4LSSH

Crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade a strain ker_2018_11 gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
QVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSPSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope glycoprotein GP120
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 41
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lssH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lssH01
3CZJA 5FYLE 1ORSB 1CLZH 4YUEL 3DVFA 4U6XB 2HT4D 3TZVC 2XN9D 1MF2H 1JF1B 1FE8H 3UDWC 1GL4B 2KZWA 1IGFL 3CK0H 3LHPH 4UQ3B 1MQ8A 3SJVD 2GTWA 1T7YA 2X05A 3KHQA 1GGIL 4K23H 4ONFH 3DRTA 3O3EA 3L3KA 2DD8H 2AEPH 2AEQL 1KENL 1DFBH 4P5MB 1PKQE 5FYJL 3DGGA 3WHXB 4OIAA 2PTUA 1C8PA 2EDLA 4R7NB 2NY3B 5I0DA 4C56B 3DGCR 3MRNB 3RFZC 2FBJL 4CDGC 3PWPB 5E94B 1T6WA 4MNQB 4N8VA 4J1UA 1JGDB 2UZXB 3EDDA 1FVCA 4KMLB 3SGKA 1U8OB 1NGQH 4JFED 3ARRA 2WZPD 2D31B 3KYKH 3VXNA 1DANT 1ADQH 2Y5EA 2MMXA 2GHWB 3RWJB 4CGTA 3P9MA 4OLEA 5D7LB 1XGQB 3TGXA 1OY3B 4KZEL 4F7TB 1WFNA 4TTDC 5EU7C 1XGYH 4OCLC 1NMAH 4XNYH 1XR8B 2EYSA 4JPWL 1WCBB 2NW2A 3BOVA 3MRJA 5IB1B 4XCFL 5HDOA 1QBML 1A1MA 4KUZL 5LBSL 4P2RB 3CVHA 3QEQE 1HXYB 3PXHA 4JN1L 5CEZL 1AE6L 4CN4A 1FO0H 4GS7B 5ISZA 1XIWD 3H8NA 1YEHL 4HWNA 5EBMA 5L6YL 1ORQB 3I02A 4JKWA 5D7IB 4BZ2L 4ZUWB 1HSBB 3MFFA 3GSNL 1MFBL 1WBZA 5GRXG 4PLKC 5EBLB 2HJFB 5AAMA 2EYRA 1C5BH 2WWKO 3FB5B 1JGUH 2BVTA 3C60D 1INDH 3T0WA 1WCQA 5C0CB 4M8QB 4NN5B 3KJ6L 4JDVB 4G8IA 2CDEA 4DW2H 5F9JA 1T4KB 3GSVB 2EH8H 2I27N 3WUWB 2XXCB 5IHUL 4NC2B 5EZJB 1V5JA 2HFGH 4M5YL 2BHUA 3V4UL 5D2LE 5M94B 5DJDA 3ELAT 4OTXL 2E9JA 3H7BA 2NY1D 2QSQA 4Y1AE 2ZOLB 2KZ1B 3MRIA 1JPGA 1HQRA 3GSRA 3P77B 15C8L 1S7UB 2CXKA 2DTMH 5AZEL 5EN2A 5JOPE 1IM9D 4LLQA 1CE6B 2OM5A 3NTCH 4JREC 1IFHH 3ARED 1W72L 2DQDL 2EE3A 3LB6D 3VCLA 4XP4L 1WITA 4PJ5D 2F8XC 1M05A 2FGWL 1A4JB 4ZQKA 1CQYA 3O9WD 3U1SH 1ZHKA 1CL7L 4M8VA 1MEXL 5FKAA 5C07B 3NA4A 2B5IC 3HC0A 5JMRA 1EEYB 1CZ8H 2R56L 3JV0A 2PO6A 2YRZA 1X5JA 3U46B 3D3VE 3DX6B 1A1NB 3IJHA 3DX8B 1FJ1B 5HYEA 1JHLL 2WANA 4HKBA 3HAEA 1JPFB 3DV4B 5K33A 1PGRB 3MLTA 3WIIH 2AJSL 4RA0C 3AU1A 2QBWA 4LLYA 4P9HH 4ODWB 4ZFOA 2VL4A 3S35H 5BRZD 2CRMA 3HE6B 3G6DH 2DYPD 2D7TL 2GSGA 5KVMC 5JHDD 3O6ML 1T1ZA 4EIZC 4YHZL 2C9AA 3I50H 4P2OC 5E7FA 4DKDC 4NQDA 5KVGH 1ZVYA 1ED3B 2JTDA 5IB3B 2I9LB 4G3YH 3PF2A 4PREA 3PHSA 3GRWH 2N4IA 3PUCA 4WI3A 5DA4A 4MDIA 1Q38A 5J9PB 2FB4H 3CH1B 1CK0L 2QHRH 3G08B 3UBXI 5GS0L 5E56A 3ARGC 4ODUB 4Z77A 2DM3A 3MXWH 4X9BA 1LP9E 5D1ZA 2BOCB 5GS3A 4HJJH 3OZ9H 4OUOA 3IFNH 3INUL 2WUCL 3HI1B 3P4MB 3PG2A 1EH9A 1G6RH 3SGEI 3JBG7 1WV7T 5D96C 3L3DB 4O2EB 1MQKL 1WTLA 3MBEB 3ZL4L 1JNHB 3DTXA 2ORBH 3TJEH 5JZ7D 1IKFL 2CKBL 3KYMA 3SDAC 1OL0A 1ONQA 4RNRA 3L6FB 5DRZB 3F7PC 1NCAH 1IGJB 3CSGA 3D39E 5F8QC 4L29A 4QXTA 4JO2L 2YN5A 3VFNB 2GJJA 2HFEA 2V5YA 5TDPB 1NDGA 4JFDD 1VDGA 1R5IB 3MV8B 1IZKA 2FDBP 3DXAA 4G43A 4LKXB 3ULSA 3IDYB 3NFPA 1LQSR 3ALWA 1G7QA 3P9LA 2V7HB 4EN3B 2J3SA 5AYUL 5E8EB 3B9AA 3PIQA 4GAGH 4PRHE 1EX0A 2JCCF 3K3QA 5I30H 1Z3GL 1YYLL 2DWEB 4PJHE 3C8KB 4PJBE 4YDVB 3RDTB 1NLBL 4UDUA 4KJQD 3LN4B 3V4PL 3QJHA 2XI9A 4TULL 4LSTH 4Z7WB 4A6YH 3GBNL 2AS5M 2IG2H 1IQWL 1BD2D 1J8HB 1P1ZB 1TJGH 4QHMB 3WIFA 4NBZB 1BZQK 2Z92A 2A6JA 5DGQA 1LEKA 3RGHA 4XXDA 2VLLA 4OZFH 1L7IH 4J3OC 1YDPB 3TESA 2QSCH 1NC4B 4Q7DA 4JY5H 2ITCA 2K9UA 5BV7C 2Y06L 4Z0BH 4FG6C 1JIBA 4ZO8A 2Q8BL 4OT1H 1NMCB 1LK2B 4MDJA 1BVLA 1KJVB 3QI9A 3MNWA 4JG0L 1ZLWH 1FNEB 4YFLF 1IC7H 2J8UE 4X7CC 4Y5VA 1FZJA 4OGYL 4UNUA 3KXFA 3MLYL 4L5FH 5I1AB 4LCIL 2H6PB 2YPLB 3B9EA 4XRCA 4TTGA 1X5XA 3B2VH 1Q8MA 4OLYH 4F58L 1G0DA 4QRSB 1OF2B 3W82A 4POUB 2XRAL 1YA5A 5HHOE 5KJRH 3KLHD 4YDIL 4XBPA 3T0EC 1A6UL 2P8LB 1HHGA 3VXOA 1NFDB 3TV3L 4NQUA 4NZUL 2GSIA 4PY8J 3T77A 1OGAA 2DQEH 1FC2D 5IVXF 1ZLSL 3MSPA 2E27H 4GXVL 4NC0B 4PRIA 3GHEH 4YFLI 2XZCL 4KHTH 1RQ5A 1KTLB 4O02L 4KJYA 1PZ5A 2DB8A 4X9IA 4TPRH 5B8CB 5CEYA 43C9A 3OBAA 3SKNA 4HFUL 4KI1A 1J5OH 2OL3H 4PJGF 3T65B 1AGBA 1HHHA 4S1SL 1EGJA 3T3PE 1DEDA 2O5XH 1NGYA 4WEUD 3MCKA 5DI8B 4PLJC 3X13B 3QDAA 4GMSH 4WEBL 3IJSA 3QXAA 2EXWD 5HGDA 1RUML 2GJZB 4CUCA 4N8VG 2H45A 4ZO9A 4NT6B 4I5BA 1EUUA 3MJ8A 3LKPA 1HIML 5IEKB 1U8IA 4NJAL 1RZKH 4LCYA 4PYGA 4TSCH 2F5BL 4YC2B 3U7YH 4XWOD 4X4MA 4XMPH 4F57H 2R1XA 1RUAH 3M17B 5F9WC 3RWDA 1E4KC 3UYRH 3VFOB 3DUUB 4W81A 4MLSA 4PD4K 4I18C 1OAUH 3ZT5A 2ENYA 5ID1B 4JZJB 5IB4B 3FHAA 3HI5L 2VXSL 4WI9A 2QKIA 3S5LA 3SKJH 3W39B 2V2TB 4XP9H 2WNGA 4X99B 4Z7VF 5D93B 1Q9OA 3DBXA 3HNTL 5EU6D 3LEXA 1RJCA 1CIUA 2KQMA 3ARWA 5ILTH 1L0XA 3OHXB 4JGMA 4OCRL 1MRFH 2W9DH 2ZSVA 4HAFA 5CP3A 2J6EA 1HDMB 1MFDH 5CJXC 4F9LA 3VWJD 1KJMB 1UKSA 3AC0A 4LGPB 4NKIL 4CN6A 5IWLC 3HC3L 3VFPA 5F3BA 3JVGC 1KSRA 4YPJA 1IAMA 1G6RB 4MYWB 4CVWA 2W0KA 5H2BB 3VXRB 1KN2L 1F11B 3MLRH 4LCWB 5J0BA 4HIJB 2XZZA 4RAUA 5M7QA 3QWRA 1FYTB 3TFKD 2BERA 4QHUA 4DKEL 4M7LT 3QFJD 1J0JA 4OCSL 3WFEH 5F8RC 3WSQL 3IRPX 2CUMA 3FO2A 4P9ML 3UZQA 4OLUH 5FA4B 3DMMB 4R8WH 4H8WL 5EIIB 4GMTH 4PJEF 1T66D 4MCZB 3RVUD 2G2RB 2NR6D 2DJUA 3Q0HA 1F90H 1CS6A 4Z0XA 4QGYA 3MRCB 4WTZA 1I1AD 1MH5A 3BPLB 3HPJB 2WIMA 2IPKB 2C3VB 3HMXH 5D6DC 4U4BA 4KJWC 3MRPA 1UXWA 5FA3B 3WN5A 1X6NA 2Q20A 4BSVB 1OW0C 4NKMA 4ODHH 2AXGA 4YZFE 2H26B 1BAFL 3VXMA 1QRND 2PYED 2APWA 3L5XL 4PV9A 5EC2B 1DLFH 4PJFE 4GAYA 5LKNA 4M61A 3GZKA 2OP4L 1MIMH 3O11B 4XP5H 1P6AB 3QCVL 2DQHL 3UTTA 3H42H 4X5WA 4WO4C 5E2TL 1AR1C 2J2ZA 3EYUH 4KI5D 3HNSL 3QULB 3MMEA 1NLDL 3GDBA 3FN3A 1F58L 3MLVL 3CMOH 4X4YA 4YHPB 3HE7D 5E8DL 2VDPL 2R0WH 3EUUA 4LASL 5EBWB 1ZANH 1Q9KB 4UILL 2P44B 4PJ8B 1FSKC 4XVSH 5BZDB 1CFNB 3L5WA 3S6CA 5A2FA 3CFCH 4Y19B 2BNUB 3RBSA 1MFAH 4JRYB 4WWKC 4WW2A 1HHIB 5C0CE 4ISVA 1A6VL 1O5DT 4NJ9L 2VIRA 4NFDA 1YY9C 1MFEH 3SCMB 2A6IB 1NEZA 3LKQB 1NSNL 2AJUL 5DYOB 3C2AH 1JF6A 1PW3A 1Q0XH 2RHEA 3BP5B 2QADD 4FQJL 2FO1A 2GT9A 4KQ3L 4LU5H 5EPMA 3BZEB 4F15C 3HZYA 3DYMA 4LAQL 5DXWA 4U05A 3ZMRA 3V0VB 3O2DH 4NGHH 4HXAL 5J11B 4RGNC 5BS0E 4XH2A 5CSGA 1IILE 1PQZA 4PGCA 3MR9B 3S96A 1SJHA 3SE4C 4KROC 5ESVA 3TN0B 4LPUA 1DDHB 5GS1A 3QWOA 3DETD 3SGJC 3BP4A 4C83A 1NGWA 4ZTOH 4H26B 2G9HB 4HG4J 1KXQE 4K55A 1ZTXH 3PHOB 4UINH 1MJJA 2ICWI 4LHUA 2YA0A 5CJ8A 5KSVA 4NN7B 2AJVL 5FGBA 1FZKB 4YHNA 1YN6B 5BMFH 5IK3B 2WUBH 1TPXB 1PG7X 3FO9A 4TQEH 3RWHA 1HKFA 4QF1B 1DE4B 4UV4H 3GIVA 43CAB 5F96L 3OKNA 1KTRL 2VLJA 3LS4H 1OTSC 4L4TE 1QLEL 3QUYB 2WLYA 5CAYB 3L3GB 2A9NH 4GRWB 4KVCH 2ZUYA 1ACZA 1CIDA 1KV3A 1HILB 4PJIA 5MERA 1IGTB 2M8XA 4L4VB 4PLOB 2Y07H 2IH1B 2FJHA 2XKSA 2NX5A 2VLRB 2GITB 2FLRT 2HT4C 4LSSL 4R3SB 3IETA 3RGVB 4Y89A 4HBCH 3AMLA 4POZC 1BQUA 3QIUB 3IAGC 4ODXA 4XVJH 4DN3L 1BJMA 1JPSL 1QSEE 3UX9B 3RAJH 1QKZL 3IT8D 4PS4H 1OAZL 1OP5H 1ZA6A 4Q58C 3QPQD 4YFEA 5C09B 3T8XB 1UXSB 3OX8B 4U1NB 3MRLA 1CE1L 4K7PX 3SKUD 4W4NA 4DZBB 5FGCB 1F4HA 3EAKA 3OJ2C 4CADB 4Y16B 2FEDD 1NAMA 3DVGB 5GIRA 2RB8A 4F7EB 2BNQB 3UTQB 2WBJD 3EYOB 3GNML 1F8TL 4HC1L 3MV8E 2IH3B 4QRPD 2FEEL 1L6XA 4JDTH 1LK3L 1W0WA 1X5HA 1N3NB 2CR3A 2X9YA 4U3CA 3FB7B 5CBEA 3A67L 1KNOB 3CLFH 5AD0B 2VSCA 4NZTH 3O4LD 3MRBB 4OFIA 4PP1C 4I77H 3REVA 4JB9L 3KDMB 2BCKB 3CCHB 3OKEA 3V6OE 1A9EA 2Z35B 5DQDL 3OR6A 1U3JA 2NXZD 1XIWC 2Q86A 3FB8A 1DL7H 4FMKA 1QA9A 2ITDB 1C7SA 4I0PA 1G0XA 1MVUB 5ESQB 2C4FU 4YXKH 3QUXB 1BM3L 4RGNE 1YEGH 3EO0A 5C2BL 3SKOB 3A6CH 2R1YB 2Z93B 3T4YB 3QDMD 1ACYH 3ZKQD 3NVQA 4UTBH 3WJJA 1FGNH 1IKNA 4EVNA 2F53A 7FABH 1EFXA 5HI5D 5C08D 1IT9H 3DJ9A 5FKPA 4LGRB 1Y18B 4QT5A 1L7TL 2VTFA 3RL1B 5E2JA 1T03H 4F3FB 1MHPH 3S5LG 2HTLD 4XHJD 5IFJB 1K2DB 3LS5L 1L9NA 2NY1C 2GJ6B 4XC3H 2Z31A 1EDQA 3BIKB 4HMCA 3WXVH 1D7FA 2JCCE 2P8PB 5DGRA 5CZKA 3SPVA 4FABL 4EI5C 2YPLE 1JZ8A 2XIDA 2OTWA 1G9MC 3WHE1 4MAYB 2IADA 1J1PL 4NUGL 3AREC 4OZHA 3VXTA 3U30B 1QLFA 3LB6C 3GSUB 4QXGH 4YHYC 3UTZB 2L7JA 5SWZB 2OMNA 4MSWA 3O9WC 4NSKB 1QBLH 3NCYP 1SM3H 1U95A 3WS3A 3UJJH 2RIKA 1U8KB 2EDYA 1B90A 3UJIL 3WL9B 5CWSA 3R1GH 5CSBA 5H37G 2QLVB 4G6KH 3MLSH 2W65B 3Q1SL 4LAJH 3LH2H 1ZWIB 3SJVE 4JKLA 2VLKB 5JXAH 2V9QA 4ZUSA 4KI5F 2HFFB 4QLRA 5K9KA 3L9RA 2XOTA 5GJSL 4R9HA 5C6WH 2BHZA 1BFTA 4Z7OE 3VMPA 4GG6A 2BVOB 3ARDD 3JSSA 4LSVH 4DTGH 5ICXB 5BW7A 1QOKA 2VR5A 5E6ZA 1HINH 3NPSB 5I1JL 4MAUH 4LF3A 3ZYJA 1PG7W 4NKQB 1XT5A 4WTZG 3EOAA 1I8IB 4MHHI 2ZUQB 2X1XR 5HVHC 4DVBA 4KVNL 3VGBA 5IVNA 1IGIL 5I15H 2Y36L 2HP4A 1QHPA 4LSQL 1RK0B 3IFLH 1AIFB 1XF5A 4FP8H 1U3YA 4MQSB 3HS0B 2LV4A 5HYSA 2O5ZH 4GRLB 2X1QA 4D8PA 1KLGA 2F58L 2R0ZL 3PE9A 2MPAL 5D8JL 3DWTA 1INEH 4ONHB 2BNRA 4K2UH 4G9DB 4HJ0D 4U1KB 3LV3A 1J7VR 3E8UL 2ILLA 5I1EH 3D69A 1XGPB 4L3EB 5H94A 5B3NA 2ESVA 3RWEA 1CF8H 5JZ7C 2DMKA 4YQXH 3MGTB 3DX9B 5ETUA 2JJSA 3SDYH 2E9IA 1GJIA 4TSAH 1U8JB 2HLFD 2MWCA 3RNKB 2Z8VC 5FGRA 2Y4SA 5E9DD 5E1HB 4U3XA 3OKKA 3V7AG 5I1LA 4EUPH 5K9QG 4HUVA 3QEHB 2X4RA 2A9ML 2AKRA 4WFGD 1C08A 3H3BC 2R29H 4K3EL 4KJQC 3KAAA 4NOFA 3HC4L 4OLVL 3VFMA 5IB5A 1DUYB 3UTPE 4X7TB 3BD4A 1D5XA 4KZDH 5IFAH 5DD5L 3NFSH 1U6AH 5D1QB 4O9HL 3Q3GA 1DVFB 1CG9B 1N0XH 4HQQL 4JM4H 3HR6A 1CGUA 3RA7H 4PBWD 3TPUA 1U8LA 1GOFA 1GVIA 3C08L 1JGVH 1CFBA 3EYSH 1FPTH 5GHWL 3QZWB 4X6DA 1CD9B 2WK2A 5E8PB 3PV7A 5HI4D 1PG7H 2RCSH 3LKRB 1N5AB 2OR8A 4G5ZH 1KPVB 3RU8H 1LILA 3SN6N 5I1KL 3TNMA 2G5BB 1FCCA 3ZE1F 4RMRA 5F44A 1Q1JH 2PKDA 2NY4D 4N0UE 1CCZA 4PJ9A 2HN7A 1KBGL 3QPXH 4LHUG 4GKOA 1ZEAH 2X4UA 1ZHNA 3WS6A 5T3XD 3NN8A 5HTSA 2UYLB 1AC6A 3EYQD 4PB9H 4LCCA 4J23A 1A6AB 1UCBH 2DDQL 4NZJA 2IEPA 1V3JA 4XB7A 5BRZE 3V6ZB 3UTSB 4Y4HA 3B4NA 1S9YA 4ZAKB 1CYGA 5I71C 1OAXL 4FTVA 4HDIA 3ZYIA 5ADPL 1TLKA 2J8OA 2EDBA 1A6ZB 5F7LB 1DSFH 4HWEL 2VUYA 1S7VA 3BGFB 2JKXA 3GMQB 1FL3A 1UA6L 2WP3T 5E6IA 3MOBH 2VDKH 3WFCH 3S37X 4MNGB 3OJDA 2CDFB 2R1WB 4Y19E 4OD3L 2DIAA 2D9CA 4DCQB 5K9QI 3CIQA 4ODBD 3H0TB 1J1XH 1S9WA 5E2UL 1D6EA 1EVUA 3KNBB 3QIBD 2DQCH 1QBBA 3I9GL 4Y8AA 4JO3L 3MCLH 4FZ8L 4GBXD 1WJ3A 5DWUH 5FF6A 4P2OB 1HQ4A 5CINH 4DEPC 4U7SA 1TVDA 5HDLA 3HKFA 1I3RB 3BWAB 4XP6L 3H9SB 3RX5A 1EEZA 1KJ2H 3ZDXF 1LE5B 1U3HA 1JZ3A 1I8LA 3X14B 1K8IB 4UI2A 1IGYB 4ONOA 4NO5A 3O81A 3VGGA 3HZMB 2J88L 1UZ6E 3K74B 3ZHLA 3KPRD 3ARGB 2CLZB 1R5VB 4QO1A 3SDXA 1QLRA 3VXUA 1JTTA 3V5HB 2AJYL 1YNLL 5I1HH 1T7WA 3MV7E 4KKNA 5JW5B 1CWVA 2FO4B 3C5JA 4L8SA 4PJIF 4E42B 5CZVL 4MJ2A 1R3HA 5KVEL 1KT2B 4NQCE 5IGXH 2CLVA 5L9DL 3B9KB 4P23A 2UWEB 2AV7A 1NFIB 3V0WL 1SY6H 2X70B 3NZ8A 5MHSE 1K6QH 1JTOA 4Z78B 1DEEB 1FAIL 5B4MC 2FX7H 5EUOB 2V6HA 4HH9A 3IDJA 5A1AA 2UVFA 3T0AA 3HUJF 1CFQB 4HMEA 5KBNC 4H88L 4V1DA 5LAXA 5EDXA 4RISL 1ETZA 1A3RL 4LSRL 3R0MA 5I74C 4WU5A 2VLRE 4DK3A 1OHQA 4YAQB 2FJGA 1P2CB 2VISA 3HG1E 3WIHL 1BZ9A 3MGOA 2L4OA 3HRZA 2R0KH 5T1LD 5K9OA 1AP2A 1HZHH 1OSPL 3CUPB 4WUKH 3QNYA 1I9IH 4G9FD 1LGVA 4MD5A 4OQTH 4ONGH 5KSBF 1JWSB 5C09E 4TUOA 2BVPA 3O3AA 3O3UN 3FOLA 1UACH 1I7TA 2BHYA 3VFTA 2YZ8A 4XNQA 4NNXA 4P57B 4JKKA 5LQBL 2GCYB 4XX1E 1F3DJ 4EUPB 1AGFA 2PXYD 5FGCE 1T66C 1CICD 5FUZH 2AERT 3TYGH 2I25N 1Y6KR 4L3CA 1CLYH 3MJ7A 1KPUB 3IU4L 4M48H 4XPBL 3QIWA 3QDJE 1VADB 5C8JA 1EK3A 2VLME 4FQXD 5DRNA 4APQB 1KB5A 1RFDH 5KSAB 1EO8L 4PJ7F 1PYWA 4P2QA 1FGVH 1HKLL 3GMMA 1KG0B 3BGMA 2ZCLH 1EBAA 5DJYA 5D1XB 5JIIA 4PV8B 3A6BL 5FUOL 2CD0A 3O0RH 2Z0BA 4LIQH 4YBLB 5BXFA 4B50A 2WMPA 2E7CA 5C0DB 3BKCH 1SYVB 3SE8H 3I85A 4LMQE 4MJIB 3X3GH 4ZS7L 2A74A 2BFVL 2B8OT 1Q9WA 2IGFL 4N5UA 5ANMB 4XAKE 3O6LL 1FFPA 4QXUH 8FABA 2FD6L 4I48B 1VKXA 3U4BL 2OZ4A 32C2B 3ZZ1A 3FRUA 4M3KB 3B6SA 2OI9B 1TXKA 1L0YA 3W9DA 3SDDD 4E41D 1EHNA 4YDJB 5I76A 4QTHA 4U31A 3HE7C 4OGXH 3QFDB 3NIFE 4LQFL 4PJAE 1TZIA 4ZOEA 2R2EB 2XICA 4PJCF 1AJ7H 3DUSA 4ZD3L 4AJ0A 1ITCA 5MEOB 5KVFH 2HJKA 4PP2A 3RWIA 3BQUA 5H8DA 2P1YA 2EH7H 5DHYB 4LK4A 3QAZC 5HYSG 4S11A 3VD5A 3K2UL 1AQDB 1T20A 3OXRA 2E7MA 2V9TA 1ND0A 4HCRL 3LN9A 4U2ZA 4OM1L 2VDNH 2JELL 4FQQA 4LEOA 2XNAB 5J4MA 4F2MA 4WENB 4X4XB 3IRZA 2FYYB 1IC5H 1GGBH 5EU6E 3QXDA 3GKZA 3O6FC 5GISL 4MXVE 4C55A 3MV9B 5I18H 1VGEH 3QUZA 1ZGLB 1OSZA 1U58B 4M43L 1MWAH 1UJ3A 1H15A 4PJDA 1CDIA 2LFGA 5L2KD 5EZOL 2NY0C 1TQCC 2ICCA 1A6TB 1M7IB 4NQXB 4RFNB 4Q9QH 4D0CA 3EZJB 4OCYH 4KMTH 4ZUTA 1JUFB 3VXSD 5DMGD 2H8PA 4JPIB 5IQ7H 3K7UA 4JVWA 2A6DA 2IFGA 3FFCE 1HH6A 2YSSB 3KYOA 1KJ2B 2X44D 1PZUB 2IAMA 2FH6A 1QFUL 4MVBC 3JTSB 3QFJE 4R4BA 1XH3A 4DQOH 3VD3A 5IIEA 1SJVA 1U8MA 2F9BT 3GGWA 4UQ3A 3J8F7 1Q72H 3UZVB 3AB0B 5C6TL 1MHHA 4X9HA 3D85A 2IAND 4M93C 4XNUH 4G7YL 5DR5L 1IGCH 2ZPKL 3WHXA 1LE9B 4XGZA 3H7LA 4OIBA 1QQDA 1RIHL 3EOBB 3QYCA 3BX7C 4JHWL 3LEYL 4BA8A 4C56A 3SEPA 2V2WA 1N2RB 3MRNA 1T89C 3OAZK 4J3TA 1MPAH 3OXSA 4I13B 1NCNA 3PWPA 2IBZX 1I3GL 2IQAB 2ZUVA 4LVOC 5TE6H 2ADGA 2OX5A 5E94A 2P5EE 1NL0L 2DKSA 5E4EB 5I17B 1A5FH 4NHCL 5DFWH 1RUKL 1U8OA 1A8JH 3NFNA 1ES0A 1DQDH 4OI9A 5DZNA 1RU9H 5EOTB 4DGVL 4OZIA 4WW1B 2IPTL 5ALBL 1MCOL 1KEGH 1Y0LA 5D7LA 1XGQA 2HT2D 4ODTL 4OFDA 5FYKL 3S37H 3HHRB 4N8CH 1XR8A 1V3LA 2O93L 2A0LD 2BSRB 4KTDL 5IB1A 4C58B 5C7XL 2PETA 5IQ9B 4XTRD 5E00B 4CRPA 1DR9A 4P2RA 3T3MF 3AAZB 1FE8L 3FT2B 3QB7C 4GSDH 5LGHH 1QSFD 3VMOA 2AK1H 4MS8D 3LHPL 3CK0L 1RI8A 2VDMH 5D7IA 1GGCL 3S7GA 4HFWA 1MAML 2DI7A 4ONFL 1HSBA 2L7UA 1I3VA 3CFJA 1G6VK 4GOSA 1YMHA 4WFFD 4N0CD 3KR3L 1DFBL 5EBLA 4IIQC 2HJFA 4DAGL 5F7WC 3FB5A 3UXFA 2W92A 4ZPTB 4Y4KB 4OCWH 1RZJC 4LBEA 5F3HB 2I9TB 1T4KA 3GSVA 3V2AR 1FIGH 3WFHB 1BHGA 1FORH 4JAMB 3VD7A 2DOCA 3GSNA 2I60H 4DKFH 5GSRB 1FL5A 2BRQA 4Q6IC 3KYKL 4IRSB 4EI6B 1QFWH 2VDOL 1KCUH 5HSFA 5T33H 3SBWC 4M00A 4X0KB 1E6JL 2P5WA 2NY2D 4GKNB 1N64H 4GW4A 2ZNXA 1S7UA 2XY1A 1CE6A 1QPXA 3BPNC 5A16B 2CUHA 5HI5C 5DUPH 2O5YH 2WQRA 4EDWL 2ZUSA 1ZT1B 4PRPB 2HTLC 1A4JA 3OL2A 3EFFA 3EYFB 4P5TB 3HCVB 1FO0L 3W0WA 4QRRB 3VFVB 2APXA 1W72A 1UYWH 3W11D 5HYQB 1WVZA 1FJ1A 1JPFA 1C5BL 2HVKB 4NNYB 1N8ZB 1QFWM 4H20L 4KRPB 1WSST 5FYJD 1INDL 3G6JF 4RMTA 3TBVB 1JZ4A 1HWGB 3THMH 4OF0A 5IMMB 2EH8L 1JGLH 5TH2A 3M45A 1KB9K 1MFCL 3H6JA 2DQJH 3RVXD 3RY6A 5KVDH 5HHVH 3WLBA 1MCBA 1P9MA 2HFGL 5T3ZD 3ULVH 2I9LA 2Y9RT 1E27B 4AT6A 3D9AH 3ZT7A 5L88L 4PGEA 3SDXF 1OGTA 1MWAB 5J9PA 4XXCC 3CH1A 2DTML 4KXZI 5J6GB 3G08A 3MJ9L 1IAOA 2DMBA 2MKWA 3ARDC 4ODUA 1A4KB 1DBAH 2BOCA 4BQCA 1NBVL 2BDNL 2PTTA 4KDTA 3H9SE 3P4MA 5HVWA 5EU3B 1UG9A 3DRQA 3G5VA 5IEHA 1BVZA 3EJYD 3L3DA 1QR4A 3MBEA 1JN6B 1X7QA 1YNTB 3PL6C 4TNWK 5KW9H 5CEZD 1X4XA 1YMME 3FTGB 3OJMB 3T0BA 5E2VH 4MQ7B 5JNYA 2ZCKL 4M1DH 5TDPA 4Y88A 4KJPD 4ORZC 3TVMC 1J1OL 5CKGA 5GGRY 4HJ0C 2HAZA 2D4FA 5DEFA 5E7BA 2V7HA 1CGSH 4KAQL 4N0FB 5E8EA 4E0RB 4R0LC 4QOKA 1A7NH 3DECA 3RUGA 2GTZA 4KRMB 1KXTB 5HHXL 2DWEA 3I50L 1C1EL 4FFZH 5DS8B 3RDTA 4ZYKB 5KVGL 1HYSD 3LN4A 5HGHB 3ARZA 4LSPL 1XGRB 2HLFC 3DARA 3GRWL 1H5BA 2FIKA 3K1DA 4LSDA 5DMJB 1JZ2A 2FB4L 3EJZD 2V2XB 1YNKH 5DEGB 2GFBB 5IVXB 2QHRL 4FMFA 4JFYB 3QDME 4FQ2H 1P1ZA 1EHXA 1AXTH 3U9PH 3HAEH 4RCAA 1VEOA 2FATL 5AG8A 4JPKH 3CDGA 3OZ9L 4NRZA 2F54D 3KPPB 1YDPA 3RP1A 4X8XA 1GGYA 4PJGB 5CLWA 1RMFL 5E8NB 3BIAX 3DSFH 4ZFZB 4C54A 1T2JA 3BDYL 3VFGH 5BOZG 4U1JA 1NGPH 3TJEL 1LK2A 4OKVB 3FQNB 2PW1A 3K8LA 5T3ZH 1FNEA 2RGSA 3O3DB 4JZOB 5GGTL 4NO0D 5DZLA 2UVEA 3C60B 4I2XA 5HI4C 5I1AA 3OB0H 1CDUA 2H6PA 2FHBA 1G9ML 4U6TA 4ODSH 3P11H 3NCMA 2DQIH 4GAGL 4ZSOB 3X3FH 1KXVC 4JHAL 4QRSA 1OF2A 1HNFA 5I30L 2DQGL 2NY4C 5DJXB 3IDMB 3FFDA 3GIZL 4G8FB 4DGIL 2YWZA 5JDSA 3BJ91 5CD5D 4KY1H 5CMAB 4R2GB 1WFUA 5DT1H 5IROA 4X6CF 4GAJL 1IM9B 5I9QC 2EO1A 4A6YL 1J11A 3EYQC 4NZRL 3SE3C 4XPGL 1NCDH 3MLPA 1KTLA 1UCTA 4UOW1 1ERNA 4JJ5A 2GTWB 4YXLH 5ANME 5B8CA 5B39G 2CO6B 3DRTB 3O3EB 3L3KB 1HHJA 5C86A 1GPOH 3W5NA 5C0BE 5KSBE 4KKLD 2QSCL 1TNNA 2R4RH 2QHLA 1XGUB 5DI8A 4JY5L 3X13A 2VAAB 3WO3B 4Y2DC 4Z0BL 4OT1L 2VMFA 4OFPA 1WBYA 2GJZA 1A0QH 4N8VB 1VB9A 4J1UB 1TVBA 1FVCB 4TN9A 1P7QA 3U6RA 1MSPA 4XZUA 4IRJC 5IEKA 3RWCA 1FNFA 2YPVL 4PJ7E 1F97A 2AK4E 4ACPA 4I4WB 3B2VL 4M6OL 5KS9F 3TNNB 1G7HA 4GBXC 5JHDB 1MRDL 5C0AA 2G60H 1PFCA 2WWKT 3VFOA 3DUUA 3U48A 1A22B 3N85L 3EIFA 1GXEA 5ID1A 2EYSB 3ARBD 5LJYH 4WY7H 4UV7H 5KJRL 2YD7A 2NW2B 1K4DA 5IB4A 3BRGC 3PDGA 2EEDA 2DI8A 25C8H 4PJEB 1I7RA 4ELMF 3W39A 5IR1B 4WUUD 5DC4B 2XPGB 4X99A 5TE4H 3WO4B 2DQEL 3QDHA 3CVHB 4U1HB 2R2CA 2OSLA 3FQUA 3ESUF 5ISZB 2ZSWA 3EFDL 2F8OA 1RUPL 2FBOJ 4K3JL 4KHXL 2FGZA 1HDMA 5D7KD 3WDJA 1T83A 4PTUA 1AR2A 1A7OL 1WBZB 4WGWB 4XCNB 2OL3L 2NPLX 4LVNB 3RIAF 2ZWLT 4FRWA 5EORH 2MCPL 4YXHH 4QCIA 4RX4A 1BGXH 5F1SA 1RK1A 4GMSL 4G8IB 5F9JB 1X5YA 2F19L 1UQSA 1PAMA 4JRXA 5H2BA 4JFDB 1MUJA 3TA3D 4EXPX 3G5ZA 4HIJA 4OZGA 1FYTA 1WZMA 4JFFA 1MCPL 4TSCL 5DJDB 2A83A 5JORB 2P45B 4MJ4A 4XMPL 2YRLA 2QSVA 1Z9LA 2ARJQ 3QP3A 3MRIB 4IMKC 3TO4A 1JPGB 3GSRB 5JDJA 2NY6D 5F9OH 4LLQB 3UYRL 5EIIA 3O8XA 3RTQD 1RZFL 5KTEH 2G2RA 4LLWB 1EGJH 5GQBA 5TF1L 1RZGB 4UNTA 3SKJL 3MRCA 3O45A 1M05B 1WEJH 3DHMA 2ERJB 4N8PA 1GYAA 4ZQKB 1BD2B 1KFAH 4P59H 1JBJA 1ZHKB 2ICWB 1EJ6A 5FKAB 2VN7A 3ZKMD 4J12A 5ILTL 5SWSA 2HH0H 5INDA 1D5BB 4W6WB 2PO6B 3G5YB 3D0LA 1MRFL 3KGRA 3RHWK 2C3GA 2W9DL 3MUY1 1MNUL 2H26A 1CICC 2D3VA 3IJHB 3TT3H 5EC2A 2YD8A 4HKBB 3DNKA 3JZ7A 1IBGH 3VFSA 3WUZA 4FQXC 3PQYD 3EO9L 5I8KH 3G9AB 3C8DA 4AEHH 3O11A 4JEGB 1EPFA 1CFTA 5IF0B 1F6AB 2HG5A 5MENA 1Y6MR 3MLRL 1QNZH 3VI3E 1T1ZB 1TFHA 4MZ2A 1MIEH 4NQDB 4RGOL 2GW5A 3H3PH 4YHPA 2OTUA 1Q9KA 4MDIB 1J0YA 4PJ8A 5HI3D 5BZDA 4RMSA 2BNUA 4OLUL 4JRYA 5CP3H 1HHIA 2VYRE 4PJXA 4LLMA 4Z77B 1YECH 1KN4L 4NHUA 4KTYA 1F90L 1NBYA 2A6IA 3TBTA 4J8RA 5D1ZB 3SDDC 3LKQA 3HNVH 5DYOA 3BP5A 2ED8A 3TJHD 3TEUA 3HMXL 5GGUA 1B4JH 3BZEA 4LIQE 5H37H 2LE9A 4OF6A 5F72S 3IDXH 3KPRE 1ONQB 2CGRL 1JPST 4ODHL 1F3RB 1AO7D 1FIEA 1JTPA 3P0VL 1DLFL 1MRCH 3DXAB 1DLHA 4G43B 3QDGD 3ULSB 1FL6B 3NFPB 1G7QB 1MI5D 3PGFL 3DI2B 4P4KD 3H42L 3ARQA 3PIQB 4WNQA 4H26A 1VA9A 2GKIA 1H3VA 2G9HA 3I6KA 4F7CA 3FT4B 2VABA 4FQ1H 1E4WH 4MJ6A 3C5ZA 2HRPL 3CMOL 4RGMB 3QJHB 1HCFX 1CXIA 4GFTB 4FFVD 4QF1A 3SDCD 1PJ9A 1DE4A 3HI6L 3QWQB 4K71C 3NA9H 5HGBA 4N9OB 4XVSL 5I1GH 2VE6A 1T3FB 3L3GA 1C12B 4X80L 3B8SA 3K4DA 1X44A 2Z92B 2A6JB 5D7JC 1JPTL 3SO3B 3BN9C 1LEKB 4D9QD 4XXDB 1L9MA 3VXPA 4NCDA 3VDBA 4FQIL 3RNQB 1UJTA 2D7OA 2W0FA 1YPZA 1D9KA 4D9RD 2W9EH 4R3SA 5D70H 1BLNA 2ITCB 4PGBB 4TNVF 4GUPA 5EZIL 4F8QA 4MDJB 4TNWF 3L5JA 1GSMA 3VWJB 3MNWB 4NGHL 2FIRT 3CNKA 3GMPB 4KKAD 4OD2B 4YK4C 4Y5VB 1FZJB 2DJSA 2YUXA 4KPHH 3KXFB 4M7ZB 1UXSA 3OX8A 1F45A 4KRLB 1N6QH 3MCG1 3BN3B 5I75B 3H2WA 1CR9H 4Y4FC 3UC0H 5DK0B 4HIHB 4M7LH 3MXVL 4MQXD 1B0GA 1D5ZB 1UM6L 4PY7A 2QQNL 4CADA 4G6MH 5HYJE 1UM5H 4H1LA 4Y16A 1ZS8B 4ZXBA 1HHGB 3DVGA 3VXOB 4AL8H 4F7EA 2OXHA 3UTQA 2WUBL 2GSIB 4D9LH 3G6JE 5DZOA 4N9GA 2C3WA 3EYOA 5DLMH 4MWFA 4UV4L 4NDMA 5MEPA 2CJUL 3ARFA 1CFSB 3VRLE 3AM8A 1N5YH 4FFWC 2A6KA 3FB7A 2A9NL 3VW3H 2VDRL 1S7TB 2WBKA 1TMCB 1I1AB 3BD5A 1KNOA 5CEYB 2R0LL 43C9B 1D6VH 4KVCL 4S10A 4LSUH 3SKNB 2A0LC 3SE9H 4YGVA 3U2SA 3MRBA 1CTNA 1LD9A 4NNPL 3KDMA 3S97C 2BCKA 2BZDA 4LP5A 5HHMD 5HJ3A 5GS2D 3ULVC 2H2PC 4HC1A 5SX5K 3MOQA 3WHE0 3IJSB 3K0WA 2HKHH 2DLFH 1QRNB 2PYEB 4MS8C 4Y5XC 5HGDB 3TP4A 4R4ND 2YMXH 3PABB 4HUWB 3W9EA 5D2NC 4O2FA 5A3IC 2VDQL 3MJ8B 4HKXB 4N0CC 5IFHH 1U8IB 4MA8H 5E6YA 3T4YA 2R1XB 4WU7A 4YWGL 3K81A 5F7UA 4GKZB 4RDQG 3LKNA 5JHLH 5CJOH 3QEQA 4F7MA 3W2DH 4TVPH 1Y18A 1NAKL 5DTFB 3RL1A 3EOTL 3S5LB 3JWNC 4F3FA 1FNHA 4ZFGH 1OM3L 2XZQL 2BP3A 3OG6B 3KPSD 3P30L 1K2DA 4YGAB 1FZMA 1Q9OB 3DBXB 3BIKA 4G8GD 4MA7H 2NY2C 3LEXB 2P8PA 1FNAA 1YEFH 3QHTC 4YR6B 2B1HH 4ZSOE 2JK5B 2ZSVB 4PR5A 2QADB 1AHWC 1CVRA 3JV6A 3IFPA 1BBJA 3UTZA 3N1FC 1R3LB 2DLIA 2VH5L 1IC1A 2ZJSL 1LHZA 4M6NH 5F3BB 3K2MC 4JY6B 4FQLH 3WD5H 5D71H 4ODVL 3JV5A 1ZHBB 2HVJB 5HGAB 1NAMH 3V9FA 4GLRH 1AGEB 3W11C 5FYLD 1S9XB 2W65A 2B4CH 1L6ZA 3BT2H 2CDGA 4K8RH 4QHUB 4Z9KB 4YIQA 3ROOB 3WNKA 2VLKA 1YEGL 1UH3A 3A6CL 2HFFA 4UZGA 4G8EA 3KLDA 4P3CL 1ACYL 4RDQF 3RZCD 3FO2B 4GT7A 2BVOA 1OAQH 1TJIL 4O58L 1FC1A 1MCJA 1NCBH 3EYVB 4L9LA 4XBEL 3ME0A 1KPRA 1V7ML 3P2TA 5EH1A 4LCUA 4OLZH 5CS7A 1MHPL 1OVZA 3UDWA 5I16B 1DN0B 1AGDB 2E3VA 4XC3L 1WIOA 1WC7A 3MRPB 3H9HB 1NUFA 5DD3H 1A7RH 3U36B 3DURA 3WN5B 4X8JB 3ARSA 4U6VH 1M7DA 1BJ1H 3AS2A 5FOBA 4GRLA 4IOFC 5DJ6B 1RIVH 7CGTA 2LQRA 5LG1A 2IFFH 4GAYB 1ZK9A 4M61B 4G9DA 4EJ1C 3QRGH 1GZQA 3EJYC 3SKMA 3VMNA 4L3EA 4X5WB 3S88H 1TTUA 4ZPVB 4Q0XL 1FG9C 3ULVE 2Q3AA 3R1GL 1F13A 12E8L 2Q8AH 3MMEB 3MLSL 3DX9A 3ZDZF 3LH2L 4J4PD 4JFOA 4X4YB 2VWEE 2EDQA 1A3QA 1U8JA 2R23B 3RNKA 2BY1A 4KJPC 1YQVH 3C6LD 4WFFE 4XC1L 1LP9A 2VXVL 3L5WB 3Q6GH 3QEHA 3LKSA 2BRRH 5F6IC 3ZKXC 4IEFB 3JWDH 1KCRH 1ITBB 2WBJB 5ITBH 4NFCA 1KCSH 1FLRH 3Q5OA 1B3JA 3F6IA 4MAUL 3OGOE 1RZJL 3MACL 1DUYA 2GT9B 5KS9E 5EOQL 4X7FC 4V2BA 1UWEL 5D1QA 3HZYB 1G1CA 1DZBA 5FM8A 4K3DH 3MX0A 4CNIB 3BUTA 3O4LB 2W0LA 4IIQB 4RRPA 5J06A 5I1IH 2O5ZL 4XH2B 3R8QA 4LPWA 3CXDH 4R97C 1VFOA 5D5ME 4PGCB 3QZWA 4Y1AD 1SJHB 3QCUH 5JIKA 5ESVB 2NXZB 1IC4H 3LKRA 1KPVA 5GS1B 4PJHA 4PJBA 2VZ1A 1SYSA 5FGSA 3BP4B 5FCUL 4C83B 1FHGA 1VHPA 3STLA 4PY8I 3O6KH 4WV1C 3QI9C 5EO9A 3GSXA 1MJJB 4LHUB 3QA3B 4NWTH 4YHNB 4TSAL 2B7DT 4PG2C 5DUBB 3FO9B 2FH8A 4RFEB 3RWHB 1U9KA 3GIVB 3TZVD 4U7KA 3OKNB 4PJXF 4UMGA 1A6AA 2VLJB 3MLXH 3D3VD 4LLVA 4BQ8A 1AY1L 4JO1H 3UTSA 2R29L 3FO0L 3GSWB 3MZTA 4PJIB 5MERB 2YOCA 4HPOL 2XG4A 3MLZH 3HZKB 1G7PA 4NQDE 2NX5B 3F12B 5T3ZE 4KZDL 3NFSL 4I3SH 3GMQA 3SQBA 3IETB 4UUJB 4ZOCA 2WLZA 1B88A 1OWWA 3IJYB 4MNGA 2YC1A 4I9WE 4YDLC 2W91A 2CDFA 2R1WA 4AEIL 2GI7A 1JGVL 2PR4H 2E6JA 4QTIH 3EYSL 1FPTL 2CRZA 3H0TA 2DI9A 3N50A 1ZA6B 5CILL 3KNBA 1JNNH 1PG7L 2RCSL 3MRLB 4KKLC 4ELKB 1JNJA 3KPLA 3FN9A 3L7EB 3RU8L 1N26A 5SV3A 4BH8A 3BE1L 3HUJB 2DLHA 5GGVL 4DUXA 1A6PA 4JM2D 4P2OA 2JJVA 4O2CA 3Q6FB 1T0MB 3HA0A 4H25A 5J13B 1EHAA 3ZDYF 5GIRB 4H1LG 4UDTB 4AQOA 4JPVL 1K8IA 4KK5D 1OPGH 1IGYA 2VXQL 3ARGA 2CLZA 1R5VA 5C0GA 4PB9L 1X5ZA 3V5HA 3D39D 4M9PA 1W0WB 1AD9A 5JW5A 1S78D 4LPCA 4D2NA 5GGQH 2FO4A 1MCHA 1FDLH 3LPWA 3PDOB 4E42A 5AG9A 1U8PA 1KT2A 1MCWW 1V3KA 3PXJA 5DQ9A 4BZYA 4HH8A 3IFOA 2UWEA 4PRHD 1NFIA 1ZOXA 1A9EB 4K7PL 3CPLB 2IWGA 1JE6A 1DSFL 4KQ4H 3SDAA 4ALAH 5I2IA 3VRJA 5GGRA 1P69B 2X70A 3OR6B 2Q86B 3FB8B 5DD0H 5IW3A 4O00A 3WFCL 4MJ5A 1LO2L 2DRUA 1QA9B 1KC5H 4I0PB 1N7ML 4NN6C 4HV8A 3RI5F 1H3WM 1EJOH 2MNUA 5EUKA 4DJMA 3EO0B 1Z5LA 5E5UB 2OS7A 2UZYB 2DQCL 2UZIL 2YA1A 4YPGB 3MCLL 1OTTD 2F54E 5K93A 2XWJB 1FFNA 3D25A 2X9XA 5CINL 4EVNB 5E99L 2F53B 4F8TA 4YAQA 5FKPB 5EULV 4QT5B 4UIMB 3W81A 4AY0A 2XTJD 5HYIA 5BVJA 3ET9F 4JY4B 5C9JB 3PWNA 3KXFE 4WI2A 3SPVB 1BMGA 1I9JH 2OTWB 1S7QB 2IADB 1JRHH 1TZHA 4OZHB 3HTLX 1I1FA 3VXTB 1QLFB 3ZO0A 4AIXA 2LU3A 1S3KH 5IGXL 3PWUB 1VADA 1PEWA 4GO6B 1YY8A 1NFKA 2YHGA 1F5WA 4G7VH 5KG9A 1U95B 2OMBA 3ZKMC 1NPUA 2VQTA 2XZAL 5HHOD 1OGAE 5CWSB 2NXYD 5D1XA 4PV8A 5CJQH 5FK9A 4JLRA 4W6YB 1I1RA 3ZE0E 4PRIE 2GY5A 1S5IH 3ILPA 3PV6A 5DDHA 3ZE2E 5T3XL 2P47B 3HMWH 2Y72A 5ID0A 5IB2A 4LARH 3TT1L 1ULVA 4MJIA 3ZTJH 5DMIH 1PBYA 3PWVA 4YE4H 4WHYH 3T0EA 3V4VH 4I48A 4X9GA 4ZUUA 5L8JB 32C2A 4FS0A 2XY2A 3M1BA 1YYML 3BKYL 4HXBH 2BVQB 3VXQA 5DJ2B 1KYOJ 3ES6B 3WFBH 5CJBA 2R0KL 3FRPA 1P4IL 3MODH 1NBQA 3EOAB 1FBIH 1HZHL 2WBWB 4GQPH 3C6SB 4XWGL 3CSYA 3QFDA 5TDOB 4L4JA 4DVBB 3MOAH 5HI3C 2JIXD 1UACL 1DBJH 4PJFA 4X4ME 4WW2C 2MHAA 1A6WH 3WKMH 2VKWA 1RULL 5JUEH 4KC3B 1XF5B 2VZ3A 5FUZL 5HYSB 4M6AA 1RZ7H 3BPCB 4D8PB 5BO1L 1AQDA 2I24N 2BNRB 1DQLH 5D2LF 2B1AL 1PDKA 3HPLA 3GSQB 2ESVB 2ZKHL 4X4XA 1DCLA 3LMJH 3R4DA 4NQVA 2ZCLL 4U2YA 4QRTB 1CFVL 2ED9A 3MV9A 5FV2A 4LIQL 1Q94A 3QIBB 1ZGLA 1G84A 3CFEA 1E4KA 4GBXB 5D7KE 1FRGH 4ERSL 3U0WH 4XPTL 3IKCA 4NQXA 3MLWL 3OKKB 5SX4H 5I1LB 4I18A 4HUVB 4DN4L 5AEAA 3VD9A 2AKRB 4QXUL 3LD8C 1C08B 4UAOC 1VFUA 3REWA 5CCKH 1R3IH 4TRPH 4W68A 4IJ3C 1KB5H 3BH8B 4JO4L 4FFVC 4HIEA 1D5XB 3JTSA 1F4XH 1ZSDB 3Q3GB 2NZ9D 1AJ7L 4S1RH 5CJXA 2AXJA 5JO5B 2Q3ZA 1K4CA 3TPUB 2XQBL 1U8LB 4HF5L 4RRPG 3VU2A 2HWZH 5IWLA 4M3JA 3OKMB 3D6GA 1WLHA 1J0IA 1XF4B 5L0QB 2M1KA 4P46D 4RAHA 3WCYA 1Z6JT 1MJ8H 3BSZH 4AEEA 4V2CB 3TNMB 2OZ4H 1YJDC 4CVUA 1T2QH 1IC5L 3DLQR 3ETBF 4MNQD 4PJ9B 3TF7C 2HN7B 5IW1A 4KKAC 4O5LH 4L4TA 5F9DC 4Z76A 4X7SL 4NQEA 1LP9F 5EOTA 5IHBA 3VXME 4WW1A 1BF2A 2YA2A 2APFA 4OCYL 1NCWL 1T1XA 4K9EH 1EVTC 3MUHL 3UTTE 4JE4B 5T1LB 3F7YA 1VFAA 2DL9A 5FB8A 4Y4HB 1WF5A 5FYJU 4G9FB 2Y6SD 4WI4A 5D6DA 2QQKH 5FDWA 3VI4E 3BMVA 4HDIB 5IQ9A 4CMHB 3GI8H 1KTDA 2NY5C 3AAZA 1OW0A 4UTAH 2HYMA 2PXYB 4JHBA 1FL3B 5E6IB 1CBVL 1KF9B 4AMKH 4FN0A 3PP3K 1S7XB 3QG7H 4IM8A 3LDBC 3BZ4A 4UT7H 1NBZA 4FQXB 4XNUL 4YX2H 1NCCL 1S9WB 1VPOH 1D6EB 4PJBF 3UBXA 4WO4A 2AGJH 5F7KC 3BKJH 3LRHA 4Y4KA 5C0CD 4GJTB 1HHKB 5IMKA 3S36L 5FF6B 2K3TA 5TE6L 1PSKL 5D72H 1CXLA 3DROA 2OR9L 5FHBL 3SQOL 1IAIH 1H3GA 4K3GA 1RU9L 5FO7A 4IRSA 4EI6A 1VFBB 4YHKH 4LLAA 3AY4A 4HAGA 4NO5B 4WWKA 3T0XA 3U9UA 1KEGL 3TM6A 2PF6A 4CBPA 3SDXB 1QLRB 3QDGE 3WJJC 5ESAA 3U79A 3O4OC 4N0YH 1IKNC 5BS0D 3DSNA 3KWWB 1TETL 3SDDB 4WCYL 2ID5A 1GOHA 2BJMH 2VKXA 2XXMB 3C5JB 4L8SB 3FONA 4Z7QF 3T2PA 2GK0A 3MO1B 3E2HC 2J8UF 5ABDE 3KPMA 2CLVB 4UNVA 3X11A 1IEBA 4U6YA 2AV7B 4U1MB 1IGFH 3EYFA 2Z31C 1CLCA 3OAZH 5E24E 5C07D 4HUUB 5LGHL 1GGIH 3D5OF 4KWUA 4QEGA 4QRRA 4MA1B 3ILQC 2E6PA 5HYQA 5JW4M 3JWDC 4N90E 5F7EL 3IDJB 1IAIM 3SGJA 2FBJH 1MCRA 2D7QA 4HKJA 4N5EC 2HVKA 1IE5A 1N8ZA 2A38A 4V1DB 4D9QE 5ICZA 3RZWA 3TBVA 1FO0A 3HE6D 5IMMA 5ACMA 4D9RE 2FJGB 2JCCA 2VISB 1BZ9B 2I60L 5L2KB 3MGOB 2AI0L 1UB6A 1E27A 1QFWL 5K9OB 4OFYD 2J4WH 3QNYB 4KZEH 1PX4A 1URLA 4MD5B 4B53A 3T3PF 4KJWD 4TUOB 4J3VA 1MCEA 3O3AB 1QSED 3S35X 5IOPA 5LXGL 1I7TB 4XNQB 4IBLT 3UPRB 5BW7C 4XCFH 1YC8A 4GQ9H 1QBMH 1RVFL 4KUZH 2O5YL 4B0MM 5FIEA 3QHFL 5LBSH 2XN9A 4IHOB 4JN1H 5C8JB 4PUBL 4OF3A 5EU3A 1YEHH 5L6YH 5F1OB 5GGVY 1K8DB 3H9YA 1PYWB 4LEXL 3SJVA 1QVOA 3R0NA 5GRZA 3ALPA 1A9BA 2X2YA 3L3OB 2V5MA 3GSNH 4P2QB 2IANB 3BGMB 3MJ9A 3MV01 5JPNA 1EIBA 1CQKA 1UYWL 4MQ7A 5BXFB 4WFHE 3AS0A 3IDIB 2X4SB 4L8BB 3OAYH 1B0RB 3KJ6H 3MV8D 5BQ7A 2MSPA 2FLBT 2A74B 2EKSB 4M03A 1Q9WB 2XWTA 2XV6B 4EN3D 5IHUH 4MB4A 4N0FA 3NIDF 4P4RB 4JFEA 1E6OH 4M5YH 8FABB 1S7SB 3V4UH 1VKXB 5KVDL 2DQJL 1YY9D 1IJ9A 3FRUB 2COQA 4OTXH 3B6SB 2JJSC 5EC1B 5KAQG 4J4PC 5MI0B 3W9DB 5I76B 4K7PY 4QTHB 4QNPE 1XGRA 5FDYA 15C8H 4LVHC 2DIBA 5AZEH 3C6LC 4AEFA 3BPOC 4X6CB 3MJ6A 1WQVT 4XP1H 1W72H 4EKXA 3DUSB 5IVXA 1ZT7A 1J8HD 4JFYA 2HJKB 4HSQA 5GRVL 1ZT4B 1YEJL 3BQUB 4RGND 1QEWB 2DMCA 4LNRB 3BI9X 5AZ2L 4C4KO 3ULUD 1CL7H 1MEXH 1T20B 1W2KT 4KROD 1QSFB 1XIWA 3L5IA 4WI7A 4PJGA 3TIDB 4J2XA 1NC4D 4FQQB 4ZFZA 1WTGT 4BK4A 3E3QC 2D0GA 5D2NB 4U6HA 4UOW0 4HUNB 3CFIC 4OKVA 1G7IB 3QXDB 4DKAA 1UEMA 4I1NB 4OBSA 2AJSH 3QUZB 1KIRA 3PGDB 5MEQB 1OSZB 3CC5A 3KPNA 3C60A 4UIKL 4Z7UE 1UJ3B 5HXMA 4OZHE 3OF6D 5DMKA 1AD0A 2YPLD 3HFML 4BKLA 2EZ0C 1T0PB 2D7TH 3GJFK 5IESH 3KYAA 5TQ0H 1A7NL 4ZUTB 3GJFA 5ACZA 4X6BB 4G80A 5GGTA 1FZOA 2A6DB 5IUSA 1SEBA 2J5LC 4G8FA 4WTXA 4YZFF 3D2UD 4Z95H 1A2YA 3KYOB 5F70A 3WS6C 1CK0H 4ELMB 4EXKA 1IM9A 4OLXH 4PJFF 2IAMB 1KIPA 1KLUB 2JB5L 3G04B 3KPTA 5GS0H 1DQML 3CH8A 4R4BB 1XH3B 2R69H 2XYCA 1CLOL 4Z7VA 5IIEB 3AREA 2HFTA 5E2WL 4NP4L 4POZD 1U8MB 3GGWB 3E6FA 4FQ2L 1HK6A 1AXTL 1H3XA 1KELL 4M4RA 3RX8A 4PJ5A 2WUCH 5B39B 1MHHB 3VG9C 3D85B 4GG6E 1AH1A 2VZTA 3O9WA 4XAWL 4JPKL 4HLJA 2EIZB 4N0UA 1MQKH 4NO2A 4XGZB 3VA6A 4ZFOL 4QRUA 3V52L 1QQDB 3B9VA 4KTEL 3HLAA 1IKFH 2XG5A 3FZUD 4M62L 1XGUA 3DSFL 4FXLA 3VFGL 2V2WB 5D7SH 2VAAA 3OXSB 1NGPL 3JV4A 3R8BB 4JO2H 1DUZB 5FM5M 4F33A 2ADGB 1BBDL 5T3ZL 4DWHA 2FX9H 2HJLA 3ARUA 3NFNB 1ES0B 4OZIB 3UROR 3LEVL 5BRZA 4NRXA 4I4WA 1HYRC 2DYPA 4ODSL 3P11L 3B2UC 1R0AH 3TNNA 1JNLH 1Y0LB 5JHDA 1ZLWK 4DVRH 4JM2C 4HUXB 5F93C 1NLBH 1YN7A 4Q2ZB 1JFQH 3ULUH 3V4PH 2Y7QB 2YBRB 3HR5A 2Z4QA 2XA8H 1QFHA 5JW4N 1JK8A 1SVZA 4PJEA 2Z8SA 3M8OL 4PP1D 5GZNC 4KK5C 5DT1L 3GBNH 5IR1A 2XPGA 5H35B 5ERWB 4U1HA 3AFLA 1A64A 4G6JL 4OF5A 1NCDL 4NPYA 1S78C 4YDKL 5CBAA 1HXMA 4XT1C 4HFWB 3BYTA 3HN3A 3CFJB 1YMHB 3M07A 4XCNA 1GPOL 4X9FA 3MUZ1 5HBBA 2Y06H 3UBXG 4P23C 2Q8BH 4QHKJ 3GUTB 1JV5A 1CT8A 5IBTL 3QRFM 4LBEB 5A2IH 4JG0H 1KIUA 1T5WA 1AXSB 1A0QL 3E3QE 3VXRD 4JFDA 4LCWD 3JUYA 3GSNB 2OL3A 3UTPD 1FL5B 4RBPH 1CXHA 1WZKA 4OCMC 4M5ZH 4C57C 1KUMA 5JORA 1A02N 2X4OA 4X6DE 2P5WB 2B0SL 1OTTC 1UVQA 4GW4B 4EI5D 5C0EA 4YDIH 3NH7L 3WNPA 3DMMD 3UAJC 3TV3H 4NUJB 5EWIL 1I8KA 4LLWA 5DJCB 5HHNA 2XTJC 1RZGA 2MQ0A 2QJDA 4XBGA 4AK1A 4OM0L 4K94C 4ZOAA 4NKDA 1BD2A 3EFFB 2ICWA 3GO1L 3BXNB 1D5BA 3W0WB 1C16A 4EOWL 1T21A 4HFUH 3G5YA 3SGDH 1W72B 4S1SH 4ZUVB 1BEYH 2Y25A 3MROB 2YN3A 5IG7B 5EB9A 3QIWC 3OPZL 4AENB 1RUMH 2DM2A 5I19L 4M4PA 3QEGH 4FTVE 1BGXL 1G7MB 5IF0A 1F6AA 4MXWL 5TH2B 1IRAY 2NXYC 5F1IB 5BJTA 1HIMH 2FJFB 3P0YH 3WLBB 3ROLB 2EIBA 2A77L 2ZUXA 2OJEA 4AT6B 1A47A 1E4JA 3DIFA 4PGEB 1OGTB 2BY3A 1UB5A 2D0HA 4KGLA 2ZCHH 4OQ1A 2CMRL 3OR7A 2GEEA 4Y19D 3HI5H 2VXSH 4U0RC 1IAOB 5TPWL 4ZTPL 2VERN 3SCMD 1EGJL 1VSCA 3HNTH 2PTTB 1LO5A 5I73C 1WEJL 3DRQB 3G5VB 4N68A 5IEHB 1L0QA 1KFAL 4OCRH 3VGDA 1CU4L 3C09B 1S9VB 2DQFA 4L3AA 5C3TA 1OP3H 4IRZH 1X7QB 3IDGB 5F97E 2MQ3A 5IHZB 3I2CL 3ARYA 3VGHA 3VXUE 3ZKSD 1MLBB 5JNYB 5T1DH 3HC3H 5FFLA 1CGVA 2E7BA 2X1OA 1NCTA 1IBGL 3TN0D 1J86A 1LEGB 1FL6A 4NBXB 3MRFB 4AEHL 4EQ3A 3MV7D 5C2UB 5DEFB 1KN2H 3UYOD 1XF3B 3L3HB 4QOKB 2CKBB 2LTQC 3DO7B 1XAUA 2WIIB 3RUGB 1EAPA 2GTZB 4NQCD 1KCKA 3CZFA 3FT4A 1A7QH 4OCSH 4D3CL 3WSQH 4JKMA 5E8OA 3CDFA 1P5VA 5MHSD 1EEUA 4P9MH 1H5BB 2FIKB 4MCYA 5K9JH 4H8WH 1WAAF 3ARBB 5HDBE 3CVIL 1T3FA 3QUYD 1C12A 5E1AB 1YECL 3RPIB 2EDWA 1X4ZA 4WUUB 5TGBA 3HRPA 3Q5YA 3LIZH 1RUQH 3NCJH 3STZB 3CDGB 5EU6A 4NRZB 3RNQA 3F65A 4L4VD 3T2QA 4HS6A 5JOFA 3VG0L 4K3HA 1J0HA 2XTJE 3WBDA 2VLRD 1II4E 4PGBA 4U1JB 3B3IA 3RGVD 2NZ9C 2UUDH 3HG1D 4NN6B 3QIUD 3L5XH 4Z7OF 1I7ZB 4Z7QE 2PW1B 3VWJA 4U1LB 4M1CC 4XI5C 3S34H 3GMPA 4OD2A 4JGUA 2OP4H 1NEUA 4I2XB 3QCVH 2DQHH 5C09D 1MRCL 5E2TH 1F2XK 2NY3C 5EU5B 4MMZC 4TSBL 2K7PA 4P46C 5E03A 2YD1A 3TA3B 1HCVA 4AH2B 3MLVH 2FSEB 4HIHA 5DK0A 3UJTL 1D5ZA 1QRKA 3QFJA 4P2QE 3QDJD 4LLUA 5E8DH 2VLMD 3FFDB 1E4WL 2VDPH 1C5CL 4YHLL 1HE7A 1MELA 1MY5A 1W8NA 1ZS8A 5GRYA 4OGAD 2YPKB 4UILH 5JDSB 2BNQD 3MBXH 1H8OA 4PGDA 2NY6B 1NC2D 3P0GB 3NA9L 4NJ9H 3RTQB 1FFOA 2ADFH 4U1SA 1F4AA 4MXQD 1CFSA 2VXUL 4LFHD 4JJ5B 4KRNA 1S7TA 1I1AA 4FQJH 1TQBB 4KQ3H 1UC6A 1HHJB 2W07A 2Y6SC 3GM8A 4TUJA 4LAQH 1UWXK 4E5XA 4NOBA 4NCC2 2C26A 2NLJA 4XAKD 6CGTA 4HXAH 4WHCA 3GK8H 4GS7C 5M95B 4NQTA 1QRNA 2PYEA 2VXTL 2DAVA 1WBYB 2C1PA 3PABA 2AJ3A 2KPNA 4HUWA 1EV2E 1TVBB 2IMMA 1P7QB 3U6RB 3PQYB 3LKOB 4HKXA 4POYA 3QUXD 1W8OA 4XZUB 3TBYB 3RWCB 2E7LC 4OZFG 4OFKA 4JQVC 4JFPA 2CK0L 2H3NB 1J8KA 1UT9A 1G7HB 4NN5C 3UC0L 3KJ4B 3QSKB 4WI6A 4GRWH 1W0YT 5C0AB 4GKZA 3ESVF 2EYTA 2AJVH 1IEAA 5FM4A 5MP6H 4NM4L 3HE7A 3WLWD 4G6ML 3KVQA 1K4DB 1LNUA 5DTFA 1AI1L 1HH9A 3E6HA 4KFZC 1I7RB 5ENWA 1O7SA 2DQUL 3FT3A 4YHOH 3DVNA 2C3XA 4KKCD 1AXIB 3OGCB 2GJ6D 1QLEH 3NIDE 4PJDE 2OSLB 3FQUB 1JHKL 2ZSWB 4MAYD 4YR6A 2JK5A 5EFIA 4A2LA 5B4MD 3NBNA 4PTUB 4LSUL 4OIIL 1G9NC 4N0RA 1WWBX 1G7JA 1QD0A 1WIPA 4AZ8A 4LSSH 1R3LA 4PYHA 5SWZD 3VH8A 4OCXL 4QCIB 2BSED 3KYNA 3BD3A 4JY6A 4DN3H 1RK1B 3GMOB 2A73A 4L9DA 2ADJA 3QR2A 1ZHBA 5D4QA 2HVJA 3FFCD 1UQSB 1AO7B 4H1LH 4JRXB 5HGAA 2XT1B 1MUJB 5GRJL 1AGEA 2VQUA 2D7MA 4YH6A 1Z9OA 3G5ZB 1SBSL 2IQ9H 2WM0A 3P3YA 4OZGB 3V5DB 1S9XA 1CE1H 4LDEB 1BJ1J 3IGAB 3L1OL 4PTTB 4JFFB 4R4FH 5CD3B 5IFHL 1MI5B 1T6VN 3ROOA 1CD0A 4P4KB 4XCYA 2H32B 4MA8L 2A83B 3U0PA 2OBGA 2EDTA 3TO4B 5DO2C 3HE6C 4Z7NE 1AKJD 4HJGB 4C56E 1XF2A 4OSUL 3O8XB 3RY6C 3EYVA 5L8KB 2ENSA 3PWPE 4TUKL 3SDCB 4MNQE 1MJUL 2CO7B 3GNMH 1F8TH 1T04B 3O45B 4HC1H 1R3JA 1YJDL 1U8NA 1DN0A 4J3SA 5I16A 1AGDA 5SX5H 2GUOA 3K4AA 2P5ED 4OZIE 3H9HA 5SWSB 4QHNB 5INDB 3U36A 5DJ8A 4J6RL 4X8JA 3D0LB 5D7LE 3I6LE 4JB9H 2VR9A 2BSTA 5DJ6A 5DQDH 2V5SA 2HMID 1AC0A 1T89A 4KDTC 5KZCB 3VFSB 4FQLL 1X5IA 1RAMA 4JG1L 3MBEC 1CFTB 1UZ6F 5D71L 4ZPVA 2HG5B 4P2RE 1NAML 3TIEB 2CXGA 5MENB 1BM3H 2FX8H 4BQBA 3BT2L 5D7IE 1S5HB 5LGJA 2NY5L 4XX1G 2R23A 3MTRA 2OTUB 4HK3N 3IDYC 1IM3A 4BZ1L 3MPCA 4EN3C 3ZYOA 1L7TH 3CFBA 4PJXB 2DWDB 4LLMB 3WFDL 3NZHL 3CX5K 2WBJA 4NHUB 4UB0H 3LS5H 1IGMH 1NBYB 3V6OC 1IQDA 3TBTB 4J8RB 3RDTC 4RWYL 4OD1H 4KU1A 4XPAL 1FNGB 4CJ0A 4QRPA 3MNVB 4YO0B 5DD1H 5GGUB 1J1PH 3MQIA 4R96A 4NUGH 5EA0L 2YD9A 1H8SA 3LDBB 1DVFD 1A7RL 5TF0A 4CNIA 1X5GA 3O4LA 4U6VL 4IIQA 4BFIA 3O6FD 4F37K 3V79C 1V7NH 1Z0NA 1CVSC 1RURH 3ULUC 3LQAH 1BWWA 1T1YA 2IFFL 1JMZA 1VFMA 1DLHB 2NY0D 4M6ML 3QRGL 4WNQB 4DZ8A 3S88L 3EJJX 3ARXA 1HNGA 1NMCC 5B21A 5CIPB 2CRYA 3D18A 3I6KB 3EDJA 4Q6IA 4F7CB 5C07E 5C0NC 1PLGL 4QWWC 3MRKB 2VABB 5GGSY 3QA3A 4MJ6B 3C5ZB 1ZA3A 3QDMA 5GJSH 5DUBA 3EBAA 4RFEA 1YQVL 2B20A 4HS8L 4MVBD 3NAAL 1SBBA 5HGBB 2D0FA 5C08A 4DK6A 2BRRL 2VE6B 3JWDL 3MRHB 5I1JH 4M1GL 2YD5A 1QR1B 4X7DC 5L8LB 1I7UB 4ZAKD 5JXED 3NGBB 1KCSL 4G8GB 1FLRL 3VXPB 1H3PL 3GSWA 1PKOA 5IROC 1M6OA 1IGIH 4TOYH 2Y36H 2W0FB 3HZKA 3CXHJ 3F12A 1YPZB 1D9KB 3QUML 5DJZB 1BLNB 4UUJA 4GUPB 1OAKH 5IT2H 4K3DL 1P7KB 4XMLL 5FYLL 3IJYA 2F58H 1FV1A 2R0ZH 3LN5A 1R24B 1P4BL 1J88A 5B8CC 5T1KA 3MLUL 4QHLA 4UT9L 3E8UH 3QCUL 1G9EA 3WNNA 4ELKA 1G7LB 3FZUC 3L7EA 1OCWL 1UEYA 3HUJA 1IARB 3RX7A 3NIFF 1CD1B 4PJAF 5IP4A 3RWFA 3ALXA 1B0GB 3Q6FA 4PY7B 4HT1L 5I66A 4X6EA 1T0MA 3H9SD 4MNHB 1LO3H 1TNMA 4NWTL 3I3DA 4H1LB 4ZXBB 1DTUA 3OWEA 4UDTA 1ZAGA 4XXCA 3RZCB 3RY5A 4LMQI 2IALA 3GMLB 3BKML 4YC2C 4N9GB 4S0SD 4MWFB 2OQJA 5DFVD 1R5WB 3ARDA 1YMMD 4NDMB 5MEPB 2MOVA 1CGWA 1PKQB 4HZAA 3ARFB 3MUJA 5KSBA 3NIGE 4F9PA 4P9HC 3CU7A 2A6KB 5DUML 3PDOA 3HC4H 4JO1L 4OLVH 4QOKE 4EDXA 4JZJC 1UH2A 4MXVF 4YGVB 5DD5H 3U2SB 2R2HA 1NCUA 1LD9B 1WT5C 3B9KD 4O9HH 2QTEA 3VGAB 3L3IA 4BYHA 3MLZL 5HJ3B 3NABH 1DQJB 5D93C 3CPLA 2LAGB 1NANH 2X10A 2DICA 5I1DA 3X12B 4Z7WE 4PJ7A 5GHWH 3W9EB 4MHHG 5L7XL 3NPZB 4LGSB 5L2JA 4O2FB 1J8HE 4QTIL 3QNZB 4R0LA 4WHDA 1BQLL 5I8CA 3ULUE 3T0VA 4YPGA 4WU7B 1BZ7A 2XWJA 1VENA 1PEZA 2BMKB 2VDLH 3LKNB 3QEQB 4HWBA 4F7MB 1K3IA 1LEIA 1T22A 1ZLVH 4UIMA 5E9DA 3N1PC 5DFTA 1OPGL 1UM4L 2Y1VA 4MLIA 4JY4A 4P48A 5C9JA 2W0PA 1FZMB 2DDQH 4RIRA 3IDNA 4HD9A 1KCVL 1LVEA 3ECBA 5EU4B 3NACL 3DMMC 1S7QA 5GRUL 4WFEE 5IBUG 3EO1B 4PJCA 5GGQL 1QG3A 1FDLL 5HD8D 4PR5B 5ADPH 3JV6B 1SJEB 4HWEH 3QCTL 3IFPB 2NY7L 3PWUA 1RIUH 1BBJB 5ALCL 1MVFA 4JZNA 1UA6H 3BPLC 2X40A 5T1KD 3VH8G 4CU7A 4APQD 1S7WA 1NFDE 1WAAE 4XPFH 5KSAD 4CVXA 4XCEB 2ICEA 1MY7A 5D2LB 2VITB 4OD3H 2DLGA 2QR0A 1R3KA 1KC5L 4Y1AB 3MREA 5E2UH 4ETQA 3VWKD 1BVKB 4GKSA 1MCKA 4PIRF 3I9GH 2CDGB 4IOIB 4M7JH 2O61B 1EJOL 4YIQB 4FZ8H 1C5DA 3L5HA 3WDIA 2X89D 1AFVL 4G8EB 4JFZL 4AIZA 1DBKH 2CIKA 4XP6H 5J12B 1TDQA 5B38G 4S2SA 5IVOA 3GMRA 1MHEA 4L9LB 1CDHA 1KPRB 2BVQA 5C0BD 5DJ2A 4LCUB 2J88H 3ES6A 3TZVB 3SE3A 3C6SA 3LZFH 1YNLH 2NQCA 3R06B 3MA7A 3BH9A 2XFXA 5TDOA 1WC7B 4PJ8C 3ARPA 3VE0A 5CZVH 3PL6D 3DURB 2P42B 1UZ8B 1Q9LB 1M7DB 1YEEL 4XNZC 5KANG 3SCMC 5FOBB 2AK4D 3BPCA 1TZGL 3V0WH 4XVUD 1T80A 1S3KL 2IBBA 2VSDA 4IDJH 1FNLA 4JGJA 4XNXH 3TVMD 4QYOA 2W9LA 1R6VA 1UWGL 5AUMB 1GZQB 3TCLB 1I85A 3GSQA 1WZ1L 3SKMB 1FAIH 2OJZH 1MHCB 1JGEB 4CU6A 4FQHB 1RHFA 3U7WH 4QRTA 1Q0YL 1B2WL 4Z18A 3IF1A 2HA1A 4Z5RA 2R4SL 3QIBA 4H88H 4OZ4A 5ADOL 4JFOB 2FR4A 3FQWA 2FHFA 4MZ3A 4O4YL 4RISH 4L8CA 4GBXA 1WUNT 4LSRH 3TN0C 1T2XA 5BVPL 1SMOA 1LP9B 5DA0B 5DMIL 2EDEA 3BVNB 4JR9L 2B2XH 4YE4L 3LKSB 1XF1A 2YWYA 1D5IL 3QQNA 1OSPH 4NN7C 3VXRE 3WFBL 4LCWE 3KPRA 3BH8A 2KKQA 3MODL 1FBIL 1TPXC 4OZGE 2DS4A 1FYTE 4G6FB 5FHAL 4JFFE 3BESR 3GHBL 1AQKL 1RZKC 3MOAL 3Q2CA 1ZSDA 1DBJL 5D6CB 3A0OA 4J3XA 3QUYC 1GCFA 5JO5A 4XPBH 5LCVH 4PRHB 1FFRA 2EE2A 2CSPA 3OKMA 4LVEA 4Y7MA 5ICYB 1JI2A 3UPAA 5E5MA 1HKLH 1XF4A 2VNCA 1TCRB 4PJHB 4HLZH 2AW2A 4PJBB 4OV5B 4LNVA 5DC9B 1SYSB 5FUOH 4B5EA 2QL1A 4OGZA 3RGVC 3LMJL 4Y5YC 3STLB 3QIUC 2DL2A 2X1WL 3ZTNL 2AJXL 1U93B 4LOUC 5DRXA 5EO9B 3GSXB 2D2OA 4LDOB 4ZS7H 4K94L 3VDAA 2BFVH 1P5UA 2IGFH 3LSOA 4IMKA 4OFVA 4ESKA 3N06B 3PGCA 3W5MA 5KANI 4JREB 1KJ3H 1DQTA 4LPTA 5F1KC 3BHBA 3FQTB 4LLVB 4RFOL 5T1LA 1QHOA 1OD7A 5CCKL 1R3IL 4Y16C 4G9FA 5MENE 3BW9B 3RBGA 3AS3A 4OGAC 4BSWA 1KB5L 2B5IB 2V17H 5BZWA 4ZD3H 1FH5L 2J8UB 3AS1A 1G7PB 1EZVY 2PXYA 4Y2DD 1YEKL 1CICA 1PY9A 4MXQC 3MRGA 1MCSA 2YC1B 3K2UH 4F37F 1S7XA 1ZXQA 2EDHA 2WWMD 3V6BR 4JRYE 2HWZL 4FQXA 2YK1H 4R26L 4OM1H 2JELH 3MA9H 4IRJD 1W0VB 5GXBB 5INCB 5I1CH 5HHOB 3KPLB 2JE8A 1MJ8L 3BSZL 4BH8B 1HHKA 1NKOA 5GISH 4FNLH 3O2WL 5FYKU 4FZEH 3G6JA 1HI6B 2SEBB 4O2CB 3UEZA 4M43H 1RZIA 3DUHA 5CUSH 4H25B 1T1WA 3VFUA 3STBA 4O5LL 3QUXC 4GG8A 5CP7B 1VFBA 1NGXB 3MRDB 5EZLB 2IF7A 5TFSH 4LLDA 5C0GB 1TTFA 4UT6L 5F71A 3D87B 4R90H 2DJ4A 3KWWA 1AD9B 3SDDA 4E41A 3SY0B 1ZGLM 1DQQB 3WLWC 5D96B 1QFUH 3MO1A 1U8PB 5CGTA 2QQKL 4NCC1 5DQ9B 4PRPD 1MCCA 3L95A 3IFOB 1WFTA 4KKCC 4U1MA 3SDAB 5I2IB 4P5TD 3QUKB 3VRJB 5GGRB 4HUUA 5C6TH 4PLNC 4MAYC 2GAZA 3AXLA 4MJ5B 2PUQT 4HV8B 4J7RA 1RIHH 3U30C 4CL7A 3LEYH 2VZVA 4GRWE 1VPOL 4PG9B 5EUKB 5CSZB 1LO4L 1BREA 1Z5LB 1WZLA 1I3GH 1KGCE 1X5AA 1NL0H 2YZ1A 2BVUA 4L4VE 3ORJA 4NHCH 1FFNB 3D25B 5T5NG 1RUKH 2VR4A 1YPZE 4L8DB 4PGJA 4DGVH 4JFXA 4RA3A 5L2KA 1IAIL 2BX5A 1MCOH 5BVJB 3HB3C 1F42A 4YHKL 3E0GA 5BV7L 2JB6B 4ODTH 3PWNB 3VXSA 3LQAC 5FYKH 3WEXA 2CLRB 1H0DA 4N0YL 3V5KB 1TZHB 3UPRA 4KTDH 2DBJA 3EOYG 2Y5TA 3FJTA 1I1FB 5HVFB 5B3JF 3NPSC 3DX7B 2ARJB 4IHOA 1LMKA 2OK0H 5BV7B 4XVTL 1YY8B 2X4NA 2ZUQC 4BFGA 1MCIA 5ITFB 5KG9B 3N1MC 1K8DA 1GGCH 1LO0H 2BNQE 1MCFA 3SGEH 1MAMH 1GGTA 4PRNB 5IVZB 2YXMA 3L3OA 2IANA 5HYJD 2YKLL 5FK9B 3KR3H 4JLRB 4D0DB 2F15A 4DAGH 3ILPB 3PV6B 5DDHB 3IDIA 4GRLC 4KV5E 4X5XA 3T1FB 3RJDA 2X4SA 2Q7YB 4P46B 3PP4H 2ZZUT 3K8MA 2HMIC 4L8BA 4B41A 3DOSA 5ID0B 4Y4FA 1B0RA 5IB2B 5KN5B 1HN1A 4E9LA 4R7DB 5T5NF 2EKSA 3MRMA 3PWVB 3FO1B 4P4RA 4PB0H 4ZS6D 3KG5A 2KUTA 1J05A 3T0EB 3T1WA 1S7SA 1KB9J 4ZUUB 2R2BB 2VDOH 3M1BB 3JWOH 4Z8FH 3VXQB 5EC1A 5FECA 1E6JH 3F5WA 1V3MA 2J4WL 3CSYB 1MAKA 1DBMH 3GKWL 3O2VH 4X6CA 4PJFB 2MHAB 4EDWH 5CHNA 1ZT4A 1EXUB 4GQ9L 1QEWA 4K7FA 1NKRA 2D03L 4LNRA 4XMKL 1MREL 4HPYH 2LVCA 3RKDD 4HKZB 1QSFA 1A21A 4MA3A 3TIDA 2X4PA 3TH2T 3HPLB 4Y5XA 2A1WL 5D1QC 5D2NA 5GRVK 4FFYL 1DVFC 2GJ6E 4NQVB 1PVHA 3LPGA 1G7IA 4S1DC 1Q94B 3PGDA 5MEQA 4H20H 3QEUB 3WNLA 5F9WB 3CFEB 4G6AD 3EHBD 3IKCB 1MFCH 4RWHA 2WV3A 5SWZE 4I18B 2MQCA 1E6OL 4X6BA 5KS9A 1EEQA 1G9NL 1SMAA 4LRIA 5D7JD 2APVA 3REWB 3BN9D 5L88H 4UOJA 2IJ0C 4R2GD 3GJEB 2BVYA 3WXWL 2JJTA 4ELMA 4BH7B 4HIEB 1KLUA 3DO3A 2V5RA 3G04A 3MJ9H 5BS0B 2VLKE 5D5MA 3TWCL 3FAXA 4XP1L 3NCFB 2H9GB 1AHWA 2DM4A 1YEDB 3U0TA 3I6GB 3OQ3B 1NBVH 3WJLC 2BDNH 2P8MA 2EEBA 3GBML 1K4CB 2CK2A 5B39A 1EMTL 2Q87A 2BY2A 4ZAKC 5JXEC 3VI3F 1OB1A 2EIZA 1J0ZA 3RIAK 3FQXA 4ENED 2PW2A 1YEIH 2V7NA 1OD9A 1I9RL 3BGFC 4Y4FD 1RZ8B 2P49B 2ZCKH 1DUZA 3BWUC 4EBQL 5F7DA 4X6FB 1J1OH 5IW1B 1B6DA 5K59E 1D5MA 4L4TB 1KEMH 1E0OB 4Z76B 4NQEB 5J1SC 4KAQH 5CGMA 1NMBL 4NWUH 5F7FA 5GZOC 3S3PA 1OARL 5IESL 5GJTL 3VRIA 5HHXH 1T1XB 5TQ0L 1BFOB 1C1EH 4HUXA 4FFWD 4Q2ZA 5DEZA 1JWMA 2KQNA 2RR3A 3F7YB 4L3EE 1VFAB 2Y7QA 4W70A 3QISA 4LSPH 1BFVL 2YBRA 4S0TD 5FB8B 4MQTB 3OB0K 1I75A 4PPTA 5FDWB 1TIUA 4MD0B 3VGFA 4Z95L 5KOVC 1QSEB 4OUUB 2QEJA 1CLZL 4OLXL 5H35A 2BC4B 2D9QB 5ERWA 1MLCB 3ULVD 2H2PD 5DFVC 1KTDB 1MF2L 2R69L 5ISZD 5CEXA 3RQ3A 5EU7E 1L4IA 2FATH 3QG6A 1BOGA 3SO5A 3ISWA 4K23L 3BZ4B 5TE7H 5A3ID 4P3DA 1NBZB 1RMFH 2AEPL 2BK8A 2DD8L 1MJ7H 1E28B 2V5TA 3BDYH 3UBXB 3B9KC 4WO4B 4HWUA 5DURD 3P4OB 3GUTA 5JR1H 3IDUA 3GJFH 3BEWB 4O51B 1DN2A 5D7SL 3RL2A 3ZKND 1JCKA 5IMKB 4CKVX 5GGTH 1AXSA 3BUYA 4NO3B 2NMSA 3DROB 1GC1H 1OTUC 2FX9L 1NGQL 1G9MH 1LWRA 5F7NC 5FO7B 3LVEA 1FSKB 2C1OA 2NYYC 1ADQL 4WWKB 3VGEA 8CGTA 4JHAH 2DQGH 3U9UB 1R0AL 1JNLL 3QT2A 2R8SH 5ESAB 2FCBA 4DVRL 3GIZH 1U8QA 4DGIH 1XGYL 1JFQL 1NMAL 4NUJA 3ULUL 4XNYL 3FONB 2XA8L 2GK0B 2NCMA 4GAJH 5DJCA 3GB7A 2W38A 4F15B 3KPMB 4NZRH 3X11B 4LPXA 1IEBB 4HUKB 5BOPA 4U6YB 4XPGH 4YBQD 3VFRA 1OOAA 4RGNB 3TBWA 1IZJA 3BXNA 5J6HA 3VFWB 5GPRA 5I8OH 2PO6D 3DPBA 5HD8C 2F54A 4ZUVA 1WWWX 4KROB 2PCPB 4WHTA 5J57B 1DANU 2G5RA 4H5SB 3MROA 5GGSA 2Q7NA 3D0VB 2P24A 5IG7A 4HKJB 3UTSE 5TQ2H 2PNDA 4APQC 1XGTA 4AENA 5ICZB 4IMLB 5KSAC 1JGUL 4WV1A 1FO0B 1G7MA 4NYLB 4DW2L 1I8MA 3ZHDA 5HHQA 4NO0A 5D1XC 5F1IA 3VRLF 4PG2A 3VWKC 2JCCB 2YPVH 2FJFA 2X4QA 4YBLC 2EDKA 5ELIA 1U91A 4MNGE 2IBGA 4NQDD 3ROLA 3CVHH 1UB6B 4M6OH 3CLEH 4M5ZL 1MRDH 4HK3J 2VC2H 3QH3A 4NRYA 3TYFB 3N85H 4I9WD 3MZGB 5IBLD 5IOPB 1NDMA 1PD6A 3IXAA 4U7MA 3P4NA 3NTCL 3D2UB 1IFHL 1UKTA 1J0KA 2OI9C 4IOFD 5D1ZD 3KPOA 4OV6F 3A6OA 2XN9B 2Z91A 3EFDH 4YEFA 2Q1EA 3U1SL 1BJ8A 4G42B 1RUPH 4BSJA 2EC9T 2FRGP 4K3JH 3SJVB 1QVOB 1S9VA 4KHXH 4TNVK 1Z2KA 3CFDB 1A9BB 5F6HI 3IDGA 3HZVB 1CZ8L 1A7OH 5IHZA 5JPNB 1MLBA 2MCPH 1BEYL 4XVUC 5HGGS 5F9AC 3O41B 3WIIL 5BQ7B 3DXAD 4OCNC 1LEGA 2F19H 3MRFA 1NUDA 2XWTB 3QEGL 4P9HL 2EDNA 4C4KT 4ETYA 4GAFB 5JQ6H 1XF3A 2UWEE 3S35L 2WAHA 3L3HA 3FN0H 2CKBA 2CRIA 1CN4A 4NBYB 1XCQA 3G6DL 4JFEB 3IU3A 3DO7A 3IVKB 2DKMA 1MCPH 2WIIA 3ZYZA 3P0YL 3U4AA 1FVEA 4CMMB 1T7XA 2ATKA 2MJWA 4G3YL 1RPQA 1BQHA 3QQ4A 2ED7A 1X4YA 5EUOE 1WICA 1MCQA 2ZCHL 4HX1B 4RFNC 4YBHA 4CN1A 1RZFH 3ARBA 2FZ3B 1ZT7B 1FG2A 4NZDA 2EICA 5TF1H 5E1AA 4MB5A 3OKYA 4HIXH 3RPIA 4W4OC 4WUUA 3MXWL 4HJJL 3STZA 4AM0A 1F3JB 3IFNL 1EHLH 1G6RL 1XIWB 3EGSA 2Z8WC 1CDGA 1FQ9C 1C7TA 2ZP0T 1MNUH 4IRZL 2ORBL