3AZUA

X-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSQPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title X-ray crystal structure of the two site-specific mutants His35Gln and His35Leu of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
total genus 34
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1991-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3azuA00
3FSZA 3GXUB 2CAKA 2PPEA 3NSCA 3CVBA 4F2FA 4K9JA 1QLEB 1WA1X 4KO7A 4DP9X 4G70B 1GS7A 2XLLA 2ZONA 2HZHA 1SFHA 3H4HA 1FWXA 1ILUA 4YSQA 3DKHA 3WKPA 1MZZA 1PCSA 1BXVA 2YAFA 1A4AA 2IH9A 2UX7A 5I6OA 1JVLA 5PAZA 1SDDB 4KNSA 1MG3C 7PAZA 3NSFA 3JTBA 4F2EA 1TEGA 1MZYA 1BQKA 1ID2A 2XWZA 3CDZA 2UXVA 1KDIA 4YSSA 2LLNA 1RZQA 3FT0A 3OQRA 2QT6A 2H5UA 1GSKA 1DYZA 2PP8A 1M9WA 4CSPA 2FTAA 4UANA 5I6LA 8PAZA 1JZFA 1XB8A 2GBAA 1PNCA 1E30A 2BP8B 4GY4A 4UF7C 3FYEB 3RYMA 3TBBA 3X1BA 1BYOA 4YSAA 4WTQA 1BXUA 1BXAA 1NIEA 3QJUB 1JERA 2B3IA 4YSDA 2ZOOA 1BQRA 1PNDA 2FNWA 3NP3A 2FT7A 4GP5B 3QPKA 3NJFA 3QJRB 1V54B 3T9WA 3S3CB 2FQFA 4G7SB 3NJLA 1AOZA 2BW4A 4PCYA 4DPBX 1NIDA 1A4BA 3FPYA 3FQ1A 5I6PA 2DYSB 1JXDA 4QKTA 1AG0A 2N0MA 1OCZB 5I6NA 3HEIB 1J9TA 2DYRB 2PCYA 3PAZA 4PAZA 1KBWA 2FQEA 1AZNA 2EIMB 4YL4A 4A2DA 2EIJB 4GYBA 1NWPA 3WI9A 6PAZA 5I28A 1AG6A 2J55A 1A8ZA 3MX0B 1IKOP 1F56A 1OE1A 1XB6A 4JHVA 2H47C 2UXTA 3U25A 2J57A 1NIBA 4YSTA 1NZRA 5B1AB 4G72B 2XV0A 1SNRA 1AANA 2DV6A 3TBCA 2IDUA 3MBWB 1SDDA 2I85A 3UACA 4HIPA 2HRHA 3L45A 1GY1A 3IE9A 3UAEA 1IC0A 3PAUA 4A2GA 3NJNA 2CBPA 2QPDB 4HHGA 4NERA 5B7EA 4BDVA 3NT0A 4ZK8A 4YSRA 4GP8B 1X9UA 1M57B 1NDTA 1N68A 1IUZA 3ABKB 1GS8A 2QDWA 1NPJA 3FSWA 2YARA 2BP0B 3TU6A 1OE3A 3BQVA 1L9QA 5B7MA 1ASPA 7PCYA 1WA0X 1WA2X 1UATA 4DP0X 3PCYA 5I5IA 2IAAC 1M56B 1JZJA 1AAJA 1KYAA 2FWLB 1ET8A 1URIA 1ZPUA 1OCOB 1NPNA 2FQDA 1NIFA 1ILSA 2HX7A 3DTUB 4G7QB 3QJQB 3X2QB 1ET7A 4P5SA 1BYPA 3FQYA 3NYKA 2BZCA 3DIVA 1KGYE 1AZCA 4JHUA 1XMEB 1MG2C 5D4IA 3EHBB 3BVDB 4E9VA 1A4CA 4E9YA 4A66A 2VW7A 1PLBA 1HAUA 3ERXA 1AS8A 3N2JA 2AZUA 3OMNB 2E86A 4HALA 2IWEA 2UXGA 1KCBA 1IBZA 3H56A 4L0PB 2HRGA 3AY2A 3C75A 2PP9A 3SBQA 3OM3B 4YSPA 1EZLA 5AZUA 3NJGA 4KNTA 2XV3A 2JXMA 4YSOA 4A68A 4YSCA 3AG1B 1SJMA 3CZUB 3TA4D 2VMJA 2Y69B 4KO6A 4DP2X 4CSZA 2BZ7A 1JZGA 2YAMA 3WKQA 4DP7X 1GR7A 2AZAA 2YXVA 4GP4B 3AW5A 4TXVB 4DP8X 2WSDA 2BO0A 1KDJA 3H4FA 3QQXA 1W6LA 3UADA 2HLEB 2XYBA 2AVFA 4W1TA 4F7KA 2BHFA 1PZBA 2HXAA 5D4HA 3OMAB 5PCYA 2UX6A 3PAVA 2GI0A 3X1FA 4E9WA 3ASNB 2TSAA 2X87A 3JT2A 5B1JA 2PPCA 5TK4A 3ASOB 2XV2A 3QJSB 3FS9A 4HHWA 2IDFA 1L9SA 1NINA 2FJSA 1ZIAA 2VM4A 2YAHA 2DWSA 2VW6A 4M3HA 5A7EA 2X88A 2VSMB 1AQ8A 2JFCA 4KOBA 1PF3A 2A3TA 1ZDQA 2CALA 2GIMA 3T71A 3AZUA 4HAKA 2P80D 2IDSA 3HB3B 3WNIA 2HX8A 4NAJA 2MTAA 1BQ5A 3EF4A 1AZRA 5B1BB 1NIAA 4YSUA 3NJKA 4E9RA 2BWDA 3V9EA 3UGEA 3G5WA 1OE2A 2B08A 1ASQA 5E9NA 6PCYA 3FQ2A 2GHZA 2IWKA 1CC3A 4AKPA 3S8GB 4G7RB 2VSKB 2TSBA 3CDZB 1L9RA 2AFNA 3KW8A 4DP5X 1SHWA 4JKNA 2EINB 4KO9A 5B7FA 1NWOA 4DP6X 1AZUA 1QNIA 5I5JA 2PLTA 2QDVA 4HCFA 4G71B 1J9SA 1ZIBA 1MDAA 4FAAB 2DWTA 1DZ0A 2OV0A 5IY5B 1OOWA 1ADWA 3NP4A 3TASA 1WAEA 4DPCX 2PPAA 2J5WA 1BEXA 2OCCB 3S8FB 2HX9A 1HFUA 1TEFA 3UABA 1AS6A 2DY2A 3AG2B 3D12B 3GDCA 1OV8A 9PCYA 2GC7C 2IWFA 3FU7B 1RZPA 2I7OA 4RH4A 1ZDSA 2BP8A 4UAHA 2I7SA 1FA4A 2XX0A 1HAWA 2NRDA 3X1NA 1E67A 5TK2A 2J56A 3ABGA 4A2FA 2Q5BA 5B3SB 4MFHA 3WG7B 3CVDA 4Q8BA 2YAPA 3S3BB 3WNJA 3ABLB 5B1KA 3PLYA 4A2EA 1I53A 4KO5A 3T6VA 4DPAX 4DP1X 1J5DA 4P5RA 1ET5A 4BXVA 1JXGA 2QPEB 3T6ZA 4A67A 5LDUA 3FPXA 1V55B 1EHKB 1ETJA 2JKWA 2XU9A 1J9RA 2Y1AA 3SQRA 3ZIYA 2OJ1A 3KW7A 1YLBB 4DP4X 4ENZA 3NSDA 5F7BA 4M4RB 1GYCA 4KOCA 4BWWA 1PAZA 1B3IA 1OCCB 2P80A 1IBYA 1CYXA 1RKRA 1KCWA 4QLWA 3IEAA 3WIAA 1ZV2A 3N55A 2VW4A 1JZEA 2YAEA 1E5YA 1KV7A 5EHFA 4HZ1A 4WKXA 3FSVA 2EIKB 1CURA 2R7EB 2YXWA 3AG3B 4NB7A 2FT8A 2YAOA 2XUWA 3ZBMA 2WO2B 3NSYA 1NTDA 1TKWA 4BDVB 3ABMB 3IBOA 4A2HA 1AR1B 1GW0A 1KBVA 4AZUA 2PP7A 3PXLA 5I6KA 1E65A 2ZWNA 4EF3A 4BWUA 1XB3A 1FFTB 4FA7B 1SFDA 2FQGA 3GYRA 5FC9A 5F7AA 2YAQA 4BXSV 1ASOA 3SBPA 1T5KA 2GB2A 3FU8A 4AX3A 1E5ZA 1PLCA 3FYIB 1GY2A 2GC4C 4BWTA 2BP0A 2UXFA 1V10A 2IDTA 4KNUA 3FU7A 2EILB 1BAWA 1JXFA 2CUAA 1WS8A 1N70A 1PZCA 1L9TA 1JZIA 2PCFA 1X9RA 2XX1A 2MRYA 1AZBA 2FT6A 1WS7A 3CG8A 5I5MA 5I6MA 5AFAA 1GS6X 2BW5A 2CJ3A 3FU9A 3T6WA 4HCGA 3ZDWA 1VLXA 3EH4B 1QHQA 2CCWA 2YQBA 2H3XC 2PPDA 4GXFA 3QJVB 5ANHA 2ZXWB 3UAAA 1CUOA 3T6XA 2IH8A 5AKRA 2XXFA 3IN0A 3V9CA 4E9QA 3NJHA 1J9QA 1CYWA 4AKOA 3EH3B 2BWIA 3FSAA 4YVNA 4YVUA 1W6WA 1AIZA 3NJMA 3NJJA 1AS7A 3NJIA 4HCIA 2WO3B 4N4YB 1RCYA 3AG4B 1SF5A 1AACA 4N8UA 4Q89A 5D4JA 3OMIB 1L9PA 1J5CA 1OF0A 2VM3A 1W8EA 2GSMB 1JZHA 2R7EA 3OD3A 3SBRA 2AANA 4YSEA 1JVOA 1PLAA 1TU2A 2VN3A 4E9SA 1JOIA 2XXGA 2W88A 2XVBA 1PMYA 3X1GA 2W8CA 2PPFA 3X1EA 4W9ZA 1PZAA 3EH5B 1L9OA 3S3DB 4X4KA 3ZX1A 4AKQA 4BK5C 3QJTB 3IN2A 1PY0A 2Q9OA 5I26A 2IDQA 3CVCA 4E9XA 2RACA 4E9TA 1A3ZA 1OCRB 1NICA 1R1CA 1A65A 1SF3A 4AI7A 3PPSA 5B1JC 1SHXA
chains in the Genus database with same CATH superfamily
2XZQH 3TWCH 3U2JA 4XX1G 5IMMA 2FDBP 3H4HA 1JWUB 2HJLA 3Q8BA 4KPHH 5EDXA 3VTTA 4F8TA 1LO0L 2IH9A 4KY1L 2VLKD 1D3CA 5KSAA 5I19L 5KVEH 4IBUA 5LGYA 4YXLL 2QVKA 3B9KC 5IVNA 1MG3C 1R5WA 2IQAB 2NY6D 3QEUA 3VGDA 3SGEH 1I3RB 4FQ1L 2AXFB 3GNML 1X44A 3IDIA 3WEOA 43CAA 3C87A 5MEND 2GUYA 3QEGL 4P2OA 1J87A 4HIIA 2PWGA 3NG5A 3FTVA 4QHLB 1RZKC 2E7LA 3UJTL 4BZYA 3M46A 4K55A 1WCBB 4IKIA 5DDHB 5FFGA 1RPKA 1F18A 2IOIA 2XZAL 4Z7WA 4GI6A 2HTKD 3CFUA 1AYOA 4MVBD 4CSPA 5AQ0A 4FXLA 3RA7L 1U8NB 4BSVA 3GIZL 2Z8RA 2GBAA 5ESVB 5AWNL 1LVEA 4ODTH 5F9JB 3BAEH 4HJ1A 2B59A 3X1BA 1TQWA 4PLJC 3E9UA 3VXMA 5KUKA 3V52L 1JERA 1KGUA 1T1YA 5FYKL 2G2RA 1EO5A 2ZICA 3ATAA 4W6WB 5SWZD 2AEQL 4HETA 4HQQL 4QKXB 4R83A 3VFMB 2R0WL 4YLQT 3KYAA 4WI9A 1MOEA 5DUBA 4BELD 1FSKC 3KD4A 2ERJC 2WBJA 1UOWA 3U36B 3U2IA 4GMSH 4E41B 3PL6B 3KPPB 4MWFB 2P48B 1VACA 3MUHL 5EOCJ 4R5XA 5HD8D 3NEXA 4FQJH 2ZP9A 1DQDH 1UWFA 2PCYA 5FWRA 3L3DA 4DHLA 3HJEA 4LCIL 4GBXA 2W1NA 3DA0A 5D6CB 2J8UF 4LESA 4PG2C 5J1AB 4Y5VA 1MSPA 3VXSE 3MMEB 3ULUH 2BNUB 3L54A 5BQDA 5JLZB 3FBKA 2HWZL 3QHZL 3POCA 4HS6B 2H47C 3MRMB 2XHNA 4KH2A 4Y2DB 1IAMA 2FZ3B 3HUJA 1YN6A 4FJYA 2W91A 4O4YH 5LQBL 3HMWL 4KKAC 4P4RA 4NQCB 3D33A 3GMNB 2CHXA 4FNRA 3T3MF 4AJYV 3RJOA 5HHQA 3STZB 3IJ7A 4P04A 1VJSA 3J2PA 4KJQC 3RZCC 4PJ5E 1Y07A 2QSQA 3IE9A 1M7XA 4PV9B 4M5ZL 2NR6C 3Q2LA 4MJ5A 1DBJL 4A2GA 4ZAKB 1OWRM 1LE5B 2QFRA 4WJG3 5DJAB 4JRXE 1NC2B 1U3NA 3JT0A 4HC1H 5J9PA 1GCFA 1L9NA 4TNVK 4NJAH 4JFDD 4AENB 1X9UA 4DGYL 2ZYHA 2PWDA 3S97C 2HFEB 2QQKL 1FGNH 3P4MB 4FABH 5A6MA 2OR7A 3LQAC 2AXGB 2YARA 4MS8D 4F33A 3HR5A 1N59B 2HAZA 4XNAA 1OE3A 3N41F 4WNSA 2DKUA 2Z7WA 1PDKA 4M7ZB 1VKXB 4TRPL 2KUTA 1LEKB 3RY6C 4X7SH 5BOJA 1V7NL 2F54E 5EOCL 5C0CA 1G7PB 1SJHB 1GRWA 5CKGA 3BMWA 5SWZA 1HX0A 1I8UA 4FHKA 4L3EE 2EIZA 3AADB 4AG4H 3K0WA 2CIKB 3QJQB 3T3PF 4AMKH 2BXYA 2OCFD 2ZUSA 3FQYA 2BZCA 5LXVA 1KGYE 2Q20A 4AQAA 3KLQA 5E08H 4N2DA 4W9JC 1J8KA 4ONGH 1CB4A 2YFNA 4QUOA 3LIUA 4FQCL 2AJUH 3RWEA 3TIDA 3FONA 1BWWA 3RX7A 4P05A 4R7DB 2EDYA 2IWEA 3QPQD 4BHUA 4KDVA 5D7SL 3SO3C 4C54A 3CFDB 4YSPA 1CTOA 3NSXA 2J3SA 2G60H 3GGWA 2XWXA 2IGFH 2LR4A 4JQXA 3DWTA 4PBWD 4FLSA 5BMFL 5GJSH 4Z3FA 3L1GA 4RGNC 1DUYA 5MHSD 3KL3A 5HHXH 4RSYA 4OKVA 3MJ9H 3IETA 1ZHNB 3S37L 1AQDB 4KKBC 3VE0A 2AITA 5ICXA 2GK0B 4MA8L 4DOHB 1MLBB 3NZ8B 1P0SE 3ETBF 3TL5A 4JZJA 1CD1B 2YGOA 2NW2B 4X9HA 4FYRA 3WXWH 1EK3A 3BP6B 4LRNL 4BFFA 5HTSA 3WYRA 1KG0B 3I2CH 3PF2A 1DUZA 3OMAB 5GRXG 2V17L 2I60H 3JWOC 2NY2C 4Y5XB 2D9QB 5C9KA 3CVIH 2PF6A 3FXIC 2HVKB 5HJ3B 1JWMA 4JFDA 3V6FA 5FA4B 3OXRA 3X14A 3L3IB 2IDFA 1WWWX 1ZGLA 3U6RB 2Z3FA 4NZUH 1HVXA 1WFNA 4L37B 1SQ2N 4Y1SA 1GYUA 1S3KL 3CZFA 3FHQA 1BZDA 2DLHA 3WD5H 4GG8A 3NIDB 4M5SA 4NCDA 4QOKE 2F53B 4M6NH 4Y4KA 1S2EA 1CGSL 4N9GB 1K8IB 3QP3A 4F7TB 1IGMH 4YSUA 5IBUG 4L4TB 3W82A 2QADB 4LLYB 2R2EB 4YGVB 3L4CA 5EU7E 3UGEA 1OE2A 3VG0L 1XHHA 3O3UN 3N41B 4ZYKA 1MEXH 4JFZL 5TE4H 1NCUA 5KZCB 4ISVB 1RK0B 4MDIA 4DP5X 1U92B 5KYUA 1TVBA 3ZO9A 5C2UB 4UZGA 2JIXD 1QBMH 3GEFA 1I3RA 2OM5A 3FOLA 2I07B 3HCVA 5TPWH 3BX7C 4KRPB 4A6YA 3H9SD 4ABQA 1W72A 3BPOC 4Z1PA 2F74B 4PJGF 3BH8B 1UWXK 4G5AA 5D1ZB 4LEBA 2WVVA 5DLLA 2QDVA 3SPHA 3A6BH 4AE0A 3FKUS 5KJRH 1EJFA 4UT7L 2JJSC 4RSVA 2JKTM 3EFOA 3I02B 3WFBH 4DVRH 1SN5A 5F1IB 5T1LB 2P5WD 3C5JA 2HKHH 5EU4A 3OWEA 1ODAA 3FCUB 3EADA 2Q8AH 1JUFA 1LEGB 2DLTA 5C07D 3VRJB 5CBAB 3ZKQD 4MZRA 5ESVA 5CEYB 5IHBA 4GAGH 2VN6A 2B2XL 4I48A 2XN0A 4P06A 3P3UA 3KWXA 4Y19D 2FR4A 2XX0A 5GZOD 4MS6A 4CVWA 2FK9A 3O6ML 3VXRD 2N59A 2NYKA 4FNQA 3I84A 3VFMA 2VH5H 3F7YB 3PLYA 4IBLT 4WW2A 1KXTB 1U8OB 3S0PA 5JXAL 4P5RA 3T6ZA 5IFJA 3OHXC 1KSRA 5GISL 5GRVK 4E41A 3HZ3A 4XNMA 4EDWL 2P8MA 4PRID 5E2UL 2WXHA 2Y1ZA 2Z8SA 2OJ1A 1NMCC 1EUUA 2PR4H 4DAGH 4DW2L 5CJ8A 1B0WA 2VXSL 1JJUA 4FQLL 5B39G 5JTWA 1HL9A 1KYOK 1YEHL 2Y7LA 4M29A 2R4SH 2WTPA 4ZG1A 1DQMH 3OWRA 4MQSB 4IRZA 1ZK5A 4HS6A 5D71H 4CKQA 3CNKA 2WPGA 4NQED 2FZ3A 2R7EB 2G9HB 1R75A 2CUHA 1DO5A 1OF2A 1IU1A 1XT5A 2CA4A 4BINA 2VQTA 1J1OH 4U1LB 1G84A 4M7KL 2K0RA 3QZMA 4L0YA 3CX5J 5JW5B 5DO2C 4ETYA 4ANXA 2JIXA 4NKOA 2OSXA 2WK2A 4P23A 3X11B 1F0LA 2RMNA 1C5DB 4N24A 4XP5H 3H9SA 1S7WB 1TQBC 3LVTA 1J0YA 4ZAKA 4GI8A 4NENA 4LBEB 4PBXA 1LO5B 4XP1L 4AYMC 3L95B 4TNFA 4TUKL 3LB6D 4HBQA 2GSGA 3C6SB 3FN9A 5IB1B 3KVDD 4HS8L 1LE9A 5ID0B 5GZNA 1K8DB 4PJCF 3HOGA 3J8F7 3RVTC 3V10A 4GMTL 3SO5A 3FJTA 1HQ4B 5C07A 1N59A 3UBGA 3V6OC 4KNUA 2H0PA 3L3JB 3SKOA 4NQXB 3ZPDA 4Y19A 1I1RA 3LKPB 4JQIL 4PS8A 1Y18B 5F9WB 3BLBA 2XWRA 2B16A 3DMMC 4OV5B 3G6JA 1WFJA 1X9RA 1KBGH 2XX1A 3VXRA 1KIRB 3HBZA 4J6RL 2YPVL 2I26N 4KVNL 4X7DC 4XPAL 5CLZA 5FGBC 1GS6X 1A25A 1I3UA 1KLGB 4TVPH 3DNKA 4NNYB 2PPDA 4GXFA 4R2GC 1BLIA 2CK2A 5I18L 2ZG3A 1CLZH 3BDXA 4XX5A 1C1EH 5GSRB 4E9QA 2EVJA 1UTDA 4DTGH 5KS9F 5HYQB 2K8QA 4HIXL 4QXGL 1UM5L 2OTPA 4H0IA 3LEVL 4R7DA 1O5DT 4KDTA 1U2YA 2HRPL 1EIBA 2G4GA 3NGBC 2K7QA 2BK8A 2DQIL 3BSGA 1B0RB 4PRAA 4FOMA 2CRZA 4N4YB 5ETUA 4KMLB 4UQDA 1WFOA 2HA1A 4N25A 4EI5A 2UY6B 4JANB 3RFZC 1ODUA 4XO8A 1J5CA 5TD4A 1I7ZB 3DO7A 4KJPD 4KAQH 1ZHNA 5I6XB 4G6FD 4FTVB 1N7MH 2GK0A 3QG6B 1PLAA 4HUVB 2OMVB 3NZ8A 4POZC 1DCLA 2CXKA 2J5LC 1IGIH 2NW2A 5D55A 4LOUD 4U33A 5FXCH 1T7VA 4BA8A 3MA9H 1YN7B 4PRHE 3GRWH 1TJHL 4LQ1A 3VA6A 3VI3A 3EH5B 1TMQA 4HP5A 3O0RL 3MLSH 4Y5XA 4K3JH 1U3HC 3C5SA 3TZVB 1QAWA 2HVKA 4JFQA 1CZ8H 4ZMWA 1XR9A 1KC5L 1ORSB 4AITA 4A63A 5FYLH 1K5NA 1F8TL 1MXDA 1N8OE 3BIKB 5I0XA 4HJEA 3HR6A 1H5BC 1MWOA 3QEQA 3VFUA 1U41A 4F2FA 1JK9B 5C3TA 3FFCE 2GJRA 2XLLA 1W8NA 1HOEA 4FJ6A 2BNQD 1J12A 4N3TA 3DKHA 3OG6B 3UTPD 4KK9D 3UBFA 4JFEE 1FL3B 4NM8L 1N8ZB 1JPST 3KBPA 4PJEE 4ZFOL 4N9GA 1A4AA 3QFJB 3QQ3A 4QF1B 3FO1A 4UM8B 3P0GB 1KJ2L 4F7TA 3C5ZC 3RG1C 1DR9A 5FHBH 4H0GA 4PJCB 4LAQH 4KNSA 3DURB 2WXKA 2MTPA 2R9HD 3RVUC 3TFKC 1NCCH 3REWB 3SY6A 3D4ZA 5FB8B 1FNFA 1T03L 1BQKA 5EO0B 1HSAA 2EE9A 3I75A 5HHPB 4Q9QL 4LVHC 3QNYB 2NNCA 3GSWB 3MLUL 1X4ZA 3DVIA 1QTYT 3U9PH 1XL4A 1G0YR 1TJGL 3UP6A 3QUZC 4U3SA 5D1ZA 2XIBA 4TVUA 3SGKA 1KJMB 1NAKL 3BKYH 4JHZA 8PAZA 3NIGF 4D0BB 3I02A 4M93B 3MR9B 2Z64C 2VZSA 4UF7C 1T22B 4R8WH 4KK8D 4YSAA 1VHPA 3QZWA 3ES6B 3QHFL 4KVPA 3SDAC 4XWGL 1E42A 5KS9B 1RZKH 3PGFH 3LDBB 4I3SL 5FLUA 2DICA 3L9YA 1H3UA 1LLAA 2PW2B 4X8JB 3DUSA 2DLGA 1EGJL 4G1MB 4ZFZB 1T4KB 3UO1H 2BOCA 2AHIA 1HOCA 5B38A 5CEZL 3T09A 4LARL 3L2LA 1AOZA 1IILE 3KXFB 3RUGF 5D93C 5HY9A 3V0VB 1Y7VA 1FVEA 1R47A 3EGSA 4M1CC 4HFUL 1FF5A 3NESA 4AJ0A 2F6AA 2GAZB 5FO8B 43C9B 1RUAH 1U8OA 3QDME 2RFXB 12E8H 1WG3A 4Y1AA 5J3HD 3A21A 1Z9SB 4D9LL 1UT2A 4OJAA 5SX5H 4PI0A 4X9GA 3A67L 3QRGH 3QCTH 4HJIA 1LWRA 2JXMB 3CX2A 5AW7B 3SZ6A 5DK0B 1YY9C 4GQZA 3SE9H 1SLWA 3BEVB 3IJYA 3VQ2C 4YSTA 5EF3A 2COVD 1TO4A 2ZWKA 1BZ7A 4LCWD 3GXMA 4I2XB 4P5TB 4R5TA 1UT9A 1OALA 4P4KB 3ZIMA 2V3DA 4F58H 1UADC 3UAEA 3IWVA 4ZOBA 3RWDB 4HMEA 1XF5A 2GY7B 1IZKA 1CFQB 4B7IA 3BGFB 4NQQA 4G8AC 1PTZA 2NY1B 4M56A 4ZQKB 4JKWA 2M1KA 3D4CA 3MBED 2OJEB 4PCSA 3CLWA 1M7IB 1G1YA 1NDTA 4M7JH 1N68A 3S5LG 1NCAH 2GIYA 1SBBA 4UT9H 3REVB 3RU8H 3AGWA 4IOSA 4N0YH 3WTXA 2AK4B 3O2VH 1LO5A 5BCAA 1XD0A 4KUZH 3VWKD 1EVUA 2WVUA 3OJVC 4P2RE 5GGSY 3SKUD 1W0YT 3H6AA 4U6XB 1NCGA 1WVZA 3TO4C 5EUOA 5ERWA 1UWEL 2Y7QA 4F8PA 2A9BA 2BY2A 2RR3A 4TSAH 1WZ1L 4WGVB 5KBMA 3MJGX 1Q0YH 3EBGA 4WI0B 3AXIA 5JYLA 2H1LM 4HOWA 2FQDA 1OK8A 4LP8A 5AUMA 4JKMA 5BW7C 5B3JE 4IRJB 3LSOB 1M6OB 2BMKA 3LQAH 4HBCH 3FAWA 4TVSa 3NIGB 5HHNA 2ZXBA 4LSQL 3P3YA 3ERXA 5EV7A 2IMNA 2I27N 4NNYA 3EO0B 2CGRL 4YE0A 4CC0A 4X6DE 2NW3B 5HYSB 1ZLEA 5GRWA 3CIQA 5DVOA 5EPMB 3B2VL 4U6VH 1XDTT 1WAAF 3KJ4B 4AGNA 4X5WB 3QWOB 3U0WH 1FFPB 3RUGB 4OLEA 1RURL 4UV4H 4WTZA 2XXMB 4IMKA 1CGVA 1AHWB 2VZOA 1P7HL 2XOTA 4XNXH 5DWUH 1B0RA 3ULUD 3QDJE 2J1YA 3GXNA 5D7JD 1U8PB 5EU6B 3VD4A 1UD4A 4LCWA 3U46B 4CGTA 2UY6A 3EGXB 4TXVB 3DGDA 4FFYL 1C16B 4JPVL 4HKJB 3D34A 3DSFL 2P28B 5GRUL 2WMPB 4XBMA 1PZBA 4GAFB 4OI7A 4PJ6A 4IOFC 2PABA 1RJLA 2W65A 3BEWA 3HE6D 4PIBA 1S7XB 5DJYA 3D05A 4OD3H 2FIRT 5TK4A 2XV2A 4WWPA 4G3YL 1T1ZA 3O6LH 5IWLC 2A4EA 4ZSOE 3DVGA 3KLSA 4WWKA 2ZUXA 5BO1L 4KI5F 3VWKA 2VM4A 2OJZH 1U4FA 1MHHB 3E1F1 3SDDD 4LL4A 1OSPL 1IBGL 1UVQA 2W9DL 3S8WA 1Z3GH 1GZPB 1ORSA 3JWOH 5I74C 5DHDA 4DUWA 1HH6B 4WCYL 5HI5D 4LQFH 4XMVA 2C4XA 4HUCA 4QHUA 3D09A 3WFDL 3G7TA 3VGFA 2ZIDA 3W2DH 1MCFA 4K3HA 5D1QC 1FLRH 2FJGB 3IB4A 1YECL 5F9OH 5JR1H 2O5YH 2X2YA 1ZRUA 1FI8C 4TLUA 5KVFE 3QULB 5JHDB 3DX1A 4ZNEA 1OTSC 4MJIB 3GO1L 5AVTB 2C9VA 2X4TB 3DPDA 3IPFA 2WLNA 5INDA 5J56B 1CFVL 1FH5L 4OLUH 1IC7L 1QBLH 5LCVH 3X13B 3HI1A 3QE5A 2R0LL 3KGSA 4FJZA 3VFRA 3DSNB 3Q2VA 3QUYA 4B9GA 1OOWA 4YDZA 2WP3T 3NP4A 2YPLE 3VU1A 3GSWA 3VGAB 5F7UA 1EDQA 3FNKA 2YD7A 1BEXA 2JLLA 3WEXB 4XVTH 5ITBL 4HV8A 4NKMB 1UOKA 2CMRH 5BV7L 4LLVA 1ZDSA 3I6GA 3S98A 2OYLA 1ED3A 2IPKB 4OJDH 4L5FL 3EOTL 1TETL 4JFFD 3KPRE 3C2AL 4P2QD 1FYTB 3F5WA 2PW2A 3HE6A 1ZVHA 2Y1YA 1P7KB 4OCSH 3QQ9C 2GK2A 4A2EA 3LNFA 3M8OL 1XSOA 3CCHB 1K3ZA 3KXFA 3UTQA 2BLFA 5FO9A 2CWRA 1DBAH 4A67A 2XWDA 3SKMA 4M1GL 1PKQB 1OGPA 4HC1A 1KIUA 3SCMC 3QIUD 3KZ8A 1AGCB 3JWNC 3SDDA 3J07A 3RNKA 1UQSA 4QRRB 4YNYB 1MVUB 4V33A 1Z9SA 5C70A 4LO9A 3C2SA 3CJJA 4ORGB 2A4CA 4CMHC 5E8EA 3LN5A 4K73A 3G6DL 4DT2A 5E5MA 1AFVH 1E5YA 2Q6WA 1XMWA 4BE5A 5DK0A 3MRRB 2LABA 3BWZA 1A4KB 1FPTL 3ARTA 2OYKA 3O3BA 1DDHB 2VERN 5DLML 1EHAA 3N9GL 3L3HA 5DHEA 2YD4A 1JRHL 1IAIM 3PV6B 4UIKH 1MREH 4PHZA 1KJ2B 1TKWA 3MUZ1 4OR1A 3ARFB 1AD0A 3RTQA 1N0XH 4P4KA 4MA1B 2OMWB 1JFHA 1OB1A 1UENA 3EO1A 3N91A 4EIBA 1OHQA 4JEGB 4AGQA 5IG7B 4NUJA 4JDEB 3GYRA 4F15C 1FNEA 5F7DA 4C56B 1KTJA 3BUQA 4AGOA 4BXSV 4EBQL 3AY4A 5I16B 2OJEA 1M7IA 3ISYA 2DMCA 5FO7A 2R0ZL 3REVA 3LZLA 1E5ZA 3Q2WA 1RZ8A 5KOMC 2DIJA 4HIHA 4OGAD 1E2ZA 1G7JB 4L1HA 1DO6A 2WD0A 3TEYA 1U91B 4NQSA 4P3DB 4OV6F 2ESVE 3QW9A 3MJ9A 2UZYA 2NY0B 3MTXA 2EIDA 1L9TA 3K71A 4NO0D 4JFFA 1UD6A 3ARDC 2JTYA 4JZNB 3ARSA 5D5MF 3WAJA 1KEML 1MJUL 4MAYD 3CXDL 2CJ3A 2W95A 3BWUF 2C7UB 4ZFGL 3ARVA 1IAII 3MLYL 3WY1A 1M6OA 4B0MB 3WLBB 3F00A 3WO3B 5J12C 2W0FA 1BD2B 4AEHH 1F1AA 4R0LA 4CN4A 4X0KA 5GGUA 1R5VB 4LVNB 3QS2A 2O6PA 4IGBB 3RVWD 2IH8A 2XXFA 1HHJA 3DJ9A 4JY6A 4S10A 3O6FA 2FJFB 4XGZA 3GKZA 3QIUA 1YCSA 4JRYB 1Z6JT 5DMKA 4ZXBC 3ROOB 5HHMD 5DJZA 1NGZB 1NL0L 2BY1A 3MRKA 1NAML 2FBJH 1RUPH 1AIZA 3EZ8A 3VFNA 2XZCL 2Q7YB 3SIKA 3ARBA 2Y6SD 3GMOB 4XXDA 3OR6B 2C5DC 4X5WA 3QWOA 3BWSA 3OKLB 1LD9B 3KWWB 3OMIB 1DVXA 2FB4H 3F8UB 1TQCB 1HINH 4U1KB 4NNPL 2OXGB 2C3GA 1YO4A 2XQYA 4G6JL 3B1UA 1EHLH 2NZ9D 4X5XB 3IK2A 3N50A 4NQDE 1IQDB 1INDH 1BMWA 4JM0A 4Q6KA 3SB3A 1Q9LB 3GQFA 4X6FA 3LQZA 4ODHH 2W88A 5JQHC 1S7UA 4JZOB 1E4KA 4YHZL 3HRPA 3P02A 5DHVB 3X1EA 2VR7A 4WTXA 2D3VA 4FG4A 4PJHF 3MFFB 1P4IH 1HKFA 3QAQA 3BKCH 4OZIE 1YMME 1UG9A 2UY7A 1P5UA 3EUDA 4YDMA 4R4FL 2ZAIA 2AQRA 2P49B 2BM3A 2XWBB 5AVSB 3LH2H 2AMUA 3B9AA 3PIQA 3LIZH 3PPSA 2PWHA 1JHLL 5F93C 1XH3B 4L4VE 1ZA3A 4ENEC 4HLZH 5F1SA 2EACA 5GQBA 5DT1L 1I85A 4JPIA 1KLUA 2PPEA 3S35L 3UYRH 4K9JA 1CXEA 2VRQA 4Y16B 3L3OA 1XL6A 2DL9A 3HG5A 4NO0A 3OAYK 1YQVH 1MZZA 4I13B 1T0PB 3BZFA 2XFXB 1TTCA 3D9AL 4AQ1B 4MAYA 2ILLA 1ROCA 3SKNB 4XMLH 3VUAA 5T3XE 3VXOB 1IFHL 2VDML 2X89A 1DVTA 2APSA 1WISA 4FNLH 1JV2B 3ZKMC 5EZJA 3T4AC 2Z92B 4JM4L 3WHE0 3MRIA 4CC4A 2GTZA 1BAFH 3WJMB 3LRSA 4IEFA 3WAKA 2OX5A 1QR1B 4JFWA 3BVNA 5D5MB 3OJMB 1L4IA 2Y5TB 4MMXC 2VXTH 5DD5H 3LJ3A 4X6CA 4UANA 5DRXB 4HKZA 2QPSA 5AVYB 3L1OH 2L7JA 3B34A 2P5PA 5FV2A 1E30A 3ZE0F 3EYSH 1TOXA 3UH8A 4WDIB 4PGCB 4YAQA 1Y6NR 4D8PA 5I73B 3TOPA 4WEEA 1IC5L 2K6YA 2ZOOA 3V95A 3BYTA 3SE4A 2ENSA 4MNQE 5J1SC 1A6TB 3TPUA 1ZT7B 5DHYA 4JFPA 3SD5A 1PG7L 2R2CA 4XMPL 1JFQL 4WLCA 4PWGA 1BCIA 3I9GL 6FABH 1RIUL 2BW4A 1JMXA 4FDWA 1DQJB 3AS2A 5CJOH 1UUNA 1FYTA 3WIFB 4F7MB 5FECA 5C7ZA 1WITA 5DJ8B 3W9DB 2VMDA 4QKTA 1HZHH 2QV4A 2O5ZH 1UYWL 5I5RA 3TO2A 1QRNB 3FMGH 4ZS6C 4FP8H 4KK5D 1KV3A 4AQ8A 1A47A 2JB5L 3AM8A 1X5FA 3HE7D 4P46D 3P4OA 2OMZB 3G5VB 3WJJC 3HBGA 2Z93A 2O93L 1KGCE 1KEGL 1OEZW 1YAIA 4HPOH 5E6ID 1OPOA 3QYMA 5DR5H 1TQVA 4BFBD 4YNYA 5DC2A 1S5IL 5F7FA 4K8RL 3DRTB 1NLDH 1YPZF 3MA7A 4GXVL 3FCGA 4PJHB 3BW9B 1XGYH 4YBQD 2YGVA 1BYNA 3TBWB 4EOWL 1AI1L 1K9TA 4LBAA 1AGEB 1HHIB 2V2XB 2CO6A 1R3KA 5I30H 5SV4A 3QQ4B 1XXDC 3MOBL 1UM6H 2RGSA 3X3FH 4Q9CA 2QQLH 2Z8WC 3DXAB 4EPSA 4WI3A 3HAEH 4GJTB 2HSIA 3JV4B 4JFVA 3D8MA 1QSEA 1WWAX 3UC0H 3EBAA 5E7FA 4ZMOA 2VXVL 4JKPL 5ILTH 2EUXA 3GMQB 3ARFA 3L2NA 4GP8B 4OLWH 4YBLC 5KSBF 2OMWA 2OYMA 2WQWA 3DHUA 3ME0A 2X1QA 3Q13A 2P44B 4NBXB 4EIZC 3VXQB 2NTFB 5B1CA 3Q7JA 1Q9KB 4J3SA 2PO6C 3L4TA 2KZBA 1T0NA 2ADJA 3E80A 5CINL 1OAXH 1KTLA 3BQVA 4KKZA 4WI8A 4CNIB 2IALB 2NZIA 2XN9D 4W9KC 1R0AH 4IRSC 3B9KD 4G8GD 3QIWD 3VD0A 2CHDA 2WGXA 2FH8A 3NH7L 4TOYH 1U91A 4QRSB 1QHOA 4LSTH 4YC2C 4P3DA 4W4NA 3IS0X 5JW3H 5BV7B 3AVEA 4BH7A 2BVYA 1W0VB 3WKNA 1UUSA 3F6JA 1UCBH 2A9MH 3WDHA 3VI4F 1TJMA 4JHUA 3L9EA 1MG2C 2X2JA 5CLTA 3ZE0B 1AGBA 2G5BA 1F3DH 2NY6B 2P46B 2VW7A 2GT9B 4K5PA 4A66A 3HI6H 4XB7A 3MNZB 1YEIL 5F44A 5CLYA 3ALWA 4WKZA 3GRWA 5E6UB 3H9ZA 3QR0A 1GKEA 4D3CH 1O75A 3K46A 4P46A 1JGVH 4M8QA 2E74C 2C9UA 2FJFA 1QPXA 3MLZH 4PLJD 2RA1A 3GB7B 5I1GH 5LG6A 4FQXC 3II2A 2DLFH 5K9OB 1NGZA 2D7PA 3UBXG 4NPKA 3EHBC 2NY2B 4WJ5A 4J2XA 4KTGA 1XF2A 5L9DL 1QFWM 1U58A 4KMTH 5FYJH 3VRIA 1G9MC 4KO6A 4PY8J 3QORD 1J0KA 2J43A 1F6LL 2CD0A 4JPWH 3QUKA 3B5GA 4L8SC 2X9ZA 1QSFB 2DWDB 4Y4FC 3GSOB 3L1EA 1A64A 4B5EA 2OMXB 4HSCX 3QWQB 1I8AA 4OTXH 5BOZG 2DD8L 1MHPL 2R59A 5E5UB 1R46A 4JB9H 2OXGA 4JGNA 2X4QA 4BKSC 4X5XA 2A77L 5CU9A 1IM3D 2BIIA 3TF7C 4RFOH 1HESA 1ZLWK 4I0PC 3TCXA 1YPZB 1CR9L 2X87A 1I8KB 4EI0A 1TQSA 2CLVA 4U2YA 4LSVH 4PH8A 1ZVSA 4ZPVB 1UWGH 3R18A 4PLKC 5TDPA 2VZ3A 5J0BA 4KX7A 4GW1A 5DHVA 5CILH 2W9EL 1DJYA 4QJ5B 2XPGB 1NINA 4XNQA 3RGHA 3B6SB 3GDBA 1E27B 2YAHA 5HGAA 1DN0A 2ZWYA 4KKAD 4PS4H 3L7FB 5DRWB 4YHNB 1NBQA 2P5ED 3QI9C 2CDEB 4AE1A 3B9KA 1E0OB 3TBTA 1VFMA 4J1UB 1QFWI 2NDGA 5LWYL 2Z31B 4LIQE 2NR6D 1JN6B 3NAAH 4AYEC 5KSBB 4BH8A 1IC4H 5E9NA 1RFDL 1FFRA 2VXQL 3PDOB 2IWKA 4IKLA 1DFBL 5K1JA 2GYSA 4LK4A 5AZEH 1S7QA 5F1OB 1WBXA 3WBDA 4QWWC 3SKNA 1AO7E 3Q3GB 1J5OL 3K5SA 3KPSD 1BJ1H 3VXOA 5D7KE 4RDQF 1MH5B 3VFPB 1CFTA 1K2DB 2EUWA 3RVVD 3C09B 4PJXA 4JO4H 3ECQA 3MPCA 2Z92A 3ECVA 3LOWA 1R4XA 4ES8A 3V6ZB 1QTPA 3DECA 5IVXF 2WWNA 3RGVD 3VI4B 3WJMA 4MRCA 5I0ZA 2O1AA 5C0JA 5C3LD 4DPCX 4MJ2A 4GUPA 3CLEL 1NAMB 2MQCA 3TYGH 3P0VL 1IKFL 4RRPA 4MQ7A 1UKTA 4R7NB 9PCYA 5E23A 2GC7C 3NVQA 5F88B 4Q56A 1RZPA 1HQRB 2ZJSH 4RA0C 4RH4A 3ECUA 2ADIB 3II3A 4N28A 2GFBA 5HI4C 1PZ5A 3HFMH 4XNZC 4OVVA 2PCFB 1P7QA 1BECA 4M7LT 3SY0A 4A2FA 2B20A 4WI6A 1UXWA 1GL4B 2YK1H 3GLZA 3SDXE 2IPTH 4FX5A 4EI6B 1NSNL 4Z0BH 4CKVX 2W92A 4PG2A 2Q3AA 3IFNH 1ZT7A 2F2HA 3U4BH 5DC4B 5DZVA 4HU2A 2CKBH 2E27H 3QXDB 2NCMA 4NO2B 4EZJA 1BZ9B 3U7YH 1ET5A 4MXQC 4RESB 1CVRA 2WGNB 4N0CD 3DLQR 2BIOA 1GGIL 2XG5A 1O5PA 1EHKB 5HPMB 1KTBA 2QR0A 4U6HB 1NGXB 5ESAB 4ENZA 1DLFH 2BNRD 5I66B 4HXAL 3ZT7A 1ZT4A 4FXGC 4UT9A 3E3QE 3CHQA 1S7TB 3QG7H 1JGLL 5IM7B 4LSRH 3RZCA 2PYEE 1K72A 4X5RA 4PJAE 1KCVL 3QCVL 2NR6A 3C5XA 3LS4L 1FORL 4JFXA 1CI3M 5L0QB 5DUMH 1FAIH 1J8HE 5D96C 2D7OA 4YHIB 1CDGA 2KDGA 4MJJA 1RZGA 3JWNH 3TBWA 2C8NA 4Q9RL 4G7YH 4H5SB 5KVGE 1G9NC 1UA3A 1V7MH 1PZDA 2HN7B 2PCPA 3F7PC 3NSYA 3KPSA 5E2VL 3UJIH 5DD3H 4PVBA 2VDMB 3FTYA 3BP7A 4FZEL 5D2NB 1DL7H 4H88L 2MQ3A 3RY6A 4AWJC 2FQGA 1WYJA 4NX0A 5LNEA 3LKQB 2VIRB 5FC9A 2JI3A 3GMQA 5CS7A 4PWEA 4JQVC 2W80C 5CJQL 1WHPA 1Q94A 1KCRH 4LKXB 2KC0A 1OARH 4OH2A 3V7AE 4UQ3B 3K74B 1Q9KA 4PJBF 4ODWA 3ULSA 2UXFA 5E8NA 4XPGL 2HLAA 3VH8G 4EQ3A 2F8XC 3T1WA 1HXKA 1RJCA 1FE8H 2BVEA 1J8RA 4MXWH 4JVPA 2CHNA 4ZFFB 1GA2A 2JCCF 1KUMA 2NXYB 2OI9B 5IVXB 3EFFA 3NZSA 1S5HA 3KPOA 4QRSA 4A7SA 3BVUA 3HZKB 3K8LA 4HPYL 1DTUA 1CLYL 1QHQA 2BX5A 4GQQA 1PAMA 2WBXA 1RZ7H 5C0BD 3ZL4H 1HXMB 3TIEB 3APCA 4YHKL 3RFZB 1K6QL 4JG9A 2X9WA 3I3BA 1J9QA 1S8DB 3DYMA 4N2HA 4NC0B 2BNRA 3C08H 2ZXAA 3L4ZA 4DCQA 2P3YA 4ANVA 2I32A 1EMTH 4YH6A 3VDCA 2GQHA 1NA8A 3NJIA 3WNNA 4UAOC 5K9OA 3AG4B 4OLYH 4Y4HC 4Z5RB 4TKWA 2FCBA 3ZHFA 4Q7DA 3H53A 4X9FA 4HWEH 3FB8A 4DN4L 1R24A 4EN3B 4HFWB 5BNXD 4TNGA 4Z7OF 1IARB 1A1NB 3VRLE 4DKEL 3LPPA 4FLOA 1N6QH 2P24A 3WCYA 2IPUK 3KVQA 1IL1B 2L7UA 3BDYH 4UZUA 3DX0A 2PYFA 2WLKA 1F97A 2DMGA 4D2NA 4Z7WE 3VSTA 4AW7A 5BRZD 1CG9B 2BRRH 3IM1A 1BBJB 2ADGB 2QSCL 4F27A 1WJ3A 1PZAA 2N1KA 1I1YA 2A83B 4G9DA 2Y5EA 4U1MB 4BK5C 4TTGA 3MLPA 2H2SC 3BJLA 4AIOA 1I8KA 3V5KA 4BZ2L 3MRPB 2E6JA 2AEPL 3QZNA 1FNAA 1TENA 4GO6B 4ZPVA 3V7AG 4AMXA 5IR1A 3NFSH 2LVCA 5LCVA 5BUGA 5GGRA 3DIFB 4WY7L 2ZKMX 2VDRH 4NDMB 5JORB 4PRIB 3WHXB 3FT2B 3IU3B 5A2JH 1DQTA 1YEEH 4QHPA 1MCOH 3PWPB 3S3SA 3BVTA 5JNYB 4M1DH 4LDOB 3QO1A 5I1DB 3WHE1 1BAGA 4DGUA 2D9CA 1E2VA 3ZYIA 3OAZH 3HLKA 3MSPA 3NCEB 3T0AA 5DO2D 2X4PB 3U1PA 4J1UA 1BOGB 3P4NB 5SWSD 1JHTB 2X9YA 1JN6A 4RBPH 3IXAB 4NQEB 2KZWA 5BVJB 1Z9NA 5C2BH 1MCRA 3EG9B 2YGPA 5DQDL 4M3JA 3B7UX 1ACCA 4OIIL 4PJBB 2MEJB 1FNSH 2JJSA 3LH9A 3MOAH 5C0BA 1TEGA 3D08A 1TYJA 1RLWA 1RPQA 1OP4A 3Q3GA 3RVTD 2FX7L 5DEFA 3QXWA 1BQHA 1A4JB 3HUJE 3PUCA 5D7IF 4ONFH 5BRQA 4YSSA 2JCCB 3VFPA 5IREA 4U7MA 4IS6A 2QT6A 3L17A 3GUTB 5D7LB 4F20A 3UTTD 1FGNL 4N0UB 5AAWC 2BHYA 4DGWC 1WGVA 4RMBA 5ISZA 3BAJA 1OZTG 4FQ2H 4TLTA 5HI3C 4PM1A 2Y9RT 2BP8B 2ZAHA 3NTCH 4YXHL 1DFXA 1KN2H 4XN5A 1J0IA 4N2BA 1BXUA 1FGVH 3NCYS 2D7TH 3U1SL 3VM7A 5I8CA 5J6GB 4R7NA 4PHXA 4YSDA 5DS8B 4WEBL 5JZ7C 2KDYA 3OHXA 4PGEB 3T4YA 1V54B 4CSTA 3U2SB 1CD9B 5BRZA 2XQ0A 1KELH 3S3CB 3NJLA 1SZNA 5CR8A 4DPBX 4EI6A 2UV3A 2XKNB 4O2EB 4ZZKA 1KPVA 5BJTB 1O6SA 3BQUD 1U8LA 5HJGA 3WN5B 5C0CE 3ESPA 3F7RA 4LHJB 2AJUL 3GSQA 3SSGA 4POYA 4OQTH 3MCYA 4W6XB 2EIJB 1D7BA 2BPBA 4GYBA 2V7NB 1RUMH 1KCUL 4N5UA 2J55A 4U6HA 4Z95L 5B21A 3MX0B 5T5NG 1IM9D 2YGNA 2BOBA 3LZNA 3WMQA 4LEXL 5F6HI 4PI2A 1TUPA 5ALCH 3V0HA 1KJVA 5SWSA 3MV11 1EAJA 1NEUA 5C0AE 2X42A 4UM9B 4S1RH 5CD5C 4WFGD 1FG2B 4N1HB 3MV7D 4YHIA 4P5MB 4IU2A 5HYJB 2I85A 2A6IB 4UTBH 4L9DA 3L45A 4Q0XH 1J1XL 4BFEA 3TO4B 4D0CB 2CDGA 1ETZB 2HN7A 4GEJA 4Z78A 5GXBB 4HHGA 5HDWA 5E2WH 3HNTL 4QDGA 5F7LB 1WLHA 1L5GB 3V6OA 3VU2A 4ODUA 3VD9A 4YLBA 5IKCB 3AXLB 1ACXA 2C1OB 5GGQH 1EBPA 3DMMA 4R90L 3TU6A 4HJ0D 2CLRA 7PCYA 4GNKB 1LO4H 4JFYB 3C60D 2E4TA 2A6KB 2PTVA 4CDGC 4LKXA 3O8XB 3C5ZD 5FGBA 2VDLH 1KYAA 3S34L 1DSFH 2G0KA 4UQ3A 4ANUA 3WD5L 3RVUD 4FG6C 5D7IB 1HNFA 3TFKD 1ZEAH 5IMOA 3K1DA 4JFDE 4TPRL 1FVDB 3RPIA 3ARED 1H6EA 4L8CA 1NIFA 2VDQL 3V5DB 4BK8A 2IV9A 1P5VA 4G7QB 4NN6B 4ORZC 3X2QB 1TITA 3K2KA 5I0VA 3O11A 2CG9X 3NYKA 4KXZI 4ZD3L 2X40A 2YBGA 3TT3L 1TTAA 2VDPH 5LNDA 3HZKA 2Z9TA 5E8DL 4OCRH 5A16A 3FAXA 4LCYB 3GWJA 4XTRC 2AJ3B 5L8JB 1NMBH 1N10A 4Y8DC 3TIEA 1TLKA 4H1LH 4L0PB 4LSPH 3RFZA 5F3BA 4LHUB 2FH6A 2UVEA 4JR9L 4ZMPA 2XXCB 4O2CB 3SDAD 1JL8A 2XQBH 4RMVA 3PP4L 3CDGB 1IM9A 3D1MC 3LIZA 3NZHH 3GLDA 5DC0A 4B95C 5FYKU 4Z7UA 1KBKA 5KAQF 1YQ2A 4W9HC 3TA4D 3BZEB 4EDXA 2XVKA 3KPTA 4PRPD 3TVMC 3WJLC 4DEUA 4AT6B 4I5BB 4Z5RA 4BGLA 4AUJA 3OJ2C 3QCUL 3MV7A 4RAVA 4WHYH 1U95A 2QKIC 1U3HA 4X7TB 2X4NA 4NRXB 3WS6C 1A1NA 4N8VA 2DTML 4OJFL 5D4HA 5JIKA 1IAOB 1TZGL 1MW3A 2TSAA 1FG9C 4XHQA 3MCG1 2DLIA 3OKEA 1H5BA 3IU4L 1G9MH 2VN5A 4K3DL 5EC2B 3R8BB 1NDGA 4AVJA 4A55A 2OSYA 5E8OB 2KYIA 3N06B 3UEQA 1BF5A 4R4BA 1E3ZA 1KTRL 2ZNXA 5HDBE 5D1QB 1U8CB 3MRPA 4M3HA 1NANI 2X0WA 3ARWA 2HUHA 2DJUA 1NFAA 4EUPB 2Y3AA 4PLNC 1J48A 4IIZA 3C5ZA 2K1MA 5KTEL 4JFOA 5JORA 1RULH 2KZ1B 3AZUA 1SXSA 2SEBA 3FT2A 3DDGA 3FTXA 1HWGB 3U7WH 4I4WB 3P1VA 4BGDA 3AITA 3KPLB 5LO7A 3O3DB 4BKLA 3GXPA 4R4NC 3A0OA 1H3XA 3CN0A 2YMTA 5D72L 4U1JB 2FWUA 4WU7B 2P8PB 4E41E 2Z8VC 2H6UA 3M45A 1Q9WA 3L3KA 3EBHA 3MNWB 3U4EA 2NY3B 4E0RB 3K6IA 2V8LA 4QRBA 1CFNA 3KW8A 2BFVL 3ARGD 2CKBB 3LY6A 1TNMA 1R3IH 1J1OL 3QUZA 2WUCH 2XPYA 2XQYK 3EJUA 1BWMA 1BHGA 4NHCH 1S9YA 2X6UA 2EINB 4KO9A 1QUPA 4GO8A 3O2WL 5AYQA 3GIVA 4ZOCA 3FB6B 1DQIA 1BGXH 2E59A 3DDFA 1CWVA 4UBDD 4CBPA 1J9SA 4YUEL 2MFNA 3SDAA 1ZVNA 1YYML 4BEIA 2DYPA 5IZ7A 3OBAA 3T2LA 4BFJA 3E7JA 4K5MA 1SXNA 2AJZB 3BAWA 2YZ1A 3MU3A 4PV8B 3RWHA 4ELMA 5EH1A 1LO3L 1PL3A 1CICB 1H15A 2DY2A 4UINH 1L0XA 1IIIA 1OV8A 1P4LB 2IWFA 2VZTA 1A7RL 1H3PH 3FU7B 1H19A 2H8PB 3HZMB 2HRLA 2BP8A 1SYSB 4LRIC 4K71C 5C08B 3CH8A 1U42A 3E8VA 3DTDA 5FYJD 3HG1B 2K78A 2FSEB 4CILA 1RD6A 2NRDA 2E6QA 3QAZB 1T20B 3HS8A 4HG4K 1JGDA 1LXMA 2RH0A 3TCTA 2DKMA 3VSQA 4DUXA 1OTUC 2AGJL 1U2CA 3DTXB 5B1KA 4AYID 1QFHA 5H4ZA 3KS0J 3QWRA 1LK2A 1WWBX 3HAEA 3GXIA 1K4CB 1ZAGA 2J1WA 1V55B 3CZJA 4LPTA 5IQ7L 3IS1X 4UV7H 2Y1AA 5CHNB 4M43L 3F04A 1J0JA 4RAHA 5G55A 4MDJB 3G6JE 1S4IA 4PJ9C 4XZUA 1QA9B 3ZTJG 2VDOH 3RNQA 1SXBA 1ADQL 1ZXKA 4QLWA 3BH4A 5IT2H 1FFNB 3VMNA 3HC3L 5TE6H 4CUCA 1GPOL 3MX0A 2HJFB 2ZKXA 3L4XA 1N5AA 1YEKH 1F1DA 3A47A 2GG1A 2IWGA 3S6CA 2RCSL 1Z2KA 5D7JB 3PQYB 4OB5H 3D18A 1HSBB 4PS3A 3GHBH 2G3MA 2JI1A 2D4FA 1IAIL 5DUJA 3ZL1A 4S1SL 2WTRB 1SHSA 1H8SA 4ZODA 3CX5K 3OLEA 3IDMB 4K07A 4AZUA 4WZ9A 3W56A 1D5XB 1JZ4A 3TO4A 3H1ZA 4D0CA 1P4BH 3KPQA 4F5CA 3BH9A 3BPLC 4IDJL 1NC4D 3THMH 3SQBA 3T8MA 1ERNA 3LRHA 1O0VA 3ETSA 2P7TB 1L5GA 1XGRB 1VGEH 1G9NH 5CP7B 2OQJA 4DOHE 4WUUD 4MHHG 3ILDA 3KYOA 3LNGA 5BW7A 2BVQB 1MHEB 4G8EB 2C1OA 5HDRA 5IKCA 1HZKA 5T3ZE 5J12B 1YEJH 1H3TA 1HIML 3ZDZF 2NX5D 2A6JB 2I9LA 4JFYA 3Q6GH 3KM2A 4MB1A 3U7AA 3VI3E 3VVVA 3VXSD 3IMSA 3M86A 1OTSD 3WFCH 2IG2L 1SOQA 5D9SA 2OR9H 2NY4D 2HVJB 2H3KA 3IMVA 4BSWB 1FVDA 3TJPA 1A9EB 2WLMA 2A9DA 5IK3B 5IB5A 4WO4C 3UBHA 3QEQE 5E9DB 3WFHB 3L7EA 5DFTA 3LEYL 4PVMA 3IMUA 4FNUA 5D70L 3MV9B 4PJ5D 3D2TA 3NIDE 3FO2A 5BZXA 5C0IA 1MCDA 1WHOA 4OGYL 3K6SB 1CI5A 2FIKA 2V7HB 1UD2A 3FSAA 4IU3A 3OKNA 4U4IA 2FHCA 4BIKA 3GSNH 1WZAA 2D0HA 2WZAA 4JRXD 1OWWA 2ROYA 1T21B 4LHUA 4MNHA 4DVBA 4ZMNA 2APVA 5DJ2B 1SF5A 4DKTA 4JFHE 5I1HH 1LDPH 2D73A 4OLZL 3BKYL 2ZOLA 1R3LB 3FTSA 3ISRA 2ADFL 4O2FA 3BZEA 4YIQA 1JZHA 4IBZA 1WWCA 1ZK9A 2YUVA 5CCKL 1V3LA 2JKJA 2XV6B 2ZX6A 4ZX4A 4AT6A 2VN3A 5IWLA 2E9BA 2WW8A 3WEBA 3O9WC 2F54D 2H26B 3WS3A 4JCLA 4JBSA 3SCMD 5FKAA 5G4MA 1SYVB 2V9RA 3FFDA 1X5GA 4P2QB 4RX4A 3V4PL 4PJ8B 3M17B 4F9LC 3CFKB 4L3ED 4W9ZA 4HWBH 1SMAA 1ZGLP 3QQDA 5HGDA 5AOLA 3IN2A 1TVHB 4ZTOL 5DMYA 2GI7A 3RKPA 4UNTA 5KBNC 1QUNA 5K39A 1A65A 4WUUA 2ZT9C 5KWYC 5D1QA 2EIEA 4JG0H 5DQJB 1AXTL 4J4PC 2NX5A 5JQIB 1NUDA 4KRLB 4EUPA 4YWGL 3B3IA 2LU3A 1WA1X 2UZXB 3G08B 4G70B 1KPRA 2ZONA 4S0TD 2A9NH 3QHTC 1ILUA 2BVTA 5KSUA 3QRFM 2R8SL 1Z9PA 5JOPE 4L3CA 2ZYIA 4I4WA 1JXKA 3OGCA 2X4OB 2VWEC 4Y1AE 1TXKA 2J8HA 5PAZA 3HHRB 2CJTA 3G04B 3QPXL 3NSFA 2VDQB 3SKJL 3BIBX 3QNXA 4J28A 4HISA 4FQQA 4KZ0A 3E3QC 4YHYC 1Z5YD 4CMMA 2YMXH 5GRJH 4LT7A 5FKPB 1UH3A 2GJPA 3S36H 3IDYC 4PJ5A 4HULB 3IFOA 2CKBA 3HRZB 1UD5A 5KANI 1KDIA 3M1BB 2MPAH 4MJHA 4NKIL 4M5TA 4HIEA 1FDLH 4MASA 1AQKL 1HKLL 2MCPL 3RWFB 3WGUB 4TYUA 3PY9A 3IJEB 4OFDA 2CO7B 5TQ2H 1Z32X 1N19A 3ZT5A 3ARDD 4O5LH 2B9AA 4C83B 3E2HC 2DMBA 3A23A 3QUXD 4NC1C 1EDYA 1UOVA 2AQPA 2OK0H 3OKOA 1YNTA 2FLMA 4XVUC 3NA9L 2H8PA 4OZFH 1P84K 4CVXA 3DYOA 4QOKD 2F54A 3KHQA 3SCMA 1QZ1A 4G7SB 3V5HA 1FC2D 2EE0A 5I8KL 1D6EB 1T20A 5E4EC 5AEAA 1B6DA 5ICYB 3QZWG 2XTJC 4N5EC 2IFFL 4U49A 4PLOB 2HG5A 2DQGH 3H0TB 1J0HA 5I1LB 2C1PA 4QTHB 2X2UA 5F21B 5EUOE 2F7QA 2K3HA 2W0KA 4TM9A 2AQNA 1M9SA 4O02H 3ZRSA 5CR1A 4QHMA 4JL1A 4NXKA 3ILQC 4XE0A 3BCDA 5CUSH 5AB0A 4KROB 1XCQA 5IOPB 2E7MA 5CHNA 2BSRB 1I31A 5M7QA 2EEDA 1OO2A 2H9GB 3LZFH 2IQ9L 3QZPA 1MCPL 4O00A 2AEIT 5D6DC 4H7VA 4ODVH 1UWXH 2WZ6A 3MJ8A 1ULVA 5JIMA 2G2NA 2K7PA 4FQHB 1MI5A 1SNRA 4DFIA 4XOAA 2H45A 1HXYB 1PJ9A 1JZDC 4XBPB 1T04B 2DJ4A 5TDOA 2V2TB 2BVPB 4CAGA 4DO6A 3PWUA 3U0PB 4WNJA 1NBZA 1MLCA 2NNFA 2WXLA 1HSBA 8FABA 1HL4A 1MJ8L 4Y88A 5D8JH 5HDQH 2XRAL 4X9IA 4GXUM 5DTFB 1XZ0A 3D0LB 4X4XA 4ENED 5EORH 1TJIL 2WXGA 2CBTA 3QDGB 5AW3B 4HJJH 4FL4B 3IGLA 5BZDB 1KZYA 5INCB 1FYHB 1MHCA 1Q4NX 1IUZA 3ABKB 4J3UA 1RY7B 4OCXL 4NGHL 3AB0C 3L6FA 2CHWA 3F6IA 3U30B 2BP0B 3ARDA 1S9XA 5K9QG 4Z0XA 1CFSA 5K59F 3SDCD 1A8JH 4M6MH 2JQZA 3ZGHA 1ET8A 4OIBA 4ZW8A 4GKSA 3MGOA 2D2OA 3VACA 3MN8A 4WFFD 4DGVH 4PU2A 1XH1A 1BREA 5E1GA 1XZWA 1TZAA 2QSTA 3FRPA 4NQVA 5HVHB 4NM4H 4ZXBA 2IPUG 4FQXB 4TNWK 4P5SA 1RHFA 4NN5B 3IJSB 4FULA 5KVDL 1UXSA 3BKML 3EHBB 4RMRA 4MQXC 3BVDB 2YIHA 2FBRA 1KPUA 4FN0A 2WCGA 1EXGA 1F4WL 3DARA 3US0A 1OZUA 3OMNB 1B0IA 1O9ZA 4HX1B 3EXLA 4L8SB 1SY6H 1A66A 2ITDA 1OT1A 1JNNH 2ZUYA 3IF1B 3NJGA 1XGUA 4ZO6A 5ANMA 3K6SA 3H3PH 2V7HA 1KLFB 2DEWX 2V3EA 2Y7MA 4YSOA 3VYOA 2R83A 3ELAT 5JIIA 3QFJE 2VYRE 3SPCA 1CE6A 1I1AB 1QFWL 4ZNEE 4PJCE 3P11H 3JTSA 3KLAB 3IDNA 4AQOA 5BZZA 1N12A 3JV6B 3ZTDC 2ZOTA 4PGDA 5HGGS 3VSVA 1ZA6B 3ZHLA 4DP8X 4KK6C 4HCRH 1KGJA 4ODSL 1IGCH 1I7RA 2AJYL 2R23B 4WTZG 4XOEA 4F7KA 4ZMLA 1EXHA 4M3KB 3RBSA 3CMOH 4HK3J 5AW5B 2Y72A 2GI0A 3QI9B 2A0LC 2FSDA 1RP8A 5T3XH 1A3RL 2PPCA 3HHMA 1DBBL 1GAFH 2C3WA 3FS9A 1PLGH 3LTVA 4G6KL 3VXNB 5E94B 1Z7JA 1NGPL 2J44A 3SJVA 4F8QA 1AIFA 4W9IC 5BQ7B 1INQB 3QJHB 4XAKE 4ZTEA 2DBLH 1N0LA 1HHHB 1A6UL 3NCJH 1MFVA 2QSVA 2WLIB 3NCBB 3HE7B 4YX2H 1MW1A 1S9VB 3N85L 3KYKH 2Y23A 4XI5C 1RZJL 2B4CC 2CRIA 3DPBB 4KVCL 5TH2B 4P07A 3AU1B 4XMKL 2JH2A 4QYOB 2NY7L 1FNHA 4JGMA 2X05A 1OAZH 4YEEA 5E6IB 2AC0A 2WQUA 1E6JH 3KXFE 3FTGB 4E9RA 5DD1H 5DUPH 3T4AA 2B08A 1JZ3A 2NSMA 2VDNL 4QRUB 1SDYA 3NN8B 1YMHB 5IHUL 1FZJA 1M71B 3QNZA 4GT7A 4MXVF 2X4OA 5L4IA 5I17B 1DDTA 2AXJA 3HMXH 3PHOA 4NUGH 5ICUA 4PYGA 4MMXA 1NEPA 4NP4H 3PGCA 1WTLA 2VAAA 4O58L 1QBBA 3CN2A 3W11D 3D85A 4CU6A 2WQXA 5ALBL 4DQOH 2FATL 4ONHA 1UCTA 5CSZB 3RPBA 1CFBA 2R29H 4I1NB 3MYZA 4LLQB 4XNZB 1JF1A 2DQUH 5AVUB 2QMKA 5I5JA 4JL2A 4KXBA 2FGZA 5CSBA 4Z3EA 4CC1A 4PRHD 2DWTA 1NMAH 4ZW6A 4XCEA 1QZNA 1MW2A 2DQDH 4OQTA 4XVJH 3RAJH 3WKMH 4N8PA 2HX9A 3QC6X 5DJDA 3KDMB 3FUNA 2IJ0C 3VFGH 2V5SA 4OJYA 5AYUL 4YZWA 5ACMA 3MRJB 2XN9B 4XO3A 3S5YA 2Y7SA 4G8GB 3ZDXB 5K69A 3IDGB 1O6VA 2WWMC 4YDJB 1U6AL 4B9CA 5LAXB 1D5ZA 3I85A 3N3EA 2VOTA 3FFCD 3U79A 4Q8BA 2YPKB 1GOGA 3BWAB 3S3BB 3VM5A 4UTBA 2FD6L 4V1DA 4L1DA 1J5HA 5TE7L 3WJJA 4JFED 2ICEC 2J1XA 4JM2C 3WIIH 3FU6A 2ZCKL 4JPSA 1DBML 3V4PB 1OAYH 1XCXA 5TFSH 5I1LA 4NZJA 4WHTA 3R1GL 4UQ2A 5DYFA 4HHAA 2DS4A 3ZKXC 3KW7A 1YLBB 3KYNB 3KCWA 5ECGA 3BRFA 1WBZB 1J1PL 4LFHG 5F7BA 4GAJH 2EEXA 3UJJH 1OCCB 3T0EB 4HF5H 5HP5A 2XZZA 4W9GC 1HCVA 4OCWH 4AIXA 4QRFA 4OAWA 3N55A 5IVZB 4AZ8B 5EZIH 3RPKA 3NIGE 3BN9D 1TZIB 3QORB 4I0PD 2EDEA 1Q8MA 1ZANH 2FB4L 3MXVL 5DD0L 2WQSA 1MVFA 4FQHA 4PLKD 2DQJH 2OXHA 4PRDB 4ZUSA 2MKLC 2WLLB 3H2QA 1GGBL 4IBWA 4ANWA 2V2TA 1NTDA 1D5IH 3MO1B 2PO6A 1AYRA 3ZZ1A 1QFUH 5I9QB 4R9HA 5FOBB 2YN3A 4HSAC 1BX2B 3VB9A 1TZ8A 2F5AL 3MKGA 3RUGE 4MCZB 4IRSA 1IGFH 3FSOA 3WEAA 4U1IA 3NEEA 4PRHA 3VFSB 4XN7A 1IEAA 1PKOA 3QDGA 2Y06H 4GO9A 5BZDA 1XR8A 4H1LA 5INCA 5I1AB 3W1ZA 4A7TA 5F89B 4PGBB 1NGWA 1L6ZA 1PLCA 4BQ9A 4WF7A 2BP0A 3RGBA 3QDMD 1UOLA 2IDTA 2VUKA 3SGJC 2P5EB 2VISA 2EILB 4PEEA 4N1CA 3WUWA 3OV6A 5AAPA 4QWWD 4YR6B 3OXSB 5I1KH 2B5IB 1JZIA 1B2WL 1QD0A 1XVSA 4NZRL 3WY4A 3FCTB 3FFCA 1I82A 2FT6A 3MROB 1CU4H 4TULH 4ZMYA 2BW5A 1DE4B 3LKSA 4OZHA 3WNPA 1RIHH 4JFEA 1AXSB 4PJEA 3CWGA 1KB5H 4FQXA 3SPGA 3ARUA 1OAQL 5DVLA 4CADB 1QBAA 4ERSL 1IQWH 3KL0A 4QJ3B 3EJRA 1G7LA 2F7RA 3F7KA 1CYWA 1WQVT 3N40F 2DF3A 5I0WA 2X70B 2YGQA 3EH3B 2BWIA 2WN3A 5F3HA 2XFGB 4L8SA 5AKVA 2WAHA 4NO5B 4Y4FA 4HUUA 5CKAA 1A1MA 5HI4D 3PL6C 4YHPA 3VTMA 5IHHA 4MKTA 3D4GA 4HJSA 1EEZB 4WHCA 3G5ZA 1RU9H 4G9FB 2YSTA 3CFCH 5J7CC 4FFWC 1A5FH 1YEFH 2DZEA 1JNHB 1FHGA 5G2NA 1NFDF 1SEQH 1K4DA 1OF0A 5T8IA 4AK1A 3GRGA 3GXFA 5JHDE 1ZPLA 4MMZB 5HYSG 1MCWM 3OD3A 4Z3HA 1VGKA 2AANA 4FFZH 4MJIE 4P2RD 5DC9B 3GM0A 2NUTB 2YRPA 4LIQH 2BZDA 4Q6IC 1BQLL 2JQMA 2LQRA 1ZA6A 3HNSH 4Y2DC 3TBVA 4ZO9A 2EAEA 4A38A 5IMKA 5A3IC 5IUSA 1FNLA 4IOIA 3SPJA 2VR6A 1E4HA 2PXYD 3S9DB 1F4HA 4UIMA 4LVEA 4H8QA 1UFGA 1NLBH 2XQYG 3QI9A 4TL5A 1KFAL 4XB3A 4NZTH 1U8MA 2CK0L 5CJOL 1XGZA 2QV2A 3CSBA 5FK9B 1RUKL 2Z1KA 1A3ZA 1OCRB 2R56L 3NABL 2PWFA 3VXNA 2YZ8A 4ZUWA 2RAMA 2R15A 5E5LA 1P6WA 2F19H 4IBYA 3M07A 3PGDA 2P45B 3P0YL 4YN3A 4NCC2 5B1JC 1TZHA 2Y2TA 3IWUA 4M48H 4U7KA 3FSZA 1T7WA 4PB9L 2CAKA 4NEHB 5EBMB 4DP9X 4HPOL 1FYTE 4QYOA 5EUKA 1BVLA 3GBLA 4ZS7H 5KYWB 5MERA 1JPSL 4XC1H 3BOVA 3FO9B 4M7ZC 1A1OB 3FCSB 3FTGA 4XVSH 3BLKA 4N8CH 1FIGL 3F84A 4ZPTA 5L7XH 4OSUL 1GTNA 1PBYA 2KLSA 3QDJD 1YMHA 4Y2OB 5CZXC 1M71A 2QLVB 4JN2B 4QRRE 5I17A 3BZDA 1DVFB 1EXUB 3IXTB 2XETA 4ABVA 2O5XL 3PWVA 4GLRH 5DWPA 5GS0C 4GKOA 4PJDF 2J7LA 1YJDC 3MVSA 4LSSL 4QT5A 3O3AA 5TTRA 4BSJA 1GKOA 3HPLB 4YOKA 2WZPD 4QCIB 2EE6A 4ZMXA 1YEGL 4K5LA 5I6LA 5DFAA 4NO3B 2DQHH 3AUWB 3SYCA 1CE1H 1SXAA 3TN0B 5C97A 2YBRA 3AQZA 1QSEE 3QJUB 3OPZL 4TVPE 4QTFA 1FO0L 3MRJA 1LM8V 1IX2A 1HCFX 1U8HB 1LGVA 3T9WA 2F0CA 4YDJA 4HK3N 3IFLL 4D7PA 5H8DA 2WBWB 5KVGH 3QUML 5LAXA 2HH0L 4JKLA 4MYPA 3S96B 1QLRB 5IBLD 1UCBL 4FXGA 3GS7A 1ZLUH 3UP1A 4UYPA 5E8PB 3MRLA 5KJ4A 2YPKA 1CQKA 3R0MA 1B3JA 3GJEA 1C7TA 1P7BA 4C4UA 5C71A 4Y4HD 5GGSA 1N5YH 3UIZA 1MFAH 4R3SB 3V4PA 1JF5A 1YEWA 1FBIL 1R3HA 3HI5L 4PVLA 1KTKE 4C57C 3O4LD 2IH1A 2KZKA 5EZOL 3QRBA 5CN2A 4FZ8H 2B7DT 2GJJA 1ZLSH 5CN3A 2NTSP 3F01A 4PMFA 5F0MB 2ZUTA 5EBGA 2J57A 4UTAH 1KJ3L 2BY3A 3VXTA 5FYJL 2YPLD 1BD2E 3EYUL 4M9PA 1MY5A 5B4MD 5FHAH 2C3VA 2DWEA 3MQIA 4EVNA 4CN1A 2IDUA 1TZIA 3B2XA 1OPGH 4HIPA 4JRYE 2HRHA 4H4NA 4IBSA 2ZPKH 2VDNB 2JK5A 2ZSVA 4K7PX 4JQVA 1TFHA 5J6HB 5K9KA 3VD3A 1F4AA 5E2TH 2QADC 2OTWB 5FYLE 4DKFH 1ZJAA 3ZE2F 3DYPA 2BVOA 1LTXA 2A73A 3KPRD 2WKLA 1M1XB 2DJMA 3CE1A 3HVDA 1BX2A 3P77A 2P1YA 2WZPA 5LKNA 4OGXL 4ZMZA 3FH8A 5GS1B 2XACC 5FUZL 5IESL 3KJ6L 4OUUA 1NUFA 3Q5OA 5LBSL 2WWKO 4YXKH 2FJHB 1LWHA 2AQTA 4JNXA 5EBWB 4MA7L 3MRQB 2I5YH 3GSNA 4ZSOA 5H4YA 3VGGA 1GIGL 1NBVL 2HFFB 3GHEL 4KRPC 4PR5A 1PX4A 3TONA 3OR7B 3N43F 2IAAC 1T83C 1G9HA 3CFEA 4PJFF 2FWLB 1E9QB 5T33H 4AH2A 1OCOB 4PJDB 1MY7A 1FLTX 1YY8B 5JDSA 5IW1A 2VXUL 1FL5B 5C6TH 1BVNP 4MMYB 1XWVA 3MUJA 5IV2A 2EVGA 2V3FA 2J25A 4RISL 1E7VA 3L08A 3VFOB 1JPTL 5IF0B 3HHSA 3V4VH 4OLXL 3DIVA 2E7CA 1VPOH 3PXJA 5F7EH 4OT1H 4S1QL 3MROA 1MJ7H 4FQIH 1J05B 4U1NB 4QR7A 1DE4A 4W9FC 2WUBH 1QNZH 2R1XB 3EDJA 4GRWF 4MD0A 4BFIA 4IHOB 3JWDC 2ED8A 1XIWD 4PP1C 2Y25A 2WN2A 4HWBA 2V5MA 3GMPA 4Y4HA 4CADA 5HI3D 5IHZA 2CBQA 3OB0H 3O4LA 2APWA 4CW1B 1A0QL 4CU8A 1CLOH 2CJUL 5H94B 1SLXA 3V7MA 4Z7VA 5JZ7D 3T2PA 2VMJA 4MLSA 4I9XA 3SE8L 3TT1L 1EEZA 2V9UA 4J3OF 4AV5A 3LV3A 4N2LA 4YEFA 1MFNA 4K7PH 3DUHA 1SXCA 4RDBA 5I8OL 4KC3B 4BK5A 1TYRA 2OLDA 5CWSA 2BIMA 3Q8CA 2FYYB 2O6EA 4OM0H 3BN3B 2NNXA 5EMYA 5IB3B 2HXAA 4QGTA 3UX9B 1P4UA 5E1AB 3LKRB 2X7LB 4K3GA 2ESVD 4KKQA 3GS0A 2KI6A 3CQFA 3PJSA 5D5ME 3CFJB 15C8L 1MWAH 1DZBA 2WWOA 3D69B 4JGUA 1TCRA 2Q86A 3UZQA 1PEWA 1T6VN 3L5WA 3VSUA 3UZVA 1KB9K 3MCLL 4B50A 3TJHD 2E3VA 2AK1L 1PD1A 5FK9A 3AACA 4NYLB 4YHML 4KOBA 1FJ1A 2IBZY 4LPYA 3LEXB 2E8YA 5CD5D 5IHLB 1S7SB 1TMCB 2H32H 1E5CA 1RK1B 4HAKA 2JKIS 2OW6A 4IDLA 5AZ2H 2A9CA 2F5BH 3EBIA 4NAJA 5LB1A 4JO1H 3ZE2B 5TF1L 3LKOB 1F90L 1JWSB 1QLFB 3ZRCC 5EZLB 4U0RC 4I87A 3G5WA 3SYOA 4KZEL 3WENA 2ZXCA 2ZOWA 3GBDA 1ACYL 4OZFA 3MLTA 1KNOB 3GBNH 2B4CH 1HH9B 3PABA 5I1JH 1G7QB 3N43B 5F9WC 4APXB 4PJFB 1FV1A 4FYTA 5D4QA 2VQ1B 5AAWA 1M2OA 5HDLA 4TQPA 4L18A 1RZFL 3PJLA 4JKNA 4NQDD 3WIHH 2VABA 3FQUB 4XN9A 4YZFF 3MV8A 4K71B 4KXCA 4IBVA 5L6YL 1MRCL 4HDIA 1ZT1B 3QRLA 1SM3H 1IAKB 4Z7QF 3SQOL 4J8RA 3QZBA 4HUMB 5IY5B 5ENWB 1DQLH 1N64L 3TASA 3U9UB 3WLWD 5JXEA 1YUKB 4QCIA 1A6VH 5ID1A 2OCCB 4UQBA 3BUYB 1YMMD 1F2QA 4X4YB 4GRWB 3V0WL 2ICWI 4XNYL 1T0MA 4M00A 5F7HA 1ID5I 3MLRH 3TNNA 1T1WA 3DXAE 5AG9A 4WK2B 4L4VD 1YNKL 2EH8L 3SE6A 2NOYA 3S4SB 3HC4H 1OGTA 1C5BL 2OBGA 2Y07L 3AREB 3BZ4B 3VXUA 1PGRB 4PJ9B 2GUOB 4RRPG 1V05A 5B3SB 3VW3L 4MFHA 5DFVD 3W0WB 2YAPA 3MHZA 2PW1A 2G5UA 4XH2A 3O3EB 3ESNA 5I6XC 1BM3H 3OAYH 1P53A 2AJXH 4RGMB 1MIMH 4IJ3C 1E9OA 2GTQA 1RVFH 3FPXA 3JVFC 1ETJA 5EOTB 5E8PA 5CIPB 5T3XD 1AKJD 3MRCB 4MBOA 5E1IA 5AW8B 1DJIA 1EFXD 3HG0A 4Q4IA 3ILPB 3QJFB 3P40A 2Y0SA 3TVMD 5IW6A 3Q1SH 5E0FA 3VXPA 4E5XB 3DROB 2YC1A 3VB8A 3CXHK 1MRFH 3DO4A 2O6DA 2DIEA 2X6MA 5L88L 4NJ9H 1CYXA 1JPGA 1RKRA 4ZO7A 3M1OA 3TZVC 5E4IA 2DDQL 5JO5B 5H37H 2XVGA 4N2IA 4Z8FL 3P3TA 4HZ1A 3L3GA 3GZKA 5IBTH 4GS7B 4RGNE 3ZE0E 2YKLH 2AJSH 3DX8A 1QRKA 4JLRA 1JGEA 1OP9A 5FCUH 3D25B 3VA2C 3BKJL 4DGIL 4I1PA 4AW4A 2B0SL 3CTTA 4HT1H 1RUQL 5JUEL 3UERA 3ZBMA 5EC1A 3FQRB 1ZE3C 3MACH 1G6RL 1INEL 2P8LA 3NCXA 1K5WA 4BDVB 1MUJA 3IBOA 4OJCA 1C5CH 5JOFA 4RFEB 4QRQB 3NFPB 4NQDA 1RP9A 2E9IA 4MNQD 5FUOL 1T5WB 4HH9B 2CIIB 2OTWA 4F57H 1S9KC 1YEDA 4KI1A 4LLUB 5I2IB 3TH3T 1NCHA 1SY6A 1T5KA 1VIWA 2TAAA 1NFIB 1KIQA 3UMTA 3VCLA 1QSFE 1HHGA 3O45B 3OZ9L 1HEHC 3GK8H 3S88L 3F7QA 1T6BX 4QD2E 2ARJA 2BHZA 3LS5L 4TQEL 1EERB 1H8NA 1O6TA 2ZOKB 2GEEA 3EGDB 4BZ1L 5FO2A 1SVCP 1JGIA 3N1GC 2ZG1A 3HC0B 5IJVB 2HFFA 2YD6A 2AQQA 2WXQA 4G5ZL 5KYYB 1XGTB 5DD6B 4PY7A 2LT9A 3BO8B 1N70A 3E8UH 5CP3H 1E9QA 1YPZE 5CFHA 1XH2A 1KGCD 2XA8H 4Z7QB 4M93C 5K9JL 2OMYB 5I6MA 4OCYL 4WEUD 1FO0B 4MMYA 2VMEA 3T6WA 1JPFB 1FN4A 3LN4A 3GZOA 3JTTB 5JMRA 2WANA 4JO2H 2H3XC 2R69H 1EO8H 4KQ3H 3LDBC 4H8WL 4F1ZA 1EO7A 3H9HB 1KY7A 3ARGB 3QUMB 1KENL 1AKJA 4U1NA 1DQQA 5DRNB 2I9TB 4GUQA 2H0JA 2R1XA 3GI8L 3ARPA 3TVMA 1D5MB 3WJLA 1MELA 3A4FA 2ATKA 4JK0D 3QDHA 3I3DA 2B77A 2IAMB 3O9WB 4LPXA 3NJJA 2QKIA 4OLVL 1GYVA 1H6FA 3BD5A 2F7OA 3WS6A 1X7QA 5JA8B 4G6AD 3RBGA 5H94A 3I9IA 4Q89A 5D4JA 1HWWA 1T66D 2EXWC 4JY5L 3P9LB 2P43B 4CVZB 4YDLB 1CK0L 1OTUD 2GSMB 5AB9A 3EIFA 5A40E 4JPKH 3MBXH 4V2BA 1URZA 2PWEA 1BVNT 1LK3L 4O9HH 1QO3A 4JHAL 4Z76A 4KBPA 4OJEH 4OF7A 4P9HL 1U8IA 1WE5A 3QIBB 4GAYB 1OD9A 3CPUA 3WE1A 4I18B 1JK8A 4OD1L 2B1OA 3CVHL 5BOPA 5IB3A 2F9BT 2FUQA 1JZ8A 1QPKA 3HMXA 5ISZE 5E1AA 3WXVL 2XG4B 1Q72H 1PX3A 4G7VH 1A3LL 3K5RA 1PY0A 3D50A 3INUL 1XF3B 3PWJA 4UT6H 4P5TC 4URTB 1FRGL 2DIBA 1Y0LB 3LXBA 4UU9A 1UJ3B 2CDFB 4KHXL 3WE6B 1WC7B 3BGFC 4I88A 1AE6L 1RJYA 2BHUA 2CO3A 3W5MA 2OSWA 3D2UD 5JPNB 1CT8A 2Z35A 5C0NC 1OGAB 5LGJB 1QVOB 3IDYB 1SMOA 5LBVA 2Y4SA 3T65B 2O26U 1A7NH 3ZUCA 5DEGB 3FRUB 1QFOA 1JVLA 3EJZC 2D31B 1GTFA 5K93A 2FE0A 4ZI8A 4HSQA 4WJKB 3TXAA 1ZHLB 2VZUA 4BCYA 1XD1A 2HFGH 3OAZK 2MWCA 4RWHA 1L0QA 3WOVA 1AC6A 4E9LA 4D94A 5D1XC 5BVPH 4W70A 1DP0A 4IRJC 1IT9H 2VQ1A 1E7UA 3FB5A 4LU5H 3WDJA 1MAMH 5E6ZA 5KN5A 2BJMH 4M9OA 4OD2A 3FQUA 3S3JA 5ICZB 4M61A 5LHDA 4LRIA 2X4UA 3P30H 3ESMA 4PBVC 1GSKA 1ZLWH 1WEJH 2QQNL 1MCEA 3U4AA 1KCLA 1JZFA 1MFCH 1PD0A 2B3RA 2IH3A 3CZLA 5E4EB 1BQHG 1EZSA 1QWUA 4HXBL 1EEQA 1BYOA 5EFIA 5DJCA 4HUXB 3KJ4C 5GS0H 3VDBA 2Q10A 2WNXA 3FT4B 4WO4D 1LP9A 5L4MA 5LGHL 3VXSB 1PQZA 4LNRB 1AHWC 4Q6YA 2JB6B 4LASL 1GHFH 4J3XA 1BFVL 2NY4B 5E6SB 5I15L 3S4SA 2HPOA 4OM1L 1DEDA 4P49A 2Q8BH 4PJ9A 1MRDL 2GUOA 3AS0A 1CL7H 1P2CA 2QLYA 2XWTB 3W0WA 5ITFA 4M6OH 5AOMA 5ECJE 3ZTNH 4L29B 4I3RL 2CKNA 4K5NA 4NS0A 3PAZA 1KBWA 5DXWA 4NPYA 4PRBA 1AO7D 1W0WA 1QR4A 4WSJA 3ZGIA 4A2DA 2GSIA 5BS0A 1AOHA 4ZTPL 3TJEL 5D2LF 4WGKA 1NWPA 1P6AB 5D7KD 3VWJD 3B5TA 3S7GA 3DBXB 1MNUL 2MJWA 4LLDA 4CRPA 2K9FB 1TR7A 1A8ZA 3ILPA 3PUUA 3EYQC 3D2UA 4JRXB 2X6VA 4XWOC 3EO9L 3LMJH 1MFDH 3MLWH 1P6FA 5CD3B 2QPUA 4S1DC 5T3ZH 3IMRA 1KXQA 4L8DA 2J6EH 2H6PA 1OM3L 5JO5A 1DLHB 1J9CT 1I9RH 1QKZH 4X83A 2OMUB 3G5YB 4JUSA 1E4XI 3I50L 2HLFD 4XC3H 3VMPA 3UACA 4RA3A 3ZW3A 3ULVL 3D25A 2VE6A 3MODH 2WKOA 3K1KC 2CBPA 1D6VL 2JMRA 4MD5A 5AVZB 5J11B 4Z7UE 4MX7A 2UWEA 3BT2H 4BDVA 1UH2A 1KB5A 5MEOB 4RFEA 4KFMA 4QRQA 2EDBA 3T2NH 1M57B 1JSYA 3BE1H 35C8H 2YWZA 1KF9B 1A7PH 1YHPA 4ZMTA 3MV7E 5DJ6B 5IBUB 1F58L 2GJ6B 3Q2CA 2LU5A 4X9BA 1OAKL 3SOBH 3IT8D 4Y89A 3WNLA 1JIBA 5CGYD 5L2KA 1IB5A 1QHPA 3KCPB 2CBOA 4UNUA 1YJDL 3CH1B 1T6WA 2P26A 1ZPUA 5CCGE 1CXFA 25C8L 5HGBA 4WO4A 4XPHL 4MD4B 1EZVX 1E90A 4GH7B 1MFEL 1EAPB 2LW3A 3EOYG 5T5FH 3VGAC 4ETQA 5E0QA 4G1EB 1MJJB 2PYED 4FFZA 5EWIH 4R97B 5C0GB 5A2LH 2M83A 5BO0D 1XMEB 4U0QB 1MIEH 1BOYA 1J8HD 5IQLA 3B37A 1ONQB 1FZKA 1PY4A 1HAUA 4YE4L 5EU3B 3C6LD 4JHWL 1JE6A 4YFLI 2BSEA 1CD0A 2E86A 3PWPE 4XPFL 2WUCL 1QEWA 4XPBH 3ZOAA 4I77L 3GJFH 3EXJA 4UYQA 1GCYA 3APMA 3SBQA 2I9TA 4I7ZC 1UACL