1PL3A

Cytochrome domain of cellobiose dehydrogenase, m65h mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
186
structure length
186
Chain Sequence
b'ESASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAHNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose dehydrogenase
publication title Biophysical and Structural Analysis of a Novel Heme b Iron Ligation in the Flavocytochrome Cellobiose Dehydrogenase.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Oxidoreductase
total genus 35
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1pl3A00
1D7CA 1D7DA 1D7BA 4QI3A 1PL3A
chains in the Genus database with same CATH superfamily
4X4ZA 4JFQA 4LDLB 1SOSA 3NCYP 5ADPH 4FNLL 1E4KC 3I6GB 5JQ6L 3MJ9A 1MPAH 2F2HA 4NENB 4P4KD 4KTYA 4ZAKA 1OAYH 4PM1A 3GI9L 4GSRA 4U6YB 4UQ2B 4YE4L 3V4VH 1M05B 3DUUB 4OLVL 3PWPB 4FA8A 5B8CB 5A2LH 4JJ5B 4ANWA 1JK9B 2YEVB 4KAQL 3OJMB 1I7ZB 3A0OA 4HIJB 4TNWF 4HPYH 1I8LC 5D1QB 4DGIL 4HOWA 5IMKA 1WA1X 3HI1A 3RWIB 1AR1D 1XVSA 3L1FA 1S9WA 5D7IB 4FXTA 2QL1A 3FQ4A 4YFLF 5DJ2A 1MCPL 4XCEA 2Z3FA 5I1HH 5HGDB 3N55A 4KZCA 4X8JA 4IIQC 2CHNA 4UNIA 4X6DA 2LU7A 4PREA 3TPUA 4LXFA 4ZUSA 1H8LA 1I8MA 5GIRB 1FNSH 4KOCA 1RZFL 1YNKL 1JNLL 2I07A 3MRCB 4A7TA 4KKZA 1GOHA 2QPSA 4PJAB 1ZTXE 3DYOA 2DWDB 2BX5A 2AC0A 1Z0NA 4K23L 1WIPA 3OR7A 2GJPA 3QCTL 3TBTB 3HPJB 2KZWA 1V3LA 4IDJL 5ICUA 4JMXA 3S4SB 4Z23A 3BIKB 1INDL 3F85A 4ISVA 3LPOA 3GSUB 2R39A 1P9MA 1EGJH 4BSJA 1MCCA 2Z35A 2WLIB 2AJZA 2IANA 3X3GL 1AYOA 1Z9PA 5I6OA 3LAFA 1AD0B 2UY6B 3GHBH 4PD4J 5HD8C 5L6YH 3CDGA 5EU5A 5AOZA 3NSFA 3LKPA 1MEXH 4UOQA 5C3LD 4DUXA 1GAFH 2APXA 4FFZH 1AQMA 5GRJH 2D73A 4P99A 4KWUA 2VDQB 4W9FC 4MQ7A 5DJDA 1NEZB 4BFIA 4GUOA 5F97E 5E5RB 3ECWA 5CP7B 1YN6A 1JZ8A 5F7EL 1A7PH 2M1KA 4P2OD 2I85A 4PJIB 1FZMA 4AMKL 5HI4C 1BOGA 1TF4A 4YS4A 3X1NA 1IBGL 2EEBA 2ENPA 4TNVK 2ZTBA 3I6LD 3ZZLA 4Q9RL 4KPHL 7PAZA 1KB3A 2WJ5A 1U8PB 2VH5H 2VXQL 1U9KA 1U8NA 4P4RA 1B0IA 1KIRB 5KBMA 5F9OL 1S7WA 3VTTA 3CUPA 5ALBH 4OTXH 3W9EA 3HBPA 3H56A 4G8EB 2GI7A 4X7SH 5DRNB 3RVXC 4FQQA 4IKNA 5T3ZL 3WKPA 2RBLA 2ID5A 5DJYA 1PZ5B 3D51A 4J3OH 3N9GL 3D9AH 3UO1L 1BF8A 1JZFA 1TKWB 2XQYG 2G60H 2P8LA 4CN1A 2FEJA 2AQSA 4WFHD 1IIKA 5EC1A 3UC0L 4I7ZC 1P5UC 4L3CA 3SO3C 2CO3A 2C8NA 3WSQH 3DX2A 3VMPA 2ESVE 3NJKA 1J9CT 5H8DA 2XN2A 1D7CA 1SLVA 1MFUA 1UWXH 4HWBH 4F7CB 3MBWB 4X7CC 1U3JA 3N1PC 4E9WA 2WYHA 2NY3C 5KBLA 2DLHA 4PWEA 2DWEB 2XV6B 5MEOA 1FYTA 3MUY1 1N18A 2C4XA 5HHMD 4F58L 2WD0A 3T2QA 4L18A 1ZLWH 3LRSB 3IFOA 3O0RL 1F6AB 5DGRA 3FBKA 2IBZX 1KENL 4PB0L 1Y1DA 3QNYA 5HYEA 1NKOA 2HX8A 1FDLH 3GBNH 4GKZB 1O9ZA 1REIA 1CDIA 2ADGA 1D5XB 4UU9B 3RY6C 5DGQA 1HWWA 1XIWB 3EO1A 1JWMB 4KH2A 1IVTA 5HGAB 1OAQH 3IPBA 4FNQA 1T0NB 1BVKA 1CIDA 1FIGH 4Z5RB 2EIBA 3CD4A 3MUUA 4LSTL 1ACYL 2AJXL 1SHMA 5J11B 1CE1H 1FJ1B 5HVGB 1ZLEA 3E2HB 3KEDA 5KJ4A 5CD3A 1EXUB 4R5TA 3VNYA 1I85C 4G7VL 2YGNA 1Z9OA 2DQCH 4QPEA 4XBEH 2P8MA 3VM5A 3HG0A 1X5GA 2LOEA 3KVDD 4O5LL 5B4MD 2AI0L 4IHBA 4RQQA 4MWFB 1N10A 2JI2A 3MC0A 1FVCB 2E9JA 5LBSH 2N0KA 4FL4C 3HJ0A 5EBWA 2ICWI 5D5ME 4WWKC 5EZOH 1XCWA 4NCC2 4GXUN 2QFPA 3WKYA 2H0EA 5TDPA 5I1EL 3DX3A 3VB9A 4FZ8L 4WVRA 2PPDA 1HI6A 4Y4KB 3ULSA 2WXKA 1G87A 3BMWA 3R4DA 4LSRH 1HZLA 4Q0XH 4K3DL 5IOPA 1MELA 2Y72A 1D6VL 4J12A 3CVHL 1WV7T 2DQHH 3C6SB 2VE6A 4L3EE 4A37A 2ZSVB 1E28B 4LVHB 2DM2A 4KNSA 3TZVA 1XSJA 1TTUA 2VO5A 4EN2A 2DAVA 1N26A 4WFED 4YL4A 5H94B 4RGMC 3NSYA 3V8CA 3LH2L 2E4FA 2OZ4H 4CC4A 3FUNA 1EBAA 4BGLA 5AAWA 3K8LA 4EMZA 1OB1A 4HSQA 2YQBA 3VXTA 2OSWA 4ABUA 3BP6A 4U6HB 1H3WM 1IAIL 1T4KB 1XBRA 4CBPA 2VLKB 1A7OH 3MLUL 4YZFF 5MEQA 3KBPA 1W16A 1N3NB 3IM1A 2MQGA 3DRQB 3PE9A 3RDTD 4DN3L 4ZMOA 4AL8C 5ICXB 5IVXE 4RGOH 1J9RA 1R3KB 5JR1H 4YHLL 5I8OH 1ND0B 3B4NA 4DFIA 3MPCA 5GGVH 4XCNA 1CJYA 2BWDA 3LS4H 2XY2A 3FUJA 2F8XC 2VDQL 2EO1A 4B53A 1ZANL 2W80C 2VQUA 2B9AA 4JPWL 1SVZA 3T1WA 3L3DB 3MA7B 3OL2A 4PGBB 3UTQB 5GGVY 3LB6D 5TE7H 1MREL 1U8IB 2VRAA 3BDYL 3QUGA 4FN0A 3J7HA 1NGYA 1DHKA 2GJ6D 2FYVA 4OLYL 4GW1B 2BNQD 1YEJL 3BIAX 4JFFB 1MJ7H 1BREA 3AREC 2YXMA 2Z8VC 3OMIB 2FSEA 3II1A 2VISB 2BMKB 2Y7QA 4KQ3L 3RGHA 2EEFA 4BK4A 3NH7L 3MV8D 5HGGS 2HVJB 3IWVA 3OKNB 4AKOA 5C6TL 3IDMA 4HFWB 3W39A 4EUPA 5EOCL 4DKEL 2DICA 1OGTB 5DHMC 4Z7QF 4PGCA 3MBED 3OPZH 4NI6A 4ODTL 3BRFA 1R9FA 4OZIE 3VVVA 4G7RB 1AOZA 4WUUA 4GG8A 2J6EH 5DWUH 2P45B 1H8SA 1HJCA 5FYKU 1EUTA 3OGCB 1P4LA 1AANA 3KL3A 4HD9A 2VR5A 5GRUL 1PU0A 4AV0A 1CBVL 3AQZA 3ZVVA 4H0HB 1X6NA 1AKJA 3T2PA 1T1WB 1P5UB 1OSEA 3QQ9D 1QEWA 3OG6B 5GSRA 5EO1B 3W2DL 3U0TB 3NPZB 5DC0A 4MNQE 4MNQB 3IU4H 5CUSL 4JHWL 5KSAD 4WU7B 2NX5E 4LLVB 3BVWA 5F0PB 5F3BA 4J8RA 2FRGP 3RE0A 4FLQA 2X0WA 4UT7L 4W70A 3U6XS 2Y2YA 4HK0B 3V7AE 4WJKB 2FECI 4JPVH 4L37A 4OCNC 5HVFB 2OLDA 3LKNB 5C0BE 1ZWIA 3ZQWA 4BH8B 5KBKA 1XCTB 2PPEA 1JD9A 4O4YH 5L4MA 2DQUL 2OXGA 1KXQE 3WLBA 3FL7A 1LO0L 4Y4HA 1DBJL 4M02A 2OMUA 1B0GB 1J05B 2Y22A 4PCKA 5ADPL 1FFOA 1KXTA 2YKLH 4Y16D 4LHUG 4WI4A 3SYCA 1MPAL 2B4CH 3AAZB 3HRZB 3TBSB 1OAYL 3FFDA 5CU5A 5EC2B 3KPRA 3V4VL 2HTKD 2FR4A 3K72A 1A6WH 5LQBL 3TF4A 4HPYL 3NGBC 5EF0A 1SVBA 4Z3JA 2YSTA 4R8WH 5CN1A 4NQDD 2HJKB 3BH8B 2AV7B 2UZXA 3HE7C 4F9PC 5AD0A 1GKOA 4YX2H 3DO4A 5I1HL 1JP5A 1AXIB 3BC9A 2IH3B 3V0VB 1AO7D 2YRBA 4LLMA 3I74A 3GSNB 3TIDB 4PJFB 4N2AA 1MVUB 1FNSL 2MQ0A 1N8ZB 5I73B 2B8OT 1XGUA 2QADB 4F7TB 4Y5YA 1DDTA 3SKUD 4RGND 4Y2OB 1PQZA 3B8YA 1UASA 3ZE1F 4R3SA 3C60D 2QKIA 3ZE2B 3REWA 4P23C 1A4KB 2R56H 1CD8A 3QI9C 4HIHB 4KNUA 2A9DA 2CO7B 3EYQC 4JQIH 3ZT6A 2DW5A 3H7BB 3APDA 4N9GB 2WUCH 3AJ7A 4TXVB 3NIGE 1IO4C 4OVVA 3VXPA 1ICTA 1TG8A 4PHZA 4M5YH 2EIMB 2IV8A 3X11B 1Y18A 4KZEH 1EGJL 2XPGA 1EFXA 2R23B 1DJYA 1WZ1H 3ZYJA 3N1QC 4L29B 3GHBL 4E9TA 2UY7B 5L6YL 3KPLA 5AVQB 1MEXL 4WHTA 4LT7A 4RAVA 3RUGA 4IRJD 1GAFL 1MQKH 2YUVA 3GSWB 4FFZL 4P5KB 3WS6A 4TOYH 5KG9A 5GRJL 3PIQB 2Z4TA 4RGMB 3KLAA 4NWUH 2YRLA 3QQNA 4ZQKB 5JW3H 4FJYA 3D0LA 1A6VH 3NK3A 1E67A 3B5GA 2RIKA 3ELAT 5CILH 3ZE1E 5G55A 1A7PL 3EZ8A 4JFZH 3EGXA 1J0IA 3O3BA 2IOMA 4FG0A 4MB4A 4XRCA 2YEZB 3IE9A 1LE5A 4XPGH 5IJKC 1F41A 4JFEE 4KO6A 4MLSA 1CO1A 2YARA 3F7YB 2A6KB 2G5BB 2Q20A 4NQUA 5C07A 1BBJB 5BVJB 4X99A 3O41A 1I7RB 1Q9OA 2VH5L 3FH8A 4R2GD 5ABAA 5FK9A 5I8KH 3NEEA 2ZOKB 4RZKA 3QJSB 1SHXA 2X4PB 3OXRA 2IGFH 4F5CA 1SQ2N 3FCUB 1LWRA 1UFGA 4OTXL 5ALBL 3WJLC 1A6TA 1U42A 3F12A 3I50H 4NQED 4AYSA 4O58H 4X7SL 1JZ3A 2AQTA 3BW9A 5IUSA 2AANA 2GFBB 2GI0A 2JCCE 3WN5A 3L4TA 5DZ9A 4XWOC 5E51A 5PCYA 1HEZB 3HI5H 3U6RA 4APQD 2ICEB 3FT0A 1JYVA 3D9AL 3LS5H 2YAMA 1F1DA 1B4LA 1I1YB 1ZLWK 4BKLA 2AEQH 2X4QB 3RX7A 5IK3B 2A73A 2GJJA 5DFVC 4R7DB 3A21A 1OD9A 3RWHA 3UACA 1XDTT 3GHEH 5B1AB 1M7IA 3MJGX 2J21A 2WIIA 1Q9WA 3WSQL 3AG3B 2WNXA 3D3VD 3FO1B 4U1KA 3BAEH 3RTQA 4KXAA 2JSFA 3WMSA 5IHZB 1O7VA 5JXEA 3ECBB 1M1XA 4HWBL 4N28A 2F74A 4P2RB 3IGAA 4KKPA 2VTFA 5DMJB 2Y36H 4B9FA 3E7JA 5JW5A 1P7HL 2WTRA 3EH2A 1Q0YH 1B90A 1AHMA 1NGWB 4HUXA 3W81A 1XMEB 2AAVA 3FXIC 1LEIA 3WUWB 1VDGA 4JL2A 5HYJE 5J56B 1FDLL 2BCKB 3O2DH 3GBNL 2OX5A 3PWJA 4PBVC 3RVVD 3BVXA 1T80A 3I02A 2ITDB 1GY2A 1DQQB 2MWCA 4JQXA 2LAGB 4GKSA 3O8XA 3LRHA 2O5ZH 3I3DA 4RMRA 1OD7A 4JZJA 5FAAA 1YMHA 3LZQA 2NW2A 1BZ9B 1KF9B 3HC0B 4WV1C 1OAQL 3Q8AA 3OTTA 3UTOA 1NFIB 2N4IA 1FIGL 2EXTA 3D25A 5FYKH 3T1FB 1CE1L 1HZKA 2MCPH 1KIQB 3Q5OA 3TO4D 3LOWA 3N0AA 1FPTH 4PJHE 1QFWH 1GHFH 4PRIA 2EDXA 3MRDA 2XWTB 2F8IA 4WDIA 2DQCL 5GRWA 5E6UB 1JZ4A 4XBEL 5AALA 4N3UA 1M7DB 1GJWA 2ZCZA 4XN7A 4ZFOB 4JFUA 4U1GB 1ZVSB 4JZNB 2XG5A 3LNFA 4HYTB 3CG8A 4KK5C 4IW4C 4NZTH 3PL6D 3NGBB 2IC2A 5LBSL 1LO3H 3U46B 2A74B 2VQ4A 1HWGB 4XNYH 4UQ3A 2I25N 1U8MB 1WPCA 4N0YH 4IBYA 3HE7B 5EZOL 2ZUSA 4Q9CA 4ZI8A 4L0PB 3FRPB 5I1AB 1HHGB 9PCYA 1DYZA 2NTFB 4K5NA 1NCTA 1H8OA 4EO5A 1OZTG 1Q0EA 1E8XA 1TJIH 2GYSA 2IAAC 4HJJH 1W8OA 4LSRL 4Q0XL 4NLHA 5AZEH 3WFDH 2OTUA 5JDSB 1JZJA 1K8DB 4LKXB 4Q4IA 5D7KD 3NSJA 2DQHL 4JB9H 4PY7A 1U3HC 2I9LB 3U6XA 4M6MH 4XX1G 4R5VA 5EWIH 2B15A 3VRJB 4U6XA 4FF9A 3H3BC 4HC1A 4GRLC 2D2OA 1ET5A 4X7EC 1CDUA 3FCSB 3NFNB 2OZ4L 3UDWC 2CBPA 5DEFA 1KTBA 2MTAA 1A9BA 4N8VB 3QXUA 2IAMD 3H4FA 1J0YA 1RCYA 4GQ9H 1FLTX 4QR7A 5AYUH 1A7OL 2NNXA 4G6ML 2J56A 3QJZA 5AW1B 3VQMA 1S8DA 1G7MA 1FUNA 1A7NH 5EBLB 5E2WH 5KYUA 1QSEB 4DUWA 4TQPA 4RGOL 3FQRB 3QR1A 1KBGH 5I8OL 4XC3H 3RL2A 4GRMA 5GGVL 4DP4X 3LS4L 1HOEA 1IC5H 2VZ3A 4WHYH 2YAHA 2A6DB 2HX9A 1IM3D 5ANHA 3B3IB 4OF0A 1VESA 2WLNA 3HZVA 3W0WB 4HEMA 1W0WB 5TE7L 1MJUL 3MNVB 3Q8CA 4MA3B 3RTLA 4AEIH 5MEPB 1TJMA 3MRGB 1BQHA 4PJXE 3BZEA 1MWAB 1MJ7L 2E75C 4NQSB 1MCQA 2CXKA 2E7BA 2GVYA 2HKHH 1H15B 1BIIA 4CW1A 2XA3A 3VUAA 3CFQA 3ZUCA 1MCKA 5C0CD 3D4YA 4HQQH 2N7AA 5AB1A 4PW3A 1P5VB 1S6NA 1BQSA 1I4FA 1DVZA 4FDWA 3OPZL 2Z7UA 4YLQT 3KPMB 2BVTA 3IGLA 3QGVA 4RCAA 2J6EL 4M6AA 1OL0A 5DWUL 5IQ9A 2VN3A 3UTZB 1NEZG 4Y1AD 1TQVA 2CKNA 2XCMC 4AJ0A 6CGTA 5K9OB 3G04B 3SKNB 3VA6A 2SEBB 1S7RB 4PRBB 1SLXA 1RJYA 2MHAB 3VFTA 3OSVA 4WWID 1XB6A 3HE6C 3MJ7B 3VRIB 5FM8A 1NDGB 1RHFA 5TGBB 4NXSA 5E8NA 4ZNCD 2VABA 3EJCA 4B7LA 2D7MA 4XO9A 5D1XD 5EIQA 2ARWA 3QNZA 1PY0A 1W72A 4A7GF 3A6CL 2AJSH 5FB8B 1LO5A 2D31A 2P28B 2R1WB 3IN0A 3IU4L 2JCWA 1N5AB 4HFUH 4OD2B 5BS0A 2IH1A 2YPKA 4J23A 1MDTA 5T1KD 4YGAB 2JJSC 4PLOB 4FNTA 2W0FA 3IVKB 3D8MA 1CG9A 1OAZH 5GRXG 5J1SC 2F08A 2K9FB 5DD0H 4JPVL 3TJPA 1WK0A 4DW2H 4KI5F 4DK5A 3WTWA 1UURA 5DI8B 4O4YL 3M86A 5L8JB 5EUKA 4EN3C 4YZWA 1HE8A 3LRGA 4UYQA 5HY9A 1OAJA 4IRSC 4QNPF 4DFHA 1XF2A 4LPUA 1TEFA 1F18A 2YKLL 4HMCA 3STBA 1RJZB 2BH0A 2CPUA 2PXYB 2B4CL 2TAAA 5ISZE 3DO7B 1ET8A 5BUAA 4I85A 3PAVA 4WV1B 5I28A 4OFQA 5F7MC 2PCPB 5D4JA 1M9WA 5E7BA 1A9VA 1R4XA 5HYIA 4C83B 3CC5A 5CEZD 4D0DB 1A6WL 3I6SA 1BXVA 4XMWA 4X80H 4XP6H 1PEWA 5F7WC 5D7JD 4QMEA 2WQAA 3RILA 1M3JA 4JPQA 4U1HB 4YHNB 3VD7A 4R8WL 1KLFA 4LHUD 4PFEA 4N90E 1RIVH 3BWAB 4YX2L 5J6GB 1MHCB 4WGVB 1OTTC 4KX7A 2J72A 4J3TA 2EDFA 3B83A 4U1LB 3RJQB 4CDHA 5C0IA 3ARBC 2R69A 4XH2A 5BOPA 3FSVA 3TASA 3VU1A 5JLZB 4P2QD 2JJTA 3FUFA 4KROC 5F3FA 2X89D 1EHXA 3T0EA 4ZFOL 2YD2A 2JB6B 4NJAH 4S0TD 2YJLA 1BGXH 4JZOB 2P52A 4PTUB 5CEYB 3TH4T 3QXTA 2R56L 4GKNB 5C97A 5I76B 3UZEA 4KXZH 4JQIL 2E6PA 5EU6A 2WXGA 2WUCL 5HHNA 3F5WA 1KWGA 1EZUA 1XF4B 1F11A 1KJMA 2FT7A 1JRHI 4NWTH 2YN5A 3MROA 4M5YL 4IOIA 1Q38A 4KZEL 1OT1A 1X7SA 3D85A 3OJVC 3WJMA 3MUGB 4JDVA 5GSVB 4LF3B 3Q2CA 3WIHH 3SPVA 1WZ1L 1AGFA 3ZUNC 1E8ZA 3VXOA 3T4YB 1ZLDA 3DV6B 3HTLX 3ZOAA 2VNCA 3FRUB 4ZZFA 1MQKL 4TOYL 1MUJB 4IJ3C 1R47A 2IPUG 4GRLB 1NBYA 4WJ5B 1VFUA 4NWUL 1YLBB 1K2DA 1RPUA 1VB9A 4FJ6A 5TQ0H 2FH6A 4P5RA 3KLHC 1P7QD 2DLTA 5E7FA 3CFEA 5JW3L 3S34H 3SDYH 2Z92A 1A6VL 1O6VA 1LMKA 1XGTB 2BOBB 3FU5A 5CILL 3TIEB 4JFZL 2W9EH 4XMUA 4PJ8B 5EZPA 2B2XH 4NZRH 3ROOA 5I6LA 2WO4A 1WSST 4FQCH 5HXMA 3BVUA 5LKNA 4AEFA 3RU8H 3HNVH 4F7EA 4G9FA 4XPGL 2RJMA 4LCWE 3OWRA 4GMTH 3RVUD 5ANMB 3H42H 2WCSA 1XAKA 4LSPH 5DRZB 5TH2B 1CBJA 3FOMA 3FTGA 5AB2A 5JO5A 1YMME 1YMMB 2EYSA 5I8KL 3MRLA 4HJEA 4GIAA 5DO8A 5JMRA 1IB5A 3F6JA 3KL0A 2DD8H 2IGFL 2C7UB 3N40P 3CU1A 3JWNH 4ZOBA 1EPFA 1FNEA 2BVQA 3I50L 4O58L 3T4AC 5IB2B 2WUBH 2VDPH 3MJ9H 4FA7B 3LN4A 1AC6A 2JELH 3LS5L 4ZUVB 2CDGA 2BNRB 4PMFA 1H3PL 2AEQL 3IJSA 1D9KA 1IQDB 4IYKA 2GEEA 2VLLB 4W9EC 1ZHLB 3C2AH 3AXLB 3K4ZA 4P57A 3IS1X 2CDEB 4BZ2A 4KNQA 1CIUA 3WFCH 3GHEL 4GBXA 3DBXA 4H13C 3MRJA 1T1ZA 3U7YH 3Q6FA 4PJGB 3W9DB 3MRKB 4QRQB 1AZVA 5F21B 3BAEL 4H0GA 5D2NC 3RX9A 1A3LH 3GMRA 3DXAD 3QPKA 5CFHA 3GEWB 4NNYA 3CH1A 1XT5A 2H0PA 3BLKA 4XNXH 1T0MB 3QWRD 2Y36L 4J3OG 4OT1H 1LQBC 3BZ4A 4UQCA 2X41A 4RMQA 1Q0YL 1HSBA 2ZCLH 1M53A 4JY6B 3BGMB 2EACA 2WXQA 1ZPLA 3CXHK 1YRKA 3LHAA 4FCAA 2NY4D 1DE4B 3KAAA 3O2DL 1FSKB 2IFFH 3PU7A 1N19A 4BWUA 4WK2B 2KBGA 3AU1B 5I23A 4I18C 3L6FA 4AQAB 2VITA 1OPGH 1BLNB 2GEQA 2O5ZL 3G6AB 1U33A 3EYUH 4MAYD 2IPTH 3LZPA 4R96A 1CFQB 4UDTB 4BFRA 1IM9B 5CFAA 1R3HA 5IQLA 1DUZB 1SLUA 3MUJA 4DCQA 3N41B 5SWSE 5SWSB 5FYKL 2VDKH 1MOEA 3PP4H 1R75A 4N2LA 1KYFA 5I82A 2MCPL 5IBLC 4KKBC 3ESNA 4FTVD 1FPTL 2A4CA 1QFWL 2GK0B 3QZNA 4HKXA 4HUVB 2ZOWA 2N01B 4I77H 5E6YA 2CLVA 1I3VA 1LO2H 2Y6SD 2W81C 2LHAA 2JTYA 3O3EB 4UM8A 2UUDH 3WTVA 3T3ME 2WQ8A 3MFFB 3T3MB 4NZTL 4DIXA 1QO3B 5C08B 1Q8MA 1A6ZB 1LO3L 2W95A 4XNYL 2IDSA 1F3JB 4A7GA 4N0YL 2E9WA 3K6FA 4NO0B 3RWFB 3QO1B 4PJ5A 4WTXA 3BVNA 1HFUA 3FHEA 2RQ8A 3EG9B 4HXBH 4BE5A 5KSVA 5J6HA 2DI9A 4JRXE 1CICB 1PDKA 5IF0A 3VFPA 1XR8A 1FFNA 1IGTA 3ZKQD 1R5IB 2WXIA 5HJDA 5LHDA 1ZDSA 3R19A 2YGQA 4PJDF 5F9DC 4IS6B 3GBDA 4KGJA 1O6SA 1TJIL 3OKOB 4HJJL 4XXWA 4KROB 5AZEL 1EJOH 1OHQA 2QVMA 5BNXD 3DPBB 1JOIA 1PCSA 1Q0XH 4GP4B 3BKMH 1JVKA 2PNDA 4JB9L 4L8BA 3RZCD 5I1GH 4Q9QH 3GB7B 1L9RA 1L9SA 2QGBA 4ONHA 2OMZA 5EO0A 5EWIL 5F7BA 1R19A 2X2UA 3PNWA 4U1JA 1Z9LA 3TA3D 2BFVH 2UYLA 1D5ZB 4N0RA 5KVFH 1CB4A 2BP5M 2UV3A 1MRCH 5FYJE 5IB4B 4LLQA 1TJHH 4JPSA 1FAIH 2MKWA 1AHWB 4K7PX 1N9PA 4RISH 3Q9QA 4UIMA 4NKMB 3JV4B 5INDA 1WLHA 4A68A 3WDIA 4GQ9L 3GMOA 2OZNA 3HG3A 4QRPD 3RVWD 5AYUL 2XZAH 1JPTH 4M93C 3RWJB 1A7NL 5DURB 3GBEA 4UI2A 5E2WL 4Z78B 1K9TA 2E6JA 5E5MB 2CUAA 4NQCA 3DYMA 3P3TA 2GBTA 3TBVB 3HHMA 1KBGL 2XWRA 4XC3L 5BRQA 1SYVA 3LJ3A 4JFQB 3FO0H 1G1OA 4M48H 1IC5L 2VDPB 3B9KC 2FO4A 4ZAKB 1G7JA 5E9AA 4NP9A 3TTYA 4CMHB 1EQWA 1U41A 3LVEA 3U9PH 2GK2A 2X0VA 4IKKA 4AQ8C 4BUHA 3Q2LA 1H3GA 4UM9B 4AEIL 5H2BA 4JY4A 2W0KA 3CN3A 5AOLA 5IMKB 3DMMC 2G4GA 1YZZA 3HI1B 2EDDA 1S9WB 2BP8B 2HKHL 5DFWH 1YC7A 1AY1H 5DJ2B 5DT1H 1BZQK 1X5JA 3THMH 1RV6X 4XCEB 3MRMB 3NIFB 4N0CC 4HQQL 5CZXD 2WQRA 1YNTA 2YPLE 3HHSB 4X8JB 4LLAA 1JFQL 4Z7UF 2R0ZH 4JFDA 4PGZA 4LHJB 4PREB 4X6DB 4ZUSB 3TPUB 1I8MB 2Q8BH 2OR9H 4PJEF 4I2XA 3EOTH 5FECA 4Z7OE 1XXDC 2I07B 4A7VA 5I5RA 4RDBA 5E99H 1YEEH 4IJTA 1HH9B 3Q06A 1M7XA 3PHOA 5SX5K 1CLCA 3HG1D 1TQBB 1JUFA 1IBHA 4WLCA 2VR9A 1KGWA 2PO6A 3VD1A 4MZIA 2KS0A 3P3RA 3RB7A 4P3CH 1B0RB 1S7QA 3MLWH 4AYMC 3VXQA 4JQVA 3VXME 4LGRB 4PVMA 4Z7IA 2H7WA 3GJFA 2NYZA 1IBFA 3F6IA 3W56A 4AH2B 3FC8A 3BN9C 3SPCA 1KB9K 2AJSL 3IJEA 4R90H 5BCAA 4H2AA 2Z35B 1DJSA 2AJZB 4HFUL 1NICA 2IANB 5DJAA 3CZKA 1XO8A 3FULA 2HRGA 3EGDA 2CHWA 2H6PA 2VXSH 5BZWA 3IB4A 2B1HH 1BEYH 3CDGB 5EU5B 2PCYA 1OAZL 3TU6A 4FXGC 2E74C 1NH6A 5DD0L 3UYPA 4DW2L 3KD4A 3VI4F 2ICWA 3ULUH 5FW7A 3ZRFC 4QHMA 4K07A 4BFKA 4MQ7B 1UZ8A 5DJDB 4BFIB 2GITA 4PBWD 2ZKHH 3BEWA 3QRLA 2OM5A 4UOZA 1YN6B 3G08A 1OIOA 2XUWA 4NN7C 1E4HA 3MKKA 3UTPE 4LGSB 1AQHA 1DCLA 1FZMB 2QVFB 1BOGB 3P73B 3DPDA 1MQ8A 3FCGA 3E6FA 1RZJC 4WI9A 3DIVA 1R5VA 4MKMA 4KV5F 2ZWYA 4XBMA 2LTQC 4GH7B 4FQJH 1G9MC 4Y19E 1XV8A 1IKNC 5F44A 3EYVA 1FI8C 4XP6L 3QK0A 4IBLT 2B5IC 4PJCF 3UBXG 1U8NB 4PEEA 1MRDH 1TCMA 4P4RB 3K7UA 3V9EA 1MCIA 2CSPA 2ZUUA 1U92A 3WEBA 1S7WB 3BRGC 4TLUA 2XTJB 3CUPB 2O93L 1IGMH 3W9EB 3WKMH 4ZYKA 1JWSA 4KJWC 5C3TA 2P7TA 2JKTM 4M29A 2H41A 3PWVA 2VIRB 4XOBA 2AQQA 5DJYB 4EOWH 5ABDE 3VI4E 3EADA 4KDVA 1KBPA 3S37X 1WBZA 2WZAA 3QUYD 4WI2A 3NEXA 1DVQA 2P8LB 4NJAL 1BGXL 3MRNA 3AGVA 1BHGA 5AZ2H 1X3DA 2J55A 3HG4A 3U4BH 4L3CB 4UZGA 1AE6H 2NUTA 1NDTA 5E6RB 2NZIA 4EQ3A 1JZDC 1A2YA 1U30A 4MS8D 1PY4A 3FT2A 1PZCA 4NWTL 4EUPH 1KJ2A 1DSYA 2OSLA 3IJ8A 1PKQE 2XV2A 1UA7A 1CQKA 2FK9A 3AXIA 5MEOB 1FYTB 3PQYA 3WIHL 3AMKA 1HXYA 1G9EA 4MJ6A 3DJSA 1Y7VA 3IFOB 2HPTA 3CZFA 3JTBA 4HPOH 2N1KA 3ZTJG 4WFGD 2WLYA 5TQ0L 1RURH 3S34L 3SDYL 3S5LB 3S6CA 3KYOA 3VW3H 4UOW0 1WQVT 1CUOA 2YLHA 3EO1B 3D0VA 1D5IH 3ARQA 2W9EL 2CJSA 3JQOB 4QOKD 4F91B 1MCFA 2B2XL 4NZRL 4X0KB 2J1WA 1WHPA 1BVKB 2YAEA 4FQCL 5GZND 4GAGH 4O9HH 4GQRA 5HDQH 1VFMA 2Y07H 5DYOB 1DVSA 3HNVL 3RU8L 4S1DC 1L0YA 4GMTL 2EO9A 1F4YH 3H42L 4LSPL 2XVKA 1TITA 2IDUA 4F33A 3QEUB 5CD3B 2FL5A 4OCRH 3QB7C 3JV6A 1QVOA 1CPUA 1QFPA 4PJDA 5JHDD 2VRKA 4MX7B 2YJQA 2DD8L 1ETZA 2CG9X 2G2NA 1UCBH 2K0RA 2JKLA 4LBEA 2P8MB 4NC0B 1GA2A 1EEUA 3FQYA 5KOVC 1R3LB 2VDPL 3MJ9L 1I9JH 5DS8A 2JELL 3KPNB 2WZPD 5JQIB 9CGTA 2YMXH 3GLDA 3LCYA 5EBWB 5FA4A 2EECA 3BD4A 3LQAC 1MW1A 4OFDA 5AW9B 3C2AL 4YBLC 1HVXA 1EDQA 5D55A 2NYYD 2W0LA 3OV6A 3WFCL 3GZOA 1KIPA 2XKUA 1QSFD 3U7YL 2ATPA 2QFRA 4ZW3A 1HI6B 4OAWA 3SBWC 5GRZA 3C6EA 1A3LL 3LRMA 1MZZA 3NFSH 4F80A 4NS0A 4TV3A 3V0FA 2XTLA 4U3HA 2B3RA 1TCRB 2VE6B 2XX0A 3A5VA 1G6RA 4XNXL 4EIGB 4OT1L 1QA9A 3TZVB 5FUZH 1IARB 3SDCD 4ZMQA 2ZCLL 2NXZD 2FE0A 2HT3D 1RZ8A 4JO3H 2GSGB 3ZPDA 5KVDH 1DVFC 3NQIA 3VXSA 1C12A 2NY0C 4I88A 5F7KC 3FN3A 2IFFL 2XYBA 2UXTA 1E42A 4J3OD 1OB1B 3L9YA 4LIQE 4NUPA 3VXTB 4OBSA 1CK0H 1OPGL 3VQLA 4PGJA 1FWXA 4HKJA 1OW0C 3EYUL 2IPTL 1GGBH 3K0WA 1U36A 4FXGB 4JFFD 5EN2A 3ZQXA 5I1CH 3BP4A 3K2UH 3PLYA 1BFSA 2FZ3A 2XXFA 3PUCA 4UDUA 4Z7UA 3VXUE 4FD0A 3HVDA 1ET7A 4PRPE 2VDKL 3PP4L 3R8QA 4D3CH 3AB0C 5JHBA 1BZDA 2YA0A 4PJEA 2X3AA 4IHOA 1J0HA 4XCNB 3EJSA 3IFPA 3PPEA 4I77L 4OU3A 4RRPA 3ZL4H 3DVGA 1R3JA 3QG6A 4ZUUA 1LO2L 3LKQB 1R5WA 5L0QB 3NCJH 2LTQB 1QHPA 5GRVL 4QKXB 2R9HD 3VD3A 1MW0A 3X1BA 1RMFH 4A2LA 1J0JA 1T89C 4PW9A 2FSEB 2Y7QB 4ZTOH 4PW4A 1YYMH 4PJ9D 1IGJB 3IDMB 1IFGA 2WO3B 2YQGA 4EUPB 2VJ8A 4HXBL 1CVSC 4PGCB 4WGWB 3KGUA 4GG8B 1WBXA 3BYTA 3KPSD 2L0DA 3FB5B 1TJGL 5BJTA 3MYZA 1QBAA 2O5NA 3F2LA 1KYOJ 5D6DC 5JQHC 2NT0A 1P4LB 1EJOL 5LGHH 4UTCA 1CLZH 1Q0XL 3APCA 3BKML 1AJ7H 5A40E 4HEPG 2BHFA 5I1GL 4Q9QL 1MAKA 4NPYA 1AKJB 2XTSA 4N86A 4M43H 4K9JA 3RDTA 3SGJA 2BZ7A 2DTML 1QEWB 2YO3A 4U2YA 5TK2A 3U36A 3AT0A 2BFVL 3MLRH 3CBKB 3FKUS 4G8GA 5KVFL 3WOVA 1JD7A 1FLRH 4YNYA 1MRCL 3UIYA 3HMWH 1TJHL 3HC4H 1FAIL 3T08A 1N0LA 3DJZA 2YD3A 4RISL 5C0AE 2GKIA 5F3BB 4J8RB 1BXXA 3CXDH 3U9WA 2BK8A 5KJ7E 2D3NA 4PJCA 1FL6A 1RJCA 1ZA6A 2XZAL 1TMQA 2Z4QA 4L37B 2GJ6A 2BNQA 5IQNA 4XN9A 1ZWIB 2Y2TA 3RL1A 2ZX5A 2V9QA 2VR6A 3KXFE 2J8UE 1YNLH 3BLPX 3V6BR 2OXGB 3WLBB 2B39A 1KY6A 2OMUB 3MV8A 4KRPB 2G2RB 3ZDYE 1U2YA 2HH0H 2O4EA 5FO7A 3ZDYB 1IFRA 4M48L 1FFOB 1CYWA 1KXTB 1NC2D 4B0MB 2X10A 1NMAH 3NCWA 4Q52A 3ALXA 5JPNC 3KPRE 3KPRB 2D7OA 3B5TA 4KK8C 3U9PL 1JDAA 4BFEA 4Z9KB 2FR4B 3K72B 5E1AA 4OF3A 5EV7A 2PYEE 3FFOA 5FKAB 1E40A 5D71L 2X9XA 3ZHKA 5DRWA 3QIUA 5DMGD 1AY1L 5AD0B 2UZXB 4O2FA 5E6SB 2E7MA 4ATTA 2KHAA 3UJJH 4MB5A 1SJEA 2XV0A 3KM2A 4CU6A 4UZSA 3V0JA 2R0ZL 4LLMB 4WHYG 4FI7A 2APSA 2Q8BL 3AT8A 5EFIA 3FSOA 2OR9L 2NRDA 2P42B 2X4RA 3EOTL 4K71B 5D70H 1ULVA 4Y5YB 2YUWA 3TOPA 5E94A 5E99L 3PF2A 1E2WA 1PQZB 1YEEL 3ZHNA 4R3SB 1G9NH 4BQ9A 1MCLA 2QKIB 3REWB 3Q43A 4ZX5A 3SO5A 1F90H 4P3CL 1Z32X 3MLWL 2COQA 5K39A 3VXPB 4H1LA 2L7EA 4N6RA 1Y18B 3C6LC 3L81A 3OHXA 5T8IA 2XPGB 4N2HA 4R90L 3RVTC 1QWHA 4AK1A 2RGSA 5D1QE 4AVJA 2VDNB 4EI5D 2VXSL 5KYWA 2B1HL 5IKCA 3KPLB 3FT4A 3RUGE 4WHTB 3RUGB 5J13C 4RAVB 1JZEA 1G84A 2PN5A 5KG9B 4CL7A 3GM0A 4UNUA 1WH0A 3BX7C 5E8DH 4TVPE 1RUPH 3D39A 3FO2B 1DBAH 3KLAB 4UT9A 3NP3A 5F7AA 3S48A 3OF6A 3VFGH 4EIBA 2AKRA 4G8AC 1L4IA 5JMOC 5F1OB 2FCBA 1G9HA 2PTTA 3NK4A 4NQDA 3T6ZA 5IFJA 2ZKHL 5E9DA 3T0AA 3O9WD 4GAYA 4JUSA 4HH9A 5DK0A 4QRRD 2VDMH 3KLSA 5B3JF 3Q2NA 5EEVA 2D3LA 4S10A 5MP6H 4LVOB 3O3BB 5FF6A 2AJ3B 2K3TA 4XRCB 2BSRA 3UG5A 2X87A 4Z3HA 1LE5B 1U4FA 2VL5A 4FQJL 4K7FA 1A66A 2HMIC 3B8SA 5C2BH 1YQ2A 2PWGA 2BSCA 3C60A 3O41B 3ZDZE 1Q9OB 3TEXA 4X6EA 4MXQD 3SGKC 1QQDA 2X2JA 1MRDL 2VN5A 3EH5B 1F3DJ 3OXRB 5GGSA 2D9CA 2P48B 4YBHA 5CU9A 1MF2H 4NIYE 1IGML 4L5FE 3WKML 1A6TB 1IC4H 4PRAA 4C56A 5CIPB 1AGBB 4WWPA 3BW9B 5DUJA 4KK9C 3WN5B 5IEKA 4P2RD 4EOWL 1GXEA 1YJDH 1WFNA 1OCWH 4Q4EA 3HBGA 5CLWA 2H9GA 3LNDA 5AYTA 1L0XA 2F6AA 3FU8A 4BKLB 1KSRA 2A73B 1S78C 4JM2D 3K1DA 5LBVA 4AEHH 1DQDH 2B1OA 5KSBE 5FGBC 3RWHB 1UD5A 5AZ2L 3SQOH 2J2ZB 4IRJA 3U4BL 3SQRA 1AE6L 2WIIB 2AVFA 2CA3A 1R24A 4FFWD 4Q6IA 3MR9A 5GGUA 3F05A 1VLXA 4U1KB 3RTQB 1T1YA 3AWFA 1I75A 1M1XB 3PNRB 2F74B 4GG6A 3IGAB 2VLRE 1UJ3C 1RIHL 4WO4D 4JO5A 4EJ1C 3SGEI 5MENE 5MENB 3ZJAA 4N2EA 1KUMA 5JW5B 5KVMC 5ERWB 2WTRB 3GINA 3OKLB 2H1PL 3ARFA 3FAWA 1COBA 3SD2A 3QORA 3MLVH 2QGDA 4ZUTA 4L1HA 5DO2C 1LEIB 4X5QA 1G1KA 3K1KC 3ELQA 4HPOL 4WFFD 3X14B 2OX5B 3I02B 2NMSA 4IQHA 3PAUA 1LP9F 1RURL 3MRQA 4GKSB 4DQOH 1P1ZA 3O8XB 4HMDA 3VW3L 3KS0J 2RR3A 4JZJB 2NW2B 3MUZ1 1W72H 1D5IL 3NG5A 4LHQB 5JOPD 4XN2A 3PREA 4FLHA 5J6SA 2Y2WA 3VMNA 4H8PA 5HDQL 4ODBD 4O9HL 4R26H 2Y07L 4APQA 3D25B 3TXAA 5IR1B 5E0QA 4Z7QB 3QHTC 1JNHB 2HSIA 2HT4C 4OZHA 4HK3N 2WHVA 4U7SA 5I74C 4AGOA 1F4YL 4A38A 4B9PA 4XO3A 3WEAA 1KEGH 1SBBA 2DKSA 5HDBF 4OCRL 2WKGA 1D3CA 4PRIB 2RFXA 3MRDB 3U0WH 5H4ZA 4FG6D 1UCBL 3VWJD 2YHGA 5FUOH 5JPNB 4PRHA 1WD9A 2MNUA 2XG5B 4JHVA 1UEYA 3K5RA 2JJTC 1I9JL 1Z5LA 4O2EA 1I3RA 3BQUA 2JI1A 4OBRA 4J6RH 5HJGA 1QBLH 2VAJA 5T1MA 2IALA 1NCCH 2YMXL 4B6ZA 1OCRB 2HN7A 2YXVA 4Y4FC 2MMXA 3P11H 2AXFB 5GS1A 1IQWH 1F2QA 5DQDH 4WK0B 1TTBA 4FMVA 4WTZG 4OCSH 4Y9FA 1HHKA 4HGWB 1UXSA 3O4LD 1M57B 4M61A 1D6EA 3I84A 4P5MA 5ID0A 3MNZB 3KH4A 2OTUB 2HUEA 3NFSL 4OGXH 4PU2A 4K8RH 4L4TD 4HK3J 3KPOB 2R69H 4PY7B 3K6SA 3FBQA 3CLWA 5A2BA 2G5UA 3NABH 5FUZL 2EXYD 5I8EB 3QDME 4TTDC 1QSED 4BYHA 4CC0A 5KYNA 4DP2X 2VDMB 1JGLH 4JRYE 2R29A 4JO3L 4JRYB 5KVDL 3G9AB 3J27A 12E8H 4X4YA 5DEFB 5HHOE 1UKSA 1W8EA 1A9BB 1EZSA 4Z3GA 4NJ9H 4UUJA 1CK0L 2VLMD 3G9VA 3W0WD 4J3SA 3O45A 1A65A 3OC5A 1Q9KA 43C9A 1J9SA 1UZ6F 2NY6D 4TLTA 4G6AD 1GGBL 3QAQA 1S8DB 1G7MB 4GAJH 4LDCA 4PS4H 5J13B 1QRND 2VLJD 1J8HE 1J8HB 3K2UL 3PL6A 4RMVA 3VG9C 5KYUB 1AQ8A 3AQXA 2IDQA 3LZRA 3LYRA 3RL2B 4D3CL 1NMCC 2EVJA 4GRMB 5EEUA 3DNKA 3L9RA 5IHBA 4JR9H 2HB0A 2YD1A 5FIEA 4EI0A 4ZMTA 3ZL4L 1C16A 4YIQA 2Z8SA 3ILPA 3BAJA 3HZVB 3P9WB 3EH1A 4GUQA 2HG5B 2QDVA 4KC3B 3NCJL 1BQHB 4KKLD 4F7MA 4P06A 1RMFL 3HC3H 2EXSA 5GGQH 5LQBH 5KBPA 3F04A 4CW1B 3ARDC 3V95A 4ZTOL 1SDYA 3WIIH 4K4KA 2NXYC 1YYML 2YD9A 3KGSA 1I4FB 1GMIA 1A64A 3DHUA 3FU7B 4NQXA 3S97C 3DX7A 4U3XA 3ES6A 3D34A 3PJLA 1SFDA 2A0LC 1ZA3A 5IQ9B 3UGEA 4BIKA 1OLLA 3MV9E 3MV9B 2F53D 5T5FA 1HHJB 3ZTNH 2IAMA 4GJTB 5LGHL 3UAJC 1NEUA 1ZT7A 1CLZL 2AEIT 3DX0A 4KJQD 4K94H 1AJ7L 1RJYB 3EOAB 4PUBH 2DMGA 3U4EB 4V1DE 1IEAA 1EEQA 1TVBA 3WNPA 4RSVA 3QIBC 1U8CA 4M43L 5E8NB 3L5JA 2ED8A 2VABB 1C08A 3QWOA 2XZZA 2L04A 3QNZB 3MLRL 1KGYE 1DQVA 1LO5B 3PABA 1FLRL 4MSWA 2F7QA 3HMWL 5BS0B 2IH1B 1J10A 3HC4L 2DQTH 3H54A 4MD4A 4PJ7A 1B2YA 2YPKB 4M9OA 1ACZA 3CXDL 3D69A 1X9UA 2R4SH 1TVHA 2W0FB 1CG9B 1XF1A 1M2VA 3GXPA 4WQOA 2QR0A 1NCOA 2PCFA 4YSCA 3QIWC 3WFEH 4TNVF 5EUKB 1YNLL 5HY9B 1QACA 2YA1A 2ARJB 1YN7A 4I0PA 1BFOB 1UWFA 5C0CA 2OSYA 5EUOE 2HH0L 2IADA 2JQMA 2X6BA 4NZUH 4ELMB 4ELME 5E24E 1NMAL 4FKEA 3RJDA 3N04A 5B3NA 4FHJA 5HI3C 2C5DC 1BJ1J 3TPKA 3CC5B 5DMKB 3VH8G 1RLBA 4GXUM 3WXWH 4F15C 4Y1AA 3SJVD 3B5HA 4M8RA 1AD9A 3S3SA 3RIFK 1SBSL 3SKOA 1EEYA 3OXSA 2EIDA 1KLFB 3QC6X 1Q90A 4NFDA 1JZ2A 4G2AA 2XNAA 1SLWA 3QDJE 5C0NC 3UJJL 4D94A 4XWGL 4YDIH 3KH3A 2KLSA 2BCMA 3FZUC 1PMYA 5D1XA 5C0IB 1NA8A 3HZMA 5FYLE 1V7MH 4JKNA 4XH2B 5D70L 2ENSA 1KCBA 3ZGIA 4E9YA 3MRRB 3QPXH 3T0EB 3FB8A 3NJJA 2XBZA 4XMKH 1G9NL 3QSKB 1BIHA 1L3WA 2X4OA 1LK2B 5IW3A 4IGBC 1IJNA 1LP9A 2DN7A 4L0YA 4W4OA 1SUHA 1F90L 2B0SH 2E0PA 1BMWA 2RMNA 5EU6B 3UGXA 5HHNB 1DEEA 5LCVA 4KFZC 3F5WB 4L05A 4MJ4A 1F4WH 2G3ZA 4P3DA 1F11B 1KJMB 3L1OH 4OM1H 4ZO8A 1KYDA 3MROB 1KT2A 4IOIB 4LBAA 5CP3A 2DL9A 2J44A 2VYRE 3D85B 3QA3A 4F27A 3WJMB 4QO1A 2Y1AA 4JDVB 4Y5VC 2CKBA 4PJ8D 2X1XR 3SPVB 3UGUA 5LWYH 2JKXA 5JW4N 2D3JA 5CLZA 3L2MA 2ALWA 3IT8D 1LE9A 2KPNA 3BAKA 3TFBA 5AAMC 1N68A 3N0PB 2PWFA 3FMGH 5E8DL 1NBYB 1RUPL 2NDFA 5DVNA 1DBAL 5D7JA 1ZXQA 3ZRSA 1K2DB 1NKRA 4G5AA 3N6YA 4XHQA 5A43C 3CFEB 4LHUA 3US9A 2Z92B 1QASA 4APXA 2VDML 5I2IB 4Z18A 3CBRA 3V6FB 5MP6L 3AGWA 3ROOB 5I66A 1RH8A 3GS4A 3AG4B 2HXAA 1T5KA 3CSPA 3MV7A 4G9FB 4F7EB 4ZX4A 1T6VN 2Y9RT 4F9LC 1HESA 1R34A 2BNRD 1H6TA 5C2BL 2EDEA 1SOXA 3WDHA 2BVOA 3INOA 1ID5I 5JO5B 3G7TA 2EYSB 3EDEA 1AS6A 3MRLB 2X28A 5DA4A 2QVIA 3M1OA 4LARH 3MU3A 1MF2L 1CFSA 2KT6A 2BVQB 4IRZA 3EJZC 2V8LA 1IC4L 2P46B 1N6VA 3DK2A 1KNOA 1KIUA 4NKDA 3LN4B 1YJDL 3AG1B 5I30H 3AABA 4OJDH 2CDGB 4FAAB 2AQ1A 1D9KB 4JFOA 5I24A 4MHHG 2NXYB 4Y8AA 3SDDA 1DQDL 4AEHL 3H1ZA 4P57B 4MZ2A 5BW7C 3K81A 4LP4A 3SQOL 4GBXB 4LAJH 1VZIA 3DBXB 5AOMA 3MRJB 1T1ZB 4NERA 5ICYA 3TLRA 3Q6FB 3B7RL 1ERNA 2QEJA 3D52A 5HHVH 5HPMA 1DUYA 3BWSA 4HXAH 1P7QA 5EBMA 3A24A 2NYKA 3V9FA 1WTLA 3CH1B 1KCRH 4EQ2A 4P4KC 3T8XA 4HUUA 1I31A 3IGUA 2D0HA 4NBZB 5AW6B 1QKZH 3A4FA 3BZ4B 2YGVA 5JTWA 1DJIA 1HSBB 1TTFA 2RB8A 2WBJD 3QIBB 5TQ2H 3GGWA 3MLVL 5CHNA 1BV8A 4Y1SA 2NY1B 1ECYA 2E9GA 2QKSA 3KWWA 3JWOC 1A4BA 4OF7A 2A3TA 2YR3A 1KB5B 2XIDA 2ZD0A 3CK0H 2OYPA 4DQOL 3L6FB 3S36H 1IX2A 2VITB 3GJFH 5F1IA 3BPCA 1NLDH 4R96B 1W72L 2AK1H 4KHTH 3GPSA 5B7MA 1OALA 4H44C 1R3HB 1N7MH 5DUBA 4DCQB 3VWKD 1UM6H 4R26L 3V4PA 5I1DA 3QAZB 4PD4K 4C55A 3TT3H 1MI5D 4LSSH 3LNHA 1W0VA 4JO8A 3KL5A 4L4VA 4JVWA 2N7BA 4HKXB 1KLUA 1DQJA 1C1EH 5L2KD 3FFCA 3U0WL 4C4KO 2G30A 4UM8B 5FUOL 1ONQA 1EAJA 1GSKA 3DTXA 1TQSA 3NQKA 3SHSA 4J4PD 1ZEAH 1F4AA 5I71C 1XGYH 2GAZA 2WBKA 4I48B 5LN4A 3DXAA 4XMZA 2CUIA 3HKZA 4J6RL 3U1SH 1MHHA 1QBLL 2F54D 5HGBA 1NCCL 3GSRA 4OGAC 2WGXA 2MNJB 1ETB1 3BVNB 3P11L 5KSVB 4UWQB 4R97C 1O9WA 4JN2A 5J6HB 3C9NA 1IQWL 4MYWB 4BK5C 5DQDL 1PDKB 2O72A 4KDWA 4JCLA 5IF0B 5FO9B 1BBDH 3VFPB 4QJ5B 1FFNB 1IGTB 4OCSL 2HLEB 3KYNA 2OMWA 2VOTA 1O6SB 2JWYA 4E5XA 4P2OC 2BSSA 4OGXL 2YSSA 4QRAA 4K8RL 5ABZA 3QUXA 4MAYA 2R69L 4L8BB 1LMIA 3T2NH 1FFRA 5HYFA 1T03H 3I9PA 2PWDA 3NABL 5DURD 1ZLVK 3QFJD 3VRLE 5EO0B 2YUZA 2OMZB 3CVBA 4MMXC 4DKFH 1WFJA 3HKFA 5KVEE 3CHXA 3PNWB 3U0PB 2VKXA 2AQRA 1JGLL 2UYLB 3VGAB 3AM8A 12E8L 1TFHA 3E1F1 4FTVA 4LLQB 4ZAKD 4UIMB 2X4UA 4MB3A 3NYKA 4NJ9L 4LMQI 2Q8AH 4ANXA 2VWEC 3GMOB 4B60A 3O4OB 1KJ2H 1S9VA 3NJGA 3K71A 1V3MA 4UM9D 2IG2H 2IOOA 5IHUH 2WQUA 3T3PE 1H6UA 3JUZA 4GAJL 4PS4L 3V52H 4KNTA 2EXWD 3OAYH 5DEZA 5DWPA 4OB5H 3D12B 5EN3A 1SYVB 1U21A 2DQGH 1T66D 2OW7A 1R46A 1NAKH 5MI0C 4N0UE 4HD5A 2FSDA 4JR9L 1G7JB 5IV2A 1JZHA 2GSIA 2N1TE 1WS8A 4YSAA 4XNQA 1RUAH 3MODL 3ZW3A 1TDQA 4H25A 7PCYA 1F42A 4GUPA 4HALA 1RPKA 1WFMA 3GMPA 4JY4B 3ZGHA 4BQ6A 3GC3A 4HKBA 3ULVF 4P05A 3HC3L 5DD1H 5DS1A 5GGQL 4HLEA 3TVMA 4HUMB 3AY2A 1WUNT 4WU5A 2KLRA 3WIIL 2HA1A 3NRFA 3RZCA 4JGMA 1VEOA 4L9DA 4YPJA 3VX1A 1YNTB 1DL7H 3KYAA 4JFDB 1XTMA 3P54A 3TA3A 1DJZA 1GJUA 1UOKA 3BHBA 4M5TA 4JE4B 4I2XB 4J3VA 4OJFH 4H0IA 2ZQKA 1E50A 2Y69B 3L1EA 5ICZA 2H3NA 5D2LF 4PLJD 2CE6A 1CXFA 1XBDA 2P5EE 2P5EB 2XN9E 3AWGA 4P5TA 3MJ8A 3ZTNL 3PHOB 3UTTA 3B9AA 3D05A 4C4KT 4LLDA 1JL8A 1JUFB 4QRPA 5KYYA 4K94L 2PO6B 5GS0C 3W82A 1Y0LA 4PUBL 4E41A 3L3OC 3VXQB 3P4NB 4JG9A 3UZVB 2EC9U 2YAOA 2FEDC 3GJFB 3UTSE 4LFHG 2BINA 4RX4A 1ORSA 2WVVA 1BVLA 4TYUA 3IJEB 3BE1H 4QRSA 5IHWA 3V79C 2ZONA 3IS0X 3OB0H 2ZF9A 4PTTA 1YY9D 4QY8B 2XRAH 2DQTL 5DJAB 2Z31A 3EGDB 1BQUA 5CR1A 5BZWB 5TDOA 1V54B 2R4SL 3SCMC 5B4MC 4H26A 4AC2A 2HVKA 4FQHA 4MJIA 1RJLA 3QEHA 2I7SA 5TF0A 3UYPB 3KDMA 4PGDA 3B1UA 1G6RH 1HU8A 4QHMB 5D72H 1AR1B 1U3NA 3WFEL 3I9AA 5D4IA 1UZ8B 3D1MC 4DP0X 5D2LE 5D1ZI 2Q7NA 2OPCA 1I1FA 2XTJD 4Y5XA 5I6KA 4AGNA 1YQVH 3HJEA 4H7VA 4NZUL 4X5WA 4P46D 3WIAA 1QX1A 1NCUA 1X5AA 3N91A 1R5VB 4RMUA 2Y7OA 1L5GB 3TJHC 4I9WD 1T7YA 5AVVB 4WWOA 3EYVB 3O6FC 3WXWL 5E2JA 1L6PA 3HG1A 5E2VH 4GSQA 1J9QA 1MCBA 2G0LA 3HS0C 4KUCD 1JF1A 4WNSA 4QGTA 4ZYKB 2J12B 4X8GA 1JWSB 1YYCA 4YDIL 2D0FA 1IIIA 2CK0H 4LVNB 5JPMA 1FQ9C 3PWVB 5BV7H 1TZHA 3SGDH 2E7DA 3DROA 3QDHA 3TCLA 2IEPA 2ODHA 4AT6A 5IOKA 1FYTD 3HB3C 4ZMAT 1S4IA 1WBZB 3C5SA 2X1PA 3QPXL 4AIZB 3IXAA 1TQTA 4XMKL 3HNTL 2VXVH 3MRNB 3NIDE 5KBDA 3IAPA 4GMSH 2DF3A 3T0DA 1UA6H 2BPBA 4ZPTA 5K1JA 5EEZA 3FSZA 4M3KB 4RNRB 2V33A 4U1IA 1ILUA 2B0SL 4NBYB 3RDTC 4E0RA 2NUTB 3BT0A 1PVHA 1JGDB 1A2YB 2X05A 1XEUA 3FT2B 1F4WL 2ERJC 4ILDA 3L1OL 1KJ2B 2IVFC 4OM1L 3UH8A 5J89A 3SPGA 2OSLB 4DNLA 3LRLA 4AW4A 4U33A 3ECVA 1OCZB 3PQYB 4DVBA 2K4AA 3JVGC 4IOSD 4F8NA 5LWYL 3LB6C 2JB5H 1HXYB 4AW7A 3L4ZA 4MJ6B 2CAKA 1OARH 3I6LE 3QZLA 1UC6A 2HVBA 3CZFB 1UQSA 1NJ9A 2JV6A 5I0DA 3FMGL 5DD3L 1EWHA 1T7VA 4JM0A 1JV5A 1WDAA 3WIFA 5LVEA 4BBWA 3KYOB 2MSPA 4U1MA 4PG2C 43CAA 3ATDA 4KQ4H 4LQ1A 2VWEE 3D0VB 3MBEC 1P69B 4UV7H 4XCFH 3BUDA 4ERSH 2Q2EB 3IGKA 5JOFA 4UT6A 3SY6A 3LMJH 1G7IA 2IFGA 1FZOA 3E38A 4HUCA 4I87A 3QUYA 4ZDHA 1WFUA 4PLKD 4XNAA 2FL5B 1E4XI 4JHAL 5TTRA 1QVOB 1AGCA 1DQKA 1RZGA 2EUWA 1ETZB 5DZAA 1UD2A 4LBEB 4LARL 3K3QA 4GEJA 3ZLQC 3I9GL 3BWUF 4AMWA 2A83A 4KO9A 3DIFA 2WZ0A 5DS8B 3SQBA 4ES8A 5I30L 5KSAC 3VD0A 3ULUD 1PY9A 5FA4B 5HHME 5HHMB 3EFDH 1MLBA 2A99A 1MJ8H 3MCKA 2EZ0D 3WGUB 1G7QA 1PZUB 3H0TA 1SMAA 1ZE3H 2X12A 1PAMA 1PIGA 3I6KA 2ATPB 3FQ2A 2HJLA 5IG7B 1RK1A 5HHVL 5DSCA 4HXAL 1AGDA 4MJHA 1KCRL 4Y16C 3POHA 3EYSH 5K93A 4YFEA 1G6RB 4Z3EA 4IK6A 3RRQA 4B3EA 4HIXH 1QA9B 4QOKA 5DZNA 1QKZL 5GZNA 2DS4A 3H2PA 1VFAA 1MIEH 4GYBA 3MMEA 5IW1A 5TQ2L 3OM3B 4E36A 1A02N 1RZ8B 2OTWA 2EKSA 5I8CA 5CF3A 5MHSD 4B96A 1WWBX 1C12B 3LXAA 4L3FA 2F1EA 1DJWA 1DSFH 2CO4A 4YHIA 5EZIH 2YBRB 3BWZA 5F7DA 3ERXA 1B9ZA 5CAYB 3CK0L 3S36L 1F58H 4H1LH 4AGPA 3K6IA 4A2GA 1Q4NX 2AK1L 3CVIH 3QJHB 1I9IH 3IRZA 5EN2B 4A39A 3BP4B 3MRFB 4UDUB 2FZ3B 4NNXA 5AUMA 4F8LA 1H3TA 1UM6L 3QXVA 4AYFA 3ROLB 2OJEA 2VUKA 1EIBA 4RGNC 3TT3L 2UVEA 2ZUTA 4LSSL 2WO2B 3BAWA 2W9DH 4PJEB 3QEQA 4IHOB 1EUUA 3C2SA 2ETWA 1C1EL 3IFPB 3SOTA 2EDLA 5BV7B 4NLAA 1UA3A 1IAKA 3BGAA 4RWYH 3DVGB 1R3JB 4UT9H 1R5WB 2K7PA 4WUUD 2XFXA 5JNYA 1JWUB 1QSFA 3H53A 5DHEA 1X5ZA 2W0PA 1W15A 5DTFA 1ZEAL 2AJVH 2DI7A 1XGYL 3AU0A 3CV5A 5FM5O 1PEZA 4G6FB 5DJXA 1ROCA 5LLIC 1TYRA 3PHAA 4J7RA 5F6IC 5H37A 3U1SL 4HOXA 5E03A 2E27H 5FS5A 3BEVA 3BXNA 3I2CH 3CSGA 1CI3M 4PWKA 3CZGA 3E1ZA 5FOJA 4NRZA 1BBDL 2ESVD 3UG4A 1WBXB 2FBRA 3VQ2C 5J5EA 4JM2F 5G2NA 5BJTB 1A14H 3N85H 2ADFH 5ESVA 3TCTA 4XMXA 5C86A 3QUZC 1UXLA 5JA8B 3L4WA 1Z1WA 2PP8A 3TBBA 2OCFD 3NDYE 2O6CA 5I75C 4JFPA 1T03L 2Q1EA 2VN7A 1ZMYA 4NPYB 1GC1C 4ELKA 2B14A 2DTSA 2KLTA 4XOCA 3RDTB 2P9RA 3KCPA 4DKFL 2B59B 2G2PA 2V2XA 2MCAA 4Y4HD 3U36B 1DTUA 5K1NA 2O30A 2VW6A 4PCYA 4G8GB 4G83A 2NY2D 1CDCA 4R2GC 4YNYB 3VI3F 2NZ9D 1N0LB 1VAHA 5TF1H 4ELDA 5IZ7A 3P30H 1TEYA 1JSYA 4ZBJA 2VMDA 1KPVA 5K9JH 2JJVA 4GXVH 1QPKA 2NPLX 4PJCB 4XPBH 1FL6B 1VFBB 3QR2A 2IG2L 5DVOA 1Y1UA 3KW8A 2GJ6B 2BNQB 2V3EA 4HGKC 3D4CA 3MO1A 2QELA 5D7EA 3V52L 4QIRA 5KS9F 3CFCH 2JQZA 2XXCB 2OMVB 4OB5L 1JZIA 4ZXBD 4MXVF 4L8CB 1D2PA 5HHQB 3MV8E 2DQGL 2FJGB 3DETC 3GFUA 3MV8B 3TBYA 3ARUA 3LEXA 5FO7B 4LRIC 1NAKL 4B0MM 2ZP9A 4LASH 2ZWKA 3GS0A 1E90A 3BPLC 2JKIS 5I0VA 5JXAH 1F1GA 1RUAL 3TBCA 3KPSA 1X9RA 5E1AB 3ZE0E 3ZE0B 1MZYA 4BUQA 2X9WA 3AACA 4LZKA 3AITA 4L1LA 4X5LA 5DD1L 5DRWB 2FEEI 3QIUB 3BPNB 4O2FB 5AVRB 5HJ3A 3ZKMC 3CHPA 3FF7A 2FLMA 1SJEB 1DL7L 3BAIA 3DRTA 3HAEG 3QQ3A 5DJZA 5EFIB 3VSTA 5DD5H 1PZ3A 3MXWH 1EFXD 2X4RB 4OJFL 1NFDE 1PYWA 5KS9E 2CBTA 5E94B 1U3YA 4POZD 1NOLA 4L3ED 5HTSA 2TSAA 3U82B 2B9BA 3LN9A 5LNDA 1EAQA 3VX0A 4FQ1H 1QEXA 4XTRC 4UBDD 4YC2C 4GI6A 2WYZA 3DI3B 3VFMB 5K39B 1S7VA 2XIIA 5DZVA 2I7OA 4H1LB 1K5NA 3CHSA 3TO4C 3H2WA 4N6RB 1YEFH 3FYIB 4G70B 3LPFA 1OE2A 5EB9A 2PPCA 3BE1L 4Z7VF 5AG9A 2XRAL 4Y16B 1NC2A 4I3RH 5HD8D 2OMXA 5IKCB 3FO9B 3VSQA 3R06A 4LFHD 3U79A 5C7ZA 4P8QA 2APWA 2AMUA 2MNWA 2OXHA 5C07D 1XGZA 3D39B 1GYCA 1G6RL 5E8PB 1LEGA 4GPVA 5D72L 2AKRB 1OO2A 5IFJB 1ITCA 2PTTB 3ETBF 4NQDB 3SDAA 5E9DB 3QS2A 4W9CC 5KW9H 4GAYB 4PV9B 1MCWW 3D30A 4HH9B 1MN4A 5DK0B 3ZSSA 2KZ1B 7TAAA 3F7QA 2R29H 4DO4A 4ECNA 3GUTA 1YQVL 4M62H 1JNNH 5HI4D 1AO7E 4L9LC 5IESH 2OKMA 4B9JA 4Y9BA 2QJDA 2BSRB 1SEBB 1IUZA 5TPWH 2VL5B 4HHGA 2NR6C 4K7FB 1J12A 1MG2C 2HFFB 1WBYA 2P5WE 3EH3B 5I16A 4RGNE 4RGNB 5LGJA 4GFXA 5E1QA 1GGIH 1OT4A 3C60B 4HIIB 4OZ4A 1NM9A 2ZAHA 2C9VA 5E2VL 5E56A 5IROA 4YXHH 1QQDB 3VQ1C 4KMQA 5M7QA 1E2ZA 3QFGA 5GGSB 1I3GH 4NQVA 4DGWC 1X5IA 5A2AA 4YLBA 4C56B 3RTQD 3RVXD 2Z91A 2CK0L 3OMNB 2KZBA 2GIYA 2BOCA 3FN0H 1PJWA 4EDXB 3IJYA 4HULB 4DN4H 5IEKB 3AS1A 4AOFA 4P2YA 1HEJC 1XSIA 4PGEB 2H9GB 3SE3C 4IMKA 1FNAA 3U2SA 3DGDA 5F6IB 5GGRY 4J1UA 2WSKA 3JWDC 2VXVL 5I1LA 4GMSL 5B1CA 1UA6L 1YYLH 5K69A 4PN6A 4UAOC 4IRJB 4N8PA 4HCIA 3MZTA 5B21A 4DGUA 4Q6IB 1R24B 3I75A 3MR9B 5GGUB 2Q87A 1WT5A 4WI3A 4FI8A 4YSRA 1T1YB 4KRLB 1NSNH 1HT6A 3O8XD 5C6PB 4GG6E 2JXMA 3OSKA 3O9WA 4GG6B 1FBIL 4QRRA 1FFQA 2MKLC 3RQ3A 2NX5D 3G6JE 3FQNB 5I6XC 3I3EA 3SD5A 5T5FH 2JB5L 3IDNA 5D8JH 4D8PB 4WHDA 4HIEB 3G5XA 2BY3A 1OARL 2F5BH 4ZUTB 1OP3K 4JUTA 2WVUA 4V33A 5EDSA 3U7AA 3ML9A 3QHFH 4R2GB 1KULA 1PPIA 3ZX1A 2C4FT 3CFJA 3FT3A 3MRQB 3GJEA 2NSMA 1P1ZB 3N43F 4OQTA 3BP5A 4NOFA 2L3BA 1BZ8A 3P3UA 4KQ4L 4PS3A 3CZUB 4NQEE 1SQMA 4UV7L 4XCFL 4ERSL 1AXTH 4APQB 5I1IH 3LMJL 5DMIH 5IWLC 2BIMA 3LDBB 4OZHB 4X5XA 3UBXA 4FQXA 1DQMH 1O5PA 4M4PA 2ZXAA 1CGSH 1TENA 3CDZB 4JM2A 3UZQA 2MRYA 2WIMA 2RFXB 1T4WA 1DVTA 1S3RA 2JE8A 5CZVH 3DX8A 2ITCB 1NCGA 2QLYA 3G3LA 1UWEH 5D1ZC 3MRBB 1A6AA 4OZFH 4UANA 1FN4A 3K6OA 2K78A 3SE4C 5I6NA 3REVA 1C5BH 5H35A 1OHZA 3U25A 3D3VE 3D3VB 2R0KH 2C9RA 2DWXA 1UUSA 4ZFZA 2VDLH 1V3JA 4O2EB 3GBLA 2LU3A 1I3RB 2X5PA 3BQUB 4WO4A 1NFAA 3QARA 5KUMA 1LDPH 1GS8A 4RFOH 2IALB 4PBXA 5T1MB 1X9LA 2HN7B 4WWKD 1WZLA 3EFDL 4Y9CA 1MJ8L 4MMZC 4JGJA 3VI3A 5GS1B 3BISA 3WN6A 1XF3B 4EKXA 5DYFA 1L9MA 3FCTA 4W93A 4NUJA 1L9OA 1UXSB 2DQFA 1BPVA 1FAKT 1WE5A 3KHQA 4M61B 2KPWA 3F7KA 4P5MB 1AQDA 5ID0B 5DJ6A 1OSZA 1ROWA 3QS3A 3EYSL 4PJBA 3K6SB 2G3NA 1NCWH 2AXGA 3HFFA 4HIXL 3FQWA 4IU2A 1WZAA 1SMDA 2G5RA 1MIEL 2N59A 3O11A 2OMBA 2D2CC 4NO5A 4PB9H 1DO6A 3IK2A 4AXWA 2W07A 1U58A 3TO4B 1INQB 2CIKA 1A9EB 4X4YB 1HCYA 1BD2E 1DSFL 3HPLA 5EZIL 5IB5A 4IBQA 3RGVC 2BW5A 3GLEA 4M6NH 1H9VA 5LCVH 4UUJB 4ENED 1F58L 3UP1A 3O45B 1NWPA 5DVLA 4R0LA 1Q9KB 3WTYA 43C9B 2E59A 5CP3H 3T0VA 2FIKA 4RAHA 4YUEH 3U9UA 5BQ7A 3CVIL 3GIVA 3RWCA 4DZBB 4ZFGH 4ZZKA 1TZIA 1I9IL 3RIAK 1XR9A 2CKBH 4JFED 2HRHA 4A2EA 3PL6B 4IU3A 1BX2A 5CXPA 3FH5A 1SOQA 3UCQA 2XVBA 4D9LH 4NDMA 2JNZA 1TQCB 4XVUC 2W9DL 5AVUB 1THAA 1SPDA 2KUTA 3L9RB 3LIZA 3ZYOA 4Z7NF 4DKAA 3GQFA 4L8SA 1YEDA 1C16B 4UT9L 3V7MA 4RWYL 3L95B 2BP0A 1NEPA 2WXJA 3R7QA 1OK8A 1ZHNA 3P9LB 3LNIA 5H4YA 3C75A 3O4LA 2AJVL 4F7MB 4IBSA 4PP1D 1KGCD 3UMTA 2HWZH 1XZ0A 5D7KE 5G4NA 5HYQB 2E27L 2X6CA 5E00A 3I2CL 1DBMH 3N1GC 4Z7VA 1OT2A 1H5BC 3MRHA 5EOCJ 5KN5A 3WLWD 4ZMPA 3B6SA 4HISA 1I1AC 3RA7H 2QQQA 4Z8FH 4XZUA 4NQXB 3DX7B 3MCG1 1RZQA 2HKAA 4OV6F 3QYMA 3KPPA 2Z1KA 4I3SH 1ZA3B 2OCJA 2XA8H 5BS0D 4X6CE 4X6CB 4D2NA 5BUGA 1A14L 1IGFH 3N85L 2ADFL 3RGBA 2R2HB 4IRZH 4MFHA 2IAMB 4N24A 4YE4H 1CF8H 5TFSH 1ZT7B 3PV6A 1NWOA 4BWTA 4WW1A 4CVWA 3CDCA 3O2WH 3CBJB 2DQ6A 3PDGA 5KSUA 2Q3XA 1IEAB 2R1XA 1U8CB 5DQ9A 1JVOA 2VLJA 4XXCA 3IAQA 1M6OA 3QXDA 1C08B 2BS9A 3RVUC 3QWOB 2O6EA 5HYJD 1GIGH 1YEHH 4TUJA 3T65A 2CBOA 4PSRA 2LGNA 4MSWB 1EV2E 1XGRA 2CMRH 2H0JA 3QJFA 2YXWA 4MD4B 4PJ7E 4PJ7B 2FX7H 1VCAA 1IM3B 5TF1L 3D69B 2XG4A 3P30L 1PCXA 1TVHB 5K9JL 1HYSD 1U8JA 4N8CH 4NPJA 1M2VB 2Q76A 4XPBL 3BSHA 4PWJA 4KMLB 1ESOA 2QR0B 2PCFB 1P2CB 3ARGA 5JW4R 1J11A 4LCYA 5ECJE 3CFCL 4Y2DA 2K1MA 1G0YR 4MAZA 1YN7B 3CSFA 5I6PA 5C0CB 5C0CE 1GW6A 2IADB 4GRWE 3I9IA 3AWEA 4JS7A 4CBZA 4HJ1A 4ODUB 1G7LA 4LASL 4FXKA 1LVEA 1BW8A 4K8RD 4Q9BA 5EG6C 2P80D 1X4YA 5JXAL 2OMYA 2CGYA 2F53A 2E7LC 4TPRH 4HS8H 1JPGA 4G43A 4Y1AB 3D18B 1AD9B 2XKNA 2UWEE 1AS7A 4G3YH 1EEYB 4B9ZA 4H88H 4MRBA 3GF8A 2GG1A 1ZK5A 3GXMA 4PBDA 3NA4A 3V4PH 2XNAB 1DCEA 5EU6D 4UQBA 3KPQA 3TN0A 5SWZE 1V10A 1N4XH 2AW2A 4G1MA 2GJRA 3H9HA 5D1XB 3QH3B 3D85D 3HZMB 2D7PA 4OZGE 1YECH 2Z8WC 3MXWL 4M8VA 5DD5L 5FM5M 2IBZY 4H40A 4GSDH 1FP5A 4HEPA 3FB8B 1QG3A 4X4MA 1OV8A 1EAPA 5T1KB 2X4OB 4P23D 4LEEA 4A7SA 3QI9D 3BKJH 1LP9B 3GZKA 5FWQA 4FQ1L 3EYQD 3L5HA 2A77H 2X42A 3HUJA 1T5XA 5KVGE 4QDGA 3MXVH 1E6OH 4P3DB 4AYEC 3HFMH 4HS6A 3ATAA 3P0YH 1QUNA 4OQ1A 4QO1B 2ZX8A 2N7SA 3QJXA 1HQRA 1T1XA 2CKBB 4AYBA 3FU6A 2WNGA 5AKRA 4I3RL 3L3IB 1FVDA 2K8QA 4F1ZA 1WAAE 1DLFH 5CEZE 2WQWA 3KM1A 3ABGA 3Q1SH 1FVEA 4YK4C 2YD8A 5D7JB 5KYXA 1J5IA 2FGWH 5C1MB 3QYNA 3MSPA 1IKFH 3U4AA 3ECQA 4LHUB 2OBGA 1MW2A 3UAAA 1NIAA 5KW9L 3ZDXF 3KWVA 4BSWA 3S96B 2R29L 1GGCH 3SDXF 3CN2A 2GUOA 1S5HA 1DDHA 4M62L 1JNNL 4Z7WE 3T04D 3WNMA 5IESL 2WJ7A 1HNYA 3IFNH 2CRIA 5I66B 4EZKA 3X12A 4F93B 3TBWA 5TPWL 5FM4A 4U4BA 2B16A 4P2QE 4P2QB 5EORL 2ZUWA 5D96C 2DQEL 4N4YB 1HSAA 2K6ZA 1GGIL 2BVOB 1IILE 4YXHL 3NZSA 3O0RH 3NN8A 4X7DC 1I3GL 1AP2B 4AEEA 4OGZA 1CFSB 4CN4A 4D8OA 3US0A 4F7PA 5GZOA 3ARYA 3V0IA 3FN0L 4B27A 1JCVA 3KYKH 4XWOD 1KNOB 1KIUB 3L5IA 4NKDB 4DN4L 3HCVA 3TCXA 2ZOUA 3ZTDC 5DVPA 4RFEA 1NCDH 1BWWA 4UTBA 4M1CC 3BUIA 3EFOA 1ECZA 3TEYA 4OIFA 1V5JA 3DVFA 2CLZA 3RVWC 1DJGA 3HEIB 5B8CC 3SDDB 3EAKA 3M46A 3X1GA 1IJ9A 1H5BB 1YYLL 5F9JA 2JI3A 3FTXA 4UINL 3R1GH 2DMBA 3N5AA 5ICYB 2CUHA 3OJ2C 3RFZA 2XYCA 2L8AA 3SEPA 5HPMB 4HHWA 3VFSA 1P7QB 2F19H 1NSNL 3DGCR 1BSIA 1FO0A 3FDWA 3FJTA 4PPTA 5B22A 3EZJB 4HKZA 3T8XB 4HUUB 5JZ7D 1ETJA 4RFNB 4YHYB 25C8H 5E9NA 5T5FL 2IWKA 4OJYA 5C0JA 3BKCH 1USZA 1Z5HA 5D8JL 1PX3A 1F2XK 4XVSH 3GGWB 5CHNB 2F5BL 3HN5A 1F5WA 1BG9A 1C8PA 4YXLH 1PL3A 3DJRA 3KWWB 4W6YB 5MERA 3PHSA 4PLNC 2WCGA 4R84A 5EEXA 4LQFH 3QHFL 5G5DA 4KXBA 3PDOA 5CZXC 4F37K 1USQA 5F1IB 5ISZD 4TQHA 3PV7A 4FZ8H 4P04A 3ZYZA 2AQPA 4ZSOA 2H1LM 5DUBB 1AXTL 5SWQA 1CGTA 3DSNA 4WEMB 4N2KA 5CNHA 3MGOA 1CGYA 3V4PB 5I1IL 5I1DB 5DMIL 2HJFB 2EUXA 1LJMA 1W0VB 4Z77A 4L4VB 4AUJA 1DQML 4PJ5D 1CGSL 1RAMA 5F9WB 4N90D 4WW2A 3FFCB 2NCEA 2RACA 5CZVL 4JFTA 5FGCB 5JIPA 1UWEL 4AX3A 1ONQB 3QJUB 3VTMA 3DTXB 2QBWA 4D7PA 1C5BL 1UT9A 4NO3B 4A2HA 3LKOA 3BAXA 2R0KL 4KI5D 3UPCA 1CGUA 4AITA 2GAZB 4DTGL 5IB1B 2VDLL 3DXAE 1NCBH 3DXAB 5DHYA 4KUCF 5ACZA 5L7XH 1MHHB 1SJHA 1LDPL 4RFOL 5CLTA 1ZK9A 2C3VA 2FNWA 1NL0H 5DD6A 3C9NB 3V0WH 3BKYH 1JYWA 2HX7A 3WO3B 4UIKH 1KELH 5E8EA 5CBAB 3UADA 2NY4B 2BO0A 2NZ1A 3KYNB 5T3ZE 2OMWB 2P47B 1WG3A 3SZKC 1S7XB 4GOSA 4E5XB 2BSSB 4Y2LA 2YSSB 2AK4D 4HU2A 3QUXB 3L48A 4G1EA 1ZVHA 4MAYB 1U3HD 1NCWL 2WWKO 3GDBA 5CSZA 5BOJA 2V5MA 2ZF8A 3B56A 1YG9A 2W9LA 2XY1A 2Y5TB 3VWKA 4NQCD 2VM4A 1ORQA 4PB9L 3NH7H 4CU8A 1JPSH 1EXGA 3ESVF 2WY3B 4K0OA 4FTVB 3VJ6A 3IRCA 5L2KA 3J07A 3DUSA 1RZKH 2X4UB 5LCVL 5T1LD 3DOIA 4M6NL 1UVQA 2W60A 4WNQB 3WHXB 1BMZA 3K71B 5J0BA 4YUEL 2PTVA 2XX1A 3VD2A 3HA0A 5C09E 4MDIA 4ZFGL 2CHXA 2DEXX 4NI3A 3VGGA 2CKBL 4LCWD 2CGRH 4D9LL 3QNXA 5I17A 3BJLA 2F54A 3WELA 5I6MA 1E3ZA 1ZSHA 4KDTC 4QYOB 2F7PA 2VDOH 2DQDH 5ADOL 2AXWA 4JFDD 3FQXA 1CYGA 1F13A 2CPCA 4TSAH 3RAJH 5IV2B 1L6ZA 2BSTA 2GSIB 4XNQB 4MZRA 1SOKA 4H25B 4H1LG 4GUPB 1ODAA 3GMPB 4JREC 2ZP0T 2B77A 2HWZL 1XIWC 2QV4A 4JPKH 3TVMB 1BECA 1DJXA 4UT6H 5F88B 4FFYA 3RZCB 2MQCA 3ARTA 2IH9A 1DBML 3LQZB 3QFJA 4WTZA 2CR0A 5J11C 2F7IA 4LESA 3G5YB 3IDIB 4MNGA 3RA7L 4Z8FL 3TA3B 3BHBB 1A3ZA 4BCZA 1F4XH 3MNDA 1CR9H 3VFVA 4QHUA 4NZ8A 2XA8L 3BPOB 5ICZB 1JV2A 2H3NB 1JN6A 1P4BH 4HAGA 3GXFA 1IGFL 2FWLB 4DQAA 5DQJA 2LE9A 3K2MC 4HBQA 3MJ8B 4IRZL 4X6BA 3UTTB 5IT2H 1CF8L 3QUMA 4XX1E 4LLDB 4QRPB 5TFSL 3PWPE 5C9KA 3HG5A 4R4BA 1TTGA 2ZPKH 3O2WL 1Y0LB 3DBSA 5GZNC 3M07A 4ZUWA 5JOEA 1J18A 3S2AA 3HE6D 1A8ZA 3SDXA 5D7IE 4HUWA 1ORSB 1ZHBA 1SY6A 1BVLB 1GIGL 2BVEA 1YEHL 2L7UA 4KKCD 1TO4A 4QRSB 3AQYA 4PTTB 3WG7B 1R3IH 2CMRL 2A4EA 4UTAA 4XN4A 4JDEA 2FX7L 3CVHB 2VUYA 5TDOB 4U6TA 2W38A 1DSWA 4GIOA 4H26B 4N8CL 2HVKB 3HIZA 4Y4KC 1RJLB 3QEHB 4AG4H 3DURA 4F3FA 4ENZA 1WITA 3KDMB 4D0CA 4DP6X 4PGDB 4HGMA 4PJAE 2WZ6A 3PGCA 4LP5A 4EN3D 4LVHC 4UQ9A 4IRSD 1XSOA 3D48R 3W11C 5CJOH 2NUPB 2WWKT 3RWEA 1I1FB 4LCCA 4Y5XB 4YGVA 3APMA 1UZGA 5DHVA 4POYA 1B9KA 3MLXH 2XOTA 4X5WB 2CU9A 1DVYA 2V7NA 3F62A 3OLDA 4JJHA 4D0BA 1ZRUA 3VXRD 1BVOA 4NC2B 1NM4A 3ULVH 4TPRL 4HS8L 4IKJA 1H0DA 3WJJC 3HG1E 3HG1B 3C5ZD 1NOFA 4G3YL 4ODWA 4H88L 3FTUA 1K5WA 4MS6A 2VC2H 1QI5A 3DUHA 4NXKA 3V4PL 3SDCC 1DEDA 1JF1B 3IDJA 3FK3A 3NEOA 1N70A 4RVBA 1AH1A 3Q8BA 2HT3C 1N4XL 3IETB 3E8UH 5JPMB 4OCXH 1G7PA 5LAXB 3ARBD 1TZHB 3EDKA 3QZWA 1O9VA 1YECL 3DROB 5EF3A 1T04A 4AT6B 1T2QH 4J3OC 2KYIA 4PJIE 3PQYD 4XXDA 1HKLH 3C5SB 4GSDL 4P2AA 4RZCA 4OJAA 3V6OC 3BDXA 4DP5X 4M00A 2EJ1A 3QQDA 1WWAX 4YDNA 3BKJL 4ZPTB 4U1IB 3ET9F 2A77L 5FUCC 5KANI 1XH0A 5LXVA 4E0RB 5H37H 5IHLB 1HHHA 3MXVL 4BZ1A 1E6OL 3TGXA 1U8KA 4XMVA 5DF0A 1J1PH 3HFML 3CMOH 1IC0A 3P0YL 3WI9A 3ZR6A 4OY9A 2CO6A 3QR0A 1BWMA 2EDRA 1KBBA 2ZUYA 4AQ1C 4LLYA 5FDYA 4JPIA 4P46A 1HC1A 4PIBA 1KYOK 3MLSH 3K8KA 5LBGA 4XP5H 1DLFL 2R9HC 1UQSB 4ATWA 1GOGA 3LZLA 3Q1SL 4AYGA 4YDLB 5E6IA 1T2JA 2FGWL 3ZKSD 3KLHD 1JV5B 1IKFL 1BQRA 1JPFA 1YY8A 3WEMA 4PJ9C 3T6QC 1U0QA 1EMTH 5BRZA 4ZMVA 1L7IH 4CAGA 5A3IC 1BEXA 4U1MB 43CAB 3ISRA 1GYUA 1HH6A 1GGCL 2ZYSA 1A1NA 1AGEA 3WD5L 1P4UA 2AHIA 1Z3RA 3IFNL 3VH8A 3LKRA 2KC0A 5JOFB 5LNEA 1G7IB 2HFEA 1CXHA 1FZOB 2X44D 2ZSWA 4LPVA 4P9HH 3OMZA 2E7CA 1GZHC 3DVNB 2R1YA 1A21A 3QUYB 4ZDHB 1XX9C 5CR8A 5IFHL 2DYPA 3CFNA 3UX9B 1UB5B 2JQAA 1AGCB 5AL0A 3KPTA 3ZMEA 2N0MA 3EJYD 4CADA 1IAOA 3QRGH 4IOFC 1WHOA 3OVUB 1XGQA 3CSTA 1YPZA 3OKMA 3V4VB 4YPGA 1TR7A 5D5MF 5DK2A 3KYKL 4JREB 4QT5A 3EDJA 1BAFH 2A83B 2R4RH 2ZNWA 3DIFB 4XZ4A 3RB5A 3NCMA 3HRZC 2YS4A 5K1VA 4DZ8A 1NCDL 4M1DH 3DYPA 5FV1L 1WC7A 4OV5A 1RERA 3DARA 4IOSA 4WCYH 1MLBB 3MCKB 2WQXA 2WLLA 3H8NA 2J1YA 3CU7A 1JDCA 3PS6A 4OIIH 1G7QB 3II3A 1T20A 3H0TB 3S3CB 3R1GL 3NCCB 3VXSD 3CIAA 1E9PB 2HJLB 3C8HA 3H9SA 1RK1B 3F7PC 4EVNB 2F19L 3VXNA 1AGDB 4IM8A 2X7LA 4X98A 2WB7A 2H8PA 1BP3B 1BZEA 1C5DA 4QTFA 5F0LB 4A6YA 5CGYD 4QOKE 4QOKB 1WVZA 25C8L 5I73C 1KXVC 1VFAB 2QADC 3BKCL 4XVSL 1I7ZA 4H8WH 4N1EA 3GYRA 2YMOA 1V55B 2OTWB 2EKSB 4YXLL 1EJFA 2H5UA 4QXWA 4J3BA 5DMGC 4YHIB 4LQFL 5F7DB 5JHDE 5JHDB 1WAEA 4KVCH 2A9NH 1XL4A 4M7LH 4KO7A 5IVXF