4LSSH

Crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade a strain ker_2018_11 gp120
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
QVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSPSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords envelope glycoprotein GP120
total genus 41
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lssH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lssH01
5HGGS 1AY1L 4PGZA 2GTZA 1FFRA 5E6ID 3ZSTA 1YQ2A 1G7MA 3PE9A 1ZHNA 1IGJB 4LHUB 4MWFA 3DETC 4PRIA 5EOQH 5JDSA 3LIZL 3VI4E 4G9FD 3DMMD 1NAML 3M1BB 4ZNEA 1I7TB 3KPSD 5I76B 3PWNB 4JQIH 2Q8BH 1DE4A 4AEHH 5KTEH 1ZMYA 2FB4H 4TVPD 4P5TA 1XR8B 1MIEH 2R0ZH 3VRIA 1A14H 3BEVB 5DJDA 1RIUL 1RK0A 3QAZC 4PGCA 2GCYA 2P49B 3V6FA 3IDJB 4PJEF 5FV1L 3VGAC 5IVNA 1R0AL 4QHLB 3JV6A 3KPMB 1IKFL 1DL7L 4OD3H 4YFLI 5F3BB 4MAYA 5GRUH 4Z7QE 3RX8A 4AEEA 5C08D 4L3EB 4WI9A 3QRFM 3O4OC 3C60A 2Z8RA 2BSSB 1M05A 2EYTA 3GO1L 4ZODA 3NCMA 1N5YH 5TQ2L 5CJQL 1YDPA 1I9RH 3SJVD 5HVHC 5CZXD 3S4SG 1LE5B 3GI9H 2Z91B 4GKZA 3LEYH 5JQ6H 1OARL 3RZCD 1G7HA 1E6OH 1F3JA 3T0EC 3IXAA 1R24A 3TIEB 2L0DA 4PR5B 3MXVL 1CDBA 2GUOA 1J0HA 3J7HA 1OAUL 4G8FB 4P5MA 2J8OA 5C0GA 5FUCE 1OPGL 2H2PC 5J12B 3CVHL 4DK3A 4F7PB 2YPKB 5GIRB 1WWAX 5C0AA 4AQOA 4F7CB 4NN5C 3TH3T 3LB6C 4EI5B 2Z31B 4DWHA 1B9ZA 5BVJA 4U1KB 1X5AA 1YPZE 3BWAA 3TT3H 5SWSE 5I16A 4HZAA 5CZXC 2Z4QA 2IPTL 1DDHB 3KVQA 4PB0L 1IKNC 4M4PA 3IDYC 3K46A 4PJCF 1MRDH 2ICEA 3R06B 4X5WB 3T0ED 2YUWA 5TDPA 2HJFA 1RURH 2X9YA 4P2OB 4DJMA 3TA3B 1XGQB 3KR3L 2O61B 2LU3A 4WO4B 4D3CH 5EBLB 4UDUB 1BZ9B 5BQ7B 4XP6H 1A0QH 1P2CA 4OFKA 1U8MB 1YEHL 5JR1L 4K7FB 4YE4H 3CPLA 1E28A 3LB6D 2JIXB 2P43B 2R15A 3B8YA 5I0DA 2MKLC 4WO4C 3S9DB 2K7PA 5DJ0B 1CXFA 3ET9F 5DI8A 3CDFA 3MRJA 5K33A 1VGEL 2R56L 1TPXC 5EZOL 3WO3B 3MUGB 3SDCB 5I71C 5BJTB 3TPUA 4XAKD 1RFDL 4PJXE 3JWDL 2V9QA 4LCYB 4APQC 4AQ1B 5I9QC 1YA5A 1R3IH 3O6FD 2MCG1 3MRNB 3NH7L 4GAGH 2OM5A 1J8HE 3BKJH 5A3ID 3EYVA 1NDGA 3QCTL 1ZXQA 1BJMA 3KPOB 4RCAA 3QDGA 3B9EA 3WFEL 3OKMA 4BZYA 2EDOA 3F7YB 3HFMH 1E4WL 4JKWA 2ZKHL 1IAIM 2IFFH 1PQZB 5I9QB 1NCDH 3GSUA 2CO6B 1MEXH 3TBVA 2BJMH 3HNVH 2DKSA 2FD6H 2HG5A 2A74B 4JCMA 2J5LC 1ZGLB 2XZQH 4WW1A 4L8SC 43CAA 1KT2A 5J1AA 4U4BA 4FQLL 3P30H 3CDCA 3KPRB 3PJSA 1AGDA 1OP9A 3U0PB 2AGJH 4PJXB 4DGVH 5IT2H 1UJ3B 1S7VA 4UAOC 1IGFL 3G5XB 3MCLH 4DOHE 2AEPH 1T04B 3D69A 5C1MB 3RWCB 4PJ7B 4XCCL 4D94A 3WSQH 2R0WH 4ZOAA 4U6VH 4N1EA 4I0KA 3WXWL 3QIWB 4JHWL 4Q6YA 3SDXE 4J3SA 1GGCH 3WFDL 2H2SD 3B5GA 3KNBA 3RWDA 1JVKA 4HT1L 5DD6B 4L4TA 5GJSL 3VCLB 1BM3H 4LPUA 2I25N 3QNYA 4UNTA 5B8CB 4Y16B 1HIML 3P4MB 5CZKA 5EOTB 3WD5L 1NEUA 2MMXA 5KVMC 4MXQC 4EI5C 4KY1H 2VNCA 4R3SB 1D5XA 4XTRC 1I1FA 2QR0B 5LXGL 4WNQA 1S7RB 1E0OB 5FUCC 1QQDB 1G7QA 4L9DA 1UB5A 3H7BB 3LRGA 5AZEL 1NC2D 4Z5RA 1GOFA 5BZDA 5L6YL 4PRIB 4UT6H 3T0EE 2FJFB 3MR9B 3ZYIA 1KEGL 1V7MH 2OZ4A 3MLUL 2CDGA 4EOWL 1RUML 3BH9A 1MI5A 1UEYA 5A40E 4XZUA 3ZKMD 3BVNB 4PRBB 4U1LB 1BIIA 4JFFE 5JIIA 4WDIA 4OTXL 4P5TB 2WWKO 3IS0X 5JHDE 2KBGA 3IJHB 1OSZA 1KJVB 3OG6B 2DM2A 5D2NB 5GGSB 5DJCA 4KDTA 5D8JL 3X12B 5KW9L 3U9UB 4HMDA 4MQTB 4QWWC 1QRNB 4LLWB 3K2UH 3MRGB 2Z4QB 3CMOH 3PIQB 4MA1B 4I3GA 4GBXA 4BZ1L 2D0GA 2GJ6A 4H0IA 3FFCD 3GMMA 3BIAX 5IUSA 4YK4B 4XXCA 3HPLA 5J89A 2HJFB 2FGZA 2NYYC 2DLGA 3RWGA 2NNAB 2Y25A 4EIGB 4YXHH 4IMKA 1X5IA 4MB3A 2V7NA 2XQYG 2OL3B 3G5YA 4MA8H 4TYUA 1NKRA 3JV4B 1C7TA 4G6AD 2VLLB 4ZSOB 3FTGA 4UOW1 3F5WB 2O5XL 3T2QA 3ALPA 3SE4C 4LFHG 4X7SL 1G7HB 4AMKL 4NQED 3S5LB 2XRAH 5L0QC 2FJGB 4N5UA 4XVJL 4ZAKA 4E0RA 4P4RA 3CCHB 4PGBB 1I9JL 1MVUB 2AJZB 3NIFE 1X4YA 1BLNA 1Y18B 1RU9H 2E8ZA 4I4WB 5BV7H 3DVGA 1ORQB 4ZFOA 3BI9X 1MLBB 2HRLA 1RZJL 1A9BB 5A1AA 1FH5H 4P9MH 3EOYG 5H8DA 4DW2H 4QTHB 2OJZL 1DQQB 4Z7UF 1WT5C 1I8IA 3ZKNC 3B2UC 1KPVA 4K8RD 4PTTB 2RJMA 2B1AL 5T1KD 5FYLH 3BZ4A 4EUPH 2WINA 3IFPB 4CMHC 4OCWH 1X3DA 2VWEE 5IKCB 5JOEA 3L7EB 3MROB 1RIHL 4GG6F 43CAB 3DURA 1I8KA 1KPUA 2A9MH 4P3CH 4KRMB 2H26B 2DMCA 5JOPD 2YRZA 1J8HB 3ZL4L 2R2EA 1WF5A 4G7YL 4Z7OE 1YUHA 1ZHNB 2R0LL 3RIFK 2ADFH 1RURL 3IKCB 1VGKA 1P6AB 1H9VA 5HD8C 3O6ML 4NO2B 1DBJH 3RU8L 4QXUL 5KVEH 1LDPL 1KIPB 2YZ8A 4I48A 3M1BA 1GPOL 5GS2D 1RUQH 1ES0B 4OLUL 4K2UH 5A43C 2DKMA 3OAUH 4Y4KC 3AXLA 4M62H 4OIIL 4M6NH 2OTPA 1U3YA 3BWAB 4S1DD 5IM7B 4PRAB 2BNRD 2W0PA 3RNKA 3TNNB 3LQAL 3ZT6A 4LNRA 3DPBA 3L5HA 1EFXA 5F70A 4PJCE 5F9AC 4QXGH 5C3LD 1JRHI 5CEYA 5BZWA 3GSVB 3KPRD 1T1WB 1S7RA 3ZE0F 4KJYB 3SDDA 4YDKH 3QUML 5JIPA 1IGIH 5E8EA 3TYFB 2OYPA 2HVKB 5BQ7A 4GS7B 5SX4I 4D0CA 1KCKA 1MREH 1G9NL 3VXOB 1HZHH 3IAGC 5D7IA 3ZTNL 3OHXB 4PJ9A 5FYJL 4UT7L 4YPJA 5SV3A 5C9JA 2I07A 1DANU 3O6LH 1DANT 3RY6A 3P0YH 3ARYA 4KMTL 4PJHF 4IRSB 3GSXB 3UBXA 4P3DB 2ITCB 2NXYB 5FECB 4BKLA 3GSQA 2X4PB 2WUBL 3V52H 3P30L 3SKOA 4Y1AD 1LWRA 4PB9L 1YEDA 2M26A 3RWDB 4NKMA 2CDFB 4NC1C 1WIOA 2COQA 1OTSD 1FL6A 1JGEA 1YN6A 2CQVA 3H9YA 1Z5LA 4FXGA 2B20A 1ONQA 2R1XA 3MACH 1I3VA 5JO5B 3RGHA 15C8H 1EH9A 1MJ7L 3VFPB 1HSBB 1SHMA 1RVFH 4PRPE 1HSAB 5EDXA 2NX5B 4R3SA 3QEQB 4XC1H 4JGUA 3TBTB 5BS0D 3UTTA 1GHFL 3OXSA 5HTSA 3UBXI 4F7PA 4WV1C 3QH3B 5A2LH 1J1XL 5C0CE 5IROC 4OD1H 1AE6L 1MCOL 3CZFA 3DV6A 1JWUB 2WK2A 4DZ8B 2A6KB 4U1JB 4RAVA 2DTMH 5IEKA 2EIDA 1SBSH 5E2VL 1AQKH 3X11A 3TJEL 1LEGB 5FK9B 4BQ9A 2DLFH 3ULVF 1U95A 4LPYA 3RGVB 2IFGA 3EJYD 3DUSA 4HEPG 43C9B 2R1WA 2VZOA 3QNXA 5AEAA 1RUMH 4FZ8L 1TTGA 1K8IB 1BVLB 3D9AL 4RGOL 3HE6A 3Q1SH 2YEZA 3FN9A 4QRSB 1R3KA 2OQJB 3LHPL 4N0FB 5JIHA 4HFUL 4ODHH 4KK5C 1QPPA 2EC8A 1JI1A 4M6MH 2FH8A 2YWZA 2VXVH 4M03A 3RZCB 2OL3A 4U49A 4TVPH 3OR6B 1JPTH 4W4OA 1ETZB 5C0FA 4D0DA 2YSSB 1D9KD 5GJTL 2VQ1A 2J12B 3HS0A 3QJFB 4NCC1 4HIIA 4FHBD 4FQXB 1XF5A 3QUKB 1U8PB 2FJHA 2IBBA 3MA9L 1NCCL 4GUPA 1N6VA 1B4JH 3QHZH 1ZLWH 4TULL 4IS6B 1U3HB 2QSQA 3LRHA 4R0LB 5F7KC 1ZANH 3A67H 5MERB 1I8MB 4KRPB 2ADJA 4KJWC 3SBWA 1DQDH 3O6KH 1CDGA 4X4MA 1CD8A 2C5DC 3GHEL 3MOBL 4X0KA 5HHVL 4X6DE 4UILL 4K7PY 4GBXB 5E2TH 3RTQA 1D9KC 1OAXH 3OGCA 4QEGA 5C07D 4UUJB 5E95B 3EOAB 1KEML 1MPAL 2NCMA 1RIUH 3LMJL 5DD1L 1PBYA 2NLJB 3SDYH 4Z7NE 1P4LB 3QG6A 4I18A 3U36B 1I1FB 4P2OC 5A2FA 3D5OF 4ZO6A 2VQTA 4Y1AA 1Z3GL 1EVUA 3S34L 3D6GA 3QDHA 3LY6A 3O3DB 3O45A 2FBJH 3FFDA 2P5WE 4MNQD 4N9OB 1K3ZA 1RIVH 1DUYA 4JRYE 2OMNA 3V0VB 4P5KB 5CJQH 1JZ8A 2VE6B 4HS8L 5I1AA 2FLRT 2RCSH 3WDHA 4OZHB 4L9LB 1N0XL 2ZOLB 1Z9SA 2PW1A 5DJCB 3VDAA 5IM7A 1MCEA 4C56A 1CICC 3NCFB 4QXUH 1N5AB 2OZ4H 2YPVL 1J86A 3KPTA 3L5WA 4P2QE 3TYGH 3JV0A 3MSPA 1SEQL 35C8L 1EFXD 1UCBH 1PZUB 3HE7C 4MXWH 1LO4H 5D1QB 3ZKXB 4KROD 4JHBA 4F7MB 1U92B 3VXMD 1MFCH 3ARQA 3H0TA 4KVCL 3O11B 2Y4SA 4MJIE 2XIDA 3T77A 5FKPA 1J8KA 1RAMA 1XF1A 4NWTH 4PB0H 5HGDB 1MRCL 3SDXF 2AV1A 3EZ8A 5HHOE 1YPZA 2EICA 4RAVB 4F33B 2Q6WA 1OTTC 1G6RA 4FABH 4YHML 4NT6B 1CD1A 5H94B 5IR1B 3U2SB 5DD5H 4ETYA 2BY1A 3KR3H 3HNSL 1A1OA 4R96B 4RISH 2IADB 4OD3L 2X89D 4Y5XC 2IGFL 2EH7H 3O2DA 4PLJD 5JW4M 3MRDB 1SYVB 4HQQH 1BAFH 4OZGF 3CK0H 3MUHL 3UTSA 5TQ2H 1JGEB 1XGYL 3L3IA 5I1CH 1GGIL 1L7IL 3BD4A 3V7MA 5JW4N 1CGWA 2DL2A 1JJUA 3S5LA 3BP4B 1CGSL 4KJPD 4YBQD 1A6TB 2DD8H 1SYSA 2ZCHH 4KZEL 2ZCLL 3LKRA 4ZNEE 5EU4B 2ZCKH 1HKLH 1ERNA 3MRJB 3PL6B 4HCRL 3L3DB 2PXYD 1TETH 4IBLT 5E8EB 3TYFA 2YSSA 2A6KA 1T03H 3ORJA 3S7GA 1BOYA 2IPUK 4ZUSA 4LCYA 1QSEA 5DUBA 3BSZH 4B0MM 1F90H 5CZVH 3MXWL 1HNGA 2Y72A 2ZUTA 1H8OA 5F3HA 3MLZH 4NC2B 4UINL 5DUPH 4PJIB 3TT1L 2C1PB 5JXEA 2DMBA 1KJ2L 4E42B 4X6BB 5I8KL 4NUJA 4LSDA 3PWPA 4MJ6A 4XP4H 2ATKB 2VLRB 1NEZA 4U6XA 4LMQE 2GTWB 3IFLL 2P44B 3JTSA 4NKDA 3VH8A 4NFCA 5IW1B 3BUTA 5DMGD 1F2XK 1T0NA 3KPRE 4KKBD 3SKJL 5B4MC 4ZO7A 4M3JA 1OPGH 1QOKA 3RPIB 4WFED 4Q97A 3WN5C 1ES0A 1IL1A 4LLDB 4AIXA 4XMPL 1NAMB 1ZV5A 2DAVA 1MF2L 4NHUA 1OAZH 1K4CA 4ZFGH 2HLFC 3NCJH 5D7JB 2X1XR 3UAJC 4PJ7A 3I02B 4M6ML 2WLYA 1FNSH 2VXVL 4BH8B 1CWVA 4X8JB 4JFZL 1MFAH 4ZTPL 3MO1A 4OGXL 4P46C 4TVPL 3TVMA 1FNGA 3PDOA 5IMLB 3IDMA 1KCUH 3EFFB 5B4MD 1U95B 5MERA 1I8MA 3CFDA 3G04A 1YEHH 4ZUUB 7FABH 3ARBA 1JWUA 3AS1A 3VU2A 1INQA 3NIDE 5HJ3B 3NCYP 4JFXB 3WFCH 3BIKB 5ISZB 3HE6B 2YEZB 1ZGLA 1CLZH 4YAQA 1NGZB 5HDQH 3ISWA 3F7VB 1LDSA 3RI5K 1YN7B 5F6IB 1JZ3A 1NFDE 4IIQB 3QCUH 4BQBA 1CI5A 1QVOA 4DEPB 4DTGH 1FNHA 4PJXA 1JE6A 1WZMA 4FFYL 4OLEA 3PWLA 1SY6L 2I9TA 4S1QL 5I18L 3VG9C 4LGPB 4Y16D 1KOAA 4I1NB 4NZRL 4NKMB 4Z7UA 3FQRA 2DDQL 2J8UB 4KTDL 3WXWH 1ADQL 5EZLA 4U1JA 4FFVC 3P4LA 5C0JB 5L2KD 4K3JL 4OKVA 1BM3L 2EECA 1WBYA 3DGGB 2KDGA 4KI5E 2P7TB 1LD9B 1S5IH 1T5XB 3WLBA 3RL1B 3MRIA 1JWMB 5IHZB 4NQEE 2WM0A 2HRPL 3QEQE 2BCKB 2R69H 4WRLA 3OKYA 3OL2A 1DEDA 5LWYH 4GS7C 1YEJL 5DF0A 3L5WB 5F1NA 4M5ZL 3MGTB 5F1IA 5F1KC 4PG9B 4DGVL 5IT2L 3G5YB 4HS8H 3OKOA 3EYUH 5EBLA 1MAJA 3X12A 4RGNC 4LIQE 5DEZA 3D39E 5JUEH 4XCCH 1CZ8L 1QEWA 5D2LF 3PIQA 4KGJA 4OZIA 3O8XB 1UWGL 5EFIB 1F13A 4UDTA 3E3QC 3QNXB 4P0DA 1I3RA 5DJ2B 1G6RB 5EORL 4L5FH 3C08L 4L4TE 2I5YH 4LLYA 3HS0B 3ARED 5B39B 3I84A 1C1EH 4HH9B 3T04D 3BFOA 3NFSH 2V6HA 4JJ5B 5GZNC 3GMMB 3GO1H 1JFQL 4JPWH 3A6CL 5DD0L 3QIBA 4YZFF 4NQDD 4TPRH 1LE5A 2B5IB 5IHLB 4YFDB 1H3PH 1AGBB 5C0DB 2CDEA 2EDFA 4KH2A 1F3JB 3V95A 3U7YH 3C6LB 1T0PB 2AI0L 2CKBA 5GQBA 3L5IA 3ULUH 3HCVA 3D3VA 1YY8B 3UPAA 3WDIA 3TM6A 4X99A 5DD3H 2VDPL 3V6OA 3HAEA 3KPRA 4H1LA 1PG7H 5C0IB 1BREA 1F2QA 1M71A 1QLEL 4YXKH 5D1QD 3RA7L 4M9PA 4P3WA 1MWAH 4X4ZA 1VPOH 2VLJD 2X4QB 4Y89A 4BZ1H 5ADPL 1T04A 3D69B 3ZE0E 5HYFA 4QHNA 5K9JL 2VDOH 4LRIC 2VLME 3NFPB 1CD1B 1RJCA 4LPVA 1RZ8A 4CADA 5FHBL 5I2IA 1MHPL 3HR5B 5HHOA 3LVEA 2E8YA 3HI1B 4L1DA 5D1QA 1UWXK 1JN6A 1NDMB 3F58H 1MVFA 2YPLD 3G04B 5EO0B 4DUXA 4HKZA 4OZHA 1EEUA 1F90L 4R90H 4HGWB 1FG9C 1S7UA 4L29B 1KCRL 3GSVA 3QUMA 1UACL 4Q6IB 3WUZA 1J0JA 2XKNB 4M6OL 4NQDA 5KS9A 1Q94A 4U1NA 2DI7A 2NY4B 3LD8B 1G9ML 5T3ZE 3SDAD 4HMEA 2R2EB 4Y2DC 3VXUA 3HE7A 3FT3A 2JCCB 1I1CA 3VFRA 5T1MA 4LEXL 4TUJA 3KYKH 5GRWA 4R0LC 4L9LA 5J7CC 4N0YH 5DRWB 1WBZA 4K2UL 5HHNB 4G3YH 2VUOA 3GMQA 3T77B 2D31B 1AHWA 1Q72L 1PX3A 5C3TA 1CYGA 2FX9L 5HHME 3KS0H 5FYLL 2EH8L 1AC6A 1YEDB 5J1SC 1NC4D 1CG9A 3ECBB 4Q9BA 2WIIB 4LAJH 4JZJC 1Y6MR 4CRPA 2YKLL 1E27B 3MFGB 1P53A 1OHQA 4JO2H 4QXGL 3WFHA 2PYFA 4AL8H 3MJ8B 5C0NC 3PWPB 3T1FA 3WUWG 2DTML 1G0XA 3OBAA 5KANI 1MFAL 1AQKL 4G9FB 2EYRB 2FD6L 4F58L 1FZOA 2CR6A 4OF5A 4D2NA 2PO6B 3LN4B 4U0RB 1OOAA 1HHJA 1AD9B 3WIHL 3QBTB 4XPTL 5IG7B 1MREL 3ZSSA 4UNVA 1N4XL 2BNUA 2EDJA 4KI5F 4NYLA 3RL2A 1A3LL 3FRPG 4PFEA 4FTVA 4YXLL 5IJKC 3IDXH 3ROOB 3F5WA 1NSNH 3QB7C 4ZS6D 3VXRD 4OLYL 2XKUA 5I0ZA 4RGOH 4TSAH 5DK0B 5BMFH 1HILB 3PL6A 2HFTA 4ELMA 1BX2B 2Q86A 1AFVL 1B6DA 1CK0H 4I9WE 1ACYL 2Y7QB 4EQ3A 5FGCE 4K7PX 3VCLA 1BLNB 1Y18A 1QLFA 1T0MA 3B43A 4JHZA 4K23H 1NL0H 1INDH 3LEXB 4GW4A 1BPVA 4Y16A 3PHQA 3QDJA 4JG0H 2D7MA 3K80A 3LN5A 4UTAH 2DL9A 3HC4L 3V4PL 2VXTH 1JF6A 2UUDH 3EFDL 4Z0BH 1JMXA 2P8MB 5DUMH 4HUWB 4WEUD 3UMTA 3KYOB 1A6UL 4ONHB 1JNLL 4JRWA 4OF7A 5GISL 3GNML 4YHPB 3B9KB 4OQ1A 5HJ3A 2YWYA 2R1WB 2DLIA 3X3FL 2A6IA 4WGVB 4UV4L 4X99B 5I1HH 1T80A 3FO1B 2AQ3A 5AD0B 1ZHLA 5BS0B 4WFHE 1TITA 2ESVB 1D5BA 1XZ0B 3BWUC 1RJYA 4HWNA 4MJ6B 5IESH 3VW3L 4ZUUA 3WNKA 1EUUA 3LSOB 5ADOL 3HE6C 3DSNA 1VEPA 4JN1L 2X2YA 4YHNB 3BE1L 4XBPA 4XPBH 5JW3L 5M7QA 2ARWA 5SWZD 5B3JE 4HPOH 4JFEA 3WL9B 1IC7H 1IEBB 5EC2B 4IOFD 5I2IB 3GRWH 5KVFH 2VSCA 2DQDH 3R8QA 3QEUB 1MIMH 4Z76A 3OJVC 4Y4HA 4PJEA 4Q58C 2VITA 4MAYB 1HCFX 1LP9B 2V7NB 4S1SL 1K6QH 3GJFH 4GXVL 4YXHL 5I30H 4N9GA 4NHUB 4F80A 4PJ5E 2V2XA 3RIAF 3TJHD 3NTCH 2XWTA 3PGDA 5DVNA 4P57A 4M1GL 1KLUB 1YPZF 4Y1AE 4I3RL 4N0UB 3H3BC 1UZ6F 3T3MF 2ADJB 5D6CA 1UB6B 4P4RB 4ZD3H 5I8CB 1Z9OA 1MJ8H 5KOVC 3FN3A 3WLBB 5INCB 4FZ8H 2FJHB 2O5YL 2P5WD 2X40A 3Q2CA 3SDCC 4RBPH 1UCBL 2CLRA 5CWSA 5JW5A 3GM0A 1FG2A 1JGVL 1CFVH 2D7OA 4OM0L 5IGXH 5D2LE 3V6ZB 4D9QD 3O6FA 4Z77B 3QFJB 3F12B 5D8JH 4XCFH 3BRDA 4U3CA 1DBKL 2BRRH 1CLOH 3MYJA 3W5MA 3QEGH 3AS0A 1BVZA 3G5VB 5FCUH 4UUJA 2YXFA 5IQ9B 3MJ7B 1YUHB 1QO3B 1DEEB 3PWUB 1TPXB 5F1NB 2DWDA 2Q8AL 3BPCA 5DMKB 1NCCH 3MA7B 2AQ2A 1IGML 2GK0A 5DA4A 5K9QI 1KIPA 5C6TH 2VZTA 2APXA 3GGWB 1BAFL 2AV7B 4PY7A 4OLVH 3QIBD 3L3OA 2B5IC 2BCKA 4ZFZA 3ZMRA 1Y6KR 2X4UB 4NKOB 3DROB 4GXUN 5I73B 4X6DF 3UTSE 5D5ME 3O11A 3PGCB 4OZFA 1A7QH 1R5IA 1W8NA 3H9HA 2UVFA 3QXVA 4TTGA 3G6JB 5GGRY 4CMMA 1UA6L 2MPAL 2B1HH 1CFTB 1P4BL 4XNMB 3HZVB 2BVQB 3BQUC 3MODL 1CL7L 1O7SA 2OI9C 4YDJA 4QRTB 3IKKA 4U3HA 4KHTH 4DGIH 4J7RA 3RBGA 3BPOB 4ODUA 3S34H 4YHPA 4JFHD 2JB5L 1XCQB 3QIBB 3ZE1E 1LGVA 3O4OB 3CC5B 4OI7A 1AD0B 1U36A 3PGFH 4BZ2L 4ODWB 3B6SB 4UV7L 4N8CL 3VRIB 1WISA 5IVZA 5HPMB 1FRGL 1LO2H 4JRYA 3LKPB 1CGYA 1AGDB 4MCZA 4BKLB 1EVTC 1N0XH 1IGJA 3AS2A 1CTNA 3OZ9H 4AM0A 3U2SA 1JZ7A 2XYCA 2ICCA 2I60L 5JZ7D 3GSRB 1II4E 1PD6A 2D03L 2Y7QA 5CS7A 5BJTA 5I8OL 1NMAL 2EH7L 1S9WB 1HHKB 3ARDB 4LCWE 4XAWH 5GS0H 4HQQL 2FEEL 4HIHB 2GTWA 5IEHB 2EDEA 5I1CL 4YHIB 1UYWH 2FEDD 4XMPH 3EDJA 3D39B 3LKOA 3FOLB 5IBTH 3MRMA 4HXBH 1RK0B 3AC0A 3FQWB 2VLKD 3G9VA 3GKWH 4WUKH 2FO4A 4FP8L 1OQOA 2P47B 4J4PC 4PRDA 2DBJA 1WFTA 2PCPA 2ZCKL 1CFQB 1BP3B 2X1QA 2AJVL 1CE6B 2P5WB 3FB6A 3RTQB 4O51B 4ZTOH 2OP4H 5DJ6A 3EOTL 2QKIB 3BGAA 3IFOB 4G9FA 4E42A 2GJ6E 1KTLB 4PRID 3FJTA 1ZT7B 2E6PA 5E5UB 4IJ3C 4OUUB 2KL6A 1UM4H 1AD9A 2EDHA 4F9LA 1G7QB 4IMKC 5F8QC 4UDUA 4Z0BL 5BZDB 5E6IA 2QQLL 2I27N 1Z2KA 2H32A 1WZKA 1Z9MA 5DVKA 4OGAD 1D5ZB 5HYEA 4UZGA 3DUSB 4FQJH 5D96B 4GBXC 3EYOA 5F3HB 5JPNB 3N1QC 2EYRA 4G8FA 2D31A 2XTJC 5L88H 2ORBH 4X4ME 5ITFB 1A2YB 4NZDA 1NBVH 1Y0LA 5AWNL 1QTYT 4X4XA 4O02L 1UQSB 1U6AL 1P2CB 2AQ1A 3BMWA 3EDEA 3CX5K 4HWEL 4QGYA 3DSFH 1CGUA 2JKXA 5D2LA 1Q1JL 3BE1H 2H8PB 2P48B 3HMXL 4HUUB 3VGDA 1OCWH 5FO9B 1HI6A 2A0LC 1MCPH 4QRPA 1S9YA 4KQ4H 1F97A 2NY2D 3GK8L 1AHWB 5AZ2L 4NQXA 4I2XB 5DEFA 2JTDA 3ZHLA 4R9HA 3IF1B 5IROA 1TTFA 3RX7A 4EUPG 5B38A 1WIPA 1M1SA 5T5FH 3DARA 3NAAL 4GG6E 4YPGA 3WLWD 3W9EA 3VD3A 4EI5A 3GJEB 4KUZH 4YBLB 1DBML 1S5HB 4GUPB 1QZ1A 5J1AB 3MR9A 2B4CC 4K9EC 2GY7B 3FN0H 1IGYB 4CDGC 1YPZB 4YGAB 3RWIB 3Q6FB 1H8SA 5LVEA 1VFBA 1F45A 5K93A 1ZT1B 4NNYA 4PGBA 4LSPH 3F7VA 3KPOA 2LTQC 2EXYC 3DX7B 1UJTA 3EYUL 4HAFA 5BVPH 4PGJA 3G5XA 1W0WB 2ZSWB 4OZFB 4LPCA 4X83A 3AAZB 4PLOB 3BPLC 3DVFA 1YYMH 1MI5E 4X7TB 4XB8A 1S9VA 2QQNL 4JFEB 2E27L 3C5SA 1CLYH 2HKHL 1NBYB 4JKMA 3MRNA 4HSQA 4Y5YA 1Q38A 4TRPL 3LN5B 1BD2A 2IWGA 3BO8A 5HDLA 4L5FL 4PJ9C 5DD1H 4EDXA 2HFFA 5CJOH 1IQDA 1BVKA 4M5YH 2Z8VC 3LD8C 4KVNL 2F8OA 3DTXB 5IJVB 5IBLC 3U6RA 3UYRH 5SWZE 1QA9A 5E4EB 1DUYB 4ZO9A 3BXNB 4Z7VF 3VDCA 4YDLB 4GRLB 3KWWA 1ZGLP 1OT1A 3MGTA 5F1IB 4PRPB 3VFOB 1GGBH 4LLYB 3GMLA 4WFGE 4Y4KB 3FZUD 3PABB 5J9PA 5TPWL 5KVDH 5HGBB 1RJZB 1J18A 4Q9RL 1VACB 5KAQF 1BMGA 1LD9A 4M7LT 2X4OB 5CKGA 2RGSA 1PQZA 5E2UL 5DD3L 4WENB 4FFZH 5EFIA 3MMEA 4APQA 5TF0A 4OLVL 1IC5L 1AKJD 5C0CD 3KXFB 5GGVL 3W0WD 1TFHA 1NCWH 2VXQH 4ODSH 4FNLH 1QRNA 5BO1H 2UUDK 4DKEL 1PKQE 3X14A 1DN2A 3P4NA 4LFHD 5J0BA 4O51A 4XXDB 1MCQA 4AZ8A 5SWSD 5KJRH 3UJJH 4LRNL 3TBWA 1BIIB 1ORSB 1OW0C 2CPCA 4NRXB 1X4ZA 1DCLA 3VXMA 1MHPH 1UADC 4MQSB 5B22A 5HYJE 1S9KC 4CW1A 5DFVC 1KLUA 4A2MA 2CSPA 4AIZA 2ZJSL 4JLRA 2PYED 1BJ1H 2F5BL 3SJVB 3KJ4B 2I5YL 1IQWL 2WP3T 1FFPA 4WTXA 4OIBA 5TE7H 4H26B 3UTTE 4JFFD 4H88L 3O4LA 5DD6A 3WNNA 2HRPH 1IBGH 3D39D 2FYYB 5C2BL 5C92A 5HHOB 5ACMA 5EBMB 3EOBA 1E4XI 5CBAA 3PGFL 4O58L 5FM5O 2IGFH 2DKUA 3AMKA 4Z95L 3BVNA 1BFVL 4PJHA 1RPQA 4PRBA 4TQEL 4YFEA 5JXAL 1U2CA 3PV7A 3S5LG 1RHHB 2VN7A 3QA3A 1NFDB 3DOSA 4H1LH 5JUEL 4P2CG 4YHIA 1FVCB 2RCSL 4OV5B 2NY1C 2X9XA 5DA0B 2R23A 3H42L 3V5KA 2D0FA 2A6JB 4ZAKC 3BKYL 5J8OA 4KZDL 3NGBC 4Q2ZB 1YY8A 1RZ8B 3RWHB 3VI4F 4Q6IC 1JF5A 1IC4H 1FLTX 2X4NB 5EUOB 2XWBB 3HE7B 3VXUB 1NPUA 1JN6B 4IOSD 5JPMB 1F4WH 4MWFB 1K5NA 5DLMH 1MCSA 5E24E 2BSED 2ZUQB 3KPSA 4D9QE 1DQLL 1QVOB 3P11H 4JFOA 3BSZL 4QTHA 4CMMB 4ODWA 3B6SA 5E08L 2DF3A 3V9FA 5CSZB 5FGCB 4ZSOA 4XNZB 3QULB 2W60B 3R0MA 1I8IB 4RIRA 3DMMC 4JPWL 3UPRA 4MAYC 3C5ZD 3TIDB 1Q9OA 4ZXBB 3MYJB 3C5JA 4UT9H 4WUUE 2FGWL 1XMWA 2FJGA 3INUL 4L1HA 4U6TA 1YEEH 3QWRD 1FCGA 2EO9A 5ANMA 5FA3A 4OZGE 4KDTC 1U3HC 1OB1A 3NZHL 1AXTH 3I6LD 2Q76A 4XWOC 3QWRA 3FB7A 4NO0A 4IDJH 1XR9A 1T7VA 3JTTA 1JNNH 4R2GB 4XPFH 3MV7D 3FQXB 3P77B 1FL6B 3MNVA 1AFVH 1YN6B 1PG7W 3TC9A 3IU3A 1HHGA 3IRZA 1HOCA 5IB2A 3GI9L 4J1UB 1KPVB 4PTTA 5CP7B 3TWCH 4Q0XH 1OARH 2AJYL 3UO1H 1DZBA 1ZA3A 2G75B 2DQCH 1UM5H 5K9JH 4MXVF 5DJ6B 3PG2A 3CDGB 3P9MB 2VLKE 4NPYB 1A9BA 1T1WA 3S37L 4JGJA 4OCRL 4UDTB 3VD5A 4JANA 4KKLD 4JFZH 3MJ9L 5EO9B 3LKOB 4JKPL 1YNKL 1HINH 4ENEC 4LCWD 5KVGH 4U1KA 1DVFD 1P7QD 2QSCH 1ZWIA 1BGXL 5JPNA 3NAAH 1MCKA 5TJWK 5F7MC 5JQHC 7FABL 2YBRA 2D7NA 2ITCA 2NMSA 4LOUD 5D7LB 5I1EL 1BFOA 2GEEA 4XCNA 3E3QE 1KXVC 4MJ4A 1H15B 4YO0A 2DQEH 5HHQB 2GJJA 4JO4L 5L2KB 1IZJA 3O0RH 4XVUC 2CK2A 3CUPA 3D39A 2CJUH 3KYKL 3CSBA 1VA9A 1AO7A 1T83A 4PRAA 3QJHB 4N8PA 4RGNE 5KN5B 5FDWB 12E8H 3N9GH 3OGCB 2ED9A 4NSKB 4JB9H 1ZHLB 3UTTD 1BVKB 5BS0A 4FFYH 3QUXB 1S9WA 1PJ9A 4OUOA 3OKEA 3GMRA 5CEYB 3LCYA 4JDZA 3QWOA 4RMVA 2G60L 5B3JF 1ACYH 3WNLA 1RD6A 2W07A 3ETBF 3CSGA 4GKSA 3ULUE 3WKML 2BNQD 4XBPB 3KWWB 4S1SH 1VADB 3W5NA 1KCSH 2MQ3A 5BRZA 1MF2H 4WFFE 3ARGC 3MV01 3MRKA 1T5XA 4XVUD 3KYMA 2AJSL 3IJSA 5FO9A 3IDGB 1ZT1A 4NNYB 1WGOA 3WIIH 2H6PA 3W2DL 3DX7A 4APQD 4PJEB 4ZD3L 4JO1L 2AK4B 3S6CA 4Y4FD 3QXDA 3ARGB 1F11B 5AG8A 3OXSB 5E6ZA 4OLWL 4YXLH 3U46A 5F9DC 3O9WB 5KSBA 4GRMA 4YPGB 3QPQC 2EC9U 2CRZA 3C5SB 5A3IC 1OVZA 3MV8D 5D6DA 1KIUA 3GRWA 3V6OE 1JYWA 1S8DA 2XKNA 3P73B 4FG6C 1JGVH 2R4RL 5D7SL 3S35H 3BESR 4MJIB 5I1JL 2D9QB 3JWDC 2VDRH 4NJ9H 1CLZL 2LVEA 1S9YB 3RZWA 1D5BB 1MFEL 3KPQB 2DI8A 32C2A 4DQOL 4X6DA 5CCKH 4IRJB 2Z35A 2G9HB 1PDKA 2L4OA 3MNWA 4UTAL 5EN2B 2P24B 3SDXA 2YK1H 1KGCD 5FCUL 5IMKA 1WCQA 4N90E 4JAMB 1G7JB 4NGHL 1IAKA 5FO8A 1QR1A 4NCC2 1A6ZA 1S7WB 5I1AB 1NUNB 4MB5A 4MB4A 1IEHA 2WIIA 4GMTH 3U82B 1T22B 3SGJA 4X7SH 2DJUA 2DQFA 4PYHA 5INCA 2WUCL 2XWJA 4GQ9H 5C2BH 1VEMA 5FGRA 4OZGA 3ULVE 3RWFB 2NY5L 3ARVA 2LQRA 1TVHA 1KIQA 3QISA 1CXHA 4QRUB 3UJTL 4Y0GA 3T0EA 2IQ9H 1SYSB 3T8XA 4D0BA 5ABDE 1P7QA 4HK3N 4MXQD 2P4AB 2EEAA 1JZ2A 3UBXG 1FN4A 4KK8D 3S3JA 2QQQA 4J6RL 1T1XB 2HT2C 3IETA 3QHTC 3SOBL 3K7UA 2AXHA 3WE6B 2W60A 2FX8H 3QULA 5E8OA 3NN8A 3QRGL 3MLXL 1LK2A 3JWOH 4NDMB 5J4MA 1T20B 2UWEF 1NLBH 1YEGL 3X14B 2HA1A 1F42A 2E9BA 2NXYC 4YHZH 4Z77A 2G5BB 2IH3A 3T0AA 4EDXB 1NGYB 5GRVL 1J05A 4F2MB 2IAMA 2X4TA 3T65B 3KLAA 5L9DH 1H15A 1TNNA 4KK8C 2C3GA 3MOQA 3KJ6H 2R0LH 3FQUB 2DLEA 3T08A 2BC4B 5FV2A 2I60H 4MD0A 2GCYB 4PLKD 2Q8AH 2UY6A 3DO7A 1P84J 4OZFH 1T7ZA 3RU8H 2D03H 2F9BT 1AGFB 4EDWH 1ZHBA 5IIEA 4IM8A 1TNMA 2ZUQC 5CEZD 5CP7A 1QKZH 1FORL 2NYYD 1KCVL 3OKKA 1TENA 4LLUB 3FCTA 1A7NL 5T1DL 4JRXB 1FV1A 2Q20A 3NFNB 1N26A 3O2WL 5KZCB 5DHVH 3KPPA 4KROB 5DHYB 3VFUA 1YMMB 1XZ0A 2KQMA 4RAHA 2N7AA 3DNKA 4JFOB 2HTKD 5DRXA 1ZA6B 1QLEH 5FO7B 4D8PB 2NXZD 2NY0D 1R3LB 3OX8A 2B1HL 4PJ7F 2A6JA 2OMBA 4B7LA 4OSUH 1OLZA 1HH9A 1F4HA 1TLKA 1ZLUH 1PEWA 5DQDH 5KOMC 4AEHL 5KTEL 5C0EB 1JCKA 2DJSA 2GSIA 4OFPA 2B0SH 2Y36H 3UZQA 5FF6A 1UT9A 4KQ3L 5DFTA 4HBQA 1U91B 3ZDZE 4U7MA 3S88H 1EMTL 3CLEL 5IWLC 2YZ1A 2NY7H 1FVCA 5HGDA 4X8XA 2YD4A 2CRIA 4LSRL 4P23A 3RIFF 4DEPC 3BZFB 4YE4L 1B90A 4PGEB 1IM9D 1L6ZA 5DK0A 1Q9OB 1BEYH 3HZYB 3TO2B 4X5LA 1KC5H 1L4IA 4X7FC 3C6LD 5AWNH 2IPKB 5JHDB 4M6OH 5TE4H 3BP6A 4JFFA 2XZAH 3D48R 5D5MA 1F3DJ 4PJXF 4DVRH 3UTOA 5J11B 3BYYA 3B4NA 4YDIL 3MODH 2F53A 2HT4C 3CLFL 4C56B 4MD4B 4JANB 1MCPL 4HJJL 1WQVT 4NZUH 1XF2B 2CKBH 3S36X 2GT9B 3ZO0A 2RB8A 4G8IA 1SM3H 3CVHH 3KLSA 5LCVL 3VWJB 5IHBA 1J0IA 5C86A 5ENWA 1WAAE 4XCYA 1AE6H 2AJVH 3TA3A 2E6JA 3LEVL 1KB5A 1HHIB 1ZLWK 1E4WH 1FVEA 3VG0H 1OB1B 2YUXA 3O8XC 4YDKL 1UKTA 3QUMH 3X3FH 1NFIB 1FGVL 4Z7VA 4XVSL 1D9KB 3BGFC 4G80B 1N6QH 4LU5H 4ZO8A 3TIDA 2BHYA 1HOCB 2KUTA 2MCPL 4HX1B 3BP4A 3MBEA 1BQHG 4L4VE 2V2TA 1ED3A 5E9DB 2DM3A 4LMQI 4TUOB 5IP4A 2VAAB 3FAXA 3VXTA 2OTUB 2AVGA 1EO8H 3H7LA 1NEZB 5F7UA 3L95A 1LO3H 3R4DA 2ED8A 1NBQA 3C6SB 4B5EA 5DJXA 5AAMA 1U6AH 4JHWH 1HKFA 1MIML 4RFNB 4H25B 4XCEA 4M5YL 1W0VA 4LSTL 1T21B 4I3SH 5GRYA 3JWDH 3Q3GA 1K3IA 3QQ9D 1K4DA 3MUY1 3P0VH 5HVGB 4F57H 2Z8WC 2WWKT 4K55A 3ARGA 5FGBA 4JDTH 4UTBL 3RGVC 1QQDA 2OJEB 1LILA 3NVQA 3OV6A 1G9NC 3L9RB 2PUQT 1K4CB 2IMMA 3TBTA 5I8EB 4CN6A 5DJYA 3MRKB 4KRLB 3FN0L 1C7SA 3HA0A 3QQ4A 1S7VB 3OB0H 3A67L 2H6PB 3RVXD 5HPMA 2Y1VA 2XZQL 3OAZK 2P45B 2HJLA 2VXQL 2NY5H 1NCTA 4ODSL 1EAJA 2DLFL 4GSDL 3QWOB 4HGKC 1ZTXH 4GRMB 2A77H 2E7HA 4N1CA 4X7DC 1W0WA 4M7KH 4M3KB 1LO0H 1PVHA 1OAXL 4LSSL 3VG9B 3I02A 1OCWL 3CFEB 3K2UL 5KN5A 1F58H 1UXSA 4KQ4L 3VFMB 4UAOB 3SQBA 3ULSB 2F5BH 1QHPA 5E99H 3MLXH 2F53D 2J2ZA 2BNQB 1XIWA 5CSBA 1GH7A 1LNUB 2DJ4A 4HWZB 1VACA 3MFFA 4K8RH 3U4EA 4ZQKB 1AO7D 4KK5D 1PAMA 4XH2A 2GJ6B 1DLHB 3STZA 2E9JA 3MLPA 3SJVA 3D3VB 4XI5D 1SJEA 3DJ9A 3QNZA 3M8OL 3RVTD 3T8XB 5GS1C 3VRLF 4YWGL 3VFRB 4P23D 4OM1H 5I17A 4XMLL 4CU8A 5LGJA 4NRYB 2RHEA 3RL1A 2A73A 3CVIH 4NZJA 1I9IL 3QXAB 4FQIL 4KZDH 5L2KE 4ORGA 2CLZA 1ZANL 3RDTC 3WE6A 1CFNA 1MQKL 3L3GA 4IS6A 3KLDA 5C0RH 4NQCE 4MJ5B 1R5WA 4XPGH 1I85C 3WJLA 3RWJB 1KPRB 1RK1A 2F53E 3BAEL 4P2RE 5IFAL 5CJ5A 2ZG1A 5M94B 4FZEL 3EO9H 1EZVX 3KPQA 2XG4A 5C0AE 4XI5C 4G9FE 1DBAH 2IAMB 3MJ8A 4DAGH 1BBDL 4O00A 3OJDA 4DGYH 5D1XD 3O2DL 5ITBH 1OD7A 1REIA 1KPUB 3CXDH 5TDNB 5A2IH 4OCNC 1B2WL 1OTUD 1T66D 2Q7NA 5MENA 2O61A 4P3CL 4CKVX 3D85B 3DUUB 3F6IA 1F6AA 5DQ9A 4OT1H 4J12A 1Q94B 4U1NB 1IQWH 3C8DA 4GLRI 3I6KB 5C0JA 2ADIB 1XF3A 5J3HC 2FBJL 3U30C 4DN3H 4C59B 3UZVB 3BP6B 4JFPA 5FKAB 1CICB 2VXUL 4J2XA 3W11D 4QHUB 3E8UL 3MLYL 3TFKC 3D85D 2DBLL 4YHKH 5DRWA 3JV5A 3MLTA 1J9CT 3Q6FA 4HKJB 1I1AA 1L7IH 5HPOA 2CR3A 5BO1L 5DJXB 3OWEA 3I50L 4CMHB 5JPMA 2IAMD 1FYTB 2X4RB 1XH3A 2CDEB 1KIQB 1GYAA 3EDFA 5TE6L 1T20A 4XPHH 3OKKB 1JPSL 3TH2T 1TETL 5CSZA 1U8JA 3IFPA 3LS5H 3MBXH 5E2WL 4QCIB 5J3HD 4FQCL 4HH9A 4ZUWA 3JSSA 3WS3B 1M71B 3IT8D 1FLRH 2R1YA 4ODVL 1MLCA 3TFKD 5CILL 1NFIA 3WNOA 5BCAA 1J8HA 1I7TA 3HAEH 4HC1A 5DRXB 3P9LA 4G5ZL 3SKUD 4I5BB 1Q9WB 1I3GL 3HE7D 3R8BB 4JQXA 3VXUD 1J0KA 3VMNA 3U1SH 2EDLA 4KKCC 1EJ6A 3UPRB 2FRGP 3T65A 3SPVA 1FPTL 3SDDB 5LJYH 5FYKE 2XPGA 2Q86B 1VFAA 3CFKA 3PABA 5D7LE 5GGTA 5J9PB 5KSBF 3D0LB 2CUHA 1U8HB 5GGTH 3SKMB 3CDGA 2V2WA 2ZSVA 4MNGA 3RY5A 2AXFA 3O4LD 4R2GC 4QKXB 1DE4B 1QD0A 1NMAH 4LKCB 1FIGL 1BD2E 8CGTA 1GGIH 2CMRH 1NCAH 3O41A 1JPFA 3VWJA 3OAYH 4NM4H 1FDLL 4RZCA 4LHUA 3WHE1 3NCJL 2PN5A 4YC2B 1ND0B 4J3VA 3T4AA 4FMKA 1TZHB 3T1FB 4PG2A 2Q8BL 4HJ0C 4YHOL 4L8BB 5BOPA 1D5XB 3W0WE 4Z7NF 4PJIE 1DQTA 3VXOA 2J88L 4KJPC 2WWMD 4DN4H 2OR8A 4FQQB 4NIKB 5I8CA 3MRQB 5SWSB 3WUWA 2A9NH 1CDHA 4FMFA 3QYCA 1SBSL 5E2VH 4KDWA 4CBPA 2FJFA 1BGXH 4KK9C 2J4WH 3AAZA 5JMRA 3BEWB 3BH9B 3WFHB 4JREC 3VXTB 4GW1B 1RUAH 2G2RB 5LGHH 3UDWC 2C4FU 3U7WH 4KRPD 5JLZA 4X5WA 5TF1H 1BVLA 3RWCA 5ESVB 1JZ4A 5A16A 3QUMB 4U7KA 2NY1B 4KUCD 1UXSB 5GGSA 3VFMA 1B0GB 1QFOA 3HMXA 4JKKA 1EA9C 4U1MB 1XGPB 5FHAH 4FQXD 4Z8FL 1JNJA 1IQDB 2A77L 4OFYD 2VITB 4JFFB 4P46B 2CLVB 3QIUC 1JWSA 4JVWA 4JY5L 3NABL 4MJIA 5FM5M 1R3HA 2GK2A 4KK9D 1JK8A 1CR9L 4GG8A 3VE0B 2LABA 7CGTA 2BRQA 5HI4C 4DZ8A 1YJDL 4PJEE 4X5XB 5I19H 1R3KB 1JPTL 4JM4H 4X80L 4WNQB 4PJ7E 5C2UB 3LKSB 3O4LE 1PSKL 2UWEA 5DJYB 3BKMH 2G5RA 2IFFL 4JKLA 1U8OA 2OK0L 4OKDA 1KTRL 1MCDA 5I1IH 2IPTH 1VFUA 4OGXH 3TN0C 3RGVA 3RY4A 1UC6A 5CEZL 4M6AA 5EOCJ 3RUGE 1DBMH 1MRDL 4UNUA 1WJ3A 3DECA 3BP7A 1LVEA 1A3RH 3O81A 3P2TA 3IGAB 1U58B 4ZFOB 1IC5H 1TVDA 3CZJA 1BF2A 4ALAH 3NA9L 5HI4D 4XNMA 2X7LB 1P1ZB 4WHTB 1KN2H 3LEXA 4LCWA 1INQB 2B2XL 4CU6A 4UILH 2XFXA 3MBEB 2CK0H 2CUMA 3C8KA 1ZHKB 4RSVA 5C0BB 5EBWA 4GRLD 1CXLA 2XY1A 5EZOH 5GS0C 5D1ZB 4HFWB 3TN0D 1CXEA 5GJSH 4L8CB 3MREA 1YY9D 5MENB 5E6IC 2KKQA 1FZJA 4TSBH 2VDKL 4M1CD 4P4KB 2Z31C 4Y8DC 2J6EL 4P4KD 4P9HH 5T1LD 2ADIA 5SX5K 1EZVY 5D2NE 5DSCA 2W9DL 1XGTA 1C5DA 3V4UL 4YQXH 4OZFG 3VXRA 2VB5A 4LLAA 4V1DD 3EYSH 3MRLA 1BQLL 3V2AR 1FE8H 1BBJA 4WI7A 4NRYA 4NO0D 3E6FA 3TA3C 4XMKL 3H9SA 4G6MH 4G8EA 4BQCA 5KSBE 2BJML 3HNVL 3K81A 3FFDB 4TUKL 5MHSD 3N85L 5J11C 2QLVB 4Q9RH 1R5WB 5D7LA 1NAKH 1UCTA 2Z31D 4HS3B 3MRMB 4MLIA 2HFEA 1SJHB 1Q9KA 4G43A 5IB4B 5L8JB 3TO4B 1CS6A 3T2PA 2BZDA 2BVYA 4ODUB 4KVCH 5H37H 2D2OA 3IDIB 4QOKA 4U1IA 3OKNA 5F9OH 1LNUA 4KGLA 1HEZB 3L1OH 1LEIB 4F33A 3QRGH 3WL9A 2R9HC 1IC1A 2HVKA 4PS4L 4KQ3H 3CAFA 2EE2A 2XKSA 3BGFB 1FLRL 1O5DT 1QYGH 2A83B 3H0TB 2F74B 4L4TB 5ANMB 5FA3B 1VGKB 1YEEL 1RJLB 3WD5H 4LNVA 5I6XB 3VA6A 3NFSL 4DUWA 4MVBD 5EPMB 3L3OB 3BHBA 4LLVB 4JZJA 3FQXA 2CIKA 1VFMA 2UZIH 3LAFA 4HIHA 3UTPE 1N5AA 2IQ9L 3FO9B 5HVWA 4DFHA 3KPPB 4LP5A 4GT7A 4S10A 4TPRL 5DHYA 3VFUB 3ZHDA 3ZYZA 1MRFL 1V3MA 2Q7YA 1KLFA 3QXDB 2DYPA 5HY9B 1ZA3B 1AHWC 4PPTA 2CRMA 5F21B 3BD3A 1FC1A 3FT2B 2VDMH 3FL7A 1CU4H 5T1DH 5MEPB 4HUNB 1DBBL 1UENA 1OF2B 2FX8L 2PYEA 4NZUL 4FQ1H 4H8WH 3P73A 4JRXA 2VL5B 2K1MA 2X4UA 5HXMA 4RNRA 4Y2DA 4EI6B 2PXYA 2CMRL 3VXSE 1R5VB 4OCRH 3BPOC 3QZWA 2W65A 2VLJA 3SGDI 4KAQH 1Q9WA 1U8OB 3VFGH 2ICWJ 4AL8L 3V0WL 2GK0B 5EN2A 2XY2A 5C7XH 3T2NL 5B8CC 3GB7A 5MEOA 2LFGA 5T3ZH 3RZCC 5CAYB 3BZ4B 1U58A 4C83A 1RZFH 4PP1C 1IM3B 3LQAC 3O6FC 4NNPL 1JNHA 3FO0H 1XGPA 3ILQD 4JG1L 3JV4A 1E6JL 4E41D 4Z7VB 1LO3L 2BHZA 1C16B 4NQEB 1Q0XL 3OKEB 4HKXB 5IVXF 1UM6H 3MLTB 2X1WL 4QRUA 4NO5B 1LQSR 2EXWC 3JTSB 4NKDB 3VH8B 4E0RB 3BDYH 3T4AB 5CD3A 4X5XA 4K23L 1Q9LA 5ENWB 4OSUL 4WWKD 1CXIA 4Q0XL 4L8BA 5DQDL 4Y88A 1UFUA 3VH8G 2YOCA 1P4IL 3MRQA 2WLZA 3EFDH 3CVHB 2JLLA 3VFOA 1A6UH 3F7PC 3ILQC 5INDB 2FO4B 3MYZA 3TZVD 5I19L 3QUZA 1U8PA 3H9SB 4X80H 5E56A 4Y4HC 3RUGB 2EE6A 3O9WA 4JKPH 3G6DL 4UIKL 3RVUD 3GSWA 5KSAB 2EXWD 4KWUA 2Y23A 2WBJD 1X5YA 4OUUA 3TT1H 4G8GD 2BMKB 5IW6B 3FRPA 3RQ3A 5I1EH 1BD2B 4MJ2A 2HAZA 3DGCR 2VDRL 4NJ9L 1JPST 1LDPH 5L0QB 5DC9B 3MREB 2VUYA 4MA1C 1RFDH 5IFJB 1EO8L 5BMFL 4I48B 4QRPB 2HJLB 2J1KA 4Y4HD 4NO3A 1KGCE 4BH8A 3PWVA 5LCVH 3EKCA 4HV8B 4GRWE 4QOKD 5H2BA 1KG0A 4H20L 3O41B 5I73C 3LQAH 4UIMA 3ZKMC 2BK8A 2UWEE 2W9LA 4LARH 1J5OL 1NH6A 3P0VL 3VFPA 2ZKHH 4OZHE 2CIKB 5C0EA 3MV8E 5IQ7H 2HFGH 2ZSWA 3NPZB 3QQNA 2HMID 2P8MA 3GNMH 4V2CB 4WUUA 1G6VK 2WQRA 1EBPA 2IG2L 1RZJC 4WI5A 4U1SB 1KCUL 1YN7A 3QQ3A 1S7SB 5DMIL 4POUB 4P23B 5IBUB 1MQKH 4HUVA 5DTFB 3DX9B 4QOKB 2X4NA 3JWNC 3PWJA 5EUOA 1A7RH 2W9EL 4LVHC 3GUTA 4JZNB 2NY4C 2NLJA 5AYQA 5LBSH 4AIZB 4FFWD 1LO0L 5F8RC 3G08A 3WFDH 3ULUD 5EORH 3H3PH 4DQOH 3VXSD 2EO1A 4ELKA 4WHDA 3P0GB 3WXVL 1QACA 4MJ5A 2X09A 5T3XL 3MRRA 2X70B 2MTPA 3O3UN 5IVXB 3KPLB 5BV7B 2OX5A 3ARDC 4MSWA 2Z9TA 1IGTA 5D1ZA 1R3HB 5GJTH 3FQNB 3ULSA 3VWKC 3VXRE 5DJ2A 2FH6A 1HSAA 1KIRA 4PJ5A 3FO9A 1LP9E 4IOFC 1D3CA 1D6EB 1RUPL 3MV7A 4HKBA 4LF3A 2V2XB 3MRPB 1EHAA 4IEFB 1M7DB 4YDVB 3HI5H 1BHGA 4HKXA 4NN6B 2JIXD 5JXED 4Y5VC 3PXHA 5C08E 5KSUB 1YEJH 3QR2A 4M7KL 4XMLH 4M5ZH 4U0RC 1MRFH 4XPHL 1DN0A 4YLQT 3S37X 4XHJC 2PO6D 2HP4A 1QBML 4WWKB 2XV6B 1WBXB 2Y5TB 4H5SA 3VMOA 3HB3D 4NN6C 5AAWA 1QUNA 1NC4A 4I0PD 1UWGH 1QBLH 5JW4Q 5JHLL 1KELL 4K71B 2AJXH 2BERA 4G6AC 4HF5L 5MEQB 3ESUF 1YEIL 1HHHB 4QF1B 3C5JB 4R4BA 5L7XL 2HTLD 4RX4D 2IF7A 5JXEC 4X6CE 4L29A 3TBWB 5DJAA 1RIVL 4HCRA 5DWUL 1H3XA 3I85A 1OL0A 3BISA 4JPKL 3UROR 1FL5B 1NEZG 4LRIA 2O5XH 1S7QA 3OZ9L 2JE8A 4RQQA 1FPTH 2E3VA 1JGDA 5CSGA 4A2LA 4EN3D 4F37F 2DYPB 4P9HC 4UB0H 4X9HA 5I71B 1F4XH 1FNEA 4H26A 3VXRB 3A6CH 4D9RE 3NMEA 3GMPB 4OQTA 5D5MB 3ZKND 3V6OC 4QY8B 5C0RL 4POZC 5DRZA 4F3FB 2P8PA 2X4QA 4UI2A 5JORB 2XWBA 4G3YL 4QCIA 4Q6IA 4OBRA 4RDQG 5IW3A 3O6KL 2AK1L 3NIGE 1MFCL 1EEYA 3HKFA 3L3HB 5C08B 1SJXA 3GHEH 5D7JA 1RULH 2E7CA 2AXJA 3ARTA 3QIBC 4M4RA 4S1RL 5CGYD 1KACB 1JYVA 1UA6H 1JPSH 1OAKH 3GIVB 1AJ7L 3KYMB 2D7PA 1FVEB 5MEPA 4JDVB 5GGQH 3VWJD 3ELAT 1CFTA 5C0CB 1AKJB 2YKLH 2DQGL 3RWHA 5BOZG 3O2VH 4WFEE 5EULV 3PXJA 2OTWB 3BHBB 2ARJA 1HEZA 3T0VA 3ZZ1A 1SJVA 4C56D 4NN5B 1UH2A 4I0PB 1OLLA 1UWXH 1UZ6E 4FRWA 3T3ME 3E8UH 4Y4KD 3VGHA 1KJ2A 2M8XA 3WFZA 4K7FA 3G6DH 3ZDZF 2H9GB 2ZSVB 1ED3B 3O3DA 4L4VD 1T0NB 4FQQA 4L8DB 2BY0A 3EOBB 1JF1A 4MNQA 5CHNA 3MX0A 3E2HB 3OAUL 1IL1B 4LLDA 4WY7H 1HQRB 3LN4A 5FHAL 3QSKB 1G84A 2X42A 2BSTB 2V7HB 3IDNA 3F65A 4Y5VA 5LGJB 5JA8B 4MAUL 1TZIA 1HHKA 1NANH 4XC3L 1FL3B 3L3GB 5JZ7C 5EG6C 3QDAA 1S7XA 4F15C 2DLHA 4M00A 2X5PA 4JFED 3UYPA 1TZGH 3R06A 2ZNXA 2OK0H 1AC0A 4W6WB 5CEXB 1SEBB 3MC0A 1DR9A 4O9HL 5F7EL 1LP9F 1B0WA 3DBXA 5C0AB 3TESA 2P5EA 1KJ2H 4NO0B 2R29H 3SJVE 4L4JA 4AT6A 3B83A 1F4YH 5ALCL 1ZT7A 5CINL 5H35B 4NQEA 3VRLE 2AEQL 3MRBA 3WYRA 1OTSC 1A64A 2O26U 2KH2B 1YECH 3RNQB 4JVPA 4KI5D 5CUSL 1PY4A 3ZYJA 5TF1L 2B4CH 2J5LB 4JDZB 2IBZY 4R97B 1CE1H 2LV4A 4Y5YC 1A3QA 4HIJA 4KJQC 5H2BB 3FFCA 3BMVA 4OGAC 4BUGA 1GOHA 4IDLA 1CGSH 4B7IA 5E70A 1ZEAL 4HWEH 3QJHA 3RWEB 3QDGB 4PJIF 3SE9H 4MCYA 1AGCB 3SE3A 4DN4L 4P46A 5HYQB 3PP4H 3B9KA 2DLTA 1QRKA 4NJAL 3V4UH 1MUJA 4KI5C 1T03L 3BUYB 2ICWA 2DIAA 2EDRA 5GHWH 4WW1B 3U4BH 2AW2A 1BQHA 1ZSDA 2E7LA 3VXPA 4QT5A 1WV7T 3U0TA 1MJ8L 3ARBD 1J0ZA 2NY2C 4LLUA 3HCVB 5IB3B 3PQYA 3GSOB 2OSLB 5IMLA 1V05A 4UMGA 3RWIA 5IHUH 3NIFF 3NACL 4OCSL 2NY3D 1AI1H 4DKFH 5E8PB 2OL3H 3VFNA 5T3XE 2GSGB 3Q1SL 1QPXA 5EU3B 3LHPH 4X98A 3SO3B 1CT8A 2JELH 4HBCL 2ADGA 4KDVA 4UQ2A 4FZEH 4YJZL 3U9PL 1JIBA 1QBMH 4GQPH 4LSSH 1ADQH 2C3XA 5IB1B 3FT4A 2GITA 2P42B 1IC7L 1X6LA 3RPIA 1J1PL 4BYHA 4NKIH 2I26N 3QUZC 1A5FH 1A7OH 4YUEL 1B3JA 1NUGA 4E5XA 4HD9A 4HLJA 1NGPL 3DRTB 4HMCA 3A6BH 4KJWD 5D9SA 4WTZA 1TVHB 5I1LB 4XPAL 1AGEB 4H0HB 3KPLA 2IANE 3G5VA 2E7MA 2DQIL 2CXKA 3MO1B 4D0BB 2YD2A 4JJHA 3BPNB 3DROA 5IBLD 4H1LB 5C0IA 4XNYH 1T1XA 3BGMA 1VSCA 1TCMA 5D5MF 2Y5EA 4G8EB 3GMQB 1SQ2N 3HC3L 4OQTL 3V6ZA 2I9TB 3WFCL 4PY8J 4U6HA 2R0KH 1RMFH 3QUZD 4LLWA 2QJDA 1XF2A 2EDKA 2MPAH 1URLA 4YDJB 2SEBA 2YR3A 3IDUA 3QFJE 4APQB 3NFPA 5D7KD 4PGDB 4JREB 3OKOB 2X70A 5IVXA 4P2QA 3ECBA 5ESAA 4PY8I 4JE4B 2YMXL 2X41A 4MSWB 5EIQA 3FMGL 2AK1H 2PNDA 4DTGL 1KB5B 4JRXE 3BAEH 4I5BA 32C2B 2XNAA 1D5IL 4M61A 3CSYB 3IU4H 2W9DH 1ZGLM 5DURB 3NPSC 1FZKA 3MRPA 3UJIL 5F7FA 3LKQA 1I1RA 3RPKA 3O2DH 5FB8B 3HPJA 1FRGH 1CICD 1FSKC 1LO2L 4JY6A 1CQKA 1TVBA 1HXMB 3GSNA 1C08B 3ARSA 2VABA 1JZ6A 1IGTB 1MAML 3BZDA 5HHXL 1M7IB 3D0LA 1JNNL 4PJGF 2O5ZH 3X17A 4O2CA 1NAKL 1FO0B 3HMWL 4TN9A 5K9KA 2DQFB 2DICA 4X9BA 1N5YL 2H26A 3MLYH 4S2SA 4ZPVA 4CUCA 3BQUA 4M48H 2Q87A 3THML 5DT1H 1M6OB 5DYOA 3BDYL 1I7RB 4H25A 4XCEB 1J12A 2DQCL 3TBSA 2EEBA 2JF1A 1VPOL 1RV6X 2K9UA 4MXWL 1CBVL 1LO4L 3GBLA 4RX4A 1OTTD 2VDML 1ZOXA 2VZUA 4FS0A 1A6PA 3MXVH 2Z93A 3S37H 1DBBH 2VOTA 4LCWB 1CCZA 1PKOA 1OAUH 2OCFD 3DVGB 4Q2ZA 5GRJH 2AXGA 3K1KC 4YHOH 1EAPA 4BFEA 4ONHA 4WWID 1BJ1J 4HXAL 4KKBC 5KVGL 1NFKA 4KHTL 3EW3B 5EU7C 2JB6A 4RRPG 3L7FA 2DRUA 3AVEA 4Z7WF 1J1OH 4O9HH 5F7EH 1CE6A 2FWOA 2J4WL 2P5WA 1QSZA 1WVZA 1OP3K 1EXUB 2C4FT 1G9MH 5ESVA 3KLAB 4X6CB 1U8LB 4R4NC 1TJIH 3MRLB 3CK0L 2BSRB 4NNPH 1CFSA 3AM8C 5JQ6L 4KPHH 5DDHA 1WT5A 12E8L 3FB8B 3GSWB 3OAZH 1T4KA 4MAYD 5KANG 4ZFFA 3SBWC 1AGFA 5FXCH 4JY4A 2Q76B 2XZCL 5C9JB 2GTZB 2VZ1A 1G6RH 1PKQA 1CFQA 2FX9H 1C16A 3C5ZB 5KBNC 3D18B 4EEEA 3VFGL 1KCSL 1CD9B 3GMNA 3TT3L 4KJYA 1HHIA 3U4AA 5ADPH 4I0PA 5FEBA 1I7UA 1NMCB 1PSKH 1YMHA 2VWEC 3ARZA 4R26L 1S7UB 2VDOL 3MXWH 4W4OC 5F9WB 5I1LA 3W9DB 1RZ7H 3KPNA 5C07B 1E4KC 3WNMA 4GOSA 4UINH 3WEXA 5SV4A 1KFAH 3BJ91 1GGTA 3NZ8B 4LHUG 1A3RL 4XP6L 5AG9A 4PJHE 2A73B 1NC2A 5IFHH 1U91A 5ESQA 1OAQH 2I24N 1T2JA 3PQYD 5E5RB 1DLFH 4P2YA 1WBZB 2BY2A 3BJLA 2QQNH 3VFTB 2ADGB 1ZHKA 5C0BA 1I9RL 3SKJH 1DVFC 5EC2A 3K3QA 2HLFD 4PJ5D 3ZKQD 3MZTA 5LBSL 4TRPH 4AK1A 2DN7A 4MNQB 5CHNB 2UYLB 1MHCB 3ZDXF 3QNYB 1RHFA 4P4KA 4O02H 3FT3B 1T7XA 1K4DB 2YK1L 4N90D 3SQOL 3IXAB 4UOW0 3P4MA 3X3GL 4JEGB 3W9EB 3LKQB 1A4JB 3ZHKA 3B5HA 4N0UA 2ATPB 5FGSA 4U31A 1MH5A 3LZFL 4I13B 4R7NA 4QYOB 3VXPB 5HBBA 3BO8B 3HFML 3GK8H 4RMSA 1MFBL 1HXYA 4FN0A 3RL2B 4LARL 1J5OH 5T5FL 2E7LC 1HWGB 1HIMH 2ZWLT 5HYQA 2N7BA 1NGPH 3W2DH 1S9VB 2OXGA 4U05A 3PP3H 5CIPA 4LQFL 2W91A 2MQ0A 3SE3C 3DV4B 2VXSL 2RQ8A 3AREC 4Y19E 4Y16C 2ZNWA 3G6JA 2DS4A 3TO4A 2HN7A 2FIKA 4LBEA 2NW2B 3WSQL 4XWGH 4PRHB 3IS1X 1A6WL 3S35L 4PRPD 3UDWA 4I0CC 2DQDL 3PL6C 5C09A 2OTUA 4MMXC 2C7UA 1S9XB 4NO5A 3ARFB 4KTDH 5CGMA 5CP3A 5IJKA 4WWKA 5FB8A 3BPCB 5DMKA 3C2SA 4O5LL 1HH6B 4MDJA 3SDDC 5JHDD 1VESA 5F7DB 1JRHL 3MNWB 1R0AH 4GKNA 3LKPA 2W92A 4RWYH 4N68A 1A9EB 1IM9B 1RJZA 1LMKA 3UYRL 5D71H 2UY7A 4RGND 5D70H 2HYMA 2BSRA 1QLRA 4I18B 5EOCH 3TBYA 5CEZE 2EIEA 4UT6L 2FR4B 1U8HA 1T4KB 4HPYH 4MA8L 4Y1AB 4K7PL 3MLUH 1FE8L 4ORGB 3STBA 2W0FA 3JUYA 4QGTA 4CJ1A 5TPWH 1DJSA 2WBJA 2Y5TA 5CD5C 4WFGD 1QFPA 3FQTA 1UZ8B 3RKPA 1CZ8H 2EDDA 3UTQB 4NP4L 3SDDD 4JPVH 3T1WA 1R5VA 3GSNH 4QTIL 4NZTH 4EXKA 4R0LA 2ARJQ 2GJZB 2W1NA 5BVJB 3DRQA 2GI7A 2YD3A 1DBKH 5EU3A 3ARPA 4HWZA 1X4XA 5FDYA 4U6VL 4PJFA 4JQXC 4JRXD 1JGLH 3QWQB 1GGCL 4RMTA 3V5HB 2CIIA 1N59B 4HT1H 4YEEA 2Q3AA 2P1YA 3QXTA 4Z76B 3GIVA 3SPVB 2VKWA 5FA4B 2BY3A 5JTWA 5CD5D 4UIMB 1K6QL 4GXVH 5I30L 3D1MC 4Z7WB 2X4SA 5L8KB 1LP9A 2OXHA 2R4SH 3OKLB 3V0AC 2OI9B 3CFKB 1WICA 2FX7L 4BJLA 1XR9B 2N56A 4U33A 1TQBC 1AXTL 5D1QC 3ZKXC 4IRZL 3BQUB 2ENYA 4RIRB 1T6WA 5F7NC 2NXYD 1Y0LB 3ZL4H 2GFBB 3O3AA 5C08A 3FONA 3L3HA 5JXAH 3TP4A 2VDPH 5EU6B 4HDIA 5C0ND 5L2JB 3K0WA 4JFPB 5EOQL 5D7JC 4YDIH 1N64L 3RNKB 1K5NB 3WO4B 3FRUA 3KHOA 1GPOH 3TF7C 1H3GA 1J8HD 1MWAL 3NCYS 5E8NA 1BIHA 2PW1B 2R1YB 4JQIL 1FV1B 1G6RL 5JMOC 1V3JA 2ED7A 3I2CH 2GIYA 1MIEL 2V5YA 1JP5A 1P4IH 5KZCD 2BXYA 1UVQA 1NDGB 1F3DH 3H9HB 1NMBH 4K9EH 3BKJL 5AYUH 2DQTH 5I15H 2XQBL 4ZNCD 5C09D 1U92A 4PJIA 2IADA 4XGZA 2EE9A 3OHXA 3C60C 4PJ9B 4XXCC 3DXAE 3GSUB 2QHRH 5FUZH 2VDQL 3KS0J 4QHUA 5ALCH 4NKQB 3WIFB 1T2XA 4IRJC 3CSYA 4MQXC 2HTKC 3EO1A 3PDGA 2EKJA 2BMKA 4LSUH 4M43H 1A2YA 1UH4A 4ZUTB 2XOTA 3HRZB 3BZEA 3D85A 2R8SL 2FHCA 4ZFFB 1AQDB 1WFUA 4WW2C 1RZFL 4FQ2L 3JV6B 4P5TC 2APTA 4OLUH 3LEYL 3O6LL 3BPNC 5FM4A 3BOVA 2CLVA 5F88A 3CMGA 4JN2A 4TTDC 3O3EB 1HN1A 2C26A 1I9JH 1EJOH 4QO1A 3VGBA 2GJ6D 2BFVH 4IRJD 4YK4C 1FHGA 4Z7UE 4Y5VB 1WSST 3GZKA 4H20H 4PJAF 4X8JA 5DFWH 2XI9A 4F57L 2Y06H 1T1ZA 5D72L 4GRLA 5T1KB 5JA9A 4JO2L 1DP0A 3HE6D 4RZCB 4GRWB 3KAAA 4G8IB 2QR0A 3ARUA 4GMSH 2HFGL 3F8UB 3FB6B 1HINL 3S36L 3GSRA 4QXTA 2BHUA 3BDXA 2F5AH 2H1PH 3VWKA 3WFEH 5IKCA 3ARDA 4HWBL 3U0WH 1F4YL 4FA8A 4UIKH 2R2HB 2FIKB 4HS3A 2WZPD 1GZQB 5FCSH 3DURB 3PWJB 4G7YH 1NSNL 4WY7L 4HULB 1AI1L 4DKFL 2NY3B 4LU5L 1NBVL 1I9EA 3HAEG 3DVNB 1A7RL 4FXLA 4GAYA 5IK3B 3B9VA 1K2DB 5I8OH 2FIRT 5GSRB 4KXZI 1QRNE 3ARBB 2B4CL 2EDTA 2HVJA 1D5MB 2HLAA 4M93B 5IJVA 4R97C 3SKMA 5ACZB 1RZKC 2V2WB 4MNGB 1AP2B 1MUJB 1S8DB 1IAKB 3JBG7 5E7FA 4MJID 5K59F 2J6EA 2R0WL 3HR6A 2G60H 5CJBA 3TVMB 1FNGB 3PDOB 4FP8H 5LKNA 3QZWG 3WHE0 1IEAA 1LE9B 3RWEA 4FQXA 2Z35B 1F11A 1JNLH 3QFJD 4XNQA 4POYA 3PP4L 2OSLA 5DO2D 3PUCA 4GW1A 1AKJA 4PJHB 2WUCH 3LRSA 3DV4A 1AIFB 3UZEA 3BIKA 1I3UA 2R2BB 1G7LA 1KXQE 3DI3B 4X7EC 3WIIL 3EYVB 1G9NH 4KXZH 1DN0B 4PJ8B 4LVNC 2X6MA 3G6JE 3EFFA 1F5WA 4IIQA 4PJGA 1B4JL 1OF2A 4NQSA 1OGAA 5HI3C 4DVBA 1JWSB 3DRQB 2Y9RT 3BP7B 4HUUA 4P9ML 5DK3A 5DJZA 3CX2A 5JLZB 4HPOL 1HQ4B 5IFAH 2J3SA 1QSED 5FECA 5MEQA 4XX1E 4PB9H 3T09A 3U36A 4X4YB 1QBLL 4QRQA 3GSNL 4NZTL 4P49A 4X4XB 2G5BA 1UQSA 2BVOA 1FFPB 1NLBL 1YEGH 2ZOKA 2ZPKH 1F58L 4IMLB 1E4XH 1U8KB 3ILPB 2FZ3A 3QDJE 4WI4A 3CXDL 5FOBA 3O8XA 1FGNH 4YIQA 1NLDH 1RJLA 4OJFH 4WI2A 1QHOA 3QEHA 3V0VA 3V6BR 1GC1L 1QSEE 4K94L 1H3TA 5CGTA 4P59L 4K3EL 3DO7B 1VENA 1MAMH 4JFDA 5EZLB 4LLQA 3EUUA 4LPWA 5IB5A 2W0FB 4Z7VE 1Z3GH 3BQUD 1XIWB 3SDCD 5HSFA 2C3HA 3DVIA 1MJJA 1P7QB 2XN9D 2P5EB 4HUXB 1F8TH 4F2MA 4FFZL 1MCFA 2FLBT 3BXNA 5DMYA 1KEGH 1MCWW 3G5ZA 4OZ4B 3PWPE 2P7TA 3C8KB 3TJEH 1A7NH 3BIBX 1JWMA 3HZKA 1BBJB 5BW7C 3QNZB 5CD3B 1XT5A 4M02A 1MY5A 2FEEI 3H3KA 5EB9A 4NQVA 2MFNA 3NN8B 2XNAB 2PYEE 4M6NL 2R0KL 4AG4H 3WNPA 3RVTC 3QXAA 3ZLQC 1FH5L 1G0DA 5GRXG 1CDCA 5C0AD 3MLVH 4EUPA 3QI9C 2CRYA 3PNWA 4N0CC 3BRFA 4GRWF 1ZVSB 5CJOL 1DQMH 1KTKE 1B0RA 4BA8A 4B41A 5C8JA 1ZA6A 4D8PA 1KBGL 2ITDB 5GGUB 2FEDC 2XQBH 4ODBD 3RZCA 2UZYB 3FB7B 1I1AD 4XVTH 3VGAB 4CADB 3ARXA 2EKSA 3HZMB 3P77A 4WVRA 3VFWA 3DUHA 1KXTB 1IM9A 1CF8H 1BQHB 4HDIB 1F6AB 5DQ9B 3HPJB 1W72B 5GGTL 2AABL 4HKZB 4NM8H 4G7VH 1FYTE 3U0TB 5EBMA 1YZZA 3QHZL 2PYEB 1FO0H 1K85A 4GRWH 2HVJB 1HWHB 1D5MA 2YC1A 2BSSA 2EYTB 3M45A 5I76A 1YEFL 1RZJH 5GGRB 3QUYA 1DBJL 1R3LA 3OX8B 4HKJA 4NHCH 1MCNA 5DGRA 4XC3H 4PJFB 4ZYKB 5GGVH 3ARFD 3CU7A 5BS0E 1A1NA 4L3ED 4AH2B 3FONB 5HY9A 4JLRB 3CH1A 1CL7H 1M6OA 4GBXD 1EDQA 5DYOB 1R6VA 2R23B 4PGCB 3HI1A 1D5IH 4RMWA 2EDBA 4X0KB 3MUJA 2ZCLH 2XTJD 5GSVB 4OIIH 3VDBA 4LRNH 2MHAB 4XXDA 2WSKA 3VWKB 3L6FA 4OBSA 2C1OA 1GIGL 1YEKH 3DYMA 1KB5H 4GO6B 1RZGA 3QFDA 4ZUWB 2JJWA 3U46B 3INUH 5IG7A 3QG6B 1FZMA 1MI5D 3SCMC 1TDQA 3DMMB 5DQJB 1OAQL 4GMSL 1I3GH 1GSMA 1T7WA 3W9DA 5IK3A 2QL1A 5FA4A 1E28B 4BFIA 5CUSH 1RQ5A 4LL9A 5KVEL 4FXKA 2EDQA 4MD5B 5EUOF 2NZ9D 2ZUYA 3FKUS 5GS0L 1UH3A 2QTEA 4JZJB 1D9KA 4G80A 1P9MA 5DR5H 3I6GB 3RTQC 2XA8H 4MNGE 4O4YH 4LAQL 5FYJE 1KJMA 1MJUL 1NCBH 4KKCD 5F96H 3SDXB 1FFNA 3DXAD 2LU4A 4P2RA 4LSVH 1XAUA 1XGUA 4KV5F 4U6HB 5GRJL 4YIQB 4JY4B 4NBYB 3SCMD 3IU3B 5I16B 1YJDH 2C4XA 2DM7A 3QEHB 3O3EA 3LZFH 2GUOB 1AH1A 4XBGB 3M17B 1BOGA 2ZG2A 2AJ3A 1KIRB 1MFBH 1WTLA 4D0DB 5HHMD 2IBGA 2R39A 3EGSB 1T22A 3U4BL 4QHKJ 3U79A 2HH0H 5E94A 5T3XD 3VXSB 1AQDA 2LAGB 3CH8A 5EU5B 5CEZH 1CG9B 3Q0HA 4HUMB 3PQYB 3I75A 4LDOB 4ONFH 1IGCH 4ZTPH 3QQ3B 4G6KH 4X6EB 1YYLH 5TH2B 3ZE1F 4LQFH 4PJGB 1OD9A 3NCEB 2D7TH 4UT9L 3MNVB 5CKAA 3DX9A 2HT3D 3WEXB 1DDHA 4D9RD 5IB2B 5IHUL 5E1HB 3VFNB 4HZLB 3GUTB 2AEWA 1N6QL 2WWMC 3OJMB 1BZ7A 5ICXA 4F8TA 1KN2L 2A0LD 1DLFL 3ZE2E 2EE3A 2NY2B 1A8JH 3BP5A 2P5ED 1AR1C 2I9LA 5CMAA 4Z7UB 3BT2H 2JJVA 3FO1A 5AD0A 1KCLA 1XIWD 1G7JA 4KU1A 4GAYB 5CJXC 4BSJA 1I7RA 1IEAB 4PUBL 2YN5A 1EEZA 3AY4C 5K59E 3IVKB 1Z6JT 4P9HL 4ESKA 5ID0A 2MWCA 3HTLX 2B8OT 2UYLA 3HLAA 4A6YB 2A38A 3C8HA 3P3YA 4NZRH 5EU4A 1J1XH 1LEKA 1OP5K 3Q5YA 4PJFF 1G7LB 3RAJH 1JK8B 3VE0A 1PLGL 3QEUA 3RVVD 5EZJB 1OGAD 3QIUD 2ERJB 5CZVL 3K4AA 4G6ML 4R7NB 3U7AA 4G42B 1JTOA 1AR1D 4JDTL 1P84K 4UTBH 1DUZA 1S78C 4LSPL 1PZ5B 4YWGH 3EYQD 5DUPL 4LHQB 3CSPA 3IJSB 1K8DA 5TQ0H 2NTFB 5JORA 4JPIB 3MRHA 4PRHA 4XP5H 2MQCA 3ROLA 3WJJA 3B9DA 5HVHB 4NQDE 4JM2D 2R4RH 5KS9E 5ALBL 5FYKL 3P9WB 5C0BE 1JUFA 1AP2A 3QIUA 3TYGL 4QTIH 2A6IB 2CH8A 3B2VL 4ONGH 4RFEA 3QHFH 4HV8A 1FAIH 5T5NG 5ERWA 2APVA 4S1QH 4AYFA 4U7SA 5I18H 1NGXB 3ME0A 3CFIC 1GVIA 4NSKA 3F6LA 2AJUL 3ARWA 4HLZG 4YR6A 3BYTA 1H5BA 2NY1D 3N1MC 1OP5H 4LPTA 3A6OA 3SGKC 3RWJA 1EIBA 1OM3L 5IOPA 1V7NH 3V8CA 3K74B 2X05A 3U9UA 3BX7C 3BH8B 3W39B 3K8KA 4QNPE 4YDVA 4GRLC 4OGYH 4G9DA 4JM2F 5TFSH 3HUJA 3N50A 1GZPA 2AV7A 2VTFA 3IDYB 1FVDB 2ESVE 3BN9C 3C6LA 5F7DA 2CDGB 1JF1B 2V17L 5D70L 4G6FB 1NMCC 4YGVA 1PX4A 3I6GA 4PG2C 4JFDB 1HQ4A 4ZYKA 4ZDHA 5DT1L 3FHQA 4OCYL 1DQDL 3QJFA 2YRPA 3WN5B 1A6TA 2VDNL 3N85H 2DQUL 4XNXL 5DFVD 1UWEL 1A6WH 5TE6H 3ULUL 4KV5E 5FUOL 5KSAD 4OQTH 2FZ3B 5FOBB 3FOMA 4GW5B 4NUGL 2MHAA 4BK5A 2AXGB 2RAMA 1U3HA 2E9IA 5EU6A 3B9AA 3ULVC 1QSFB 4U2YA 1A6ZB 1S7WA 1I75A 4XWOD 2NY6C 3EGSA 3S4SB 5C6WH 4KHXH 4QOKE 3RRQA 3SDYL 3PHSA 5JW5B 2IEPA 2H45A 4JFYB 1CGTA 3V0WH 1LK3H 1J10A 1H3WM 3O3BB 5LAXB 4IRJA 4AIOA 1C1EL 5D96C 3DMMA 2FWOB 2DDQH 2OLDA 5J56B 3GHBH 1DSFH 3FB5B 2YD6A 1KB9J 5J1TC 1B2WH 4QYOA 4WGWB 4ZAKD 2F15A 3V7AE 4PJCB 1A4KB 1XCQA 1M7XA 1KENH 1MELA 3P40A 4R4FH 5T1MB 4WEMB 1MNUH 2X4TB 1FYTA 2W0KA 2X4RA 1M4KA 3OSKA 4GQ9L 4LSQL 3ULVD 1KCRH 3BP5B 5LQBH 3Q5OA 3PQYE 4C54A 2YD7A 3C6SA 1MY7A 4YNYA 2YA1A 4LASH 3TGXA 4JRYB 3V7AG 3BKYH 2ICES 4PRIE 4PREA 4KK6C 1KUMA 1W72A 2Q7YB 2RIKA 3HZKB 3WS3A 3VJ6A 5EUKB 3KGRA 4MXVE 5D1XA 2ZOLA 2HN7B 4N0YL 2P8PB 3Q48A 1RI8A 3L6FB 5F96L 4H8WL 2ITDA 5GGUA 3VXSA 2ICWB 3BUYA 3GIZL 1NBZB 1JV5B 2VLJE 4RFOH 1I4FB 3HZVA 1I3RB 2VISA 4XNZC 1JMZA 3CNKA 1EHNA 3S36H 2QQKL 5B38G 1KFAL 4JM2B 4JQVA 4R90L 2VH5H 1NGQH 4YHZL 1NC2B 3N0PB 5BXFA 4HZLA 1B0RB 3SDAA 3ROOA 1LO5B 1IAIL 3MRCB 1KYOK 4X9GA 3U7WL 4LSUL 5DC0A 1SVCP 2JJTA 1HYRC 1RZIA 3NFNA 4YZFE 4BUHA 4N8VA 4MA3A 4XPFL 4NNXA 2DIBA 1EV2E 1MAKA 3WUWB 1N64H 1N4XH 5F7HA 5GS1B 4XBEH 3U48A 1W72H 2CDFA 2A1WL 4OCLC 2D7QA 5JDJA 5E8DL 3KDMB 1AGBA 4OCXH 5C0DA 1FL3A 4Q9QH 4L3CA 4WU7A 2I07B 2H8PA 3UC0L 3GJFB 2VO5A 4Y4FC 1HYSD 1Q0XH 1T1ZB 4NO2A 5D4QA 4ENED 3HZYA 4F9PA 1OSPH 3TO2A 3EDDA 1H5BB 3GSXA 4JY5H 3UBXB 2XZCH 3RDTA 5IV2A 1VKXA 1Z9LA 3LPFA 3SGEH 1A6AA 4L4TD 5J6GB 1HQRA 3RA7H 5F9JB 4M8QA 5EWIL 1IFHL 1P7KB 5FM8A 5SWSA 1IAII 5EU5A 3GMOB 3ZDYE 5T1LB 1CGVA 1R3IL 3LKRB 2H9GA 3AU1B 5I1IL 4J8RB 2PCPB 5DZNA 1KV3A 1K8DB 1FNSL 3VMPA 1J88A 3Q5TA 4XBGA 2Y36L 3D3VD 4WWKC 3RAJL 1Z0MA 1FFQA 3NA4A 5FIEA 4CVZB 2ESVA 4JZOA 5TGBA 4PG9A 1A3LH 2PR4L 2ARJB 3GSQB 1JUFB 1P69B 2F5AL 2H1PL 5EO0A 3LV3A 3SGKA 3LSOA 1MEXL 1T3FB 4XRCB 4OLYH 2CJUL 2H2PD 2XN9A 3NA9H 4TSAL 4LBEB 2XFXB 2F53B 2P8LB 3TZVC 4YBHA 5TQ0L 2R2BA 4C56E 3NPSB 4Y5YB 5CLWA 2RR3A 4AENB 4XWGL 5I1DB 5E00B 4FXGB 4RGMC 4O2EA 4MD5A 1B6UA 2HFFB 2X1OA 5ID0B 3TZVA 1KJ3H 5JHDA 4NQCA 4Y8AA 5JNYA 5BRZD 3W82A 5SWZB 2Y06L 4F7EA 2BNQA 3SKOB 4TSBL 5IBUG 1FGNL 5IFJA 4M93C 3UYOD 4WHTA 3HC4H 5HHNA 5E8NB 4HJJH 3RFZC 1YNLH 4GAJL 2CKBL 1TJGL 5SX4H