1WZ1H

Crystal structure of the fv fragment complexed with dansyl-lysine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHATYYAESVKGRFTISRDDSKRRVYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVSAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational dynamics of complementarity-determining region H3 of an anti-dansyl Fv fragment in the presence of its hapten
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Ig light chain
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2005-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wz1H00
1JGEB 1LWRA 2F5AL 4PJGE 5E6IC 3VCLB 1I1YA 2RHEA 3FFCE 4RZCB 4FQXB 5JNYA 2PO6D 1NGZB 3PL6C 1BWMA 1S5HB 3VDAA 1LK3L 3HA0A 1K8DB 4GXUM 1FIEA 3FT4B 4MNGE 1XGRB 5IOPA 4ZSOB 1Q0XH 1N5YL 1OSZB 1F5WA 3D69B 4ERSH 3FKUS 4BQCA 3ZDYE 1ADQH 3SJVA 2AJUH 3EOAB 4M1DH 1OTUD 1FFNB 2AV7B 2Y07H 3RIFK 2NW3B 3TH4T 4O00A 3ZYZA 4S1DD 4UUJB 2P5WB 3IAPA 3QXWA 4PGZA 3DIFB 4N0YH 4GRWH 3QIWA 1M6OA 3P9LB 4HS3A 3TESA 4NN5C 1D3CA 3QWQB 1QR1A 4M1CC 4QXUH 2KQMA 3BXNB 4NYLB 3BWAB 3ARBD 3VXMA 2OSLB 1B4JL 1D5MA 2XZAH 4OZHB 5DUMH 3RAJH 4JQXC 3KWWA 2VDPL 5D2LA 5TDOA 3GMLA 3B9DA 2BVQA 3U7WL 1AD0B 4M5YH 1VGKA 2DIBA 2FECL 1KCUL 3DMMD 3MLYH 3VXPB 1Y6KR 4O51A 1A7NH 4JAMA 1TVDA 3HPLB 1P7HL 1ZEAH 3N50A 1FIGL 3NGBB 3UJJL 1JFQL 5DDHA 4LU5L 3KPMB 3E6HA 3D18B 3DRQA 4GMSL 3W2DH 4YPGA 4M6MH 5DEGB 1MAMH 2X70A 1FV1B 2UYLB 4YHLH 4Z0XA 1Z5LA 4XBPA 4JN2B 4JQVA 2GK0A 4JDVA 2H26B 5FKAA 5A16B 2FECI 1AP2A 3NFSH 1H15A 3ARGC 1JGLL 4JZOB 3RWFB 2UWEA 4AEHH 1KYOK 5GGQH 4XNYH 2X4QB 1JNLL 4N0UB 3WIHA 1EHNA 1JPFA 3O9WB 5EU6B 1S9WB 2RCSL 3OZ9L 4MA7H 1GGBL 4CN1A 1S7UA 2YRPA 2P5WE 2ZPKL 3OR7B 4R26L 2D3VA 5SWZB 5IT2L 2ZPKH 5CUSH 2IANE 2D4DA 5F1NB 5KN5B 1HE7A 3GBMH 2DF3A 4P49A 4X7EC 3PDGA 4MLIA 4XVSH 1JNNH 3HR5B 5LQBH 1BVLB 1QRKA 3FQXA 4IRJA 3CVIL 1IGFL 1KJ2B 3TCLA 3K1KC 2AW2A 1GAFH 3C5ZB 3WUWG 3IJYB 1KCRL 4DZ8A 3MUZ1 4YLQT 1BAFH 3HAEH 4L3ED 1DQLH 1GC1C 3BN3B 1T1ZA 1V5JA 5T1KA 1F4YH 1NFIB 1TJHL 2O26U 3D2UA 3O6LH 1OAYL 3F8UB 1IE5A 3TT1H 2YKLH 1KXTB 3VRJB 3V4PH 3V5HA 2WV3A 4X9HA 4NT6B 4G7VH 4GAYA 4ZXBC 1MCWM 2NY6C 5HI3C 4KXZI 4HT1L 4JR9L 1U9KA 2N7AA 1NC4B 2HRLA 4ZFGL 4RGOL 4XH2B 4U6XB 5JW4M 2VLME 2P5WA 4PJFE 5FK9A 2V2XA 1EHLH 1CXFA 2PO6C 3DRTB 5D1ZA 4LASH 1F90H 4JFFD 1YDPA 4X4MA 2NCMA 1KN4H 4FOMA 3QJFB 1K8IB 3RGVD 4EN3C 4NO2B 1ADQL 1T83C 4YBQD 2IAMD 4YXHL 3VJ6B 4GW5B 3DI2B 1EMTH 1MJUL 4JFHE 3W0WE 1GL4B 1KEML 3FN3A 2FH6A 3VXPA 4U1MB 1A02N 1C5DA 3KPNB 4HJJL 4R3SB 4Y1AB 3V52L 2J4WH 1QSFD 1FBIL 3H42L 5EOQL 5GRVL 4JB9L 5D7JB 2D9CA 1BQHB 4NKOA 4XPTL 5I8EB 4H88L 5IROA 2IBGA 3PWPB 1MJJA 3LV3A 1JYWA 4OAWA 5EO1B 3PP4L 4Z0XB 3VXTA 4WY7L 4Z0BH 2EH7H 1CLYL 1G7HB 4TSCH 3VFWB 4O02L 1H8OA 3FONA 5ACLA 3UYPA 2DQHH 1QKZL 1PFCA 3QI9D 4B5EA 5ID1B 2EEBA 3NFNA 5DWUL 4L9LB 1F2XK 1S9KC 3CX2A 4H8WC 1GC1H 1WITA 3ZT5A 5SWQA 3BFOA 4P2YA 4HXBH 5FO8A 1JHKL 3L3KA 3PG2A 3SGKC 3FB8A 3PXHA 3S36H 4RISL 4L5FL 4X99B 5GRXG 4MJ2A 1EA9C 3IFNH 1GCFA 4HQQL 1MFCH 2A9NL 4M6OL 2OL3B 5DZLA 4TNWF 4HULB 2DQJL 3UDWA 4I9WD 4HUMB 4EEEA 2BVYA 1AQKL 1BQLL 1YYLH 3NMEA 4MDIA 3V0WL 3FO9A 1HHGA 1DBML 5GJTH 1F8TH 3E6FA 1CFNB 2UYLA 3L7FB 1KFAH 4J3UA 2OP4H 4XAKD 4YZFF 5C0EA 5JO5A 5TE4L 3SE4C 4UU9A 4X9GA 4L3EB 2XTJC 4X80H 1FL5B 1UQSB 4PJ9D 1OOAA 4R96B 2BSED 5C07A 3RGHA 4L3AA 3P4MB 1CICA 3CIQA 1RJLB 5GIRA 5C8JB 5D1XC 4BZ2H 1IGIL 4JFEB 3BZFA 4E41D 4JAMB 3I6LE 3SDAD 1IBGH 4DK6A 4GKNB 4JRWA 3STZB 4AIZB 5HHXL 4P3CH 5T3XE 4NGHH 1XF4B 2AJVL 3G6JE 4Y16B 4JQIL 3DVNA 3TH2T 1P4LB 3G5YA 4MWFB 5F9AC 3UX9B 2KH2B 3QULA 1AXSB 4M7ZB 1FJ1A 4BSJA 4GT7A 2VDQH 4N0RA 4C4KO 4P2QB 1HQRB 4NKQB 3CMOH 1E4XH 2MQ3A 3MCKA 4JKKA 4QCIB 1RURL 3MNVA 5E9DB 1AE6L 4NQCD 4D94A 5I30H 1JV5B 2DQFA 3PHQB 1JHLL 2QADC 4WDIB 2CK0H 3X13A 1E0OB 3IDGA 4RGMB 4FQPA 3OG4B 1QLEL 4ZUWA 5DUPH 5L9DL 4UQ2B 2AEIT 5TPWH 2XXMB 1RUAH 1B3JA 1YDPB 4LCWD 4NZUH 5DVNA 3RDTD 2H26A 2UZYB 4UBDD 1IFHL 1B2WH 3GEWB 3QG7H 3BXNA 5I30L 5DT1L 2MQCA 3HUJF 3F7YB 3PWPE 4QYOB 1NDGB 1FCCA 5CP7B 4Z7NF 4ODVL 2WBJA 4BK4A 1TNNA 2L7JA 3I50H 1MRCH 4KHXL 4NZJA 3JWDL 2OTUA 5DJ6B 3F62A 3GMRA 1U8MB 4P3CL 4Y1AE 4PJ5B 3QCVL 4LLVB 3K46A 4QRUB 3UBXG 3K4AA 3HPLA 3FT2A 1S7SB 3BD4A 3Q5OA 3ZO0A 5JIIA 4BZ2L 4Y5VA 2H45A 1AY1H 3Q5YA 2YD6A 5T33H 3STLA 2XICA 2X1QA 4RRPA 4CW1B 1YYML 3W0WB 2BSTB 2NY6D 1QLFB 2ED8A 1JE6A 2NX5A 2DWEA 4JVUA 4Y4HC 4PJEB 4L4TB 3OAZH 4HLJA 4AQOA 1AP2B 1XR9A 2ZSVB 1DQTA 1TTGA 5K9QI 1EO8H 3WV0A 3DRTA 3MRRB 4FA8A 4S1RH 3CFEA 3OJMB 3G5VB 4X7TA 5HDBE 1OARL 3B5GA 3V7AE 5E7BA 2FEDD 4QRSB 2M26A 4YZFE 1CFVH 4JPVL 5GS2H 1KIQB 5E8PB 5DC0A 3G5ZA 2R69H 3MRJB 4PV8B 1OP5K 1LMKA 4UIMA 5KJRH 1ZT4A 4GKOA 4NT6A 2OX5A 5I6XB 1G9MH 1WCBA 5CINL 1VACB 4P4KC 1R3IH 1PY4A 1JGUH 2HA1A 1I7ZB 3KPPA 3TO4B 3MV7D 2Z91A 1QKZH 2XY2A 5H94A 2E7CA 4TSCL 4KZEH 2EDEA 1OLZA 5J9PB 2VITA 3PP4H 1RIUL 1X5XA 3LZFL 1F2QA 1J8HB 1O7SA 1X6LA 4QHLB 3WS3A 5IV2B 2IAMA 3CFIC 1YEIL 3BZEB 5SX4I 4EXPX 2CDGA 1U93B 3G04A 3QCVH 1OP5H 1B0GB 1LNUB 1NH6A 3HI5H 4PRHD 2PCPA 1DANT 5FECB 5LJYH 3ZMRA 2X1PA 1FAIH 2VO5A 1J8KA 5E6IA 3ZYOA 5GS0H 2CGRH 3GNMH 5CEXB 1JNHA 2P4AB 1KG0A 2JLLA 7CGTA 3W9EA 1TPXB 2CQVA 2P5EE 1TLKA 3HE6B 4UV7L 1B6UA 2LQRA 4XXCC 4XPFH 5KANG 3BP7B 3QG7L 2EXWD 5DF0A 4Z7NE 4GS7B 4XXDB 3UPCA 2AGJL 3IFPB 4YFLF 5EORL 3BOVA 1REIA 4KK5C 3ARZA 4UDUA 5IK3B 3LKNB 4K7FB 4N0FA 3OKEA 5GSRB 1UXWA 1XGQB 4P9HL 3HG1E 3UTQA 5GS2D 4BUHA 3VGEA 3O4LD 5DR5L 1KLUA 4F80A 1J05B 4ZMAT 5DZNA 2N7BA 1X3DA 1I8KB 3CVHA 2MQ0A 3U4BL 3P9MA 3ARFC 2J8UF 3KYAA 5DHYA 2X4OB 3P9WB 3RZCB 3EDFA 4J8RB 2IALA 3FFDB 1R24A 4XNZC 4FFWD 1NFDF 2VLRE 3ROLB 5BW7A 3RVUD 3SDDB 1MQKL 1DSFH 2PETA 4HDIA 4HMDA 3DO7B 4XBEL 3WNLA 5DJ6A 4JVWA 1TCRA 4LFHD 4BFGA 5ID1A 3GSNA 1IGCH 5FOBA 4WO4B 5GS1B 2BRQA 4OLUL 4YGVA 1CK0L 4P9MH 2EXYD 4N90E 4J6RL 2VSCA 3QDJD 3D9AL 1G6VK 2R0KH 5C0JB 4L8CA 1QBLL 2OZ4L 2Y72A 1XH3B 3D85B 3OX8B 4P3DA 1S3KL 1EFQA 4IMLA 1F6AA 1Q9KA 1HWGB 4QEGA 2FYYA 5DRXA 1X5KA 4OT1L 4ZUWB 4RMUA 5I2IB 2UZIL 5DMJB 4WDIA 4KMTH 1K3IA 1JRHI 3MMEA 4HUUA 1ETZA 5MEPB 4ZNEA 4HSQA 3ILPA 3QWOA 5CAYB 4MVBD 1F97A 5F9DC 4CJ1A 1J9CT 2VZSA 1FGNH 32C2B 2OK0H 4MXWL 4LLUA 5JXEC 5A2IH 5EZJA 1IM3B 3QNZB 2Y9RT 3OTTA 4B50A 2BHYA 4X8JA 1DUYB 1A7PL 1P1ZA 3FQWA 1S5IH 3BZFB 4CGTA 3BP5B 2Z8WC 4Y19B 5IQ7L 3NACH 1Y0LB 5GS0C 4LHUA 2PTTA 4TNVF 4JFOA 3KPQB 3LQZA 3QISA 1JRHL 3VD7A 3MV8A 1BGXL 1LE9B 1KULA 5HY9A 5IQ9A 4PRIE 1S9YA 2Q8BH 3X12B 2WUBH 1IC5L 3BH8B 5EU5A 2Y4SA 3STLB 3NZHH 4B53A 1KF9B 4HFWB 4WEBL 1WQVT 5L2KB 2EO1A 4DK3A 3GRWL 1NMCB 5EC2A 4G7YL 4F8TA 4OIIL 4QTHA 1U3HB 4XHJC 3PGFH 5J12C 5FHBH 5JMRA 3GMOB 3TC9A 4URTB 4G6ML 1QFHA 2HG5A 4LRIA 4D0BA 4QHMB 4PJ9B 4KROC 5HGDB 4OCMC 4DKFL 5I1KL 3F7PC 3C2AH 2JCCF 3V7MA 5GIRB 2VERN 5F7YC 3U2SB 2R2CA 1A1OB 4JN1L 2VE6A 2E6QA 3V5DA 3WFEH 4LPVA 5I76B 1EK3A 1RZKL 3QAZC 1J18A 4OD2B 3MBEA 5C09A 1CDHA 1A5FL 3BPOB 1IILE 1ZLVK 5HYFA 3OHXA 4L3CB 3VXRA 4EDWH 2KQNA 4UILH 4KJYB 4RGOH 4ZUSA 1BF8A 2H8PA 2VITB 5DJXB 4CBPA 4XPHL 3V6ZA 4JR9H 3TPKA 5D96B 2QQLH 4NPYA 3QR2A 2AXFB 4IRJC 2FO4A 4KGJA 4ESKA 4BZYA 4POZD 3VXQA 1MI5D 4PRPA 4JFDA 3E3QC 1I1AC 3P0YL 4N0YL 1NAMA 4Q0XH 4QRTB 1I9IL 4LSTL 4LLYB 3WXWL 3QUMA 5C0AA 3KYOB 3QA3B 5D1ZC 3HG1A 3I6KA 2AEPH 3MNZA 3O3EB 1CGYA 1OAYH 2BXZA 1Q1JL 5MHSE 3GMRB 3MFGB 1PEWA 3OSKA 4P23C 5C07B 4X6DE 5F6IB 4YHIB 1MNUH 4LVOC 4K71B 3LS4L 1ZXQA 1EEYB 3JZ7A 1LK3H 2IFFL 4V1DE 5ISZA 3RWJB 1KG0B 1BX2A 1DEEB 1FFNA 2E7BA 3HE6C 3QHZH 5FUOL 2C3GA 5BXFA 4C56A 4S2SB 2IPUK 4XP9H 4ZODA 1GAFL 3T65A 5FYKU 1MF2L 1YECH 3M45A 4MQXC 4ISVA 1A6WL 1QSEA 3KJ4C 1T6WA 2IAMB 3DVGB 4QRRA 1N5AB 1PGRB 4D9RE 5HI5C 1JZ8A 4KKAD 3IVKB 4NQDD 4QRPB 3T0BA 1J10A 1B88A 3BW9B 3DTXB 43CAB 1YNLL 1L9NA 4QY8B 1FNFA 5FOBB 1LVEA 3KPSE 3UTTA 1VACA 3TBWA 1I1RA 5AEAA 3MRQB 2YMXH 3LRHA 3T1WA 1CGXA 4F33A 3HAEB 4UT7H 2X4SB 2WAHA 4E5XA 3TYFA 5EU3A 3MRJA 3QH3A 4NO5A 3T3MF 4DGVL 2HLFC 3NFSL 5IEKB 3FT4A 2VAAA 2P44B 4HKJA 3TO2A 4TQEH 2IEPA 1H8NA 3LB6C 2BRRL 1ZGLA 1X9QA 3N1PC 3SGKA 4YHLL 2BNQD 1R3HB 5JUEL 5F9WB 4JFFB 2AERT 1LK2B 5DK0B 3T3PE 2YPLE 5EU5B 3MXVH 1OLLA 2ZSVA 2HVKA 3DVFA 3CFJA 1FL6B 1TZGL 4MJ6B 2NTSP 3JBG7 3SE4A 4P2OA 2P8MA 3TNNB 4Y2DC 4PRAA 1KJVB 1HHHB 1W0WA 5AYUH 4ONFH 2K1MA 5D70H 1OGAB 1AD9A 4DKAA 1KNOB 4MMXC 4XCNB 2YWZA 5AYQA 2F54E 3T09A 3VE0B 4X7DC 3RTQC 3QQNA 5EULV 1UM5H 2Y6SC 1B4JH 3OB8A 4WWKB 3IS1X 4U6TA 3P4OB 4I0PB 5C7XH 3P4NA 2EKSA 5I74B 3WN5B 1KJ2A 4PJ8B 3ET9F 4GMTL 4XPBH 1DBKH 1ROWA 2GK0B 3RUGF 4PRHA 2X4OA 3NCBB 1D9KB 1CGUA 5H94B 3TBSA 3F58L 3VG9C 2R0ZH 1U8QB 4XC1H 3ABZA 2YUVA 5IMOB 3MRLB 2HFFA 5EORH 1SJXA 5FFLA 4ERSL 5EZLA 2NY2C 2B4CL 4OFVA 5EUOB 3LPGA 3DUHA 1G1YA 1PKOA 4ONHB 1EVTC 1CGVA 3L5WB 4R2GB 12E8L 5C0GB 1QFOA 2EYSB 5GS0L 2DMKA 3MJGX 4XWGL 4TULL 2A9MH 3L3DB 1GOFA 1HXYA 1UH4A 5HY9B 2E9BA 4Y19E 4HPYH 2P8PB 1HHIA 2XIDA 1Y18B 2R0WL 3D85D 4WEUD 2DTMH 4LF3A 3FQRA 4WHCA 4AMKL 3PHOB 2IGFH 3WBDA 3F7VB 2CRZA 3GM0A 3CH1B 3PV6B 2ENYA 2B2XL 2HFEB 3CSYB 5E5MA 4X5XB 1IGMH 3FHAA 3FCTA 1FGVL 4MX7B 3VFSA 5F7UA 4JFPA 4DCQA 4WU7A 1DBAL 3MRCA 3NIFF 1JPTL 3VFRB 3QI9C 5E9DE 4NJ9H 3VFUA 4IRZH 1Y6MR 4F7EA 1R5WA 4JFDB 4ALAL 4TRPH 4NO0D 2P24A 4N0UA 1NKRA 1U2CA 2NY5H 1NUFA 4FN0A 4EDXB 3D39B 5IMKB 5TDOB 1U8LA 4PJIF 2HKHL 1UXSB 2I60L 2X1OA 4K55A 4M02A 5IFHH 3G6JB 3HC3L 3WHE0 2JJTC 4WEMB 1C7SA 2MSPA 2AS5M 3F5WA 1GHFL 1ZWIA 5ACZB 5IBTL 3HMXA 5DJCB 1RUPH 3O2WH 3DMMB 1WAAE 5DMGD 1CCZA 3RWJA 3B6SA 3IDXH 3ECBA 4RAVB 3B9KB 3FQNB 3FFCA 2VAAB 3PV7A 3T0ED 1SMAA 2YC1A 2NY3B 1MJJB 3RWIA 5JDJA 3CJJA 2LABA 3BN9D 3C5ZD 4Y2OA 2WINB 3S5LA 4NM8H 1BQHA 2OQJA 3KYOA 3QA3A 4HKXA 1GPOH 3OXRB 3I02A 2AV1A 4KKAC 3T4YA 3OPZH 1LO4L 25C8H 4HWZB 3VH8B 2EDRA 2D2OA 1XGUB 5DUBA 3BKJH 3C60B 4MMZC 4OCYH 4UOW1 1DLHB 1U95B 1U8HB 2MCPL 1MUJA 2ERJC 2V7HA 4ODUB 1CICB 2O5XH 4WGWB 4H25A 5JW4R 3SHSA 2JB6A 2MJWA 4I0PA 2W0LA 1NBVH 3ZKQD 5D2NB 1OCWH 1MHEA 5GGVL 4TNWK 5I76A 1IAKB 2J8OA 3MRMA 4AJ0A 2BSRB 3SDXB 1S7WB 2CK0L 2VXVL 2A6JB 1U8PA 2ZKHL 3K0WA 2EKSB 2Z35B 2NY1B 4EI5A 4LSVL 3H9SB 4LCYB 1N64L 8CGTA 5FF6A 1JMXA 2OJZH 4XH2A 1AO7D 4YHOL 3IU4H 3ULVH 2PKDA 4HWBA 1YPZB 5D6DA 4E42B 2I9LB 2FWOB 1TVBA 1IM9A 3QDGB 4I5BA 3C6LA 2YHGA 5H37H 4QO1A 4S0SD 3SPVA 5IW3A 1U92A 2R8SL 1A1MA 5C0AD 1WTGT 3O3BA 1CR9H 4MZ3A 1J0IA 5EU6A 4WJ5B 3V7AG 4Y4KD 1CQYA 5H2BA 4PD4J 4XRCB 3IFOB 4CMHC 2WIIB 2DTSA 1UZ8B 4Z18A 4XXCA 5DJ0B 5F7EL 3CK0H 3QDJB 2F74B 3B9KD 3JWOH 4TUKL 2JJUA 5F1OB 5TE4H 1ZVSA 4LF3B 5IVOA 1CIDA 1FNEB 1HI6A 2YD3A 3BSZL 5DJYA 3CC5B 1WFUA 4QRUA 3ZYIA 5AZEH 3ILQC 1F42A 4TN9A 4BH7B 1MRDL 4CJ0A 1CL7I 4LLWA 1W8NA 2DQJH 3TBTB 2A9NH 4M6OH 1D9KC 2L4OA 1HSBB 3VG9B 1YEHL 4JFXB 2ESVD 4HGKC 4I3GA 5GRYA 4ONHA 1BM3H 2HH0L 3I3EA 3P11H 2A77L 4NN7C 3VGAB 1LE5B 1OAQH 5EBWA 1Y6NR 5BW7C 2ATKB 2DS4A 2PW1A 1MHHA 4YHNA 5CLWA 1AHWB 1EFXD 3ZKXC 1A3RL 4L9DA 2GSIA 4LAQL 1QFWI 3IKKA 2ORBH 4YDLC 3BKYH 1X5JA 3BP4B 4FXGA 4WUUD 1FSKC 2L7UA 3X3GL 4WY7H 4YHYB 1IEAA 1U36A 1IGJB 1YNTB 2FO1A 1L0XA 4Y4KB 4M3JA 2VXTH 3QUML 5LGJB 1OAQL 4J4PC 4H88H 2Q3ZA 5LCVL 4G43A 3C5JB 3WIIL 3HTLX 4MLSA 5FYLE 3GRWA 1QYGH 4PRBA 3SE9L 1UEMA 3QDGD 4NO0B 5JZ7C 2R2BB 5DK2A 2H9GA 1J8HD 1M1SA 3SKUD 4JANA 3FHQA 2YA1A 3SDXE 5KS9F 4NC2B 1OGAA 1P9MC 1SY6A 4QXTB 4HXAL 3ARGA 2IC2A 3SDCD 1MCOL 2XRAH 3JV6A 5HYEA 3K4ZA 1ZKAA 4Z8FL 1WEJH 5ICXB 3LD8C 4HWEH 1CTNA 1MEXH 3Q6FA 4HWNA 3FB5B 3SCMB 1K2DB 4UNVA 3IDYB 4HD9A 1U8HA 2K3TA 4NZRH 1BBJB 5DEZA 1T21A 5SWSE 3D25B 3EJZC 4X9FA 3MRIA 3DHMA 5ERWB 3TCXA 4DAGL 1DQQA 5E1AB 1TFHA 4KK8D 3MA7B 3WN5A 4M93B 3MLVH 5T1MA 1RZGA 3B9KC 2CIIA 4MAYC 2ARWA 3DO3A 3NVQA 3LRSB 3EYVA 2BVOB 3N0PB 2EXYC 1CTOA 5MENB 3RWIB 4TVPL 3ARTA 4G7VL 4JM2A 5I8OH 2X9XA 2V17L 5A2JH 1WFNA 1G7IA 3QIUB 4I4WB 2VRAA 5J3HC 4K94C 1F58L 3MNWB 4ONOA 1WBZA 3PWJB 4LRIC 3KPRB 3O6LL 4LDLB 3CGTA 4V2CB 1IJ9A 5TQ2L 5MENE 3PWPD 2BY3A 3C60C 4U3XA 3FMGL 5HPMA 3WIIH 3UPAA 4OZIE 2OJEB 1IC7H 2Q86A 3GMLB 3O4OB 5LXGH 5MERA 3WDJA 3DBXA 4L8SA 4PJDA 1RHHB 4IIQB 4PGDB 4L8SC 1MIEH 2YOCA 3SY0B 3BKYL 5DS8A 1LO4H 5HVGB 5IVXF 2FR4B 3OXSA 3GFUA 3VFSB 4R90H 5M7QA 5C0BB 3LKRB 3FB7B 1A2YA 4FQHA 4ETQB 2HFEA 2A77H 4NN5B 3FOMB 1HCFX 2MMXA 4LCYA 1UJ3B 2BJML 4UV4L 1TZIB 3ULUF 1CBVL 2YBRA 1CE6B 4OQTL 2D4FA 5FDWA 2GKIA 1T3FA 2QSTA 1KV3A 3HMXL 3VH8A 1OPGH 4I3SH 4K9EH 4PP2B 3IJSA 1RU9H 3PWUB 4YBHA 1A4JB 2J88L 2QSCL 2VWEE 4LHUG 5IFHL 4KKLC 4FFWC 5F72S 2BNRA 5EUOE 5GSRA 3WFCH 1ZA6A 1OT2A 2YC1B 2G75B 3ARFD 4YK4B 5F7EH 2YXMA 5HHNA 4JDTH 1XMWA 5I1LB 1OY3B 1FZKA 2GT9B 4M6ML 4NQVB 5EDXA 4HG4J 4GG8A 1F6AB 4IRSA 2G2RB 4OFPA 1XGTB 4W81A 4OZGF 1IGML 4XP5L 4XC3H 4QT5B 2P46B 5K59E 2FB4L 2N1KA 2H9GB 4HIHA 5C9JB 2A74B 4FP8L 1FN4B 4PJFF 1KB9J 2DLHA 2LV4A 3IT8D 2VABB 3PUCA 3OAUH 2WWMC 4HPYL 3BX7C 4Z78B 5D93C 2W9DL 2GY5A 5LGKA 3VFVA 1Z3GH 2A9ML 5IBLD 1FYTA 3K3QA 2PXYC 1OGAE 3G6JF 4MQ7B 1OSPL 5KSAC 5EOTB 3TWCH 3MX0A 3LPFA 5DJ0A 4NSKA 4XXDA 2LFGA 1K4CB 2WUCH 2CUMA 5F6HJ 4Y4KC 4JPWL 1ZHLA 5E00B 1UXWB 1XGQA 4X5WA 1RI8A 1IEBA 2OMBA 4ONGL 2XZCH 1MOEA 3QHFL 3MYJA 2H2SC 3ZTNH 1LD9A 2W1NA 2VR4A 1NCCL 4DFHA 3C6LB 3WKMH 1CE1H 4NO3A 4NQSB 3G9VA 4OM0L 4OM1H 5HGBA 5I18H 3ARBA 3VXMD 3N1FC 5BVPH 1JPFB 2FJHB 3O45A 3SDYH 1AO7A 2E9WA 4WRLA 2UWEE 2P42B 4LSUL 3O6FD 5GGRB 3HUJE 3MV01 5HYQA 4JFYB 1AIFB 2ZP0T 3GSVA 3RUGE 1BPVA 4MA3B 3GO1H 1OHQA 3NABL 4LBEB 4XAKE 3BP4A 2UV3A 5DXWA 1MREL 4WI8A 2IBZY 2BVQB 5EIIB 4UT6L 1DQMH 1S5HA 5HJ3B 5ABDE 3QUYA 1HYSD 4AH2A 3BEVB 4ZS6C 1A14L 4FMFA 2XKUA 5M95B 4HUWA 3CLFL 3DETD 4CKVX 2AEWA 1T2JA 5DDHB 2XOTA 3RGVB 2X9YA 1MVFA 3MLRH 3SDXF 5HPOA 4QXGH 4Y5XB 4Y5VC 2NY5L 5DSCB 4JFXA 2CDEB 5D1XD 1KGCE 1P53A 3UPRA 3CFKA 4O2EB 1M6OB 4W6WB 4XX1G 2EIDA 5TDPA 4NQDB 4ORZC 4NJ9L 4FXLA 3UTSE 1HYSC 1FPTL 1D5XB 2NZ9C 3O3AB 1ZLUK 4YC2B 2AJ3B 3MCG1 1U6AH 4G42A 1R3JA 1KGCD 1V7NL 2GITB 4Q9RL 2PYED 5HGDA 3V4VH 4PJCB 2HG5B 4R6UA 5FYJU 2VXUH 3QSKB 4QLRA 2VDKL 2VIRB 3ZKND 1QFWM 5H2BB 2QTEA 2Q6WB 1FNGB 3S4SB 4S1SL 4PJHB 5BOPA 1VGEH 1T7YA 3KLHC 4Q6YA 5A2FA 4XZUA 2H6PB 1YNLH 4L8SB 2HWZL 4J3VA 4O58L 1T04A 4UV4H 1CBVH 2APTA 4IOSD 2DI7A 3OKMA 4PGEB 3CZFB 2IF7A 2YK1H 5J1TC 4ZXBB 3QIUD 5CBAB 3FN9A 3JUYA 4HCRA 1W72A 4MSWB 4QNPF 2YBRB 2X7LB 4JFDE 2ZUTA 1CZ8H 3QO1A 2HLAB 5ID0B 1HSBA 3FOMA 2FL5B 3PGDB 2X09A 1U91B 3WFBL 1ACYL 4HWBH 4XP9L 1MLBA 4EIGB 1XIWA 4UU9B 2XZCL 3QHFH 5DLML 3SDAC 3FONB 4OGAD 1B0WA 1FN4A 1Z0MA 3LS4H 4NCC2 5IG7B 3FMGH 5K33A 4EI6A 1CS6A 5GSVB 4NBXB 3EYQC 2YXFA 5DZOA 4C56E 1Q1JH 3D69A 5MERB 3V5HB 3STBA 1BBJA 4ZO6A 5EOCJ 4NQVA 1ONQB 4WO4D 3KS0H 2BZDA 4Q6IA 3KPNA 3S98A 2V17H 5BV7C 3L9RB 2VLLA 5BMFH 2NY7H 4QCIA 5HHNB 1G0YR 2HVKB 5JHDA 4FQ2L 4DUVA 43C9A 1YPZF 4PG9A 1WBZB 1JPSH 2BHZA 4RGNE 5E8OB 4ETQA 3X3FH 4JPKL 5HDQL 4WFEE 3ULSB 1P4BH 3DXAA 1PZ5A 1H15B 3ARPA 2F8OA 5D6CA 2DM7A 1TZHB 5D7IB 3H9HB 3UTTE 3VE0A 3WNMA 3BHBB 3B2VH 3GSVB 4M1CD 4X8JB 3WDHA 1N7ML 1CXLA 4OI8A 4L9LC 1LILA 1X7QA 2VAJA 2FX7H 1AJ7L 5I16A 1BD2A 2XRAL 1RZFL 2EC9U 5KSAB 3ETBF 4MQ7A 5F7FA 1V7NH 1C5DB 4HK0B 2HKFL 3AROA 5KG9A 2GTWB 1K5NB 1XCQA 4PRPE 4TSAL 1LK2A 3TPUB 1YC8A 5CJ5A 1ES0A 2NXYB 4N8VG 4LPYA 4OIIH 4RX4D 1B90A 4EI5C 5C6TH 1A6AA 1H8SA 4MXQD 1IRAY 4P2OB 3WL9A 4K7PY 3PWLB 3TV3L 4QT5A 2J88H 5GGSY 3A0OA 1T0MA 4OAWB 1S7VA 2IBBA 3NA9H 5EO1A 2C7UA 1JRHH 5T1KD 4FFZL 4R90L 3QUZC 4N90D 4JFYA 2YSSB 2IH3A 3KPLB 4DWHA 1A6ZA 1J86A 1P6FA 5J11B 3BUTA 2OBGA 4PY7B 2B5IB 2HLFD 4L8DB 4OGXL 3AB0C 1JF1B 4YHMH 4MXWH 5C92A 3GMPB 3VFGH 5IW1A 2SEBB 3RNKB 3AREA 3RU8H 2OL3A 2VZ3A 5I18L 2G5RA 5I1GH 4WI7A 4XAWH 3GUTA 3S35X 4FTVB 3BKML 4J4PA 2YD1A 2DWDB 3U6RA 2GCYB 1T04B 4NWTH 3UTSB 1ZLUH 1VKXB 2AXFA 1D9KA 5IESH 4PJBA 4LSTH 3IETA 2VLKE 4R7DB 5CBEA 3UBXI 3QUZD 5AAWA 4O5LL 3VXUD 4YHZH 4U1LA 4F8QA 4JRYE 1S3KH 3ROOB 1MQ8A 2OZ4H 4JFED 1QBLH 2HN7A 3JWOL 4XNMB 5T1LA 3CK0L 4P46B 4QYOA 3K2MC 3Q5TA 3QQ4B 3OR6A 5IB2B 2VUYA 4OLUH 2WANA 4EDWL 4C59B 4EJ1C 1Y18A 4OGZA 5CEZD 3ARDB 4E5XB 5I1IL 4X4ZA 5L8KB 5I6XC 4PS4L 3WFEL 5E00A 1DSFL 4DN3L 1BIIB 5I1EL 2FJGA 3EFFB 5DMKA 2AQ2A 4HWEL 2CMRH 3UYRL 1FQ9C 1ZVYA 4N68A 3UPRB 1E28A 4HPOL 4BQ8A 5I1EH 2H6PA 1VSCA 2IH1B 3HRZB 4WUKH 1WK0A 2A0LC 2Z8RA 4CMMA 5HYJB 3KYMB 4FQCL 3T3ME 4JFDD 3NAAL 4HMCA 4G8FB 4OZ4B 4MAYA 3KHQA 1YEFL 4FXKB 5GS0D 1Q9OA 3PGCA 2PR4L 1ZMYA 5DYOB 1RJZB 3P4LA 4G7YH 1WEJL 5SX4H 2XPGB 35C8H 4PG2A 4RFOH 4HKZB 3F7YA 1FVDA 4PG2C 4P2RE 3BIAX 1RIVL 1CQKA 4YHPB 1EGJA 2QSCH 5D7IA 1A6TB 4UV7H 3Q1SL 4M7LH 2ZOLB 3MJ9A 4CVUA 3MXWL 4PJ5D 1IGYB 4U1HB 2FH8A 4JG1L 2PW2B 2FX9H 2WIIA 4M8VA 5E8NB 1MFDH 3TA3D 2AKRA 3WLBB 3O6KH 5DJCA 1QO3B 2ZG2A 4Y16D 5IMLB 3HI5L 5D7JD 4N8VA 1OP3H 3VXSB 1HZHH 5IK3A 2AJXH 1OTTD 4MJIA 4JJHA 3VFGL 4HK0A 1MAJA 5JIHA 4F7CB 3LZFH 4L4TA 1LEIA 4JPIA 2XWJB 2XWBA 2WW8A 5CD5C 5BCAA 4KZEL 2YN5A 4JFQA 4R4BA 2OQJB 2OLDA 4LAQH 3GSXB 3L1OH 1CL7L 3VXMB 4IOIA 4KMTL 4NUJA 1NC2A 4AZ8A 3KAAA 3HZYB 4M6AA 4XVTL 1SQ2N 4WU5A 5FECA 1XGYL 3NFNB 3FRPG 1AIFA 1KT2A 5C0CD 4HF5L 4UB0L 5I1CL 2P5EA 1P69B 3IFPA 1HH6A 5D2NA 2R39A 3BSZH 2JB5H 3WFHA 1PKQE 3TBYB 4NKIL 5T3ZD 5E1HB 5JPNA 4OLXH 3HE6A 4Q9QL 1IAIH 35C8L 1KPUB 5D7KD 3GMQB 3VWKA 5EBMA 4E41B 3REVB 4WV1C 3CU7A 2AP2A 1BFOA 2HKFH 2PYEB 4RFNC 2Y5TA 1EO8L 5E2VH 3B9EA 5C6PB 4WUKL 1CLZL 3CDGB 4CN6A 1CWVA 5GXBB 2RGSA 1FFPB 3MLVL 2WQRA 2HT3D 3JUZA 4ENED 4LVNB 3R0MA 5JOPE 4P4RA 5F89A 1N6VA 1JTPA 4IHOB 3VRIA 3HLAB 4NZRL 5HGHB 1SHMA 4G6AC 4Y2DA 1U0QA 4OUUA 3GI8L 5TH2A 1ITCA 4LLQA 4PJCA 4ZOBA 3SDDC 5KS9A 5DHVB 3JWOC 3MRHA 1QBMH 4QHUB 5J11C 1U3HD 5FOJA 2F74A 4ZG1A 2B5IC 5DRZB 4L8DA 1CFSA 5DD1H 1JPGA 3QEQB 2ZKHH 3PIQB 3M17A 1N0LA 1GZPB 2AK4D 5B39G 2B4CH 3AFLA 1KLGB 4LLDA 5GGUB 4JFFE 2YPLD 2MCPH 3EOYG 5IVZA 1RJYA 3U82B 3TPUA 3T1FA 3RU8L 3MLPA 4F37F 1DBKL 2H32B 4JFHD 1Z2KA 3P9MB 1E4WH 5JR1L 5J6GA 1SBBA 1WWAX 4WI9A 3T4AA 4WW2A 2X41A 1M71B 4WW2C 3F7RA 5EBWB 3EO9H 4JDVB 1N6QH 1JK8A 4HH9A 5DJZA 3X17A 3PWNB 2VDMH 2VQ1A 2AXJA 4UIMB 5KG9B 1GXEA 3H6JA 2WBKA 1DEDA 5FCSH 4ONFL 3QAZB 5D70L 4NHUA 5FCUL 2F5BH 1SYSA 3TV3H 3DX9A 1HNFA 2I60H 2H3NA 4WHYG 3LRSA 4NBZB 1KSRA 3K1DA 2IJ0C 4OZIA 1PBYA 2DQUH 3QQ3A 5T5FL 3RNQB 4W4NA 1YEDA 1OSZA 3BD5A 3L9RA 5DC4B 4IRZL 4P2QE 5GGVY 2ZNWA 4KUCD 3C8HA 4TSAH 3DUSA 1PZUB 4FQ1L 1OAUL 3VWJB 4N9GB 1JZ3A 2OL3L 1QVOB 4J23A 3NPSB 4G8FA 4XVUD 1RZFH 5DQ9A 5HHPA 4JG0L 1MFCL 5DJAA 3HB3C 5I73B 1UB6A 2YA0A 3Q6FB 4TUKH 1AFVH 4GRLA 3U30C 4NFDA 4GUPB 1C5CH 3KLHD 4OD2A 1NGWA 3PQYB 4ZUTB 2BXYA 3VJ6A 1RZ7L 5E8NA 2DYPA 2HFGL 4FQXC 1GZQA 3B4NA 4KRNA 4LCCC 5DVKA 2VE6B 5SWSA 1NDMA 2B2XH 5J7CC 2CKBA 1JBJA 1CGTA 3X3FL 4HAGA 1X6NA 4WFGD 4FTVD 4QTIH 3IB4A 1AGDB 2DRUA 3BPOC 4IDLA 3MODH 1I8LA 4OF8A 2OJZL 2R0WH 3SQOL 3V0VA 2GYSA 5TQ0H 1TQBB 1Q9OB 2Z93A 1SBSL 1J7VR 4HKBB 1RUAL 4J1UB 4K7PX 4TULH 1K4DA 1WV7T 3MREB 4PRPB 5EA0L 3GO1L 2W0FB 3F58H 1DUZB 3AS0A 4M5ZL 1OT1A 4I77H 2ZG1A 1NFDB 4AENA 4Y4FC 3WO3B 4H26B 3O8XA 2APWA 3C08H 4K94H 4HBCL 1L9MA 1EAJA 4YO0A 4P23B 3U36A 5T3ZE 4ZUVB 4OCYL 5CMAA 4J2XA 3WKML 3HAEA 2I9TA 1CDBA 4X5LA 3MRHB 2AEPL 3PDDA 3QNZA 2Z31D 4MA8L 4GG8B 4IRSB 3E8UH 4UAOC 3EHBD 2X4NB 2P49B 2Z0BA 3TZVB 4WV1B 5E2WL 3P30H 2K7PA 4XT1C 5AYUL 1I7UB 3HZMB 2QQLL 4K07A 4X5WB 1DN0A 3QIBA 3RY6C 1M4KA 4DGIL 3ALXA 3RDTA 4F7MA 1XGTA 4HIXH 5GGTH 4HT1H 2BCKB 3G08A 4PJ7F 5L2KD 4UILL 1CFTA 5JHLH 1Z3GL 3NFPB 5HGHA 3TBWB 2W0PA 3SDDD 1RK0B 2HJKA 5D6DC 3AS1A 1I85A 5EZOL 1VFBB 2IMNA 5J13B 1GHFH 5ETUB 1YA5A 3OAZK 1AQDA 2EDKA 4EIZC 4HIEA 3QDMD 3L95A 3PE9A 4TTDC 2EYRB 3KNBA 4X9IA 1NCBH 4IM8A 3O9WC 3IFNL 4XP5H 2P43B 1CDUA 4KTYA 5EG6C 3O9WA 5DQJB 2AI0L 1P4LA 1BMGA 3G5YB 4MWFA 2J7LA 4P5TB 3HI6L 5CZXD 4I0PC 2FEEL 2DOCA 3LEVH 2J12B 4F57H 4TPRL 2H1PH 1DVFB 1RPQA 3T65B 5EB9A 1CDYA 3MA7A 2H2PD 2V2TA 1G7MB 1T1WB 1UWXH 4XI5D 3BPNC 2KUTA 1UKTA 4NHCH 4ENEC 4IBLT 1CLYH 4LGRB 5DURD 5GGRA 1KB5H 4XP1H 1HHJB 4JFZH 2HRPH 1B0RB 4ZQKB 4UT7L 2JIXD 1HXMB 4X8XA 4F15B 3OAYK 3I75B 4U1JA 2C4FT 4GAJL 4B7IA 5BS0B 4ZAKC 5BRZB 1HHGB 5GZNC 4ELMF 4PGBA 1NSNL 4PB9L 3HR6A 3EO0B 4R2GC 4Z78A 1DR9A 5BRZE 1N26A 2FCBA 1S5IL 1ZS8A 2V9RA 3BT2L 2CR6A 2MOVA 3LAFA 4RWYL 1JPGB 1T80A 1YMMD 2PTTB 1D6EA 1AKJB 3B3IB 5EOTA 2D7QA 2VISB 4M8QA 1A7BA 1FGNL 4EOWH 3QQ9C 1WWCA 4G8IB 4P2RA 4JLRB 1T66D 1A6WH 3BIKB 1C1EH 3VWKB 5BVPL 2VJXA 5SWSB 1FL3A 5DJDA 1I9EA 2HJFB 3AREC 3ARXA 3BDYL 4OZGB 4LHQB 1E4KC 1MIEL 4P2QD 2ARJA 3VMNA 3GDBA 5DSCA 3WXWH 4M6NH 3CNKA 3RBSA 3EZJB 3WJJA 4M3KB 4QTHB 3FQTB 2IFFH 5FHAH 4HIJB 5KBNC 3WJJC 3VG0H 2WUCL 4U7KA 1ZT1B 1QVOA 2BERA 1I7RA 2LAGB 3F6LA 2BNRE 1AGCB 5EUOA 3EGSB 1L7IL 1W0WB 1WT5A 5I73C 5DEFA 2FHBA 4RMTA 2C1PB 5HPMB 1IGCL 4Q0XL 2FEEI 1DTUA 1N4XH 3W82A 3OAUL 5I15H 1RZKH 4FFYH 1MQKH 2RIKA 3UO1H 1HDMA 3DMMC 4NHUB 1J8HE 1L7IH 3GBLA 3P4NB 4OF3A 1KC5H 1OWRM 4FQLL 2WNGA 4EUPB 3C2AL 4G3YH 4Z7VB 1U8PB 3UROR 5FUCE 4GG6B 2FL5A 5FV1L 5IVXB 4V1DA 1OQXA 1DL7H 5JUEH 5IJVB 2C3XA 3QO0B 1C08A 3BI9X 2BRRH 1Z9MA 2Q8AH 2M1KA 1OTSD 3G08B 3HC4H 4YPJA 1MCOH 1C1EL 3HZVB 4F7EB 5C0GA 4HXAH 1PX4A 5HI3D 4XVSL 3I9GH 1U95A 5SV3A 4MNQA 3BD3A 4D0DB 1FZMB 4XP4H 4K9EC 4I3SL 4K9EL 3U79A 5KSBF 2JCCB 1W8OA 2BVPA 2P8LB 1K3ZA 3HMXH 3OBAA 4PP1D 5C0RL 4LP4A 4OQTH 3OJDB 4QXWA 4AH2B 1KIRA 1SJHA 4L4JA 5IT2H 1H3WM 2W07A 1X7QB 1Z9SA 1T2XA 5HVFB 2R4RL 4MA7L 1ZTXL 1N8ZB 1CDGA 1T20A 2XA8H 5DO2D 1CF8L 4A6YA 1NEZG 3SEPA 1KB5L 4XP1L 3RWDA 2IAND 4Z77B 3HZKB 1LO2H 5J3HD 4NRZB 1G7LA 1U91A 5CJXA 3ARRA 2W9EL 2X9WA 4TVPD 5LXGL 5TE7H 1S7VB 5CINH 4PRID 4OT1H 1J1OH 3O6FB 4PY8J 1I1AA 1A0QL 3W2DL 1CXEA 3LDBB 4WGVB 3D39A 3ORJA 1CDJA 3MC0A 4YQXH 4CMHB 2E8ZA 4CRPA 2V2WA 5GZOD 3HCVA 3FB8B 1WWBX 3G6AA 4KK9C 1HOCA 1AGBA 1WCBB 4XCFL 4QRPD 1F02I 1P2CB 2CRYA 3BQUB 4JO3L 4BZ1L 5IM7A 2LTQB 2HT2D 3L3IA 3QXAB 3OKEB 3U7WH 4W68A 2BSRA 4XBEH 4YXLL 3W11C 1QP1A 1FDLH 2BSSB 2VDPH 3E0GA 4OZGE 5JHLL 3AS2A 1B0RA 1A9BB 3P9LA 4HS3B 2R1YB 5DUML 1U8NB 3TNMA 3ULSA 1U3JA 4HIXL 3H9SA 4XPHH 3UTZB 4J6RH 3AAZA 3SDCC 4U0RC 4QXUL 3JTTB 1AY1L 5C70A 5IR1A 1A5FH 2F8VA 1R3JB 3TFKC 5DR5H 3VGAC 3LHPL 5IF0B 4GXUN 5KS9E 3C9NB 3OKYA 1T2QH 2B8OT 4ZS7H 1UFUA 2GSGA 2AQ1A 3ME0A 3GMNB 1ZGLP 1MEXL 3RUGB 2VXSL 4HIIB 2ZUXA 5KZCB 3VFUB 2EYRA 4PJXF 1N5YH 1I1YB 4DKFH 4WVRA 1WZMA 4APQA 1MI5E 4G6MH 3VD9A 4UT9H 4HUWB 5KSAA 2RFXB 3GSNB 3LQMA 4I77L 4Z7WA 4RAVA 3OG6B 2CGRL 3GNML 1K85A 3VFTA 3BVNA 5DUPL 1NPUA 4NOFA 1M7IA 4LQ1A 1BJ1H 4OQTA 1EHXA 5CCKL 4LSSH 2YRZA 5KZCD 3MV11 2XACC 3FQNA 1NCAL 4XNMA 1AGEA 3DXAB 3MODL 3C09C 5B39B 4D0BB 3X3GH 4D8PB 5JW3L 5I71C 1J11A 2IG2H 2I07B 5IQ7H 4PJ8D 3B8YA 2ORBL 1F4XL 3C8KA 3OPZL 2V5MA 4ODUA 4NIKB 4O4YH 5F21B 4HIEB 1AHWC 3IDYC 5FYJH 1RZ7H 3MGOA 2Q6WA 2OK0L 2VKWA 3UJIH 5IWLA 4W6XB 1CYGA 2H2PC 3WS6A 4C4KT 5HHMD 2HH0H 5HDLA 1SM3L 4ZFFA 3WS6C 2AABL 1E27A 2BSTA 1NBZA 5L8LB 3EKCA 5DMIH 3GSNH 4YDKH 5F7DA 1CFVL 2DL9A 3LN4B 3E2HC 4RIRB 3V6ZB 1JCKA 5IBTH 5TFSL 3QDGE 4PRBB 1Z5LB 4PJEF 1OAUH 4Z7VA 3BRFA 3V0WH 1UEYA 4ODWB 1T1XB 4DZ8B 2I26N 1WF5A 4YPGB 4ODXA 2FWOA 5DQDL 2O93L 5FA4A 1WCQA 1MH5B 1UKSA 2DQUL 1H3VA 1KXQE 4HDIB 2BDNL 1EBAA 3GJFK 3O3EA 4MJ5A 1CK0H 4P9ML 3OGCA 1RMFH 4OKVA 3VXME 1JPTH 5ETUA 4Y5YA 5C0BD 1TXKA 5I1HL 4UQ3A 1QRNE 3O4OC 1FE8L 4TUOA 1T5WB 3NCCB 3V6FB 1O5DT 4IS6A 1FZMA 3D2UB 4IMLB 4GW4B 1MCPH 3BQUD 1MRCL 1ZA6B 1X44A 5C0BE 2GTWA 2IGFL 2J3SA 5HD8C 4HGMA 1YYMH 5EPMA 4QGYA 3I6LD 5JLZB 3NIGF 3UJTH 3WO4B 5CGMA 4LQFH 1NCAH 2Y7QB 2XNAA 4LLWB 3W39A 5DT1H 4JB9H 4YJZL 2ED9A 1CG9B 2BSSA 4P9HH 1FBIH 3REWB 4DKEL 5FKAB 3ULVF 3I02B 4QHKI 2CLVB 1DQJB 4LKCA 4JN2A 1T0MB 1IEHA 4P0DA 5HI4D 2MKLC 1Q9WB 2PO6B 2XPGA 4L3EE 4KHTH 2W9LA 4N8PA 1VEOA 3MUY1 1IFHH 1WUNT 2G9HB 4O9HH 5C3TA 4TYUA 1JUFB 3GMMA 2KBGA 3QQ9D 5JDSA 3VXSD 4FQXA 5L9DH 3MNZB 5B4MD 25C8L 4DKEH 1OAXL 3GI8H 4PJCE 3X11B 2FJGB 1EHLL 3RFZC 1K4CA 4RFEA 1IGIH 2DMCA 5DMYA 2ZUUA 4XB8A 4AK1A 2PN5A 5LGHH 5DMGC 1RIUH 4D3CH 3MUJA 4WHTB 4C58B 4R7NA 4XMPH 4GG6A 4I2XB 1A9EB 3S36X 3T2QA 2HTKC 4K2UL 3FQTA 3CMGA 3FN0H 5E2JA 2YPKA 3RWGB 3AUVA 5DYOA 3HE7D 3WFZA 4JO3H 4JHWH 3DOSA 4QY8A 3QDMB 2BVPB 3ALPA 1U8OA 2R1WA 4XCFH 2DN7A 2G75A 1IAIL 4NKIH 1KFAL 3VFPB 3TA3B 1F8TL 5DQDH 2A1WL 4PJDB 1VGKB 1QFPA 1YEKL 1A0QH 4QRRD 2IQAA 4UB0H 3C5SA 5KVEH 1BIHA 4Y1AA 5CIPH 1ZHNB 4P4KA 5CJOL 1FGVH 4WUUB 5GPRA 4BSWB 5IB4A 4RGNC 1N3NA 2ZWLT 4NQEB 1RJYB 4EUPH 2R1YA 4MHHG 3CDGA 1LO0L 1ZGLB 2YMXL 2XA8L 3DGGB 3L3GB 1NC4A 3VGFA 4D8PA 2N4IA 1UENA 3RZCD 1QEWA 4YXKH 5IFAH 1I1FA 4M43H 4BKLA 1T3FB 1AGEB 1H3UA 4P23D 5DI8B 4YFLI 5GZOC 2A6DA 5C0DB 3D39D 3MPCA 4OV5A 3WSQH 3D3VB 4G6KH 1ZGLM 3I50L 4PRIA 1ED3B 1EEYA 4PBWD 2R1XA 2ZUQC 5KS9B 3O4LE 4ODVH 1FL5A 2ZCLH 2O5YL 4PRAB 4XP4L 3QDAA 4QWWC 3LKSB 5DURB 2Y5EA 4MS8D 3RX5A 4YDJB 5D7LE 2VL5A 5GGQL 4LIQE 2XZZA 4ODHH 3MRDB 4LLAA 4JO2L 4LAJH 3HC4L 3ES6B 3V52H 3DX6B 3MNVB 2Q8AL 4NN6C 1RZIA 2YA2A 4MDIB 4Y5XC 1QLEH 4YX2H 3DVGA 3LPWA 4QRRB 4F3FB 1QRNA 5EC1A 1HWHB 2AK4E 2R56L 1LEKB 1NLDL 1S7QB 2QL1A 2Z31B 3QDJE 4LNVA 4IRJB 2NY4D 5JOPD 4ZFGH 3C60D 3MLTB 3QT2A 1A7NL 3S96B 3CH8A 1PYWB 5ALCL 2Y1VA 4PLKD 3VRLE 5JQHC 5EIQA 1FP5A 1WC7A 4M03A 3MO1A 3QCTL 4LVOB 2EDDA 3RAJL 1ZWIB 3O2DH 3BPLC 3EDKA 4X80L 3SY0A 5D5MA 4DEPC 2AJZB 3NCFB 1ZHKA 1DQQB 5E1AA 4KKLD 1TCMA 2HT4C 1Q9LB 4YXLH 3WD5L 1PAMA 5C0AE 3VG0L 3X11A 1GSMA 3WO4C 4MA1B 4Y5VB 1BAFL 1R3KA 5CJQH 4YDVB 3HZMA 2E7HA 3S5LB 2CIKB 1KCRH 3LVEA 4NWTL 1TZIA 3MV9A 2Z93B 1F11B 1INDH 2Y25A 4LCWE 4LSPH 1P9MA 1A7RH 3GI9L 1MY5A 2NXZB 3S36L 4HAFA 2O5ZH 4BUGA 3RVWD 1U8IA 2MNUA 4H0HB 1DQLL 3NIDE 4LNRB 4K8RH 2FD6L 2GW5A 3G5XA 1UKQA 1IGTA 5JOFA 1UWEH 4QKXB 3GRWH 1JGVH 4J3WA 4ZS6D 4JFEE 5EN2B 4O02H 3O41B 4PGCB 1KCVH 1WAAF 2Y7QA 3IF1B 3CFCH 2JJSC 4UI2A 2H41A 4F7MB 4WI4A 3GBML 4LKXA 4MS8C 4XNYL 5JOEA 1KCVL 3FT2B 5HVWA 2HRPL 1HKFA 4PREA 2DKSA 5CGTA 5E2TH 1INEL 2YUWA 4CADB 4MQTB 2EDTA 4C83A 2CO7B 2A74A 3P0VH 3E3QE 3D0VA 1NCTA 2NY3D 2X4RA 1NUGA 4R9HA 3ZE0E 5IIEB 3NH7H 3VXTB 3D6GA 3GKZA 3OB0H 2R23B 3BYYA 1E4JA 1MJUH 3MRQA 5IGXL 1DJSA 4RQQB 3BHBA 5FKPB 3GI9H 3DROB 5CEYB 3RPKA 2AEQL 1RHFA 2NTFB 4LSPL 4LU5H 3T77A 2FNBA 1BP3B 1A22B 3AY4A 1FIGH 3UJJH 2MPAL 4K3DL 1VADB 5CJQL 5ILTL 3TA3C 1I9IH 5L6YL 2X6MA 3GHBH 5CZKA 2VLKB 1MFAL 3CLEL 3PHQA 1NKOA 4EVNB 4BSWA 1LHZA 3OKKA 5F9JA 3FO9B 4ACPA 1CVRA 1ZHBA 4X6EA 1JGDA 4FTVE 4G6AD 4GBXD 4P3WA 3U4EA 5GGTL 2DWDA 1MY7A 1ZEAL 1QLRA 3O2DL 3W0WA 3TN0A 4FFVD 4KJWD 3QZWG 3UO1L 1GGUA 3QCTH 1RFDL 4JZJA 3MRPA 3HPJA 3ARFB 5C71A 5I15L 4JZJC 5BO1L 5E2WH 5DD3H 3TBSB 2FIKA 4CN4A 4OD3H 3NCYP 5IHUL 3V4PL 2R1WB 3QXUA 4B41A 4U1JB 3JXAA 3TT1L 2Y07L 2HTKD 4K7PH 3BISA 3PQYA 1Q72L 4RBPH 1FZOA 5C0ND 3SDDA 2JB6B 1WBYA 4U33A 2HJFA 3C08L 4Q2ZA 4CVXB 4WUUA 1T66C 3H8NA 1FVCA 5DLMH 2NX5B 4GKSA 1VEPA 1G0XA 5J06A 4LFHG 4HWBL 1YEJH 1R5VA 2F5AH 4RFEB 1CLOL 5ICYB 2PYFB 4KY1H 3HHRB 3D18A 4JCLA 1CLCA 1Q0XL 3OX8A 4P3DB 3SKNA 4EOWL 3CX5K 1DN0B 1MPAH 4LVHB 5HYJA 3MRNA 3BKCH 3QWOB 4WI5A 2ICES 4BSVA 3ALWA 5CUSL 3FCTB 1DFBH 3QG6B 4CVZB 3NACL 4GRWE 2CLZB 3KYKL 2R1XB 3OB0K 1FVEB 2ARJQ 4X4ME 3SGJC 3OZ9H 4PY8I 4N8CH 3QFJD 4OLZL 3ARDC 5E8PA 4HH8A 5C0JA 3N85H 3H0TA 4ZPTB 3QHTC 5ACMA 1IAIM 2PXYA 3KPSD 3KR3L 5INCB 4DOHB 4F3FA 5I1AB 4P57A 5FXCH 3V6OA 1ZK9A 3UDWC 5DJ2A 5F9OH 2UZIH 3AC0A 4FQ1H 3EOAA 3LEVL 3CDFA 5ITFB 1F4HA 3OKOB 5KJRL 3HI6H 4ORGA 1HINL 1ND0B 4J8RA 1U58B 2ADJB 2I9LA 2CDFA 4ZFOA 3SCMD 3BPCA 5DD6B 4PRIB 3MRFB 5D1QA 4K8RD 4LSDA 5FYKL 1OAZH 3WLWC 1T89C 5A16A 1RUMH 1T83A 2OSLA 5C0DA 4UNTA 2AK4B 1NFDE 3P3YA 4M5YL 2K7QA 5EZOH 3FN0L 4PY7A 1QSVA 2DQEL 5CEZE 4UT6H 1K9TA 1MHEB 1WZ1L 4XMPL 3NABH 1V3LA 2JF1A 3RWCB 4DGIH 2FZ3B 2ZOKA 3EDJA 5KVDL 4L29A 1A1OA 2OTWA 3B9VA 3MJ8B 4LKXB 5DRNB 5T33L 3G6DL 2VLJA 3U4BH 4PFEA 2G5BA 3UZVB 4L1DA 3DETC 2VZUA 4ZUUB 3UTSA 1CGWA 1LQSR 2XQYK 4NRXB 5DRXB 3QPQD 4WCYH 5L7XH 4EQ2A 3NZ8A 5EU7C 2A6KB 4PGJA 3LEYH 1LO5B 1PJ9A 1I1AB 1CE6A 4U49A 4KRLB 4O9HL 3ULVD 5EC2B 4GFTB 4BFBD 3LQAL 4NYLA 1H0DA 1YUHB 1NANH 4ZPVA 1GOGA 2RAMA 4NQEE 1ZLSL 4I9WE 4NUGH 2MHAA 5L8JB 1MRFL 4BM7A 1A4JA 4RDQG 5F6IC 3GGWB 5IVNA 3DO7A 5D1QD 1I3RA 2PNDA 3VXUB 4JFOB 1RZ8A 1SBSH 4KKBD 4NNPL 4HGWA 1HI6B 3PL6B 3Q2CA 5FGSA 3WIFA 3VGGA 3VFOA 4KH2A 5GRZA 1P2CA 2E9JA 1FFRA 3IRPX 3U1SL 1EX0A 1QHPA 4HC1L 4XC3L 2AJVH 1OM3L 3WJLA 3QUKB 2FX8H 2YD8A 2DQDL 4X6CA 3ZE0F 4N0CD 4LLYA 2VXQH 2HFGH 3HPJB 2IFGA 4JZJB 3QNYA 3HRPA 1FLTX 5BVJA 4ZFZB 3WUWB 4V2BA 2H32H 3RWFA 1OP3K 4NN7B 2MKWA 3S7GA 5I1JH 3LCYA 2BY1A 1AFVL 2ESVB 2FBOJ 3IJSB 4RAUA 3WFCL 5EN2A 4Q9QH 2VZOA 2OI9C 4KTEH 5JORB 4JG0H 2CKBH 2NYYD 1GH7A 4KZDL 3TBYA 4I18C 1FZOB 1P1ZB 3IXTB 1X5IA 5EZIL 3C5JA 3CU1A 1OPGL 1AQKH 1R5IB 3L1OL 1GZPA 3CCHB 4LRNL 4HQQH 3FRPA 3EO1B 2X4PA 5IM7B 3DSFL 2BJMH 3TEUA 4CMMB 2CO6B 3MV7B 4PBXA 3MYJB 5FDYA 1SM3H 4RFNB 3QEQE 2QHLA 3TJHD 5JXAL 2XWJA 2IQ9H 2LE9A 5J1AB 2HFTA 4LVNC 3HMWL 5FM5M 5AG9A 2DLTA 1OP9A 5D8JL 5IF0A 4IHOA 1N6QL 1I85C 2EH7L 1QD0A 5E2UL 3FB5A 3TT3L 2ICCA 4Y8AA 2X40A 1WBYB 3T04D 2VLKA 1IC7L 4MD0B 4NO2A 4MNHB 4UIKH 4DVRL 3D3VE 1PG7H 2A6IB 4PYHA 1FZJA 4NZUL 3DYPA 3ULUD 4JM4H 2VDRH 5DK3A 5T3ZH 3UYOD 4NO5B 5I74C 5BXFB 4GJTB 1U8KB 5ESAA 5FYLH 4W6YB 1F58H 2VLJD 2GY7B 4QF1B 1VKXA 5CHNA 1UC6A 5HXMA 4XP6H 4X6CF 3LN5B 3MQIA 4TVPH 4I48B 5ENWA 4MAYB 4AT6A 2X4UB 2GJ6D 2ADIA 4YXHH 4HPOH 4HLZH 1PG7X 1QBML 1MAKA 3NTCH 4JQIH 1D5BB 1Q94B 3IAQA 3NN8A 3QIUC 5AUMA 4LARL 1YMME 4DTGL 1UM6L 2VZTA 5EZLB 4PS4H 3MLUH 1MIMH 1T4KA 4RBPK 1KTDB 1VEMA 1C5BH 3L6FB 4Q7DA 1YPZE 2LU3A 4NJAL 4ZNEE 1UB5A 3FL7A 4YUEH 1DVFD 4POZC 2ESVE 4OCRL 3U2SA 3BJ91 2FIRT 1A8JH 2K9UA 1H3PH 1AKJD 1DEEA 4IIQC 5E2VL 1CT8B 3IGAA 1DP0A 1H5BB 1HXYB 2NYYC 2V5RA 4PRHE 2ITCA 4WHDA 1JF6A 5GGSA 1EJ6A 3KXFE 3QJHB 3KDMB 1C7TA 3NIGE 2YEZB 4I0CC 2JKXA 3N1QC 2O61A 2YKLL 4NO3B 4NQSA 1XR8A 3I84A 3FQXB 2GQHA 4AEEA 4Z95H 1UACL 5E7FA 5T3XH 4GRLB 3I6KB 4XAWL 1SVZA 4RISH 1O0VA 3KXFD 4Q74A 3FAXA 2BX5A 2G9HA 5DD6A 3SOBL 4HXBL 1YEGL 4RAUB 2W0KA 5LCVH 1NGPL 4NKDB 4HF5H 4NQED 1QSED 3H9SD 3QYCA 2Q86B 4JGJA 5BVJB 4YFEA 4X6CE 5DWUH 2AVGA 1HIML 3IXAA 1IGFH 4YAQB 1LDPL 2V9TA 3QPXH 1MFBH 5E6YA 3QXDB 2EH8L 3DX9B 4KKBC 2OTUB 4AQ1B 1IAII 2C5DC 1RVFH 4M9PA 4J4PD 3WKNA 5HGAB 3IAGC 5E8DH 1HZHL 2NY3C 4YDIL 2JTDA 2APFA 3BZ4A 3RWEA 3TIDA 2J4WL 3FB6A 2EEAA 3MRRA 1LO5A 2CKNA 2QADB 3X14B 1MFDL 5J1AA 1GGBH 1G6RB 1MRDH 3REWA 5IHLB 3O8XB 3FQUB 4M7LL 2DM4A 1VFAB 4MJ6A 4P9HC 4KKNA 5FUZH 1H3TA 4MJ5B 4WU7B 3RL2B 1YUHA 1ORSB 1HQ4A 3SE3C 1VB9A 2VIRA 2ZCKH 5JDSB 2ICEA 2WP3O 3C60A 5ADOH 1F90L 1WIPA 5JPMA 3NAAH 5DJ8B 3DJ9A 5F7HA 1DL7L 3GHEH 1T7ZA 3H0TB 4G8EB 4HK3J 4JY6B 4I18B 4UINH 1JP5A 4YWGL 3DYOA 3QIBB 1F6FB 4GMSH 1V05A 3HC0A 2XTLA 3DNKA 4I2XA 5HDQH 4JPKH 5K9OA 1DCLA 4JQVC 3BPNB 1NMBH 3FO0H 2X4PB 4WHTA 3I3DA 3MLYL 3KGRA 5I17B 2F53D 3B9KA 4BA8A 3HAEG 4EKXA 4TSBH 3RIAK 2QV2A 4LSVH 5L2KE 1N4XL 1JI2A 2NY7L 3W5NA 3L7FA 5CJXC 1UM4L 3TN0C 5JHDB 5KVMC 5HHOD 5B22A 3H7BB 4DOHE 2I07A 4WWID 1MUJB 5E24E 1OF2B 3HE7A 3MV9D 1CD1B 5GRVK 2X2YA 5D2LB 2AXHA 2VN7A 5D1XB 2F19H 4O5LH 5GSVA 3DXAD 4R4NC 4YEEA 2O5XL 2MFNA 4LBEA 4AIZA 3VXSE 2VLMD 3VFPA 4M6NL 1S8DB 1G7MA 3W9EB 5IW1B 1ZT4B 3BKJL 4HZLA 1ZLVH 3B2UD 3TYGL 1IT9L 1JL8A 1QPPA 2HP4A 4WV1A 4WTZG 3TO4C 3BDYH 2BVEA 4AIXA 4OZFB 5J56B 1HSAA 5E95B 1YY8A 4GSDH 2R4SL 1CFQA 2NW3A 1Q0YH 4XVJL 5DFTA 1ZANL 2X7LA 4NQEA 4RA3A 4RWYH 2YK1L 3VD4A 3BT2H 3EZ8A 4MB5A 1G9NC 1RUKH 1IMHC 2D31B 5I0DA 4YC2C 5F70A 3KXFA 4NP4H 4XGZA 2QLVB 1NAMH 3GSQA 4X98B 3RL1A 2CDGB 1KTDA 4FFZH 5KSUA 5C08D 4E9LA 1KTKE 4MB4A 4U31A 5D5MB 2ZSWA 5KSVB 3ES6A 4F9LA 3HC3H 1M7DA 1MJ8H 1WTLA 2X5PA 5D7LA 4AEHL 2Y36H 2AJSL 3O2VH 1BD2E 1LGVA 4AYFA 3PDOA 1I8IB 4YDJA 4Z7QF 5LBSL 2W60B 4Q6IB 4PLOB 4Q9RH 2X4NA 1ONQA 3DSNA 3O41A 1A64A 5E5MB 1A6UH 1H3GA 3WHXA 4PTTB 1H5BA 4FNLH 2VDNL 3HNVH 3F65A 4WW1B 1JHTA 1BWWA 4X0KB 4PPTA 3EW3B 4KTDH 1X5AA 2FX7L 4X6BA 5ANMA 1S7QA 1JFQH 1AR1D 4RNRA 4U6YA 4JEGB 1WAAA 3QNYB 2YS4A 4XCCH 4C54A 1HQ4B 3EO0A 1HN1A 5CSGA 4NFCA 4P4KD 4FQIH 4L1HA 4ZYKB 1GIGH 3V4UH 4MNGB 1P4BL 2A73B 1YEEH 4XWGH 3WIHL 1AHWA 2HVJB 1QUNA 1FORL 3K8KA 2AK1L 3TVMD 5B8CB 4OI9A 1OB1A 2B7DT 1Y0LA 3QDHA 4X4XA 4LDOB 3CAFA 3N9GL 3BGFC 4NZTL 1VPOL 4U7MA 5F9JB 2EXWC 4MA8H 3SDXA 3KPTA 5IEHB 3EYSH 4M1DL 1P5VA 3H7LA 3JVGC 3M1BA 1XIWB 1F11A 3GJFH 3DROA 5CEYA 5MEPA 2A83A 3O6FC 3MSPA 4MNQE 3P0GB 3Q0HA 1A4KB 3AXLA 3SO3B 5IHBA 2WWKO 4PGCA 3WFBH 2NXZD 2QQQA 4YHNB 1C12A 5B4MC 5FO9B 2W9DH 3RQ3A 1S9XB 3MRDA 4KFZC 3O0RL 4WTZA 1XF1A 2JELL 2F8XC 4QTIL 1XCTB 1RUQL 2PYEA 5I17A 5AD0A 1A2YB 4O58H 4YNYA 4KGLA 5CHNB 2F53E 5C0CB 1QHOA 5K9OB 3FB6B 4EI5B 2CIKA 3QCUH 4HZAA 4Z7VE 2C7UB 4FQQB 3MRPB 5HI4C 1OD9A 4JDTL 5J12B 4HUXA 4DW2H 3GMOA 4TQEL 1PSKH 3MOBL 3G6AB 5EBLB 4KQ3H 5MEND 2Z8VC 4RZCA 5KAQG 1MCLA 1DN2A 1ZSDB 1IGJA 2Z4QB 1TJGL 3LDBC 1U6AL 4GBXB 1MCEA 2EIBA 4EVNA 1J12A 1EGJL 2A38A 3OR7A 3MLSL 1FPTH 1XEDA 2ZCHH 3VXNB 4FFVC 4KJWC 5KTEH 1YMMA 3AB0B 5IHZB 5FAAA 1P84J 1JIBA 4PRNB 1AD0A 1LE9A 4OZGA 1QLRB 2XTJD 4N5EC 4QXGL 4JKMA 2FO4B 1KIUA 2LTQC 3NIFE 2WZPD 1XF2A 5FCUH 5MI0B 3U9PL 1A14H 4PTTA 2ENSA 2ADGA 1P7KA 3AAZB 3FO2A 1DLFH 4K23H 1TMCB 3TBTA 4G6JH 5GHWH 3LKRA 1EFXB 1L4IA 4QHKJ 3D1MC 1OGTB 4WFFE 3KPLA 3DV4A 1C8PA 4CVZA 3S96A 1VENA 4LP5A 5CFHA 1RZKC 4HS8L 1PDKA 1YY9D 2V5SA 2IMMA 2KKQA 5BJTA 3MRGA 3O4LB 5C0IB 1AD9B 4PJXE 1AGBB 1G6RL 3X12A 3A6OA 1MNUL 5B8CA 1HILB 1KENL 1T5WA 3PWUA 3AM8A 4JGMA 1XGRA 5AG8A 3VRJA 1FYTD 1CE1L 2PYFA 5DJ8A 3BRGC 1BBDH 2D7TH 3VXRD 4NDMB 4PJHE 1MJ7H 3ARDD 3E1F1 4I1NB 5IFJB 1QSZA 4X4YB 4CL7A 3P0YH 2H8PB 5DJXA 5IVXA 4KVCL 4C56D 1D5IL 1HSAB 2XV6B 3VXRE 4GG6F 2EE3A 3QUYD 6FABL 1N0XL 1G7QA 3B5TA 3ROOA 3BDXA 4KI1A 5MHSD 5IEHA 1G6RA 3T3PF 5HYJD 5D1ZB 5EO9B 4ELKB 1BFVH 4MAUH 4R4ND 1UA6L 5F7MC 4LLQB 4F33B 3HG1D 5I71B 4POYA 4LNRA 4RGND 4KROB 5KANI 2LVEA 3T0XA 3K2UL 5KVFH 1IM3A 4Q9BA 3HE7B 3HCVB 1N2RB 2NXYD 3B2UC 4X99A 3LKPA 4H8WL 3ZT6A 5CIPA 5CSZA 1WZLA 3NCJL 3SCMA 1MCDA 2A73A 2X89D 3MZTA 4YE4L 3WIHH 1F4AA 1QA9A 4LSQL 1AXSA 3DX7B 4F58H 5HHVL 3M07A 2AKRB 3BH9B 1AXTL 5JW4N 5MEOB 4ZTPH 2NLJB 3QDME 5TF1H 4ZUUA 3KXFB 2NY0B 1MHCA 4PRHB 1F3DH 4J3TA 5C0FB 1P7QB 1IC5H 2V2XB 3ESUF 4BQ9A 4I2XE 1I3GL 3ZKSD 4Y0GA 3L7EB 2D0GA 4Y2DB 4MNQD 3T2NH 4L4VD 5JTWA 2NY1D 3GJEB 5H35B 3DPBA 1AO7B 4M4RA 3ARVA 3MLZL 3RIAF 3VXOB 2D03H 2P8LA 4PB0H 1EHAA 5A2LH 1MCHA 1A7PH 3PNWA 3EYOA 4KUZH 3BUYB 2EE2A 4X4XB 1IC1A 4IS6B 4U1GC 2D0HA 3S5LG 2DB8A 3LKQA 3C6SA 2UVFA 4JHAH 1NGQL 4NRXA 2AJXL 1AGDA 4I3RL 2WWKT 3IKCA 4OLWL 4QHNB 4HX1B 5IB5B 3U0TB 2EE9A 3S3PA 2ZUSA 1BHGA 4WNQB 4JFPB 5C6WH 3L3HA 1TIUA 4KAQL 5L88L 4YH6A 1V3KA 4NRZA 2MTPA 3MXWH 2IANA 3DV4B 3IJHB 5FA4B 3L3GA 3TIEB 3M1BB 4X6FA 2NY2B 5C0EB 4RA0C 4MD5A 4WFHE 1RULH 3G5VA 3EJJX 2DIAA 3PQYD 4KI5E 2Q76B 1H0DB 1QNZL 3MGTB 3ULUL 3EBAA 4U3CA 5HYIA 4X83A 3TZVD 4XCNA 4X7SL 2JIXA 5DFWH 5DRWB 3T0EB 2XG5A 3GGWA 5MEQB 1T7WA 1U8LB 2CLRA 4RMQA 4H26A 4CW1A 4XNXH 5I1LA 1HKLH 1XGPA 2PTVA 4U1MA 1YEDB 1EERB 4PP1C 3RNQA 1VESA 1OTSC 4H0IA 3UYRH 5DJ2B 4JY4A 4YHOH 4ZOAA 3FRUA 4GRWF 4PJ5E 4N9GA 3CSYA 4ODXB 5I1IH 1G7JA 4ZQKA 3PV6A 1OGTA 2EEDA 4FS0A 4JM2C 4NNXA 4WUUE 1UM4H 3VGBA 4WFFD 1NL0L 3MRKB 3S37X 3RZWA 4KV5F 3QI9B 3T0VA 4Z7WF 1OCWL 5D9SA 4GAFB 6CGTA 2AGJH 1KPVA 4OGYH 4WW2B 4JKLA 5FYLD 1MH5A 2AXGB 1LP9E 2QKIB 3GSUA 1L6ZA 3OKLA 4JRXD 4YIQB 1DBJH 2EECA 1IM9D 2B4CC 5DQJA 5F3BB 4WJ5A 3IRZA 1XCTA 3GSRA 4LVEA 3SO5A 1YQ2A 4E0RB 3VXNA 2FDBP 2QSVA 1JYVA 3L95B 1IEBB 5T1DH 4X7SH 2VDOL 3V95A 3CVHH 5I1GL 1OB1B 1RIHH 1TETL 1B4RA 1XT5A 4QF1A 2QQKH 5FUZL 1I7TA 1FO0A 1NCWL 3MREA 5DK0A 3T8XA 4LKCB 1OL0A 5DHVH 4WFED 1W72L 4HCRL 4F2MA 3H9HA 4RMWA 1DANU 3EAKA 3QDGA 3QDMA 3VH8G 3BP7A 5L2JA 2EDBA 2CR3A 4LPUA 1XZ0B 5E8DL 2WBJB 5I19L 1BZ9A 1U8JA 3TP4A 4XPGH 3WE6A 3CC5A 4PJIB 3ZKMD 1WGOA 2EDJA 4YO0B 1S7WA 3EOTL 1MWAH 4GRMB 3UZEA 3H9YA 1GOHA 3BEVA 1NLBH 1ZT7B 2BOCA 4AEFA 4G8GE 1IAKA 1VFMA 1HIMH 3WEXB 4KRPD 1DBAH 1I8KA 3CVHB 4M7KH 2Q7YB 5E08H 1A7QH 4R4FH 1KCKA 3RDTB 2AJYL 2WIMA 5I9QC 3TF7C 3IDMA 4OLEA 4Z6AT 3SOBH 4BFIB 2EDXA 2J8UE 4FZEL 2YR3A 3GJEA 4EI5D 3FAWA 2RQ8A 1EFXA 3B2VL 2YSSA 1WSST 1IL1A 4PUBL 4S1DC 4QXTA 2F53A 4WI2A 3F5WB 2R8SH 3S3JA 4ZSOE 4Y4FB 5JORA 2F58L 3ARDA 2D7NA 5HHOB 3P40A 3D0LB 5KSBA 3MGTA 2DQCL 2P7TA 4DGYL 3L3DA 3QQ4A 1BVZA 3FFCB 4MCZB 1N64H 1IAOB 4HV8B 4D9LH 1X5ZA 3V6OE 3BPLB 1ES0B 4NJAH 1F00I 1IAMA 3NPZB 1QA9B 4Y7MA 3Q48A 4BK5A 2V9QA 4Y4KA 1RZIB 2J2ZA 2DQFB 3V79C 3L3HB 4M48H 3TZVC 4XC1L 2FATL 3LS5L 3S34L 3NOIA 1HXMA 2W59A 4LHJB 4X5XA 5GISH 4KK6D 3BZDA 3HZKA 3Q3GA 5DUBB 2ADIB 2VLKD 5KAQF 1I9RH 3HKFA 5C08B 4F7TA 3R06B 1RURH 2WBJD 4UTAH 5C7XL 3JVGA 3BWAA 4XNXL 2VDQL 4H1LH 4ODTL 3O6FA 2PUQT 5E6IB 5CWSB 3LSOB 2Q7NA 4ZD3H 5EZJB 2NPLX 3MA9L 4JREB 4MYWB 1CICC 1HDMB 4U6VH 2ICWA 2ICEB 4DFIA 2C1OB 5CJ8A 4OLVL 4P2RB 4YHYC 4YAQA 4PREB 4NNYB 1YNTA 3BAEH 5HTSA 1D6EB 4WNQA 5FUCC 1MHCB 1CD9B 2HWZH 3PJSA 3R8BB 5ICYA 1CU4L 4QHNA 5CZXC 3H3KA 2XWBB 5B21A 4ISVB 1V3MA 1J05A 1RUPL 3O2WL 1MWAA 4KQ4H 2RJMA 5D8JH 1MCBA 1C08B 2NY1C 1FRGH 3DVIA 5GHWL 3JTTA 3K74B 5FV2A 1JMZA 3HNTH 8FABA 4P46A 1MI5B 1I9JL 1VFAA 4L5FH 3UAJC 3OKLB 3P73B 2JK5B 4KRMB 2D03L 2PW2A 4LRNH 2Z92B 3P77A 4YDLB 1IGTB 2HTLD 3HFMH 3TJEL 2GTZB 5KTEL 5B3JF 1JZ5A 1Z9OA 4Q2ZB 2LU7A 3MLSH 2JJTA 1I3GH 4I18A 4FTVA 1P4IL 2DD8L 2VOTA 4EUPG 2DQTL 3CSBA 5C0BA 1KELL 4G9DA 3RWHA 4AMKH 3CXHJ 2XZQH 5SWSD 1PSKL 4BFIA 1WZKA 3VWKD 4ZTPL 1G84A 1KBGH 5K59F 2OMNA 4NBYB 4DKDC 5GRUH 3L5XH 5E8EA 3GSXA 2C3VA 1D6VL 3IU3B 1FC2D 1MF2H 1YECL 5GRJH 2GSIB 1S7XA 4JPIB 4RNRB 3ARGB 12E8H 2E27L 1OM3H 4PJXA 4WENB 4KRPB 2X44D 5FKPA 3U1SH 5FDWB 4H8WH 4LSUH 3LD8B 1JNHB 3WE6B 3SDYL 1DUYA 1OVZA 4YHPA 3MRBA 1KPUA 3J8F7 4OM1L 1U8IB 4M7JH 1L7TL 3DECA 1KIRB 2QEJA 1NCCH 1OQOA 4WHYH 5C09E 3UTSD 4LLUB 3FZUD 3TH3T 4HJ0C 3KPMA 5DVOA 1QR4A 3IGAB 4LIQH 4KUCF 4LASL 4XCEA 2XFXB 4HEPG 5D7SL 3VFNA 6FABH 3K4DA 5IBUB 3IVKA 3LEXA 4DN4H 5K9KB 1BVLA 3T8XB 1DE4A 2IH1A 3CZJA 4R4BB 3LQAH 5D5ME 3QRGL 3AU1B 4EZMA 3V8CA 1UM5L 1BZ7A 2Y5TB 3C5ZC 3D0VB 1LEIB 4PJAB 4JZNA 4Z7UB 3HE6D 3LEYL 5IJVA 1K6QL 3TBVA 2V5YA 4CADA 2GFBB 4PR5A 3DTXA 2R9HD 3DWTA 4R0LC 4ZAKA 1VPOH 3P4MA 1UZ6F 2YN3A 1KACB 2JCCE 2NY0D 2VABA 5MP6H 2OXGA 2WK2A 3MV9E 4WO4A 5GS1A 1WFTA 4IRJD 4MAYD 2QKIA 3IDNA 1HH6B 3QB7C 3ZSTA 5KSBB 3SCMC 5HVHB 5EFIA 1TJHH 5I1KH 1YEEL 4Z76A 1BECA 5A43C 1BVKB 3T0WA 3L3IB 3A6BH 1S9XA 2UY6A 2NW2A 1N8ZA 1FNSH 3L5XL 3LN4A 1DLFL 2NY6B 3GIVA 3HR5A 3I3BA 4OCNC 3L3OA 1M7IB 4XNUL 4KVNH 4JFQB 1QOKA 1QBAA 4YNYB 5IMMB 1KELH 3PJSB 3QFJA 1M7XA 4OJFH 4DGVH 1A7OL 4F7CA 3N1GC 3KYMA 2DLGA 2GUOA 3CFBA 4MXVE 2Q8BL 4AL8H 1F3JA 3U46A 3U4AA 1BGXH 1YC7A 3TJEH 2I27N 3PWJA 2DBLL 1CXIA 3DV6A 3U30B 3QRFM 1G7LB 5F7KC 1WIOA 1BOGA 3T77B 5I8CB 4PRDA 4LLMB 1A4KA 3ZZ1A 3QUZA 5CWSA 4KQ3L 4ZPTA 1A6TA 5LBSH 4JREC 3MOBH 4CVXA 4GQ9H 1ORQB 4WIQA 4M7ZC 4HGWB 2Y36L 1JNLH 4C56B 4DQOH 2ZOKB 3F12A 5F7NC 2BNRD 5CP3A 4L3CA 4HC1A 2BNQA 5C0CA 5I1DA 1YMHB 1A9BA 2ZZUT 4ZDHA 2XNAB 5I0ZA 2FR4A 2RFXA 1EIBA 4OCWH 3ARBB 3CD4A 1NAML 4OKDA 1RK1A 3OV6A 3SGDH 5FGBC 1LD9B 4YBQC 1HEZA 4FABH 5FGBA 2B39A 3EDEA 2P5ED 3GJFA 1XF5B 4MSWA 5E94B 4XWOD 5D1QB 3DUSB 4OZIF 3KLAB 5FM5O 4QHMA 3RX8A 4XGZB 3VA2C 3WNPA 4FG6D 5D93B 2DJSA 1CXHA 2J1KA 4FQJL 5C9KA 5A40E 2W0FA 4JFEA 1YEJL 1KCUH 4H1LB 2C1OA 1A21A 1CFBA 4ODSL 3ZLQC 3ZL4H 4I8DA 4OCLC 1ZSDA 2ILLA 5FEBA 1SYSB 4WI6A 3VXUA 1KLGA 5EUOF 2W65A 4U6HA 4HUVB 5B38G 1T0PB 4ZXBD 5INCA 5C09B 2F19L 1QRND 5ANME 1IKNA 3ZTJG 5GJSH 5CS7A 3RGVC 4EN3D 2FATH 1GGIL 1EJOH 4R7NB 1SVCP 1NBQA 4PJDE 1KN2L 3V2AR 5A2KH 3VWJA 4Z7OE 3GSOB 4LGSB 2Q20A 2VTFA 2A6KA 4N1CA 3VRIB 3VU2A 4FHBD 4D9LL 5ICZA 2H32A 1FO0H 3RVTD 3OXRA 4P4RB 5BJTB 4JHZA 2CJUH 1EAPB 4EI6B 2D7OA 3EYFA 4UNUA 5T3XD 4NWUH 2VSDA 1KIQA 1N6UA 3UZQA 3M17B 2WM0A 1X5YA 1MFAH 4FRWA 4ELMA 2IQAB 1Z6JT 3QIWD 1FVCB 4X7CC 4NQCE 3GIVB 3GB7B 4WEBH 1TITA 1QQDB 3U0PA 3WMSA 4WWKD 4KTDL 3L5HA 4PLKC 4Y1AD 5D7JA 4R4FL 1G7QB 1QLFA 5L0QB 1J1XL 4ZXBA 5CBAA 3QEQD 3LIZL 5TDNB 2VDLH 4FNLL 1IZJA 1M05A 1HK6A 1A6UL 1WWWX 1JV5A 2QQNL 2YPKB 3P0VL 1BLNA 1MWAL 3VFRA 3CSGA 2BVUA 2C9AA 1XF3A 5BZDA 4G6FD 1R24B 1MLCA 1INEH 4KJQD 1JUFA 3CFDA 3N06B 2C3HA 4OGAC 4YR6B 2OCFD 4C57C 4OLYL 2ATKA 4AENB 5I8KL 1QFUH 4QOKB 3ZDXE 4OV5B 2J6EL 4UTBH 3SKJL 5C8JA 4MCYB 5EWIH 3RY4A 4KKCD 2KZ1B 4N1HB 1ODAA 2DICA 3VWKC 5HVHC 1DVFA 3OMZA 4F37K 1J87A 1GGYA 1MHPL 4K8RL 2GEEA 1UT9A 2FBJH 4UUJA 1TQCB 4MJIE 2R4SH 5JLZA 4IDJH 1P7QA 3VDBA 4MVBC 3D9AH 2MWCA 2CSPA 4CU8A 4PG9B 3MCKB 3BGMA 1RIHL 43C9B 4M61A 4AG4H 1NAKH 4PR5B 3MACL 5C08E 2Y23A 1JNJA 1NBYB 2GJ6A 3FQUA 1HHHA 2IADB 3EOBA 4IJ3C 4OUOA 4P5KA 4Y5YB 3S37H 4P5MA 3OAYH 3ZE2F 2CXGA 5T5NF 1HCVA 3UTPD 4EQ3A 4PV9B 3JWDH 1Q38A 3WNOA 3BE1L 5F3HA 4GBXA 1U8MA 4GQPH 1IQWH 2HYMA 5ADPL 3MV7E 2FZ3A 3MBEC 3KDMA 5D72L 3SKOB 1OTUC 4R8WH 5IWLC 1HYRC 1PKQB 3B6SB 2ZNXA 2VXVH 3PHOA 1NMAH 3MLUL 2A6JA 2VKXA 2HLAA 1UM6H 1I3VA 5IB1A 4LPTA 3BIKA 2NXYC 5BZWA 1FFOA 2NR6C 1NBVL 3FO0L 1NMBL 3V6OC 1WLHA 5DK2B 4OIBA 5HSFA 5EU7E 4MDJA 15C8L 3C6LD 5F96L 4F9PA 1AI1H 1E4XL 3HS0A 1HKLL 4UINL 4ZPVB 5D1QC 3U7YL 3EYFB 4DUWA 1FG2A 3EYUH 1KTLB 3KNBB 4ZAKD 4QHLA 1F3JB 3U46B 1FAIL 1JWSB 2R56H 3EYOB 2EO9A 4PGBB 2R29H 1KTRL 1IEAB 4JO1H 1NEZB 5FYKE 3BP6A 4HWZA 4L4VE 3PP3K 4JM4L 1VADA 4AM0A 2DMBA 3BEWA 5JHDD 3RNKA 1I75A 2ZOLA 1QPXA 3QEGH 3PP3H 4GS7C 4XMKL 3IFLL 2YD2A 3OKKB 1XH3A 3WXVH