3AZUA

X-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSQPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer(cuproprotein)
molecule keywords AZURIN
publication title X-ray crystal structure of the two site-specific mutants His35Gln and His35Leu of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 34
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1991-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3azuA00
1OV8A 2UXGA 2PPAA 1EZLA 2QDVA 1GW0A 3ZBMA 3KW7A 3FPYA 1GY2A 4DPAX 3NJJA 3NJFA 4WKXA 5A7EA 2DWTA 3FYEB 2VSMB 4QLWA 3HEIB 7PCYA 1MZZA 4KO5A 4N4YB 4NB7A 4GYBA 1A4CA 1ASQA 3H4HA 1X9UA 2XV3A 2FQDA 1NIDA 2AFNA 1BXUA 2BW4A 1QNIA 2HLEB 4AKQA 4DP4X 1A4AA 2H5UA 3IBOA 4A2EA 2EILB 3HB3B 5F7BA 3S3DB 4E9TA 1PZAA 5PAZA 1KCBA 2W8CA 2AVFA 4QKTA 2IH8A 3OM3B 1WAEA 3QJQB 4M3HA 4G7RB 1OOWA 1KDIA 2E86A 2TSBA 2Y1AA 2QT6A 3TASA 3CVDA 3DTUB 1PZBA 4BXVA 1AS6A 4YSCA 4M4RB 2XYBA 1SNRA 4AKOA 4PCYA 3TU6A 4YSOA 3SQRA 4F2EA 2XU9A 3PXLA 2IAAC 1A65A 2IDSA 5B7EA 1GR7A 4F2FA 4CSZA 1ET8A 3FU9A 2OCCB 5TK2A 2XX1A 2HX7A 2GHZA 5D4JA 1V54B 1PLCA 2YAMA 2CCWA 3L45A 4GXFA 1PNCA 1NIAA 4KO9A 1FA4A 2PCYA 3EHBB 1A8ZA 1L9PA 2HX8A 5B1JC 1JVLA 1J9RA 3QQXA 1OE3A 1W6WA 4BWTA 4DP1X 4FA7B 4Q89A 2GIMA 1GS7A 3IN2A 4HCGA 1PLAA 2DYRB 2P80D 2VMJA 5I6LA 1SF5A 3NSCA 4DP0X 2PP8A 2YAFA 2FJSA 1B3IA 5ANHA 1IBYA 4E9QA 1JZEA 3TBBA 3T71A 1SJMA 4G72B 1AZBA 1W8EA 3D12B 1L9TA 1QLEB 3FU7A 2PPFA 4N8UA 4G70B 3V9CA 5B1KA 2Q5BA 1PY0A 2BW5A 5PCYA 3IE9A 4A2HA 2H3XC 5B1AB 4YSDA 4X4KA 5I6MA 3CZUB 2HXAA 2IWKA 1WA0X 2FQGA 3X1GA 1FFTB 1JVOA 1M56B 1NPNA 4YSRA 2X87A 4JHUA 2PLTA 2HZHA 3AG1B 3FQ2A 2BP0A 2XX0A 1I53A 3ZDWA 2XXGA 2UX7A 5AKRA 3T9WA 1X9RA 2B08A 2PPCA 4HAKA 1AZCA 3OQRA 5B1BB 2I85A 1GSKA 3CVCA 1JXDA 4A2DA 4DP2X 2LLNA 1MG2C 5I6KA 1WS7A 1JZIA 5I5JA 4DP6X 1SHXA 1J5CA 1AZRA 3X1BA 3NJIA 2OV0A 3DIVA 1ET7A 2VW4A 3MX0B 5I6PA 2ZXWB 1GYCA 4DPBX 3X1FA 2JFCA 1XMEB 9PCYA 1SF3A 4A2GA 1W6LA 3OMIB 1V55B 1YLBB 1JZJA 1L9QA 1AIZA 5E9NA 3NJLA 4CSPA 2GI0A 1ZPUA 4DP7X 1TEFA 1ID2A 3N55A 1KDJA 2HRGA 3T6WA 3UGEA 3PLYA 5AZUA 5IY5B 1KGYE 1NIBA 3CG8A 2UX6A 3QJSB 4K9JA 4GY4A 1BQRA 1FWXA 1XB6A 2CALA 2TSAA 5I6NA 4YSPA 1PZCA 1AAJA 1L9OA 1ZDSA 4JHVA 5D4HA 3QPKA 1BAWA 3PCYA 2VM4A 2GSMB 1AACA 4BWWA 3FU7B 1RZPA 4E9RA 2YAOA 2VSKB 3UADA 4HHGA 1MDAA 2YAQA 1ADWA 3FQYA 1OCZB 2GC4C 1QHQA 3U25A 2XXFA 4ZK8A 3H4FA 1A3ZA 2IWFA 3OMNB 1WS8A 2BP0B 5TK4A 4A67A 1BYPA 1NZRA 1AQ8A 3AW5A 5I5MA 4E9XA 4BK5C 3AZUA 2BHFA 2HX9A 2UXTA 4BDVA 3V9EA 1SFHA 1AZNA 4BXSV 4W9ZA 2J5WA 3NP4A 3EH3B 3CDZA 1OCOB 2EIKB 4W1TA 3X1NA 4E9WA 3AG2B 4YVNA 3FSWA 3NJHA 1OCCB 3NJGA 4YSSA 1RKRA 6PCYA 1EHKB 1KV7A 1RZQA 1SDDA 1KYAA 4P5SA 1E30A 1XB8A 3FU8A 1PNDA 1V10A 2FQEA 5I26A 4ENZA 2W88A 1ET5A 2MRYA 2J56A 1PMYA 3QJRB 2PPEA 3T6XA 4DPCX 1E5YA 2BP8A 2IDFA 3AY2A 2CJ3A 2QPEB 3EF4A 3T6ZA 5AFAA 1JXFA 3ASNB 1KBVA 4AX3A 1TEGA 1R1CA 5B7MA 2DWSA 3NSYA 1PLBA 1F56A 2DYSB 3SBRA 3FPXA 4UANA 1L9RA 1JZGA 1N68A 2EIJB 3BQVA 3IEAA 1IUZA 8PAZA 2BZCA 2JKWA 4L0PB 3X2QB 3JT2A 3FS9A 1NIFA 2B3IA 3DKHA 1J9SA 3TBCA 2OJ1A 1J9TA 3EH4B 3NSDA 3WNIA 4YSQA 1NDTA 4GP4B 2A3TA 5D4IA 2R7EA 4TXVB 2N0MA 4GP5B 2H47C 1IBZA 4G71B 3QJVB 3C75A 5B3SB 3PPSA 4NAJA 4HALA 1HAUA 2J57A 2I7OA 1GS8A 4AZUA 1MG3C 2NRDA 4UAHA 5EHFA 3ZIYA 4YSUA 2YXVA 1XB3A 3S8FB 4BDVB 3WKPA 3JTBA 3CDZB 4KOCA 1E67A 3G5WA 2YXWA 3T6VA 3UAEA 2DV6A 3PAZA 3S8GB 1SDDB 3QJTB 2EINB 1E5ZA 4PAZA 2ZWNA 5FC9A 4UF7C 2WO2B 2GC7C 1IKOP 3ERXA 2XWZA 2JXMA 3AG3B 4HCIA 2BP8B 1NWPA 4HZ1A 3X1EA 1JXGA 3NJMA 1CC3A 2P80A 1CUOA 4YVUA 3ABMB 3NJNA 4E9YA 2BWIA 5B7FA 1BXAA 2WO3B 4YL4A 1AG6A 3ABGA 1HAWA 4Q8BA 1ZDQA 2CUAA 1JERA 2MTAA 3MBWB 3QJUB 1PAZA 2XLLA 3GYRA 2VN3A 5F7AA 2UXFA 1ILSA 1URIA 1NICA 2XVBA 2XV0A 2IDUA 2FNWA 2IWEA 3NSFA 3AG4B 1BQKA 1J9QA 2ZOOA 2PP9A 2R7EB 2IDQA 3WG7B 2FT6A 3FQ1A 1AS8A 2BWDA 2Q9OA 3FYIB 2UXVA 1ASOA 1KBWA 3BVDB 3FSZA 1BYOA 5B1JA 1CYXA 2VW7A 2X88A 4GP8B 5LDUA 1OCRB 2Y69B 1M57B 2WSDA 1DYZA 3NYKA 1L9SA 1NINA 1HFUA 2BO0A 1PF3A 2PPDA 4AI7A 1IC0A 2QDWA 3SBQA 3NJKA 3OD3A 4HHWA 1ZIAA 2I7SA 3GDCA 3OMAB 4KNTA 2YQBA 7PAZA 1GY1A 1RCYA 2GBAA 3S3CB 1AZUA 1AG0A 4G7SB 2AZAA 5I5IA 1CURA 2RACA 3WI9A 3NP3A 4KOBA 1OE2A 4EF3A 1WA1X 2VM3A 4MFHA 3WIAA 2VW6A 3ZX1A 3NT0A 1ASPA 1E65A 1SFDA 1VLXA 4RH4A 4YSEA 4YSAA 1CYWA 4F7KA 2BZ7A 4WTQA 5I6OA 2IH9A 1N70A 3H56A 1ILUA 3PAVA 2HRHA 3PAUA 2YAEA 4BWUA 1MZYA 1ETJA 1UATA 2FT7A 3UAAA 4E9VA 4KNSA 1PCSA 4DP9X 3SBPA 3FSAA 4JKNA 1BEXA 3WKQA 2ZONA 3S3BB 4AKPA 1M9WA 2CAKA 3KW8A 4FAAB 4DP8X 2J55A 4P5RA 3UACA 2DY2A 1AANA 2PCFA 1AOZA 2AZUA 2YAPA 3RYMA 1OE1A 3ABLB 3TA4D 1JOIA 2FTAA 4HIPA 2GB2A 3IN0A 1AS7A 3CVBA 4A2FA 1A4BA 1SHWA 2YAHA 1JZHA 1NWOA 4A66A 1DZ0A 1ZIBA 3EH5B 1TU2A 2QPDB 2YARA 1JZFA 4KO7A 1GS6X 1AR1B 2XV2A 2XUWA 2PP7A 3FSVA 4YSTA 4NERA 3WNJA 2FQFA 2FT8A 2EIMB 3FT0A 2FWLB 1ZV2A 6PAZA 4A68A 3GXUB 2CBPA 1OF0A 5I28A 1BXVA 4KO6A 3UABA 1WA2X 3ASOB 1TKWA 3ABKB 1BQ5A 4DP5X 2AANA 1NIEA 4HCFA 4KNUA 1KCWA 4E9SA 4G7QB 1J5DA 3N2JA 2IDTA 1T5KA 1NTDA 1NPJA
chains in the Genus database with same CATH superfamily
4NO0B 2DI8A 4R7DA 4JKLA 4U1NB 2Z0BA 4UT9A 1GW0A 4L5FH 3IPFA 5DQ9B 2EEBA 5I1CH 2C9UA 2FJGB 1MZZA 1O9WA 4TN9A 3REWA 5ADPL 4OZ4B 2IVFC 3F85A 2ZIDA 4JDZA 4RMTA 4QOKD 2ATPA 2ITFA 5E4EC 5T1LD 4ZZKA 1QR4A 4OQ1A 4QR7A 4N2IA 2XV3A 5GXBB 1KGCE 3T3PF 3DO4A 3B37A 3W38A 4A6YA 4M7LT 3DBXB 4IIQA 4HF5H 2ITCA 1E2WA 3E1ZA 3ELQA 1QWNA 3LQAL 4M3HA 1V7NH 3ULUD 2C9XA 4JQVA 2WCPA 4NZTL 4OCSL 5EWIH 5IEHA 3WS3B 3Q5OA 3Q5TA 3WFBH 2XA8L 2MMXA 3OTTA 5KBDA 1Y0LB 2EICA 5GRUH 1E2VA 2WJ5A 1U6AL 4KKAC 4JANB 3V8OA 1EV2E 2A1WH 5IFJA 1IKFL 3PWNB 4JO1H 4BRVA 4PD4K 5D6DA 4HBCH 3RX7A 4FQ1H 2L7QA 2FJUB 5TQ0L 3EYSH 1Q0YH 2GQHA 3F7QA 3NZHL 4P4KD 3TZVB 2GK0B 3Q2CA 2HTKD 2FEDC 4RDQG 1BF2A 2WLHA 3FT9A 3U2SA 4UIMA 1AGEB 5D1XE 3REVA 3MRHB 2HLFC 2V5TA 1LD9B 2BIPA 3ULSB 1E4JA 1T66C 4JQXC 1S5IH 2EDOA 3QIWB 1TYJA 4ODWB 1AQDB 1JPST 2OULB 1KF9B 3SYPA 5ADPH 3LRKA 4WUUE 3RVWC 3M45A 2ZXQA 2PXYA 1CICA 3MFGB 1HILB 1N64L 3QFJE 4HSAC 4KMQA 4EI5A 1RJLA 4G42B 1LO2L 4X5RA 4Z3HA 3PIQB 2V3DA 2GHWB 1Y6NR 5F6HJ 3D6GA 3BC9A 2A6IB 2ZXCA 3L2NA 1HCZA 3LKQA 1YN7B 1ZLUK 4H20L 1UOLA 1FIGH 3LQAH 2V8MA 1LEKB 1PY0A 2D2OA 3UEQA 4XMKL 5D7JA 1FRGL 5EEUA 1FDLH 4NZTH 2G9KA 3DX9B 2QVKA 4OCSH 3GBNL 4G8GD 1A7PH 1BD2B 3GGWB 5I6MA 2XA8H 1D6VL 4E0RB 5ICXA 3GSUB 4N25A 1GJUA 1ZSHA 5DJ6B 1IKFH 4G80B 4LHQB 1B6DA 2LQRA 2X4PA 2D31A 5TQ0H 1NCOA 2CLVA 3NZHH 5AKRA 2OMYA 3ZO9A 4DO5A 5GQBA 5MHSD 2AJYL 1X5GA 1GSKA 3KYAA 3DPDA 4WO4B 3U36B 4F58L 4JFXB 4POUB 1T04B 1I7TA 4OFYD 5EZJA 4XI5C 4BQCA 2F08A 4MCMA 1BMWA 2DLIA 3L4VA 4HX1B 2XICA 3FTXA 5KVDL 2DM3A 3DV4A 3KVQA 1HNYA 4NQDE 4M6AA 1PFOA 1W6LA 2XN9E 2DTML 2G9HB 4JQIA 1TSHA 1N64H 1IGYA 4HAGA 1AD9B 3NJLA 1TCRA 2CHZA 2KHAA 1LGVA 1LO2H 3DURB 1FGNL 2DIJA 1SHSA 4L9LB 2GK2A 3KPMB 1ZHNA 4QOKE 5FS5A 1JWUB 1JS4A 2APVA 2WZ0A 4QWWD 4H20H 5CBAB 1KIPA 3CDGB 4DPRA 2XWTA 3LXAA 4GG6E 4IBZA 5AB0A 3BP4B 4IBLT 1PZCA 4JHVA 3QPKA 1IZJA 1FRGH 2XYCA 1UG9A 2XNAB 2OYPA 4LLQA 1SDAB 1EXGA 3GBNH 1TSRA 1XTMA 5FM8A 5T3XD 2APWA 5F9JB 1RUPL 2WQ8A 3QXDA 3P0YL 4FYSA 1WHPA 3ULUE 1ANUA 5HHMD 3V0FA 3GXIA 2P9RA 3OPUA 4QJ4B 3HNTL 4MXVE 1YEGL 3RDTB 3QP3A 1NC2A 2W59A 4DQAA 3TF7C 2BOBB 4MZ2A 3RVVC 1X5IA 4O02A 4HEPG 2NW3A 3ZTNL 2ADJA 2WNKA 2XTJC 2FHFA 3T65A 1J8HE 3BGMB 5IQ9A 2CGZA 2MOVA 5C0RL 2NZIA 3K8LA 2AJYH 4MVBC 4HK3N 2AI0L 1R3KA 1C16A 5SV4A 4F58H 1AI1L 5ANMB 1MJJA 9CGTA 3RIFK 2ZX8A 4QCIA 5AAWC 1U8JA 1DVXA 4NQXA 2HRPL 2WWKT 3VO0A 5E0QA 3QVAA 2BVPB 1XVSA 2EDQA 4J4PD 4NXSA 1BZ8A 1K2DB 4HV8A 3OKEA 4JGMA 4N0FB 4RAUB 4F15C 2DTMH 1C5DB 1BF5A 2CLRB 1RZQA 3K71A 5F1SA 4N8VG 5IHUL 4PLKC 4ENZA 1XB8A 1EIBA 3NFNA 3T04D 3BIBX 4GS7B 5HGGS 1FGNH 3SKUD 3TNNB 4XPAL 5HYSB 4XP4L 5FYKU 1PFCA 5FHAL 2NW2A 5JORA 1WZKA 4ZTPL 1EFXB 1YEJL 3WCYA 1F90L 4O02L 3TC9A 4AC2A 1U93B 3TJHD 3FU6A 4DH2A 2CLZB 4F8QA 1UM5L 5SX5K 5I5RA 1Z3GL 5DZLA 3VFUB 2GTWA 3IFOB 3LXUX 4MQTB 1RUPH 1USQA 3QZBA 3P0YH 2Z8RA 3IK2A 3U0TB 3OG6B 4I1NB 3DX7A 3LJ3A 3HNTH 1JZGA 4KU1A 3R06A 3MRLB 3X2QB 4F9PC 5HGHB 5CGMA 1J9SA 3QQ4A 3TBCA 3ZTNH 4WFED 5J57B 3D0VB 3VXQB 3EH4B 3IWVA 1DCLA 4F2MA 5C0RH 2W07B 4U1IA 4X4XB 3QQ3B 2AI0H 4NQCA 3L5HA 1AI1H 2N0MA 2EVJA 3GLZA 3ARBC 4MQ7A 2CDEA 3KR3L 4R90L 4APXB 5FF6B 1P4IH 2MFNA 3GMMB 2HRPH 1A14L 3WNOA 3UAJA 4NQVA 4OV5B 2ZX5A 4NJAL 2KDGA 1WT5C 5DTFA 1WWWX 2ZWYA 3FCGA 2JCWA 4G9FA 1N26A 4UAHA 3TEXA 1TVBB 3JWNG 1NCTA 4JKKA 1N3NA 2IH1A 1YA5A 5FYLE 4LIQL 4LSUH 5J1AB 2EUWA 1SMOA 2X53A 3RGVA 4BGLA 4PU2A 3UTTA 3DV6B 1XBDA 1HSBA 3N1QC 4XPAH 4XP4H 2Z0UA 2V0AA 5J12C 4DGUA 1E67A 2FX8L 3OVUB 1GZHC 5FHAH 3VWJA 2RCSL 3VD5A 1R3HA 4ZTPH 1NMAL 4JO8A 1YEJH 2DV6A 5KS9F 4O02H 3ZRFC 3Q01A 5GS1C 4BSJA 5H2BB 3HC0B 2ZWNA 4I0PA 5FC9A 2EIDA 1UM5H 2ICEC 4H26A 1Z3GH 4MAYB 4BBWA 1J9CT 3Q2WA 1ZHBB 4LQFL 3ZLQC 4HUCA 2CM6A 2F7OA 2M2DA 2JVUA 3DUSB 4ENED 4LLVA 5DVKA 2DWYA 4KKQA 4CADB 2K6YA 3VGFA 4X7TA 1RUQL 5EG6C 5DEJA 4LHUG 3TFBA 4HIIB 4G8FA 5I66B 3UFIA 5F44A 5IHWA 3QRBA 4GI6A 5JQIB 2MKLC 3ARFB 4JPVL 5HHQA 2DPKA 1VADA 3WKMH 1Z5HA 4RFEA 2Z91A 3VD3A 1A25A 1Q9WB 2VDOB 4WI4A 4Y4FB 1ZLSL 4HZLB 3KCPA 1KXQE 1OB1A 1LJMA 1NICA 3AS0A 3RWEB 2EEXA 2LW3A 4PI0A 1U2CA 3NCWA 3KR3H 1TJGL 2EE0A 1AP2A 5CLTA 1A14H 4RMVA 4NJAH 2MNUA 2VKWA 3C6LC 5JPNB 1A6WH 3CLWA 4LIQH 1KJ3L 3WNKA 1P7QD 3CVHL 4MKMA 4NRXA 4JO5A 4JFOA 1BVOA 1T7YA 4ES8A 4CC1A 2FX8H 1ETZB 3C09C 2RCSH 1FI8C 2Z35B 4M48L 3H9ZA 3MUJA 3TYGL 1L9SA 1UWGH 3KYKL 3T0DA 4L4TA 4D8PB 1E0OB 3TNMA 5HHOB 3SBQA 1QRNE 2F54A 4WQOA 3SKMA 1WFOA 2B4CL 1RK1B 4KNTA 4ZAKB 4GSDL 1HXYA 4OZGA 4QAWA 2ZYRA 5D1ZC 4GXVL 3TIDB 5HDWA 3RWDA 2J1XA 3ZHDA 3ARDA 5DQJB 1RUQH 3W39A 3L4ZA 3L3HB 4LASL 5DZJA 5L4FA 1CBJA 2HJLB 4WDIA 3MJWA 3WI9A 2YQ2A 3VFPA 4JPVH 4CU8A 4M8RA 2VDQH 4WUUB 4Z7UF 1XBRA 3KH3A 2DQ6A 2V17L 5A16B 2FHBA 1VHPA 3QFJB 3QORC 4N0YL 3IMBA 4RH4A 3ZE0F 3CZFA 1N0LB 2X0VA 4NCC1 4WTQA 4TQHA 1ZLSH 5I8OL 1H0DA 1MXGA 5J1TC 4Q9RH 1YNKL 3VI3E 1S9KC 3APMA 2OW6A 5F1KC 2BHYA 1ZT1B 5EA0L 4E9VA 5JYLA 5IP4A 1J8SA 5FO9A 4HC1A 5GGRB 3KHOA 3MREA 2W81C 4N5UA 4F7PA 4ZMNA 4JEGB 2WZPA 1XF2A 1GYUA 2P42B 4BSWB 4FAAB 2IAMB 1F3RB 5KYYA 1KJ3H 1PG7X 5ERWB 5I0VA 3CVHH 4LOEA 3OAYH 4YLCA 1QMUA 2YOCA 5FFOA 1KB5B 4S1DD 5C71A 1SYSA 3HCVA 4F15B 4KHXL 2EUVA 4HIJA 4DW2L 4O2EB 4A2FA 4J3VA 4BEIA 1MFCL 3I9IA 1MPAL 2PMZA 3KYKH 5KYWB 1MNNA 1NWOA 4J27A 3GMLA 4ODTL 4B60A 2ITDB 2AEOA 1KNOB 4PJFF 4P06A 1LQBC 1ZLVH 1VFBB 2WUBL 4XO5A 2B4CH 1SXAA 4H8UA 1MQ8A 4GSDH 1R75A 3W9DB 4PV1C 3WFHA 1J7VR 1ZSDB 4GXVH 7CGTA 1G7JB 1FHGA 2OSWA 5E1AA 4HH9A 2OTUB 4JL1A 4K07A 4LASH 4HC1L 4JHBA 1S7XA 4QRSA 1TKWA 3ABKB 3MRBA 3HPLB 5D7KE 4NQDB 2P7TB 4E9SA 1QSED 2GIYA 2IDTA 2XN9B 4AQ1A 1A1OA 2V17H 1FVCA 1DR9A 4N0YH 4JHWL 1MIML 1TFHA 1OV8A 4D0CA 1DBJL 1GCYA 2DMBA 5I8OH 1EZLA 4DN4L 3CPUA 1YNKH 3ZKMC 4AEEA 4LVEA 4LMQI 1MJ7L 5EA0H 1KTBA 3DJZA 3M8OL 4GG6B 3ZKXB 2CJSA 1GW6A 3VUAA 1J0JA 1RZ7L 4M6NL 1A8JH 2G60L 2B1OA 2H9GA 3LEVL 2J25A 5EO9A 1SLUA 2X3BA 3C08L 5EBGA 1HYSD 2D3VA 4X42A 3LB6D 1IQDB 4IKIA 3HZKB 2H5UA 2K78A 4PY8J 1A02N 4KHXH 2UYLB 3D39A 2W8CA 4DW2H 2AXGB 3OM3B 1MHCA 4O2CA 5E2TL 1HKLL 1MPAH 1VAHA 3DPBA 2VQ4A 2IV8A 2V33A 1C7SA 4N2AA 4QDGA 1J8HB 5L9DH 4I9WD 4HGWB 4ODTH 3KNBA 5B21A 3O8XA 1NFIB 2NUPA 3FO9B 4UT6A 4JNXA 1DUYB 1MRCL 5HI4C 2EQDA 1EJ8A 2X89A 3C5JA 5CZKA 1G7MB 3TBTB 2C3GA 4YSCA 3B43A 4OF8A 2GIXA 3QAZC 2O6EA 5G4NA 5DD1L 3GMQA 4Z18A 1NSNL 1MCWM 4K15A 5HDBE 3HLKA 4HC1H 4B5EA 5KEZA 1FNEA 3CVIL 4OBSA 1F6FB 4Q74A 2L4OA 4JY6B 5E4IA 2WTRA 3U1QA 1YO4A 1MIMH 5IG7B 5CZVL 2CRIA 2J5LC 1JK8B 1KIQA 1V54B 5F0MB 4XHJC 4Y5XB 2IADA 3EOYG 4XXWA 4WGVB 3MV8B 1T1WA 3CFEA 2X9YA 5ITBL 3QO1B 5C3TA 1MJ7H 1ACYL 1FA4A 2PCYA 4AGOA 5C0AD 2APFA 2DD8L 5F3HB 3FU0A 3M8OH 4F91B 3GB7A 4QRUA 2AQSA 4WVRA 1F11A 4M6NH 3V5HA 5I1KL 3SZ6A 1RMFH 2ENQA 3LEVH 1Q8MA 2NY0B 3CFQA 3EF7A 2VMFA 4UT6L 1E43A 2QV2A 3U4BL 5F96L 2DLFL 2YAFA 4TSCL 5FGSA 1YDPB 1B3IA 1JWSB 2P3YA 1AZBA 2IBGA 1VGEL 4NO3A 2Y9RT 1T5XB 5E2TH 2H32H 2Q5BA 1FYTE 5I30H 2Z31C 1L3NA 4ODXB 5DC9B 4ZPVB 5E2VL 5MENA 4KRPD 4C56A 1FNAA 1IQWL 3HLAA 4NENA 4A2HA 4I89A 2X42A 1XR8A 2WO4A 4D9LL 2AKRA 2HLAB 4KFMA 5LN4A 4F5CE 4QT5A 1MRCH 2IWKA 4PWEA 1UZ8A 4CC0A 2OMUA 2WOBA 5B8CA 5ISZD 2PLTA 3GI9L 3AG1B 4HDIB 4IJ3B 4AW7A 1I53A 3AUWB 1OGAA 1T1XB 4BH7B 2ZXBA 1PIGA 2UX7A 4TUUA 3CVIH 3UAFA 4OZHA 3H53A 1REIA 2B08A 3R4DA 1INQB 3VFRA 2YUZA 4PVMA 2IXQA 5GS2H 1AR1D 5CZVH 4OGXL 1G1OA 3BPLC 4N2OA 3US1A 2ICWB 2VDNB 4LOUC 4XMXA 5AVXB 5ITBH 5J9PA 4XP1L 4JFTA 1ACYH 4CGTA 1KTDA 3EYVA 1ONQB 1XSOA 3MX0B 2DD8H 1QPPA 1IMHC 4GKNB 3NIGF 4DOHB 3HE7A 5DVPA 2F7QA 4PJIE 5I1KH 3PRZA 5E7BA 2CBQA 1R4XA 4UT6H 5GS0C 2DMKA 4F33A 2ZG1A 3U4BH 5F96H 4FXTA 3VCLB 4TSCH 4J3XA 3CC1A 4KZEL 3A6CL 3KLDA 3KYMB 3OB0H 1VGEH 3HRZB 1OAXL 3H9HB 3T77A 2TSAA 1SVCP 5BPPA 5I1DB 1LE9A 1IQWH 1P4BL 2ATKB 3CHSA 4LHJB 2GSMB 4D9LH 4H0LC 3FU7B 3I2CL 4X6FA 5F71A 1U3HD 3O6ML 3NCCB 4ISVB 2YAOA 5D93C 3CIAA 4PP1D 2V9RA 2YD0A 3GI9H 3V0WL 2OI9C 3FT4B 1E9PA 3QDJE 3BSGA 3GFUA 4ODHL 4Y1SA 5HVWA 4Z76A 1U8OA 3PWPA 2GC4C 3JV4B 1I1FB 3PU7A 2QQNL 4ZK8A 5DSCB 1UWFA 2BS71 4N28A 2C8NA 3P3SA 2PETA 3D07A 4HIEA 4OGXH 2F6AA 1Y6MR 3CFDA 2VLLB 3TA3C 3W2DH 4Z5RB 1KSRA 3AXIA 4MWFB 4WNJA 1AKJB 4PGEB 2GBTA 4GBXC 5EBWA 3GSQA 4MSWB 4PJ9B 2ICES 3RBSA 5A2AA 5IOPA 4CVZA 5G4OA 4ODUB 2X7LA 1BVLB 4MDIB 1XCXA 1NBQA 2DL2A 2E7BA 4HEPA 4Y16A 4WI9A 1MH5A 1QRNB 3HZYB 4Q7DA 5C0AE 2B2XL 5F9WB 5E9DE 3B9VA 4KJPC 1VA9A 5GGRY 2P43B 2W0PA 3I9GL 3L48A 4R5VA 3VFOA 1WWCA 1AQKL 1PJ9A 4M5YL 5FYJD 2CMRH 4F7TB 4KZEH 1OP4A 3A6CH 5I17A 3MRDB 3BFQG 3MRNA 2CRYA 3MNVB 5IJCC 1OAXH 1DDHB 1ZT7B 3PQYA 3EHBD 4NT6B 3II3A 3SDDD 1A9VA 3HMXA 2CJ3A 4NUJB 4C4KO 3QYCA 5CMAB 1P4BH 1J0HA 1U4EA 1UADC 2DQCL 2DM2A 4N8VA 4PH8A 1L3WA 5B7MA 4QF1A 4MRCA 3LRMA 1X5FA 3P9MA 4LFHG 3FPXA 3SDCB 1UZ6F 2GJPA 4GRMA 1N68A 2IQAA 3V0HA 3DYMA 5KSUB 1I8KB 1DFXA 1NM4A 4E5XG 3TPUB 1HHJB 1FNGA 2IOOA 5T5NG 5JHMA 1N67A 5C92A 2W60A 5T1JA 1BAGA 3NA4A 4FMKA 2I26N 3G04B 4X5WB 3RY6C 3QAZB 2AW2A 1K3ZA 4X7FC 3CBRA 5CKAA 2L7JA 3HN8A 5E8EA 3K74B 4U4IA 4D0DB 3A22A 3MNMA 3V6ZB 4P2OC 2X1OA 4TL4A 4N90D 4ELKA 3QWQB 4KGJA 1IBZA 1VFAB 4OIAA 2WNWA 3T3MF 3ZSTA 1EJ6A 3JT0A 4G3YL 2K0RA 3RNKA 4G8AC 3RLSA 3OAUL 2J6EA 3BLBA 4JFFA 4TNVK 3AWGA 4J3OC 4HUWB 1G94A 3IRPX 5CEZD 2VN7A 5I15L 2NCMA 1FL5B 4AT6B 1VEPA 2B2XH 2H1XA 4BDVB 2AV7B 3BGAA 2V2TA 3FTGA 2DQGL 1AKPA 2OJEA 3O3EA 1AQKH 4M5YH 1I9IL 1HN1A 4XCEB 4LPXA 2PWDA 2XWCA 1YNTF 3T0EE 2BSEA 2CUMA 2YXWA 3T6VA 4XPHL 5CZXD 2EEFA 3O4LD 3FB5A 4E42B 3B9KC 4ZRGA 2EDFA 5J06A 2YPLA 3KWWA 3O9WA 32C2A 1S9VA 3LMJL 1WBZB 5E6SB 3I6KB 4NO0D 3MV9A 1I8UA 1RZIA 4MS8D 1XGPA 2Q6WB 5KG9A 1JNLL 2R27A 3ZDXF 2DQCH 4QLRA 4XB8A 4P23D 5KJ7E 3BUPA 1KXTA 4I3RL 2F1BA 1QRKA 1TLMA 4NLAA 4MNGE 3DJSA 5IROC 3RUGA 3WEAA 2M26A 3ETTA 1C5BL 1GGCL 4OIFA 1NEPA 1E27B 1X5YA 3QIUB 1ZS8B 1ZGLP 2X6AA 4LL9A 3NCYP 2DB8A 4LVOC 3KLLA 4YNYB 3HG3A 3QJUB 3GYRA 2DBLH 3JTTB 4KZCA 4TULL 3FFCD 1HZKA 2YFNA 4PD4J 1EHLL 3VRLF 4I48B 2IH3A 4UOZA 4GFTB 1UVQB 3FONB 5C0EB 1DQKA 4X6EA 4F20A 3RL1B 2LU4A 4HPYL 1BOYA 4G3YH 3BKYH 3ZHKA 5M94B 4HW6A 4C4KT 2CKBB 3OAUH 4ERSH 3ZYJA 4K5PA 3HMXH 1FFNA 3PGCA 2RB8A 5EU5B 2NY2B 4Y1TA 1YEFL 5I15H 3OR6A 5BO1L 5BUGA 4HKJB 2WGXA 4PJBA 3L6FB 2DQGH 2X12A 3LKNA 2VH5H 4WNQB 1I9IH 4ACPA 3Q6FB 3OB8A 2MCAA 2G5RA 1JTTA 2BP5M 3TZVD 3RTQA 2WSDA 1UWXH 5HDBB 4XPHH 1FN4B 2CM5A 2GTZA 5IHHA 4Y5VA 5FYJE 1U3NA 3MBEB 1E6OL 4UTAA 3LMJH 5BMFH 2QDWA 1QLRA 4ABUA 3QHZL 4RGND 3NOIA 1JNLH 3GS7A 4ZMWA 3QDGB 4I2XE 3NABL 4BUHA 4HJ0C 1VACB 1GGCH 4GAFB 1YECL 5E6IB 3WIHA 3ZL4L 1M2OA 2R83A 3GK8H 3T0EC 2OZ4A 2HVKB 1CT8A 5D93B 1QPXA 1J8KA 4TULH 4F7KA 5INCA 1HSAA 1EHLH 2WWMC 2YEVB 4YLQT 2HRHA 2Y5QA 3AU1A 3VH8B 2QVFB 1SQMA 3GBLA 3L9RA 1KIRB 4HPYH 3WGUB 3QDMA 3AY4A 4RMSA 1QNZH 4PJDE 5ECJE 4CNIA 1GJIA 1FYTB 4PQXA 4JS7A 2ZONA 2QADC 1HL9A 4JM2F 1MJUL 4TNWF 5JNYA 1H5BA 4Z0XA 1JV5A 3UYRL 1YEFH 4IU2B 5BO1H 4P46C 1RAMA 5C2BH 4XWOC 5CO1A 1IAKA 4D0BB 3MLZL 1M3IA 2XPGB 4XCFH 3VVVA 3MN8A 1TZGH 5J8OA 5E2JA 1H8NA 2ESVA 5JPMA 1I9EA 5DC4B 4AE1A 3Q43A 4JFQB 4PV9A 2XZZA 5JXEC 1E5CA 2VXUH 1Y1DA 1QQDB 5HGBA 4GW5A 3D69B 1E6OH 1ZIBA 3KLAB 1LP9F 4QRRA 1QVOB 1D5ZA 1SGKA 2XT1B 3C5ZA 2DL9A 3FZUC 1GS6X 3MYZA 3PP4H 4UZGA 2XV2A 4HJEA 3QHZH 4MHHI 2A6DB 3J2PA 3HS0A 5IM7B 4Z78B 1IBHA 4FJZA 5T1MB 2WJ7A 4UM9D 3QISA 4IOSD 1E8YA 3NABH 2MOGA 4JE4B 3L08A 3D52A 4NQEE 5I28A 1BGXL 4KO6A 4UAOB 3UZQA 4PVNA 1YECH 3OWRA 4XCYA 4MDRA 1F97A 1Q9OA 4K3DL 3ZMRA 3E8UH 3SB3A 1UXSA 2ROYA 4YC2C 1TQBB 2VOTA 3JUYA 4PJIB 4K3EL 3GSNL 2CRMA 1ZJAA 4PWKA 5HGDB 4J3OF 1KCKA 4RRPM 1DDTA 1AGCA 2HT2C 1UURA 2MEJB 1XCQA 2VLJA 4J3BA 4Z77B 4DKFL 4FQ2L 5DVOA 4AQEA 2R2CA 3CLEL 3S36L 3VFSA 4NB7A 3BEVA 4UTAH 5K9OA 3DIFA 1I4FA 1MJUH 2AEQL 3QUZD 2R4RL 3UMNA 2EYRB 5EZLB 5E99L 5CR1A 3C9NA 3UYRH 3MJ7A 5SWZB 3VB9A 4CW1B 1NBCA 1FV1A 2D3JA 2O61A 3MLZH 1BXUA 3L16A 2P26A 4MJ6A 3RDTD 4EIGB 1TTBA 4F57L 3K0YA 1LK3L 3AGVA 5E8PA 3GJFB 3O0LA 2BNUA 1UC6A 3GSXA 4HBQA 5C0JA 3QDJB 4N2LA 5CCHE 2PCFB 1G87A 3JWDC 2RTTA 2D9QB 3BVUA 1JPGA 1SMAA 2Y1AA 4KKLC 1NLDH 4NUGL 4PCKA 3U9UB 2HYMA 1ZT4B 1IARB 4OD2B 3AMKA 2Y36H 2EDEA 4GRLC 2AV1A 1H6EA 1DJXA 4H8QA 3QEGL 4U2ZA 1PZ5B 4KC3B 5IJDC 1BGXH 1SHMA 4APQC 2Q2EB 3DK0A 4KI5E 2FYYA 3PE9A 4TQPA 5ALBL 3DVGB 2JJVA 2Q7AA 3CBJB 1UXWA 1J11A 1MJ8L 2KQMA 4CMMB 3TCXA 3CPLB 4K3DH 4YO0A 4MMYA 3T2NH 5IOKA 4C58B 4HJGB 4YFDB 4IBQA 3WUWG 2VNCA 5TH2A 5C09E 3VX1A 4Z9KB 3GSNH 4LRIC 2KPNA 5E9DB 5DDHA 3S3PA 4Z1PA 1WZ1L 1X3DA 5DU7A 4WWID 4F8NA 2E6JA 2FGWL 3WJLA 3UJJL 1AC6A 3V5DB 1AZVA 3PWUB 1TEYA 2FWUA 3CH1A 3NCFB 5DWPA 5D9SA 4DKFH 4FQ2H 5B4MC 4IBSA 1I85C 1SXSA 4IBTA 3CLEH 3S36H 3D2UD 1W6WA 2VUKA 1D5XA 3RPIB 5FYKD 4OVVA 2DYPB 2R4RH 4KTEL 5E99H 2AQ2A 3RHWF 1THCA 4K71C 2VWEE 1F0LA 2CQVA 1I7RB 1R5IA 2XPYA 1K8DB 2DQFB 2X4NB 5HHPA 1TZIB 2J4WL 4F57H 3WL9A 1LK3H 3LEXB 3UOAB 4H13C 1G5AA 4AJVA 3D12B 4LCWA 1HCVA 4AUYA 2Z4QB 2XG4B 1YUHA 2G5BB 3EJZC 4KKAD 1T3FA 2BNRB 2C7UB 5J56B 3IE9A 1HDMA 2NNAA 4NUGH 1QFHA 3SE3A 2G4EA 2WTOA 4JVUA 2FEDD 4BFFA 4IOFC 3FQTB 1BQHB 1HQ4A 4BFOA 2H8PB 4GG8B 4K3HA 1CLYL 1DVFA 3OAZK 4OFVA 5IFAL 5ALBH 1L0QA 5DJAB 3BH4A 2OMZA 4J8RB 2HLFD 1MJ8H 4FG2A 4FYTA 1XF3A 4GKLA 1T66D 5E5UB 5FW6A 1JXDA 2XFXB 5DMKA 1BPVA 1CFTA 2X4TB 2VR7A 2R2HA 1JZIA 4H8WC 4P2YA 4U0QB 2FGWH 1YRKA 2KH2B 3BD5A 4KK5C 3RVWD 3VMOA 1QLFA 4PWIA 4MA8L 2WSPA 3NDZE 4NBXB 3IDJB 3CFIC 3L3KA 3T0EB 1DSFL 4RA3A 3UG5A 4DVRH 2IBZX 3HHSA 3BKJL 3EYFA 5CJXA 1GYCA 2J8UB 5C0FA 3WS6A 2V2WB 2V2XB 4Y19D 2EIEA 4KTEH 3G5YB 4DK3A 4NRYB 3J27A 1JZJA 3PNRB 5CIPA 5E9NA 2VRQA 4WW2F 4EUPA 3RFZC 2WYIA 2GI0A 3EYOA 1ZWIB 4KTDL 4QRPE 1AIFB 2F8XC 4MNGB 1ID2A 2J4WH 2VC2B 2QADB 2NY6B 2X9XA 1MW0A 4J3WA 4ZS6D 3TVMC 4N0UA 1EAPA 3JYCA 4HOZA 2KL6A 1G0YR 2GUOA 3Q3GB 3GWJA 2DKSA 1XCWA 1HHKB 3AREA 1AACA 1P84K 4RESB 2VN5A 4G6AC 4ZX6A 1G9NC 4OM1L 1WAAF 2Z65C 4NGHL 1JN6A 4JK0D 3BSZA 3WV0A 2H0JA 2VQ1A 2XQYA 2BC4B 1CLYH 2XZQL 3NFPA 2FH6A 5IFAH 2B0SL 2QL1A 2NX5B 4Q9CA 1EEYB 5D5MA 2NDFA 1V27A 3QDHA 4XI5D 4RIRB 2DQJL 4JG5A 4JVPA 1S7TB 1LM8V 1HJBC 1R3LB 3DOSA 1QATA 2HN7A 5CHNB 4W9CC 1S7VA 1ZXKA 4KJYB 1S7RA 3BD3A 1QSFE 4MA8H 2BHFA 1WGOA 1TYRA 4G8IA 4YC2B 4FNUA 4WI5A 4C47A 4G43A 1DSFH 3U6RA 1PL3A 2OXHA 2C9SA 5T1KA 2AMGA 4JG9A 3BKJH 3L1OL 5EU7E 5HHOD 4M7KL 1PG7L 4CVXB 3GKWL 4IHOA 4R83A 1FZKA 3UCRA 2P8LA 3LKOB 3P73A 2UUDK 3FO2B 2X70A 5KAQF 2LU3A 3AQZA 2VUOA 1WSST 4KTDH 4I2XB 4KKNA 1X5ZA 2ZUWA 1WF5A 3PL6D 1U95A 1Y7VA 4G1MB 4NM8L 3U7AA 3LHPL 3QJRB 2FL5B 3DSNB 4WEUD 2JLPA 3PWLA 2R0ZL 3A3YB 1BVNT 4V1DD 1MVUB 3WHE0 1V05A 2GPZA 4NNXB 1MELA 3L4CA 4L18A 1MW1A 4K3GA 1Q94A 2ZNXA 5D6DC 1NUDA 3RVVD 4FYQA 4Q97A 5H94A 3P3YA 2XTJD 5C1MB 4B3EA 1DEDA 1FFPB 4NGHH 3BQUD 3SYOA 4AXWB 2KPWA 2R1YB 4MVBD 5C9JB 5GHWL 3BHBB 1U8IA 1UEYA 2XZQH 3WAKA 4G6FB 2B0SH 1G0DA 4PJDB 4KKCC 2RMNA 4PJEF 1I3UA 5T5FL 2DQJH 3APNA 4WTWA 5DS8A 3IMWA 1NDTA 3OPZL 5CIPH 4EUPH 3QZNA 4MD5A 1ZA3B 4KTYA 1U91B 4M7ZC 4GP5B 3TESA 2PXYC 1GPOL 3MJ8A 1IGCL 4YK4C 4AZ8A 4EI5C 1KBGL 5I73B 5D1QA 1CFMA 4PLKD 4UIKH 2L0DA 3L1OH 1W0YT 4E5XA 3RI5K 3MFFB 4M02A 4M7KH 3TONA 3ZDYE 4E41A 1YYML 3C8DA 2YD9A 1XB3A 2WP3T 3B7RL 2TRHA 3K2KA 1XX9C 2A9AA 5HHNA 3VI4A 1T7VA 3FB6A 3IMUA 5I24A 4Y19E 1LEIA 1ACZA 1SYVB 2OL3L 4TUKL 4J4PA 4F7EA 1T7XA 2W9EL 3Q2NA 4NQEB 5IF0B 3BZEB 5GGUA 3LHPH 4BZ1A 4MYPA 5T3XL 1TZHB 2FDBP 2R0ZH 4M1DL 2EINB 1RIUL 3H55A 1L0PA 4Y4KB 2C4FU 2Y2TA 3BIKB 5MI0B 1WIPA 1EZVX 2OTWA 3C2SA 4JZJA 1LEGB 4TL5A 1CIDA 4FNQA 3FF7A 2K8MA 5KVEL 2QZQA 1LWJA 4FNRA 3BVNB 3BZ4A 3OV6A 4PTUA 5GRVK 4ZZFA 5E70A 3DROA 5GHWH 4IRJA 3UTSE 4CDHA 1FBIL 2FUQA 4KVNL 1KLFA 5IW1B 3D25B 3ARBD 3O2VL 4YHYC 5C07A 1ULVA 1CFNB 1V7MH 3F7PC 5LHDA 5L2JA 4NPKA 3OPZH 3LRLA 4F7CA 2FEEI 5B3JE 3B3BA 4TQIA 1GPOH 4EVNB 4YR6B 1IGCH 4X6CA 1KBGH 2XV0A 2YUWA 4YE0A 4XGZA 2F1AA 1VERA 3OAWA 1XGUA 4UDTA 1INDL 4YL9A 1J9QA 3K5RA 3MAWA 4KROB 5DF0A 1EXUB 4H0GA 4PG9B 1D9KA 3CFCL 2KQNA 4L37A 1A1NA 1YQVH 3KPPA 3VGBA 1SEBA 1YYMH 2L3BA 2YPKA 3W56A 4YXHL 4R7VA 2A6KB 5F1OB 4ETQB 2X2IA 3AACA 1CYXA 1NM9A 2RFXA 5GRWA 5TD4A 3VWKA 3GSVA 5H37G 2OL3H 3BZFA 2W9EH 2ISDA 2HH0H 1WBYA 4ZW7A 3S5YA 3H6JA 4PRPE 5T3XH 1G6RL 4M1DH 5J4MA 4N3TA 1RIUH 4TQEL 3G5VA 3VJ6A 4FD0A 4NNYB 5C09B 1N2RA 4ECNA 4PWGA 1FZMB 3MV8D 2IWGA 3TT3L 2R29L 7PAZA 1UB5B 2UZYB 5KVEH 4GUCA 1J0YA 4UQAA 1PQZA 5BRZE 2ED6A 2F74B 3LZQA 5DYOA 3L3JB 1T2QL 3AVEA 4WTZG 5DEFB 4R7NA 4KVNH 1MCFA 2B3RA 2ZUTA 4Q6IB 1CURA 3B34A 3HUJA 2FCBA 2FH8A 5EUOA 4B9CA 1FAIL 3IU4L 3NT0A 4L0YA 4JRWA 3IDGA 1PKQE 3K7UA 4XNZB 4PWHA 3TWYA 2Y7QB 1YEEL 3FTUA 5SWSD 3C6LD 3K2MC 5BXFB 4UI2A 1ILUA 5E03A 1PPIA 4P4RB 4KRMB 3O2DA 4NKMB 1B0WA 2GUYA 4DKEL 3KG5A 2YHGA 1SJEA 5AAPA 1INDH 2HVBA 2KZKA 3ZN6A 3KPSE 2CAKA 2Z8SA 3CFCH 4YAQB 1FNHA 3CSPA 1AOZA 2C4FT 1QO3B 4YPJA 1EMTH 3WELA 3ZMNA 3AITA 1NCNA 4FHKA 4C4UA 1JOIA 4GFXA 1FFOA 3MRRB 3MUY1 3HG1A 5E8NB 3QRLA 4N0CC 5D1ZD 3ZRSA 1P7QA 4NPYB 4H8VA 4HUNB 4TQEH 1U8LA 5EPMA 1MWAA 2XUWA 4XMWA 4U6YB 4WGKA 2A83B 5E1IA 3WOVA 4X99A 3ZL2A 3S88L 1XH3B 3TT3H 2R29H 3O2DL 1HJCA 3BGFC 2XSKA 1CD1B 2PO6D 3QORD 1D3CA 5C9KA 3VRJA 3UABA 2WVVA 3OSKA 1T2QH 1R24A 3HI6L 2ZOLA 4IRSD 3DJTA 5D70L 2DKUA 1OAKL 4OJYA 3OKLB 4WWKC 1NCHA 2A0LC 1QUNB 3E1F1 3IU4H 4KH2A 3STZA 5HYJB 1TTRA 2Z92A 4XP5L 3OHXB 4J2QA 3WNNA 2WQXA 4JRXA 5D7IE 1YEEH 3ILDA 4F1SA 2VL5A 4BA8A 4DT2A 1IE4A 2DWDA 4DKEH 4ZX5A 4WKXA 4ZMQA 4ALAL 4F3FB 4FXKB 2WUCL 3EGSA 3ESPA 5JOFB 2AJ3A 2Y4SA 2V9TA 4M7ZB 5DMJB 1N5AB 4YK4B 4XXDB 5DHEA 1CR9L 4KDVA 2ENYA 4Y1AA 2BFGA 4PHXA 5DFVC 3E7JA 3PNWA 4G1EB 4P48A 2Z7UA 3S3DB 1UOWA 4JFEA 4R8WL 1PZAA 5MEPA 3NIDF 4FG6C 5PAZA 2AJVL 1O7DE 2X1PA 3QJQB 3E0GA 3FUNA 4ETYA 4U31A 2O4EA 1VENA 3KEHA 1BX2B 4JKMA 1ZK5A 5KYUB 2NZ9C 3BCDA 1T4WA 1MFBL 3TASA 1XGRA 2WXQA 3SJVD 3S88H 1PZBA 3N91A 3O2DH 3U46A 2H4EA 1ZVSB 2D2CC 2XWJB 1EGJL 1QSFB 2P5WD 3IB4A 1TDQA 4Y5YC 3SGEH 3NMEA 4WHTB 3HI6H 1L0XA 2CBTA 4HJJL 2QEJA 5D70H 4GUPA 1IIKA 2R51A 4FTVA 3O3DA 4I18C 4XP5H 4BIKA 2ZOUA 5F21B 3LD8C 3MHZA 4AYID 3BP5B 5KSBA 4U2YA 1A2YA 4FERA 1E50A 1BIIB 2BOCA 4WCYL 5AVZB 1QSEA 4RISL 2UWEA 3P9WB 1HINL 5K9QG 2N0KA 2FZ3B 4ALAH 4XNMA 2WUCH 3CZGA 4HFWA 2D73A 3QQXA 1AO7E 1BBDH 3OBAA 3NVQA 5I2IA 3HAEB 2HTLC 3AFLA 2ZKXA 4HCGA 1KB9K 4OI7A 4X5PA 3ECVA 4P3DB 3VFMB 4IEFA 2AK4D 5I6LA 1CR9H 1IAIL 4P2AA 2VZSA 3ZT5A 3ZW3A 2GCYA 3KPRB 5CN2A 3GZKA 4R8WH 4DWHA 5B38B 3RZCA 1QHPA 4WHYG 1W0VA 2QELA 2C3VA 4L1SA 5HI4D 4IBYA 3FFOA 5AAMA 4JUTA 3ARDC 3B6SB 2R1WB 3GXDA 4YPGB 2I07B 3HBPA 1H19A 2QQKH 1YPZA 1MFBH 3Q1SL 3BW9B 3IDNB 4HK0A 2PYEE 3TBSA 5CSZB 4HIXL 4K4KA 3X1GA 4QXUL 4Y9FA 5DT1L 1EGJH 4QO1A 1LQSR 4JHUA 5HJ3A 4YGVB 4A7SA 4Z7WA 2NXYB 5HYSG 4XHJD 4HJJH 2D0GA 4MRBA 1T2JA 1MHPL 3D9AL 3GC3A 5KSVA 2B77A 1PEZA 1XCTB 2MCMA 3ZDYB 4GXUN 3RGHA 3QR1A 4RBPH 5ITFA 2LLNA 3T4YB 2FYVA 1BAFL 1OK8A 2QMJA 1WS7A 5I5JA 4HIQA 4FF9A 1P6AB 4WCYH 4U1SA 4RISH 1ET7A 1HINH 5DCCA 5EULV 3QAQA 2VUYA 4R3SA 3I3EA 3JWOL 3VD1A 3QFGA 2J3SA 3D3VE 3UP1A 3F00A 3T4AA 3BRFA 1JGVL 4A2GA 2HPTA 2AEPL 4N9OB 1HOCB 5DD6A 1ZANL 1V55B 4YIQA 1L9QA 4Y9CA 4X6DB 4F37K 1KCSL 3FW6A 2ARJB 1IAIH 1Q1JL 1S8DB 2Z31D 4Y2DA 4FQXA 4PM1A 4ZO9A 4CMHC 4PRNA 3NIGE 4MB4A 4PRIE 1W2KT 1AGFB 4ONHB 4MAUL 3UTSB 3JYBA 3F84A 4YE4L 3EKCA 5E5MA 1AAJA 4HD9A 5DJ0B 4NN7C 2HP4A 3KMDA 3MYJA 5HGAB 5JXAL 4ZW5A 4C59B 1AH1A 2Y23A 3Q1SH 1UGKA 4UDUA 3PJSB 3F83A 3I3DA 5F9AC 3V4PA 5C6TL 4L3EE 4XNQA 3GUTA 4HIXH 1MY5A 4QXUH 3EG9B 4E9RA 5DT1H 2VMDA 1GTFA 3NESA 3VSQA 4PP2B 4HKZA 1NGWB 5K59E 4XT1C 5EOQL 3SJVE 4HU2A 5DLLA 2QPFA 4LOUD 1MHPH 3ARTA 3D9AH 1T7WA 3BGFB 4KXDA 5LBSL 3SE6A 3CFKB 1U58B 2HJKA 3H7BA 1XZ0B 2BNQE 4DHLA 4X98A 4LKXA 1BAFH 1HHHB 4OZFB 5E4OA 3N42B 3TBVA 4L3FA 2OCJA 4WWKB 5GISL 3DOHA 3CFTA 4R4NC 5GSVA 4MD0A 4BKSC 4IU3B 2QSQA 3LSOA 4PRPB 3HR5B 4Z7OF 2E7LC 1I1AA 3JWOH 3TURA 2VDLH 4M3KB 4W1TA 5BS0A 4AIZB 1JGVH 3S2CA 3HHMA 1ZANH 1ESOA 1JHTA 1YEDB 1KCSH 1NAMA 1E30A 3V4PL 1M2VA 1PNDA 1NCUA 1MCIA 1Q1JH 4YHZL 3KLQA 4X50A 1IAII 4P2RD 3ROLA 3QHFL 1TQCB 3IGLA 3FUEA 1QA9B 3C6EA 3DX4A 5E56A 2KLTA 2WCGA 4MAUH 3QNZB 4YE4H 3ET9F 1UZGA 2HPOA 1IBGL 1J88A 5I19L 4KQ4L 3EF4A 2V7HA 4DZ8B 1RPQA 5JXAH 2G3XA 1U8CB 3OKDB 2BSRA 4XWGL 4FHJA 5C6TH 3TBWA 5A3IC 5FWRA 2HKHL 3CSYA 4U3HA 4YZFF 5EZIL 2ADIA 3Q8FA 1A4JA 3LRSA 4JDVB 5IB1A 2ZP0T 8PAZA 5BOZG 2E9JA 2KLRA 5EOQH 4XBMA 5E6RB 3TA3D 4KX8A 5IKCB 1JGEB 1SUHA 3COOA 4DCQA 3L7EA 2FJHB 1J9TA 3KPSB 4GBXD 1I3RB 1UZ6E 5CBEB 5KSAD 2A74A 1MUJA 2I9LB 5LBSH 2V6HA 2VMCA 43CAA 4Y5YB 1ED3B 2WKGA 2JIXD 4NZFA 2IGTA 1MRFL 3CNKA 4ZUWA 4Z7QE 3SE8L 1NGZB 5A1AA 5E6ZA 3VXUA 1S3RA 5GISH 3C75A 4KJPD 4I18B 3WUZA 4LO9A 5EBMB 2AS5M 1NMCC 1SJHA 4MCZA 2VDMB 4CKQA 2QLVB 4OZGF 1P4LB 4ZUUA 2ZUQC 2Q7YB 2I9TA 1JK9A 3FRPB 1TCMA 4NEHB 3DTXA 4YHZH 3V4PH 4Z3EA 4IMLA 3WO4B 3MLTB 2CIIA 3QHFH 1IVLA 3G5WA 4R97B 4TUJB 5JLZB 4Y2OB 3X1EA 3PXJA 3O0RL 1KTRL 3WE6A 4AL8L 5B8CC 1IBGH 5I19H 5K69A 3OF6D 2OSLB 3ABZA 4KQ4H 3PHAA 5I76A 4N6RA 3CUPB 5EF3A 4JZNA 1IM9B 5D7IB 1EEUA 4M1GL 2G30A 5I8CA 4GAJL 5GJTL 4EI6A 2HKHH 3SZKC 4Q52A 4B9ZA 3SDDA 3N0PB 2E76C 1TVHB 3VDCA 3VXPB 2GBUA 4YHPA 4CKVX 5ICZB 2YEQA 1HAWA 1D5BB 4P2OD 5E00A 5SX4H 2VLRE 4HEMA 3AMLA 2GSIB 3B2UD 2HFEA 2QVMA 3ZU8A 5A6MA 5HDOA 1NAMH 1ILSA 2WXGA 4FCAA 1FLTX 1XT5A 1MRFH 4J3OD 4JPQA 3SE8H 5JHDA 3CFBB 1DQTA 1QWHA 2F7IA 4GQ9L 3DHPA 4U3SB 2X4UA 1DQQB 3DUUB 4W9GC 4FQQB 2WB1A 1HOEA 3Q2LA 4HPOL 4JBSA 3LV3A 4PSPA 2FJFB 2P5EA 2HWZL 4LVNC 5HYIA 2X44D 4WU5A 4KUCD 4X4YA 3ZQ9A 4M7LL 3B9KD 4JZOA 1EVTC 2BRQA 1KBWA 4UQEA 2IANA 3TV8A 2OQJA 3L5XL 3M86A 3SKJL 1IFGA 5I74C 2EP6A 4WI0A 3OGCA 1KPRB 4LXFA 4JN1L 4UNIA 4Y2LA 4Y9BA 4CUCA 2AJUH 2BHUA 1F3JA 2N4IA 3O0RH 1I1YA 2BO0A 3P9LB 3QUMA 1KYOK 4FXGB 3EUUA 4AM0A 4JUSA 5IROD 2R8SL 4LCCA 3SDYL 4CMHB 1RLBA 1T1ZA 3S3JA 1T6VN 4WEMB 5AG8A 3K6SB 4M1GH 3DO3A 4GAJH 5GJTH 1QLEL 5I6XB 4IKJA 2DOCA 5H37A 3NSJA 3C87A 3RWCA 4G59C 4NO0A 2V3FA 1AG0A 4OY9A 4LCUB 4U1NA 5DQDL 3ATBA 4XOBA 5F97E 3T0AA 3CQPA 1AO7B 3QIBC 1CCZA 2WQSA 5SX4I 4UQ3B 5DQ9A 1E65A 4TVSa 4JRYE 1VLXA 5EN2B 4FA6A 1SMDA 3CFUA 2ZAHA 1DO6A 5DD0L 5ICYB 4OZ4A 4Y16C 2BM3A 2CSPA 1GJWA 4GQ9H 3CLFH 1MOEA 4NBZB 5CEZL 1M3JA 1JPSL 2KC0A 3RVXD 1OTSC 4WTZA 3UBXB 4HPOH 3B7UX 4OLUL 4ORGB 3DBXA 4UUJB 2HWZH 3QJFB 4YFLI 1TJXA 1A7OL 4M7LH 5AW3B 2WAQA 3MGOB 4NWUL 3HG4A 2PYEB 3L5XH 3RYMA 3SKJH 4ELME 3WS3A 1B4LA 4LP5A 3FULA 1NUNB 5CFHA 3CQQA 4JN1H 5CEXB 1Y0LA 3R7QA 5DS1A 2Z7ZA 1H3VA 4JANA 3SBWA 3EJUA 2YARA 4HJ0D 5DURB 3UTQB 3PWNA 4YDVB 2VZUA 3IAQA 3SDYH 2R8SH 4ILDA 1JF6A 3FSVA 3UDWA 1EAOA 2E74C 3TZVA 3A4AA 3II2A 1DN2A 4GEJA 2GK0A 4AMXA 5DMIL 3SPIA 5CKGA 4CN6A 1QLEH 2ROXA 5AALA 1LP9E 3TF4A 4RDBA 4FP8L 2P46B 5AVWB 1BLNB 5I1HL 4RDQF 1JYVA 1P84J 1AGEA 1VDGA 2WWMD 2AANA 3MRHA 3NEEA 4PBVC 1KXHA 3D3VB 1LD9A 4R5XA 4OB5L 1AGBB 3N2JA 4QEGA 4I9XA 3ULSA 4QRAA 3QIWA 4ODWA 4ZQKB 3DHMA 3RWHA 1T03H 1AQDA 2D4DA 2EDDA 2YIHA 2PPAA 4XVSL 4YDIL 4WLCA 2IQ9H 2OJZL 2VSDA 3EYUH 3W11C 1HILA 4X2UA 2WV3A 4PRIB 1GY2A 2XDHA 1O9VA 4P46D 5CEZH 1JPSH 4G42A 4XWOD 1AD0B 2IC2A 3VQLA 3PIQA 3QUMH 1ECZA 4LLAA 4OLUH 1A4CA 1VCBC 1NCAL 2EYTB 1DLFL 4EAEA 4MMXB 2A6IA 3UERA 1YN7A 2O5ZL 3UZVB 5CP7B 1FYHB 1A3RL 5JXED 2KI6A 5ELIA 4X0KA 1SM3L 2F5BL 2FRGP 5K1VA 3QYMA 1LEKA 3ZTDC 1BZOA 4WK2B 2BW4A 3ISWA 3P3RA 4HJIA 4L3EB 1U33A 3JWNC 4DP4X 3FZUD 3DX9A 5H37H 5KZCD 3PFUA 1ORQB 1LVEA 2NX5D 4HS6B 3H9SD 5I8KL 1BD2A 1NMCB 3GGWA 4OZHF 4X6BB 4HS8L 3V9FA 4E0RA 3GSUA 1NCDL 3TX4A 5DJ6A 4OLWH 2ZCLL 4G80A 4LRNL 2EDXA 3OGOE 3INUL 4ZFZB 3ZGHA 2BNQB 1RY7B 3WHXB 4J6IA 1MI5E 5DMIH 3IJSB 4F93B 5JW4N 1TPXB 4FP8H 3TU6A 1WFJA 4WO4A 4ONGL 3U36A 2B8OT 4JMXA 4DUVA 1T04A 5I1HH 2DAVA 2EDHA 4MB1A 3QEHB 2HT2D 4UQDA 3PG2A 4IOSA 2CO3A 1GR7A 2J43A 2NNFA 3FQRB 4OB5H 4HX1A 5KJ4A 4DO4A 4GI8A 3L7FB 3KH4A 2Z93B 1FZOB 1BJ1H 1CF8H 4RMWA 2BIOA 2CCWA 2G9HA 5EU6E 1NIAA 2IPTL 5E8OB 3RTLA 1AD9A 1U8KB 3CZLA 4RZCA 1NGXB 4XBGB 4D7PA 1JYWA 2EADA 3DURA 4EXKA 4L23A 1PIFA 3KPMA 3T5WA 1DLFH 5G55A 5EB9A 1J1XL 1JWUA 2VRAA 1XIWD 4Z7VE 4FLOA 2O5ZH 4MX7B 3K3QA 4RSYA 2CNYA 4NN5C 3FQXB 1A3RH 3NG5A 3CDGA 5CBAA 1SM3H 2F5BH 2P80D 4Y5VC 4PB9H 2JCCE 4NRZB 3SHSA 4K5MA 5IB3B 4QNPF 5A40E 4HK3J 1RP8A 4JCWA 2ZYIA 3NZSA 3U9WA 4G72B 4KKLD 4LVNB 3F7KA 5DHYB 1UKSA 1W8EA 5F9JA 5I8KH 2X4QB 3LIUA 2OMXB 4HS8H 2KZWA 4GRLD 1PLGL 3VXSD 3CHPA 3RDTA 1N6UA 3G08B 1S3KL 4APQD 4ZW3A 5I74B 2ZCLH 4LRNH 1I8LA 1J1OL 1EXHA 5EO1A 3INUH 1MF2H 3ESMA 1N59B 5H35B 2IOMA 3BGMA 3MU3A 4Z7QB 1FFTB 1GH7A 3CFMA 2DF3A 3CDFA 5DRZB 5J7CC 1OAZL 4ONGH 5ANMA 1FLRL 4P2QD 3FQ4A 3PREA 4K94L 5AVTB 1URLA 3AY4C 5B4MD 1SLWA 2XI9A 1MCPL 4AV0A 1VEMA 4UNUA 3WTYA 1UFGA 4U7SA 2I60H 2BVPA 2ZXAA 1G4MA 1K2DA 4U1JB 4RAUA 4N0FA 3KL5A 2CCVA 4L3CB 1ZTXL 1C5DA 2CLRA 2IPTH 3QIBB 3QUYC 4WI3A 1TYEB 3ILPB 5GZOA 2WIMA 3G6AB 2CE6A 2WXMA 3N9GL 4WY7L 4U49A 3TNNA 1NC4B 4DPBX 5HYSA 2JFCA 3RG1C 1Y18B 5DHVH 3P11L 4MJIE 2BRRL 1WFUA 2OFQA 4OJDH 1AIZA 5GGVY 1U93A 5EFIB 3I6LE 3EJZD 3G3LA 2CLZA 3C5ZC 3S6CA 3VFUA 1IC5L 3IFOA 4L1TA 2JJTC 4MD4B 4PJGA 3HS0C 3QBTB 3ZTJG 4ABVA 4KVPA 5L4IA 2NSQA 5C0GB 2WOYA 1PLGH 3ECUA 3FQWB 4IDJL 3U0TA 4D7BA 2VLRB 4IOFD 5F6IC 5A6IA 1CGVA 1L9OA 1YG9A 1S3KH 1F6LL 2CXGA 4C83B 1CGUA 3MRLA 3RY5A 4BELD 3D09A 3DGGB 5HGHA 4UQ2B 2WYTA 1ETB1 3D0VA 3VXQA 5HYFA 5DK2B 1X5JA 3ZHNA 5I82A 5E4AA 2W07A 3UX9B 4FNLL 4X4XA 1OAZH 3QQ3A 2DLEA 5JHBA 2WQAA 1A9BB 4ZOEA 4KK5D 4K94H 4APXA 5FF6A 3GMMA 4ZXBB 4WWNA 1MCPH 1I75A 4OM0L 1WS8A 4OV5A 4GIOA 1T21B 4PGZA 5K9JL 1FSKB 3ZQXA 1AQ8A 3AW5A 1TVBA 5FKPB 5CGTA 5FYKL 4BK5C 1FO0B 2EE6A 3ILEA 5J1AA 2UXTA 1A47A 1EWHA 2DM7A 3DV6A 4PMEA 2G2PA 1TQTA 2J5WA 4WY7H 5KBNC 4LEXL 4LAQH 2H0EA 1LLAA 1T6BX 3NJGA 3TVMD 3P3UA 1XZWA 3P11H 1ZHLA 1AXIB 2BRRH 3O4OC 5F7KC 3RUGF 4XB7A 1CDYA 5H2BA 2YWYA 3HC0A 4Y89A 1N5YL 1XF4B 2MRYA 2NY5C 3TTSA 4MAYA 3UL4A 1ZHBA 2OXGB 5LCVA 3WLWC 2HT4C 4G6AD 4AH2B 4B96A 3DUSA 4IDJH 4CADA 2FVNA 4EN3D 5DHMC 3BZDA 1XMWA 4FI8A 4PUBL 4KQ3L 4JRYB 4HIIA 4JL2A 5I66A 5BW7C 3LYRA 3BPOC 1R1CA 3ARFA 1TENA 3NAAL 5LAXB 3VXSE 4DEPB 2NOYA 3BQVA 4X7EC 4M1CC 4OV6F 1Q9WA 4Y4FA 4YH6A 4HZLA 3V4UL 5J11B 3LZNA 3IKCA 1A4KA 4U6TA 3WJLC 3ZKQD 1MSPA 2XA3A 1G1KA 4PJBF 5IQ7L 1QWUA 2QGBA 1WBXB 4OM0H 3U9PL 3WDIA 1FZJB 2NY1C 4ZSOE 5JPNA 5K9JH 4I88A 1J5OL 5LCVL 4ELMB 4W6XB 1XDTT 5FYKH 1II4E 5BQ7B 1F86A 1EA9C 1GC1C 4L5FE 5K9QI 4LEXH 3U48A 4IBWA 1HIML 4RETB 1ETZA 2ADGB 1KJ2B 2MHAB 1DUZB 2Z35A 3ROOA 4DAGL 4K2UL 1ID5I 2E75C 3U30C 3EGDB 4D8PA 3IXTB 1VGKB 5HHOA 4HULB 2ED8A 4UT7L 4X83A 3CHXA 1RK1A 4M5ZL 5LLIC 4NN5B 4ZAKA 4YHLL 3GBML 3VH8G 2YRZA 4OLXL 3ES6B 3TIDA 4PAZA 4PJ5B 2DQMA 5DQJA 3WMPA 3WDHA 3QHTC 1DVFC 3L3HA 4NIKB 2WMPB 4GSQA 1S5HB 4KQ3H 2HJLA 4KKCD 5IK3A 3DMMB 3NAAH 2N7AA 2QSTA 4WUUA 1RZJC 3T0VA 3CHRA 1CC3A 4HQQH 2IGFL 5A16A 4MJ5B 3QFJA 1N0LA 1TTFA 4FJYA 3V4UH 4M8QA 4V2BA 2OMBA 1CICD 2PXYD 4WZ9A 3VXNA 1Q4NX 4EI5D 4BSVB 3MBWB 4WJKB 2FE0A 1ZK9A 3J7HA 1ZA6B 2EE3A 3DX6B 1RUAL 4LDOB 1YMHB 5GGRA 2DTSA 4HUXB 5CJXC 3U9PH 3WS6C 4H8PA 1YNLL 4LBAA 4U1KB 5DJYB 5FM4A 5BRPA 1J5OH 5LCVH 3MRFB 4BSWA 1JD9A 2IAMA 3L4WA 2WBJC 3F01A 5ERWA 5ALCL 2K7QA 1KB5A 3FCSB 4BHUI 1DSYA 1RUMH 1HIMH 5LG6A 1CG9B 3GTNA 4O2EA 4MJJA 4DAGH 4QUOA 4K2UH 5KYWA 2YKKA 3H0TB 3TN0B 3FSZA 5IMKB 5B1JA 3SQBB 1MI5B 1OCRB 3IFLL 2ITDA 4P05A 1KNOA 5FV1L 4X7CC 2FX7L 2VDOH 1VFBA 1KB9J 3UMTA 3OC5A 1DYZA 4M5ZH 1LDPL 5BOJA 4YHLH 3W9DA 5I75B 3QCUL 4OLXH 1ZSDA 4XTRD 4BV1A 1G7JA 4LSDA 4WI6A 2OTUA 2A9CA 4W68A 4AE0A 3HPLA 3TH4T 4TKWA 4HWNA 4NQDA 2P7TA 3S96B 4ABWA 2XN9A 1DANU 4FQIH 5EU6B 3AQYA 4EPSA 2YUXA 3H7LA 5F6IB 1A3QA 3BD4A 3FCTB 2EZ0C 4UOQA 3ECBB 2YA1A 1IL1B 4F9PA 4R6UA 1KB5L 2F7PA 5CEYB 4BKTC 5KVGL 1U30A 1WA1X 2EYSB 1HHIB 4Z7VB 2X5PA 4GW4B 4IRZL 1I8IB 4UYQA 1RUAH 5JTWA 1CYWA 4GG6A 2JCCB 3KPRD 4B7IA 1YNLH 3N44B 5LNDA 2X6VA 2PCPB 4KXZH 4XNYL 3BN9C 1DJWA 1MZYA 3LKSB 2QSVA 1JF1B 5ALCH 1V5JA 1IQDA 4I7ZC 3WNPA 1X4ZA 3PDOB 3HZKA 1MVFA 3BEWB 1WT5A 5EOTB 3VMNA 2Q3XA 4AQAB 1M9WA 1Q1PA 3QG6A 2UYLA 2VISB 1AFVL 2J55A 3UACA 4N1CA 4N9GB 3MUGB 1UXLA 1R9FA 3K0WA 5FB8B 1J8HA 3RX9A 4U1MB 2QHRL 1NC2D 2VDPB 3ALWA 4HGWA 3GMPB 3HIZA 3VXRE 3IFLH 3ARZA 2FTAA 5EBLB 2GB2A 1DJIA 1UD8A 1NFIA 2FX7H 3FO9A 3HZMB 3IN0A 5L0QC 4HWZB 1DUYA 1NBYA 3ZE2B 4BH8B 2OMVB 4BZYA 4X8XA 3TBTA 3QCUH 3V6FB 1G7MA 4UINL 3KVDD 1MFEL 2D7OA 4NKOA 4ZFGH 3EXLA 3VXOB 1QFUL 3GJFK 4Z6AT 2YSSA 4LSSL 1AHWC 1NMBL 1IGML 1MAKA 3SD2A 4ZUVA 1S78C 2HJFB 3DHUA 5C0BB 5IG7A 1JK8A 3ILQC 1KB5H 4Y5XA 3AWEA 3KM1A 4YBLC 5FO2A 5KVGH 3MV8A 1OGTB 2GY5A 2AK1L 2CBMA 3QO1A 5D1QC 1T5KA 4QIRA 4WSKA 4MJIB 2K3HA 2E6PA 3BKCL 5F3HA 1GZQB 1NL0L 3CSFA 4X9YA 4NFDA 1GGUA 2QDVA 3VFTB 5JHLA 4PJAE 4LKCB 3UBGA 1HL8A 1M7DB 1ADQA 2BMKB 2RALA 5CF3A 3NJJA 4PREB 2RHEA 3HEIB 4KO5A 2FWOB 4LP8A 2NY1B 1YDPA 1BQHG 5DRXB 1JWSA 3C6LA 5KVDE 1QAWA 3IU3B 4B9KC 3Q8CA 4OZIB 1AFVH 4J23A 1INEL 1X9UA 1T5XA 2NSMA 3C8KB 3H4HA 4N0CD 2AFNA 1TNNA 1ITBB 4ODXA 3POCA 4ZPVA 3ML8A 2QHRH 3WDJA 5IT2H 2EDMA 4PYHA 5L8LB 4JZJC 2HLAA 5BZWB 3VNYA 4PRHE 3WHE1 1DANT 2AVFA 4PLNC 1S2EA 5KYXB 3SDXE 4N86A 1CU4H 4JMNA 1M71B 4UINH 5CD3B 2BERA 3VXME 1MFEH 1KWGA 3JVGC 4HDIA 1G0XA 4NQCD 3DNKA 1QFUH 5D2NC 1T1XA 4BH7A 4URKA 4LSSH 1NMBH 1IGMH 3BAJA 1YEKL 4WWKD 5JHLL 2I5YL 2A0LD 2B1HL 4ZPTA 1INQA 1WEJH 4AKOA 3ZDZE 3U0WH 4OI8A 2ICWA 2D9CA 1V3JA 2IAAC 1JZ2A 2AJZB 2V9QA 1UWEL 4L48A 2AK1H 2Z1PA 3VACA 3C2AL 3UTTD 5DZVA 1CGYA 3BKCH 1JZ6A 3AXLB 1NL0H 1AZZC 3W1ZA 1Q0EA 4WENB 2WZAA 4GKNA 2WNXA 3VWJD 5C0CB 1PLCA 2YAMA 1QR1B 4ZNEE 5FEBA 2J1YA 4IDLA 4L2LA 3FT1A 4I0PD 1FCCA 2HX8A 2HG0A 2SEBB 3VCLA 5DFVD 3BT2L 1BWMA 4FG6D 3KYMA 3HRZA 3N41B 5JIPA 2P47B 2G2NA 4JDTH 4MXQC 3H9HA 2DYRB 3Q8BA 2PP8A 3IJYA 5DJXB 2YD7A 5D5MF 5I1DA 3TTYA 3T71A 1SJMA 3I02B 2ATKA 4FABL 2BLFA 3GBEA 5EIQA 1X44A 3FU7A 2VDNL 4NXKA 2Z9TA 1N18A 4ISVA 4PIRF 3E38A 3V7MA 3FT4A 1YQ2A 1OO2A 1XD0A 5B1AB 5I71C 4ZSOB 5F88B 5IQNA 1YEKH 4LEOB 3E6HB 3JV4A 3EH1A 5JHLH 3FRUB 1I1FA 2B1HH 1PW3A 3BO8B 5DSCA 3LY6A 1T6WA 3DYPA 3WEXB 3FMGL 4M5SA 1OVZA 2X4RB 4ZD3L 4AUUA 1RQ5A 4O58L 1KZQA 2VLLA 4U3CA 4Z5RA 4UM8B 1E6JL 2HFFB 3L4UA 4MWFA 4CVUA 1UWEH 1AKJA 2PYFB 4PGEA 2X40A 4PJ7E 3C2AH 4W81A 4MSWA 3MNDA 2PPCA 2Y06L 4ODUA 1BVLA 4BFKA 3HC3L 3QQ9C 2HTLD 3QWRA 5IVZB 2L7EA 3DYOA 5J5EA 1QRNA 1WP6A 5HY9B 4LF3B 2H1LM 2CUHA 2ENSA 1MQKL 4K5LA 2ZD0A 3NSXA 4LLWB 3KCWA 2ZXGA 4L4TD 4X8JB 4XXCA 3D48R 5J6HB 2F54D 3BT2H 2V5YA 3DX0A 3V0EA 4F7TA 1WRFA 3D05A 1UYWL 3MNVA 3HE6C 2F68X 1SUJA 5G2NA 1DDHA 3CXDL 3UG3A 4NT6A 3ARDD 4MZRA 2GFBB 4DP7X 4IBVA 2QR0B 1TEFA 4LIQE 1UCBL 4NUJA 4PLOB 4Z8FL 2F53E 5CMAA 1H3UA 2LR4A 3B7TA 4FABH 4R9HA 4NNPL 2E56A 3SE9L 3I75B 2VDNH 5AYTA 2F8VA 4DFIA 5HD8D 4MQSB 3SDCA 1IBDA 5D4HA 3KYOB 3I74A 3CDCA 4LGRB 4R5TA 1LMKA 1VESA 1UD6A 4KKPA 1I8KA 3CZJA 4F2ME 1RPUA 3TPUA 1K6QL 1HHJA 4LCVA 5HXMA 5D7SL 1IAIM 3MRQB 5B1CA 1MHEB 1TOXA 1KYOJ 2WVSA 3QXTA 3G04A 4X5WA 5T5NF 1A7NL 3FMGH 3QEQE 4ZD3H 1F41A 4D0DA 4R96B 3V6ZA 1AHWB 1E6JH 4U1GB 5FUCC 1U92B 1VFAA 5CLWA 1IEAB 3FH7A 2B9AA 3S3SA 2A9DA 3VI4F 2Y06H 2RA1A 1KG0B 4G9FE 1CGXA 4IGBB 5AL0A 3HC3H 2UV3A 4HUWA 4YBLB 1FG2B 1WUNT 1VPOL 4OJCA 1FL5A 4AT6A 2ZOTA 1E5UI 1MQKH 2Y0SA 2AV7A 4BDVA 4LMQE 4D9QD 2XZAL 2N7SA 4M3JA 2XN2A 1RULH 2J2ZB 3F6JA 3FN3A 3IKKA 3MV11 4XCEA 3NACH 1JZ5A 4M03A 3NJHA 2ORBL 4OGZA 4YSSA 3QARA 3L4XA 4I5BB 1UYWH 2OZNA 6PCYA 4E42A 3L5JA 3CXDH 3FBKA 3P2TA 4P59L 2XKSA 5C08B 4HP5A 3QCVL 4ZMPA 2OMWB 1WBZA 3I6KA 1UCBH 4R7DB 4TV3A 5D1ZI 4Z8FH 2V5RA 3IBEA 4K23L 2Q6WA 4NNPH 5FECB 3SE9H 4WI8A 4FFWD 2BSDA 2ZUYA 3AY2A 2ICWI 3CBKB 3P4MB 4MBRA 5IIEB 3MNWB 1PZ2A 2WZ5A 5ESAA 2ZUVA 3QIUA 1ZS8A 4QHLB 1DQJA 2P45B 4X6CF 2Q20A 3MTRA 4DZBB 1HT6A 1K6QH 4YNYA 4NS0A 2VSCA 5D7SH 3DGDA 5EZPA 3VQ1C 1MDTA 3JTTA 5KANI 3RVTC 2QPSA 5D2NB 4BQ9A 4I48A 3FS9A 5KTEL 1CDGA 1UVQA 3GZPA 3T0BA 5C0EA 1P2CB 1MW2A 4R4ND 3RL1A 1CS6A 1I3VA 3UBFA 3WNIA 4IOIB 2XJKA 2CKBA 2A77L 3K46A 2EO9A 1IGIL 4WO0A 4TXVB 4UOW0 3RB7A 1QP1A 3C60B 3QG7H 2EXYC 5EU5A 3VXRB 3IF1A 2R69A 5D7LE 1VPOH 4HKJA 3X11B 1DN0B 2X4SB 3DECA 4GNKB 3WYRA 5HVHB 3L6FA 4HALA 2QGDA 2XZAH 4PJXE 1YMME 2I7OA 3J07A 4O4YL 5F9OL 1YY9C 5ID1B 2XWBB 3Q6FA 4WIQA 3RZCC 1A6UL 2NLJB 4JFDE 1Z5LB 2F8IA 3MROA 3PAYA 5DJ8B 2X89D 4HZAA 3RZWA 2VIRB 1LO5B 4H7VA 4P59H 3MBEA 2QKIB 3QCVH 4EZKA 3HFML 4F1ZA 1IT9L 1IC7L 3C6SB 3HUJF 4XMLL 3ZTJH 2AQRA 4K23H 5EUOF 4L29B 3SGKC 4BFIB 4B0MM 2EECA 5AZEL 3S8GB 3QDGA 5IMOB 3RE0A 3B2VL 4WWOA 4OLYL 1DVUA 5CXPA 5E6IA 1DJYA 2XWZA 2FAUA 4I3SL 4JKWA 4K9EC 1HK6A 1FL3B 4PJAB 2OS7A 1OALA 4WRLA 2R69L 3HVDA 5JA8B 2HVKA 3B9EA 5D8JL 2R4SL 4M61B 3GLEA 1EO5A 1XGQA 1G7IB 2FB4L 3VH8A 5JR1L 5KTEH 5LAPA 1BQLL 1KIRA 5A7BA 5C6WH 2MKWA 1UM6L 1BG1A 5GS0L 1IGIH 2JTYA 3KDMB 1FYTA 5BUPA 1AC0A 3TA3A 1P6FA 1NDMB 3DETC 3T2PA 2XVBA 4IU2A 2QLYA 4F5CA 4PRHB 4Y2DC 2ZXDA 3TEUA 1FVDB 2VTFA 4FQXC 4BQ6A 3SDXB 4YXLL 2XPGA 4O4YH 5F9OH 2ZOOA 3TYFA 3CN1A 1RUKL 4N1EA 3VG0L 3VXMB 3VFGL 3N1FC 3LZOA 2BWDA 2ZPKL 4FFYL 1RL1A 4D9QE 4BFRA 3VYPA 1QQDA 5IW6B 1ASOA 5IVXE 1YAZA 2MPVA 3A4EA 3D69A 4PR5B 1QVOA 3HFMH 3H42L 2PTTB 1IC7H 3QGVA 1OGAD 2A6DA 4Z78A 5IM7A 4KV5E 3ZDZB 1XFPA 3HE6B 4BM7A 5EC1B 1OLLA 5A2IH 2P48B 3K2IA 1WWBX 5FM5O 1PX8A 4FQCH 5AOLA 3B2VH 4OLYH 5E94B 2J12B 4PLJC 1KCVL 5C0DB 1QTYT 2K4WA 4HAFA 3S7GA 5K5YA 1OKEA 1C7TA 2I7SA 3MGTB 4I3SH 2IEPA 1NCIA 4OCNC 3IJHB 3MMEB 2R69H 4PJIA 3AADB 5D8JH 2R4SH 5HGDA 2W65B 5I1LB 1OM3L 1ZHNB 2XHNA 3GNML 2ED9A 2JXMB 5HP5A 5JR1H 1P53A 3P0GB 3FN9A 1F1AA 2P4AB 1VCAA 3SY0B 1BFOB 3CD4A 3W82A 1IC4L 3FQNB 1UM6H 4XZUB 5GS0H 1I1AC 1T7ZA 5HPOA 1N70A 2AJXH 1VJSA 2EYRA 5EZLA 5FV2A 3PV7A 3FT2B 5SWZA 4TUOB 3CH8A 3FUMA 4CW1A 4JFPB 4IK7A 1BW8A 2H3NA 4BFJA 4YXLH 1EAJA 2E27L 3NGBC 1N19A 3TLRA 2DI7A 1MCDA 3D39E 1RUKH 3C5SB 4WU7B 2XY2A 3GJFA 2VR8A 4X4ZA 2R0LL 3KGTA 5F7FA 3VFGH 3VG0H 1PBYA 2DEWX 2ZPKH 4R0LC 1UKQA 3T65B 2B1AL 3QDJA 1WO2A 3B7YA 2PCFA 3CN4A 1FL6B 4EOWL 4LLYB 5BZXA 3FL7A 1RPKA 3PWJA 3UP6A 4B27A 3CN0A 3CX5K 3CQFA 3BMWA 4ZG1A 1AS7A 3U9UA 5BOPA 4OD2A 3PWPD 1MLCB 4DK5A 4QY8B 5DK0B 1E3ZA 1ACXA 3B9KA 3U82B 2ID5A 1DZ0A 4UV7L 1PZ5A 2NY7L 1NGQH 4PJ7B 2ILLA 1OPOA 2DWEB 3DVGA 1JFHA 2X3AA 4HV8B 4NERA 4N20A 5IZ7A 4ZFFB 4CMMA 2UWEF 3HAEG 3CPLA 2GJ6D 3GXUB 4HJGA 2YRLA 5I1JL 3FCUB 5IROA 1N7MH 3R1GL 1TETL 2WCSA 5E9DA 1PG7W 4KBPA 1UOKA 1OM3H 3SCMB 4XOAA 4Y16D 3GNMH 4B41A 1WTLA 1ZRUA 2NW2B 4LLMB 4HCFA 1KCWA 3PWUA 1J5DA 1NGPL 5B38G 3VFWB 3N40P 3GSWB 2M1KA 3LNHA 2UXGA 1EEZB 2WIIB 2GTWB 4ZTOL 3RPIA 3LZRA 1WQVT 4PS4H 2J20A 2CU9A 2NY4C 3FPYA 5F7DB 2F53B 3PQYD 1K9TA 3Q6GL 5A7EA 3UYPB 5CJ5A 1I7RA 4QYOB 1K8DA 2DQFA 2E27H 1TZIA 4D2NA 2OMNA 1NCWL 1YPZF 5FA4B 3LEXA 3QXWA 4M6OL 1Z9SB 4HS3A 1C08B 3BH9B 4MS6A 5FX3A 1DQIA 2Z4QA 2XG4A 5MENE 4C56E 2G5BA 4EOWH 4Z7WF 2GJZB 2BNRA 4GXUM 1TTGA 5DUBB 4GO8A 1HNFA 4A55A 2EABA 3QEQB 4QKTA 3O41B 4P07A 1JNHB 3VG9C 3FQTA 1BQHA 3QZLA 4OFIA 4PWJA 4PY7B 4XX1E 4JG1L 2H8PA 4UV7H 2NY7H 4GG8A 3NIFF 5JIMA 4OZHE 3O45B 4J8RA 3LXCA 2X3CA 4BXVA 4BFEA 3JZYA 5I1JH 4K5OA 4JFFD 3R1GH 4KNQA 3LH8A 2CDFB 5D96B 2XYBA 1TETH 4U6VL 5LJYH 4JGUA 2EXWC 2X4TA 5HYQA 1MFAL 3W11D 3CC5B 4J3OH 4GMTH 5F3FA 1NGPH 4NHCL 3IDJA 1M7UA 4HSCX 3T0EA 2FLRT 1QI5A 1Z32X 2C9AA 3N85H 2ZP9A 1GYAA 2GHZA 3UEZA 2J8UA 3G9VA 5D4JA 1UB6B 4ZTOH 3RU8H 2V2WA 2BSED 1RU9L 4GXFA 3G5YA 3L81A 4NRYA 2E3VA 3CVHB 4KY1H 2YPLD 3O9WD 2YUVA 4ABQA 3G9AB 3NPZB 3IPEA 2CGRL 1ZWIA 2CDGB 3G6JE 4J1UB 4MNGA 1NCWH 4XPFL 2BJML 4Y4HC 4FA7B 2HA1A 4AGMA 4M6OH 5DJZB 5HYEA 5JDSB 1KJMB 3IDXH 3Q3GA 3BRDA 4K7PY 2O26U 3I9PA 5I1GL 2XG5A 4LCCC 1HHKA 3GXNA 3TBBA 2W0FB 1JHLL 2JI3A 4HD5A 1LO4L 3BWZA 1A6AB 4MA1C 4OZFG 3FUIA 2PPFA 1C12B 1B0RB 1GOHA 5FGBA 3ULVC 4QNPE 4JG1H 5EEWA 3K4DA 3EJPA 2BC4A 4XN1A 5F93C 2VE6B 3WNLA 1JUFB 1QSZA 2NX5A 2DEYX 1EEYA 4YSDA 3CZUB 4RIRA 4GRWF 4OSUL 3HPJA 4XNBA 4LHUD 1QZNA 5D7LB 3RBGA 3TH3T 1R3LA 4NRXB 1CFSB 4U6VH 1Q0XL 3MUHL 4JFOB 1PS3A 1B6UA 1QACA 5CHNA 5I8EB 4PJXB 1YMMB 1CDUA 2EDWA 1MFAH 1KCRH 4AUJA 3DA0A 1MHHB 4NHCH 4JFDB 5I1EL 1IKNA 4AM0Q 4G83A 1TZ8A 3K6FA