3AZUA

X-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSQPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title X-ray crystal structure of the two site-specific mutants His35Gln and His35Leu of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
total genus 34
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1991-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3azuA00
2XV3A 4A68A 5B1BB 2TSBA 5TK2A 2ZONA 3CVDA 4X4KA 5E9NA 4A2GA 1KCWA 2PP8A 2GB2A 1MZZA 2GC4C 1T5KA 1DYZA 1KBWA 4HHWA 3QJTB 3ABMB 5AZUA 4G7SB 3H4FA 2EILB 1GS8A 1NIBA 1X9RA 2BWIA 2HX8A 2ZWNA 4BWUA 1F56A 3QJUB 3SQRA 3WKQA 3X1EA 7PCYA 1JXFA 2R7EA 2OJ1A 3NSDA 1GW0A 1JZIA 4AKPA 4E9RA 1BXUA 3NYKA 5B1JA 4FAAB 3IE9A 4YSTA 2J5WA 1SFDA 4YSPA 3FQ2A 2PLTA 6PCYA 1PLAA 4W1TA 3ASOB 4ZK8A 2GHZA 2GI0A 3WNJA 1L9RA 3DIVA 2GBAA 2YAEA 3PPSA 3CG8A 1M57B 1BQ5A 3NP4A 3FSVA 1XB8A 4HZ1A 3EHBB 1TU2A 1JXGA 1ZIAA 1E5ZA 3FU7A 3FQYA 5B7MA 1SHWA 2BO0A 2FWLB 4BXSV 2QDWA 1IC0A 4E9XA 3MX0B 3WKPA 2XXGA 3S3CB 2UXTA 1ILUA 2PCFA 2VSKB 1NICA 1AANA 2AANA 2EIKB 1HAWA 1CURA 1L9SA 4F2EA 1NWPA 2AZAA 3S3DB 1AIZA 3NSYA 3QJRB 3EH4B 5I6MA 2FQGA 2J57A 5B3SB 4KNUA 2IWFA 6PAZA 3ZBMA 2XV0A 2EIMB 2BZCA 3AZUA 2FQEA 4A67A 1KV7A 1M56B 2GSMB 1PZAA 4YL4A 2QDVA 5D4JA 2P80A 1MDAA 2BW5A 1RCYA 2X88A 1L9PA 1SF3A 2FT8A 1SDDA 1AZUA 4AX3A 3PXLA 3JT2A 1SHXA 4HALA 4P5RA 5F7AA 2FNWA 5D4HA 1FA4A 4EF3A 5I5JA 1GS7A 3X2QB 5PAZA 1JVOA 2HRHA 4G71B 4JKNA 4UF7C 3PAUA 3GDCA 3FQ1A 4HCGA 5I6PA 2JXMA 1NIEA 3CDZA 3AG3B 3FYEB 3PLYA 3UAEA 2J56A 9PCYA 2YXVA 1OF0A 1OCRB 3NJHA 1AS6A 2A3TA 2IDQA 2FQFA 3IBOA 4HCFA 1ID2A 4KO6A 2R7EB 3ZIYA 1E5YA 3FU9A 5I5IA 2PPDA 4NAJA 4YSQA 1BQRA 2N0MA 3CVBA 1DZ0A 4HAKA 1QNIA 2DWSA 1QLEB 3ABLB 2PP7A 2IDFA 4KOCA 1M9WA 1JZGA 4AKOA 3NSFA 1PZCA 3WG7B 1WS7A 3NJKA 1ZDSA 2FQDA 1NIAA 3OMAB 3UAAA 4W9ZA 3N2JA 4JHUA 4L0PB 3BQVA 2JFCA 2HX9A 3QJSB 1PZBA 1GR7A 2HZHA 2PPEA 3FU7B 5B1JC 5FC9A 1UATA 3FSAA 3QQXA 2IDTA 2NRDA 1MG2C 5I26A 1A8ZA 1PNCA 4DP8X 1ADWA 1FFTB 3C75A 1SNRA 2PPAA 1EZLA 3QJVB 4A2HA 2BZ7A 2IH8A 2Q5BA 3PAZA 2IDUA 2I7OA 3GYRA 2BW4A 3L45A 2VW7A 3AG4B 4JHVA 3SBPA 1ZV2A 1CYWA 5I6LA 1ET8A 1ET7A 1GY1A 2XUWA 3NSCA 3OQRA 3NJNA 4CSPA 2DYRB 2XWZA 3T6ZA 1TEGA 2XV2A 2CBPA 5I5MA 2DV6A 5EHFA 3ABGA 4F7KA 2J55A 1HAUA 2CCWA 3FPXA 3CVCA 3OMIB 4E9QA 1J9QA 2BWDA 4YSCA 4N8UA 1WA2X 2YXWA 1SDDB 1ZIBA 1JERA 1I53A 4M4RB 1WS8A 1E67A 2BP8A 4AZUA 3TU6A 4Q8BA 2IAAC 1A65A 3NJIA 1AR1B 2PCYA 3T71A 3OMNB 1PY0A 3CDZB 3UGEA 1IKOP 1NPJA 2PPFA 3QPKA 3FPYA 1NWOA 1E30A 4G72B 4YSRA 2VW4A 2IH9A 5I6NA 2UXVA 4E9TA 4G7QB 1IUZA 2E86A 3FU8A 3UADA 3DKHA 3NJLA 1KBVA 1HFUA 1V55B 3FS9A 4E9VA 1V54B 1KGYE 5LDUA 1N70A 3NT0A 1A3ZA 2IDSA 1L9OA 4QLWA 4DPAX 4DPCX 3WNIA 2B08A 2XU9A 3ASNB 2I85A 3AY2A 3IN0A 3S3BB 2OV0A 5AFAA 3NJJA 1PLCA 2YARA 2ZXWB 1URIA 2YAQA 2YAMA 4YSEA 1GYCA 3DTUB 1E65A 1IBZA 2WO3B 1PF3A 3FSZA 3X1GA 4NB7A 1OV8A 1SJMA 3FT0A 4RH4A 1GS6X 1N68A 2GIMA 2UXGA 4KO7A 4BWTA 5IY5B 3G5WA 4PCYA 4BXVA 1AZRA 1AAJA 4E9YA 2XX1A 3WIAA 4GY4A 1PLBA 1NIDA 2H3XC 4E9SA 1OE2A 3HEIB 3T9WA 4WKXA 3D12B 4YSOA 4YVUA 1NINA 4YSUA 3ERXA 1WA1X 3AW5A 1PNDA 2HRGA 1TKWA 1JXDA 2AVFA 2JKWA 1OCCB 3TA4D 1NIFA 3S8GB 3WI9A 3QJQB 2XVBA 4GP5B 4KO9A 4DP5X 2I7SA 4A2DA 4N4YB 3ZX1A 3IEAA 2EINB 1YLBB 2B3IA 3MBWB 3NJMA 4DP2X 1AQ8A 3U25A 4DP1X 5B7EA 4HCIA 2FJSA 4DP9X 1XB6A 1NZRA 4BDVA 1J5CA 1JZFA 1BQKA 2BP8B 3SBRA 1ET5A 2XYBA 1ETJA 2UXFA 3RYMA 2UX6A 3KW7A 5F7BA 1NTDA 1OOWA 2PP9A 3TBBA 4WTQA 2BHFA 3H4HA 1BYOA 1R1CA 1AACA 4YSAA 4YSSA 1EHKB 1KDIA 5I6OA 1ZDQA 1AZCA 5I6KA 1A4AA 4BWWA 4DP7X 3X1FA 2VM4A 4ENZA 3FYIB 4GXFA 4AI7A 1AZNA 1QHQA 5B1KA 4QKTA 2LLNA 1J9TA 2BP0A 2MTAA 1MZYA 4A2EA 3OD3A 1KCBA 4M3HA 2DWTA 4F2FA 3H56A 4DP0X 2H5UA 4G7RB 3HB3B 3CZUB 2W88A 1OCOB 2YAHA 5PCYA 4GP4B 1FWXA 1JZJA 2Y69B 5D4IA 2VN3A 2OCCB 1BXAA 2QPEB 1MG3C 4AKQA 5A7EA 1ASPA 3EH3B 4UAHA 4HHGA 2GC7C 3T6XA 1XB3A 4E9WA 4BK5C 2FT6A 2QPDB 3T6VA 4P5SA 2MRYA 3TBCA 1PAZA 1CYXA 1OCZB 2CJ3A 2VM3A 4DP6X 3UABA 3S8FB 2X87A 7PAZA 5AKRA 1V10A 1CUOA 1W8EA 4TXVB 4FA7B 2AFNA 4GYBA 4A66A 4KO5A 1BXVA 3PCYA 1CC3A 1B3IA 2DYSB 2AZUA 1ASOA 2TSAA 2YAOA 1W6LA 1GSKA 2YQBA 2IWKA 1KYAA 1AG6A 1J9SA 1JZEA 2CALA 3ZDWA 2CAKA 2Q9OA 1KDJA 2XXFA 1JZHA 1L9QA 2VSMB 4Q89A 5B1AB 1WA0X 2EIJB 3GXUB 4BDVB 1RZQA 3N55A 3X1BA 1WAEA 2ZOOA 3KW8A 3UACA 4HIPA 1L9TA 1ZPUA 2IWEA 5ANHA 3V9CA 2HXAA 4DP4X 1JVLA 2QT6A 4GP8B 2VMJA 1X9UA 1BEXA 1AS7A 3EH5B 4CSZA 1GY2A 1BAWA 3NJFA 2DY2A 1VLXA 2YAPA 2VW6A 3OM3B 2HX7A 3TASA 1PCSA 4PAZA 5B7FA 4DPBX 2WSDA 1A4CA 2P80D 1RZPA 3BVDB 4KNTA 4NERA 3NJGA 4UANA 3JTBA 5I28A 3V9EA 1ILSA 3AG2B 2CUAA 4MFHA 2BP0B 1W6WA 2WO2B 2W8CA 2RACA 2H47C 5TK4A 1J5DA 3PAVA 1A4BA 3X1NA 4KOBA 1AG0A 3FSWA 2XX0A 2YAFA 1BYPA 1RKRA 4KNSA 2FT7A 1OE1A 1OE3A 1PMYA 4K9JA 4YSDA 3SBQA 3IN2A 2Y1AA 3ABKB 1TEFA 4G70B 1SF5A 1XMEB 3NP3A 4A2FA 1AZBA 1J9RA 1SFHA 1NDTA 2PPCA 3AG1B 1NPNA 8PAZA 1JOIA 1AOZA 1AS8A 2UX7A 4YVNA 2HLEB 3EF4A 1IBYA 2XLLA 3T6WA 1ASQA 2FTAA
chains in the Genus database with same CATH superfamily
1AXSB 1T6BX 3BN9D 3CVDA 3JWDL 4X4KA 4FX5A 4RFEB 4Q2ZB 3CFMA 3MLXH 5FFGA 3RUGA 3QJTB 3QRBA 4UQ2B 2VAJA 2A6DB 4WRLA 4ODWB 4JO2L 3QFJB 2NQ3A 2XA8H 5D7IE 5FM5O 1IL1A 1UD3A 3WKQA 3H2PA 5EO0B 2X6UA 1KJMB 3IS1X 4LGSB 5ESVB 1V3LA 1B6UA 4PM1A 5GS0D 4C54A 1K2DA 3FB6A 2PF6A 4FTVE 3L6FB 5IOPA 3L08A 1AC0A 3ULUC 1A1MB 4W1TA 3UTZA 3NOIA 3O2WL 5HD8D 2NSMA 4OCLC 3UPAA 3PJSA 1BCIA 4OM0H 5E1AA 3VXRE 2YAEA 5DDHB 3NCMA 4M62H 3QUYA 1BYNA 4HJIA 4WTXA 3VW3H 4S1SH 2FJUB 2KKQA 4PPTA 2MIZA 3GRGA 1XB8A 1TZ8A 2NW2A 2OMYA 3ATBA 3F6JA 1E5ZA 1T2JA 2FBRA 4J3OG 4JRXA 6TAAA 4KJWD 2OL3L 3ARGA 3RZCA 3LPGA 3MX0B 3WKPA 1NAMH 4H8HA 4W4OC 1AANA 3FZUD 2F18A 5EU6A 1J5OH 1LK3L 1NWPA 1KIRA 4BELD 5K9KA 4LLVB 1S7QB 4OD3H 3S3JA 1PLGH 1YMHA 2XTJE 4U1JA 3UBHA 3JWNC 4C4KT 1RJZA 4OZGB 5IB1A 4AM0B 4PJ7E 4EZLA 1AHWB 4WFGD 1AR1C 4I7ZC 3G3LA 4YX2H 1S7WB 2L4OA 4NZTH 5FYKH 5DC4B 1ULVA 3LIUA 4KVCL 2XYCA 1AO7A 2ZUUA 4PCKA 1AGDA 1KIUA 5AVXB 5KW9H 4TULL 3UTQB 4GAAA 5INCA 3FUEA 5SX4H 5AD0B 1DEEB 1MUJA 1RCYA 3GSOB 5CD5D 1L9PA 2OMTA 3D5OF 5HHPB 4K8RD 4WUUD 3AT8A 1D3CA 3CFTA 3MDJA 4M48H 4P5RA 1KMGA 3DHPA 3RKDD 3TV8A 1TJHL 3A6OA 1AGCA 3E3QC 3BZFB 1MH5A 1X5LA 4G5ZH 1G9MH 2WTOA 3EO9L 3W56A 1UACH 4R2GC 5I16A 1JZ4A 4D8OA 1CLOH 2BVPB 1ITCA 1INQB 2BMKA 3LKSB 3MN8A 1N5AB 3P11H 3ZTCC 4HEPA 4WW1A 1M71A 4R5TA 4ETQB 1T0MB 2AEPH 3WN6A 3QQDB 4XI5D 1RHFA 4Z7OB 1VKXB 4S1DD 3V7MA 3BVUA 4XWOC 4KX8A 3ARYA 4EI5D 2VLMD 3VSTA 2MPAL 4R4FH 1Z1WA 2I07B 1X5GA 1Q38A 3FN3A 3P4NB 1LD9B 3CSPA 4Z7WA 4DW2L 2HLAB 5F8QC 4LFHG 4K3DL 1U9KA 1F4XL 3MJ7A 2J25A 32C2A 1F41A 4LCIL 3IDGB 2V9TA 3H9SB 4XP4H 1GGYA 3GTVA 1C7SA 3FQXB 4L8DA 1J48A 1Q1JH 1F4AA 3O0LA 1NIAA 3OF6A 1S5HB 4LEOA 5DF0A 3KGSA 4L0PB 4Q0XL 3NN8B 1NFIA 5EBWB 1KCRH 5KWYC 2GY5A 1TCRA 1FYTB 2ZX6A 4M8UA 4XPGL 3SOBL 4PJEE 3VGHA 3WS6C 4G80B 3FAWA 4OD2B 3MRMB 1G7JA 1PIFA 3O6ML 1FN4A 4PJFF 2GJPA 3MRKB 1HC1A 5C0JA 1BJ1H 3KWXA 3IFOB 2ITDB 3CFUA 5E8NB 3TH2T 4N8VB 2F54D 4Y4FC 4ZFGL 4U6VL 3FO2A 5GZNA 5HDBF 1I7UA 2WANA 3NEEA 1YEEH 3BIKA 3L48A 2YEVB 5KYXB 4MCNA 4OB5H 2V2WA 3S35H 1IV8A 4Z0BL 3ZE0F 3KDMB 3JWOL 1HN1A 4HT1L 5AAMA 1ZGLP 2DYRB 1ACYH 1CVSC 3WFEL 5I5MA 3PQYD 4ONGL 4PUBL 5BO1H 3PHQB 3MV9B 4QR7A 4XP9H 1CE1H 2WGXA 1JGLL 2Z35B 2G0KA 2KI6A 3IGAA 5IIEA 2YXWA 3Q06A 5BQDA 1JERA 2CKBA 2PXYC 1R34A 3EYSL 1IT9L 2MKLC 3O11B 5D1XB 1OF2A 2V33A 4LP8A 4FXGC 3ARDA 5EIIG 1DFBH 4P9HH 1LP9A 1A3LL 1KGCD 1U8PB 2XQYG 1JXJA 5F3HA 5KANI 1HK6A 1NJ9A 4OIIH 3WV0A 3MCLL 3EJRA 3U4EB 3HZVB 1XAKA 3VCLB 1F90L 4JFFD 4CU7A 4WHTB 4F7CA 2Z3FA 3K74B 3HB3C 2CK0L 2E86A 4NQEE 2VJ8A 5CM1A 1JGUL 3DVNB 1UURA 4IRZL 2GFBA 5KBPA 2A74C 2VISA 2Y3NA 3P9LB 4O02B 4QLWA 4IBQA 4DPAX 5C0FA 3BSZA 4DPCX 3HAEG 1CGUA 1WP6A 4WWKD 4JKKA 3ASNB 4NN7C 5CJXA 5F2FA 1WZAA 3GRWA 1IC4H 1HCZA 4LLMA 1U8HA 3KCPA 4LSTH 4U1HA 3D39D 2OV0A 2KZ1B 1RXLA 1PTZA 2A9ML 3LDBB 3HE6C 3L7EA 4GJTB 5BJTB 4JO1H 3WY3A 2GSIB 3FQNA 3NUKA 1Q72H 3H6AA 3T2LA 1SJHA 5CWSA 5D2LF 5E6SB 1T0NA 4F57L 4ODHL 1KTLA 1JPGA 2GITA 5GS0L 5JQHC 4FFZH 1N68A 4XMPH 1FZKB 1ZLWH 1BIIB 3G5WA 5IQMA 1YEKH 2VLLA 2IWGA 3DMMC 5LCVA 3T0EC 4JRWA 2HPOA 1PLBA 3U4BL 3KXFD 4N2EA 1FZMB 4PJCF 3K0WA 3EUDA 5DD3L 1BVNT 1S9VA 1TR7A 4CMHC 3B5TA 1SBSH 3KLSA 1FFPA 4U7SA 1XH3A 2AI0H 4K7FB 2X1OA 2YEZA 2BJMH 4IEFB 3V6OC 3MKKA 1UM6H 4F80A 5TFSL 1U8CB 4MJJA 4ANVA 3VXMA 5KN5B 5L6YH 2CNZA 5J6GB 5ADOL 3WFBH 4K7PL 1LQBC 1ZHLA 3UP6A 2EDLA 2VLKE 3QNZA 3IEAA 3K6FA 4QI3A 1N67A 1P0SE 1U0QA 2F7PA 3NJMA 2MCMA 3QDME 3QDGB 4DP1X 3U2SB 2X09A 3NK3A 3KEHA 1U58B 3MR9B 3UC0L 1JZFA 3LIZA 2MSPA 1D6VL 1RIVH 1QO3A 1MAML 4BFIA 4MDIA 1UOKA 4CAGA 1HQ4B 4HQQH 1NAKL 4X0NA 3BW9B 4W70A 1MLBB 4JZJC 1NEZA 3GSNH 4ZS7H 2W9EH 1MW3A 2PP9A 4I8DA 3FHEA 4KV5F 2AEIT 5AVWB 3U36B 1UKSA 5C0NC 2K8MA 4L3CB 4XO3A 5EFIB 3H4HA 3SD2A 2C9VA 5L2KD 5C8JA 4BFKA 5DUPH 1FNAA 4XCEA 3X12B 4U0RC 1A0QH 1BQHA 4YO0A 3KYMA 1JTPA 4UU9A 1A7BA 4K8RL 1XSIA 3X3GH 2ITCB 1WYJA 4JFYA 4APQA 2E7DA 4H1LG 5EBMA 2R9HC 2R2HA 2FX7H 5DQDH 5HHQB 3FYIB 5BZZA 2HPTA 3ULSA 3WY4A 5I74C 3D39B 1R3HA 3MV11 3SKNB 2C4FU 1MHEB 3MTXA 4LO9A 3TJHD 4PJGB 1JDCA 1MZYA 3R4DA 4KY2A 3FRUB 4EQ3A 4YHZL 1FJ1B 5E2JA 3Q5TA 2VITA 3ALWA 1F6LL 2Q86B 3T77B 1NQBA 2QPEB 1EJOL 1QEWA 3RTLA 5E08H 4UQ3B 5FDYA 1BG1A 3P3UA 1XF5A 4MZIA 3KPOB 1GGIH 1HIML 1I8AA 4QAWA 3V0JA 4E9LA 4BK5C 2R2CA 3KYOA 4H5SA 3B2VH 1E2WA 1P4UA 2FHFA 2DW5A 3L9BA 4O02L 1GPOH 4DP6X 2XN9E 2VM3A 2AGJL 1OTSD 3EG9B 4XXWA 2H7WA 3ZTDC 2R1WB 3L4TA 5L88L 4NNXB 3CN4A 3Q6FB 1IGJB 4UTAH 4PY7A 1YQ2A 3HNTH 4UT9H 4EUPA 5D7JA 3DO7A 5AW5B 4WTZG 1GKOA 3NCEB 1RP8A 1QFWI 3O3BB 1JMZA 3MOBH 1XD1A 4N0CC 5KBDA 5GJSH 1DDHA 3S88H 3IAPA 3ULUD 3STZA 1AZVA 2G3NA 2AJXL 3CNKA 1YNLL 1NOAA 3GQFA 4NN5C 1FG9C 5F7DA 2QR0B 1WFTA 2V2TA 2NY4C 4BH7A 4FTVB 4I3SL 4XXDB 1EO5A 3WN5A 5FGCE 2ITEA 2HRLA 3QQ4B 5GZOA 2F74A 4XB3A 1TQCC 3OJDB 3AY4A 5CHNA 3VXRB 1WC7B 1AS7A 2XQ0A 2WLLB 1A7OH 2ZYHA 3NPSB 3O4LD 3EO1A 3STBA 4ETYA 3DX4A 1ZK5A 4XGZA 2VW6A 1JXKA 3OKOA 3K6SA 3L2MA 1RULL 1VDGA 2O5XL 5E2VH 3FOLB 3L3OA 3M8OH 1EAOA 4NBXB 3BPOC 3NIDF 4KVPA 2X2JA 4JFEA 4DKFL 1NFKA 2L0DA 1J05B 3TVMB 3V9EA 4MFHA 4WCYH 4CMMA 4DH2A 1ETA1 4MXWH 5CGBA 4F5CA 2N01B 4KZ0A 5EU4A 3KPLB 4LMQE 4N1CA 1AR1D 4WKZB 4Z3TA 3LEVL 1QSFE 2XTJB 4P4KC 1MSPA 3R06A 4KXAA 5TDNA 2X4PB 1DBJH 4QAMB 3VRLE 3MQIA 1T4KB 3BMVA 3V0GA 2HRPH 4F2ME 1CFMA 4AEHL 1XMEB 3II2A 3MYZA 1IEBB 2H32B 1J9RA 1V3MA 2BSBA 4R2GD 3EFDL 1Q0XH 2WXQA 1CTNA 3LHPL 2OMXB 3BKMH 5MEND 1BZ9A 2HG0A 2YD3A 2CDFA 2VDNH 3G08A 2X89D 3FT3A 3QO0B 4ANUA 5IV2A 4LCWA 1W0VB 1H3PH 2VAAB 3GZOA 1ASQA 3VRIB 1ZXKA 2AABH 3I3EA 5FKPA 4BEIA 4HH9A 4LEEA 3L4UA 4G8AC 5EOCL 4K5MA 2VDOH 3W0WD 3ZHLA 2GC4C 1ZLWK 1P84K 4XWOD 5DU7A 2F8IA 5GS2D 4BHUI 2DMGA 2EYSB 3LYRA 1JYNA 4G1MA 4F8QA 1A4JB 1IVLA 2XC8A 3SQOH 4ORZC 1CFVL 1FSKC 1H0DA 3VQMA 3VFNA 5CCGE 4WO4B 2D7TL 4RBPH 1R5WA 3SQRA 4RISL 3MRFA 1KXQA 4FFYH 2DLEA 2GT9A 1GW0A 1S2EA 4U3XA 2CHDA 1Q9WB 1HL5A 2X42A 3UCRA 3RWFA 3RZCC 4LSSL 2K7QA 4ODVH 2DWDB 4GW5A 4YHIA 4ZK8A 5TDOA 5DLLA 1M7UA 2YD1A 3MNWB 2FJFA 2FVNA 3HRZA 3UH8A 4LT7A 2K3TA 2SEBA 5MP6H 4M1DH 4IBSA 4O9HL 4PV8B 3GLAA 1WF5A 4M61A 4Y4FD 5CIPB 2ZX9A 2GBTA 4PJEB 1NCBH 3EOTL 3KR3H 3AS0A 1SXNA 5KBKA 2X4OB 4Z0XB 3L17A 5CU5A 1N8ZB 3WJMB 3IETB 2YFNA 5HGAB 5KSVA 4XCFL 1AR2A 2EE6A 4JDZA 1FO0B 5L8LB 3ARBA 5A2JH 5FUOH 3PWVB 3TJEH 4UUJB 1Q94A 4HPOL 3FB7A 3QUMH 2MOGA 4PHZA 4QRPA 4OGAC 3IPBA 2CO2A 2EDNA 1J12A 4IKNA 4XB8A 4PJAF 2ESVA 4AL8C 2BCKB 3V5KB 4JUSA 2QMKA 3SYOA 1IU1A 4JM4H 2PXYD 4R2GB 3BKJH 3KJ6L 5J1SC 4X6EB 4TYUA 2WZ0A 2R0WH 5JW3H 2J1XA 5H37H 5D8JL 2MFNA 5C97A 4HUUA 2X0WA 3CC5A 5KEZA 3S37X 1HHIB 4O00A 4HS8L 4XVSH 3HS0A 1GOHA 3BI9X 3IKCA 1KENH 4GXVL 4JGUA 3T3ME 4OLXL 2D9QB 3NZ8A 5GHWH 1SPDA 4XNQB 1ONQA 1HH6A 3MROA 2GTWA 3HB3D 2WTRB 3C60A 1K8DB 4FJ6A 1G9NL 5GPRA 1WAAF 3GB7B 5FKAA 5SV3A 3ROLB 1NIEA 5TE7L 3LZPA 2AJUL 1T3FA 1C9SA 4N26A 3ZO0A 1DBKH 2J56A 3RI5K 1EVUA 4MZ2A 1NMBL 3VH8A 4WQOA 2GG1A 1AIFB 3UMTA 4O4YH 2DYPA 3G9AB 3C08H 2GVYA 4NQEB 4RETB 3IDYC 1FNFA 2QGCA 1KB5B 1L7IL 1ID2A 4TQIA 3WYRA 1VSCA 2IPTL 2ZXGA 4OJFL 2PPDA 3ZZQA 3HE6D 3QCUH 5EUOF 2FYYA 5JOFB 4R8WH 3UO1H 3LH2L 5HP5A 3ABLB 1FIGH 4PFEA 1VHPA 4AGNA 2EUVA 2K0RA 5ICXB 1A3RH 3NRFA 4KOCA 1G87A 2GPZA 3K2MC 1UXSA 5I6XC 4QOKE 1AXTH 4FLSA 4UOW1 3DRTB 1F6AB 4XC3H 4NQDA 2Z9TA 3DMMD 5GZNC 2XTLA 2DQTL 1IEAB 2CJUL 1WH0A 4TNGA 3SY0B 4BZ1A 3NA4A 2Q8AH 4CJ1A 4HIXH 1IARB 3F5WB 1GW6A 4X4ME 1LEGB 2HZHA 3WGVB 4YHOH 2Z0UA 1RVFH 3AFLA 3BSHA 3GMNB 4HH8A 4X5QA 5D5ME 4Z7VA 2R2BB 4DP8X 3VXSD 3UAFA 4MJ6B 4J3OH 5IFJA 3PHAA 1R3KA 1Z9SA 5JLZB 1YECH 1SNRA 3CVHH 3D0LB 2NCMA 4YGAB 2GYSA 2HT3C 3G6JE 1SLVA 3TBTA 3IJEA 3WY1A 5IVZB 3KYNB 1TYJA 2AQQA 1U8JB 3V4VA 2XUWA 3HFMH 3L13A 5A3IC 2VR6A 2X9YA 1WJ3A 3ARDC 3PGCB 2HFGL 4GI8A 4CSPA 5DK2B 5I0DA 3QWOA 1HYRC 4Y4KA 3N44B 4GB9A 4A2LA 1E4XL 4G8GA 2VLKB 4PV9A 4JFOA 4MNGE 1NLDL 1TTRA 3K46A 1NMAL 3ECWA 2IBZX 4R96A 5D1QE 4LSQL 4G6JH 2BWDA 2QKIA 2WXOA 3FMGH 3WHXB 1WV7T 5AUMB 1J0IA 5C0ND 3OAUH 4NQSA 4M4RB 1EJ6A 3LPOA 3S34H 2XQBH 4TQEH 4UQ9A 4EI6A 3V4LA 2ZWYA 1BD2D 5E5UB 1A65A 1OVZA 2CIKB 3UPRA 4PRPA 3MLSL 5LBGA 1CGVA 4NN7B 2HAZA 2R9HD 2F68X 4YFLF 3U48A 3ET9F 5AEAA 2FGZA 3SDDC 1AD0A 4APXB 3S5ZA 2WXMA 4Y5VC 3MACH 5LXGH 1D5MB 4JG9A 1SGKA 1KOAA 5HHOD 2MCAA 1T89A 4CVZB 3MOAL 3LSOA 4GQ9H 3IRZA 5FK9B 2NY7H 1UWXH 2AK4D 1UM4L 4U33A 5AAWC 4J8QA 1TQBC 2ZKXA 1IM3A 2I85A 3T0EB 3X14B 4TV3A 5IJVB 2JH2A 2YQ3A 3BVVA 2CDGA 4AWJC 5JR1L 2EDRA 3O0RL 4F3FB 4TVSa 1X3DA 1URIA 2P5WE 3K3QA 3O3DA 4LLYA 4QJ3B 4RBPK 3RVVC 1H6FA 3DTUB 1S7XA 3X1GA 5HGBA 4IBVA 2CJSA 3LEYH 3O3AB 2ZAHA 3DI3B 4KO7A 4N2MA 4QRRE 1Z9OA 5C0DB 1WLHA 1DFXA 3N43B 3ULVF 5HPOA 3W82A 2NY3C 3FFCE 1HEHC 2XN9B 1TSHA 3MUUA 1NFDB 4YHLL 4G83A 4PG9A 4X8CA 4N0CD 1CE6A 3G5XA 1E4HA 1MY5A 1PAMA 1TKWA 4QHUA 1Q9KB 12E8L 4Z6AT 2G9HB 4TNFA 1IGCH 1ZVHA 2XZQH 4FZEH 2GI7A 3GMMA 2VMFA 3VFRA 2OR9L 2WQVA 4JZJB 1LO2H 4NZUL 3RVUC 5GRZA 1KWGA 2NY4D 3QDJE 2P5ED 1LE5A 4YHYC 1DVTA 1A6UH 1NAMA 3U9UA 4BYHA 4JPWL 5LJYH 4A2DA 1HSBB 4BINA 5LG6A 2VXVL 4U6XA 1UUNA 4LPTA 4Z95H 4HKXB 4U1GB 4N8CL 2E75C 4TUKL 1R47A 4QRQA 1ET5A 5FGCB 5IR1B 3I50L 1WCBB 3OKEA 3D0VB 1HOCA 5F9JA 3BQUB 4JFUA 1T5XA 3I85A 1OOWA 4XMXA 2D2CC 1KT2A 1JWSA 4M5YL 3TT1H 5JOPD 4KHTL 4MA1C 3MREB 3ETSA 5CR1A 4EXPX 4F8OA 4WUKH 3VFGH 5DJZB 2ZCHL 3HUJA 1ORSA 2E6JA 3FU0A 4GSDL 3W9EA 4QNPE 3SE3A 1MQKL 5FYJU 4FQLH 2CH8A 3C5SA 4P4KD 3CLFL 5DD0L 5DGRA 5BRQA 3MRDB 3QXDB 3SKUD 4YHNB 1NCWH 4YMPA 3FT2A 1FL5B 3DX9A 4FFTA 3KPSE 1THAA 1DSWA 1D9KB 1XSKA 3HC0A 1HZHL 4PJ5E 4DUVA 1N2RA 2C7UB 2WQSA 1BZQK 4G59C 5DJ0B 3K72A 4XXWC 3BAIA 2ICWA 4M4PA 3MLYH 4LSVH 1OCOB 3TZVC 1A2YA 3I9GH 5L4IA 1RURL 1X5KA 2YXFA 4F2MB 5HGHB 1KPVB 5D7JC 1PKQE 3EH3B 1T2QL 4FXLA 1XB3A 1MXDA 1X5FA 3L1OL 4MS8C 4PWHA 5D1ZA 3DV4A 5HYJA 2FT6A 4GKNB 1ZWIB 5IBUG 1N59B 3Q13A 4Y2DA 3T0VA 4PRIA 4X83A 2N1TE 4YDJA 2DQGL 4M1CC 3GC3A 3NDYE 5ICZB 5IQOA 4XPFH 1V10A 4JQIL 1CUOA 3MU3A 5SWQA 4NN5B 1IX2A 4BFJA 2FECL 3NIFF 2Y36H 5CZVH 1S7UA 3WN5C 2OAAA 2R1XB 5EZOH 2YQBA 2AC0A 4NSKA 1CGSL 1TQCB 3PF2A 3ZSSA 2ICEB 4HUWA 2IMMA 4GAGH 1OW0A 4FNUA 4X50A 3GF8A 1CXIA 2J4WH 3RZCD 1A7RL 1WT5A 3A21A 1BX2B 1L4IA 1N19A 3LRHA 4GW1B 4X6BA 3VXNB 2F2HA 1IE4A 4HFUH 4KKNA 5EU6D 4F15C 2V7HA 4JO4L 3WE1A 3P02A 3WHE0 5ILTH 3AMKA 1L9TA 3BZDA 4UAOC 5DK3A 3LN9A 4OLVH 3I74A 1L3WA 2XOTA 1CU4L 4J4PA 3DJ9A 2NW3A 3D3VA 4IM8A 1MPAH 5DVMA 2FLBT 2YAPA 2YUVA 3OM3B 3DVIA 5DZAA 1AO7D 5DS8B 3ZMRA 2CHNA 4UTBH 4LF3A 3S96B 2J6EH 3UGUA 5E1QA 5FM8A 2B5IB 4KNTA 3UX9B 2WWKT 5TH2A 4PWFA 2P47B 2A6JB 2DB8A 4ZD3H 3D25A 4YDVA 4U7KA 2PR9A 3QULB 2EVFA 3MV8A 2YMTA 4RNRB 3QQNA 5TE6H 4JFPB 5D2NE 3VVVA 1FCCA 5KVGL 5J1TC 4QRTB 2AITA 2ZF8A 3FO1B 2ZUTA 5MERB 3F8UB 3BKYH 3U1PA 2YHGA 2IPUK 3K4DA 1RQ5A 3VD1A 2JKIS 4FNPA 4AH2B 4HIQA 3OX8B 4P3DB 3MLTA 4YFLI 3FFOA 1UWXK 3I6LE 3RWEA 4O51B 1AJ7L 4AUYA 4Q56A 1V3KA 5DYOA 4D9QE 4I77L 5DJDA 5F96L 4MRCA 1JPSH 3R4RA 3T3MB 1FSKB 2ZPKH 3OVUB 5FOJA 3MMEA 4NJAH 3MLVH 2XLLA 4NZRL 4OTXH 5I30H 1QFUH 1V27A 2QLYA 3DK2A 2Y5TA 5F97E 4HXAH 4OKDA 1W15A 2I60H 4KQ0A 3OF6D 1OGTA 3QNXA 2PP8A 3MFGB 1K8IB 4BQ8A 3FBKA 3NZSA 3B2MA 4PJFE 1NCTA 3DETC 3RWDB 1HI6B 1QG3A 4BA8A 5AZUA 1QPKA 3C6LB 5GGQH 3HRZC 2IH1A 2X6AA 3ARQA 4GUPA 5EMYA 3T4YA 5HDBE 3AWFA 1UH4A 5ITFB 5EZPA 2JI1A 4JS7A 4LZKA 2JCCF 3RVXC 3UIZA 2A6KB 5E95B 3V6ZB 3KPNA 5GZND 5CUSH 3ZE0E 1JGEA 1B4LA 3RWCB 1WIOA 3IM1A 1DQQB 3W57A 2O5YH 1FFNA 3ROOB 2WMPB 2NXZB 4IBZA 6PCYA 3RUGF 4IKIA 3ARZA 3MBEA 1QTPA 5GGUB 2OQJB 4H8WC 2GHZA 2GI0A 3G5YB 3WY2A 3RDTB 1IAIM 4HX1A 1XGRA 2B1AL 1M57B 5AW8B 2EE0A 1QRKA 3Q3GA 1ORQB 1NDMB 1J1XL 3T2QA 2HT3D 2OM5A 3T1WA 1TU2A 2XPZA 5D5MB 3JXAA 1ZIAA 3HS8A 3WENA 1YMMA 2X4SA 4AYFB 1ZGLB 3L8QA 2GJ6E 3Q1SH 4AJVA 2FEDC 3L4YA 5F6IC 3B83A 3N1PC 2XWTA 5CNHA 5A3ID 5ID0B 2QPUA 2VSKB 3ARDD 2DTML 1X5HA 3G6JB 4AV0A 4S1RL 4JPKL 3D05A 4PSPA 2VUKA 1NLBL 1KXHA 4UMSA 3RL2B 3ZYJA 4UB0L 3VUAA 4CKVX 1AIZA 1Z6JT 1F3RB 1MWAB 3FUKA 2FK9A 3NSYA 3TO2B 2ZUYA 3U0PB 2G60H 1RJYA 5CMAA 1YN6A 2JIXB 4KNUA 3C60C 6PAZA 4WTWA 3OLIA 2CA3A 4MNGB 3GXMA 4F93B 3HG1E 5D1QB 4I9WD 4I0KA 4OZHA 4GRLC 2W9LA 5IVXA 5FYKU 2V7NA 4K3JL 2BW5A 2J6WA 1ANUA 3GMPB 3SDDD 1HH9B 1WEJH 2CIIB 3I02A 3VFMA 3W11C 4N3TA 1I85A 1D5ZB 1P7QA 3GT6A 4HALA 4MLSA 4R90H 4OCYL 5EA0H 5HDQL 3BC9A 4P23C 5I5JA 4WFGE 2K6YA 3S0PA 5D2LE 2O5ZH 2C1PB 3WEXB 4PP1C 2R4SL 5I0WA 4XPAH 2DI8A 2ZWZA 1U8OA 2X1XR 1KLFB 3LS5H 4G9DB 1WZ1H 4PBDA 1TZIB 3ZRCC 1PQZB 4B9IA 5AOLA 4HWBH 3RGVC 1KYDA 4LHUA 2HMIC 3O45A 5I6XB 1PYWB 5CEXB 4N22A 2D7OA 1Z2KA 1OCRB 3NJHA 4PJCE 4NQCD 3SKJH 3TS8A 3CFCH 4WV1A 2R7EB 1E5YA 4UTAA 3BZ5A 3OB8A 5A2LH 4D3CH 3VX0A 5EU5B 1KY6A 4UT9A 4WHYH 3VXTA 2XNAB 3EYVA 3H1ZA 3E9TA 1BZ8A 1HSAB 3RVVD 1EBAA 3CBKB 3NH7H 2V37A 2Y06H 3E8UL 3WS3A 1EAPA 1W0YT 4X9GA 4UT7H 4TNWK 1MAKA 3M1CA 3VXMD 5T1JA 1PZCA 1FLRH 3CK0H 3AXLB 3KWWA 5IK3B 2NY3D 4FQXA 4QO1A 4BA0A 5IB4B 2VH5L 3FONB 5DMYA 2RBLA 2R4RL 5I1HH 5I1EH 2VR8A 3S2AA 1TJGH 2QPSA 3B9EA 5I1GL 1AQDB 3PL6B 1YYML 2QL1A 3WTYA 1NCCH 4I48B 3TPKA 1NSNL 3DTXB 1AYRA 3FFCB 3K2IA 2ED9A 1G7LA 1SXSA 3MXWH 1QEXA 5F1NB 1U8IB 4KV5E 1Z5YD 3L3GA 5AW0B 2BRRL 3RVUD 4A2HA 2QKIC 2BZ7A 4ODUB 3MFFA 4UQAA 2EEAA 2QGBA 2Y6TE 4MCZA 3FT4B 3VI4F 1H9DA 2N0KA 1HCYA 3SBPA 2ZUQC 2F7QA 3DPBB 2IV9A 4L4TE 5K9OB 5E9DA 2K1MA 3QDJB 5DUJA 2E7HA 4FMVA 4YN3A 1NGWA 2CBPA 1FZOA 2KMWA 4FYRA 2K9FB 4AL8L 3SDDB 4ATTA 1K4CB 1I8LC 4S0TD 4Y5VB 1HAUA 1C5DB 1W91A 1LEIB 2Z91B 3FHQA 3UTSE 3J07A 2UZXA 3A5VA 4YSCA 5FO8A 4NZFA 1RFDL 1MHHB 3E6FB 5FO2A 1LE9B 1HZKA 4MVBC 4I0CC 3DSNA 5B8CB 1T89C 1QR1A 1WS8A 2RQEA 4H0LC 4H88L 3PGFH 5C07D 2WQXA 3QJZA 1MI5A 5E4IA 4M7LL 4I5BB 1T04B 4XP6H 1TQBB 1MWAL 4AITA 1QYGL 4NQCB 3CQPA 3RB7A 1ZVSB 3BGFC 4LSUH 5I9QC 3G6DH 1UWGL 4AVIA 4L8BB 5ABDE 3PWLA 3WCYA 1NCGA 4KXZI 5I1JH 1UWYA 4XMKH 5HYSA 5H2BA 2IOIA 2UXVA 4XRCA 3TIDB 1XZWA 2HJKB 3IK2A 4HPHA 2IADB 4RFOH 4EDXA 2AK1L 3DO3A 1WVZA 3NT0A 4H20H 5AOZA 4ZO6A 3TZVD 4PMFA 5D72H 4JDVA 3WNKA 3QFDB 3KPSB 5GGSA 5F0JB 4PJ5B 1OALA 1G0YR 5D7JD 1JTTA 1OD7A 2JKXA 4AIZB 2NSXA 4MS8D 3KPRE 3NJJA 4HOZA 4AEIH 2FBOJ 5GRVL 3LKPB 4PJ8B 5DZOA 3VXQB 5DWPA 3BT2L 4AJYV 2VXSH 5LBSH 4N68A 1UZ8A 4M1CD 1PKQB 1IQDA 4FFYA 2J2ZB 3AADB 3D08A 3WTWA 1SJMA 4PJ6A 3BEVB 4F58H 2EEBA 3PHSA 2VMDA 4QJ5B 1K85A 3EYQC 2WB7A 3LKOA 5HVFB 4YHYB 2WLIB 5AWNH 1QQDB 4HDIB 3WIAA 3LRMA 2P8PA 4YBQC 2QSCL 2LVEA 1NIDA 2H3XC 5D93C 5GZOD 2CCVA 2Q7AA 4YZFF 4UIMA 2F53E 4XH2B 1IAKA 3GMQB 1VESA 1XR8A 3EDEA 4AYBA 3NIDE 3IU4H 4GS7C 2JJWA 2O4EA 2D3JA 4M3KB 4RMBA 1PKOA 4I1NB 3L5IA 4RFNC 2VC2H 2YD0A 4MQXC 4K9EC 4NM8H 1GGBL 4MA1B 1BF8A 3HPLB 3HHSA 4AGPA 4HZAA 1YLBB 3QUMA 3PAYA 2AQPA 4R4BA 3BFQG 3KH4A 1DN0A 5L9DL 4P05A 5E2UL 1J5IA 4UT6L 2BIOA 2GK0A 2PYED 2KL6A 2C5DC 3P3SA 3VFVA 3JV6A 1C7TA 1MFMA 3UTPD 4NBYB 4ZI8A 4NENB 2J1ZA 4Z5RA 3SSGA 2ZNWA 3B7UX 3QYNA 5BZWA 5F7BA 5BO0D 1MRDH 2MNWA 5H37A 1TYEB 1JHLL 1NC4A 3O81A 5JW5B 4NM4H 3QNFA 3BSZL 4YSAA 4MDJA 3L3HB 2X4QB 5H94B 4LLQB 3TZVB 5B39G 3D4CA 5ADPL 4KQ3L 2JV6A 4BWWA 1EH9A 5I6KA 4NKMB 1ZANH 2D7PA 1HKLL 5CLTA 2WQAA 2ZAIA 3IDMA 4AQ8A 1W9XA 3BLPX 3F62A 5FFLA 4NHUB 4TUOA 3BO8A 2X4RB 4LCWD 1XGYH 5DJYB 2CDEB 4R7XA 5GRJH 3QRFM 5D2NB 5D1ZC 3QXTA 2AJ3A 4AYID 2DBLH 5EO1B 5CEZE 2Y9RT 1U36A 1SYVB 5L2KE 4R6UA 4Y2DC 4ZPTB 5AKSA 4PGDA 3SJVE 3RX8A 25C8L 3P4OA 3CZUB 1YUKB 3K80A 4GP4B 4FG6C 1XBRA 2OCCB 4MB4A 2ZWLT 3MRNB 4OGXH 3EJTA 3QPXH 3FCSA 3M6DA 5DYFA 1GZQB 5HHVL 5IKCA 4PWKA 4V1DD 3V4PH 3ES6A 4M7LT 2UZIL 1C5BL 5CS7A 2DQHL 4AUJA 2FSEB 1KPUA 3OPZH 1OW0C 2CGRH 4P0DA 2XN2A 3BUYB 1GOFA 2ZOUA 3DETD 1OCZB 2CJ3A 3FOMB 1UTDA 1T22B 1RPUA 4FQ1H 2I5YL 2RGSA 4ZQKB 3VWKB 1S9YA 1E3XA 1GSMA 4KO5A 4TLKA 3KL3A 3QC6X 2WCPA 3P0VH 4KPHH 3FF8A 1S8DB 4XVTH 1NCDL 2E5EA 5LGKA 4PJFB 4PW9A 4GNKB 3RVXD 4EVNB 1DVFA 1JZ3A 4FZ8H 3VU2A 2ADGA 2KZKA 1KYAA 4TSAH 4J4PC 1YEFL 4GLRH 3U30B 3PJNA 2PYEB 1U2CA 2FEEI 2CAKA 2Q9OA 3CVHA 4OCXH 3UZQB 5HDBB 3VI3A 2VSMB 1KGWA 3V52L 5I1CH 2AW2A 3GSWB 5FA3B 4PRAA 2PYFA 3HJEA 2GQHA 4PJ9A 5F7EH 3N55A 3MLUL 3ZE0B 4PJAE 3UACA 1UJ3A 3CCHB 4H2AA 3EHBC 2BVEA 4HKBA 2EDYA 5BVPH 4PGBA 4PVMA 4G7VH 4OFDA 4P9HC 5LWYL 2ESVD 3KGTA 4F8PA 5CN3A 4YNYA 4EAEA 5IVNA 3L81A 4OZFH 3VA6A 1HXMB 3IFPB 1YDPB 2FEDD 4UTCA 3PPEA 4BSVB 2P26A 2AQSA 3UROR 3VFTB 4QY8A 5E8DL 4QHNA 4NCC2 2R2EB 3UGXA 2XZAL 5BRPA 4NKQB 1EHLH 3LN4B 4BGDA 1M2VA 1QBMH 2GJ6B 5DJ2A 5IJBC 2R27A 3MJGX 3TNNA 4C4UA 1HEZA 4PRHE 4DSYA 4X7SH 1WAAE 2Y7NA 4YHKL 4OKVA 1ZLSH 3GBLA 2CBQA 2MCPL 3C60D 3MV7D 2HFEA 3U4AA 1DL7L 5E99H 5DHYB 5E4EC 1M3JA 3LN5B 3G5VB 5HVWA 4PI0A 3SE4C 2AAVA 1G7MB 3BP5B 1BM7A 2DMBA 4NO0B 2WD0A 2BC4B 3CUPB 2E7MA 4GRLD 1FQ9C 1KXTA 4IGBA 3ZR5A 3TGXA 4V1DB 2ATAA 4WFFE 5L4FA 3VFSB 5CBAA 1H15B 1BPVA 4FABH 3W11D 2VDPB 4P2OA 5EUOE 2G5BA 4DZ8A 4JPQA 1CF8H 3RNKB 3HG1B 4K23L 1M05A 5JPNA 4G7YH 3S5YA 5FDWA 2B15A 3I75B 3NCCB 2KPNA 2EC9U 3BH9A 1FZJB 4PP1D 5I8CA 1CFTB 2ZTBA 2PR4H 3WTVA 3BVNB 2XXMB 3LH8A 3B9VA 3B7SA 3RGVD 2HMID 1UXWA 1IBYA 1GC1L 4PJ7A 1Q90A 5D2LB 2N3JA 3H3BC 4CN1A 1ROCA 5F1SA 1T0OA 5HJ3A 4X6DA 3CMOH 1WHPA 4A2GA 4F8NA 4NKOB 3LAFA 4XN1A 2BSSB 3DARA 4Q9QL 2ZZUT 1CZ8H 5ESQA 3NTCL 3CSYB 4JFQA 4KGJA 1DBMH 4WI4A 3MBEC 3EADA 5MENE 4PJCB 3FQWA 1MFBL 1T1WA 2VZOA 2DQUL 3GXDA 3RE0A 2KYIA 3JWDH 5DHMC 3WXVL 1KLGA 2DH2A 5C0EA 1QFWL 4HULB 3MRIB 2EDMA 3PGDA 2R0KL 3E2HB 1U4EA 4Q9RL 2A77L 4K71B 3IE9A 4YSTA 3LZQA 4JO2H 4JZNB 4WEUD 2V5MA 3RNQB 4TTGA 1VEPA 3GMLA 4I0PC 4F37K 5JXEC 4IMLA 2H1PL 4G8GD 1NC2B 5IJKA 2GBAA 3DOIA 5ANMB 2P7TB 1NUNB 2WXLA 4JW3A 4Q6KA 4WFEE 4CVUA 1T5WA 4GXUM 2VR9A 3BZEA 4M5ZL 1VJSA 3O2WH 4JY4B 2G75B 2FDBP 1KWKA 3HC3L 5DMIL 3BZ4A 4F24A 2ZE0A 2PTUA 3IB4A 4YS4A 3KPMB 2V5TA 4BFRA 4P9ML 1B0GB 3NACL 4PRPD 1RD6A 4OZIA 2ZXCA 3ZKSD 5K39A 2LE9A 2X3AA 1FI8C 3M07A 2FRGP 1I85C 5LDSA 1UQSB 4AQAB 2HG5A 3FFDA 2OL3H 4HIJB 4L4TB 4P23B 5FB8A 4OSUL 5BOPA 2XACC 5IG7A 1KBGL 4MYPA 2WO4A 3RL1B 3HW7A 4MVBD 2VDRB 2YRLA 2IWFA 2VJ0A 3D9AL 3QG6B 2EP6A 1LK3H 4U6HA 4J23A 2LW3A 5F89B 3ZKXC 1EDHA 2VQ1A 1M56B 2F7RA 3CFEA 3MUHL 4G6FB 1IM3D 4L4VE 3X11A 2X88A 3AS1A 3HLAA 4XNZC 3OGCB 1XGTA 4WV1C 1MN4A 4KVCH 4LXFA 5CP7B 4L3EE 7FABL 3QORC 5HPMA 2ZXEB 5IHHA 4HK3J 4TULH 1U8QB 1X4XA 3PV7A 2JKTM 2ETWA 5AW2B 1UWEL 3CDZA 3GK8L 4LCVA 3ULVE 3AG3B 3FYEB 2P9RA 4J5VA 1M3IA 4OCRL 3SCMB 3CZNA 2VDPL 1ZA3A 1TJHH 1U2YA 5HHNA 2NT1A 5IMMA 3EO9H 4FQXC 1QI3A 2IPKB 3ZIYA 3IDIA 1OARL 4DN4L 3CU7A 3KLAB 3LY6A 2F0CA 3SE9L 2D3VA 3T09A 2DWSA 4GBXA 1QLEB 5C0AA 1A4KB 3QT2A 1JMXA 4OZ4A 5C09A 2CM6A 5LBVA 1A6AB 3WKNA 4DVRL 1VFBA 1JZGA 1UJTA 1ZY9A 2WAHA 3EYQD 2QGEA 5KVDL 2MPAH 4OF3A 3UAAA 4W9ZA 4YBQD 4DW2H 2ZUQB 4H8WL 2P43B 1DSFL 4K3DH 3VXPB 3QJSB 1F4XH 4WAFA 1H8NA 4ZMQA 3RIFF 2VKXA 4LCIH 1TZAA 5DS1A 1AE6L 4A55A 4G9FA 3VXUA 1YAZA 4YAQB 4ZFOA 5BS0E 3WUZA 3KD4A 1ADWA 1CDBA 4JREC 1OCWL 4Q0XH 3H0TB 4YR6A 3MNVA 2IAND 4AW4A 3EGDB 3VDCA 4URKA 2F53B 4OUOA 3ZGIA 3IXTA 4MQXD 1F8TL 4XPGH 3SOBH 1A9BA 5DZVA 4ZODA 3NIDB 3O6MH 3TO4A 2YC1A 3BVWA 2J6EA 2YJQA 4O2FA 1FVEA 5E2WL 1UA6L 4JZOB 1TEGA 4ZFGH 4U6VH 1G7QA 1QPPA 3L2NA 5IW3A 1GRWA 4WJ5B 4F7KA 1E43A 1T80A 3X13A 2WWNA 1EXUA 3OMIB 2MH4A 1I8MA 5D7LA 5C0CE 4Z0BH 3WSQL 1RJLA 2BNUB 3ZMEA 3JWOH 5GGVY 5GS3A 3QEGL 4HT1H 4PLNC 3D2UB 1DN2A 3MRPA 2H9GB 3IXAB 3WFEH 5DRZB 4FHJA 4ONGH 1H19A 4K3HA 4PUBH 4JRFA 3IDJA 4QXTA 5H35B 1JGLH 1P53A 3E80A 3D85B 3H55A 2IG2L 4N1EA 3W5NA 3EDDA 5CJ5A 4N0UB 2VIRA 4MJIE 4HV8B 4RMQA 5KSBF 3EYSH 1QLRA 1ZT1B 1IT9H 2P28B 2CSPA 3D6GA 4PGEB 2VDRL 5D1ZD 5J13B 2VLRA 1CCZA 5HYJD 4JY6B 1F1DA 4J6RL 1ZS8B 1SQMA 5HGDA 1A3LH 3L4WA 4PRID 4Y2DD 2XCMC 3BD3A 1HFUA 1DZBA 1UXMA 2O6PA 5E1GA 5E8OB 3RURA 1V54B 5J89A 3FB5B 2CBMA 3TIEB 3BXNB 3MRRB 4AUUA 1A9EA 3NIFE 3K81A 3M7FB 3MCLH 1QPXA 4FG6D 1F90H 2B08A 3ELQA 2HN7B 2IVFC 2CK0H 2EYRA 1L3NA 3SJVB 3DBSA 4Y4HA 2OSWA 3AU1A 4UOW0 1JGUH 4IRZH 5AFAA 1T1ZB 5HHOE 5CBEB 2EEXA 4HS3A 1JGIA 3BRFA 4NO3B 2YAMA 1QAWA 5D96C 1IBZA 1I1AA 3R18A 3U82B 4GS7B 1YYCA 3MXVL 2HCZX 1KTDB 4RH4A 4PS7A 1JF1B 2EZ0C 2IANB 4RFNB 3BEWA 4PCYA 2A9MH 5DHVB 4ZOBA 2XX1A 3K2KA 4N2FA 3GKWL 2X2IA 4AW7A 5T1LB 4J4PD 4F57H 1QLEL 4ODHH 3VQLA 1KZYA 3D3VD 1CGXA 3FTVA 3WXWL 5GS0H 3IMSA 1FG2B 3TM6A 4LK4A 2HVBA 1G7PB 3AAZA 2CLRB 1ZTMA 4Y1AE 5BZDA 3U4BH 3GMOB 1JFQL 3RWIB 3OXSB 3S8GB 2BSCA 4KK9C 1T20B 2MOVA 3EHBD 5DD3H 4CNIB 3F7YA 5DZPA 3QR0A 4Z7AA 3HG0A 1NBYB 4B7IA 4FXKB 1L0PA 4JDEA 2W0PA 2PO6A 3MV8D 5C08E 3L5XL 2ZD0A 3OC5A 5TFSH 2P4AB 4PJAB 2XBTA 4WSKA 5I1AA 3ZZSA 4WWPA 5SX5H 1BQKA 1QVOA 2AV1A 4PIBA 5EC1A 5ADOH 5ID1A 4K7PH 2IBZY 2UXFA 1J0YA 2XKNB 4EPSA 4PYHA 1JN6A 1LO5A 4ZNEA 1WBZA 3QZWG 4GKZB 2VDLB 2ODHA 2ED6A 3FQUA 4F7TA 1MEXL 3UC0H 5KYUA 3DX3A 4NFCA 1D6VH 1HINL 1MAMH 1EHKB 5ACLA 1NAKH 2VZSA 1XX9C 1E90A 3SO5A 1GZPA 8FABB 1PZ2A 4M7JL 5HYQA 1LO3L 3HI1A 4TSBL 3HFFA 2CM5A 4PRHB 4ENZA 3DXAE 4Z7UB 1JDDA 1OKEA 3O8XB 1ECZA 2MTAA 4N25A 4G42B 4HWBA 4K8RH 2J88L 4H8PA 2GJRA 4M6OL 4CA4A 3CX5J 2EVGA 1XGQB 2QBWA 5IHZB 5AZ2L 5E1HB 4ZFZA 5JHBA 2Y69B 2Q2EB 2JCCE 4HGKC 4ORGB 5EUOB 4L8SA 1CDIA 3OHXA 5JIIA 2YO3A 3F7RA 5I71B 1ACCA 3LNGA 2ORBL 3V0DA 3CFJB 4IOIB 4YHZH 5JNYB 4JPSA 3SZKC 3MCKA 1J11A 3SDXB 3RUGE 1M9SA 1FL6A 3DVGA 1EJOH 2RFXB 2GJZA 3MBED 1HIMH 3D0AA 1REIA 4KUCF 3SN6N 4J2XA 4QCIA 4E5XG 1I8KA 1UJ3C 3ZTNL 1RZJL 1RMFL 5I8KL 4O02H 3GIZL 1PVHA 5I5RA 3VGDA 3K91A 2AGJH 3P3TA 1D7FA 1E4JA 2WYIA 4MJ4A 1HHGB 3TCLA 5L88H 1FIEA 4ODBD 1DHKA 5T1KB 5K33A 4M02A 1L9QA 1GH7A 3A3YB 1WA0X 2TRHA 5TDPB 1N6UA 4K9EL 4EN3C 1QASA 1OL0A 1JHKL 4LKCB 3CXHJ 2C3HA 4MCYA 2RJMA 4HIPA 3M1BB 4RZCA 4W6YB 3QAZB 3A47A 2CR6A 3LQAC 3V9CA 1FF5A 4HJEA 3O3EA 2KBGA 3VJ6A 4JRXE 2DM7A 2AJXH 3U7WL 4Y2OA 3WNPA 2VMJA 5IFAL 1YNLH 1RK0B 4CSZA 2NUTB 4QPEA 3BSGA 4WZ9A 2HX7A 4Q58C 1IBGL 4I3SH 3GBML 2OXHB 4IGBC 5HHMD 4HKZA 4PREB 4LCYA 5IWLA 3AABA 1RZPA 3GJFK 1DJZA 2B8OT 3Q7JA 5AW9B 1AGEA 2DQIL 1P7QD 4P2OC 3U7YL 1T03L 1O7DC 1LNUA 5EBGA 1W6WA 5JPNC 2NR6C 2Y5QA 1HE8A 3G6AB 1RULH 2O5XH 1RHHB 1J5DA 2ZAGA 3W39A 4XNMA 4DKFH 1J8HE 3RGHA 2VDLL 4ZG1A 4YDLB 1SY6L 4LHUD 1JGVL 4H26A 2ZWKA 3C2SA 3GSRA 2FT7A 3QUKB 1Y0LB 2HVJA 3G04A 4EIGB 3HCVA 1P7BA 3GHEL 3CDCA 3IN2A 4L3FA 1G5GA 3ZUCA 4LKXB 3EXLA 3LEVH 3WNNA 2XWRA 4JHBA 3QORD 1MNNA 3LZOA 4L4VB 4PLOB 3PNWB 5AG9A 2W65B 1HEJC 3ATEA 3E6HB 1JOIA 2OX5B 3QHZL 3WFHB 1CGWA 1YCSA 4AEHH 5LBSA 4D8PB 1H3XA 4QHMB 2XV3A 5B1BB 4FQXD 3EFDH 3N85L 4GMTL 2Q0ZX 3LHPH 3GO1L 4KZEL 1G9HA 1KULA 4XMUA 2DMCA 4JGMA 1T1XB 4H13C 3WMPA 4P99A 4GRWB 4I0PB 4YC2B 4C56A 3ESUF 1OGAD 2UZPA 2HX8A 3F64A 3WEMA 5IJKC 5E8EA 3MA7A 2VXUL 2ITFA 1YEIL 3KL5A 4XC1L 4ECNA 5EOCH 3VI4E 1E40A 5DR5L 2DRUA 3WFZA 5ISZA 1S9XB 2Q10A 1UOWA 1BXUA 3HR5A 4FAAB 1SFDA 4XMVA 4PJDA 1BA9A 4NO2B 3ABZA 3ETBF 4ZUTA 1CFVH 3VD3A 3IJSB 1IKNA 1H3TA 2D7TH 1QA9B 3FO0L 4RISH 2ZX7A 1SJEA 1HWWA 3L95B 4XBEL 1BMWA 3N50A 5F1IB 1ZA6A 5F7MC 2ZCKL 5EC2B 3C2AL 2YMOA 3EUUA 5EF3A 5ABZA 2AMUA 3NESA 4F20A 4LSSH 5SX5K 1Z5LA 3ATFA 4N6QA 4MMZA 1EBPA 3L1GA 2F08A 2G9KA 3BRDA 4WSGA 1F3DH 1IGYB 2F1AA 3KLDA 4JUTA 4E9XA 1J8SA 1T1YA 2PCFA 2WBXA 1Y1UA 2WZAA 3CFDB 4O9HH 1RUPL 2E7LA 2ZUXA 3N5AA 4X5XA 3EOTH 1ETZA 5JPMC 1HJBC 2JJSA 5BCAA 2WBJB 5JDSB 1OTUC 2YD8A 3QJRB 1ML0A 1DBBL 4XCFH 4RMWA 1MHCA 2G5RA 1XZ0A 3TBWA 5MEPA 3F3HA 3MTRA 5EH1A 1I8IB 1M7IB 3ZBMA 4HPOH 2QLVB 1JZ7A 4X98B 3TN0A 4RGNC 2YA0A 2FQEA 3RA7L 4J6IA 5C0CB 4RAHA 3IVKA 4MJ5A 1IBDA 1MWOA 1Z3GL 2P80A 3UTTA 3VWJA 3EZ8A 3UBFA 3IFNL 2K4AA 2EIEA 3KJ6H 2H2SC 1E5CA 1X6NA 2OR8A 5D8JH 4QYOB 5I76A 1UB6B 3KHOA 2DD8L 1KTJA 4FD0A 4UF7C 5F88A 5DEZA 4MJIB 4NRZA 4HEPG 4P5TA 2JXMA 3V0VB 3FT1A 2K78A 4HS8H 4UQEA 1U8NB 4GXVH 5I82A 3IPFA 4OLXH 1IO4C 4QF1A 4OZHF 5IVXF 4WW2A 4ELDA 1T4WA 4KI5F 2WLHA 1OSZB 2FQFA 4HCFA 4GW4A 2XA3A 1G9NH 3T1FB 4YZFE 2EDJA 3MGAA 5FWQA 3CE1A 5TE7H 3NIFB 4LVHB 4PR5B 4YDIL 2AJUH 3RKPA 2WINA 2XPGB 1NMBH 2P49B 4HC1L 4HAKA 4P59L 5F93C 1RERA 5KS9B 1C12B 1X5ZA 2MOQA 4NRXA 4HGWA 4X5WA 1L7IH 3P4MA 4JREB 2IPTH 4N6RB 2EZ0D 3IMTA 2MKWA 3NSFA 1I7RB 4OJFH 3F12A 3S36L 5IEHB 1F11A 4Y16C 5JIQA 3ULVL 2I69A 5DHXB 3Q6GL 2FQDA 1DLHB 5DA0B 3ZT7A 4PS3A 3LH2H 1KELL 4KI1A 2X05A 2EABA 5C6WH 2JFCA 4G3YL 2HX9A 4S1QL 1PZBA 2EDHA 1S7VA 2FIKB 2Y7QA 3TBYA 5DUBA 4XBGA 5IVOA 1UGKA 3QQXA 2JKRM 3UBXA 2GY7B 2E4TA 1LHZA 1SJVA 2CJUH 2DQTH 3IT8D 3T2NL 5KVEL 1FFTB 4OZFA 3LXAA 1T21A 2YZ1A 4HKJA 3NFSL 2A6IB 1F2XK 3HZKB 3MUGB 4KK9D 3RAJL 3ZK0A 1XGPB 1NC4D 4PVBA 2QTEA 5AKTA 3WNOA 4JR9L 4RRPA 4NC0B 4Y1AB 3AB0B 2AXFA 1KIQA 4KDWA 4UOZA 1K5WA 4N90D 4I18B 1J88A 3NQIA 3BP7B 3NJXA 5C08B 5IESL 1PFCA 2JELL 4LNRB 5FA4A 1XEUA 2JK5A 3DIFA 3IF1B 4N8UA 1OT4A 4TQ8A 4E0RA 1SDDB 3PWPA 2HFGH 3F6IA 4Y5YA 3FRPB 1E4XH 5CIPH 4UNIA 3JWNH 4CUCA 4FEIA 4WU7A 1USQA 1A6PA 1NLDH 2ENQA 4Q8BA 1NMAH 1D7CA 1XO8A 3CXFA 4Y88A 4DK5A 2VT0A 2OCFD 4LSQH 3T71A 3AACA 4ZUUA 3TBSB 3I6GA 3UPCA 2VWEC 5A2CA 5MEQA 4Y4HC 2CO7B 3MO1A 3ZIMA 5BQ7B 1DVUA 1ODUA 4WGVB 3ZL4L 2NPLX 1YEDB 1JGDB 4PYGA 5MI0C 3GKZA 2B59A 3HZYB 5IMOA 3MLSH 2EDWA 3WO3B 1I1AC 4GAYA 1OPGL 3VE0B 3T2OA 1D5XA 3SGDI 4XCYB 2FUTA 2QJDA 4HXBL 2W60B 4AGLA 2OTPA 4AG4L 2KQNA 5C0GB 1DQKA 4ZS6C 2P42B 3T8XB 2K45A 2GCYA 4AYSA 1SJXA 3VX1A 3OKNB 4P3CL 2IFGA 1UT1A 2OMVB 1XWVA 1UM4H 1J87A 3NCYS 1CK0L 2JCCB 2YAQA 1D6EB 2EXTA 1Y6MR 5ACZA 1JWUB 3QUXB 4P4RB 4FNLL 5GS2H 1JV2B 3GTTA 3OB0H 3HG4A 4BWTA 4LPYA 4HWZA 1KIPB 2EUWA 1JK9A 5JR1H 4HUCA 5EIQA 1IGTB 3O0RH 2JJUA 1S6NA 2PCXA 2ENSA 2GUOB 4HHAA 1JJUA 2PO6C 4ANXA 4JKPL 1IL1B 3BWUF 2IJ0C 3BH8A 3NGBC 5DRWB 1CXKA 2QMJA 1SMDA 5FFOA 1JTOA 2XIIA 4O2EA 4R5XA 1XHHA 2PWFA 4L37A 1E4KA 4X9YA 4EN3D 4KRNA 3FCGA 4YHLH 1HNFA 2D4DA 1IAII 4KO9A 3TEUA 1B2WL 12E8H 3L5JA 2EINB 1DEDA 2LLLA 3MBWB 4IHOB 2R8SL 3CX2A 1HVXA 2X28A 2J5LC 2YRZA 3C87A 2DEWX 3GSVA 5EZLA 5F6HI 1TVDA 4H0IA 3GUFA 2OR9H 4BDVA 4NZUH 3SHSA 3B2DC 2OL3A 5DI8A 1E5AA 2BOBB 4JPWH 2DQFA 1NEZG 2Z4QB 4IGBD 4JFEE 4YBLC 4ONHB 5D7SL 4J12A 1VZIA 2CBOA 3O6FA 5KUMA 2VXVH 4UDTA 4IK7A 1FAKT 1Z32X 1P9MA 3BDYL 4N8CH 2N1KA 1INEH 4P2OD 1HXYA 4TUKH 1XR9B 5IF0B 1BQHG 2F7IA 2NR6D 2OI9C 1BP3B 3ZZLA 5JQ6L 3EFOB 3I50H 1QW8A 4MAYA 1OY3B 2VSDA 1AZCA 1G6RB 2DS4A 1A4AA 2F61A 3MJ6A 3Q9PA 1SYSB 2QV4A 3LOWA 5T5NG 4L1LA 4M5YH 3OHXC 4KHTH 5I73B 1KCLA 1JHTA 3RPIA 5D9SB 2BP0A 3O6LL 2J1KA 3WIFA 4MQSB 2ZCHH 4GSDH 1I9EA 5ECGA 5IEKA 1J8HB 1MQKH 2AXWA 5HHOB 3L9EA 2CLZB 2Q6WA 5DO2C 3L3JA 3CLFH 5DD0H 2YS4A 2MMXA 3K1DA 4AT6B 5LGJA 4LIQE 5PCYA 4AENB 4DEUA 1HHKA 2H0PA 5TE4L 2PW1B 1HZHH 4YHPA 5JHLL 4XMZA 2VJXA 1MFDL 3IJ7A 1CFSA 5G4MA 1TYRA 2F15A 1RURH 2DH3A 1M71B 3AXIA 5J1AB 2LT9A 3MCYA 2JF1A 3S8FB 4X7TB 5K9QG 4EN3B 5J12B 1P5VA 1T2QH 1KNOA 3CJJA 4MHHI 4EUPG 1OP4A 3UBGA 3L1OH 5JW4N 2HJLB 3KAAA 3HZ3A 3LKQB 1ASOA 3W1ZA 1KXQE 1AXSA 5SV4A 2DQGH 4RFEA 1W6LA 5DWUL 1BBJB 4GSQA 4RMSA 4Q2ZA 4JQIH 2BY1A 4RLDA 3MJ7B 3WUWB 2UWEF 2J73A 4UQ2A 5DZNA 2A6DA 3VG9C 4MJHA 3VI4B 2XXFA 4ODWA 3QFJA 4NC1E 2EIJB 3GXUB 4XMWA 1DJYA 1YN7B 2E56A 1RZQA 5IWLC 5EO0A 1CGSH 4MCMA 1KJMA 2FJHB 5FEBA 1I7ZB 5ESVA 5FW6A 1TZGL 2EVIA 3PS6A 3DUSB 4JB9L 4P57B 2BSTB 3U46B 1A7RH 2AKRB 1FNHA 3L6FA 4U3SB 1A1MA 2JI2A 4X6CF 3EH5B 2KH2B 3WAJA 4J3OF 4JO4H 5BUPA 5I0YA 1XD0A 3QIUB 5BW7A 5DDHA 5FYJE 3EJJX 4QRPE 5AAPA 4YBHA 1YO4A 4AY0A 3BIKB 2VYRE 4CILA 2KS0A 1CU4H 1MJ8L 3U2JA 5HBBA 2Z92B 5CILL 1OTUD 3T6QC 5I66B 2Z7WA 1DLFL 3CFNA 3TCXA 3B2UC 3MX0A 3WLWC 5T3XE 1L9MA 1NL0L 3O9WC 5T1MB 3OPUA 2AXGB 4PIRF 2VOTA 4PN6A 1A4BA 1U91B 4RGND 5FUCE 5MHSD 2CKBB 3RHWK 4LLVA 1S7QA 1LK2B 4BH8B 4BZ2L 2AP2A 1NCIA 3AGWA 3CBRA 2CPUA 4U7MA 1PMYA 1WFMA 1ZLEA 2Q1EA 4MNQE 2C9SA 4OZGA 4L18A 1E2VA 4AM0A 2H2SD 5KVGH 1AHWA 1G6RL 2E59A 2I25N 2ROXA 3HMWL 4XAKE 1S7WA 5LNGA 2R56L 2Y25A 3L3IB 4WWID 5JIPA 4U1NB 3L3DB 2V3EA 4CBZA 4QHLB 1MJUL 4IRZA 3UTQA 1P1ZB 2IGFL 4YDMA 5C09D 4NP4L 3GEWB 3TPUB 5AD0A 1DEEA 1KJ2B 3GSOA 4J3BA 5D7HA 5HHPA 1BECA 1AJ7H 2R51A 5EU3A 2O30A 3TONA 2D7MA 1VGEL 5C0FB 3BZFA 4I77H 5F96H 3EJQA 3OB0K 3CWGA 5TQ2L 2NXYC 1IKNC 2BVPA 4I4WA 3U6XS 3KWVA 3ABMB 1INQA 4LGRB 3LKSA 3A6CH 1N5AA 4NZRH 4G9FD 3VXUD 3S98A 1QFOA 4NN6C 5FECB 4ETQA 4TVPE 3QARA 3QJUB 1T0MA 4NQDE 4KC3B 5L0QC 1B9KA 3QQDA 4GSRA 2C3XA 1UGNA 3Q1EA 4Y16D 1VKXA 4ENEC 1WFUA 2XZCL 4E9RA 2E0PA 4MMZC 5LXVA 3MRGB 4QTFA 2I07A 3B9KB 3P4NA 1LD9A 3F83A 2HLAA 2VZ3A 3SGJA 2GUYA 2E7LC 3LQAL 2R83A 5JPMB 4DQAA 3DIVA 3IDGA 3H9SA 3FQXA 1MCDA 2A7BA 3KJ4B 4F9LC 3IGKA 1R24B 1S5HA 5D7LD 2JJVA 2OZNA 4IDLA 5SWZE 3FSVA 3NN8A 5EBWA 1JXGA 4KRPB 4FA6A 1FYTA 1AGFB 3UC2A 4G80A 4OD2A 4RGNB 3MRMA 3Q8CA 2EDKA 3MRKA 4AK1A 2B1AH 3APMA 3S3CB 3IFOA 4HK3N 2ITDA 5KSBE 5E8NA 1TIUA 3U9PL 1J1XH 4BFNA 3FQRB 3IDUA 4N8VA 3VWJC 4MMXB 4R97C 4UILL 2L7EA 4A7GA 4DK6A 1R75A 2VLRD 2IO5A 2QQQA 5KYXA 1O9VA 2FL5B 2OLDA 3PG2A 2DTMH 2BXZA 4S1RH 2K3HA 3KDMA 4JPKH 4M7KL 5F8RC 4P5TC 5KYYB 1NLBH 2W92A 4QTHA 4UB0H 2APFA 4NS0A 4A67A 1QUPA 2VNCA 3MV9A 4JHAL 2QDVA 5D4JA 2Z35A 4WW2C 5C8JB 1X9QA 3BUQA 2BPBA 2DL9A 3F05A 2JLPA 4Y4HD 1B2YA 2WVSA 4LEBA 3V0WL 3QXAB 3ILDA 4YHML 3I2CL 4APQB 1FA4A 4GQZA 3O11A 4PHXA 3NG5A 4WK0B 1YUHB 2R23B 5D1XA 3SDAC 5DEJA 3RBSA 2QQNL 1OHQA 1I1AD 3VH8G 3HBQA 4K3JH 5L2JB 5L4MA 1U8PA 2EDDA 2DIEA 3PLYA 3WIHL 4H8UA 3K6IA 4OCYH 1EGJA 4JGJA 5HDQH 4Y16B 3U4EA 3HZVA 4ZS6D 3VCLA 1AS6A 2A3TA 4WHTA 2R4SH 2WVVB 4ZDHB 3GGWB 4LQFL 5IZ7A 3AREC 5LHDA 4Z7QE 3PWUB 5F1OB 2Z7ZA 5JHAA 1QUNB 5F9WC 3CSTA 3DVNA 5EB9A 3A22A 2HKAA 2DQDL 3SGDH 1KJ2L 1DZ0A 1SVBA 3OJVC 3P9LA 1BFSA 1RZ7L 3DROB 4O02A 2WTPA 4TOYL 4OGYL 3W5MA 1G7HB 3QVAA 5MEOB 1OD9A 5DVPA 4PS4L 1RPQA 1NCAL 2Q3XA 5DCCA 2B1OA 15C8L 5GSRB 4PJHF 1GJIA 3VYPA 4G1EB 1C16B 1Z9PA 1DO5A 5BJTA 1E7VA 1DUYB 3B3IB 1UD2A 3E8UH 1LLAA 2PO6D 3R0NA 4PY7B 5C0BE 4ADGA 2OJEB 5C9JB 4P2QD 2G3ZA 4K94C 3FU7B 3FUIA 2HFFB 2VLJE 4Z3JA 4HSQA 2A83B 1FZKA 1BIIA 1KV3A 3PXHA 2VH5H 1YZZA 4C58B 4BFOA 2FNBA 2R4RH 4JMNA 2GTQA 4Y19E 4X7DC 3C9NB 5I1GH 1FZMA 1YYMH 2Y23A 3PFQA 3WOVA 4JHVA 4Y5YC 1NSNH 3WTUA 3DVFA 4L23A 1BG9A 2ENPA 4K7FA 4HCRL 4IEFA 2BRRH 3JVGA 1U8CA 2AS5M 3MRLB 1NGXB 5KN5A 4CU6A 5FYKE 5J6GA 2M2DA 2CCWA 3CVCA 2G2RB 4XGZB 2P1YA 3M45A 3ARSA 4JO8A 4JRYE 2QZQA 3SBWC 2J1YA 3QDGA 4KXBA 4CVXB 3QK0A 3L3OB 4ZW7A 2OULB 3PIQB 1U58A 3MR9A 3LRSB 1X5IA 4OUUB 4AL8H 2Y4SA 4RZKA 2IAAC 1HQ4A 5HJGA 1F00I 5DJCB 1TVBB 3UXFA 1RFDH 2DBJA 4U3CA 4JFFA 4AVJA 5IB5B 1T66C 2D0GA 5IQLA 4L9LB 3ZE2F 2FWOB 3V4UL 4H88H 1I9RL 4OCWL 5FV2A 3RJOA 4L3CA 3U36A 5EFIA 5HVHC 2VW4A 2H3NB 3R06B 1F4HA 2WUBL 4G7QB 4M7LH 1QSEE 3X12A 2B1HL 1CR9L 1PG7L 2ADJB 1MWAH 4XX5A 5I15L 1KGIA 4NNYB 4UNUA 5DJ6B 1QYGH 1GZHA 2ITCA 4IIQC 4GRMB 3MJ8B 1XQ4A 3MRQB 1BWWA 1UWGH 2PNDA 5HHQA 4GG6B 1JWMB 5EZJB 3D39A 3SKNA 2XU9A 5E5RB 3AY2A 2IXQB 4BCZA 5I1LB 2AK1H 4P2QB 3HBGA 4OJYA 4ZFOL 3FRUA 5IREA 4A63A 1DQVA 2YARA 4HETA 3QWRD 2NY5L 2Q86A 3ENEA 1E9OB 5CCJA 3T77A 4HH9B 1DANT 1UFGA 4XX1E 4JFHD 4Y2LA 3H7LA 1E4KC 1FVDB 2VE6B 1M2OA 1GS6X 4UQ3A 4U6YB 3KPOA 1MRFL 1F3JB 1AAJA 4R0LA 3ZDXE 1YSOA 2BLFA 2WSKA 3NCJL 3BT2H 2Y7MA 1QBAA 2EYTB 5AYUL 2WLYA 4NLHA 4LLDB 5DA4A 1JZ6A 3ERXA 2R1WA 4JFXB 1YJDL 3BN3B 3N1MC 4RDQG 2CRYA 3UZEA 2BIHA 1IGJA 3Q6FA 5G5DA 4YBLB 1BFOB 2JKWA 2QSCH 1GYUA 2ZCZA 2OYPA 4DOHE 3VNYA 2OMUB 3WNMA 3O3BA 4C4KO 2ODIA 4JE4B 4B9JA 1RAMA 3COOA 3VXOB 1MF2L 3RWHB 4MAYC 2ICWJ 2VB5A 2WK2A 1NZRA 4XBPB 1IBFA 3V8OA 3ZKMC 3T4AB 2QR0A 4EOWL 3FF7A 4X9HA 4U31A 1GGBH 4KK6C 3ISRA 4B50A 4XXDA 2BM3A 4JPIB 3R1GL 1HT6A 3QQ4A 5L9DH 3EJUA 5E2UH 1EHXA 4UT6H 3OJDA 3GI9L 1S7TB 1WC7A 1NBQA 3ARBB 1J1PL 3VXRA 4X9BA 4YPGB 4QRPB 1AACA 5DJAB 3WLWD 3B2UD 1MLCB 3O9WD 1EXGA 1UOLA 2UZYB 3FOLA 4ALAC 5J5EA 2Z34A 1JHLH 3THML 4OI8A 1CVRA 3QEQE 2FR4B 3BSZH 1J05A 2P5PA 3TVMA 2J20A 2QV2A 4RAUA 5ADPH 2KHAA 4KQ3H 35C8L 4JHWL 3QCVL 5LUMA 3KPLA 3VRJA 1HKLH 1E6JL 4WKZA 3QH3B 1E9PB 1G0XA 3B6SB 3IKCB 3WMQA 5HTSA 5HDOA 2F9BT 5C9KA 2X4PA 1FNEB 3NCXA 4FI7A 4MNQB 1IC1A 4QJ4B 3LQMA 4N1HB 2ICES 2Y7SA 2P45B 1UEMA 25C8H 4XPHL 1LWRA 3QO1B 1CFQB 4LP5A 5ISZD 1MHPL 1IEBA 2YSSB 3O6KL 4P5SA 3FULA 2DYPB 3SGKC 1U8KB 2BNQE 4U6TA 2NXYD 4XX1G 3ZDYF 2OMXA 4OBSA 4WENB 4TVUA 5AKRA 5HHVH 4WVRA 5IJDC 3QO0A 4TXVB 2YD5A 2WCSA 2UZIH 1C5BH 1W0VA 2DQHH 2VAAA 4LBEB 3VRIA 4FF9A 5E5LA 5CSZB 2D7NA 2M26A 4N2HA 3W2DL 3GSQB 3QR1A 3Q2WA 4D0CB 4ENED 3LKNB 3OKMB 4GI9A 3SPVB 1JZEA 2I5YH 3ZDWA 1A4JA 4LNVA 1NCDH 3UG3A 2QQLL 3JWOC 5E00B 2LGNA 3ESPA 4WO4A 4FG0A 4QTIL 2V5SA 2FYVA 2ZOKB 2WLNA 1YEFH 2O26U 5HDLA 1U3HC 1Q9WA 2W94A 1YMME 1XAUA 4G8FB 2HXAA 4F7MB 5I0VA 3V52H 4ERSL 3O9WB 5IGXL 2DWDA 3MLUH 3WKML 3JUYA 2OMZB 4AK2A 3D69B 3MJ9L 3V2AR 4OT1L 3EJYC 2E46A 3MNWA 1UWFA 3U6XA 1QKZL 5C1MB 5SWZB 1CGTA 1O6SB 2CG9X 5LWYH 2X6CA 4HWUA 4ANWA 2EQDA 2P80D 4UMGA 4Z78B 4PV8A 3VWJD 5CIPA 1O0VA 1R33A 2N7BA 4PJEA 3SDCB 1S7RB 2X4OA 4Z0XA 4J3UA 2DIAA 3ETBJ 1MJ7L 3AU0A 1T0PB 5KSBB 1N8ZA 3WJMA 3IETA 5E8DH 5HGAA 2HYMA 2XZAH 4OVVA 2D3LA 4P5TD 1FO0A 1MCIA 1N10A 4R96B 4KMTL 5HHME 4OZHE 4UUJA 5IVXE 2WZ5A 3WKYA 4KI5E 2E9BA 2XX0A 3FU3A 3P1VA 3GPEA 1WDAA 4B5EA 4KNSA 1CBVL 1SEQL 3S35X 4YHKH 4JG0L 2HP4A 2YKLL 4YPJA 2MCPH 2I32A 2BCKA 3V5KA 1DL7H 4N24A 5FPIA 4M8QB 1HWGB 3IMUA 2ZUVA 3SDAD 2NXYB 3QS3A 4X6EA 5F7HA 5DK0B 2CXKA 4OLZL 2K9UA 2X89A 3D7PA 1FP5A 2A1WL 2PPCA 4NYLB 2ERJC 4FFVC 1NPNA 1HHIA 3GXFA 3Q2CA 2BNRD 1N64L 4K23H 5F7YC 4XNQA 3AXHA 1A22B 1A6TB 3ARED 2ADYA 1K8DA 4L1HA 2GB2A 4Z8FL 1SOQA 4AM0Q 3GB7A 3ROLA 4QYAA 1TQSA 5ICUA 1GC1H 4A7QA 2UY7B 3CVIL 2PABA 5C3LD 1GS8A 4Y5XC 2YN3A 1KEML 1AIFA 4K5PA 1ZV5A 4UV7L 4Z7QB 4KROB 4NQEA 5D7KD 3L4XA 1ERNA 2BDNL 4YIQB 4ZX4A 1S7XB 4Q9QH 3KBPA 1NFAA 3NTCH 3D48R 4BQBA 2AJVL 3MRCB 1KXVA 3MLZL 2EE3A 1HILB 3POCA 4OV6F 5JOFA 2J5WA 2BZDA 4OCNC 1MFBH 3JYCA 2DQUH 4PRNB 3WXVH 2EC8A 5ICXA 1QFWH 1EVTC 1AC6A 2R0KH 3N3EA 4UQBA 3DRTA 1F6AA 4Q9RH 5IB3A 2A77H 3G5XB 5C0BB 3VSVA 3NZUA 4MNHA 2ED7A 3I84A 5F71A 1IEAA 3NFPB 4PTUB 4XCCL 3LNIA 3SY0A 2VLJB 5GRUL 3CPLB 1P6AB 3F5WA 2H1PH 5IW1B 1LEGA 5E9DE 2FWLB 3GMNA 4BXSV 1KPRB 2AJYL 1IC0A 3LXUX 2R2BA 4K73A 4NQTA 2HUEA 4Y19B 5L8JB 3LX9A 1I9IL 3MGTA 4MJ6A 4N5UA 3EH2A 5JLZA 1CURA 3D0LA 4M5ZH 1SEBB 1IZKA 3D2TA 4ZW5A 4PRBB 4KJPC 1CI3M 2IAMB 3HC3H 5DMIH 5IVZA 4DFIA 3KYNA 4XPBL 3ZTEA 3SDAB 3KWUA 5D1XC 5AVZB 4E41E 3FTSA 1KFAL 1MCWW 2E7BA 1CD1B 1FE8L 2JKLA 4P9MH 3NACH 1MI5E 4AE0A 3PGCA 4LVOB 1NOLA 5DK2A 3EH1A 4AV5A 3NABL 2BNRB 2VLKA 5E5MB 1CXHA 4JRYB 5KOMC 4OSUH 1KBGH 3MRJB 4TNVF 1T66D 3CU1A 1SF3A 3AREB 3D9AH 1XSJA 3WHXA 3DGGB 5AUMA 3SO3C 4M4RA 3E1F1 1GS7A 1VENA 2B16A 4D0DB 4C83B 4JO3L 5CZXC 3VA2C 1NEPA 5KYWA 4E42B 1XTMA 3QJOA 2CIKA 4LHUG 4S11A 1RP9A 3SGEI 4ZFQA 3Q8BA 3UYRL 3JV4B 2QVIA 5I1DB 4PQXA 1CLVA 4APXA 2K7PA 1QSEB 7FABH 1RIUL 3QHFL 4NZ8A 1GHFL 2EVHA 4TN9A 3CDYA 1JNLL 3LDBC 3V5HB 1D5MA 4CVZA 2IALB 2NX5B 1UWEH 3GK8H 4QRUB 2WQUA 4NAJA 4OCRH 5ICYB 4I3GA 2VDPH 4N0YL 3BUPA 4NEHB 4GKSB 2RB8A 2F8VA 2LABA 3TNMB 1CIDA 4AJ0A 2AEQL 2BVQB 4PJIF 3T0EA 3L1EA 3X14A 5IJVA 1OARH 4NOBA 4DN4H 3CPUA 7TAAA 1RZIA 4EIBA 3SE9H 5KBLA 4FP8L 4F3FA 3PJLA 4KRMB 4OFKA 4WK4B 2SODB 3S7GA 3BQVA 3MA9L 2M83A 4DVRH 1S3KL 1GR7A 1OAQL 3WHE1 3V5DB 3BP6B 3O3AA 3V6OA 1UATA 4GKOA 5ALCL 3ZDXB 2YN5A 2VL5B 5KVDH 3K8KA 5C0DA 3MVSA 4L29B 5I24A 3CN1A 3C75A 4H8WH 1S3RA 2XN9A 3OKKB 1W72B 1DSFH 1NFDA 3IDNB 1EZLA 43CAB 1AP2B 1JVKA 1XL6A 1BBDL 1OM3L 1AE6H 5I17B 2G2PA 3KLKA 1Q9KA 2XBZA 5GS1C 3P40A 4A6YB 4ZTOL 4ZZFA 2G9HA 1ICTA 4MAYD 3ZPDA 1OCWH 4DOHB 5I1IL 2MHAB 1QMUA 3ZKMD 4H4NA 4LE8A 4JZJA 1F8TH 4HOXA 4I88A 2RR3A 2OSYA 4KK6D 1DCLA 1JDAA 2ENJA 4DCQB 2Y2TA 2WBKA 3C5ZB 4O58L 1A21A 1HSBA 5E2WH 1UA6H 3LH9A 4NLAA 5B38B 4HKXA 5I8EB 4UM9D 1E7UA 1KF9B 4GIPD 1A7PL 2WM0A 1GZHC 4HGMA 1KCVL 1OWWA 5C86A 4W93A 4BSWB 1WCBA 3DUUB 4P46B 3D0VA 4JJOA 3S2CA 3VYOA 3WSQH 3UGEA 3BQUA 1JYVA 4A7TA 3CFKB 3IKKA 3QEGH 3PRZA 3P9WB 4FRWA 5HYSG 1ID5I 1BWMA 3TYGL 1YG9A 3MNMA 4G72B 3MREA 4AQEB 4XCNB 5DJZA 3HNVL 2IG2H 1KBVA 4KTEL 2L04A 3GXTA 4NFDA 3QEQB 1HNYA 2VDRH 2W0FB 3VTAA 3QXDA 3X3FL 1W80A 4M7ZB 2BFVL 4WEMB 4YHNA 4WFHD 4J6RH 4AV4A 3S5LB 1WWWX 3DJTA 5DQJB