3AZUA

X-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSQPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of the two site-specific mutants His35Gln and His35Leu of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
molecule keywords AZURIN
total genus 34
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1991-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3azuA00
3OMNB 1AG0A 2FQGA 5I5IA 3NJNA 3ZBMA 1N70A 3NYKA 4PAZA 1FA4A 2GIMA 1SFHA 2VSMB 2OJ1A 4KOBA 2YAMA 5B7MA 3QJSB 4E9TA 2Y1AA 3SBRA 1OCRB 3EF4A 3UACA 1W6WA 4YSOA 2IWEA 2VMJA 3NP4A 1EHKB 4JHUA 4A2FA 1CUOA 3T71A 4DP0X 4WKXA 3S3CB 1PMYA 4YSDA 3FSZA 2IAAC 4A2HA 1GY2A 1GW0A 2PPFA 4AKOA 4A68A 1A8ZA 3FSWA 3FT0A 2DYRB 5TK2A 3X1FA 2IDTA 2BP8B 3AW5A 3PXLA 3WI9A 1M56B 2XXFA 3N2JA 1JZEA 5FC9A 1R1CA 3X2QB 9PCYA 1CC3A 1ID2A 3FQ1A 3UADA 2XVBA 3H4HA 2JKWA 5LDUA 2I7OA 2VW6A 5F7AA 1IUZA 4YSUA 3PAVA 2FT6A 4KO5A 1A65A 4G71B 4E9RA 1AOZA 3X1GA 3CDZA 2OV0A 4A66A 3HB3B 2GSMB 1PLAA 1MG3C 3PPSA 1SJMA 2BO0A 4GP4B 5AKRA 4QLWA 1OOWA 1AACA 2UX7A 2ZOOA 3SBPA 5I6LA 2VSKB 4P5RA 4HIPA 1SF5A 4CSPA 2PP9A 2EILB 3V9EA 2J5WA 2CBPA 4DP8X 2EIKB 3D12B 1XB6A 1BQRA 1PNDA 3KW8A 4Q8BA 2XLLA 2H5UA 4N4YB 4E9XA 3FU7B 3WKPA 2IWFA 4HCGA 5F7BA 2IWKA 2BW5A 3X1BA 1OCOB 2BP8A 2XYBA 2HX8A 2Y69B 5B1AB 1KBVA 3T6VA 1ASPA 2N0MA 5B1KA 1KBWA 4YSSA 1IC0A 3NT0A 2PP7A 3OD3A 1CYWA 2UXVA 1TEGA 1AIZA 4E9WA 2FNWA 3N55A 4G70B 3TA4D 4DP4X 2HRGA 1AG6A 1KDJA 5PCYA 2AZUA 2BWDA 1E5YA 2ZWNA 4AI7A 1BQ5A 3NSDA 2X88A 1PAZA 1PZCA 2GBAA 2H47C 5I5JA 1ASQA 5I28A 3WG7B 2DWTA 1IBYA 4G7QB 4GYBA 4KNTA 5B1BB 4HCFA 3AG3B 1OCCB 4A67A 4ZK8A 1ASOA 2ZONA 5I6PA 2FWLB 3T6XA 4DP9X 1WAEA 2PP8A 3IBOA 2UX6A 1WA2X 2CJ3A 4G7SB 3NSCA 1KV7A 4GY4A 3UABA 2PCFA 1ILSA 1L9PA 5B3SB 4Q89A 2GC4C 1V54B 1E30A 3FYIB 2YAHA 3HEIB 1AS6A 2VN3A 2FT8A 2WSDA 5D4HA 1HFUA 4AX3A 2W88A 2RACA 2VM3A 2H3XC 2XV3A 3OMAB 4YSPA 2IH8A 2IDSA 1SHWA 1AZUA 1GS6X 2J56A 4JKNA 1ET5A 4DP5X 3ZIYA 1NIAA 4A2EA 4YVUA 4BWWA 4KO9A 3X1EA 3AY2A 1PLBA 2MTAA 1NPNA 2BZCA 2UXTA 4ENZA 4M4RB 1JVLA 3JTBA 3IEAA 4YSCA 5D4JA 1GSKA 1M57B 4L0PB 3S3BB 2QPEB 1JVOA 1MG2C 1WA1X 2UXGA 1A4AA 1AS8A 1AAJA 3PCYA 5IY5B 1PCSA 3NJFA 6PCYA 4BDVA 3FPYA 1AZRA 2XX0A 2UXFA 3T6ZA 1XB8A 2WO3B 2BWIA 4YL4A 3ABGA 1DZ0A 1KCBA 5E9NA 1A3ZA 4DPAX 1NTDA 1RCYA 4P5SA 2FT7A 2WO2B 2XX1A 3X1NA 2VW7A 3NJGA 1HAWA 4G7RB 3AG2B 1JZJA 1L9SA 2A3TA 2FQEA 1RKRA 1ADWA 8PAZA 4A2DA 5TK4A 4QKTA 2R7EB 2CCWA 4BK5C 2Q9OA 2QPDB 4AKPA 2XV2A 1GY1A 1FWXA 2YXWA 2GC7C 4AKQA 2XV0A 4GXFA 4AZUA 2BP0A 4A2GA 3TU6A 3BQVA 5AZUA 2XXGA 1NWPA 5B1JA 2CAKA 3S8GB 1JZGA 3FPXA 2TSAA 2FQDA 1HAUA 2EINB 3FU9A 1JXDA 3FU7A 3ERXA 3UAAA 2FTAA 2FJSA 1KYAA 5B7FA 3EHBB 4NB7A 1PZAA 2HZHA 4W9ZA 5I6NA 1IBZA 1BAWA 3GXUB 1AQ8A 1ETJA 1JOIA 3ASNB 3FYEB 4DP2X 1JXFA 3CVCA 3KW7A 3NJKA 1ZDSA 2GHZA 2DYSB 2GB2A 3TBCA 5I6MA 1ZPUA 2BHFA 1V55B 2BP0B 1ET7A 1ILUA 3CG8A 1J9TA 2XWZA 3BVDB 1JZHA 3CZUB 2VM4A 1MZYA 2AZAA 3IN0A 2X87A 1XB3A 4BWUA 4F7KA 3SQRA 1SFDA 2HRHA 3S3DB 5EHFA 2AVFA 1OCZB 3FSVA 1QHQA 1GS7A 1URIA 7PAZA 1XMEB 3T9WA 5AFAA 3PAZA 4WTQA 4RH4A 2NRDA 1WA0X 5I26A 1NDTA 1CURA 3QJRB 2IH9A 3FSAA 3PLYA 2XUWA 1SDDA 1DYZA 4UANA 1J5CA 3WNJA 1ZIAA 1V10A 1BXVA 1CYXA 1NZRA 4DP7X 1OV8A 4YSAA 1RZQA 4F2EA 3EH5B 1JZIA 4NAJA 4N8UA 3CVDA 5ANHA 4YSTA 2I7SA 3AZUA 2AANA 3DIVA 1NICA 2I85A 2DV6A 3WNIA 4HALA 5I6KA 3FQ2A 3ZDWA 1PZBA 1MZZA 3QJQB 2OCCB 2JFCA 1SF3A 3H4FA 3H56A 1PF3A 3G5WA 3DKHA 3DTUB 1UATA 1M9WA 1QLEB 4YSQA 1BQKA 2YQBA 3FS9A 4UAHA 1PNCA 2VW4A 4BDVB 1TKWA 2PPDA 1A4BA 2E86A 4DPCX 4HAKA 1W8EA 1NIFA 1AZCA 4NERA 1T5KA 3NJHA 2YAEA 1W6LA 2QDVA 4DP6X 1OE3A 1X9UA 3JT2A 4KO6A 4TXVB 2QDWA 1WS7A 4FAAB 4BXVA 2YXVA 2IDUA 4DPBX 1OE1A 1A4CA 3UAEA 4KOCA 1SDDB 2AFNA 2R7EA 1JXGA 3UGEA 2FQFA 2J57A 1AZNA 4W1TA 1N68A 3FQYA 4FA7B 1B3IA 5B7EA 2DY2A 5D4IA 1NWOA 3RYMA 3GYRA 3AG1B 3WKQA 2GI0A 1FFTB 4YVNA 1ET8A 1AS7A 3QJVB 1KGYE 1J9SA 1RZPA 2B08A 2YAQA 1I53A 1IKOP 4K9JA 2PPCA 4JHVA 3IN2A 2QT6A 3IE9A 4YSRA 1TU2A 2LLNA 3EH4B 4EF3A 1BEXA 4YSEA 2YAPA 4GP8B 4PCYA 7PCYA 4UF7C 4HHWA 2CALA 1L9OA 3V9CA 2HX9A 1NIDA 1SNRA 1NINA 4KNUA 2PPAA 3ZX1A 1JZFA 1E65A 4HHGA 2HXAA 2ZXWB 1NIEA 3GDCA 3U25A 2HX7A 1TEFA 3S8FB 3OMIB 4KO7A 1BXAA 3SBQA 4KNSA 1AR1B 1NIBA 1F56A 3MBWB 1MDAA 3WIAA 1BXUA 5A7EA 3T6WA 4HCIA 2J55A 2B3IA 1BYOA 4GP5B 2MRYA 4BXSV 1NPJA 3CDZB 4E9SA 5PAZA 2TSBA 3QQXA 1BYPA 1QNIA 1E67A 3MX0B 4X4KA 4G72B 1SHXA 2DWSA 2PLTA 2YARA 3OM3B 2CUAA 3QJTB 1OF0A 1AANA 2W8CA 3AG4B 1KCWA 2Q5BA 3ABLB 4MFHA 6PAZA 1J5DA 1ZDQA 1GYCA 3FU8A 3NJMA 3PAUA 1J9QA 1ZV2A 1X9RA 3CVBA 2IDQA 1GR7A 2YAOA 3OQRA 3QPKA 1VLXA 1EZLA 3NSYA 2BZ7A 3ASOB 3TBBA 3ABKB 4F2FA 2IDFA 4CSZA 1PLCA 2BW4A 1KDIA 3EH3B 1L9QA 1L9TA 3NJIA 3NP3A 1E5ZA 3NSFA 2P80D 4BWTA 2PCYA 3NJLA 1ZIBA 2EIJB 1GS8A 1J9RA 4HZ1A 1PY0A 1AZBA 2PPEA 3QJUB 5I6OA 4M3HA 4E9YA 1JERA 2EIMB 5I5MA 4DP1X 4E9VA 2P80A 5B1JC 4E9QA 2HLEB 3ABMB 2XU9A 2YAFA 3NJJA 3L45A 3TASA 1OE2A 3C75A 1WS8A 2JXMA 1YLBB 1L9RA
chains in the Genus database with same CATH superfamily
3MJ9L 3HVDA 3SBWA 1HZKA 2A2QT 3LXCA 4BUQA 1ZGLA 3BIKA 2F19H 3QI9D 4I9WE 3AJ7A 3OGCB 3Q6GL 3CXHJ 5B21A 4EIUA 5GZOA 1MQKL 2DDQH 4GEJA 3VXNB 4DKFH 5D1QB 3SZ6A 1UKSA 2ZOKB 4L1DA 4S2SB 1YAZA 4JHWH 1F4WL 1DE4B 3UBHA 4Q9CA 2VC2B 1EHKB 2K3HA 3MYZA 4NT6B 4YGVB 4MHHI 1FNLA 1FLRL 2XKUA 5HHME 3VFPB 2G75B 1P84J 2GITA 4YSDA 5L0QB 1AGDA 1EUUA 1F3JA 2P8PA 1D9KD 4LPUA 5TE4H 1HHJB 4YR6A 1EMTL 1DUZB 5E03A 5D2NE 3GBML 3GMOA 3L3DB 4D0BB 2DYRB 4BEIA 4I13B 3ZHDA 1K5NA 3PXLA 1M56B 2OMVB 4WNSA 3HAEB 4DETA 4XB3A 2EE3A 5LNEA 5J5EA 2EQDA 5GGTH 4DT2A 4X9IA 4IS6B 3VXSE 9PCYA 3IDUA 4WI6A 5BV7L 1JHTA 4GRWH 1HHHB 1FVEA 3OXSA 1U8QB 5E8OA 1BLNA 4ZUUB 2OL3B 5EZIL 2A6DB 4QIRA 1AZVA 12E8H 2DQTH 5ADOH 2D0HA 4WU5A 3RGBA 1JS4A 2Y9RT 3AM8C 1XBDA 2HT4D 3OC5A 2WCGA 4XPHH 1QSVA 4XBEH 3X1GA 3ESVF 1B3JA 4GO8A 3ULVH 2Z8RA 4MDRA 4N28A 4A66A 4DGYL 2Z34A 4P48A 1JN6B 2WLIA 4E42B 4U1GB 1R4XA 1RZKC 3TLRA 4WFHD 1R3LA 3KYNA 1CGVA 4K71B 4P5RA 4LESA 4U1HA 4HJTA 2W80C 5MI0B 3B9KC 4YXKL 4ERSL 2K7QA 5B1CA 4KHXH 1JPEA 2FIRT 5F6HI 1Z3GL 4WI9A 1T4WA 4Q8BA 4UV7H 4F80A 2E7LC 4N8CH 4NQDB 2HH0L 3RRQA 2WV3A 5IB1B 4QRRE 4ZFFA 2OYLA 2UZPA 3ARYA 3VTMA 4KQ3L 5BO0D 1AE6L 3IE4A 4DO4A 4AXWA 3UG4A 1N0LB 4XNXL 1NL0H 1AD0B 2Y69B 2EH8H 3ZO9A 4HH9B 1OLZA 3C87A 5BW7A 4K71C 3VM7A 1R0AL 4OZIE 4L37A 1FL3B 2C7UB 2NUPA 1IC0A 1Q9WB 3UYRL 3LKRA 1HN1A 1S7SA 2IXQB 4K23H 5CCHE 3F6JA 4JFVA 5DLMH 1FG9C 1CLYH 3KPSE 4G70B 5CEYA 3O3BB 3UIYA 4RDQF 1E5YA 4XP4L 1E4XH 4AI7A 1BQ5A 5D7IF 2CUIA 4BBWA 2R1YA 1M2VA 1TTUA 5B3JF 4XRCA 2FB4H 1KIQA 1OAZL 1F1DA 2APSA 4ZK8A 1THCA 3KLAB 4X4XB 3ZZSA 4HF5L 2PYEB 1NMBL 2EYTB 1D5MB 1R3KB 3CXHK 1LP9F 4G7SB 4OIBA 3ZLQC 3QUYC 3O2DA 2PCFA 3BKYL 3UABA 1JFQH 2JB6A 3VFUA 4DK6A 3W81A 1VCAA 4L8BA 1AS6A 3L3GB 3QEUA 4NKMA 2IADB 4TPRH 3IPEA 2W9LA 1FUNA 2D0FA 2BJML 1Q9OB 3LKOB 5L0QC 2X41A 4JPIA 5DHVB 4C55A 1PLGH 2Z91B 3VJ6A 2R69H 2ITCB 4IMKC 3A6CH 4ZNCD 1A1NB 4MB4A 2AP2A 2C7FA 4FHBD 1H6EA 2GFBA 1B9ZA 5LWYL 2WJ7A 4PS4L 3SDAB 1IGCH 2X89D 3HBQA 2MTAA 3FXIC 2I07A 2BSSA 2WXIA 2LU5A 5F7DA 1U8HB 1T1XA 3REWB 3FCUB 4R7DB 3CAFA 1SEQL 4JPVL 3X12B 5FYLD 1E2WA 4WUUE 3MLWH 3QRGL 4JFFE 1WUNT 1JV5A 3EBHA 4YH6A 2VR7A 1SDAB 3QUXB 4XMLH 3B9KB 4L4TE 5BZZA 3BKMH 3HN5A 4G6ML 1UC6A 1RZJL 5IFAL 3MHZA 4NC0B 3WLWC 1F11B 2QR0B 3HIZA 4U1GC 5IFHL 4YIQB 3D2UA 3VFVA 3UBXB 3BWAB 1BZ8A 3BVNA 1RKRA 1CL7I 1LO5B 4FXGA 3ARXA 2CHZA 4Y0GA 3LB6D 4LLQA 1NC4D 3E8UL 4P2OA 5KVMC 4Y4HA 4QHLB 1WZKA 2WQ8A 3V4VH 2V5YA 2WMPB 2XIIA 4ZX4A 4KZDH 4CW1B 3NA9H 3RDJA 1YN7A 1HCVA 1HNFA 2G9KA 1NCJA 5DYOA 5LNGA 3F7PC 2BP0A 3LZPA 4HUCA 2HRLA 1QZNA 4U7MA 4TL5A 5HI3D 3MV9D 1DVZA 4N6RA 3BQUD 3TA3D 2WBJD 5DRWB 1I3RA 5J9PB 3VWJD 3N06B 5AAWC 1EA9C 2CLZB 3P73B 2H1LM 1P4BH 3T77B 1OWWA 1KYAA 1BAFH 3POHA 3H42L 3AS2A 3N41F 2DQEL 4TSAL 3ZYIA 3QRBA 3DSFL 4LT7A 3P54A 3WTYA 3KW7A 3NA9L 3NAAH 2FD6H 5IBUG 2A6JB 4HJGB 5DEFB 2ZCZA 4IRJD 1UZ8A 2W0FB 2P43B 1XX9C 1NGQL 4J6IA 5IZ7A 5E6IC 1GIGL 2OAAA 5DS1A 3MNWB 1VHPA 2D3VA 1KJMA 1CGXA 4M7ZC 3W1ZA 3L5HA 2YPKA 5HDBE 5ISZD 3L2NA 4GUCA 1ZLUK 4NBXB 2DQGH 4I8DA 4KZ0A 2QADD 3BAKA 1N59B 1YHPA 1IEBB 1T21A 1XWVA 4M1DL 5AFAA 4APQD 4J3TA 9CGTA 2BVTA 1XGTB 5MEPA 5ICXB 3K2UL 1KBBA 3NH7L 1O75A 2NY7L 3P0GB 4PVLA 2FH6A 4TV3A 5I26A 2Q86B 5BCAA 3L3IA 5CEXA 3QPQD 3MCKB 4O02A 2MIZA 3AXLA 2DIJA 5FYKU 3R0MA 1QUPA 1BWWA 1LQBC 4DK3A 5GZOD 1FNHA 3ZVVA 1W0VB 1NZRA 4DP7X 1M7UA 2EKSB 5TJWK 1A6PA 3FTGA 5JHDE 1QLRA 4NHUA 3P4OB 2AJUL 4MDIB 2Y36H 5E0FA 5GS0L 3T5WA 3CVHH 4H20L 2CK0L 3FO1B 1AGBB 3HZMA 4JKLA 4YDLC 5F1IB 4B3EA 1XH3A 3K72A 4ORZC 4KKLD 3L9YA 4BH8B 3JTSB 4JFYA 1PZSA 5SWSE 4WZ9A 1YMMB 4I87A 5HYSA 1MLBB 3VXRD 1JNHB 4MMXA 4N0YH 4NSKA 4AQEA 5IQNA 2JFCA 3HI5H 1BM3L 3H4FA 5IJVB 2WLHA 3MUHL 3GNMH 3PHSA 3QEGH 1ZA3B 4JRYD 1T0NB 4JREC 4H25B 1EZSA 3IJ8A 2R51A 5TDOB 2F7RA 1UASA 3UTZB 5EEZA 1S9WB 1SYVB 2YD7A 3GIVA 3NZ8A 2ADJA 4L1LA 3HNSH 4HIHA 2AJZB 5SV3A 1NIFA 3DXAB 3GZQA 3EDDA 1S9KC 5HBBA 1TJIL 2R8SH 3JT2A 4IM8A 4QJ5B 1H6TA 5DHDA 3E1ZA 2BS8A 2YXVA 2LLGA 4L4TB 3FFCB 4PJGB 1T0OA 3UTSD 2YJLA 5CBAA 5DLML 3ARFA 3APDA 4EOWL 4FFWD 5EOTB 2AK4A 1LO2L 1Z5LB 4X5QA 3C5JA 4WV1C 1V3JA 3QIBB 3U30B 4GMTL 4NRXA 5D1QD 2OQJA 5MENE 1TFHA 3MRDA 3MRRB 4X7SH 5EWIL 5I75B 1C7TA 1TCRB 5CFHA 3IXAB 1LP9A 5F7NC 5HJBA 1FC2D 1ACXA 1B0RA 3Q06A 3BKCL 1CJYA 1KB5A 3T1FB 3Q48A 3NIGF 3T65B 43C9B 1RZPA 4XN7A 3RWGB 1DBAL 5CP3H 1KXQA 1TQCC 5EN2A 3CSPA 4PRBB 1JZ7A 1HQRB 5E51A 5EUKB 1JGUL 5ID1B 4YSEA 1E8YA 3AS3A 4XMUA 3VCLB 2CR6A 3HC3L 2QKIA 4BZ2A 4KJQD 4AYGA 2AQ2A 3TX4A 1M7IA 4YZFF 3OSKA 2ETWA 2YUZA 4PM1A 2B14A 1NINA 1YNTB 3U7WL 3K6IA 3K2IA 2WNKA 3G7TA 1F00I 3V6FA 1CDBA 3GDCA 2W81C 4PJAE 1N5AA 4GKSA 1AYRA 2OMYA 3OMIB 4TM9A 1U8CA 2AKRB 4XB7A 3RVUD 4PJAF 1AD9B 1EAPB 1U6AL 2EDXA 1WFMA 3BVUA 4GKOA 5FK9B 2JIXB 1F2QA 4MNGB 1KXVC 3LEXB 3QW9A 3U1PA 4HIXL 2P3YA 3CDZB 1DVFD 3LIZH 1BYPA 1BFTA 3MX0B 1LO0L 4KUCD 1SHXA 1MCWW 2L7QA 5FGCB 4W9IC 3WS3A 3F62A 1G9NH 3CC5B 1U3ZA 4MLIA 2YGNA 3CX5J 4ZSOE 5E6ZA 5HYQB 1KCWA 4ILDA 3KDMA 1C08B 4TVSa 1IAKA 5C9JA 2CDEA 3QUZC 4WI0B 1LK3H 2BIOA 3MREA 2MQ0A 1J9QA 2DLFL 5HDRA 4NQDD 1TO5A 2AQQA 2OPCA 2D7MA 1GJIA 2YBRA 1D5ZA 1CQKA 2VLJD 1NCWH 2R2EB 2WWMD 3K6SA 2F7QA 1A14L 2IDFA 2B4CL 2M8XA 4G6FD 1IRAY 4TTDD 3WHXB 1LM8V 2ED6A 1TVDA 3DROA 4YBQD 3ROOA 1A6AB 1OVZA 3P0YH 1RUKH 2OYMA 1Q0YH 4JHWL 4LSUH 1XGPB 4LSPH 3WLBA 3L5WA 1DVQA 5LGJB 4MD0A 3GSRA 4TVPE 3RWDB 4IDLA 1CXEA 1V8HA 1E2ZA 1T89A 2A9BA 2PPEA 3R19A 5E1GA 4J3SA 5FPIA 3S2CA 1P7QA 5F7FA 3F7QA 4AT6B 5I5MA 3GSWA 4W70A 1T2QH 2V9RA 2FO1A 2VXQH 4YXHH 3FT2B 8FABA 1R47A 3CXDH 5C0NC 3EYQD 1OE2A 3QNZB 4DKAA 4Y4KD 1RUQH 32C2B 5IUCA 5KG9A 5GHWH 2FQGA 3VQ1C 5BS0B 1IVTA 4XP9H 4N1CA 5KAQF 3NFSH 4PRHB 1KPUA 5C0GA 3WYRA 1WYJA 1F4XH 1FZMB 1X4XA 4Y4HD 3VD0A 5DMKA 5E1AB 1GYUA 3VH8B 1SVBA 1JMZA 2W0LA 1NGWA 4I88A 3D85D 3TV3L 1Q94A 4P4KB 5I76B 4MMZC 1PQZA 3GB7B 4H8WL 5DJZA 1NEZG 2RH0A 4A2FA 1PIFA 1I9RL 1UGKA 1QZ1A 4HIEA 3UTQA 1CDJA 1FZKA 4WW1B 3EDEA 4EBQL 3ZE1B 4X7TA 4ZO8A 5FIEA 5DUMH 5GGSY 1I9JL 3P9LA 4HHAB 5AVVB 4HJUA 1CK0H 3MUZ1 4Z5RA 3LKPB 3O9WC 4R2GC 1QO3B 4P2YA 3WY2A 4U05A 1A6ZB 2YA0A 1HJBC 3FSWA 1ZTXL 2XQBH 3T6QC 4L2LA 2OR8A 4FXKA 2VDOB 2JLPA 5HHMD 2J8UA 5DJYB 3P30L 4C58B 3PL6B 4HT1L 1MCDA 3ZO0A 1BAFL 1QUNB 1R1CA 4QOKA 5IP4A 3MRCB 1B0IA 5AALA 2PYFA 2V17H 2JKWA 2R56L 4K9EC 1I4FB 4RISL 5D8JH 4GRLA 5GRZA 2Z4QB 4PJBE 1OSZA 1E27A 4P05A 2OJEA 1RZ8A 1YEEH 1AXTL 1UWGL 2WM0A 3RA7H 1U6AH 4PQXA 1ACZA 3SE8H 4F58H 1T1ZB 3X14B 5C0CA 4FQHA 4AQZA 3TBSB 1OP5K 4H5SA 2EIDA 1EHNA 3F85A 5DD5H 3MLRL 3PWLB 3QH3B 1EAOA 1X5XA 5GISH 2ZOOA 4ONGH 5HHVL 4Z7QB 3ETBF 3MA7A 4BZ1H 1KJVB 3CHRA 4E68A 5DJ2A 3ARDC 4LOVA 5KYUA 3H7BA 3HFFA 2FX8H 5EU6D 1NCCH 1RZJH 3AACA 2YA2A 2MQGA 4YLCA 4DO5A 3L4YA 1WP6A 5TDPB 2ATPA 1AO7E 2CGYA 2JK5B 2W07A 4FFTA 3HS8A 1ZWIB 4FP8L 3U6XS 2QQNH 2XWJB 3BEWA 3EJYC 1HXMB 4JO2L 2XYBA 2FLMA 1MI5B 3DGGB 3MTRA 4AGNA 4KKQA 1I3GL 2C34A 1SOQA 4UOW0 1KBVA 3PV6A 5ESQA 1HCZA 2YO3A 2NXZC 5GGVL 3V10A 1OTUD 2ZSWA 1NFDE 1KACB 4HX1B 2YD1A 4PCTA 1JWUA 4J5VA 1PEZA 1KDJA 5EORL 4EPSA 4ODHH 5AD0A 2W9DH 2YGPA 1AHWA 2F74A 5I5JA 1DJYA 1OGAB 4R4ND 1FDLL 3UYPB 3I6KA 1DLFH 4HCFA 2XA3A 4A67A 3AFLA 3F6IA 4ZW8A 2OP4H 3BCFA 3HNSL 2FSEB 4N2BA 4ZXBD 5MEOB 5EBLA 1AP2A 2XN1A 1YY9C 4DUWA 3UC2A 3ARGD 2Q7YB 5IMKB 2YZ8A 1A7NL 1MUJA 1DEEB 1V54B 3QDME 1FHGA 2H0EA 4NRZB 4PR5A 4UDUB 5I24A 3QIUA 1YEJL 2B39A 5F9WC 5C09A 2EZ0D 4GOSA 1HFUA 4N9OB 4BCXA 4UM9A 1R3IH 3ELAT 1PW3A 3WKMH 3DXAE 4F3FB 2X4OB 4HS8H 1GCYA 2AJXL 3SDDD 1UJ3B 2VLKE 1Y18B 3SD2A 1BJMA 5I2IA 4R0LC 3T3MB 4A2EA 4PJFF 4I48B 3GIZH 4HV8B 4Q6IA 3CX2A 5FAAA 2H7WA 3DETC 3FDWA 1NOLA 1U3HD 1TNNA 4P23A 4PJHE 4DGVL 5J0BA 2VDOL 2FCBA 1R0AH 4HIIA 1UXWB 1RJLA 3QUKB 3IPFA 1HJCA 4U1NB 4AJVA 2RTTA 1IEHA 4Y1AE 1A4AA 3RBGA 2EYSA 3BLBA 4NFCA 1BFOB 3PCYA 1LK2A 3GUTA 1J18A 2EECA 2IQAA 1LEKA 2YC1B 1CL7H 2DH3A 5GGQL 2HH0H 4PMEA 1DQDL 3TH2T 1QFUH 4CVXA 2V17L 4G5ZL 1DANU 3UH8A 3TF7C 2NY3D 1KBKA 3ESUF 2EYRB 3O4LE 3AG2B 3G5XB 1I1YB 3ZYOA 4F20A 2X2YA 3WN5C 3SDDC 3P77B 3Q5OA 3ARTA 5C92A 1ZTXH 2XQBL 4OV5B 3OAWA 4TRPL 4PTTA 1QFWI 2Q6WB 3L13A 4ZMZA 3TZVC 5DRXA 3VI4E 2R2BA 3GBNH 5ALBH 1NUFA 4XOAA 2HFGL 4YDJA 3SJVE 1GY1A 4P46D 5G55A 2XV0A 2G5BA 4PS4H 3SHSA 3FO2A 3M45A 3VWKD 3TIEB 4RGMB 3H2PA 3QEGL 1L6XA 3A6CL 4HKXB 5CBEA 4H8WH 1MVFA 4AG4H 1DBML 4N0UE 5GGUA 4OFVA 1KB9J 1ZY9A 2XOTA 4FQJH 4UQIM 4MS8C 4EDWH 2KZWA 3T4YA 4X9BA 3DPDA 5DRZA 1JZ5A 2F5AL 2X9ZA 1M05A 2G9HB 4KRNA 4ZZFA 4IOSD 1MHCA 1HHIA 4X9FA 3W2DL 2HT3C 2JE8A 3UG5A 1BZEA 2NMSA 4UQ2B 2F54B 5A1AA 5F3HA 3SDDB 4AEFA 2F8XC 2W65B 3UDWA 2HN7B 1A3QA 4QF1B 4Y8DC 3I9PA 5CILH 5AVRB 4WVRA 5CINH 1IM9A 1KENH 3DIFA 3D0AA 3UBGA 5DTFB 1MZYA 2ADIB 2AZAA 4AYSA 1XL6A 3PGDB 4H8VA 3L2LA 4PJDA 4OLWH 4RNRB 1R5WB 4G6MH 1QHQA 3KYMB 4Y4KC 4JM2F 5LVEA 5GS3A 2NRDA 4UIMB 2AXFA 5F9DC 1MCIA 1M1XB 1OB1B 2X3BA 3Q2VA 5KN5B 3IJ9A 3QRGH 4HPHA 1PY9A 1E4WH 4F7MA 1Y6KR 1RUKL 2P7TB 1ZS8B 3FL7A 3SQOH 4IU3B 3GHBH 2H2PC 2ATAA 1MWAL 1CXHA 1YAIA 1RZQA 4M00A 2D9CA 1NCTA 4RIRA 4MAUL 1JPFA 1BD2D 2VDQH 1JRHH 4FNQA 4IEFB 2FD6L 2O5YL 2Z4TA 5DDHB 4B0MM 4ZMWA 3GSNB 2DH2A 2ZYHA 2PWDA 1Z3GH 3IDMA 4FQQB 2Y25A 1KYUA 1PZBA 3OR6A 5ICZB 4U1KA 2VLJA 2K4AA 3BAIA 4Z3HA 5ISZE 5CU9A 2ZOLB 1ETZB 2LU4A 3CFJB 2VJXA 1NBZB 1BM7A 1WIPA 1Z7JA 4GBXD 4UTBH 3T09A 5LQBL 3SKOB 4ISVA 1HDMB 1CD1B 2VQTA 1GA2A 3QK0A 4KVPA 4JQIH 1NMBH 1DDTA 1KG0A 2CLVA 4FKEA 3BN9C 4GRWF 4CVZB 4Q9RL 4HSCX 3QZMA 2E7MA 4U1IA 5JIKA 3OXRB 2E3VA 3DYPA 3NEOA 4IJ3C 2WAHA 3GSVA 5JPNC 4BXVA 4CSSA 1S9XB 2J6EL 4BZYA 5AKVA 2IDUA 4OW6A 5KANG 5C0CD 1BW8A 4JDVB 3N1FC 3STLA 1S78D 1XEDA 1J1XH 5T3ZD 2HP4A 3SPIA 2EE2A 3GI9H 5CJ8A 1WFTA 5ALCH 3ARZA 3FNKA 5F97E 5ITFA 4ATWA 2XN9B 1CG9B 4RSVA 5KVEL 5JZ7D 2HPTA 3TT1H 3WY3A 3P4NA 1HH6B 5I9QC 4XTRD 2GI0A 4PV8B 1XF4B 3SDXB 4N90D 2GJPA 3GLDA 3IF1A 1K72A 5C0IA 1EFXD 1H0DA 2WIMA 1FNSL 3VGBA 1UG9A 3ULAB 4OY9A 3O4LD 1PTZA 1ZHNA 2CDGB 3MBWA 4UV7L 4ZTEA 3TTSA 3EYQC 5C9KA 5I16A 3M17B 4BHUA 5KVGH 4JG1L 3FCSB 4U2ZA 5JHDB 3O6LH 2HFEA 4MXWH 5JDSA 5KAQG 4UUJA 5IIEA 1GTFA 3BZ5A 4KDTC 1ECZA 1S6NA 3WKML 4BGDA 1AKJA 2QLVB 4UT6A 1BJ8A 1H3VA 2X4SB 4ZFGH 4KGJA 4JCLA 3HJ0A 4MB5A 4LGRB 3UTSB 3S8FB 1CFQA 4KO7A 1CDYA 3IWVA 3B4NA 1ED3A 4FLSA 4G42A 3QAZC 2VOTA 4WEBL 1B0WA 2CA4A 2IF7A 3PFUA 5JLZB 1J1PL 1BYNA 2XI9A 1MJUL 1BM3H 2NY5L 2Z65C 3KPLB 3P2TA 4GRLD 2WSPA 4FI7A 4PGEB 4UOQA 4E9SA 1P6AB 3EYUH 1RAMA 4JK0D 4Y9BA 2Q87A 1TJXA 1N8ZA 2X0UA 2YOAA 1KF9B 3OM3B 1WZAA 1FV1B 1OF0A 2VQUA 3O6KH 3GUFA 2X40A 5L2JA 3QQDA 4XP4H 1E3FA 2VN6A 5CP3A 1M2OA 2JKIS 2ESVB 4NNYB 4WO0A 5D7LA 5IREA 5HHXL 5IB2B 4I3RL 5D4QA 3QWOA 2DMCA 1ZHLA 4KNQA 4J2QA 4PLOB 4R96B 2QSQA 4Z7WB 4ZQTA 3IU4H 1SUJA 3QFJB 2GJRA 4ZPTA 2NY4D 3H9SA 2CE6A 4XPGH 3F7VB 3K6FA 3EGSA 3SE9L 4YDNA 3LV3A 1OK8A 4PCSA 1W80A 3FUHA 4NKDB 2VRQA 3RWHB 5L2KE 3NJIA 3WY1A 5JYLA 3CTTA 1DE4A 2XZQH 4QGYA 3L3OC 2J8UE 2A6KB 5DI8A 1MNNA 1U21A 4M6OH 4UIKH 3BRGC 2FWOB 1J9RA 1O7VA 2TRHA 3DTDA 4UTAA 1OAYH 1MCQA 2G0LA 2BH0A 2DQGL 3GJEB 1D9KA 1DZBA 2X53A 3V5HB 4BYHA 2DTSA 4GKNA 2Z31A 4XNYL 4L4VB 3SKMA 4PRIB 4E41B 2Y72A 1X7QA 3LRSB 3L3DA 1EAQA 4XVOA 3ZMRA 1ZMYA 1KCKA 4A2LA 4G80A 3GTNA 3C75A 3GTTA 4O2EA 4YLQT 4A7GF 1AKPA 5F8RC 5CJQH 5CCJA 3NMEA 5F7WC 2AV1A 3LRHA 2OL3A 3L48A 4OLZL 4ADGA 3LRGA 2OJ1A 4G8FA 2DJ4A 1KZYA 3H2WA 2G3XA 4X83A 3GSQA 5DJ8A 2ZG1A 2FGWL 3QDJE 3QEHB 5K39A 3EF4A 3ZE0B 1N6UA 2VDPL 5IWLA 2ID5A 1YNLH 4MAYC 2RMNA 4P5KB 2V37A 1UACH 3C2SA 1C5DB 1G7HB 2L0DA 1L0YA 4D9RE 3ZDXF 1FP5A 4L4VD 3HPJA 3ZDXB 5J6HB 1ZCRA 3C6EA 1AH1A 3Q9PA 4I5BB 4UMSA 5DFTA 5CJXC 5TE7H 3IDYB 3US9A 1P0SE 4CAGA 3OAYK 3LQAH 1PZ5B 4JO1H 1HL8A 4WSGA 4QWWC 5A40E 3KPRA 2HTLC 4DGIL 1MFDL 1U8MA 1J87A 4J8RB 2X7LB 5AZ2L 3TWYA 2BHZA 1FZOA 4OIAA 3AGVA 1QLEL 4K8RC 2WP3T 5J1SC 3U9PH 5D5MF 3X2QB 2M26A 4ETYA 1CC3A 2GUOA 1PZUB 3O8XC 1ES0B 3BP4B 2NUTA 1IBFA 1WZ1L 1G4RA 1IBHA 3VRLF 3Q8EA 1B2WH 2ZWLT 3DA0A 3EDJA 3G5VB 3NCWA 4Y2DB 2K70A 4PJFB 1XR8A 3LB6C 4XPAH 2FT6A 4HWEH 2A7BA 4H2AA 4NCC2 1D5XA 5GIRA 3PWPD 2ICWB 3S3JA 2X5PA 1E6OL 3WD5H 3I85A 4MNGE 2LU3A 4XOBA 5BPPA 4OLEA 4P23C 4GJTB 2Y7SA 2P45B 4PVNA 4QD2E 3KBEA 5HY9A 3HS0B 4WTXA 4KRMB 5JORB 1TTRA 1V7ML 4K7PY 1HVXA 4HD5A 2OMTB 1AZZC 2G5RA 4S1SL 4ELMF 1GXEA 4DP8X 2I27N 3D12B 1AIFB 2VN7A 3HE6D 5EDXA 2OXHB 3B9EA 4ONHB 1F6LL 1WTLA 4M7KL 1IL1A 1FH5H 4KDWA 1NCAL 1P5UA 2BDNH 4Z7WF 4MA7H 1MFMA 2PCFB 3I50L 3O2WL 5I75C 1A9EA 4HCGA 3E3QE 3B7YA 3BP6B 4LLMB 3LQMA 1OCOB 5BS0D 4L8BB 1NFIA 2YZ1A 1O0VA 2ZG2A 4WWKB 1S7UA 3T4AA 2YLHA 1A7OL 3CDGB 4JKMA 3ZOAA 5I1IH 5CJXA 5E99L 1V7NL 1THAA 1PCXA 2BSTB 2JQAA 3K8MA 4JPWL 5LGHH 1S7XA 5B3NA 3SEPA 3V4PL 2AK1L 3ZY7A 5LCVA 2I5YH 1WC7B 4CMHC 1BPVA 4FQ1L 2HMIC 1DQLH 4TVPL 4RWYL 1UCBL 4LQ1A 2EXSA 1IBGH 2EDNA 4EVNA 1YEIL 5D2LE 1AHWC 2GBAA 4PUBH 4QXUH 4XNQA 2PYED 1NLBH 1T2XA 5GZOC 4AC4A 3WFDL 4UOZA 3RFZA 1TLKA 3F84A 2J25A 3KL3A 1GZQB 1QPXA 1BZ7B 1OLLA 3T3MF 2KH2B 1MW1A 2CZNA 3MMEB 1MPAH 5DD6B 5TDNB 3WTUA 3OMZA 4YGAB 2QV2A 5D1XC 3FCTA 1YZZA 2E7BA 3FQWA 4GAGH 2ZX7A 3RPKA 2A38A 1T1YA 5FECA 5D1ZB 1FORL 3GEFA 4ODVH 5IBUB 3MBXL 3NCBB 5KSBF 4F8LA 1E3ZA 3WFDH 4JDZB 4AY0A 2H3XC 3DHPA 4NQCD 5DK2B 3OMAB 1FE8H 4XMPL 3UBXA 1JYNA 1LE9A 1N10A 1YEKH 5EPMA 3IRCA 1OTSC 2H4EA 4IMLB 4GQQA 4MBOA 4P2OB 3ZIYA 4EI5C 3SDCC 4OZHF 4QHLA 3I74A 3T0EA 4FOMA 3HNVL 4YVUA 3AREC 2Z92B 3P0VL 1PLBA 2RB8A 4C59B 5A2BA 2BP3A 3DJSA 4IIQC 5IJKA 4H1LH 2D7TL 4BJLA 2IV8A 4XCNA 1NCNA 2YPLB 1IAIH 2ATKB 2D03L 4RRPA 4PJDE 2UXGA 4XPHL 1X3DA 1MRCL 4XVJL 5G5DB 3U46B 5AB1A 1H9VA 1JXKA 1UWFA 4FFVC 4Z7UF 4Z7UB 4BDVA 2OYKA 3A47A 7CGTA 4RMSA 2QFRA 4OGYH 3JWDL 3L6FA 5AAMC 3UTTB 3OAUL 3VRIB 4DUXA 3WNKA 4G8GB 2WVTA 4ZTOL 2WXGA 4C4KO 1TOXA 2A6JA 3MACL 3P9MB 4HJGA 5FFOA 1ZANL 1JZJA 2VZTA 4JPQA 4WQOA 5K1JA 3JT0A 1ADWA 1BVNT 1YDPB 3QJFA 4X9GA 3MNMA 2Y0SA 2VB5A 2YMTA 2K8QA 3D39D 3KYKH 5ERWB 3OKDB 3WD5L 3ZKQD 2AEIT 3S2AA 5FYJH 1IQWH 1HSBA 2R0WL 4FI6A 3EG9B 2F15A 1JF1B 3LNHA 5C7XL 3I6SA 1QQDB 1M6OB 3QQ3A 5JOPE 1HXYA 2HTKD 4FFVD 1CD0A 2P8MA 1B2WL 4M43L 2HKFH 3IJ7A 1HAUA 1JXDA 1MCHA 1XCTA 2W60A 2AERT 5CN1A 3MCKA 5HDQH 5B7FA 1MRFH 4GB9A 1S2EA 4LP8A 4RAVA 4UZSA 5FYJL 1SLUA 2E0PA 4PY8J 3MRNB 4L05A 4DGIH 2J21A 3C6LA 4HBCL 4WFEE 1F4HA 3DUUB 4GG8B 2FIKA 3MLSL 1ILUA 5I1AB 3MRKA 4R7LA 4NQXB 2G60L 2KMWA 1JZHA 2AJ3B 1HNYA 1N7ML 3CZUB 5HHOA 3KHOA 2CXGA 2Q3AA 2NTSP 4TOYL 3BPLC 4LSRH 1E43A 2OULB 4XP6L 2W5PA 3R1GH 1Y0LA 1AKJD 2EVHA 1PX8A 2WP3O 4TSBH 4DQAA 3HCVA 4JRYA 1TQBB 1XR9B 1U3HB 4PJBB 4B9PA 1GTNA 2OTUA 2XFXB 3ARGA 3ML8A 4S1SH 3WXVL 4ZMPA 2R1WB 5A2LH 4L29A 1ROCA 4KROD 4BFIA 1JMXA 1S9WA 1SYVA 3QUMB 2B0SH 3UGUA 4RESB 1QAWA 2XUWA 2AEQH 4GW1B 5BNXD 3B1TA 4MXVF 1J5CA 3FQUA 4J1UB 3PWUB 1QABA 1CI5A 2BVEA 4MYPA 5KS9F 4XO5A 2YGQA 4ZW3A 5CM1A 1C16B 3CGTA 1FNGB 3TIDB 4F15B 1LVEA 1UOKA 2BY0A 3CNKA 2XSKA 5DJDB 3QDMA 2WQSA 4NN6C 2P5EB 2PABA 3NRFA 3RNKA 1L4IA 1F90H 1NICA 1TYRA 2YEZB 4MAYA 2DV6A 4XMPH 4OJEH 5DYFA 4HALA 3S5ZA 5I71B 4X9YA 5FB8B 2DB8A 4UIKL 3C9NB 5K1VA 2V2XB 5IK3A 1AXSA 3D07A 3RAJL 3L4VA 3T08A 2UWEF 2H6UA 3TH3T 5IB5A 1QMUA 1U8LB 1NKGA 1G94A 4JRXD 3BAWA 3NTCL 5B22A 4H26A 4L3EA 3F5WB 3MNVB 1MJJB 3BVXA 3U0PB 4YSQA 1BQKA 3IVKA 3FS9A 3UJJH 1PNCA 3D34A 2N4IA 1TKWA 1ZT7B 3CD4A 3GXMA 4E41D 4LP5A 4N2FA 4DPCX 3HG0A 2DI8A 3IU4L 1OHZA 2AJYL 3S35L 4NERA 2P28B 2R23A 4B3VA 5HHXH 4OQTL 3WDJA 3LYRA 4FULA 4IMKA 4WEMB 5KJ7E 3INOA 2QDWA 3TO4A 5JW4M 1FO0L 5LJYH 1D9KC 4LQFL 4MJIA 2N01B 4P06A 3RZCD 3FUJA 2VKXA 5HD8D 3OAZK 2JTYA 2I5YL 4DEUA 4S1RH 5D70L 2NR6A 4NO0A 1AQDB 1AZNA 1NANH 1CFBA 4JPWH 5LGHL 3OGOE 3C8KA 3DX4A 3V6OA 3QC6X 3V0WH 3RVTC 4YX2L 4M8VA 1NEZB 3MV01 1R46A 4OLXL 3PWPB 3MLWL 4YVNA 3ZHLA 4MD5A 3AGWA 5E56A 1Q1JH 2UWEA 3APFA 3BUTA 3BZ4B 3RX7A 4F24A 2J71A 1H19A 4A2MA 3OSVA 5EBMB 3O8XD 1KGYE 1DFXA 4LCIH 5TGBB 2ZJSL 4LDCA 4LEXL 1KT2A 4E5XG 1WBXB 3DWTA 5CMAA 5JXAH 3L3JB 2VT0A 4MJ4A 3MJWA 4PJCF 5EEYA 2XQ0A 2QEJA 4HPOL 4YSRA 1R3JA 3KDMB 4ONFL 4FC3E 5JW3H 1UB6A 1GGBH 5D93B 5SWZE 1KCUH 4Y5YA 4M9PA 4ZMLA 5E9DA 3O6FA 1GZHC 5KS9A 3BYYA 4M4PA 1SNRA 3QDAA 2PPAA 3VXUB 5BVJB 2H0FA 35C8L 3W9EB 1AOHA 3LRLA 4W81A 5DZJA 5BRZD 1UENA 2HKHH 4YHMH 2NY0C 5FO9B 2FH8A 1IGFL 2HUHA 5E2TH 5KVFL 3SN6N 3LMJL 4AQOA 2CIKA 4PJEF 1CCZA 4S0TD 1HYSC 3V9FA 5KVEH 2X09A 4JFOA 3FZUC 2HJKA 1EUTA 2GTZA 3CFCL 1KOAA 2WVVB 1P6WA 2P48B 3VI4A 1H5BA 4JHAH 5ALCL 1NGZB 2A74A 2C9VA 1OGTA 2X2UA 3SDAD 3AQZA 1BBDH 2ZKMX 3T2QA 2NTFA 1JPGA 1A3LL 3KPOA 4FTVA 4NZTL 4C4KT 2KDYA 1J5DA 2BC4B 5DFVC 3LS4L 3KBHE 1OK0A 3ARQA 2ZX8A 1JDCA 2JJSC 1NMCB 2VERN 1UWXK 3VFMA 2GVYA 5DQJA 3ASOB 1HWHB 5GJSL 3TBBA 2D31A 4ZG1A 1MFNA 4MCNA 4MHHG 1FFOB 3TBWA 1I7UB 4CKQA 4CSZA 4ZUSA 1U2CA 5DJXB 5HJ3B 1T0MB 1E8WA 4XNXH 5FHAL 2PR9A 1NKRA 4X5WA 3L7EA 3VXSA 3REVA 4QHMB 1ORQA 4Y5XC 3VD2A 2KT6A 5C08D 3I6GA 4PJ5E 4R0LA 3TNNA 3RLSA 1G7LB 4RAHA 2DIAA 3EKCA 1XSKA 4NM8L 1P7HL 4QTIL 2EIJB 5FYLH 5D7HA 2DJMA 1JERA 3QFDA 4HJ0C 3WU1A 1LL1A 5H37H 4CDGC 1U30A 2QJDA 4LAJH 1B4TA 4AMKL 4NQEA 3PL6D 2WTPA 3D18A 2DQDH 4FXKB 4P2QB 4OM0H 2HFTA 1GC1L 1X5JA 3LH2L 1QBML 3DOSA 4YQXL 1NCGA 3ZE2E 1JV2B 5J6GA 3W3BA 4QOKB 5GRVL 2Y5TB 3QULA 1AG0A 3RP1A 5I73B 1S7TA 3L95A 4QRRD 4ODWA 1P6FA 3ILQD 3PHOA 1J1XL 1DQQA 5I1LA 4OGZA 2EE9A 5BMFL 5AQ0A 4IBQA 1INEH 1BQHA 5DFAA 3NP4A 5IW1B 1EFXA 3BGMA 3BD5A 4Y2OA 3X14A 3P11H 1A2YA 5AW9B 3B2MA 4XP6H 4Y9FA 2ZOWA 4RGNB 3CIAA 5ESVA 3HC4L 1MFEH 1QPKA 3EZ8A 1F3DJ 2FECL 1DFBL 3FSZA 4QRBA 1EFQA 1OSEA 5CILL 1ZGLB 4A68A 2IPUK 4Z3IA 3LAFA 2IDTA 4GS7B 3VXNA 4M3KB 4BCYA 5HI3C 1RUAL 2ZOKA 3HC4H 1ML0A 1YSOA 4OD3L 4X5XB 4Z7WE 4CADB 1I7RA 1J5OL 1MRFL 3SDCA 1OCWH 1NOAA 1S9YA 4IKNA 1EEZB 2IOIA 3RJDA 1DBMH 5C70A 2N0KA 2DDQL 1TZHB 2DQCH 2JKXA 3GMRB 1KTJA 4X6EB 5CLTA 1J8HA 2D4DA 4ODTL 3FFDB 2HLAA 3CSFA 1PBYA 1E5UI 3CV5A 3VTAA 1JF5A 1IQDB 2PCPB 4XC1H 4ZS7H 3FSOA 5E08H 4UYQA 2ZCLL 3CLWA 1MG3C 2L3BA 5T3XD 2DI7A 1LMKA 5T5NG 3ZUNC 4IIQA 4QLWA 4L4VE 5DHMC 3C8HA 5C0BD 2VXVL 3ISYA 4IHOA 4DN4L 5ID0B 3KMDA 2WLLA 3GXPA 5A43C 3B7TA 4A1RA 3E8VA 3V4LA 3GS0A 4FDWA 4F7EB 3L4TA 1TZGH 1RJYA 1SM3L 1JZ8A 1PVHA 1BQRA 3DI2B 3OZ9H 3LSOB 3U4EA 5FDWA 4O51B 3QORD 3PABB 4N20A 3GMLA 2Z8VC 4N4YB 5D1ZI 1L3WA 2H3NA 2ITDA 2GABA 2GCYA 2LW3A 5INCB 3T8MA 4QHKJ 4HIQA 2PW2A 5T3XE 1K5NB 2W59A 4FLRA 3HAEA 1YECL 1TZAA 3U36A 3KYNB 3ZE0E 1T7WA 3KJ6L 3OJDA 3OAZH 1CFVL 5GJTH 3HUJB 1IILE 3ATEA 1NGXB 4L18A 4F3FA 2X89A 5IVXA 4U0RB 4D8OA 3FT4A 4N0FB 3TA4D 3TJHC 2AZUA 4MMZA 3ILEA 4I48A 4A7UA 4QHUA 5TFSL 4GAJH 2FVNA 3K7UA 1Z32X 2B1AH 2FBRA 5LLIC 1XXFC 4ADJA 1T5XB 2WLJA 3HN8A 2H2PD 3QG7L 2BNQA 1N0LA 4GYBA 1OB0A 4H1LB 4NAMA 5KEZA 5EU7C 3F65A 1QVOA 4YNYA 4JQIL 4OD2A 1U93A 2NSMA 4L37B 3RJQB 2CBOA 3N91A 4WGKA 4YE4H 4HMCA 2R2HA 3EAKA 1R3LB 1XIWD 2PO6C 3N1QC 1LK2B 3NCFB 1URLA 1FFPA 3FN0L 3Q8AA 4I0PB 5JOFA 4LVNB 1IC7H 3BE1L 4I77L 3ROLB 2WGXA 1ZOXA 1J10A 4N0CD 2GSGA 4NQDA 5AOLA 1YN6B 2R1YB 4XI5D 1IAOB 2XFGB 4XRCB 2CHNA 4HWZB 4OZ4B 2CWRA 4OLVL 1LDPH 1MCRA 2EYTA 3F2LA 4YJZL 1RK1A 4AXWB 4DP5X 3DGCR 3IDGA 1FN4B 3N1MC 4MGXA 4W4OC 2Q6WA 1NFDF 4PY7A 4ZO9A 4J8QA 4AV4A 1DVYA 5ACLA 3L1GA 2NUPB 3RWEB 3HNTH 2BZCA 1PG7W 1XO8A 3LKRB 5E2WH 4LEXH 2G5BB 1OTTC 3DVFA 3GT6A 3S3BB 3UZQA 2IADA 5AYUL 4DESA 2ZXCA 5MEQB 3QCVH 4XMTA 1HH9A 3BPNC 4MD4A 3QWNA 3VE0A 4YHZL 4ICWA 1HYRC 4G6FB 1M2VB 4GQ9L 2OTPA 1A1NA 1WE5A 4WFFD 1XB8A 1J05A 1WH0A 2P42B 1BQSA 3W39B 1HHIB 1YEHH 1FCGA 2FJGB 3FHQA 4B95C 2ADGB 3UEQA 2C9RA 4JW3A 2VW7A 2QVTA 3IETA 1KCSL 4F33B 3NN8A 5KVEE 4HW6A 1OAKL 2DMGA 2HN7A 4EMZA 1T1XB 4MJ2A 5DZOA 2R7EB 1YMME 2EC9T 2UY7A 4Y1TA 3ZK0A 2NY3C 3ALXA 4PRDA 2MWCA 1XEUA 4NKMB 3ET9F 1MFCL 2CG9X 3M86A 4ZOBA 5GSVB 3TO2B 1FF5A 1WAAA 4EXKA 3UJJL 5JHBA 5AVQB 2PO6B 3DV4B 5ISZB 1Q38A 3K6DA 1USQA 3NTCH 1HI6B 4AYID 4FQJL 2CAKA 5E5LA 4G6AC 2BIHA 2TSAA 3QHTC 4F9PA 4QHKI 3G9VA 4Z6AT 2XVGA 1LO5A 2WQAA 1BOGA 4QXGH 3HC0B 3VWKA 4K94L 2WLYA 2WWNA 1CR9H 1PZAA 1IBZA 4U3HA 2ZD0A 4DP2X 2BOBB 3Q2WA 4CW1A 1PD0A 1JGEA 4XB8A 5C0FA 1TYJA 3L3HB 1XSOA 3Q2NA 2JQZA 1ZEAL 2MKLC 2BP0B 2NPLX 4GPVA 2V33A 4GFTB 3VFTA 3WSQH 4R97B 3EH1A 3ULVE 3BVDB 4U1JB 1G1OA 4KH2A 3SOBH 2LHAA 3MRPA 4JFEE 4CC0A 4YHPA 3O6FD 4BWUA 3GZOA 4OZFB 2MOVA 1SFDA 3D3VB 3MR9A 2VDLL 4L48A 3WNNA 5GRUH 4GBXA 4NRYB 2IG2L 4ZUTA 4FLOA 3S98A 3OF6A 5AKSA 2SEBB 4XPBL 1CGYA 2PNDA 3SKOA 3ULUC 3NFSL 1UZ8B 2W0FA 3TGXA 4I18A 2WMPA 1CURA 1BFVH 3FSAA 3FB6B 3QI9A 3BJLA 4J3OF 3WTXA 4OZHB 1EO8H 3ULVD 1EO8L 3FTSA 4X8JB 5K9OB 2YPKB 4Y5VC 2Z8SA 1BD2B 1U4FA 4NAQA 4ZW7A 1EH9A 2BVPA 5KYXB 4HIJB 3P73A 5FCUH 3B2VL 5CD3B 2H8PA 2AS5M 1YYMH 3T77A 3WE6A 4HS8L 3ULSA 1J8RA 3VD3A 2DQUL 1OAUL 3D0VB 2I60L 4X6DE 3BUYA 2K6YA 4B53A 5GGVY 3RQ3A 1U8KB 1IC4L 1NQBA 2Q8BH 1PD6A 1K4CA 4P2RB 1W0VA 3BDYL 4JKPL 3JTTA 1CO1A 3KXFB 5E24E 2ZYRA 1RUML 4MWFA 1LMIA 1PF3A 2DMHA 4OI7A 2I24N 1ZEAH 3RKDC 3MLTA 3SE9H 2MNWA 3EOTH 5C08A 3BAEH 2X0WA 3KGTA 4AIXA 4P5MB 5LN8A 3MAWA 4BH8A 2CPCA 2RJMA 4N8VB 5HXMA 1L0QA 3UZVB 3FC8A 3UAJD 4U1LB 5JHDA 4FQXB 4UU9B 2IFFH 3QNYA 4QRTB 4G1EB 3UJIH 4D0CA 1XGTA 2JWYA 5MEPB 2OZNA 3MDJA 3EYSL 4YHLH 5KYNA 1MVUA 3GXDA 4LLWB 2LOEA 1RURH 4FE9A 2G5UA 1CXLA 1JXGA 2J57A 2C3HA 3OGCA 5EU4A 1CFQB 4W1TA 1OO2A 4Q74A 1P5VA 2I9TB 5IM7A 2XNAB 1F41A 2AJZA 4ACPA 3E7JA 3B83A 2Y7QB 4M7JH 4WEBH 2WWKO 4IOFD 5ICUA 2UY6B 2UYLA 3HMXL 4FKHA 2HVJA 1RMFH 3PPEA 4GNKB 2HVKB 5JLZA 2AQNA 1JI2A 5FM8A 3KPLA 2PWEA 4X80H 2Q76B 3NGBC 1H3WM 2G3MA 1J9SA 5E8DL 1JDDA 1ZVYA 2YAQA 1BBJA 1I53A 4MNHB 1FV1A 2WOYA 3U7WH 3LRMA 2R83A 4Z3FA 2WTRA 15C8H 3BUPA 4G9FB 1HHGB 5T5FH 3TBTA 1ZLWK 5T1DL 3C5ZD 1SHMA 5SWZB 1SEBA 2A74C 5TDOA 2WNWA 3PQYA 4XN5A 2E56A 5GISL 4KNUA 3E6HA 5GS1C 4JGUA 1GYWA 4NZUL 5FYJE 1E65A 4XNUH 1UJTA 1U8QA 4ZUUA 3S35X 3LV3B 2GJ6A 2HX7A 4OKVA 5HSFA 4RA3A 4WKZB 2EUXA 2VJ8A 4KMTL 4X4YA 1U0QA 3WENA 4FYQA 4IRZH 3L5XL 4ZD3H 5E1IA 2A6KA 2BNQD 5DI8B 4H2CA 1IKNA 3BJ91 1KEGL 1DJWA 3ARFB 3WELA 4EIGB 2Y7MA 3HI1B 5JOEA 3VUAA 2E9WA 3GJEA 1D9KB 2DWSA 3ECBB 3U9UB 5A2KH 1E4HA 5AUMA 2YRLA 2VE6B 4HT1H 4E36A 3IKCB 4JR9H 4L8DB 5HGHA 3OG6B 3TCLB 3FRUA 3A21A 2VR4A 2YJQA 2VN4A 2CDFA 3BAJA 5L9DL 3CVBA 3MUUA 1TTBA 4HAGA 4ZD3L 3BP7A 4P2AA 3L5XH 3DUSB 4PS3A 5E5RB 4BSWB 3WEMA 3OKEA 4GXUN 1U92A 4XGZB 2V7HB 2LABA 3ZTNH 2RR3A 2PR4L 3PXHA 3SKJL 3ZMEA 3UDWC 4KFMA 1BF2A 1TT6A 3QG7H 2QKIB 4WI4A 5KJRL 3VGDA 4OIIL 1C8PA 2D7NA 1ROWA 4ZFZB 5I1KL 2ZCKL 4YBQC 5J4MA 3QQ4B 4WI8A 4HDIA 4EN3A 4ZUWB 3RIFF 3MREB 5F3BB 4HEME 5JNYB 3PGFH 3W9DB 2NY4C 4F15C 3A6BH 2B59A 4WNQB 5J89A 3NQKA 2JJTA 1ITCA 4UBDC 5EU3B 2AI0L 1W72H 4OJAA 2CK0H 5C0BE 4GEIA 4PB0L 4WO4C 1FL5B 2HFFB 5E8NA 1XZ0B 2J73A 2B15A 4LDEB 2K6ZA 4FYTA 4S10A 5EIQA 4MKTA 2CA3A 3UADA 3MUY1 3SYQA 3OMNB 3ILPA 3EJRA 4PG2C 5HYJA 2VQ4A 5GS1A 3M1BA 4TLSA 3ZBMA 2ED8A 1N70A 4DQOL 1FIGH 3K2UH 3I2CL 4NHCH 4WI0A 4YDKL 2NLJA 3RDTA 5B7MA 5BZXA 1U8PA 3UP1A 4LL1A 1JWMB 4DVBB 3TBVA 1BV8A 4ZOCA 5A2AA 1WFNA 4TNWK 5HDBB 2P8LA 1KFAL 4DP0X 3BW9B 3U9PL 3WHXA 3BQUA 2ZPKH 4GT7A 4S1QL 1EO7A 3SY0A 4QRPD 3O41A 4FTDA 3SGKA 3TESA 4IW4C 3NFNA 2UZYB 2FAUA 4Y19A 4M6NL 5CN3A 1E50A 4JHBA 4AKOA 4BQBA 3BPOB 1FZMA 4XCYB 2BP8B 3PWJB 5AVWB 4OZIA 4DZBA 4NKIH 1IVLA 3REWA 1I9EA 3GLEA 2WWOA 3IFOB 1XCWA 3N2JA 2R29A 5EFIA 3PF2A 2XACC 1ZA6A 4P46C 5CO1A 1IGYB 1MWAA 5FUZL 4Q2ZA 3VU1A 1JNJA 5LDUA 4QXWA 3OJVC 3TM6A 2XTJB 3MA9L 4PREB 3W11C 2EIBA 4W9EC 4YSUA 1LTXA 3CH1A 2P47B 3CVHL 3FRPA 4H20H 4XNZB 4MQTB 3WEXB 5JZ7C 3LZFH 3FTYA 1A6ZA 3G6DL 4OCWH 5EEVA 4NWTL 2BSTA 3THML 3V6ZB 2VN5A 4QRPB 2OMNA 2Y5EA 1II4E 3UZEA 5SX5H 4FXGB 1KPUB 4HZAA 3EFOA 4UT9H 4KVNL 4N1HB 3V4VB 1G1YA 4EVNB 1INEL 1Q94B 4P4KA 1BREA 1PQZB 3C60D 3GB7A 3UAJC 3V9EA 3K80A 2D0GA 4DGUA 4Y89A 1ZT4A 4NGHH 3TA3B 1QI4A 2IAMC 5C6WH 4I0CC 2B1HH 2GQHA 2LFEA 3KW8A 2C3GA 3ZYZA 1INQB 2EXYC 4FD0A 4KK6D 1WICA 1SLVA 5B8CB 5A2JH 2JKJA 1L7IH 3MCYA 3QC5X 2GKIA 5L8KB 1WT5A 4ZXBB 2P44B 1JGLH 2DQDL 4NZJA 3BPLB 3HPLB 1T3FA 4L8SC 1IM3B 4XPGL 5B1AB 4ELKA 3MXWH 4MJJA 3RNQB 2R69A 4P2OC 4H8WC 4GMTH 4HFUH 1DLHA 1UH3A 1TETH 1TEGA 1AIZA 1N4XH 4RGND 2J1KA 3INUH 2AJXH 3ARVA 3O3AB 2DJSA 2XG5A 3GC3A 2FEJA 1TTCA 1J0ZA 2N7BA 3EJYD 1MHEB 1WO2A 3GMPA 5HHOD 1RIHH 3MYJB 1R3IL 4LNVA 3QUGA 3Q05A 1A4KA 2ERJC 4G11A 3B6SA 5KSBA 1GJUA 2VDNL 5A6IA 5IOPA 1CT8A 2OW7A 3V4VL 5ICXA 5GZNC 4JNXA 4A6YH 4X6DA 1L9PA 4AL8H 3T3ME 5CEXB 5B3SB 1CFTB 3H9HB 3SDYH 2ZOUA 4LPVA 4QOKE 1CGSH 3FYIB 1NM9A 3BISA 3U7YH 4WHTA 3KEDA 4TUKL 2F74B 4OUOA 5K59F 2W88A 1BBDL 2C4FU 3EHBD 4LLYA 4NZDA 2XV3A 4CMHB 3F7YA 4ZFOB 4YSPA 2IGFH 2IDSA 1X5GA 2XWJA 3BEWB 4MDIA 4ANUA 1F4YL 4F9PC 1GS6X 1EXUB 1WITA 2ZZUT 3M7OA 4MXWL 4AYDC 1ORSA 1XH3B 3K72B 5GS2H 4NBYB 2FWUA 2J12B 2XIBA 3RJOA 3MRIA 2LVEA 3MRGB 1IKFL 4K7PL 3P4LA 1KZQA 4OBRA 4ENZA 5DK0A 3IEAA 3S48A 3LS5H 3IJEA 3C5ZA 5AW8B 4GAYA 4YHYB 4NUMA 5HJGA 1T5WB 2YKLL 2DM7A 1GAFH 4MJ6B 1BMGA 2ZUQB 4OB5L 1X44A 1KJ2H 1AMXA 4FFYA 1UM5H 1ZTXE 1KCUL 5LKNA 3VWKC 4GIOA 1KCVH 4NUPA 4R2GD 4LEBA 1AFVL 4IGBC 2A4CA 1RZKH 1J0IA 3FB5A 1NLDH 3ZL4L 3AU1A 4DPAX 1MCLA 3D3VE 3ZKMC 3US0A 1NTDA 3VACA 4N2EA 4L4TD 1JF6A 1O7SA 5EBLB 1AP2B 3A4AA 3WHE1 4P23B 5K59E 2YBGA 1E5CA 5F96H 2BSRB 4V1DB 2OK0L 4A2DA 5TK4A 1UWEL 3DO7B 1FQ9C 2KL6A 1YG9A 4UT9L 4MTMA 2EO7A 5C09B 2L4OA 3TNMB 2QPDB 5KSUA 5D1ZC 4QRPE 3VFNA 1KTCA 2OZ4H 2WUBL 4Y2DC 3MRRA 2ARJQ 4XPFL 4JRYB 3RPIB 4UT7H 3TU6A 3PV7A 4JFQB 2XN0A 4UDTA 1Y18A 5I2IB 3O45A 5GRJH 2X9WA 1ZLDA 2YA1A 4HUKB 3ZRFC 4Z18A 5LAXB 3RU8H 2CNZA 3DXAD 2EJ1A 4XNDA 3WXWH 1RV6X 3BH8A 1XCXA 4FLQA 1YPZA 5KOMC 4FQ2H 1A21A 1SLWA 3G5YB 3VDAA 5C0RL 3W57A 2FATL 3K1KC 5H4ZA 1ZK9A 1BX2A 4EUPG 1CLZL 4Q6KA 1C16A 1S7SB 4KJYB 1V55B 3E6FB 2EH8L 4NI3A 1I8IB 5AVSB 3O3DB 1DN0A 1WZLA 3LRKA 3SO3C 1K3IA 1SXNA 5J7CC 5CBEB 2WXKA 4FMVA 3I9GL 3WIIL 3MV8A 3UPAA 5I6XB 1UD3A 1AXIB 3GHBL 5CZXC 4OCYL 2CBMA 5FB8A 3M1OA 3PQYD 5IESL 5DT1L 4HBQA 3DX9B 4NPJA 3CBJB 5EULV 2KZKA 3QR2A 1AJ7H 1URIA 1NJ9B 2C26A 3IFPA 3BKML 3KPPB 1I1FA 4JRXA 3WTWA 2HLFC 3QJHA 5A3IC 1HQ4A 2VDPB 3KWXA 2F54A 4H26B 4L3EB 4XX1G 3KPSD 4JUSA 4N5ED 4NYLB 3CN4A 1RI8A 4PJAA 5T5FL 5EZJB 4N87A 3VFUB 5J11B 3WS3B 4P59L 1DTUA 3C2AL 2O30A 1HC1A 1H15A 3AADB 1WF5A 3B2UC 3QO1A 2XICA 1A4JB 1BXVA 3L08A 3ZSSA 4CU7A 5I30H 1JFHA 1UFUA 3CX5K 2NY6C 1S5IL 2V5MA 3ARSA 1EPFA 5D6DA 4MZRA 4EZKA 2VZUA 2R29L 4B6ZA 2WXFA 5IF0B 3BRFA 3WNMA 2Z91A 5DS8A 3NSXA 5IGXL 1MCJA 4L4JA 4ZX5A 5E2UH 2DQCL 3PHAA 2R2EA 5ADOL 3AZUA 5E7FA 1K8DA 1MRDH 1VFBA 1XD0A 4JZJA 2VDKB 4OFIA 3UC0L 5T3ZE 4F7MB 5BV7H 3JWOH 2CKBL 1YYCA 4LNRA 1CLCA 4QF1A 3O8XB 1BIHA 3QVAA 3H1ZA 3TS8A 2BNQE 1IM9B 1CBVH 4WFHE 4I4WB 5IQ9B 3MV11 4M6NH 1M9WA 2WXPA 2YQBA 3WKNA 2KERA 3GFUA 1KTDA 1A4BA 5BRZE 4TYUA 3LOWA 4KXZH 4WO4A 4XHQA 3BP5A 4H0IA 1CFSA 2DLFH 4DP6X 2MCG1 3BVTA 4YIQA 4K5LA 1LEGA 5D96C 5T33H 3VFVB 1EGJL 2VLRA 4U0QB 2LV4A 4JQXC 4NPKA 4HC1H 2VAAB 1L5GB 2VR3A 1JZDC 3W9EA 3Q3GB 1H8SA 1LO0H 1FIEA 3MLXH 4CJ0A 1QTPA 1QRND 3BWUC 4JQIA 2DQUH 1GGIL 3NFPA 3SY6A 3UYRH 4FA7B 5I1HL 3AXHA 5A16B 2DY2A 4PBXA 2XETA 3VXOB 3R7QA 3FTXA 1NGWB 2V0AA 5KSAC 2YFOA 4U1IB 3WUZA 4IEFA 2WXQA 2JTDA 2CUMA 2LAAA 2WVVA 4KQ3H 3VI4B 4PB0H 3KPMA 3BPCB 3IM1A 3S0PA 4OGQC 2B08A 4AGQA 1IKOP 3SYAA 5D7LD 4J3UA 2ZXBA 4WWPA 4ZTOH 1MFVA 5FA4A 3VM5A 3NIFF 4ADIA 2LLNA 1S3RA 2IBBA 1H3XA 3JWDH 1RULL 3CFJA 2Z9TA 2NX5D 4XP1L 4DEPC 3MV9A 4Z7QE 3KR3L 4GSXA 1AQKH 3FO9B 1XF4A 3KDPB 1Z66A 5DVLA 5FKPB 4YO0A 2D31B 5LBVA 4GUOA 1I7UA 2O6EA 3L3OB 1MFBH 4HUXB 4Z7VB 4AQ8C 5D71L 1JTPA 2F54E 1UGNA 4LDOB 4OZFG 3IMWA 5HHQB 4WI3A 1AO7B 3LNEA 1ORQB 2BSED 2NCMA 4KDVA 2OJEB 5JIQA 1HWWA 1RK0B 5C0DA 5FM4A 4M7JL 2XXMB 1IEBA 1F58L 1KPRA 3RURA 4X0KB 3LPPA 2VDMB 5PAZA 2TSBA 3UBXG 5DJAB 2F58L 4H5SB 1ZVSA 4UUJB 5IIEB 1X4YA 1QFPA 1BEYL 1RSYA 2PLTA 2Q3ZA 3O0LA 4V11A 3AG4B 3EW3B 5EG6C 3ALPA 4LHUG 1W2KT 2BMKB 3WAJA 4NO2A 3MA7B 1ZDQA 1L6ZA 3FTGB 4NJ9L 4AQ1B 4G9FD 4ZOAA 3H7BB 2IDQA 4ODXB 4HJIA 1GR7A 1VFAA 2I32A 4HJ0D 1JD7A 2R4RL 2BZ7A 2FO4B 4K2UL 2DQJH 4K5MA 4XNMA 3HZMB 4NT6A 4YMPA 1OP9A 1Z1WA 1ZWIA 2E7HA 4K94C 5D72L 3TBYA 1N18A 3HC2A 4AEIH 1HOCB 5CD5C 3RWCA 3BZDA 3QAZB 3CSTA 4YDMA 4QEGA 3AWFA 5EA0L 3U2JA 4Z7IA 4GFXA 5HGBA 2UZXB 1KPVA 1T7ZA 3TWCL 4Y2OB 2ZKXA 3ZZLA 3SGDH 5T1DH 3QDJD 2BHYA 4IBZA 1O9VA 2F19L 2QPUA 2VYRE 1DANT 4DWHA 1CD8A 3NZ8B 4QXTA 4OLUH 1KEMH 1JDAA 3NESA 4HWUA 4OFDA 1F13A 3EO1B 1HINL 5CKAA 2KZ1B 1QSZA 4PJCE 2EDHA 5DURB 3TN0C 2Z93A 2Y1YA 2YAFA 4HYTB 3VG9B 2BNRB 2YGVA 3BQUC 3QA3B 1SJHB 3IDJA 4IBSA 1OSPH 1I7RB 3FMGH 4YX2H 4L4TA 5E2WL 3TC9A 1XF5B 4QTHA 2MNUA 4L1SA 1GGCH 2FSEA 4BD4A 3PP4L 3PDOA 2C9PA 1KGCD 4TULH 1G9EA 2VDRB 1MCPH 4FG6D 2Z31D 3GMOB 1JN6A 1SFHA 1KGJA 2R9HC 2OQJB 2WLIB 4Y5YC 5DF0A 3MRDB 4NO5A 3VMNA 2ESVA 5JQHC 5AAPA 3QIUB 3K46A 1GOFA 3BH9B 1TCRA 4OIFA 4RGOH 2K4WA 4RMQA 5BXFB 3P3YA 5IBTL 4OQTH 1IFGA 3RVXC 3L5IA 3TV8A 3EADA 3T0BA 3MODL 2J72A 1S7WA 2J5LC 2CO6A 1EIBA 4XBPA 1DVFA 1SJEB 1IC7L 3BE1H 1UJ3A 3RWHA 4RAUA 1DCLA 1Q72L 4KXCA 5EUKA 5ID1A 3IB4A 3PREA 1K5WA 4QI3A 4PJXB 3TT3H 3WFCH 3UX9B 1MHHB 4A55A 3V55A 3OKOA 4M48L 2BIIA 4LDLB 3U4EB 1YCSA 1O6VA 4H8PA 4JRLA 4U2YA 2DQEH 2RAMA 1IC4H 1YNTA 2ZX9A 2XA8H 2Z31B 3N43F 4KROB 2NZ9C 1HIML 3SKMB 4YEFA 3HLAB 2V2TA 1A66A 2YSSB 1QR4A 5EIIG 4GKSB 4OCXL 2YD2A 4CC4A 1FJ1B 3KVPA 5AZ2H 1UT1A 3D2TA 1ONQA 1MFDH 1F4XL 2HKAA 4G80B 5ES4B 1G7PA 4GG6B 3DYOA 5EO1A 2X6AA 3EXJA 2WQWA 2E9JA 4CILA 2KLSA 5CEZL 1MREL 3ZJAA 4LSVH 5FR3A 2X7LA 1WD8A 5CSBA 3V7AE 3GJFA 2EYRA 5EUOF 3QEQE 1KIQB 3D51A 3HB3B 3BWSA 2Y24A 3MX0A 4B9FA 2PYEA 3FT4B 3KPSA 3QEHA 1JTTA 5FYJD 2VSKB 2ZUSA 2JMRA 2VWEC 1QX1A 4OUUB 4X7CC 1U58A 1TFPA 3OHMB 1RZ7L 3OZLA 4P4RA 2YRZA 2IXQA 3OZ9L 3L3GA 2XLLA 3UPCA 3LVEA 1IKNC 3JV4A 3V6OE 4JM2C 4TOYH 3CDYA 4FFZL 2GJ6E 4Q0XH 5DHVA 2WVUA 3ZUCA 3ZU8A 1R33A 1K9TA 4NPYB 1NGPL 5HY9B 4UTCA 4YHOH 1VERA 3DO3A 2IFGA 4K0OA 3WS6A 4X4XA 3TJHD 2GSGB 3UTOA 1KEML 2W95A 2J6WA 4QLRA 2GUOB 4UQ2A 3U6RA 5A6MA 2QQLH 1LD9A 1SLXA 4HWZA 3T3PB 5L7XH 4OZ4A 3N85L 5T5NF 4IRSC 2JB6B 4KJPD 5DUPL 1TVBA 5ITBH 4QXGL 5ACMA 4PJFA 5HYIA 4PIBA 3CZNA 3V7AG 1A9EB 1UOLA 2B4CC 2X6CA 4WNJA 5CIPB 3S34L 3IBEA 1P2CA 2WB1A 4GH7B 1CBJA 2BY2A 2P1YA 3DVGB 2O61A 2WKOF 3PHQB 4DN3H 4LLUA 2DQJL 5KG9B 4I7ZC 4O9HH 4MD4B 2ZOTA 1JFQL 3SDAA 4I3RH 5D5MB 1KELH 1VESA 4Q89A 5IB4B 5FYKH 2DF3A 2QADC 2YAHA 4LLQB 1J05B 5DO2D 1DJZA 2D7PA 4UINL 1U8HA 1MELA 1SXAA 4ZTPH 4IRSD 4QCIA 2VC2H 1RH8A 5D1ZD 3G6JA 4O4YL 2WIIA 3NN8B 4TNVF 1QSEA 3WN5B 3MPCA 3CMOL 3PGCA 4GW4A 5F7LB 4ZW6A 5I8OL 3ATFA 1JRHI 1O6TA 3QUXA 5C08E 2UY7B 3OHXC 2VDLB 4YHZH 4WWKA 3T4AB 3QXVA 1F6FB 3FCTB 4JANA 5JR1H 3D1MC 4Q9QH 4M4RB 3JTBA 5DFWH 3D2UB 4IGBD 1GSKA 1ETZA 3VGEA 1WUZA 4HG4J 2LTQC 2J2ZA 4NNXB 4B5ZA 4TQHA 2ADFL 5TQ0H 3TXAA 5DEFA 1RL1A 4UWQB 4R8WL 3ETBJ 4TL4A 4U33A 4MVBD 5EU5A 3QQNA 3TPKA 2BCKB 1JCVA 2ZP8A 1AZRA 2SODB 3DX0A 3FQNA 4P3CH 4N68A 1MCFA 1KCBA 2PWHA 3HZKA 1PSKH 1ZJAA 4JY5L 3CU7A 4H0GA 3DSNB 4XCEA 4LEEA 4YXKH 1V5JA 3QCTH 1CWVA 2O4EA 2YWYA 2F5BL 4PRPE 2N59A 2ATKA 4R8WH 5J57B 1PGRB 1L9NA 3II3A 3QH3A 4QKTA 4U1JA 5AB9A 1D7DA 4BFBD 1MH5B 2K3TA 4LCYA 2Q9OA 3ULVL 1Z5HA 3TH4T 3WO3B 2IPTL 3TOPA 4UNIA 5DJ2B 4UCFA 5KYUB 4DZ8A 3PWVA 5J56B 1HH6A 5DJ0B 2WYHA 3LEVH 4P2RE 5D1QE 3ZKNC 4AZUA 5MEND 2D7QA 2IOMA 5MP6L 2EKSA 3MJGX 4EI5A 1H3TA 2CBTA 1XL4A 4O2CA 4A7QA 1QLRB 1AQMA 4Y7MA 2Z92A 3PL6C 2F9BT 1DBJH 2IBZX 5KVDE 4J23A 3FB6A 2FTAA 3EBGA 3OZKA 4L5FL 3H3KA 5B38A 3IFLH 4NB7A 2EEBA 2V5TA 4XCNB 2QQKH 1AQ8A 1RHHA 4FFZA 3O9WB 4JFYB 5ESQB 1JXFA 1T21B 5IHUH 1CFVH 3MCG1 3RVXD 4I1NB 1T1WB 2FK9A 3STZA 2AJUH 5TE4L 3L3IB 1ET7A 3CG8A 4KJPC 2WN3A 4O02B 1X5KA 4DN3L 3MV7D 3UCQA 3OL2A 2BDNL 4YBLC 5E4AA 3VYOA 3CFBB 3HZYB 1ZVHA 3S3DB 1NAMH 4LPYA 2YMOA 3FSVA 2GJZB 5BO1L 1M1SA 3KXFA 2O5YH 1BZ9B 2C9XA 2AXWA 4Z7VF 1YNKL 2YPVL 2J1ZA 5IW6A 2NDFA 2PUQT 3GBLA 3RGHA 2Q7YA 5L7XL 1YMMA 3ARDB 1S7RA 4PJGA 1ZLVK 4NN5C 4ZFOL 4YFDB 4WEUD 3IJSB 3UROR 1OV8A 1KYDA 5CFAA 4NRXB 3FBQA 4HUVA 1CICB 2RCSL 4WLCA 1Y0LB 1D3CA 4ETQA 1DJXA 2XQYG 3OKLA 3VQMA 3Q5YA 3VMOA 4B9GA 2NT1A 2BX5A 4TQEL 2IGTA 2Y2YA 3T8XB 3D0LA 2F53D 4RAVB 1KTLA 1S7QA 4LASH 4IU2B 1KIUA 3EGSB 2I85A 3T65A 4JFDE 3WNIA 4F7CB 4HV8A 4WUUB 1RPKA 5IM7B 5KWYC 1ZLSH 3DK2A 3RWGA 5IESH 1QA9A 2ZE0A 5GRXG 3C6LB 5IV2B 2QGCA 4J6RL 2HVJB 3ENEA 2DMKA 3RIFK 1MI5E 4WIQA 2ZCHH 1RY7B 3RBSA 3G5WA 2DRUA 4PJ8D 1BFOA 4DERA 3BRDA 4MNHA 4UAHA 1N6QL 2DBLL 3ISRA 4LSVL 5AZEL 1ZLWH 1T6VN 2OMXA 4AV0A 2IQ9L 1ZPLA 4F57H 2JH2A 3P11L 1X9UA 2ZCHL 2X70A 2R1WA 1EJOL 5T1LD 4HGWA 2JIXA 4IYKA 1OP5H 43C9A 3MRJA 1OE1A 3LEXA 3MRLB 1N26A 2AW2A 2AV1B 4GW1A 2X2JA 3UAJA 3DHJA 4P4KC 4L9LB 5DD3H 3ESOA 4M1CD 4X8GA 3FN3A 3SE4C 1ZV5A 1GOGA 1TKWB 3R0NA 1C1EH 2E7DA 1I7TA 3IMBA 2IANE 4YDZA 4A39A 4BZ1A 2B77A 3AG1B 3CSYA 3B7SA 2X6BA 4F8PA 1E28A 4AEHL 4AEHH 2WINB 4G83A 1SQ2N 3LN5B 2MCMA 1VFOA 4JS7A 3MODH 5CLWA 1SJXA 4YC2B 1WV7T 2BY3A 1C1EL 2QT6A 4BH7B 5LDSA 3T4YB 3WCYA 3VFOA 4L8DA 4MNGA 3D7PA 1OAQL 5I1JH 5IB5B 4PCYA 5K93A 4B41A 1F02I 5IVXF 5DVOA 5G4NA 1NBCA 3SKNB 2VQ1A 4GO6B 1H5BC 1ZD6A 2W65A 4F27A 1Q1PA 2OZ4A 4ZPVA 3ASWA 1A7RL 1RJZA 1WGOA 1Z5YD 3ZDYB 2WQVA 4XX1E 3OLEA 1D7BA 1CQYA 2CRZA 1TJHH 5EZPA 3WS6C 2WLMA 2WUCH 3FQTB 3SBQA 3K4AA 1F56A 4PWGA 1JHLH 3TO4B 2EDJA 2AXGA 1NBVL 4WTZA 3VI3B 3KYOA 3HG5A 2EUZA 3T6WA 4HS3B 3MBEC 4M8QA 2J55A 4CRPA 4LRIC 1OP3K 2MRYA 2NY6D 2EIEA 1M1XA 1T66D 3KLHC 3K1DA 1IEAA 3LD8C 3S4SB 4ESKA 5AB2A 2VC2L 5DO8A 3LQZB 3HMXA 3FH7A 1E4JA 4JCWA 3NIDF 1WHPA 5FO9A 3UP6A 3TN0D 2IPKA 1P4IL 1H8LA 4K5OA 1KN4H 2N1KA 3RWIA 1U9KA 2X28A 3TJEH 2YAOA 1NBVH 5D2LB 3VH8A 4ONHA 4WDIA 4U6XA 1OQOA 3QXAB 2GTZB 3TFKC 5HYJB 5DDHA 2ZICA 5CWSB 2NNRA 1ETB1 3VMPA 5EBWA 1T6BX 4RMWA 1DO5A 1W0WB 1EK3A 3TTYA 2JELH 3GSOB 1N64H 3J2PA 3D3VD 5EIIA 1I8LC 2CO7B 2VMCA 4YDLB 1I3VA 2CNYA 2GYSA 4AGLA 5BS0A 3ARPA 3EFFB 4PI2A 4F8NA 5DK3A 4GAAA 1O9WA 5EOQL 4JUTA 3L1OL 5DMKB 4EN3D 2PYFB 2UZYA 4Y19B 1KTRL 3DV6B 3MUGB 4W6WB 5GGTA 4XNQB 1N5YH 1W72B 2X10A 1TIUA 2XU9A 5JHLL 3TASA 4MA1B 2GHWB 3TT1L 1GZQA 2NX5B 3APCA 1YLBB 3B2PA 1NUNB 2KPNA 1BZ7A 1SMDA 3PJSA 1OGTB 1AHMA 3P9LB 4HHAA 2WZAA 4F5CA 3QZPA 2FJUB 4HUMB 5DHYB 2VCOA 3GI9L 2VM9A 2AEPL 3H9SE 3K74B 4YHKH 3SCMC 1SYSA 1I8UA 3D08A 3FRPB 2W94A 3SBRA 1EO5A 1FAIL 4WV1B 3NCYS 5HHVH 5K9JH 3QZWG 4KPHH 5J1AB 4O4YH 4P2RD 4F57L 4G6KL 4LSRL 1JCKA 1PX3A 2IQ9H 5DJXA 4WJ5A 3UTTE 5EPMB 2B9BA 1L0XA 1JV2A 1B0GA 3CN1A 2DBLH 2ATPB 2JK5A 2W07B 2F7IA 4JO3L 3G6DH 3T0EB 3LZFL 2ZKWA 2WZ6A 3TNNB 2PPFA 4NUJA 3WGUB 1HXMA 4O9HL 2YMXH 2NNCA 3TBSA 3BKJH 1KIRA 1UCTA 2F5BH 4PJ5A 4X2UA 4JE4B 3OHXA 4PWJA 1S9VA 2NY1C 2XA8L 2NY2C 1PFOA 3GKZA 2V3FA 5CZVL 4LASL 3HVNA 4TVPH 3S3PA 1MQKH 2BNUA 2AK1H 3DOSB 4NQCB 4AQAB 2V5SA 3GMNB 3VXRA 4IRJB 1AC0A 1OGAA 1K85A 3AC0A 5DD1L 1NEUA 3U2IA 4FF9A 4I89A 2ZSVA 3UZEC 4X5XA 3ULUL 1W91A 2VL4A 5CKGA 4ATTA 1FVDA 2EZ0C 4GP4B 4UT6H 5IMOB 3WE1A 5CSGA 1X5YA 3G08A 4MVBC 2ZAHA 5AWNH 3FQXB 1ZTMA 3EJUA 3MACH 3LEYH 3QPXH 3F12A 1XIWA 3QUXC 3BGAA 1H8NA 3AQYA 4OR1A 2EIKB 3ARBD 4OLYL 1J8HB 3CMOH 1XB6A 5CJBA 4IBVA 2BNRD 2OMWA 3LEYL 3QPXL 2W9EH 1CI3M 1MAMH 1VZHA 5I1DA 3H9HA 2X4OA 1B88A 1Q9KB 1Z6JT 2OCJA 4I0PD 4M7ZB 2NXYC 1OM9A 1GGYA 1NMAH 5E9DE 5FYKE 5BQDA 3FFCD 4P59H 4X8XA 3F83A 3OD3A 1LNUB 4FXGC 4GSDH 1IE5A 3MLPA 2W0KA 3V0DA 5T1JA 3QAQA 1RJLB 3QUKA 4PJ8A 1MUJB 4GKNB 5TPWH 4JZNA 1DBKL 2AJ3A 2H3NB 2ITDB 5TE6H 4U6HA 1PAZA 1QW8A 1JNNL 3V6BR 2HG0A 3QNXA 3QEQA 3PIQA 4AYMC 3TL5A 4YS4A 5IEKA 4U3SA 2PCPA 1CZ8H 1PJ9A 3ML9A 4KV5F 3FUFA 1KJ2A 1T5WA 1QLEH 4LKXA 3L3KB 4H8QA 4OF0A 3KYKL 4L29B 5F0LB 1NGXA 2ICES 2R0KH 5D9SB 4Q6IB 1EGJA 5IJKC 2JKTM 3AT0A 1E30A 2ORBL 5TE7L 4F7EA 1G87A 1NDMA 3ZE2B 2DKSA 3VGGA 4FFZH 1VFMA 3CWGA 3ZZ1A 3K81A 4MJIE 2Y2WA 1CXKA 2JJTC 3JXAA 4QRQA 3QWQB 3HPJB 2VITB 2P5PA 3DRQB 1FGVL 3OC8A 1ET5A 3CLEH 1NIAA 2P5EA 3FTVA 4FKKA 4UAOC 4UT7L 4WCYH 5L2KD 2ZF8A 4APXA 4BUGA 3D30A 3FB7B 5H2BB 3EF7A 4TNFA 4WWNA 4PJDF 2ZXGA 2YD6A 1I1YA 4PS7A 5DRZB 2EXYD 3L1FA 3RPIA 1A6WL 2V4LA 4ICXA 1MHCB 1JVOA