3AZUA

X-ray crystal structure of the two site-specific mutants his35gln and his35leu of azurin from pseudomonas aeruginosa
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSQPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of the two site-specific mutants His35Gln and His35Leu of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
molecule keywords AZURIN
total genus 34
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1991-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3azuA00
2OCCB 2Y69B 3H4HA 4E9YA 1F56A 1JZFA 1KCBA 2YARA 1J9RA 3C75A 5B7MA 4UF7C 4A2GA 1AOZA 2OV0A 5FC9A 3UGEA 2FT7A 1IBZA 4BWWA 1MG3C 1AS7A 3DKHA 3UAEA 1E5ZA 2FNWA 5E9NA 1AZBA 1YLBB 4TXVB 1ASQA 4WTQA 3IN0A 2VW6A 1JVLA 3PAUA 4M3HA 2PCYA 4G7QB 4DPAX 2DWSA 2XLLA 1QLEB 1CURA 3KW7A 1KV7A 1MZYA 1A4BA 3EH4B 5I6MA 1ZDQA 1L9OA 3BVDB 1SDDB 2XVBA 2Q5BA 2BZCA 2GSMB 1AZUA 3NJKA 2HX7A 3FSVA 5I6LA 2VM3A 3FQYA 3HB3B 3NJGA 4G7RB 3OM3B 2DYRB 3NP3A 3CVDA 4BWTA 1W8EA 2PPAA 2AVFA 5I28A 2XX0A 5D4IA 2YQBA 1L9PA 5B1KA 1SNRA 3ZDWA 1NWPA 4L0PB 3EHBB 2A3TA 1JZIA 1SHXA 4HCFA 2J56A 4E9RA 1PZCA 1J9QA 2HRHA 3X1BA 3IE9A 2AZUA 1JZEA 4MFHA 3ABGA 1V55B 1ASOA 1UATA 3GDCA 4GP8B 3NSFA 2YAOA 1SF5A 2QPDB 2PPCA 1NIBA 2PPFA 1PCSA 4AKPA 4GP5B 4UAHA 3EF4A 2W8CA 3ABLB 2YAFA 3S8FB 2HX8A 1PLCA 2WSDA 3S3DB 3NSDA 3PLYA 1PY0A 3H56A 4X4KA 2XU9A 1BYOA 1M57B 1B3IA 2IH8A 1SFDA 2EIJB 3ABMB 4M4RB 2IDTA 2I7SA 3NT0A 3UAAA 1PZBA 3TU6A 5D4HA 3FPYA 4PCYA 1WA0X 2H3XC 3PAVA 2TSAA 1NIEA 1VLXA 1NWOA 3S8GB 3BQVA 3NJMA 4BXSV 1XB6A 2FT6A 2CALA 1KBVA 4HHGA 5TK4A 3WNIA 1PF3A 2WO3B 2YAEA 3FQ2A 2BWIA 1ID2A 2BHFA 2BZ7A 4E9TA 1N70A 1ZV2A 1NTDA 2DV6A 3AZUA 4G72B 1OCCB 1EZLA 3V9CA 4KOCA 2XYBA 2FJSA 3CZUB 1NIAA 1BQ5A 1AAJA 2RACA 4KO9A 5ANHA 4RH4A 5I5IA 1MDAA 2Q9OA 3GXUB 5I6NA 1GS6X 3FT0A 3PCYA 2NRDA 5B7FA 4P5RA 5I5JA 2UXGA 3QJSB 1PMYA 5F7BA 2XV0A 2VM4A 2PP8A 2VN3A 3CG8A 1AG6A 1ZIBA 2UX7A 2FWLB 1DZ0A 3NJLA 4KO5A 1JZGA 1JOIA 2XV3A 1PNDA 1GR7A 2PLTA 3X1FA 3DTUB 3WI9A 1OE1A 2OJ1A 4AKQA 1KCWA 2QDVA 4YSUA 5EHFA 1FWXA 1GW0A 1QNIA 3T6ZA 2J57A 1OF0A 1E65A 1PLBA 3G5WA 4Q8BA 2J5WA 2J55A 1PZAA 3TBCA 2UXTA 3S3CB 5PAZA 5I6PA 3FS9A 3T71A 2GIMA 2JKWA 2HXAA 2X87A 4GYBA 1AANA 1J9SA 3FYIB 3V9EA 3OMAB 4GP4B 1X9UA 4UANA 2PP7A 1JZHA 1T5KA 2YAMA 1SDDA 3CVBA 4KNTA 3FU9A 4K9JA 4N8UA 1JZJA 4HHWA 4YSAA 1AR1B 3NJHA 5A7EA 2DWTA 3NYKA 2XXFA 3ZX1A 4BWUA 1ET7A 4DPBX 2FT8A 1A65A 1QHQA 4FAAB 2WO2B 4W1TA 1ILUA 1E67A 4G70B 4BK5C 2HLEB 2XV2A 3NJJA 2PPEA 7PAZA 4HCGA 2H47C 2GI0A 1KDJA 4HAKA 4HZ1A 3S3BB 3MBWB 4BXVA 2QDWA 4DP2X 2IWFA 4DP8X 1WA2X 2AFNA 2IWKA 2I7OA 2MRYA 3JTBA 1SF3A 3OQRA 1ZDSA 2EIMB 4DP5X 4GY4A 3T6WA 3WKPA 2UXVA 4KO7A 4JKNA 2IH9A 1M9WA 4DP7X 1OV8A 4YSQA 2BP8A 3QJVB 3OMNB 1HAUA 2GC7C 3MX0B 1KGYE 2R7EB 2VSKB 1ASPA 2VW4A 2UX6A 3DIVA 5TK2A 1WA1X 4DP9X 3L45A 5I5MA 2FQDA 2E86A 1GSKA 5I6OA 1AACA 1NINA 3ASOB 5IY5B 4Q89A 2EINB 1JVOA 2PPDA 4ZK8A 3CDZB 3X1GA 4G71B 3NJIA 3KW8A 2QPEB 2FTAA 1CC3A 2GHZA 4YSOA 2P80D 3JT2A 3TBBA 5B1AB 1CYWA 1X9RA 4BDVB 4KNUA 4HCIA 2IDUA 3AG3B 3WKQA 4YVNA 1WS7A 1ZPUA 3T6XA 3T6VA 4E9SA 4YVUA 3ASNB 2CUAA 1IKOP 3IN2A 2TSBA 3N2JA 1J5CA 2BP0A 2I85A 3NP4A 4EF3A 2BW5A 2JXMA 1A4CA 3FSZA 1KBWA 5AZUA 5LDUA 1ZIAA 1NDTA 1V54B 2BP8B 3WNJA 1M56B 3PXLA 4YSCA 5B7EA 2W88A 1HAWA 2XUWA 1NZRA 7PCYA 1ADWA 1TEGA 3X2QB 4F2FA 1E5YA 2IDFA 4W9ZA 1AZRA 1N68A 2JFCA 2QT6A 1RCYA 3FU8A 1L9SA 2FQFA 3UADA 1W6WA 4A2EA 1J9TA 3NJNA 3TASA 1IC0A 1GS8A 2BWDA 4JHUA 1JXGA 3FU7A 2BP0B 1ET8A 4AZUA 1FA4A 1GYCA 1CUOA 4A2HA 2YXWA 2ZOOA 4A68A 2HX9A 1JXDA 1OCZB 4E9QA 1ETJA 4YSEA 1A4AA 2GC4C 2VW7A 1OCOB 2YAPA 1URIA 4E9VA 2BW4A 4AKOA 2R7EA 2VMJA 1MG2C 3EH5B 5B1JA 3X1NA 1EHKB 3T9WA 2FQGA 2XX1A 3CDZA 2EILB 2CCWA 1TKWA 4A2DA 1PAZA 4HALA 4CSPA 4BDVA 3QJRB 5I26A 3NSCA 2H5UA 1AG0A 3OMIB 1BXUA 1NPNA 1BYPA 3PPSA 4NAJA 1FFTB 3FSAA 3QJTB 2IAAC 2XWZA 1KYAA 1L9RA 3AW5A 4G7SB 1BEXA 1V10A 3AG1B 3IBOA 3UABA 1ET5A 2XXGA 4DP1X 1DYZA 1W6LA 1OE2A 3QQXA 1NICA 2DY2A 2ZXWB 1NIDA 1AS8A 3FU7B 3WG7B 4KOBA 3H4FA 3EH3B 3AG4B 2YXVA 4KNSA 4N4YB 4PAZA 4DPCX 3UACA 1KDIA 1RZPA 3FQ1A 1JXFA 1HFUA 1SHWA 3SQRA 1BXAA 1GS7A 1ILSA 5B1BB 4A66A 4KO6A 4NB7A 3U25A 2HRGA 2PP9A 1PLAA 1AQ8A 2AANA 1L9TA 5B3SB 3HEIB 1J5DA 2ZONA 1I53A 3NSYA 3X1EA 4AX3A 1WS8A 1BQKA 1SJMA 3ABKB 1E30A 2IWEA 3ERXA 2YAHA 2P80A 4F7KA 1AIZA 1SFHA 2YAQA 3QJUB 4QKTA 3RYMA 3PAZA 4DP4X 3FYEB 4JHVA 4E9WA 3TA4D 1OOWA 6PCYA 2UXFA 2VSMB 5F7AA 1GY2A 1L9QA 1NIFA 1IUZA 4YSDA 3QJQB 3SBRA 3IEAA 4DP6X 3CVCA 1TEFA 1NPJA 2IDSA 2CBPA 4A2FA 4AI7A 4QLWA 1GY1A 2HZHA 5B1JC 3AG2B 2CJ3A 4HIPA 3ZBMA 4CSZA 3WIAA 5AFAA 3ZIYA 4F2EA 3QPKA 1IBYA 5D4JA 1OE3A 2AZAA 1XB3A 1AS6A 1TU2A 4YL4A 4DP0X 2B08A 1CYXA 5AKRA 2ZWNA 2B3IA 4P5SA 1JERA 4NERA 3AY2A 1A8ZA 2MTAA 2BO0A 1BXVA 3D12B 4YSPA 3SBPA 4YSSA 1PNCA 1MZZA 1R1CA 4YSTA 6PAZA 4YSRA 1RKRA 3N55A 5PCYA 1OCRB 1AZNA 2IDQA 4FA7B 2PCFA 1BAWA 1XB8A 3FSWA 2DYSB 4WKXA 2LLNA 8PAZA 1RZQA 3OD3A 5I6KA 1BQRA 2CAKA 2N0MA 2EIKB 2GBAA 2Y1AA 1XMEB 3GYRA 1WAEA 3NJFA 9PCYA 4E9XA 3SBQA 1A3ZA 1AZCA 2X88A 4GXFA 4ENZA 4A67A 2GB2A 3FPXA 2FQEA
chains in the Genus database with same CATH superfamily
2Z6FA 2OCCB 4K94H 1NCDH 4HKXB 5F70A 4WWOA 2O5XH 3P9LA 1EEQA 1UYWL 2CBOA 1GPOH 2WZAA 3I3BA 3MV11 2HMID 5A16A 3BP4A 5I0XA 2JCWA 1AYOA 1WICA 3ALWA 4O2FB 2HT2C 3MZGB 2LFEA 4B0MB 1KCKA 3UAJA 2E5EA 4WTQA 4XNZB 1FNGB 1AJ7H 3CUPA 5B21A 1E42A 4ZMZA 2CD0A 2X44D 5HGAB 1FPTL 2D2CC 5AOJA 4C55A 2F5AL 3MR9B 4D3CL 2HVKB 3O0RH 1XR8A 3FQRB 5I6MA 2P24B 4AMXA 5MEOB 1KT2B 3J7HA 2A9MH 3VXRE 1JZ5A 3FO9B 2YPLB 3NJKA 2OTUA 1RHHA 1R5VA 5FUZH 4FI7A 3FT4A 2J2ZB 4A1RA 1BOGB 1NC4D 1T7YA 1WHOA 5E08L 3E8VA 4PW9A 1KFAH 2UZYA 2EDLA 4PJEE 1MCIA 5D4IA 5IHUL 3ZYJA 4J3XA 3BD4A 5B39A 4PJBF 3I9GL 2D3JA 3O41A 1K5NA 1ZA6B 1ERNA 4IQHA 4WO4C 4RSVA 4ERSH 4RMUA 5ACMA 2P8LA 5C08E 2MQ3A 2WLYA 5B3JE 1R3LA 1YY9D 1N67A 1M3JA 2YEZB 1ZT4B 1T0OA 1FZMA 4L8CB 5HYJB 3GDCA 3GXIA 3SYQA 2MKLC 3N3EA 1A9BB 3MGTA 1NGZA 1PFCA 3C6SB 2YAOA 4ZMNA 4AENB 2AF2A 5DQ9A 5KANG 1NIBA 3RDTD 1LE5A 4JFZL 5KSBE 1KXTA 5C0DB 4GP5B 3HRZC 5CSZA 1FLRH 3WIFB 4N2MA 2EDFA 1KBGH 4CGUB 2Z92A 4PJIF 1K85A 4O51A 2ROYA 1J8HA 4BH8A 2VMCA 3D9AH 2WXLA 3STLB 1QFHA 2WWMC 2IH8A 2AJSH 2EIJB 5ERWA 2BNRE 5IB4A 2XWJB 5D4HA 4PCYA 3IPBA 1LDPH 4C58B 1NC2A 2PETA 3S96A 4K9EL 5KBNC 5DD0H 3BKYL 1KCSL 3DXAA 3GNMH 5E2WL 1LD9A 2Q1EA 3GS4A 5TK4A 3MLVL 5FM5O 3WNIA 1MFDH 3FQ2A 2YK1L 3ULAB 2ZE0A 3DNKA 4XXWC 1N70A 3ZUCA 4Y1SA 2IPUK 5AYTA 3EYOA 2DMCA 4MNHA 2MWCA 5EU7C 1MIMH 3TO4B 3ARZA 3HI1B 4EDXB 2UY6B 1ZHNA 2DEWX 4KJPC 2DI8A 1HZKA 1AAJA 4F8LA 2ENJA 4QO1B 3TOPA 4WW2C 3EJPA 3TA3D 3V0GA 1IRAY 2YPLD 4XN5A 2V0AA 2ZOKB 1DJSA 2BM3A 2ZCZA 4FTVB 3B3BA 3KLDA 5HJ3A 2FSEB 3GSOA 4G8GB 1W16A 4NQCB 4OGZA 2PP8A 3VQ1C 4OBSA 3VAEA 4DFHA 1F8TL 3QNZB 4Z3JA 2OMXA 2UX7A 1R0AL 1U6AH 2W9EH 3RWHA 5C7XL 1USQA 3L6FB 1VZGA 3DTUB 1KCWA 4AKQA 1ID5I 4DGVH 4UV7L 1MH5B 3GQFA 1TZ8A 1F6AB 4RZKA 1JF6A 3FFDA 4AG4H 2X2UA 3H54A 4G1MB 2KS0A 1ZHLB 4J3BA 5JHDE 3GRGA 4J6RH 4JFXB 1HKLL 3L4ZA 4YK4B 5D7LB 4PB9L 5TD4A 1T2JA 2B20A 4CMMA 4Y19E 5C0AD 1U8NB 4QYAA 3ATBA 2Z7WA 3KEHA 5KW9H 4UIKL 1JG9A 1KWGA 2X87A 3ISRA 1KCRL 3HC4L 4KK8D 4WIQA 5IG7A 3GBNL 4QR7A 4LIQL 3S7GA 2RTTA 4LF3A 1N0XL 4MKTA 2JMRA 2KPWA 2WWMD 2ZCKL 3Q6FB 4OCSH 4NDMA 4FQHA 4PJEA 5IBTL 1LO3H 4HLZG 4WU7A 2DRUA 3AU0A 4PWHA 2V6HA 3PABA 3HE7B 3MCG1 4ZMVA 5JLZA 1IAKA 2E0PA 5G5DB 2R39A 3HBGA 3M17A 3ESNA 4P5TA 1ET7A 3MNWA 4OB5L 2Q8BL 5HGGS 3WTXA 4G6ML 4DKAA 5DJ8A 4UV7H 4JFUA 1J05B 2EEFA 2WWKT 3H3PL 3NGBC 4LCCB 43CAB 1LMIA 2XN2A 1UWEH 4GW4A 4S0TD 4DGWC 1Y18A 4G70B 4PWFA 1IQWL 3FT1A 5SWSB 1MQKL 5T3XH 5TE7H 3WGVB 1TETH 2PPEA 4N2OA 5LQBL 3MYZA 3NFNB 2A6KB 3L3OA 1RIVL 2ZAHA 4HF5L 3SKOA 4HZ1A 5IQMA 3OHXA 1ZHKB 2NT1A 4DP2X 1S9KC 3WN5A 3QVAA 4L48A 3QUYC 4RMSA 4BGDA 2ENQA 3S5LA 3KD4A 3L13A 3FF7A 4ZSOA 4JZOB 1CZ8H 4TTGA 4HULB 4NLAA 4R96B 2F53D 2IH3B 5AOKA 2VQ4A 2X1OA 4NQEE 1UT9A 3ALPA 5LNGA 1CXHA 5CZRA 2Z31B 2RGSA 3L8QA 3PREA 4ZW5A 3FCGA 3FRUB 1CWVA 5C09B 4OV6F 4Z3HA 1MNNA 4JRYA 4Q6KA 1JHTB 2R69H 2R7EB 4GNKB 1ZWIB 3NIDF 4FS0A 4NJ9L 2XA8H 4RGMC 5IGXL 5I73C 3F7PC 5D5ME 1BMGA 3Q0HA 1T0NB 4Y9EA 2KYIA 2R0LH 2RQEA 3VE0A 3WTVA 4E0RA 1R5WB 2QKIA 1GSKA 4P2QD 4YGAB 5JOPD 5C0BA 3GSXB 3ZE1B 3VFMB 1YY8A 3K1KC 1YJDC 1MCFA 5B8CC 3GZQA 5CR8A 2Q2LA 4G71B 4UIMB 4LSQL 3MNZA 1D2OA 1CC3A 4OGAC 3RKDC 1S78C 2QEJA 3ULSB 3P0YL 1VF5C 4LASL 3O6KL 1HH9A 3TCLB 4MZRA 3QI9D 5EU4B 3BKMH 4MX7B 2VO5A 5IT2H 4WEMB 2C7UA 1RIHH 1W8NA 2DI7A 2OMWA 2Z31A 2VAAA 1MNUH 3QXDA 5ISZA 5I1AA 5I15L 4ANUA 4R4NC 4XZUA 1B90A 2CUAA 1RUKL 3SO5A 3OKLB 4JUSA 4HJEA 4NHUB 4U33A 4FP8H 4AIOA 3NFPA 4Q58C 3V4PB 1SJEA 3FSZA 5HHOD 4L4VE 1A14H 2FBOJ 2IPKA 2BP8B 3I74A 3ZE1F 3LEXB 3KPSB 2NY1C 4KKPA 2X1QA 5E2UL 5FX3A 5MHSD 4J39A 4YO0B 5E2TL 1Q1JL 3SKOB 3WE6B 3KLQA 2JCCA 3GFUA 2NY1B 3GMQA 4CADA 1MFBH 4NM4H 3V8CA 5D1ZA 3TWYA 2CBMA 1LP9E 3BZFB 3O8XC 4OCMC 2XQYK 3ARED 2XBZA 1PY9A 3IXAA 2XY1A 3IK2A 3V95A 2GAZB 5SX4H 5E9DB 4D7BA 5CCGE 1QTYT 2J1YA 5FUCC 5FYKH 4Y2OB 1JWSB 1MFMA 3NTCL 1GYCA 2MCPH 4FG4A 4DUWA 2VL4A 3SE8H 5EU5B 1X5ZA 1DCLA 2OYPA 5CO1A 4QGYA 4YC2B 5FWRA 5KYWB 1BG1A 5CEZH 4X9IA 1JGUH 4JO2L 3RL1B 5IB2A 2VDMB 4AGMA 4HH8A 4PRHE 1U8NA 3RL2A 1MREH 3EYSL 3MOAL 3KPRA 2W07B 3II1A 2DKMA 4MDIA 2JJTA 2C7UB 3F85A 5DC9B 3PV6B 4W6XB 1IBGL 1MHPH 3LXUX 3L2LA 4PV9B 1I75A 5FYJL 5D6DC 1K4DA 2KT6A 4RGNE 4XCCH 5IHZA 3L7FB 3KPSD 3CFEA 3BQUA 3Q5TA 2YOCA 5GZNA 1CDHA 1B2WH 1FFTB 4U1KB 1YPZB 2D03L 2DIAA 3WY3A 3MLRL 4GAFB 4J3OG 4PREA 4D94A 4G80A 1IZJA 2OW6A 4PJGA 4TSBH 1ET5A 4ES9A 1OGSA 4EZJA 3KLKA 2X89D 3ZZLA 2YGQA 5EIQA 4B9ZA 3WG7B 4ODTL 3O2WH 4M56A 3VWJC 4XNDA 5CEZL 1UC6A 5AW4B 5BRQA 1IAIM 4HD9A 1AE6H 4PAZA 2Y5TB 1AC0A 1NUGA 1PYWB 2VMDA 1LWJA 4Z78A 3B2VL 5H4YA 4A66A 5I8EB 2OJEA 4ZXBB 2DQFA 4X80L 1TQUA 2ZYRA 5GGTL 4JN2B 5FO2A 5FHBH 5GZND 1A6AA 1CD1A 1SJMA 3CH8A 3WHXA 3IDUA 3GI8L 3OKOA 1AIZA 5F8RC 1FSKC 3KPLB 4OFYD 5HY9A 2CR6A 1JRHL 1E3ZA 2BVOA 2BRQA 2WYZA 4HS3A 3ZLQC 1JGIA 4MRBA 5C3IA 4YSDA 1FZKA 2WQ8A 3REWB 2WLMA 2XN0A 1CI3M 1TSHA 1TEFA 4AI7A 2EDRA 5DHEA 1OZTG 4XXCA 2EDNA 1KTJA 4JQIH 1PZ2A 3CD4A 1DFXA 3VFSB 1URZA 3IMBA 2ENSA 1TZIB 3MA7A 4MLIA 3V0DA 5E8EA 1T04B 2B08A 2QBWA 3TFKD 5KVGL 2CIKA 3KPTA 2UVEA 2VLMD 5ADPH 4X6FA 4Y1AE 4X5LA 1OGAE 4UZSA 5TFSL 4C56D 4JVPA 2R0ZH 3MCKA 2E7CA 1J1OH 4F2MB 4O5LL 3SOTA 3GBEA 2V3FA 1LNUA 4MXWL 4KVCH 2ICEC 2W60B 3HS0C 4UQ9A 5IB5B 4PJ7F 3FN3A 5PCYA 3UBXB 3L9YA 2Q8AH 1H8SA 1HI6A 3SE3C 2W60A 4KXBA 2ICES 2FYVA 2PCFA 4WV1A 3H9SB 3L3KA 5FHAH 4HS8L 4DIXA 3QEHA 4G2AA 1S9XB 3EOAA 1TJIL 2DLGA 4NO3A 3UO1H 3DUSA 3RWCB 3FOLB 4Z3FA 2QZ5A 4M48H 3BEWA 4OLWH 1BAFH 4AEIH 1ES0A 2CIKB 2F7QA 3QWRA 4LGPB 3ARWA 1M9SA 1GGIL 1DCEA 2IEPA 4NQEA 4GXFA 1VEPA 5FM5M 3W9EB 4DVBB 1W0WB 3T77A 3R19A 3FO9A 1FNEA 3B2XA 5ECJE 4Q9RL 5C7ZA 4XOAA 1A3LH 5C0AB 4Z3GA 3CQQA 2DL2A 2OV0A 4PRPE 4A6YA 4QOKD 2E7MA 2MH4A 3VGEA 5E95B 1IBZA 3HA0A 4CBPA 2NTFA 4X6BB 4Z7QB 4UQ2A 3A6CL 5F3HB 2VJ0A 43C9B 4Q2ZA 5DZOA 1MUJB 1FNGA 3CUPB 5AOMA 4PCKA 5AW9B 1N4XH 4HMEA 4OFVA 2PCYA 3LXBA 3MBED 3JWOL 2H45A 4J6IA 3HJ0A 2LT9A 3BP4B 3PGCA 4P2QA 1OW0C 1UZGA 2ZXAA 2ZX9A 4M61A 5TQ0H 1G9MH 3RVWD 1G4MA 4NENB 5F7DA 1C5BL 1M6OB 1DQJB 4BSJA 1TJHH 2GJZB 5AYUH 2R1YA 2CRYA 3HMWH 2ZKXA 5IVXE 5IIEA 3FSVA 2V7NA 3B1TA 1J0KA 3FQYA 3KYNB 5J6HB 1IEBA 1EAJA 1MCDA 3P1VA 2Q7NA 4LEXH 4BWTA 3CFTA 1W8EA 3H53A 4XXDB 1J5OH 3FB7A 3QJFA 2Z31D 2EICA 3I75B 5INDA 4YIQB 1NWPA 4IRSB 4UILL 2A3TA 2NUPA 3EJSA 4V1DB 3ZL4L 1P7KA 2DLEA 3O3EA 3QXVA 1SHXA 4IDLA 8FABB 4PREB 4BFKA 3KAAA 2FD6L 3TV3H 3PFUA 3V0VA 1GZQA 3RUGA 2VNCA 4N90D 1NGYB 4F5CA 3A47A 3O4LE 5IHZB 5SX4I 1E27A 2R1YB 4FNLL 4JFOB 1XHHA 4ZXBC 2YRLA 3HE6A 1WC7A 2N7SA 3F3HA 4J23A 3VDBA 5G55A 2C1OA 2ZXGA 3DV4B 2YEZA 5HDBF 4MNQE 4KK9D 1IC4H 1YC8A 2CXKA 4FZEH 2WSDA 4FG6C 4LEEA 5DA4A 1F4XL 3BPOB 4JDTL 3RGHA 4LEXL 5AVUB 1BYOA 5HBBA 1EV2E 1DANT 1MUJA 1UOWA 2VDRL 3D25A 3L17A 5EOQL 3MV7A 2XA3A 3WNPA 2R2HB 3DX0A 2CJSA 5DJAA 1XH0A 4JL2A 3LZPA 1S46A 1GYWA 1IQDA 4WFFD 4B9PA 1VENA 3RVVC 1ROWA 2KDGA 1X4XA 1P4UA 5SX5K 3ULUH 5E0QA 1OAYH 5E6IC 4JJ5B 4PGEB 2CMRL 3T3MF 3IXAB 4OT1L 4ELMF 4O2EB 2JCCE 1GA2A 3DRQB 3D39E 4ELKA 1BV8A 3LN4A 4MGXA 1N8OE 3O8XD 4FLOA 1RIVH 1R6VA 1QA9A 4RH4A 2H32A 3FFCE 3O3BA 3E3QC 4NUGH 5DT1H 3UTPE 3W39B 3FT0A 4HFUH 3QC5X 1S7SB 1BWMA 1XV8A 3HR5B 5AUMB 1I85C 2UZPA 2DQDH 1PMYA 4IU2B 4ZNCD 2PN5A 1YEGH 2VM4A 1DO6A 1NCJA 3QDMD 5DMIH 2GCYB 2XG5A 4GG6A 2J25A 4HIJA 1V7NH 1IGCH 3HRZA 3ATFA 1MHCA 3X13B 1Q0EA 4ORGA 3MV8D 4JPWH 4APQA 2E7HA 1KTDA 1WD9A 4HJ1A 4U1GC 4X42A 1UD4A 1JGEB 2K6ZA 3W9DB 1U4EA 3QRBA 2OMTB 4ZYKA 4YDVA 1OGPA 2BS71 3VFVB 1IM9D 3ZMRA 2W91A 2VRQA 1OO2A 1BEYL 1CZ8L 2EXSA 3VO0A 1U93A 2V5MA 1UT1A 3QDGD 3WKNA 1CT8B 2A74B 3RX9A 2UXTA 1LO0L 3MRJB 3K5SA 4PTUA 4ETQA 4W9GC 1CL7L 3V0IA 4YBQD 2YMTA 2E9BA 3KPLA 4DCQB 1X9UA 1IL1B 1R3HA 2FIKB 1F18A 3UYPA 1QUNA 2PTVA 3TIDB 3WXVL 5IW3A 3BAWA 2XZCL 3JV6B 4IJ3B 4JFFE 4RA3A 2JV6A 4R8WH 1I7TA 4XP4L 4ZO7A 5EPMA 3G6JA 5AW1B 1MWAL 4BWUA 2APBA 5I9QC 2WCGA 3GJFH 4GINA 3ATEA 4DT2A 4OF6A 3LH8A 4PJEF 5DEFA 3QDGE 1JV2B 2V4LA 1M6UA 5EZOL 1ILUA 3MJ9H 2VLJE 5HDOA 3TNNB 4L8SB 1T2QH 2A74C 1U9KA 2AAAA 1QBBA 2FH8A 4OQTA 2IWGA 3TNMB 1XD0A 2EE2A 3QORC 3KWWA 4XO8A 4M93C 3MV8B 3PUCA 1WEJL 2K3HA 3QPXH 3C5ZC 5LXGL 5E1HB 5ESAB 3QDMB 3T77B 3KWVA 4Z7WB 3L3GB 4DP8X 1U8OB 2AFNA 3JTTB 2QVIA 5AG8A 4GLRH 2B2XH 1EQWA 2UV3A 4P59H 2BSTB 3KBHE 1ES0B 3DYOA 4IJ3C 1ZY9A 1K4DB 1HL9A 2YR3A 5F2FA 4LL9A 4NHCL 1BQHG 1SDYA 3SGJC 5L9DH 1BFOB 5ISZD 2IH9A 4YE4L 5AAMA 3HB3D 2O4EA 4H40A 2W92A 3TF7C 1SJVA 1QQDB 4N2CA 4YFLF 2ZCHH 1NMAL 1DBBL 3MX0B 3RL2B 3MJ9L 4J3OC 4E41E 4TNVF 4GRWB 1JN6A 4MXQD 2V17H 3RL1A 1U2YA 2UX6A 1MCSA 1AKJB 4FFWD 4FKHA 4H7VA 4PB9H 5AW0B 3RNKB 5AVRB 3T4AC 5D2LF 4N2BA 4KKNA 5IY5B 1AP2A 3C9NB 2Z34A 3NIDB 4N28A 2P8MA 2QVFB 4AC4A 1JRHH 3FONB 2ZUTA 4XH2B 4H1LH 1DQDH 4WDIB 2J1WA 3U7WH 1SVBA 1T2XA 4YSOA 4RETB 2P80D 4XOCA 3BRDA 4UBDC 1GH7A 4HJGA 4ZUWA 4PJ6A 3VXQB 4U6XA 1MRCL 3SDAC 4ZNEE 3N43B 2DH3A 3LQAL 4P3DB 5KYXB 4EJ1C 3KDMB 1PD6A 4MS8D 2EE6A 3CX2A 2X4RA 3CWGA 3FAWA 4X99B 4ZX4A 1PSKH 3CU1A 3EFOB 1GW6A 3AWFA 2FHCA 5IVZA 3W0WE 4EF3A 5DTFB 4ZQTA 2ZPKH 5JZ7C 1GPOL 3J2PA 5FUCE 1NBVL 1V54B 3A67H 5JQHC 1M56B 1YVLA 1FN4A 4HWUA 5ADOH 1DJIA 4KV5E 3KG5A 1XGPB 2YRBA 1XR9B 1OPGH 2XWTA 2IMNA 3WXWH 2EUWA 3NESA 1BMZA 4HQQH 2D3NA 5GGVY 3F7VB 4NHUA 1KIRB 5I8EA 1OP3H 4B3EA 2OTPA 2F61A 1DDHB 2DDQL 3FU8A 1YEFH 2D0GA 1JWMA 3BT2L 1E9QA 3RP1A 4NQDE 4BINA 5HVFB 2EAEA 1KJ2A 4U3CA 4APXA 4GXVL 4A7SA 1C16A 1QEWB 3ESOA 3FB6A 2JXMB 3BPLB 5HGHB 2AJ3B 4LPVA 3EHBC 1WAAE 2HFEA 1KJMA 4Y4KC 4MMXC 1KXQE 3QWNA 4NN6C 3F01A 2KC0A 1H5BA 1U93B 3Q8FA 3OV6A 5CU9A 2Y4SA 3E9TA 5EF1A 3GSQB 5DR5L 1AOHA 1IGML 2EVFA 2R7EA 4K9EC 4N26A 3MV9B 3EH5B 4YDVB 1PZ5A 1Q94B 2X4UB 5MEND 5KSUA 1KFAL 4LO9A 1PJWA 4YLCA 1FFRA 5DD3H 2X4OB 1J18A 3ATAA 4NUJB 3UIZA 5GGUA 5TQ0L 2CJUL 4QOKE 4F9PA 3EJCA 1EAQA 1CFVL 1XSOA 1ZANL 4EIZC 2AJUL 4MASA 4MBOA 4G3YH 3L5XL 2IPUG 3PG2A 4ZXBD 1OW0A 32C2A 1K8DB 3KYKH 3TX4A 5F0LB 3WAKA 5FKPA 4Z7OF 5IQ7L 3T2NL 3P3TA 1BDYA 2C1PA 5DJZA 1NICA 1CU4L 1AS8A 3N0AA 5CBEB 4NQXA 5MP6H 3AVEA 3DVGB 1XF5B 4XN8A 1A3RH 3GKWH 4HBCL 4KNSA 1G9HA 3S35H 5DWUL 4DPCX 3DHMA 1A3QA 1P1VA 1BGXL 1OAXH 4JJ5A 1TQCB 1B4JH 3UL4A 3O4LD 3UTSB 1U33A 5MEOA 1FV1B 1PKOA 3VM7A 2WBKA 1GZPB 1G6RL 1GMEA 4JX0A 4GQPH 4P5KB 3MR9A 4G5AA 4BYHA 2RCSL 3BAKA 1R3JA 2IWEA 2PTTA 1OPOA 4FNSA 4P2RB 1QLEL 1EAOA 1ZS8B 1ZV9A 3MODL 2MIZA 1YEDB 2VMEA 1SJEB 4B6ZA 5J3HC 2BDNH 2DZEA 3QZMA 4Q6IC 4WUKH 1OARH 4M6ML 3ZW3A 4Q97A 3EHBD 1NGXB 5DO2C 3NCCB 1L5GA 4YAQB 1U8HB 4KTGA 2NQDA 5DUPL 2E76C 4PJDB 2IDSA 4UU9A 3I02B 4O2CB 5I1CL 1HH9B 1UJ3C 2DBLL 2FB4L 3QUKA 2Q2EB 4PB0L 4Q9BA 1XXFC 2GEEA 2VITB 3FF8A 4K23L 5I1LA 3B3IB 5TQ2H 1UKSA 2XQYA 4NQDB 1F4HA 1KENL 1TCMA 1XF2A 4WGVB 3TT3L 3ARDD 3WMSA 3ULVE 1CF8H 4ONFH 3S4SA 3VFOB 4AL8H 4FLQA 3U4BL 2VLRD 4X2UA 3UG5A 2BY0A 4P9MH 2J5LB 1F3RB 3LVTA 1MEXH 1U8PB 1JYXA 2FSEA 4JFVA 5CIPB 4KX8A 3TBYA 3B9KB 1WPCA 4WEEA 1M2OA 1KLFA 4G1EA 4HIHA 4JFEA 2F7IA 3LZRA 2RD0A 4XP1L 3HMWL 3KYMA 4XHJC 1TNNA 4OGXH 3ROOA 1NCOA 1NGWA 4HS6A 4OLVH 3CZLA 3GMOA 1X5KA 4IIQB 4EBQH 5ESQB 1LP9F 1MW1A 2AV7A 3O2DA 3VDCA 2UY6A 1AMXA 5DLML 3WFHB 3TBVA 3QUML 4WW2A 3UPRB 1A1MA 1QP1A 4N5ED 3LH2L 4NZDA 4NP4H 1TQBC 4P2QB 5D7SL 4LGSB 2EZ0C 3SD2A 4JPWL 3KBEA 4NM8L 1INQB 3U0PA 3C08L 1L3WA 4OB5H 4KRLB 4XVUC 3QR0A 2PXYC 4JREB 1U95B 2RBLA 3F58L 4YLQT 2PYEE 4UOJA 1CGSL 1S7VA 5ANMA 1JVKA 4A7TA 4HIIB 3MV9D 1AS7A 2J8UB 4DF9A 3QHFH 4LKCB 2MCG1 3H6AA 3QEGH 4FQJH 5D70H 2PW1A 4YZFF 3MUUA 4UMSA 1ASQA 5ERWB 3TO4C 3PWVA 1L0QA 4KI1A 4P9HL 3GRWH 3PWUA 2R8SL 1HXYB 1LO4L 3JXAA 1CURA 1H8OA 1MZYA 2BSRA 3L16A 4YDLB 1O9WA 5L6YL 3HG2A 1FFOA 3MJ7B 3G6JE 2R1XA 5IVNA 3EOAB 4LARL 4KKBD 2XETA 5I6LA 5D2NC 2DQHL 1YEJL 2VDOB 2ITCA 4LCVA 2Z3FA 2PF6A 4S1RH 4EVNA 2QJDA 3HOGA 3ARBB 1QLRB 1E90A 4NKDA 1SVZA 4CMMB 1CFTA 5IVXB 1DSWA 4N6RA 2CK0L 4F8TA 3EHBB 3LZOA 4JG1H 4IIQA 3MRIB 2CQVA 4MA8L 1HSBA 2J56A 2LAGB 4LSRH 2CJTA 1NGWB 2HMIC 4LZKA 4UTBL 4N8VG 4N2FA 1BM3H 3U7YL 1S9VA 4MAZA 4AITA 4FG6D 1CCZA 4F15C 4YX2L 4YHZH 1N2RA 3FKUS 3L3IA 4MA3B 3U4AA 4JFQA 2QADD 4AV4A 4R7XA 3FO2A 2YPVL 5DMJB 2FJGA 2O6DA 4M6NL 1XWVA 5D5MB 4UCFA 1YEIL 3V7AG 1UD3A 4IMKA 4UAHA 4XBPA 2BS8A 3HUJE 3L08A 3EF4A 4BKLA 4HWEH 3QQ3A 2ED8A 4HS3B 4TSCH 4CU8A 2VITA 4MYPA 5ABZA 4DHLA 5LO7A 3G7TA 3NSDA 5ITFB 2E7DA 3D51A 5HY9B 2CDFA 4UTBA 3ARGD 3BUTA 3MRBA 2PW2B 4ZZFA 4PJDA 1MCOL 2ZKYA 4O2FA 2Z35A 4JM4L 2AQSA 35C8H 3LKNA 2O6PA 1NDGB 3BKML 3FPYA 5HHQA 1IAOB 4NC1C 1F42A 3BQVA 3WFZA 2OTWA 2E56A 3NPZB 1ZS2A 3L54A 3R06B 2WXNA 1H3PH 3VI4F 3BUPA 1BX2A 5E5UB 2NDGA 4Q6IB 3W5MA 2HN7A 2D7TL 1O5PA 3UMNA 1T6WA 2PYFB 3QI9B 1S7UB 4PJ7B 4Z7QF 4JLRB 2PWGA 5HDWA 1KPVA 3UBGA 5FOBB 3HG3A 5I6NA 3OPUA 3AACA 1JCVA 3JT0A 5SWQB 1TG8A 3F7QA 5B7FA 1I8UA 3DO7B 4N1CA 1ZTXE 1UXLA 4AUYA 3UJIH 5D1XA 4NQXB 3FTGB 4PP1C 1T2QL 1FVDB 4HA1A 4J27A 3O2VL 1MRDL 1INEL 5I1JL 3CHRA 1RURH 1RUQL 1GTNA 5ESVA 1U3HA 2AXJA 3U9UB 4M9PA 4TVSa 1UXWB 1UM5L 5IW1B 2XQ0A 1NC2D 3L4VA 4QRFA 4RGOL 5LGKA 4L8CA 3MLZL 4IW4C 2OJ1A 1YMMB 3N0PB 1IBGH 2CLRB 4Q6YA 3T4YA 2C9XA 3LYRA 1GW0A 4FI8A 4PY7A 3S34H 1OF0A 5A3ID 1AD0B 3MKKA 4FHKA 3RILA 1RK7A 2Y7OA 1XAKA 5CCKH 2K8QA 5KBKA 4WUUE 3VFRB 4B97A 2GJJA 1FZOB 5EU5A 3SJVA 1SHMA 5KTEH 1NCDL 2HXAA 2W59A 1BOGA 2ITFA 2WZ6A 4PJ8A 4MBRA 4Z3TA 5FW6A 4KUZH 5C86A 2VISA 1E2ZA 1RL1A 2L04A 1NCWL 2PYED 1SYSA 3B7TA 2Z4QB 4P2AA 1JZHA 1UD5A 5D9SA 1MRCH 4I5BA 4ODHL 4L23A 1ODAA 5HI5D 4HHWA 3JUYA 2ZKWA 2ZSVA 1IBHA 5CZXC 3R7QA 1D5XA 3A23A 4OZFH 1YSOA 4HX1B 5C0AE 1ORQA 3VMNA 1TO4A 1I7UA 5JQ6L 3EDEA 3GMQB 2XRAH 4LCYA 2DWDB 4P2QE 3MRRB 4JFFB 4JJOA 2WO2B 1HHIB 1W72H 1BJ1J 3PP3H 4FG2A 3LKPB 4F27A 4KI5C 4OLYL 3RZCA 1Y1UA 2Y2TA 5JO5A 1IGJB 2DTML 2IG2L 3CDGB 3LKSB 3S37H 5FR3A 5KOMC 2F0CA 3BSZH 5FECB 3BYYA 3IF1A 4WHYH 1N6QH 3NJVA 4I2XE 1I1RA 4Y4FA 1TJMA 4OFPA 4NUGL 4Z7UF 3VXSB 3KJ4C 4KWUA 4OVVA 1JGVH 3IDIB 5GXBB 1CXLA 4TF4A 4QRUA 2OXHA 3ZXAC 3O6FD 4L37A 4QAWA 3F12B 4U6HB 3VFWA 3D18B 4WFEE 5IFHH 2FRGP 5D7LD 3WGUB 1ZKAA 5HYIA 2WJ5A 1D5MB 2RR3A 1C7SA 4LNRB 4NBXB 5HHOA 1HAUA 3I2CL 5D2LA 3SOBH 2K6YA 3IMVA 3MMEA 4GMTL 4Q52A 4Z18A 1T0NA 2X9XA 3CZJA 2OBGA 1DQIA 3GEWB 4Q7DA 3T0EA 1ONQA 3C5XA 5FFOA 4IS6B 5HJGA 2BMKA 5C07B 3C9NA 3TYFB 1JVOA 2YMXH 4XX1E 3RX7A 3UDWA 3L1EA 1T21A 3CDZB 4XCFH 3KW8A 3HC3H 3POCA 4B0MM 5ADPL 2WLIA 1JN6B 4NCDA 1AYRA 4CSTA 4WENB 4H8QA 1FVEA 1RZJL 1B88A 2QMJA 4FQ1L 4BE6A 1A1OB 2P8MB 3QHZH 1CLVA 1KJ2H 4NAMA 3B6SA 4HIXH 2DB8A 3T6VA 2LTQB 3C8DA 1GC1L 3VI3F 6FABL 2TSBA 1BA9A 3MRLA 2EIZB 4EI5C 1CDBA 5HHNB 3BI9X 3WSQL 1BG9A 2FBJL 3IU4L 1VESA 1A4CA 4Y4KB 4NIKB 5GHWL 4DKFH 3CU7A 1VAHA 5AKSA 1WH0A 4LVOC 3W5NA 3U4EA 3LRGA 2OMBA 4IBQA 5KVEH 3K2KA 1VB9A 1XF3A 3CFCL 4KRPD 4NWUH 1JNHA 2X7LA 3NCMA 3OTTA 5DMKB 5LLIC 3BKJL 5LXGH 3AB0C 4MAYD 2QSCL 3DA0A 1L9SA 1BIHA 3QPQC 1NBYB 2W9DL 1Z9SB 3NDZE 2WW8A 4M8QA 4UOW0 5ESAA 2QHRL 3PHOA 3L3DB 5FYJD 2XVKA 1A1NB 1YMMD 2VDKL 1XZ0A 2A77H 1AGFA 2ISDA 3SDDA 1YJDL 4X6DF 4HIXL 3RKDD 1JXGA 1ZK9A 3ECUA 3GF8A 5JW4R 1X5YA 2GI7A 4JZJB 4GQRA 1BIIA 4F37K 1AI1L 1UOKA 1DDTA 5HYJD 2HX9A 2I9LA 2WVVB 5GISL 3C6LC 3HMXA 4G6KH 4XN1A 2B16A 3F84A 3FNKA 4HSAC 4OJDH 1A22B 4R7DA 3TJEL 3ZTCC 4R4ND 4YSEA 2VW7A 5DJXA 2YD9A 3PIQA 4QRSB 2AW2A 2DYPB 4PJGE 4G1MA 2WUCL 4PB0H 5DGQA 4GI8A 5F1SA 3D08A 4AKOA 1WFOA 4FMKA 2J6EA 5TQ2L 3ARVA 3FO1B 4PGCB 1M71A 4TQ8A 1YG9A 1KCLA 2BHZA 4PJ8C 2KBGA 2CR0A 4Y5XA 3RUGE 5MI0C 3LD8B 5DUPH 1FE8L 1ZA3B 4ZUVB 1P7QA 5JHDB 2YZ8A 2H5UA 5DJ6B 3SDYH 2WK2A 3IDNA 1ZTXL 4FTVA 4IK6A 3SDDD 3U0WL 2C9AA 3WHE0 3FSAA 1CFBA 3QJHA 4U6HA 5TPWH 4GSDL 5K9OB 4P46C 4M5ZL 2F74B 3D52A 1UXWA 1KENH 2GABA 4GFXA 4R7VA 1SBBA 1C1EL 5EZPA 2FJFA 4AH2B 3EYQC 2R29H 3T0WA 1MSPA 2R2EA 4IU2A 3ZK0A 3LHPL 3HG5A 4KPHH 3FU7B 3VXMD 3ULVC 1IGTB 3UP1A 4TQHA 2H41A 2AJYH 2I24N 3VFWB 1FAIL 4NGHL 4K3GA 5T3XL 2GTZB 3RIFF 1KTDB 3W9DA 3ZGHA 1BZEA 3CPLA 2Z0BA 3DBXB 2VDLB 3TZVC 1VCAA 3B8YA 2YUZA 2W65A 3QYCA 5IB1B 5DYOA 4LCYB 1GCFA 3GSNA 5JOFB 3Q9PA 4Q0XL 4AWJC 1LEIB 2BY1A 4M43H 4KHTH 1IV8A 2YGOA 4PP1D 2WUBH 3EJJX 3HNTH 3NSYA 3G3LA 4FCHA 4X7DC 1CBJA 2DJSA 3BUYA 1BQKA 2BOBA 4L3CA 4IBTA 2WBJB 3RVUC 4WGKA 4WFGE 1JF5A 1WISA 3APFA 3EUUA 3JVFC 4ZS7L 3GMNB 5KS9F 2XACC 5MEQB 4PJHA 3QZWA 2Z31C 2BRRL 2JKXA 2G0LA 4MB4A 1JZ6A 4JFHE 5I9QB 2NXZD 5H35A 1NPJA 3T3PF 2CBPA 4B9GA 4QLWA 1G4RA 1ZLDA 1YEGL 4KJWC 1BECA 2F15A 4M7LL 5FF6B 1CFMA 5C6TH 4G8GE 3B7RL 3T04D 1KB5L 4KXAA 4KZEH 5ISZE 3VWJD 4FA6A 2GJ6A 4TVPL 3APNA 2EP6A 1VEOA 3MOBH 4RGNC 4KHTL 1P9MC 5EBMB 3DECA 2VR7A 3BC9A 3L9RA 3RDJA 4NERA 4H20H 3WNNA 3D07A 4JHBA 2CH8A 1RZGA 4QRRE 5KWYC 2NW3A 3SBPA 1AD0A 2CJUH 3BN3B 5B39B 3EO0B 2ZKHH 1H3XA 2NY6C 4XNXH 3PNRB 4Q4EA 4XCYB 5TTRA 3K46A 3SQOH 4HOWA 5CP3H 3DV4A 1EFXD 4X4YB 2WM0A 3RZCD 2V7HA 2DYSB 2WAHA 4YX2H 3MJ9A 3U82B 3UTTD 4GLRI 2WIIA 4N6RB 1S7UA 2PXYD 5F0MB 3QFJD 4LLWB 1BQRA 4WKZB 1H6FA 5T1MA 5CNHA 2A5UA 2X4TA 4M7LH 5AB0A 2XBDA 3HVNA 5JHAA 1INEH 1ZPLA 2EVIA 3NQKA 4GAJH 4Y9FA 5D1XC 1FFNA 1OB1B 2XWDA 4BH7A 2CUMA 1VFMA 4PJ7A 3WY4A 3MRHA 1J9RA 5EC2B 4PPTA 5AAMC 3UTTB 2ZICA 1NDGA 1G9ML 3U2SB 1BD2D 1JXJA 1HJCA 4Z5RB 5DUBB 4ODVL 4B7LA 1L0YA 1BZ9B 3MI6A 3WTWA 3UTZA 1DQQB 1OD9A 3NH7L 4M61B 2P5WB 5ANMB 1NFIA 3QQ3B 5EZJB 5CD5C 2XSKA 3VTAA 2ICCA 2P4AB 2VUKA 4YLBA 3U7AA 2F5BH 1XX9C 2Q7AA 4UTAH 3QP3A 3MXVL 2VC2L 4CMHB 5CF3A 3G6DL 4HCRH 3BZEB 1YUKB 4JHAL 3VA2C 4GQQA 3U6RB 3ZU8A 3TM6A 4OKVB 2OSWA 4QHUB 3ARGA 4WW2B 4G8IA 4ZTPL 2QSTA 4M4RA 1L9PA 4KU1A 4R0LA 3RWJA 4MMYA 2B2XL 1MEXL 1DR9A 1EZVX 4L0PB 5KVMC 1G7MB 4QOKA 2IQAB 2CCLA 2J8UF 3V6OA 3H9SA 4PJGF 1II4E 3KYMB 3EADA 4I3RL 4K2UH 5JMRA 4LSDA 4Z9KB 1E5UI 3EGSB 1IX2A 4JO5A 3KL3A 5HGDB 4UT9H 5CCJA 2H4EA 4M1DL 5DEGA 4KXZI 5DLLA 3QORB 5I19H 2JB6A 3EIFA 3QEHB 1XEUA 5CLWA 2WD0A 4ZFOA 5E1GA 1PKQE 5IJVA 2CHZA 2PXYB 3DVFA 1UZ6E 3CX5K 4PRAB 4LRNH 2ADGB 3FT3B 3A21A 3VFSA 3BCFA 1MFNA 1FC1A 2BC4B 4LP5A 1WP6A 4J3VA 2EVGA 4IGBD 4KX9A 4X6FB 2CO4A 3BPLC 4PRBA 2LLLA 3MNVB 2Y9RT 4LT7A 4RFNC 5IGXH 5BZDA 4OJYA 3PWJA 3LQAH 4XC1H 3V79C 2K9FB 4N0UB 4NZ8A 2QQKL 3S8GB 1TMQA 1NAMB 1P1ZA 1TXKA 2A1WL 4ZOCA 4MNQD 1J9CT 5I18H 1PVHA 4ZQKB 1NAML 3QGVA 2CPUA 3T1WA 4ODWA 4KK6C 1LO4H 1P2CA 2C26A 3NCFB 2BHFA 4WK4B 5KN5A 2KERA 1DUYB 2I07B 2ADFL 3QUXA 1T5WA 4JDZA 1EZLA 3SDCD 4D9RD 1RZIB 1O7VA 4MAYC 2GPZA 4A37A 5T1MB 3IFLL 2WCSA 4WEBL 5IV2B 1D6VL 3O81A 4LMQI 2V7HB 4L4TA 5KVGH 3AADB 1P9MA 4QRQB 3DOIA 3GMRA 4HGMA 4J3OD 4JFEB 1RZFH 4CN4A 3IPEA 3SSGA 1CXEA 1Q72L 1NL0L 2C9UA 4WCYL 3ZMEA 4JFDD 1OTTD 2L7UA 5DYFA 5FCUL 4PJGB 1EPFA 1HILA 3NCBB 1ZIBA 1MFBL 4NM4L 1UM6L 3FUIA 4LOVA 1G7PA 3JUZA 5C2BH 3SE9H 4D9RE 2AJSL 4HP5A 3WLBA 4KKAC 2AQTA 2Y7MA 4QYOB 5JW5B 5CXPA 4O2CA 5E9AA 3I9AA 3U48A 1GTFA 5E6ID 4XCEA 2F8VA 4ZUSB 1LDPL 2WP3T 2EVHA 4NUPA 4OKDA 5HI5C 3MVSA 1Q94A 5PAZA 4GKNA 1NGXA 4QXTA 4AQ1B 4PRNB 4XP6L 1XF2B 4OI7A 1IAIL 4KROD 2GIMA 1WD8A 4K3DL 1H19A 1MCLA 4YPGB 5GS3A 2FH6A 4LLMA 4XPAL 1YEWA 2IAMC 1SDDA 1OP9A 3K0YA 3HG4A 1KJMB 1AR1B 3C6LA 1GZPA 3OJDB 3HZKB 1VADA 3VXRA 2E7BA 2IFGA 3QW9A 4TUOB 1BZDA 4YJZL 2Q76B 1A65A 3IKKA 4AQEA 2NXZC 2VRAA 2O6EA 4CDGC 2BHUA 2DKUA 5JTWA 3W11D 2ZAIA 1UH4A 1LLAA 3HNSH 1TTFA 2HLEB 2H8PA 3VWJA 4IIZA 1DDHA 1IC7L 2HJLB 3A0OA 3KCWA 4HPOH 4WK0B 3RTQA 4TUKH 4BFOA 5FYKU 1A4KB 2FL5A 3E80A 1XGYH 3GK8L 3JVGA 2ZKMX 4HCGA 4J3OF 3S35L 1MJJA 1EJ6A 4MQXC 5HD8D 2FJFB 4JRWA 1TTRA 4GI9A 1SN5A 3IJYB 2KZKA 1IT9H 2QDWA 1R46A 3CMGA 3V5DB 1R24B 3QUGA 5EEXA 1U58B 2NY6B 3UJIL 1X5JA 4JBSA 4XPAH 3CNKA 3IM1A 1EFXA 2VLME 3P9WB 4KRNA 15C8L 3JWNG 3F7LA 4U05A 5DJ0A 4LSPH 5EBWB 4DO4A 4HGWA 3O0LA 3QS3A 4PMFA 5CJBA 4R2GD 5JW3L 3FULA 1VFOA 4XB7A 3CVIH 1FH2A 2OMWB 4PRIA 2EH8H 3D9AL 4KTDL 4PGZA 4G6KL 2WWOA 5E6YA 2X4UA 3TBWA 3MRFA 1XGRB 2VXVH 4ZMOA 5HYSA 3KCPA 3AQYA 4J8RB 2VW4A 3GHPA 2V2TB 4L18A 1F58H 3Q44A 5C09E 1RSFA 3QUXD 4YZWA 3KGUA 2DQGL 1IC4L 2ZCLL 5E5MA 4OCYL 4D0DA 4MNGE 3VXNA 4ZD3L 1JHLH 3PQYD 1NEZA 4S11A 5EU6B 4TOYL 3AQXA 1SYVB 5F3BB 2WBJC 4WI9A 3BJLA 4XNBA 3OR7A 3AREC 3LDBB 4LCWB 1YY8B 3F64A 4XO5A 1T03H 5AZEL 3T6XA 3ISWA 3M6DA 1B4RA 3MBWA 3M8OH 5LGHL 1EXUA 3F6LA 1OVZA 2H3NB 1XH3A 3KCPB 2XZAH 1VCBC 2JXMA 2G3MA 1UB5B 2VLJB 2Y07L 4O9HH 5DI8A 3WD5L 1W72L 5LDUA 3MUJA 3SZKC 2CO2A 4GIPD 2P45B 4AGNA 1ZHKA 1WWAX 2WO4A 4NX0A 4XNUL 5GSVA 3KXFE 3U9WA 1HAWA 2XUWA 3GSUA 4KMTL 4I1PA 4ZD3H 2P8PA 3L4TA 3X11A 4AE1A 4MZ3A 1C1EH 1HNFA 3VQLA 3P3UA 3NJXA 4U6YA 2AQNA 1C08B 5KYXA 1W6WA 1AHMA 3LZLA 4KQ4H 4BCZA 4RNRA 2J1XA 2HUHA 4PLOB 1ZT1B 1FRGH 3O6FB 3T1FB 2WANA 1IB5A 3PY9A 3EFOA 5IQNA 4C8XA 5J89A 2WLIB 2NX5E 4YGVA 3R8QA 4KRMB 3BIKA 4TULL 4G8GD 1P6WA 4DH2A 3EUDA 2ZJSL 2VZVA 4JB9H 5C08B 3Q6FA 1ETJA 5JPNC 4R5XA 3QG6B 2NY3C 2Z4TA 4LHUD 4ZUWB 4YHYC 2IBZX 1LO3L 1L9MA 5L6YH 3HE7C 4JGUA 5BVPL 5K39A 1JV5B 1LQSR 3M17B 1PL3A 4PJAA 4FFVC 1O75A 2G0KA 4OLUH 4PTUB 3VCLA 1MG2C 2EEBA 2B1AH 1TPXB 3VGGA 2YSTA 4R7NB 2CO1A 3KGSA 3T2OA 5KSBF 5KYUB 1RUPL 2VR3A 1EDYA 2WN3A 1CL7H 1DTUA 4NDMB 5JXEC 3GSNH 1NFDB 1AR1D 4Z7AA 1KGCE 3OX8A 4QTIL 3GSWA 3QIBD 2VZ3A 4X6EB 5I66B 2CLZB 2N4IA 2ZKHL 4ICXA 1N19A 5KVDL 4AQ1A 1NEPA 5IVOA 1EJOH 2CDGB 2G75A 3HG1B 2IPTL 2DQTH 1AZZC 1TJHL 4PUBH 1QFOA 1GHFL 4QJ5B 3TZVD 4XVUD 1V10A 3FQXA 1ZLSH 2NDFA 1RJLB 2BNUA 3VFUA 3QAQA 3PRZA 2X2HA 4BZYA 3BMWA 1RVFL 2ORBL 5FECA 2YPVH 1EK3A 4M62L 35C8L 5D1QA 5J6GB 4XVTL 1LWRA 4BZ1A 3ARTA 4TUJB 1S7XA 4NOBA 1HEJC 1VIWA 1EEYB 4NWUL 5IMLA 1EIBA 1M7IA 1HFUA 1SHWA 4I3RH 2BVTA 4OJAA 3RGVC 5JDSA 4MJIA 2KDYA 3G6JB 2AK4E 3KWWB 4BEIA 4Q9CA 4YDNA 2CA4A 5F88B 3VWKC 4YHLH 3X1EA 1GIGH 1WS8A 1HINH 5CN2A 2RIKA 1EJOL 1OSPL 4XRCA 3UYPB 5FGBC 1QSEA 4HUWA 2A7BA 2VMFA 5LNEA 2LQRA 1KWKA 2GUYA 2JH2A 4HOXA 4JHVA 4FADA 2WWKO 1WCQA 3IJSA 5EPMB 2UZXA 4ANXA 1KB9K 4P4KB 5E6IA 3NZHH 1DBKL 1NIFA 3SBRA 4XBGA 5FO9B 3NMEA 4Z8FH 1CT8A 4GG8A 1HYRC 2XY2A 3T0AA 2P42B 5B1JC 2R69A 3AG2B 3VG0L 5I30L 4H25B 1F86A 1TZHA 5HYJE 4GG6F 3JV0A 1ND0B 5FKAB 4FYSA 3QUYB 3H9HB 4KHXH 4JKLA 2OMTA 4ZYKB 3MRPA 1QSFB 5AZ2H 2BP5M 1Q9KA 4WO4A 5BO1H 5IP4A 3E3QE 2B3IA 4XOEA 1O6TA 1V05A 4LE8A 4B9YA 3MRKA 1WK0A 4MQ7B 3FCUB 3TLRA 4WEUD 4GG6B 3N41B 3MGTB 1JZDC 1PNCA 3IGAA 4NRYA 4AQAA 5KZCD 1XIWA 3CC5A 5ILTL 2Z92B 4ZO8A 3Q9QA 5GIRB 4JKPL 4GT7A 1AZNA 4X6CA 4KGJA 3P9MB 4U1LB 4AY0A 1E50A 5JNYA 4IMLB 2EDBA 4WJ5A 3MFFA 4K5MA 1FO0B 3OD3A 4K7PL 1JNJA 3UIYA 1DQMH 3E1F1 3L3JB 3M88A 3IFPA 5D96C 3T65A 1ZT7B 1ECZA 4Y4FD 3T8MA 4POYA 12E8L 4RX4D 3WJJA 1SMOA 1QTPA 4LHUA 2X88A 4QF1A 2OXGA 4IDJH 4ENZA 4TL5A 2GSGB 3Q48A 1UM6H 2QZQA 3X12A 2XRAL 1L4IA 2XWCA 3RGVD 4GQ9H 4LXFA 2XZQL 4JY5H 2QR0A 3U6XA 1OANA 1T0PB 5E4IA 4YQXL 1XIWD 1QZNA 4QRRD 1P5UA 4N2HA 4JKPH 2ZUQC 3D2UB 3HPLB 5EA0H 5F21B 5CFAA 4GMSL 1HJBC 1IE4A 3GXDA 4W6WB 2L0DA 2JTYA 4F9PC 1FNLA 3WFCH 3D2UA 3HPLA 3DVNA 4XP6H 3RU8H 1KEGL 1IQDB 4XO3A 3U83A 1SEQL 2VLRB 1NFIB 4HJ0C 3QIUB 4XX5A 3QUZD 2VXUL 2ICWI 4PHXA 1ZDQA 3UTQA 1HQ4B 3BVDB 3LXCA 1EVUA 2XQBH 4JPIA 5DUBA 4Z5RA 4MA8H 2EC8A 4M1CD 1IGMH 4XAWL 4BUGA 3QNXA 3SE6A 5F1NA 1F00I 1MWOA 4JG0L 2VM3A 3N1MC 1NEZG 4P46A 4M9OA 2VGLM 4BQCA 2H6PB 2AVFA 2XX0A 5KSAB 5BRZB 4YHPA 1M7UA 4FTVE 3MRGB 4PJXE 3VD3A 4KAQH 2WHVA 2PCFB 1Z9PA 5KVGE 3HVDA 3TC9A 1U92A 3ABZA 4XR8C 1QZ1A 1KTLA 3ISYA 3OF6A 2I60L 4HXAH 3FUHA 1IEBB 2HT4C 1LK3H 5K59E 4LBEA 2VKWA 3DJSA 4EIUA 4WZ9A 3I2CH 4YHOH 2ERJC 3O3EB 4PRHA 3NCJH 3R0MA 5D7HA 3SE3A 1HWWA 3ZT5A 2XQBL 3P4OA 2J6EL 1Q9KB 1JUFA 4ATTA 3D4ZA 2AGJH 2ZG2A 5E1AB 1V5JA 4LCUA 1CFSB 1A2YB 1I8KA 2OMUA 1N64L 2E4FA 3ABLB 4EXKA 4F8QA 4DNLA 1D9KD 3CHQA 2JSFA 4HC1L 1PPIA 3DROA 2D4FA 3K4ZA 3Q1EA 4XPBH 3SO3B 1CO1A 2C9QA 2CSPA 4NO0D 3GJFB 1F2XK 2IDCA 2ZOWA 4Q2ZB 4X6CF 2IDTA 4J4PC 5F96H 4P57A 2MNUA 2ZXEB 1A7QH 3N44F 5LVEA 3ELAT 1BVNP 1A9VA 5FGBA 3L5HA 4EDWL 5JORA 2V3EA 2HVJB 1KG0B 4OY9A 2FUQA 2VUYA 2DLTA 3OVUB 3BQUD 4DESA 5KS9A 3I3DA 3CE1A 4K3DH 4Y88A 3U0PB 5IFAL 1D5IH 1FNSL 1ZHBA 2ESVE 1UCBH 2OLDA 4NQEB 5T1KD 1IU1A 2VDNH 1FORL 3RQ3A 4NQSA 4MCYB 2AKRA 5KS9E 5DFAA 4N22A 5IEKA 3WFHA 1DVSA 1NIAA 1T03L 4WSGA 5L7XL 4JHAH 3PHQB 2Q9OA 2D73A 1P69B 4QF1B 1XCTA 3A6BH 3QDHA 2KH2B 4NPYA 4QKXB 4FMVA 3GMLA 4JM0A 3DHJA 1JWUB 1EGJA 5J8OA 3IT8D 3MRDA 5FYJE 4CL7A 2EADA 2Z7UA 5A2BA 4QNPF 3E7JA 2OMZB 3LNHA 1AQKH 4KVNH 1EEYA 3ZE0F 4IMLA 1N12A 2BOCB 4FQQA 1YPZA 2PLTA 2DIEA 2OCJA 1Z6JT 3D4CA 1QAWA 5BZWA 2MCAA 5IFAH 1A8JH 3EFFB 4A39A 4BCYA 2CLZA 2XKSA 4U1HA 4OZGB 4NPJA 4LLQB 4P04A 4ZUUA 1XIWB 2APXA 3BGFC 3QUKB 2J72A 3K2MC 1E4XI 1JGUL 4NFBA 1JNNH 4NJAH 3V4VH 1I7RA 3A6CH 3NEOA 3RGVB 1HKFA 5JW3H 2XN9B 4F9LA 2E7LC 2W9EL 1T04A 2B4CL 3UFIA 1P6FA 1YZZA 3UROR 2WQVA 1YMHA 1MCWM 2HSIA 2KL6A 2QELA 5F93C 3C5ZD 4OM0L 3S4SG 4OZIE 1FDLL 5JDJA 3CSTA 1BPVA 4ZFGH 5IQ9B 3K2UL 3SODB 3RFZC 5DJ2A 4YFLI 1JZJA 1H6EA 3NJHA 3CTTA 4JGMA 4XTRC 5C0CB 1JAEA 1CE6B 2BJML 2WXHA 1T66D 2DJ4A 2EUXA 2WSKA 2FT8A 2YD2A 3M1BB 2YC1A 2GAZA 2Y5TA 3H2WA 2QGDA 3CZKA 4KKCD 4LPUA 1I8LC 3QDJE 3N50A 5J1TC 4XN4A 3PWPA 1SJXA 2PO6D 1ZANH 3QEUA 2GI0A 2ZNWA 3L7EA 4ZW8A 3GSUB 4DN4L 4BQ8A 4ODUA 1XZ0B 3SDDB 5IFJB 2A38A 3UYRL 1U36A 1IKNC 1I1AA 3S3BB 4AVJA 2KQNA 1FL5B 4QRTA 2HCZX 3H3PH 5HVHB 4TL4A 1VRSA 5D1ZC 2MRYA 4L05A 4Y7MA 1G7HB 2OSYA 1OAZL 1VPOH 5EMYA 4QY8B 3X3FH 4MWFB 2V2WB 4MSWB 4OGYH 1SF3A 4UTCA 4DAGL 5F0JB 4Z3EA 1T7WA 4OVUA 2FECI 3S48A 5HDQL 3CK0L 2B5IC 4GY4A 5DHVB 4MAYB 1CFQB 1NUFA 4R9HA 1XGUB 4XZUB 3PL6A 4XMKH 4E41B 5KSVB 4FLSA 2GITA 1NMCB 4NRZB 2JKJA 1FG2B 1G87A 1JIBA 4P2YA 4BUQA 1YN7A 2HFFA 3GGWB 3SPGA 2A9NH 3WNOA 1U8KB 4Y4KA 2Y5QA 1Y07A 3BSHA 1DJYA 5JPMB 1TTCA 2AI0L 3GSQA 4WTZA 4CVWA 3GWJA 1U91A 4X4ME 1E2WA 3KLSA 4UIMA 2EECA 3LOWA 1UURA 2FNBA 2JQAA 4JANB 4XMPL 3MRCA 3VFGL 3DPDA 3BRFA 1T4KA 5FDWB 1ADQA 5D7IE 4EKXA 4IBVA 2EO1A 4XNYH 4XBEH 5DDHB 2EINB 4WI8A 2Y7NA 2ZP9A 1YUHA 4GFTB 4TULH 5T5FL 5C0GB 3EYFA 1BHGA 1AO7E 1WAAF 5DRWA 3WV0A 5HGHA 2X9ZA 5IVXF 2Q86B 4CC4C 1N18A 2OZNA 5L8LB 4XXWA 2NNFA 2IDUA 3ZKNC 1M05A 2BIIA 4R3SB 4H8UA 5E5MB 1E9QB 3MFGB 4WJKB 5EN2B 3G04A 3KPQB 4PR5B 2OYMA 4E9SA 3ASNB 4FMFA 4X8XA 3KR3L 1OAKH 1H3GA 4TV3A 2I69A 3HJEA 3KM2A 4OD1H 3WELA 3FN9A 1I3RA 1COBA 3LNDA 5D2LB 4OQTL 1CI5A 3WNJA 1PZDA 4TQPA 5F89B 2XPYA 3CFQA 4YSCA 1DVUA 1U8CA 2IQ9L 4M7JL 3MRQA 4A04A 3Q5YA 4KKLD 1X5HA 4EZKA 4KZDH 3SGDH 1M7DA 3ZIYA 2M1KA 4R90L 1IBDA 7PCYA 1SZNA 1HYSC 4PS4L 4HWZA 2XPZA 3B2UC 2Y1ZA 2IDFA 1N68A 2QT6A 4L37B 4XOBA 5I1KH 4EUPB 1MHHA 5KYNA 4Y4HD 4LK4A 3KPQA 1DBBH 4PR5A 3UEZA 4FFYA 5K59F 1R3KA 5F9WB 1E5AA 43CAA 1T83A 3IJYA 2COQA 3VXSA 1JF1B 2ZNXA 2Q76A 3MLWL 1B6DA 4PTTB 4P8QA 2QQQA 4JHUA 4QRPB 4AYFB 5LGJA 4XB8A 3VU2A 2BXYA 1FA4A 1JDAA 3MNZB 5DEJA 5SV4A 1JBJA 2APFA 3VX1A 4AXWB 1DBKH 1CN4A 5LCVL 2R0WH 5JXED 2UWEA 3JV5A 2Y24A 5HHPB 1AKJA 2BSEA 1JZ2A 3D3VD 3QIBC 1I7UB 4ODBD 2B4CC 1IZKA 2EVJA 1B6UA 1OSPH 2Z91A 2BW4A 3S2CA 1JHTA 4GSDH 4BZ1H 1EHKB 3RZCC 1NAKL 1WCBB 3IMTA 4WHDA 2F1AA 4XPFH 3V52L 3G9VA 4F3FB 3IRZA 1ZSHA 3S36H 2QKIB 3ESUF 3LPFA 4CSPA 2NW2B 1CFQA 2F68X 3GIZH 4LFHD 1N7ML 1LM8V 1B0WA 3GUTA 3VXSD 2EXYD 1QR1A 4V1DE 4UILH 2GT9B 3ZVVA 1ZWIA 2WLNA 1JZ7A 4U1IA 5IBUB 5T5NF 2XWZA 1BREA 5AL8A 4B7IA 1N5AB 4IHBA 1DLFL 4XN2A 4F57L 4ZUSA 3D50A 4FXGB 4W9HC 1XF4A 4GS7B 5IMMA 4UT7H 5DK3A 2MHAB 1XGUA 2ITDB 3IFNH 4JO3H 4GRWF 1OM9A 3WLBB 3MV8A 2K9UA 5JA9A 1E8YA 4NO5B 3VXTA 3NUKA 4KOBA 3IETA 3DLQR 1BJ8A 4XCCL 4CN6A 1D9KC 1LO2H 1T6VN 5I1GL 3S5LB 1U58A 2CGYA 2GK0A 3KS0H 3JVGC 4GRLC 4LSRL 3V5DA 2Q3ZA 3Q3GB 2AMGA 2DM7A 3BAEH 4RRPM 3H2QA 4NZRL 4WVRA 3U25A 5DC2A 3FOMB 3UOAB 1PLAA 2A6KA 4AUJA 4R97C 3AS1A 4HUMB 2F1EA 3P0VL 1D7DA 5GRUL 3PABB 1QBLH 4AIZB 2EH7L 2Y22A 4W6YB 4L4TB 3EZ8A 3VH8G 1R33A 2EDEA 4PJ8D 5E51A 5CD3B 4GW4B 3IDJA 2YC1B 4N25A 2ARWA 3QI9A 3S97C 3RFZB 4YDJB 1ZLWH 5LJYH 2APVA 4TUOA 3CCHB 2OMVA 3KNBB 1X5FA 1B0RB 2NPLX 5C0CA 4CAGA 3ZQ9A 3BWZA 3EOTH 3BGMA 1E0OB 3KPOB 4KDTA 2XN9A 3SO3C 3V55A 3EYUH 5KEZA 1G6RB 3N91A 3WIHL 1OP5H 3WFDL 1U8IA 4HIPA 3R06A 4C4BA 3V0WH 2ADGA 5ID1A 3ULVL 1JS4A 3D3VB 5F7UA 5ICZB 3C5JA 4HIEB 1DQTA 5CZVH 5HGBA 3EFFA 4WFHE 1SHSA 5DVKA 1CYXA 4K8RL 2ZWNA 2GY5A 4YHKH 5IROA 1EZVY 1R5IA 3FQNA 4M5SA 1TMCB 2ZPKL 5F7KC 2Y3AA 1MHCB 1FNSH 1O0VA 1A8ZA 4JFEE 4AENA 4APQB 1QBAA 1OCWH 4P23D 1BXVA 3D12B 4DEPC 1RLWA 3VXUB 1YQVH 2O93L 3AABA 2DWEA 2OCFD 2EDWA 4M6AA 2DICA 1SUJA 1J0YA 3AQZA 1G7MA 1YNKH 4QOKB 2LLNA 4IK7A 4V2CB 2BX5A 3NABL 1HWHB 1BBDH 1Y0LA 2R51A 4TTDD 3ZTDC 5FO7B 1XMEB 3RVXC 4PRIE 4MNHB 4QMEA 1TQVA 1MRFH 2IXQA 1AIFB 1QG3A 5ABDE 2W95A 3HAEB 2MEJB 1IBBA 4MMXB 5GGSB 5J57B 4X9HA 5IWLC 1YRKA 4G8IB 3TCLA 4F1SA 4EVNB 1BAFL 4JY4B 5GS1C 3LRSA 3SCMC 1OP4A 5KJRL 4XMVA 1KZYA 2D0FA 4HWNA 1E5ZA 4FXKA 1YLBB 3CVHB 4LLYB 3M1CA 2VDML 5J13B 4M3HA 5I2IA 3HI5H 3CXFA 3DXAB 1MPAH 4Q9QH 2X42A 4JFTA 4F8PA 3BPNB 2Y06L 3UH8A 1DVYA 1I8KB 4JVWA 1J87A 1IC1A 4R83A 2JJTC 4R5TA 2B59B 4QXUL 5F7NC 4N85A 3PWUB 5FYKL 1FFNB 1OB1A 1AZUA 3ZDYF 2G3NA 2PW1B 3MV8E 3NN8B 4BFEA 5DJYA 1AVAA 1M1SA 4FN0A 4G7RB 3NJGA 4KHXL 1U42A 4JDVB 2YD4A 4UMGA 5MEPB 3UZVB 2FE0A 2HJKA 4HEME 2B39A 5L88H 2E6PA 5KOVC 5JHMA 2GKIA 1FL6A 1KLGB 1PX4A 4LLWA 2IGFL 1NOFA 3MCLH 3SPVA 4CC1A 5BO0D 1JZIA 4P2OD 4KH9A 3FC8A 2DQEH 4LEBA 4JPKL 4E9RA 1ZEAH 2NUTB 1J9QA 1OHZA 2OSXA 2H6PA 3ZSTA 3IMRA 4HAFA 4N0YH 3TV8A 1OGTA 1A1MB 3B7SA 5C9JB 3A6BL 3EO0A 1JPFA 5IIEB 3BUQA 4XZ4A 3FQTA 4O58L 5TE6H 3T4AB 2PPCA 4DJMA 2F58H 1GYUA 1HKLH 1FGVL 1TKWB 2GIXA 4BBWA 1F4WL 4G82A 4I0PC 1RD6A 4AEHL 2FAUA 1BFVH 1LO5A 1UGKA 2HJFA 5B22A 3DO3A 3PLYA 1XSKA 3FUFA 2GQHA 4LPYA 1YNTB 1WWCA 5T8IA 2ENYA 2HPOA 2K7PA 4Y5VC 4YXKL 1D6EA 4HUVB 5EBMA 5FLVA 2B15A 5E94A 4GW5B 4Y5VA 3BXNA 4NQDA 2XBTA 4XVJH 2PWEA 2VL5A 1DQQA 3ARDB 2EDKA 2JIXD 4C56B 3FQWA 4BXSV 1HL8A 1XB6A 1KBVA 3QCVH 1PSKL 3FK3A 4GAYA 4UU9B 1FPTH 2HTKC 4AL8L 1W0WA 3WHE1 3OZ9H 4E9TA 3NA4A 5T3ZL 3AZUA 5H94B 3O45B 4U1NA 2A6IA 4HXBH 4N5EC 1NBVH 2F58L 3MLTA 2G3ZA 3P2DA 1TPXC 2VDLL 3BVWA 3RWFA 1Z32X 4Y9BA 3MBXL 2F18A 3CZUB 1H0DA 4LCIH 4XVSL 4BQ9A 5A1AA 1WE5A 5DFWH 3FOLA 1YEDA 4HSQA 4N0RA 2QFRA 3REVA 2WBJA 3DBXA 2YOAA 4PGDB 2J4WL 4XODA 3SDXE 5MERA 5IROC 2ZJSH 5KBMA 5AENA 3QUHA 4OD1L 4H0IA 3PU7A 3TN0B 4H1LG 2QFPA 5DJCB 1HT6A 3N85L 4JO1L 5E00A 5EUOB 3J8F7 4NZJA 2XYCA 5T1LB 4NQDD 1QO3B 4OQ1A 2EIDA 5TPWL 4BJLA 1EHXA 4WHYG 3GLEA 3W2DL 1AO7A 3KPMB 3ECVA 3B9KC 3SKMA 2XV3A 1OARL 4M6MH 2YPVA 4HYTB 1A9EA 5BPPA 1TZIA 2VXQL 4XCYA 1Y0LB 5EHFA 4UOW1 3FN0H 1ZA3A 2P1YA 2EXWC 3O6ML 3T6ZA 2WZPA 3RBSA 2R59A 3MBEA 4LLDA 2H9GB 3BX7C 4KK6D 4MQ7A 1RMFL 2BIOA 1VZIA 3K81A 4WLCA 1NGPL 2HFTA 2KZBA 1NBZB 3FUDA 3S3CB 4KTEL 1F45A 5F3FA 3FS9A 5F1OB 4GYBA 4F93B 2V3DA 4ZUVA 1H3PL 3IXTB 4QJ3B 4JQVA 4P4RB 1JYWA 4KQ3H 2VDOH 5E2VH 4H25A 2PP7A 2V9UA 3OAUL 3EW3B 3P4MA 1P5UC 3GXMA 5GRWA 4YSAA 1J7VR 3KJ6L 1G7QA 2DQTL 4LLUB 4XP1H 3ZX1A 2Y7QA 5BS0E 1MY7A 1X5LA 2D7OA 4UDUB 3LQZB 3V52H 1QSEB 4GRLD 1FFQA 1D5IL 4HUWB 4LU5L 5B38B 1KYUA 1EEUA 1YA5A 1A14L 3SN6N 2WYTA 3DIFA 5AB9A 5DXWA 1I8IB 2B77A 4L9LC 3I50H 1S9WA 1JGLH 4J1UA 4JHWH 4Y16D 1I1AC 1FGNH 4O02L 5C70A 4OF5A 4YDJA 3UPAA 1AGBA 2IO5A 5JDSB 3KR3H 4APXB 4OTXH 4NRXB 4BXVA 4G80B 1T1XB 4H0LC 3TVMD 1BF8A 2YBGA 1UB6A 2BVEA 2OYKA 2G75B 3OKMB 3ZR6A 4ZDHB 4UDUA 5ICXB 2ZSWA 2E9JA 3CFEB 3NCEB 1TTBA 4DP5X 3SYPA 1E43A 3MRNB 2CRMA 1B0GB 2BNUB 4BFRA 2YKLH 4HKBA 1F0LA 4Y2DC 5TDPA 3SGEH 3TA3C 4O02A 1OV8A 3U4EB 1UKQA 2IFFH 3H2PA 4IYKA 5DS2A 3ZDXF 1G6VK 3FRPG 4I3SL 1G7LB 4QDGA 5B3JF 5T3XE 3O3UN 2DQCH 3HE6C 3GSVB 2Z7ZA 5HHXL 4UQBA 1ZD6A 4QHMB 3RWGA 3AS3A 2RFXA 3FT2B 5JR1L 2C9RA 4F1ZA 2OR8A 4FQ2H 5E03A 1WA1X 3VMPA 4EMZA 1YECL 4N2GA 2F54E 1AACA 2NT0A 1J5HA 3M8OL 1D7CA 1OK8A 4MJJA 2D4DA 2VDKB 1NM9A 1YPZE 2JB5L 3OZLA 5AQ0A 1NMBH 2BFVH 4PJAB 1F1AA 4GAGL 3X14B 4F37F 4O9HL 3V4VB 1EJFA 4UAOC 4GG6E 1GGTA 2I5YL 4M7ZB 2ZOLB 4QTHA 4NSKB 1VKXB 1N6VA 3SE4C 3BIBX 2IG2H 3K6SA 1UA6L 3TYFA 2IVFC 3T2LA 3O4OB 4R7DB 5IB3B 1WS7A 1CDGA 5I8CB 5IBLD 1KCUH 1QO3A 3IN2A 1DVZA 3MGOA 4UV4H 4YGVB 5DURB 5EH1A 3SKNB 3ZDYB 3ULUD 2CGRL 5EIIB 1QLFA 4JZJA 1DQDL 3GSVA 1YDPA 3ULVF 2BFGA 2JIXB 1XCXA 1OCWL 5E6UB 1LO2L 5HHOB 3QUMH 2OMYA 3ECWA 4G43B 2GY7B 2BY2A 3CBJB 1Q38A 1BVKB 1B0GA 4AQ8C 4X5XA 3P11L 4TSCL 3X2QB 1MXGA 2ZSWB 1U3ZA 4PI2A 4LB8A 4UBDD 4X7EC 5DHXB 4LKXB 2YO3A 2ICWJ 1NMBL 4GQ9L 4F91B 5L2KB 2DYPD 2AK4A 4XGZB 1OAQL 1IEAA 1CPUA 5CCKL 2A9ML 4HV8A 4XE0A 5HDQH 4HWZB 4J12A 3OLGA 4WFHD 4YDMA 4LL1A 5KUKA 1EEZA 3TNMA 2O72A 1EXUB 1CFNB 3GXPA 3F00A 3MUY1 4YOKA 2IH1B 3L9BA 4NC0B 1BPLB 1D7FA 3S88L 1KNOA 2OR9L 1MF2L 3IJHB 4KITB 1Y6KR 4DGIH 5LBSL 2RMNA 2TAAA 1MOEA 2CIIA 1TTAA 1T21B 2I27N 2P5EB 3CDZA 4AW4A 2VR5A 3SKUD 3RX5A 3U1SL 4ISVB 2Y23A 1EGJL 1SLWA 1SDAB 2ICEA 3N40P 2JVUA 4PJAF 3WJMA 2Y06H 1AQMA 1AXTH 1SOXA 2XFGB 2HKFH 3P4LA 4DCQA 2Q86A 3HFFA 4PJ8B 4FRWA 1GKEA 1FZJA 1KCVL 4K94C 3IGKA 4MXWH 1NPNA 1XGRA 4XP9H 5HYSB 3LY6A 3QWOA 1E4KA 2IAAC 3TO2B 5LBSA 1C5CH 3ASWA 3RWIB 3BFOA 1DBMH 4NQTA 3G6AA 4LLDB 4FEMA 1FL3B 1W6LA 25C8H 3O9WA 5IJCC 4TNGA 4LSVL 5JPMA 4GKZA 5L2JB 5D7JD 3MU3A 2WXOA 4X7SH 2ZTBA 3H4FA 1HCVA 3ILEA 2H8PB 3C2SA 4G3YL 2OS7A 1KDIA 1E3FA 3VGFA 1NCIA 3QBTB 1F1GA 2JELH 1FG9C 2PYFA 5DHVA 1HEHC 4OI9A 1MJJB 1I7ZB 2HRGA 3ZDZE 2C4FU 3VXRB 1IIIA 1L6XA 4FFVD 3OR6B 4ZFFA 1S7SA 5B3SB 3EBAA 3HEIB 3L81A 3N41F 4NI6A 4RGND 4NCC1 4WW1A 1LP9A 4PMEA 2BLFA 3MUHL 2D31A 4Y7OC 3I9PA 1OGAD 1ACXA 2AJUH 3REVB 1HWGB 4MAUL 1MLBA 3J07A 3LPGA 1P5VA 3PP4H 5DQDH 1ORQB 4JRFA 1SXSA 1TEYA 1TCRA 2ICWB 2LU5A 4JAMB 4ZAKB 1JSYA 1VADB 3V6FB 4NEHB 5HTSA 1N26A 3CZEA 4HVBA 5KSAC 2Z35B 2K0RA 4Q6IA 1T1YB 2R0WL 4I18B 2ARJB 3DX7B 3QXTA 1OY3B 2CJ3A 1HQRA 1F58L 2CDFB 2FEEI 2V5YA 4RGMB 3IDMA 1F3DH 1QYGH 2OTWB 3FQWB 4XAKD 4ZPTB 1CE6A 4X4XB 1OGAB 4EEEA 4IHOB 5J56B 4HKJB 1MH5A 3NIDE 4AYGA 1M7XA 2CKBH 1AIFA 3DX8B 2JELL 4C57C 5EO9A 1RPKA 2QGBA 3BQUC 1GGYA 2Y6TE 3OXRB 3D25B 5K9JH 5EEYA 2E9WA 1CICD 3T2QA 3JWDL 3R0NA 3O2VH 1ICTA 1YMHB 1KJ3H 6PAZA 1FH5L 1T0MB 1JCKA 1ZEAL 4GUCA 4OV5A 1VGEH 3FU3A 1G7LA 4I77L 2NNCA 4XMTA 3CZFB 4XBPB 2XWRA 1OTSC 1XB8A 5D5MA 4GRWE 1CVSC 5TDPB 4UNIA 8PAZA 5L88L 2CGZA 2H3KA 4NBZB 4NQUA 1JYVA 1ACZA 3HI1A 3ME0B 2YA0A 4AZ8B 5L8KB 5D7JC 3NJFA 4L4TD 1XT5A 5BOPA 2AABL 4UQIM 4ODXB 2GB2A 4B95C 1SXCA 1E28B 3WFCL 1PTZA 3EXLA 3C75A 3HC3L 4A2GA 2WXFA 3WUWB 5IJDC 4TLSA 1QSEE 3KPOA 2GIYA 1QNZH 2N01B 3PWJB 3T0DA 2YJLA 3D09A 5JW4M 1YNLH 1JI1A 5E23A 4TQIA 3S37X 1BX2B 4G8EA 4NFCA 4ERSL 1KPRA 1XH2A 1CS6A 3D7PA 4R97B 4O51B 4DOHB 4DPAX 3F7KA 4LKCA 5CD3A 4XB3A 5AOZA 4G42A 4OCNC 3HE6D 2HLAB 4HXBL 1R19A 3X3FL 3DK0A 4ZUTB 2YQ3A 3VUAA 1KMGA 1UXSA 1U95A 2MJWA 1ADQH 4FNTA 4OLZL 3QHFL 5KAQG 2QTEA 1TLKA 1NCBH 5D2NB 5DQ9B 3SJVD 4TNWK 4NNPH 3BRGC 4P9HC 4NUMA 3TVMC 3T0XA 3H9ZA 5EB9A 4LVNC 5DVNA 5I24A 3CLWA 4Y4FC 1E8XA 1HIML 3EGSA 3ROLA 2AJVL 2QSCH 5I28A 1VEMA 3U30C 3TWCL 1E6JL 4GH7B 4IGBC 4ADGA 1INQA 5E7FA 1LEKA 1X5AA 3QO1A 3SYAA 5D7IB 4MHHI 2ZUSA 3OKDA 5F71A 5LCVA 1TDQA 4UUJB 2DM4A 3LV3A 4QWWC 4L8DB 1Z2KA 3ABGA 5FO7A 5T1KA 5I73B 2HH0H 1U8PA 1T20B 2IQAA 1CG9A 2WPGA 1ANUA 3FJTA 5DD6B 3WEMA 4MMYB 5CN3A 1KT2A 2NTSP 2OL3A 1PS3A 4G9FD 2XN9D 1TYJA 1A7QL 1X7TA 4K3EH 1G84A 3VYNA 2C3HA 4LDEB 2W8CA 3TN0A 1I3VA 2HX8A 4UTBH 3LEYL 4N0CC 2YEVB 2H6UA 2M2DA 2HWZH 2ZX7A 5IW6B 4AVKA 2AQPA 2R15A 1DQLL 4YHPB 1B3IA 2VM9A 2FDBP 1V3MA 2Y2YA 5FWQA 4TRPH 3S6CA 1L5GB 1UXSB 1W2KT 3KPSE 1TENA 3TBTB 3VI3E 1RV6X 1ZTXH 4RQQA 5C3TA 3WS6A 5HGBB 4L5FL 1DN0B 4CN1A 3H0TA 4I9WD 2IAMA 1I7ZA 1OTTC 3UTZB 5D55A 1NBQA 1G1OA 3P77B 3PNWA 1B2YA 4GAYB 1JF1A 4KY1L 5JOPE 5DS8B 2BWIA 1ID2A 1ZSDA 4FQXA 4BFIA 3CHPA 5D4QA 2BZ7A 4EI5A 1ZV2A 1Q90A 3N1QC 3C2AL 4YAQA 4AMKH 3ZE0E 3BXNB 5LHDA 5DCCA 3TEYA 5KAQF 4ADJA 1JGLL 2FJSA 4JHWL 4I48A 4L1LA 1XF1A 1CLOH 3QR2A 2RACA 5C0JB 2MCPL 3OAYK 3GXUB 2X70A 3ZSSA 4D0CA 2IMMA 2LU4A 4A7GA 1KZQA 4P5KA 2PWFA 4JN1H 3TO2A 1MLCA 3GBNH 1YPZF 3WKML 4C54A 5EUOF 4PBVC 2UXGA 3QJSB 4IRJB 4S1DD 4ZXBA 3IDXL 4I4WA 2WIIB 5GJSL 2IAMD 4RDBA 1TVDA 2ICEB 3Q2WA 3WFBH 5CS7A 4JVUA 4R0LC 5LKNA 3OSKA 5KSBA 2WNKA 5EUOE 3TT3H 3AWGA 3WI9A 2X41A 2VC2B 4HEPG