QLYA 1OANA 5C07E 1SDDA 4GAJH 3ATDA 2JTYA 4QT5B 4A7SA 2P8PB 2C1OA 1KEGL 1UATA 4IU3A 4PJ9A 5ABAA 4HIXH 2YQ2A 3ARYA 4E41D 1CFTB 3TESA 1ID2A 2YFNA 1CF8L 5HHOE 2DEYX 1U3HB 4MSWA 4PS4H 1CUOA 3B2PA 4Z5RB 2OTUA 2R9HD 1RZGA 1UXSB 1QUNB 4LLUB 4NYLA 5DUJA 3U6XA 3VXNB 2VJ0A 3BQUC 5JW3L 5AZ2L 2VJ8A 4Z3GA 3UGEA 3W37A 4DGYH 1E4XI 3UC0L 2IBZY 4G6ML 4L8DA 4OCSL 1SJHA 4HFWA 5CEZH 1TLKA 3IDMA 2VN4A 3TO2B 4LLVA 4XB8A 1JNHB 4HWBH 3MA9H 4Z7UA 3ZDZE 1KBBA 3V0GA 1HFUA 2NY6D 4LCWE 4IOIB 1S46A 3CCHA 1UXLA 3CH8A 4YDVA 3S37H 1PY4A 2CPUA 3VSUA 3LKRA 4UTAL 1CYGA 3FQYA 4QHUB 1R47A 4UQEA 1KLGB 3F58L 1W0VA 4Z0XA 5GS0C 1U95B 1E6JH 2DTML 4WWKB 4TUOA 3ZDYF 2B16A 2RB8A 3GZPA 3BUYA 4KX7A 2QZ5A 4FYRA 3BWAA 5IJCC 1LGVA 4JHVA 3ZE0E 1XCQB 5EBMA 2BCKB 2E4TA 3UPCA 2OLDA 3L3DA 2MPAL 1IGMH 4XPFL 3Q8CA 1WRFA 2W60A 1QTPA 3GXTA 4P2RE 1HH9B 4U1SB 4W9CC 1Z9OA 3O6LL 2ZWSA 5LG6A 4HXBH 3Q7JA 5EU4A 5C0IB 1WAAF 1FG2B 3JTSB 4JFOA 4J3XA 3GI8H 1QW9A 5ISZD 3QXWA 4OR1A 1KTLB 4FG0A 4UQ2B 3E38A 3AY2A 3NCCB 2JXMA 5BUAA 2A9NL 3ARXA 4F24A 2DIEA 1WUNT 4AYGA 1TEYA 5EUKA 5HGAA 2EIJB 1RZJL 1W2KT 4FZ8L 3MXVH 4JJ5A 3KL0A 5I24A 3EDFA 1DVUA 3GSXA 4M43H 1NPNA 4CNIA 2VMCA 4NQTA 1Q72L 3Q43A 3U7WL 3PGDB 5KVDH 5LGJB 1TDQA 1DL7L 1U8KB 1TZGH 1AYOA 3ATFA 4Y4HB 4H1LG 3ARSA 5J6GA 1UVQA 2ZP8A 3SKMA 4JUSA 5TQ2H 3D0VA 2D7MA 3PP3K 4LSQH 5DHVB 3N40F 4MXVF 5AALA 1UHVA 2NW3A 3QQ4A 2EILB 4FTVB 4V1DE 3B9EA 2WINB 3EDKA 4HMEA 2A9MH 3DLQR 4BWTA 4JGUA 1K2DB 2E46A 4HOXA 1Z2KA 5IR1A 1WIUA 4BUGA 4PW4A 2XJLA 5I0WA 4NN6C 1KPUA 4LLMA 2GHZA 3SCMB 1N10A 4MDRA 4NN6B 2HRLA 5DQDH 5H37H 2VDOL 5HHVH 2WJ7A 3ECVA 4TQHA 5FO7A 3AAZA 1TMCB 3ARFC 5FYKH 3ZRCC 1S78D 3ARFB 2K70A 3FU7B 4GRWB 3HN8A 3V4VA 3IJSA 4OLYH 2C9SA 5IFJA 1E5CA 4IMLB 4ISVA 2ATKB 2DMHA 2JI1A 2X4NA 5F2FA 3HRPA 1CDHA 1W91A 1I1AC 3F6LA 4HJUA 4ZOAA 5C6TH 3LXAA 3VG9B 5L8JB 3BAXA 3FCGA 1QSZA 2IPTH 3HKFA 4N8VA 5DD1H 1XIWD 4L4TB 4NZJA 4KFZC 2P45B 1UD5A 3ZTDC 1CFSA 5JUEL 4I2XE 4ZNEA 1YPZB 1QSFD 3J27A 4CSZA 3UTSB 1WE5A 3MNDA 4ABWA 4WHTB 3MJ6A 3M17B 4R3SB 5ID0B 3K8MA 3PWVB 4IKIA 5AENA 4I4WB 3UBXI 1ZV5A 3CDZA 1AGEB 3WFDH 2BP8B 5INDA 4GLRI 3D3VB 4K7PX 3QUXA 5E94B 1NUFA 4KMLB 4P48A 3VSVA 5E6IC 2NZ1A 5DD6A 4TSAL 2QQKH 3O0LA 4PB9L 2GQHA 5E8PB 4NI6A 3LRMA 3D0LA 5H4ZA 4LF3A 5AZUA 2LAGB 3SE9L 4JZJC 2ENYA 3O9WD 2EYRA 3NYKA 1N8ZB 3MAWA 3DROB 4JZJB 2DQHL 2JCCB 3D8MA 5SX5H 4LPVA 2WNXA 1MFVA 4F33B 4XMTA 2BHUA 4Z7QF 1R3HB 1I7RB 4DSYA 4ZSOB 2YAMA 4J3BA 1JGEB 4QNPF 3GMQB 3RWDA 4HWZB 4IJ3B 1K3IA 3EAKA 4QY8A 3UEZA 5K33A 2MCPH 3L7EB 4UTAA 4PJAF 5CU9A 1BZQK 5EOQL 2G2RB 1UD2A 4XP9L 1A4AA 1J86A 5F9OL 1T80A 2YKLL 3OV6A 3V95A 3IKCB 4P23B 1NMAL 2H9GB 2ITDA 2X4OA 3IT8D 4GAAA 2ENJA 3RHWF 4LHUA 4OH2A 4KUCF 4QTIL 1XSOA 3GB7B 4MKMA 3WIHH 1XF5A 4M7KH 1YAZA 2AJYL 4OT1H 5KYYA 2QADC 3ASNB 1OEZW 1L3NA 2QADB 3CZSA 1KIQB 1PIGA 1N12A 1S9YB 3LZFH 3QDJA 1CQYA 4ZO8A 5D7LE 5DJYA 2Z0UA 4LSTH 3S5LA 1BLIA 1Z1WA 5DGRA 4M3KB 5MEOA 3G6JE 5LBSL 5F89B 2QSCH 2RQ8A 2X4UB 2Z7ZA 4X4XA 2Q9OA 5E2TH 2KPWA 1XGPA 5HYEA 3QIBA 4K9JA 1RZPA 2BOBA 2GJ6B 1GZPA 1TQBB 4OZIA 3QXAA 4ICWA 4P4KD 3EFOA 4Q4EA 1T6WA 1EV2E 5GSRA 5D5MA 2CR6A 3PWJB 2X4SA 3BKJL 4OLUH 5EN2B 2NCMA 2WQWA 5ETUA 5DJ0A 1DVSA 1KGUA 3E7JA 1KFAL 1S3KL 5CGTA 1F6FB 1KTRL 2YOAA 3APNA 3DSFL 4FP8H 4H4NA 3SQOH 4DESA 2HKHL 5IVOA 3MBEA 1RULH 4OZFB 1HZLA 1F6LL 3X12A 2UWEF 1AE6H 1N3NB 2NQCA 3OPZL 4AUUA 3IAGC 5I1KH 3B9DA 3EBAA 3MREA 1D5MA 4J4PA 4PJ5A 3FQXA 2O5YH 3OHXC 5F7YC 1TTUA 3BUQA 3BEVB 3P0GB 5F6IB 3S3JA 3OHXB 3MROB 5ANME 2CO2A 4LPTA 5TDNB 3IFNH 3LPFA 4PJDA 5EZJA 2GEEA 3QXVA 2FBJL 4N0UE 1FGVH 1S7UA 1WFNA 1UWXH 4NUGL 1GHFL 2GCYB 1DN0B 3QEQE 4XNMA 2FQEA 3ZJAA 3JWNH 4EZJA 3VG0L 2D31B 2ZJSH 3LXUX 2A4ZA 3ZKNC 2CCVA 2V8MA 2EIDA 4JK0D 4TSCL 1WA2X 1CD8A 1A4JA 2V5TA 3P3UA 5DJXB 1XAKA 1VRSA 3VH8G 3DIFA 4I9WE 3QHFL 3DBXA 5IGXH 1KCSH 2JWYA 2HJKA 2W8CA 3SGJA 3DX8A 4M6MH 1PU0A 3MLUL 1EH9A 4TNVF 5E8OA 3EFFA 1MIML 4BCZA 5FAAA 1MHCB 4BGDA 1AZUA 5KUKA 2MEJB 3LNIA 1JD9A 3D4ZA 4V2CB 4EJ1C 1NIBA 2AABL 3MMEA 4K8RC 4WEEA 3RY6A 1YEEL 3B6SA 1EBAA 4YSTA 3TFBA 3CFIC 5D2LA 3ILQD 2A6JA 2CLZB 3HLAB 2QGEA 4OCXH 3BHBA 4XT1C 3EGXB 1ETZB 1BV8A 2GSGA 1T4KA 4QO1B 1VFAA 1XSKA 4L4VE 3UDWA 5J1AA 1G94A 2EKSA 1BM3L 4JHAH 2YWYA 3NTCH 4OJEH 5KTEL 2NXYC 1A5FL 1CXHA 2B2XH 4DW2L 1ZXQA 4OQTH 4KY1L 1RURL 3BN3B 4IGBD 3GJFB 2ZG1A 1W0YT 4X6EB 1FYHB 4QRRE 4IDJH 3RIKA 2QHRH 3W0WB 4AITA 2DWTA 5EC1B 2WP3T 2QR0B 2V6HA 1OP9A 1T22B 3JVGA 3ZKMC 5L6YH 1F58L 1T04B 3AG3B 3DIDA 4Z7UE 5BZWA 3VXQB 4YXHH 5SWZD 1HU8A 2H8PB 1YYML 3TZVB 5LN4A 2KC0A 5DWUL 4BGLA 1EAQA 3W56A 5HYJD 4PJ8B 2DJSA 3N1GC 4LLWA 4Z7VB 1NFIA 4M7ZC 3T0ED 5B38G 5GJSL 4M7ZB 3N2JA 3BFWA 2AEPL 2ALWA 2OI9C 2XQ0A 2OI9B 5CZRA 1U8IB 3OKNB 1N0LA 2GT9B 4ZXBC 3O0RH 4YS4A 4MLSA 4BK4A 1OGAD 5E70A 3TN0A 1SPDA 4UTBH 5I66A 4BCYA 2VDNL 3NCBB 3PWNB 4P2CG 2YGVA 4RISL 3EXLA 4JPKH 5I0VA 1A6TB 2N01B 1E50A 4KPHL 5C09D 4TQ8A 2CO7A 1NCUA 2R0ZL 3US9A 2FBOJ 1G7IB 1ONQA 3MYZA 4N9GB 2Q87A 3F5WA 2K1MA 4K7PY 5HD8C 1JPFB 2Z93B 2B1AH 1JI2A 2ICCA 3LZPA 1NCNA 3V6ZA 1E4KA 4JGNA 4YHOH 5DEFA 4FNUA 4ZX3A 1EO7A 1AQDB 4R7XA 2WXPA 3RGVC 1A47A 5MENE 1EHKB 4NKQB 3UJTL 2HWZH 4I3RH 5C3IA 1BD2E 1XGRA 1NM9A 3KJ6H 2D2CC 4KU1A 5LBSA 3UYRH 4OCWL 4LKXA 4WHDA 2DF3A 2BS9A 3MRMB 4LEOA 3OKYA 2OMWB 4JS7A 1PD6A 1DTUA 3SE6A 1EXUB 1OAJA 3Q1SH 1I1FA 4OVVA 1LO0H 2R4SH 2V0AA 1T5WB 4PJIE 3ZHLA 2WVUA 2YD8A 2GI7A 5CCKL 3CX5J 2VDPH 1RVFH 1VFBB 1QBLL 3D6GA 4XP4L 5D4IA 3T8XA 2XSKA 3M7FB 4G7QB 3LCYA 5AOLA 4BQ9A 3SPJA 4DEUA 2BIOA 3CU1A 5DGQA 4KJQC 4OJFH 2XZAH 5B1KA 4ZMTA 2DWEA 3US0A 3HI6L 2B0SL 2MQ0A 4Q7DA 1EHNA 4B27A 2XN2A 5TDOB 2H0JA 1A3QA 2AQ1A 5IWLA 2WUCH 4PY7A 4X6BA 4NXKA 4PPTA 1MRDH 2WZ6A 5CIPH 4HIIB 4OV6F 3UO1H 1E8YA 1MRFH 2YPLD 3QR1A 4OZHA 4QHKI 3U30C 3LV3A 5DHVH 5GGSB 3QXUA 2ZOLB 2D03H 2TRHA 4R2GC 4N1EA 4CVZB 4IBTA 4HK3J 4NHUA 4Z7IA 4E0RB 4X8JB 5FOBB 4N2HA 3D08A 1CR9H 1SXCA 3L5WB 3KBPA 2Z35B 4XXDA 4Y7MA 4YDIL 3R1GL 3ZL2A 3D2UA 4WWNA 1LMKA 3SDDC 3RP1A 2ATPA 2YAQA 3EJCA 3ASWA 4EN3C 4X4ME 4EN3B 3BVTA 3KH3A 2NXZD 2C9QA 3OJDB 2QPDB 3D12B 3DARA 3HZVB 4UF7C 2BY0A 1IC7H 3CLWA 5FV1L 3RIAF 5F7EH 1DVFA 3MRJB 1PX4A 4IOFD 4XC3L 1MIEL 2N1KA 3RX7A 3WKQA 3KGTA 2FWOB 5HPMB 1AKJD 4AQZA 4A55A 4XMPL 4NNXA 2XKNA 4AENA 3FU8A 1A7QL 2J5LC 3QJOA 3U83A 3VDAA 2WIMA 3WFCL 4R83A 3QZLA 4TUJA 4BKTC 4D9QD 3MZTA 1NDTA 1SFHA 4WEBL 1NL0L 1EEYB 3A21A 4YBLC 1ACZA 2XBZA 3ILEA 4PRPE 4YHNB 1THAA 1GS8A 4NERA 3U7YL 4KVPA 4ZFFB 4TUKH 5J89A 1HXMB 3VE0B 4F57H 1KCVH 1OP4A 1BOGB 5T3ZE 1B88A 3IN0A 3HZ3A 1K4CB 1SHWA 5GRXG 4Q56A 1T1ZB 4GW1A 2J57A 4U2ZA 4BRJA 4WGKA 3DPBB 3NJKA 5I1LB 1HWGB 3U7AA 1MFDL 1QFWH 3KPMB 3GD1C 5FUZL 4PRBA 1S7XB 3GBEA 3RVVC 1FFPB 2R7EA 4Y1TA 2BSRB 4A66A 1A7BA 1KT2B 2EDTA 5AD0B 1NMBH 4E5XA 1F2XK 2ZNXA 1BLNB 4TNWK 1CE6A 4U2YA 4X6DF 2PP9A 3RNKA 2ZCZA 4JANA 3FHAA 1CGSL 1LWRA 4AM0Q 4E68A 4NENA 1HE7A 4WFFD 5M95B 3KG5A 3LHPH 4F58L 4C4BA 3LN5B 5ITBH 5ADOL 1KYAA 2OL3B 3QI9A 4KO7A 3QZBA 4GMSH 2WYIA 2OZ4H 3SKOB 4GG8B 4NFDA 2NY6B 4HALA 4R97B 4ATWA 4BH7B 3A67L 1MWAB 2A73A 1U8PB 3FHEA 2Q76B 1ROWA 4I1RA 1VGKA 1D7DA 2IFGA 3F3HA 4NHCH 3L5XH 4S1DC 3MNZB 1GGIH 3KPPB 5SX4H 5T1LD 1BXVA 1R3KA 5H8DA 2XETA 1WO2A 4JFFD 5CILH 2YAEA 1IGYA 1TQWA 2DQMA 3GKZA 3FQ4A 3BZEA 4X6CF 1CO1A 2YGQA 4W6XB 4Z7WA 4V2BA 5HI5D 5F7AA 2Y3AA 2IWEA 4UCFA 4JB9H 3CVIH 3H9SA 1HQRB 2VJXA 5CGYD 4AOFA 5I2IA 4NKOB 4MB3A 4QHLB 5HVFB 3LOWA 2YD3A 3GF8A 4BSVB 5AVRB 1UZ6E 3BAKA 2D7TL 2NY2C 3F04A 4G9DA 3QDAA 4X4YB 3CPUA 3K6FA 1Q9LB 5ISZB 3R0MA 3WIIH 3HE7A 5B4MC 3BWUC 4G9FD 4ZW5A 2IADA 2AXGA 3U2IA 2QGCA 2BCMA 2XZCL 2ZNWA 3CVHB 1GTNA 2G75B 1S5HB 3VFPB 2X0WA 1BQHA 4PJ5E 2ZG3A 2ZWNA 5C92A 1XHHA 2DAVA 4RZCB 4DGWC 4O02B 3H56A 4M5TA 2A6DB 1ADQL 1QVOA 2J5WA 3MV7E 3WNJA 1HZHH 1SM3L 4HKJB 2YA2A 3Q05A 1GGBL 1GSMA 5LN8A 3PWUA 2O6PA 2ZYSA 4LIQE 5B8CB 3DO4A 3QPKA 4V33A 2IPKA 2EDEA 2XPZA 3ZHKA 1H3PH 5E9AA 1GAFH 1WF5A 5JR1H 3F7YB 3KDMA 5F6HJ 1O5DT 5K1NA 2AKRA 1JNJA 4FQLH 1U91A 3B5TA 5FA4A 3CXHJ 1P4LA 3PJSA 3ZXAC 3ULVD 4GQ9L 3W81A 2WLLB 5F9DC 2I32A 4G6FD 3Q5YA 1S7WB 1MUJA 3IGAA 3WJLA 2P80D 3SE4C 4P05A 4HD5A 4XX5A 5DQ9B 3N1QC 4F8PA 1FYTA 2P5WA 4PWEA 4B41A 1E0OB 2CO6A 3FNKA 1RD6A 1F3JA 4HLZH 1ZIBA 5KAQF 3X13A 2ZICA 4X7SL 1IM9A 1SEQH 3ZE2F 4RGNE 4JPIA 4K5LA 2VXSH 3MLPA 1V3JA 4WF7A 1U92B 3AB0B 4MQ7A 2FGWH 3HG3A 1U30A 5C0DA 4XBGA 1KLUA 3JV5A 3LS4L 1XIWB 1CLVA 3AZUA 3TA4D 1HZKA 1ORQB 5BRZD 2DQUL 4QRSB 5EHFA 3VFWB 2WLKA 4E42B 1LYQA 1QSFB 5DEGB 3ARVA 3HC2A 2J72A 4MX7B 3TTSA 3ATEA 3CX2A 4PRNB 2RR3A 2ZONA 3U0WL 2WHVA 3LNFA 4BKLB 4YSRA 1DZ0A 1HQ4B 2V2XB 1NEZB 3N1FC 4PGEA 2DD8L 2IFFH 1T0MB 2I60H 1UUSA 5IQOA 3TT1L 5E9DA 2J44A 1HHHB 3F05A 4OCYH 1CI5A 4CA4A 1UJ3C 3GLZA 4QRPD 3L1FA 4PWHA 1J0JA 5D1ZI 4GAGL 4CRPA 3VH8B 2H2SD 5DUBA 2LU3A 4HC1L 3Q2NA 2DQGL 4HCIA 2SEBA 4MA8L 3CFTA 1LDSA 1MCPH 3FQUB 3ETTA 4JO4H 5SX4I 3PV7A 3KPSD 1R24B 1A6ZB 3PL6D 1O9WA 4XVJL 6PAZA 3PWLA 5T1MA 1MCEA 1N4XL 2OYKA 4DZBB 4L8BB 5AVWB 3CLFH 4FX5A 4N8VG 4ZO7A 5CHNB 3HRZA 2EC9U 2ZAIA 4FQHB 4NQDD 1L3WA 2CR3A 2YN5A 3HN3A 5DRXB 4XAKE 4WO4D 1P7KA 5DURD 5DZNA 5AFAA 3D25B 4PJXF 1KYOJ 1J11A 1JDCA 1WEJH 4A1RA 3ARBA 2H32B 5TFSH 1S7RA 4LKCA 3BVNB 3ARUA 1TTBA 1HAUA 5JA9A 4ZAKC 4D9RD 5CINL 1PY9A 4ZAKB 2R1XB 4JQVA 1OB0A 2Y7QA 1RUKH 5AOZA 4PLOB 2GIXA 4KK6D 3HC4H 4AQ1C 2EC9T 4PIRF 4R26H 4G3YH 2QQNH 3DV4B 6FABH 3ARGA 2V2TA 2PO6D 3V6FB 2D3NA 4XODA 1YNLL 5DHMC 5BZDA 2JVUA 1PQZA 3IDYB 4JVPA 1KCWA 5B38B 4UZGA 3RKDD 2ZXCA 3V0AC 3P9LB 4IEFA 4JHWL 3LQAL 1JTPA 3SQBB 2KMWA 4P4KB 5I9QC 3FT3B 4E36A 3P11H 3L2MA 2WLIB 1KGCD 4IU2B 5CUSH 3T3MF 3VTTA 1S7TB 1RZ8A 5A2CA 5JW5A 1NANH 1R5WB 6CGTA 5EEZA 1NGWA 4U3XA 4O00A 3QO1A 4QF1B 4R4ND 1ADQA 3E1ZA 4ZPVA 4KDWA 5EO1A 3C60A 1D6VH 1AY1L 5JOEA 2QKIC 2Z91B 4H7VA 2VT0A 4EI6A 2B5IC 1S9WA 2CHZA 2E6JA 2JKXA 3IETA 3K6NA 1CICA 4K23L 4JFYA 3ZE1B 4R9HA 4YPGB 4PP2A 5A7EA 4NBYB 4K3JL 4FXGB 4JRFA 4FNPA 2A2QT 1FFQA 4XNUH 5I6MA 3P0YH 3TBTA 4AZ8B 5T5FL 4JJHA 4EDXA 1INEL 3ARDA 5KVEH 3E8UH 4PJ6A 1X9UA 2FLRT 2HFTA 3QQNA 3W9DB 2Q10A 5GS2D 1T0PB 1ML0A 4G5AA 1OIOA 5E0FA 3L4ZA 3EYOB 1KB5B 1MCRA 4MCZA 1FNLA 1J87A 3MRDA 3ML8A 5HHNB 3B2XA 2DPKA 1NFKA 5I17A 1SBSH 1NCDH 3D52A 4G6JH 4UOW1 1NJ9A 2XN1A 3WS6C 4EE2A 1J0IA 1MCJA 3ZK0A 5I8EA 2V8LA 3CFJA 2RMNA 2P46B 3H6JA 2EDMA 4H20H 1YNTB 2EDHA 1ACYL 3ZUNC 1UB6B 5E2VL 1KIPA 3R7RA 5DI8B 2XT1B 4ZYKA 5KOMC 1JZ5A 2ZX8A 1A3RH 4ANWA 3QZWG 2PPAA 1NBYA 1U21A 5I26A 1ZLWK 4M1CD 3C08L 3N04A 2AQ3A 3ILQC 3WL9B 3MRFA 2J88H 1KCRL 2Z34A 3QVAA 2F74B 5BVPL 4H1LH 1AC6A 4Z77B 3HI5H 3GMOB 4LSSH 1OT4A 3S2CA 4P9ML 1XGUB 1V3LA 2ZKXA 3CUPA 1IB5A 4P2AA 1PX3A 3ZY7A 4N90D 1RZFL 3BPNC 2NLJA 2B1HH 3IB4A 3D69B 1LHZA 2APFA 2VL5A 4UINL 4Y2DA 2HH0L 3R8BB 3UAAA 2F58L 4IGBB 3W1ZA 1U4EA 3QRFM 2H1XA 4L3CA 3V8CA 5E7FA 4N2NA 4YLQT 3WFZA 5GZND 5J9PB 4JKPL 3T3PE 5I1HL 4HC1A 3KL3A 5SWZB 3GI9L 1FFOA 4M9OA 3HHSA 5KSAD 3VO0A 1MJJB 5HVWA 1EO5A 1T5XA 4NZRL 4Q8BA 3SOBL 5HYJB 3T0EB 4M8QA 4U6YB 4BELD 2DTSA 4W9GC 3E6HA 5HGBB 3VJ6B 3HG1D 4WUUE 3FTSA 5F3BA 4NP4L 1IT9L 4IMKC 3D1MC 2XV3A 2YBRA 4BQBA 1PKQB 2AJSL 3N85L 4UM8A 5C08E 3ZPDA 4A2LA 4E5XG 1OGAB 3VXPA 4EN2A 4JRXA 1KUMA 1PS3A 2X2UA 3AY4C 2HFGL 3BVDB 3L45A 5TH2B 1YEFL 4F5CA 1G7MB 1QTYT 1T1XB 5IOKA 3TONA 2XOTA 4DKEH 5IEHA 2MOGA 2DZEA 4IOSA 4RDQG 5HDRA 4KHXL 1FG9C 5C09B 3U0PB 1QYGL 3S34H 3VU2A 4KRNA 1BA9A 4TXVB 3OSKA 4H0GA 4JDTL 4KK5C 5HDLA 4KWUA 3OR7B 2CJSA 1ULVA 2ICEC 2JLPA 3LEVH 1PCXA 3NJVA 4NFBA 4QDGA 3SBWA 3AXHA 2ICEB 2QPSA 3H2PA 1IJ9A 3K74B 5DQJA 1E7UA 1DBAL 1JGDB 4GH7B 1AD0A 3TIEB 1T83A 3U4BH 2AJUL 1MFEL 2VZOA 4XVOA 3DPDA 4PJCF 4Y9EA 1HIML 1NANI 4RQQB 4J8QA 2WYTA 4DVRL 3GMPB 3QJSB 1RHHB 4DF9A 4ZUTB 3BKCH 4N8UA 5F96L 5D72H 1LDPH 4LPXA 3PP3H 4YZFF 3S35X 4WEUD 4ZBJA 1AXSB 1TTGA 1THCA 3FTXA 4IBSA 2VR3A 7FABH 1BQLH 1LEGA 2WXNA 3OMAB 1H15B 4LMQI 2EYTB 2E6QA 2OK0L 2YRZA 3MACH 2WTPA 3G5XA 4O02H 1A7NL 2F9BT 4K7PH 3SO5A 1FFNB 1HXYA 5JPMB 5AW1B 1JWUB 3WJMB 5IMKA 1N2RB 3SKNA 2WCPA 4ABUA 2QEJA 1PD0A 1YMMD 1FZOA 1G9MC 2XYCA 3MCKA 1KBWA 3MLYL 3NT0A 2YPLB 4WI7A 4ODHL 2IMMA 2L7UA 3K2MC 1KPVA 1MREH 4XP5L 3FCBA 2A1WL 2AK4E 1YJDC 4FQCL 1FJ1A 1K8DA 1TVBA 1AVAA 2R0WL 2X4PB 4AQ8C 5EOCL 4BK8A 3IDNB 4K15A 1LE9B 1AG6A 3L4TA 5AAWC 2HVKA 5K93A 3ZKQD 4N2GA 2R2BA 3U1SL 3WTVA 1SOQA 2OSWA 3VFNB 1T20B 2YRLA 3ESUF 5BS0E 4WFHD 4YX2H 1G4MA 2FZ3B 5ID1A 3UZQA 3J2PA 4KK8C 2HLFC 2F1BA 3QFJE 3WFEL 5KS9F 1N7MH 1XTLA 5GQBA 3DOSB 1G7LB 3B43A 2NXZB 1IE4A 5EU6A 1U8HB 3VWKD 4YHMH 5F9JA 5L4FA 2R1YB 4YQXL 1E5UI 3N44F 2C7UA 1KXQA 4K94H 2K7QA 4LOEA 1AKJB 4WFEE 4I18C 3QZNA 2C7FA 4KROC 5JHAA 3L81A 4GMTH 3B7YA 3BGFC 4MJHA 3NRPA 4JCWA 4J3OD 4FTDA 4NQCA 2KUTA 1MI5E 5MEQB 5FUOL 4R0LC 2GK0B 4G6KH 4FC3E 5CCJA 3MRRB 4NAMA 4ONGH 4RRPM 4PGBB 3ZDYE 2GBVA 3EOBB 3QUHA 4KXDA 1ZLSH 2G2PA 4WY7H 1HHJB 3L3HB 2FLMA 3MRLB 3HS0C 1MNUL 4NT6B 4WU5B 4JFEA 2Y2TA 3HS0B 4OLVH 4JNXA 4XPAL 2A9AA 3ET9F 1M42A 3EJYC 3ABKB 3NIDE 4JE0A 4LNRA 2Y06H 3VI3E 1MHHB 4XVTH 2UY7B 1WAAE 1XR8A 1ZRUA 1AIZA 4XTRD 4WDIA 3K8LA 2KZ1B 2A4EA 2AGJL 4CN1A 5AKSA 3ML9A 1NLDH 4OU3A 1GCFA 4ODXB 2EUXA 1DQIA 1U8NA 3MGAA 4LCIL 3QQXA 4DZ8B 4Z76B 4HUKB 4EUPA 4XCYA 4YL9A 4IRZL 3QJFA 5B39G 4UILH 1K6QL 3BPLC 4OIIL 5IROC 5I30H 4JBSA 3BPLB 1F4AA 1BSIA 1SJMA 2DQJH 4B50A 3D4GA 5T1LB 3VXMA 3ZUCA 2KDGA 5DLML 1G7JA 4EVNB 3DTUB 4RAUB 5B7EA 4AE1A 3WEBA 4JFFB 5IFHH 1AP2B 2EDQA 3ISRA 4K5OA 1UENA 2FX8H 2QGDA 1QATA 3RX5A 3PDDA 4GS7B 2VLME 5JIDA 4Z7NB 3TJHD 1YC7A 3DK2A 4J23A 4NM8L 2YEQA 5KYNA 2FDBP 2DN7A 5F7LB 3D48R 4L9DA 1Q9KB 4EI5C 4JY5H 5FIEA 1S9VB 1BAWA 3HNVH 3QAZC 2J8OA 2Z92B 3BH8A 2NYZA 2N59A 1TJIH 2F5AL 1X9LA 1FZJB 3BD4A 5HGDB 5K39B 1SVCP 3MRKA 4APXB 2F08A 2Y6SD 4N2AA 3CFDA 2NY3D 3QQDB 5D7IB 4YXKH 5I6XB 3MV11 3QCTL 4GUQA 1TJHL 1B9KA 4G9FB 1T89C 4RLDA 1QTSA 2ZX9A 2Y36L 3F00A 3LKQB 4GJTB 2CU9A 1B3IA 3BISA 2IG2L 3ATBA 3KPQA 4LOFA 1HS6A 2F18A 4JN1L 2CH8A 3RWIB 4C83A 1RJCA 2AMGA 2BSCA 4DO6A 4UQ3B 3C6LC 2IOOA 1L0QA 3OKOA 5F0MB 4P59H 1SDAB 5EEWA 5ENWB 2ZOWA 5GRVK 1USQA 3IU3A 4KX9A 3F7PC 1QLRA 1L7TH 1A14L 1B4LA 1G9NL 3LTVA 1A7RL 4J3OG 4TNFA 3JZ7A 4ZUVB 1EJOH 4J7RA 5A40E 4QHPA 2Q5BA 3L54A 1HHKB 1PEWA 3TBCA 2E0PA 3KCWA 3MV8D 2E7CA 1NAML 1QLEH 3H9YA 5C0RH 2CUHA 2NR6D 2KT6A 1BVOA 3MFFB 1NAKL 2J25A 4WI0B 1E4HA 4F20A 3BZ5A 4FABL 1GY2A 1CT8A 5KG9A 3VW3L 3DDFA 3MUGB 1I9EA 4G1MB 3QQ3B 5E6SB 1VPOL 4G6FB 2XLLA 3ZGIA 3MLWL 3C6SB 2G9KA 4PAZA 5SWQA 4AW7A 1VB9A 2DIAA 3BKYH 5FYLE 3V5HA 4MNHA 5E1AA 3P77B 4R84A 4DPAX 4XH2B 4I0PC 4NUJA 1Z9PA 5JHDD 3VRJB 1BQHG 4Z7QE 1PYWA 1JUFB 2QFRA 3KLLA 4NO0D 2NPLX 2N0MA 1OVZA 1HHGB 5KBKA 3OF6D 3FN0H 2X2JA 4JDVA 1FIGL 4C57C 4QNPE 4OLEA 4OJCA 1XGZA 4K55A 2IQ9H 5E5MB 4P3DA 4JPVL 1JV2B 2F1EA 3O3AB 3AQYA 3TJEL 1JHTA 4PJEE 3Q5OA 4E9SA 3HC0A 5BRZB 1NDGA 2ZWLT 1MXGA 3PRZA 4PJAE 4C56D 3RWHA 2VABA 4MMZA 4F7EA 2YUVA 1WHOA 5KVFL 4FULA 5F7KC 1EFXA 1K4DB 4XVUC 3D87B 2Q7YB 1SOSA 4HX1A 1WH0A 1TNNA 4OZGF 3UERA 4FQ2H 5I18L 2H1PH 3LKPB 3OKEA 1DBJL 1RZ7H 2YK1H 2MWCA 2G60L 2VSCA 1XGTB 5CZXD 1OCWH 4AGOA 4QRPB 3L5IA 1AZRA 1BGXH 3CH1B 4ZMNA 1GGCH 3F7VB 4HIHA 4YO0A 5GJTL 5IVXA 2FL5B 4UM9D 4PJBB 3L3OB 5GPRA 1FAIL 2OSYA 1J5CA 4F5CE 3L6FA 4GOSA 2VN7A 4NQED 3FQWB 3F7KA 4QRQB 3PL6C 1PZ3A 2JK5B 2XYBA 3KPSB 4IRZA 3PL6B 1QRKA 2VAAB 2ZUXA 1CF1A 3QZWB 4YHIB 4Y4KD 4XCNA 1YYLH 3PP4H 1RY7B 1BQUA 1UQSA 8CGTA 2FJGA 4NQDB 4U1KA 4Y5VC 1Y0LA 4ZTOH 4Y5VB 3WYRA 2G5BB 1BAGA 1EGJH 3HPLB 3MR9B 4UT7H 4WO4B 4XO8A 5DURB 1J1XL 1VACA 4K7FA 4Q6IA 2D73A 2N4IA 4HUCA 1SDYA 4A04A 2UWEE 1ACCA 3H3PH 5GRJH 3BSZA 2ED7A 2IV9A 2EO7A 5D1XC 2VWEC 1IGFH 1M56B 2OMVB 1HH6B 3KWTA 4AXWA 5D1XB 1RFDH 5CD3B 2C3HA 4GKZA 1C5CH 1C12A 3CSPA 1HSBB 4YDMA 5DD0H 5TQ0H 4YXLL 4M62L 4PCYA 4HS3A 1CG9B 1SEBB 4K9EL 4O2EA 3BN9D 2PO6B 1W16A 4LLQB 1B0RA 4JFTA 3GTTA 4WK2B 4N2EA 3ULAB 4NZ8A 3QYNA 1QFOA 3NVQA 3PHSA 3B9KD 4M4RB 3IFLH 4HH9A 3FQTB 4PJFB 4MJ5B 5MHSD 4XX1E 3MJGX 3R8QA 2YMOA 1FORH 2ILLA 4LBEA 3T2NH 5FYJL 3WNIA 3UYPB 4D0BA 2DEWX 4PBXA 3HZKB 2EVIA 3CDFA 35C8L 1C16B 2PCFA 4O4YL 3SE8H 3L9YA 4KKLD 3ABZA 4GNKB 3QA3A 2DDQL 3DVNB 5F7DB 3V7AE 4LDLB 4AT6B 4U6VL 4ZQKB 4BXVA 2YAOA 2KPNA 3H9HB 5IGXL 3RX8A 1UD4A 2WVVB 1FN4A 2RCSH 3IBEA 3SDCC 3RWJB 2NY1D 3LIZH 2FR4A 4AEIL 1KULA 4NSKA 2HJLB 5EOTA 4QXUL 5IHZB 4UUJA 1NAMA 4YSCA 1EHLH 2CRYA 3BAEH 4HK0A 1W9XA 3CMGA 4CGUB 4DP6X 4XCFH 4NZTH 1NCAL 4N2OA 2ZKYA 4HV8B 5D8JL 2WQXA 4DPBX 4ZUUA 3RPBA 3T2PA 5H94B 5FFGA 2NT0A 2WNGA 4BWUA 1KXQE 2BSDA 2I85A 3EJRA 3F12B 5FCSH 3ULUL 2ZXAA 5C71A 5CWSA 5EIIA 5CP7B 4RETB 4Y16C 2GG1A 3NFPA 4H8WC 4JLRA 3QDMA 3G5VB 4O2FB 4FLSA 1A1MB 4XNDA 4NQCE 3NSJA 3QWRD 4WV1A 2EQDA 2EYSB 3HNSH 1PNDA 4RMUA 4Y19D 2QVTA 3WSQH 1DJWA 3H42L 3HW7A 3II3A 3GMNB 3SPVB 2A9DA 1OQOA 1LM8V 5CZVH 5DDHB 4HGKC 5C07D 3PUCA 2DQEH 3MLZL 4L8SA 1E9QB 2XVKA 3FUIA 3H53A 3VFUB 2AQ2A 5JW4Q 3V10A 3ZO0A 1BIHA 1QEWA 2ZCLL 4MAYD 4Z3FA 1OK8A 3H6AA 4LIQL 1PNCA 3H4HA 5LNGA 2XN9E 3TA3D 3L1OL 1AJ7L 1GH7A 5HHOD 3V5KA 3Q2CA 5IQ9A 4L0ZA 4DN4L 4L0PB 1S7QA 1MCSA 3QE5A 1DFBL 2XY2A 4XN1A 4XBPA 2NZ9C 2LVEA 2BVUA 5I19H 1JDAA 2IGFL 1NWPA 1USZA 4M6NH 1MLCA 2YEVB 1HCZA 3UPAA 4BIKA 3IE9A 3JVFC 2YUWA 1VENA 3KYNA 2UX6A 3NCFB 5KSAB 3BRGC 1GKEA 2EIZB 2BZDA 5B7FA 4Y0GA 4JG5A 3WO3B 1TJGH 2QL1A 2YQ3A 4LCWD 5LB1A 2R29H 3SN6N 5JHLL 1FO0L 3FOMB 3SYQA 12E8H 3NDYE 4N68A 4JG9A 1WIPA 1J88A 1HKLH 4XMKH 1KGYE 4MGXA 5A6IA 3RWEB 2YC1B 3QZMA 2FX7L 4JO3L 5IIEA 3GSVA 5EUOB 2VLLA 4PRHA 2WZAA 1J8HE 2EEFA 1L9SA 5EWIH 1C08A 2MMXA 4JY4B 2DMCA 4P2OA 5JIKA 3LZLA 3L7FA 4PJ7F 1G1OA 4RFNB 4OLXH 4QRUB 1GSKA 3CFNA 4FD0A 3T6VA 2IAMA 2QQLL 4OF7A 1R3JA 4MMXA 3ZTNH 5FHBH 3FPXA 4KBPA 1UFGA 1JZJA 2ZUTA 1IKNC 3AXLA 1AS6A 1E9OA 5E7BA 1JZ3A 2GSIB 2AV1A 1L6PA 3FYEB 1X7TA 1PDKA 4IHOA 5HTSA 3MV9E 3V4VH 4UU9A 3H2QA 3DA0A 3JV4A 5I8OL 2WN3A 5FLVA 1UWGL 3QUKA 5DR5L 2AF2A 4P5KA 4CN6A 2VM4A 4LSRH 2V5MA 2OW7A 3K6IA 5T3XL 1DQDL 5I1JL 1OM3H 3FT9A 4JGJA 2LU5A 3X17A 4U3SB 1OT1A 1JZEA 3UPRA 3C5SA 2APVA 2YO3A 2FJFA 2P24A 3QUZC 4RIRB 4L23A 3WD5L 3DUSB 3R4RA 2AXWA 5IB2A 2VCOA 4OSUH 5C9KA 4TVSa 1VADA 1IVLA 3AS0A 4V1DD 2E8YA 1YMMB 3F6IA 4XXCC 2BXYA 1CF8H 2WSPA 2R1WB 3BP7B 2BWQA 4F2MA 2E76C 5K59F 1KLFB 5JW3H 5AZ2H 2BP0B 3UC0H 3EBIA 4RGOL 1P6FA 4G6MH 5CFHA 3UMNA 2WOBA 4TS6A 4OCSH 5AVSB 5I8CB 5CSZA 1IAKB 4HIJA 4W9KC 3TCLB 1S5IL 3QG7L 5LDUA 3EHBD 3T4AC 1D5XB 1LO4L 5D1QA 3RBGA 1GPOL 4U7SA 4XBMA 5IB5B 3UCRA 4A2FA 3RZCA 4KK9D 5GGRA 3CC5B 4TLTA 3SYCA 4ODVL 4X6DE 3VWKB 4F8QA 4MVBC 3FSOA 5GHWL 1WHPA 3RL1A 5AW6B 4UTAH 1SY6H 3QUYA 3V0VA 1P5VA 1XD1A 3GTVA 3CIQA 1LO2L 4TLUA 1W6WA 4D0CA 1F90L 3F58H 1R34A 3CBRA 2DTMH 1G7QB 3HVNA 2VDQB 1A02N 1NINA 2EUZA 2F54D 4NQSB 4GG6E 3EZJB 4NQUA 1N0XL 3G5WA 2LW3A 3RA7L 3RVTD 1IU1A 2HG5B 4TMPA 1DQKA 4X5LA 2LLGA 3NA9L 2A38A 2FSEA 1FL6A 2VXQL 2QQQA 4FLOA 2MPAH 1GR7A 4XPFH 3TC9A 2W94A 3VI4F 4APQC 4ES8A 1BIIB 4AGPA 1WZMA 4X7FC 4F8OA 5L4MA 3K0WA 1JF6A 3O6LH 4LCVA 4YIQB 3SIKA 4XOBA 1SUJA 4X6CE 4G6AD 1ZIAA 4HIQA 3QUMA 4Y9CA 2FIKA 4QXTB 1D9KD 1UZ8A 5SWSE 4EO5A 1BVLB 1O9VA 3MRIA 2W0LA 5K9JL 1K85A 2JJSC 2F7IA 1E8XA 2NT1A 3LVEA 1KDIA 1OAQL 4F7TB 5F9AC 3WLWC 2Y69B 2A9NH 3PY9A 1BMZA 1B3JA 5JA8B 5JHLA 1FO0A 1IFHH 1RZJH 1MELA 4QOKA 4FZ8H 4X9IA 5I1AB 1P84J 2PKDA 4XN9A 5C7XL 1U58B 4YJZL 1ZT4A 5I5IA 3ES6B 1EWHA 1Q72H 5AVZB 3U7WH 3VWJA 2YD9A 1DL7H 5FO8A 5DZOA 3VA6A 1LP9F 2AEIT 3EYVB 5C9JB 4H2AA 3IJYA 2W0FA 4R4BA 3KPRE 2LTQB 3IE4A 3WIFB 5DMGD 3K4ZA 2JIXB 3O2DL 3RKPA 5D7LD 1JERA 4X5RA 4M93C 5I75C 1R19A 5E9NA 3ROLB 2NOYA 2VQ1A 5ESQB 4CKVX 2HPOA 2C3GA 1AZBA 3OR6A 3SJVE 1CYXA 2CDFB 1Q0YH 1AIFB 1LNUA 2VDOH 4JFZH 1FHNA 3FC8A 4I1NB 3WE6B 5HYQA 1F4XL 1R33A 2JCWA 5E4OA 3P54A 4ZK8A 1MRCL 3L95A 2Y6SC 4A38A 2VISB 3QT2A 3V6BR 2GJZB 4NKMB 5IHLB 1Q1PA 1IEHA 4K3DL 5DJAA 3B2UD 1O6TA 3OZ9L 1RZIA 5KOVC 1Z9MA 1KJ3H 4X2UA 3DK0A 1JHKL 2YPVH 2BW5A 1XMEB 5CP3A 3MUUA 3ZE2E 4PMEA 3D5OF 5JUEH 1JZDC 2WB7A 4Z3HA 3O4LE 5DYFA 2BIQA 4GFXA 1QEXA 2JI3A 3X1NA 5FF6B 1HE8A 3V5DB 5JLZA 4JFDB 5IJBC 2BS71 2VLKA 3MQIA 5CF3A 3GSNL 1X5IA 2P28B 4Y9FA 1A3LL 5F44A 2DQ6A 2JJUA 2I9LB 4MJJA 3QEQD 4TSAH 3VXRA 1YY9D 3IN2A 3GUTA 4IIQC 4I48B 4PB9H 4HWEL 5E24E 3SDAA 1SN0A 4L37B 4PV9B 4CVXB 2NR6C 3MV8B 2I07A 3DOHA 4XN7A 3CFMA 2X6AA 2XWJA 1AI1L 5DJ6A 4GSUA 3SE9H 1K72A 4ENZA 4YE0A 5D7HA 5KSUA 3EG9B 4XB3A 2DQHH 4HYTB 2ZXWB 4XZUB 1HILA 5B22A 4I9WD 1P53A 3MN8A 3RWFB 2ZYIA 3RFZA 3NPSB 3OZKA 1JK8A 3K71B 2BK8A 5BJTB 1UA6L 3KS0J 5EV7A 4DUWA 2APTA 1AO7A 4YHPA 1GGYA 4IRSA 3SZKC 5I1IH 5ICYB 1CVRA 4JKWA 3I75B 4PH8A 4HMCA 3V7MA 5JHDB 1AGCB 4NKDA 1BBJB 1WBYA 3B3IA 4A7GF 3TJPA 4NO0B 3C9NB 4Z0BH 3DO7B 4XP9H 5F9OH 2FJHA 2YKLH 5B21A 3T1WA 2AQQA 2YSTA 1NMAH 1PGRB 3AG4B 3IFPB 4L4VD 4W6WB 4QTIH 1SLXA 4LSUL 2ZUUA 3TNNA 2AJYH 2VXQA 4F1ZA 4C56B 2ODHA 2DIJA 3VXUA 2BIIA 4PJXE 5C0CE 5F88A 4QRRD 3DXAE 2X4TB 4FJYA 4LVHC 4NBZB 3RWGB 5IJDC 2BZ7A 4LVHB 4M5SA 2BSED 3A4AA 5LBSH 1CN4A 4RGMC 4WHYG 4Q52A 4UV4L 3MUY1 1UASA 1WFTA 2MRYA 1TSHA 4WQOA 4XXWA 4JCLA 5A2LH 5EZOH 3QR2A 4N25A 3HE6A 5DVKA 4AQAA 5DC9B 3TVMD 3NPZB 3WN6A 2OS7A 1X5GA 4MNQE 1VERA 3FRUB 5KSBB 2R69L 3ARRA 4FOMA 2JKNA 1ZS2A 3BKJH 4L29A 4QPEA 5DS2A 1M2OA 4UM9B 4QAWA 3HTLX 2HFEA 4I13B 4S0SD 3FUJA 4JFVA 1KFAH 1S3KH 3F7LA 1WGVA 3FUDA 4JX0A 4MMYA 4NQEB 4UV7H 4W4OA 3DSFH 4XN4A 3SGKA 3SY0B 2HKHH 5JHMA 5DK0B 1G84A 1LEKA 3C87A 4B9GA 1FL3B 4Y4KB 2Q20A 3TEWA 2MOVA 3T3ME 4NGHL 4A67A 4XMLL 4BHUA 1ASOA 3P73B 3Q6FB 2AV7A 2NNRA 3MSPA 2TSBA 2JB5L 1DE4A 3FONB 2WP3O 2ADJB 3MXVL 3Q01A 1CI3M 1DQLL 2F53E 2VRQA 4HXAL 4LRIC 3O2DA 3ZR6A 5AAMA 2J20A 3QFDA 1Z5LB 2FBJH 4OBSA 4UQBA 2ICWJ 3H0TA 1OTTD 5EULV 4NUGH 1FNAA 5JPNB 5J1SC 1GHFH 2XX1A 4Y5XC 1BQKA 3LZNA 5MEND 4W9DC 1BD2D 5F8QC 5CU5A 4UDUA 3QWOA 3KXFA 5F7UA 1PF3A 3VG0H 2NDFA 1MCKA 2OMBA 1E5BA 1H0DA 4S1QL 2JSFA 4FMFA 4TSCH 3P9MB 5KYUA 5TE7L 3ZYOA 2Z0BA 3IBOA 3BN9C 1MJ7L 3K4DA 4CU6A 4S0HA 1W15A 3Q8FA 5GGVL 4HMDA 3I2CL 4R5XA 5DD3H 3KVDD 1YY8B 3K72A 1ZDSA 1KXHA 2OCCB 1MIMH 3B9KC 3IDGB 3MLUH 3TU6A 3UGXA 4ZZFA 3B9KB 1T03L 1XL6A 2IALA 2DQFA 2ORBH 3CTTA 5EU5B 5FO2A 1I8IA 1UXMA 1WT5A 1DQJA 1YEEH 3P4OB 4UT6H 5TGBB 1HJCA 1MG2C 3OQRA 4NIKB 1OAXL 1TVHA 3BUBA 1A3ZA 3HMXA 4L1DA 3WTSA 1DLHB 1WWWX 5IT2L 3WHE0 4Y2NA 1CDGA 2C4FT 2XJKA 3EYUL 3CX5K 5FECB 1NSNL 3JUZA 4YAQA 3APCA 3GSNA 4JZNA 1BM3H 2GC7C 2EO1A 5KTEH 4TL4A 1A5FH 1AHMA 4DW2H 5CEXB 4KY1H 2W5PA 4WK4B 1S8DA 1YDPB 1G7HB 2XI9A 1A64A 1HYRC 2WQ8A 2NY1B 3IEAA 4OAWB 3AREC 4P2QD 1TEGA 2F7RA 1J05B 2ZTBA 4LLYA 4WTWA 4DVBB 4OLWL 4GW4B 4NRXB 1NCTA 5FDWB 1F58H 4RWHA 3X14B 5EH1A 3SSGA 1EEZA 4J2XA 1M7DB 3GQFA 1YYMH 1K8IA 1ZHBA 1AXIB 3L3KB 5DWUH 2FO4B 3CK0L 3CJJA 1NDMB 1OGSA 4GSQA 3ZHNA 3CSBA 5J1TC 3RVXD 5GJSH 1XV8A 1UACL 1KBVA 2YD0A 2YAPA 2BVTA 4AG4L 2AEPH 1M1XB 4JDEB 3WGVB 1SXAA 1ROCA 4Z78A 2WNWA 4FQXD 1ZE3H 4LU5L 5FXCH 4YNYA 4L0YA 1EDYA 1TTFA 2FEDD 2IO5A 2A83B 2G5UA 1UXWB 1UZGA 1ZPUA 3HAEA 4OZGA 4NPJA 3VSTA 5FV2A 2X10A 1JMZA 2VDNH 4JZOB 3HNTL 5CJQL 4MD0B 4RISH 4EF3A 3QUXD 4Y19B 4FKHA 3H3BC 2ZKWA 4MNGE 3BVUA 4HWBA 4KPHH 2CK0L 4NQVA 4PRPD 2R0ZH 4C8XA 5C07B 3IDJA 3VXSE 3PQYE 2MCPL 1YA5A 5T3ZD 4J3OH 1NFDE 1KPRA 4L1HA 2BWDA 4MAYB 4R96A 3CHRA 3RDTC 5IK3B 4GXVL 3BRDA 3UJTH 3BUDA 3VGDA 3TA3B 5HHOB 4PV8A 5A16A 3LNEA 3QNZA 3MRNB 4OCWH 5I6OA 4OUUA 3AUVA 1AHWC 1MJUL 2JB6B 3WXVL 3K6SB 3MV01 5IESL 3AWFA 1N67A 4GKSA 5DA4A 1A1OA 3HCVB 1MNNA 3FN9A 1P2CB 1KN2L 2R69A 2ROYA 4CMHC 2FWLB 1VA9A 2XTLA 3KYMB 4TVPL 4S1SL 4CMHB 5AB9A 5CCKH 4OIAA 3QIUC 2ESVA 2CBPA 2AQPA 4PJCE 3S48A 3ZDZB 4P3WA 1JF5A 1HJBC 3IS0X 3I02B 5T1KA 1AC0A 4BEIA 4U1IB 4LCWB 4DPRA 5B1JA 2ZOKA 2B0SH 3HI6H 4POUB 1U8LA 4N2CA 1J7VR 2G0LA 3NSYA 2VDML 2Z31C 2XIDA 1SN5A 2Z31B 1SMDA 4QXWA 4EKJA 3ZW3A 5I1EL 2OSXA 1VZHA 4M3JA 5HDQL 1MFNA 1QSEA 2CIIA 3K3QA 1YEJH 5AYQA 1G43A 3ZE0B 5EO0B 3IMVA 4ALAC 4LBAA 3WKNA 4FQPA 4L05A 5I6PA 3DKHA 3DURA 3HUJE 2C9UA 3N43F 1XX9C 4YR6B 5AKVA 4YDIH 3R1GH 1EJFA 1XR9B 2LU4A 5J3HC 3KR3L 3QIWD 4GKNA 3BO8B 2Y23A 4A37A 3K2IA 4XWGL 5D4HA 4QKTA 4OFDA 4F7PA 2F8IA 2AJZB 3NRQA 1Q9OB 3X2QB 4LL4A 2HJFA 5B1CA 1M71A 2Q0ZX 3VX1A 3C6EA 3BOVA 3IGLA 3CHOA 4GXUM 4XC3H 3RURA 1RPKA 5H37A 1FNGA 5GGTL 1NC2A 4XNXL 5KS9E 4U1LA 4XMPH 5FW8A 1Z9SB 5JZ7D 2BERA 4RMTA 1A7QH 4MDIA 1M6OB 1I75A 1U6AL 3BXNA 3MV7D 1VGEL 5GRYA 3WFCH 2VR9A 4NRZB 4WEBH 2D9CA 4PJHF 5DMJB 5DFAA 1V7ML 3O8XD 2VZSA 5AOMA 3V6OC 5CSGA 2OJEA 3U7YH 2ZCHL 1MQ8A 1AGBA 4UMGA 4OF8A 3RVWD 3W5MA 4MA7L 3EO1B 3OKLA 2NY0C 4PJGA 4V1DB 3DUUA 3FT1A 1EZVY 5BZXA 3A4FA 2GABA 5B3SB 1AR1D 2FEEI 4WRLA 3LZOA 3BPCB 2CBOA 1MFDH 4G8AC 5CN1A 4XRCA 3THML 1T3FA 5FUZH 4FA7B 2DICA 4XHQA 1CXFA 2DLTA 2XWBB 4MCNA 2X6VA 1KEML 4J5VA 5AW4B 3WMQA 2HMIC 3D39E 3EHBC 1QOKA 1Z5YD 3PCYA 4F58H 4RGND 3EHBB 5DTFA 5F1NA 3CXHK 5ADOH 2IOMA 4KK9C 3SBQA 4JO2L 2VC2B 1OP3H 4H40A 4ESKA 3STZB 2ZUSA 5L2KE 2DL2A 3O3EA 2IH8A 4H8QA 4DK6A 1JPGA 1FVDA 4K71C 4KKRA 4MD4A 3OJMB 3HPJA 3ENEA 3HG4A 3WKYA 1AKPA 4F3FA 2MH4A 3T77B 2PCYA 3KPOB 3AQZA 1U8QB 4I2XB 4KJYB 3JXAA 2PXYA 3M1CA 3ZDXE 1JXKA 3MODL 4WHCA 3LDBB 4YWGL 2J1YA 2WWMD 3MUHL 1ZVYA 3Q8AA 2R2CA 1RL1A 2CUIA 2IC2A 1UADC 3FF8A 1IRAY 3BH9B 3T8MA 3KLHC 4HBQA 4GUPA 1XH3B 1KF9B 1Z9LA 3KYOB 4Z7AA 3BPOC 4G6AC 3ZMNA 3BPOB 3LY6A 5LQBL 3CPLB 1AYRA 2VXUL 3MBWA 1D9KB 1BVNT 1GZHA 4YHOL 3WNKA 4LEBA 1IBGL 3WJJA 1WCBA 2H41A 1HHIB 3RPIB 4I3RL 5CBAB 2XZCH 3NBNA 4AEHL 5L8LB 1WC7A 4CJ1A 4HJSA 4NRYB 3G7TA 4LB8A 2IQAA 2OXHA 5L88L 3B9AA 1WGOA 1L9QA 2UVFA 3DX7B 2V2WB 3WKML 5KBNC 1A6WL 3LB6D 5EEUA 3IKKA 4NUMA 3CN4A 1CB4A 1TYJA 4WW2B 3DX6A 1ADQH 3VVWA 4XAKD 3G5ZA 3PAYA 3Q2VA 1PY0A 1SM3H 5C0AA 1GGBH 3NN8B 1H5BA 3LNDA 4TTGA 3FTGA 5C7ZA 5HPOA 4KHTH 4NOBA 3VD9A 1TPXC 4X8CA 1JWSA 3OGCA 3RWCA 4FFZL 2Y9RT 1RSYA 3LPPA 4XO9A 2D2OA 2WXRA 4PP1C 3WHXB 5DMGC 5E8EB 2EH7L 2PTTA 2AHIA 1LMIA 3DV6A 3EH1A 5D7LB 3V0DA 2AXHA 2CR0A 4H8HA 4ZMYA 4GQ9H 1Q90A 3FL7A 1ZT1B 1T66D 3NGBC 4L9LB 3I6SA 1NGYA 2EDOA 3NGBB 1BQSA 1KYOK 1R5IB 3M1BB 4X4KA 4KDTA 3G6JB 4HZLA 3VXOA 4HHAA 3BRFA 4P46C 5JDSA 3MRQB 4L5FE 5IFAL 2JE8A 5KVGH 3VA2C 3ELAT 4X7SH 5GZOA 2Q1EA 1PZ2A 3T6ZA 3LPWA 2CO4A 1PZ5A 4LAQL 2HRPL 2WXHA 4IRJD 3OLGA 4HUVA 2EEBA 4KUZL 4YDKL 3EJQA 5KANI 1O75A 3B2UC 2OTWA 1IM3A 1LQSR 3IU4L 3WN5B 1HINL 4Q0XL 4QXGL 3R7QA 5FB8A 1EMTL 2JFCA 1ZSDA 3LS4H 1OCCB 2AXFB 4QTHA 2X0VA 2QPFA 4W9FC 1OSEA 2X7LA 4JM4L 2FATL 1AD9A 3UJJL 2HLAA 2NRDA 32C2A 4KRPC 5ANMB 1G6RB 3EO0B 3T8VA 4KRPB 3U0WH 5CBEB 4G8EB 3G5YA 3GMLB 1HEZB 1T6VN 2PCPB 3U2SA 4DKAA 5I71C 4N0UB 3FSAA 5GSVB 2BNRE 3VFMB 2DD8H 4NQXB 1DBMH 1VCAA 1T7XA 2LU7A 3QEQB 3TT1H 5C3LD 2B39A 1IEBB 4QT5A 2P8PA 5GGQL 1U33A 1IMHC 2P5EE 4GAGH 2HVJB 2XV0A 2MNJB 1CFTA 4HC1H 4GW5A 2DQGH 5CEZE 4LCUA 4PLJD 5HI4C 2XTJC 1TITA 4K3HA 4WI9A 1U3HA 5EORL 4BFRA 3EH2A 4WKZB 4MQXD 4Z5RA 3R19A 2OMUB 4LLUA 4XVJH 1UXSA 3VXNA 4F7KA 5BNXD 1N4XH 1MQKL 4PJ9C 2G5RA 1J5IA 1CLOL 4B9IA 3QP3A 4F8NA 3LKOB 4L18A 1F00I 3MGOB 2VSKB 3F2LA 3TO2A 1I85A 1HT6A 2PWHA 2N0KA 2IDFA 1FIEA 1BPLB 1JNHA 3EOAB 3X3FL 4MCMA 2EADA 1TNMA 2DH3A 4ZX4A 4XHJD 3KHOA 4L4VB 3NSXA 4IOIA 3E8VA 1MW0A 4UTBA 4N5UA 4X98B 4IM8A 2F15A 3PGCB 1UM4L 4HCFA 5CINH 4QHUA 3L5XL 1KLGA 4WWPA 2F8OA 3KYKL 1U95A 1YZZA 3AWEA 3CFUA 1V54B 2ICES 4QRRB 4WWKA 2EECA 4N2LA 2ESVE 3FQ2A 2V7NB 5DRNB 3O3DA 1JWMB 2AEWA 3LRSB 3O6KL 4Z7UB 1YNLH 4WCYL 5E5RB 1LP9A 1XCQA 2E47A 4YSEA 1IL1B 1KIUB 2BCKA 1JCVA 4PWGA 3S3PA 1AQMA 1JMXA 1FZMA 4YDVB 3TVMB 4JHWH 2ZUVA 3LQAH 1MFBL 1U41A 4LPYA 4U1SA 5HY9B 1ZTXL 3WU1A 4DKTA 4LVNB 3EH4B 1H3UA 5C0IA 1HL5A 1FG2A 4WUUD 3WY1A 4X6FB 1KCUL 4P04A 3BIKB 2BWIA 2UUDK 2FJUB 1T1YB 1UD6A 3IJEB 5GGRY 2ED8A 5C08D 1SYSB 4PUBL 4UQ2A 1AY1H 2X2HA 5KVDE 4Z95L 5CR1A 3L3DB 4K23H 2EXYD 2OR9L 3BZ4B 1F0LA 2W60B 4NZFA 1PFOA 4FFZA 4BQCA 4K3JH 4Y5YB 2HUHA 3VQMA 4FNSA 1OY3B 5T5FH 2K7PA 2EDBA 1INEH 4N0YL 1PMYA 4AM0B 2N56A 2F6AA 1S9KC 3S88L 2WCSA 5LGJA 3PGDA 1GIGL 1U8KA 1FSKB 2AJXL 4N28A 1Z6JT 3WTUA 1WS7A 4Y4HA 3UP6A 5MENB 4D94A 3DYMA 3CBKB 1BD2B 2Q8AH 2H2PC 5J11B 2JXMB 4X80L 3DJSA 5D7KE 5DHVA 2YD2A 4AH2A 1VFMA 1GAFL 3I3DA 4FTVA 3FQRB 4JJ5B 5FYKE 2WINA 4HGWB 2QHLA 2Q7AA 5IBLC 3MUZ1 4MRBA 3OKKB 1K2DA 4PJIB 1ANUA 3BP6B 1ACYH 1UCBL 2BFVL 1EDQA 5E2VH 1K3ZA 3SCMA 3CMOL 5LAXB 2K8MA 4HT1L 1CIDA 4MFHA 3FU9A 5JMOC 3C08H 3ARFA 3FU7A 3UP1A 4F91B 5LHDA 4IMLA 2KLSA 4KH9A 2ATKA 3WENA 2VXSL 2D4DA 1PG7L 5A2IH 4M1DL 2IDCA 3FB7B 2BHFA 5IG7B 4P9MH 3WDHA 1KPUB 1N6VA 4GRLD 4KNQA 1GCYA 1RZFH 4K8RL 2X9WA 1KY7A 2AK4D 4KH2A 4N2KA 4UINH 1YPZA 2HH0H 5KBPA 3AGVA 2F58H 2EICA 4UBDC 3UTSA 3ZOAA 4P2QB 4WHTA 3M17A 4R3SA 3OXRA 5ID0A 2WXIA 4GBXD 4JKPH 3PWVA 5I1HH 1TZHB 4POZC 4I4WA 5BS0D 4X4ZA 1AGEA 3GI9H 2Q3AA 2OAAA 2BP8A 3QFJD 1YUKB 5E94A 3D3VA 4NZRH 4RAVA 3SOBH 2DQTL 3JBG7 1J0YA 2VXVL 3RVXC 3Q9QA 4CU8A 3X1GA 1CFSB 2IFFL 5E8PA 1D3CA 4XPBL 3N91A 4B9YA 3BLKA 2YUXA 4FQXB 1CGWA 1ZT7B 1N8ZA 3DROA 4NP4H 2JCCA 1IT9H 4M7LT 3U9UB 4J8RB 4WFED 3BD5A 2AJSH 3O2VL 3N85H 4MJ4A 5LG1A 5E8NA 3SOTA 4F33A 1EANA 1Q38A 1R3HA 1I7RA 3BWZA 3QG6B 1YEFH 4FYTA 3JTTB 3QUXC 4ZSOA 4FDWA 3TEUA 3BT2L 1MCPL 2HA1A 3QUXB 4JO4L 2DV6A 4H8UA 1MI5D 5AL0A 3GMQA 1Z3RA 4HWZA 4KHXH 1F86A 3UROR 4ELDA 4PRPB 3VD2A 3EBHA 1RK0B 3TO4D 5CMAB 1BF2A 1NCCH 4MS8D 2G2RA 4JDTH 2J1KA 1MW3A 2MHAB 3IKCA 4P23A 2H9GA 3HBZA 5I0XA 2K78A 1NCBL 3GB7A 1DBAH 3IXAB 1M1SA 4PJ7E 5J5EA 5TFSL 2AJUH 3NACL 1VIWA 1MFEH 4PVMA 5F3HB 3ZZSA 1NC4D 1MN4A 2WK2A 1AXTL 1HIMH 1U93B 4HJEA 4MQTB 1KIQA 4NX0A 4R8WH 4QY8B 2J6EL 4U4IA 4Y1SA 3S2AA 3GGWB 1FA4A 4I87A 4N5EC 1G7PA 1TG8A 2IF7A 4Y1AE 4Y8DC 4G8GE 4G3YL 5LLIC 4E9VA 5F89A 2X4UA 2R2EB 3ZR5A 2X4OB 3HAEG 4J2QA 4M8RA 3ARQA 3OAUL 5DEJA 5JNYB 2OK0H 4FQIL 3ZN6A 4CC1A 5CNHA 1ZANL 1CXKA 4MA3B 2GJ6A 5KYYB 2CIKB 1A7NH 2YWZA 4HUNB 2P52A 3VU1A 3PWJA 4NCC1 5E95B 3P11L 2HTKC 4O58H 4TN9A 5EN2A 3SKUD 1RLWA 2KERA 4PV1C 3F83A 1L9TA 1T6BX 3MLYH 1A9BB 3LH2L 1ZVNA 3KEDA 2PP8A 2VLMD 3VQ2C 1BZDA 1XGPB 3QIBC 4KRLB 4OZFA 5C97A 3QIBB 2A1WH 1RJLA 2BOBB 1N3NA 4FQCH 4DGVH 2R0WH 3QXAB 1X4YA 3V79C 5EOCH 3JWNE 4I88A 3VGEA 2NX5E 4K3GA 3L3GB 3BEVA 2X4SB 3U1SH 3OHXA 4WHYH 1PLCA 3MROA 4QHKJ 3A5VA 4G11A 1IQDB 1G87A 25C8L 2LABA 4OF0A 1KJMB 4X0KB 5TDNA 2E9IA 2NYYD 4F37F 2X1WL 3QIWB 3D9AL 4Q74A 4Z6AT 1H3TA 2NDGA 3WFEH 4ODWB 4Y4FD 5K59E 3MBEC 3JUYA 2GCYA 1DN0A 3WO4B 1MEXL 1NICA 2W65B 3W9EB 5BVJB 5TD4A 3U2JA 4M02A 3IRZA 1YLBB 3MJ9L 4J4PC 2D31A 3W39A 3P9WB 5FK9B 4YQXH 2ZOTA 1RHFA 4PJ5B 1QKZL 1EAPB 4JFSA 3INUL 1ZLVK 5DJXA 1N59A 5D70L 1WAPA 3MOAL 3QXTA 3UTTE 3WTYA 2OSLB 3TX4A 3ULSB 2GJJA 5IBUG 1C5BL 3QRLA 3MV7B 3MX0B 3J07A 1YAIA 4GQQA 3FMGL 1MHCA 5FUOH 3O8XB 1PJWA 5AVXB 3D30A 1E8ZA 4NEHB 4TULL 3BZDA 3T6XA 5LKNA 1XMWA 4GIPD 2WNKA 1X44A 3RU8L 2PYEE 2N7AA 2CLZA 1EEQA 3HLAA 3JV6B 3ME0B 5GGUB 2B9AA 3EGXA 1ETZA 1MNUH 2VQTA 3SGJC 5G5DB 2HJKB 4N2FA 1AR1B 4QO1A 2X0UA 4XPAH 3VI4E 4XPTL 3GYRA 4LSSL 3T1FA 5DMIL 3O6FD 5FYLD 5LJYH 3RY6C 3GJFA 2B1HL 2WBXA 1M2VB 1MY7A 3W0WA 5B1AB 2AGJH 4LL9A 5EC1A 2QR0A 2NY5C 1T22A 1JS4A 4RGNB 1T04A 3GJEB 1QFPA 4LCIH 3VXQA 3BT0A 1TTAA 2H8PA 3BEWB 3ZHFA 4IRZH 3TZVA 2XQBL 5E5UB 1SOXA 4K0OA 5J1AB 4GEIA 1EQWA 2HT2D 1K6QH 3D7PA 4PJ8A 2WBJD 4OIIH 4LK4A 4Z7VA 3CZUB 3GPSA 4OGXL 3RIFF 1SMAA 3QORD 4ZUSB 1TKWA 4TNWF 1VJSA 4KTDL 4XCCL 3I6KB 3TL5A 3V52L 5DLMH 3GSWB 2GT9A 3JVGC 3BJLA 2OL3L 3VUAA 1L0PA 2Y7LA 4HH8A 1LP9E 3PWNA 1FCGA 3NZHL 2RFXB 1MWAL 2W07A 2HTLD 3NZUA 1A9EB 1A6TA 1DDHB 3T08A 4NM8H 4H0IA 2PW1B 1QO3B 2UXVA 3FH7A 1QX1A 3WV0A 4FEIA 4JM2D 1DVZA 3F6JA 3CG8A 4JGMA 4N9GA 2ADGB 3UAJD 2M83A 2VQ4A 4MASA 1JPFA 2F5AH 2Z93A 1ZVSB 3LAFA 2J6EA 1MHEB 3O41B 3TN0C 4HA1A 3K1DA 4DP7X 3QCTH 3O11B 1TJHH 2O5XH 3M46A 1MZZA 3KLAB 4FG6C 3UBHA 3BLPX 5CSBA 1G5AA 2ADIA 3WNPA 2Y36H 2X89D 1UM5H 3F7QA 5EZIL 4W9JC 3U4BL 2IG2H 4KJPC 1CLYL 3MRMA 2OMWA 3D18B 1ZHLB 4JN1H 4LOUC 1EXUA 2E75C 5DZVA 1XFPA 2XY1A 1E4KC 3FZUC 1BFVL 5EO9B 1T5WA 2X44D 3V6ZB 4JFXB 3EGDB 3ZDWA 2DWDB 1F1GA 4KI5F 1ZD6A 3GLEA 3X3GL 2RH0A 1VFBA 4LDOB 5HHPB 3CVHL 1RJYB 1XAUA 3B2DC 1G0YR 1A14H 1G9NH 1A7RH 3C5ZD 5IMLB 2X5PA 3BYYA 3L4YA 4QHNB 3MRPB 3MACL 1R3LB 4O02L 5AB1A 3Q6GL 4YZWA 1NAMH 1IAMA 4K7PL 4UQIM 1I1FB 1NAKH 4B5EA 2YKKA 2YS4A 1PBYA 1R46A 4IHBA 4FABH 3ARWA 3RI5K 1VPOH 3MCLL 5HJGA 4PREB 1U8CB 3T8XB 4ZQTA 3MLWH 3FFOA 5GGSA 3DX2A 2ZOLA 1HOEA 3S96B 4NCDA 1RPUA 1XF2B 1CD1B 4CVZA 4E0RA 2VKWA 3DGGB 3E6FB 2AZAA 4X8JA 5EF0A 5FOBA 4DFHA 5IWLC 4M9PA 1RP8A 1ZGLB 3L5WA 3BQUD 3MJ9A 3RYMA 1ZGLM 2YGOA 2Z35A 2EDJA 4YMPA 4PY8J 1OCRB 2AQSA 3ILPB 4IRJC 5JIQA 1G0XA 5ACZA 4IRJB 4JPQA 4YE4L 4PS7A 4GSDL 2FH6A 4NBXB 4A6YB 1RK1B 3UH8A 3QJUB 1FIGH 4EN3A 1NOLA 3OJDA 3CSTA 3HZVA 1N7ML 2YSSB 1F3DH 4LSDA 1TXKA 3TJEH 2G4GA 4KGLA 5BOPA 4JFPB 4WO0A 1COBA 3QDGE 3MRJA 1OAUL 5DS1A 5J12B 4LCCA 2BNQE 3BE1L 1OPGL 1F11B 2FWOA 3MRGB 3GM0A 5HPMA 5KVFH 1JPTL 1P69B 3VFTA 5FM5M 5GS0D 3RGBA 1WZKA 2W38A 3BGMB 4LFHD 4YFDB 3JV0A 4DKDC 1F1DA 1EEYA 1N18A 5AVQB 5I18H 1DBJH 4YHNA 1KJVB 1DJYA 2G60H 1W8NA 4W68A 4ZFFA 2YGNA 1HXMA 2GC4C 3VE0A 3QHZL 5GJTH 1JNNL 2IBGA 3HG0A 1K4CA 4S2SB 4ZW8A 4E41A 4CW1B 1FAIH 2L0DA 1M9SA 4JY6B 5LCVL 1HDMB 3DPBA 4OLVL 4WW1A 1IAIH 1KB9K 4FI7A 5GGVY 3PFUA 2WSKA 4MJIE 1S7XA 3Q9PA 2OYLA 1FFPA 4MB1A 2BSRA 5AD0A 1KT2A 3GRBA 3GBNH 5J4MA 1CFBA 2H3NB 3NJFA 1BLNA 2XWRA 2VM3A 3TT3L 4MAZA 2DRUA 4UYQA 2CHWA 3GXNA 4Z8FL 2ZP9A 5DCCA 3LN5A 4ZFOB 4G43B 4B3VA 3GPEA 1J1XH 2OL3A 3A23A 2NUTB 5IB1B 4XHJC 3RTLA 2YN3A 3SKOA 4D9LL 3GMRB 4GG8A 4BH7A 2XN9D 2WO3B 3X1EA 1MWAA 43C9B 1SRDA 5FFOA 4P07A 1U8PA 2Q76A 2WQRA 3UTQB 4B5ZA 3MNZA 3KPPA 2E56A 3FBKA 3U9PH 1BQ5A 1ZE3C 1NCIA 1O5PA 2FCBA 4YXLH 2DEXX 2Z8RA 3PABB 4FFWD 2Y5TB 3QI9C 4M62H 5ELIA 4K9EH 1NMCB 3T3PB 4PVNA 4E9QA 3OVUB 5C0JB 2FX8L 1ADWA 3MCG1 3W3BA 5E1GA 4GY4A 4LQFL 4QYOB 3T0AA 1BG9A 5B1BB 1MCOL 1KGJA 3GEWB 4NKOA 4DK3A 4EIZC 1DVQA 4QHLA 5FYJH 4KXZH 2KDYA 1XF3B 2P8LB