1WZ1H

Crystal structure of the fv fragment complexed with dansyl-lysine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHATYYAESVKGRFTISRDDSKRRVYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVSAEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig light chain
publication title Conformational dynamics of complementarity-determining region H3 of an anti-dansyl Fv fragment in the presence of its hapten
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2005-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wz1H00
2OTUB 4Y5XB 3TT3L 1GIGH 3U0PA 4M03A 1EEQA 2DDQH 2QR0A 5I1KL 1T22A 3IU3B 3QUYD 1FFRA 1XF3B 3FHQA 5CD3A 4C56A 3GMPB 2X4OA 1FO0A 5C9JA 1XIWD 5IEKB 2O93L 1RZKH 5H2BA 1RUKH 4RZCB 4DN3H 1JTOA 4HIEA 4KJPD 1MRCH 2DICA 4LNVA 5FYLD 1CG9A 3O6FD 5MERB 3KWWA 3VG9B 3HZVA 4P3CL 5JTWA 1I85C 3CMOH 4AEHH 4AZ8A 4KJYA 3RA7L 3GKWL 1C08B 4EDXA 4P2QD 4PGZA 3VXNB 2VLJD 4C83B 1AGCA 3FT2B 1Q9LB 2BY0A 3ZLQC 1XR8A 3FO0L 3FO1A 1CE1H 4MNHB 1D7FA 1QSEE 5IMOA 3WO3B 4RQQB 3MLXL 1S5IL 1S8DA 3T3PF 5GRXG 4GLRI 5ITFB 4GXVL 3O3AB 4QO1A 3ES6B 4IIQB 3CXDH 5J3HD 4KI5C 3RAJH 5MENB 3L9RB 1VSCA 3O2WL 4TSCH 5HPMB 2VC2H 4S0TD 2X10A 4L8SA 4GW5B 2FO4B 4OZFH 2Q6WA 4XWGH 1NAKH 4G7YL 4YQXL 4UTAL 3WDHA 3GHBH 1QFUH 3FTGB 2B20A 3MROB 4QHLA 1KLUA 1SHMA 1W0VA 4QGTA 5IBUB 1BVKA 5ADOL 5C3LD 5I73B 2HN7A 4S10A 3OXRA 5KTEH 3BKJL 1FNLA 2ZCLL 1K6QL 4ZFZA 4MNGA 4ZS6C 3OJDB 5TGBB 1EGJA 1FO0H 4YHIA 5J13C 3RY4A 4X8XA 3ULUH 1DQTA 2ZJSH 3U0WH 1PG7L 4NZRL 2NNAA 1R6VA 2ICWB 4WEBH 2DB8A 2GJZA 1A9EB 1BZ9B 1Q8MA 3OR7A 3RWHA 3VXMA 4OUUB 4JFFB 3DO3A 4N0UB 3NCCB 2EDTA 3QFJE 2DS4A 3WFCL 1J1OH 5BS0E 1MFBL 1IAKB 2J88L 3LQZB 4O9HL 4QXUH 1NFDE 1H8OA 5CGYC 3W9DB 4CN1A 1N26A 2AJVL 2R29L 3MA7B 5JUEH 3ARYA 3QEQD 4XI5C 2GTZB 2B5IC 2ZG1A 4K8RL 3BOVA 4XC1L 5FB8A 4U6XB 3KYNA 2B0SL 4YDKL 5F9JA 5LGJA 2EYSA 4M7JL 4P99A 1R3LB 3C5SB 3AREA 1U8MA 3W0WD 4M3KB 1HQ4B 4JR9H 5C08D 2PO6C 3BKCH 1LK2B 5CD5C 2OQJB 4P9HL 3RTQC 1IZJA 3NZHH 5CJOL 4RAVA 1UXSA 5DQ9B 3RX7A 2YD4A 5EU5A 4DAGL 4CVZB 4M8QB 4OCWL 2C1OB 4RX4D 4MAYC 3JV6B 3MRFA 3GSQB 4UILL 4NHCL 2AEQL 3HNVH 3MOBL 1U3HC 1NLBH 1KJ2H 4JLRA 3CUPA 3DV6A 4FXKA 3UJJL 3MX0A 2F58H 3FT3B 4GLRH 1IBGL 1U2HA 2J4WH 3WDIA 1SMAA 3RVWC 3PWVA 1KCLA 2MQ3A 3REVB 2V5SA 2E27L 3AS2A 4H1LB 4AJ0A 1AJ7L 3VWKD 2Y5TA 3IDIB 5C09B 5BMFL 4AEEA 2YPLB 4UIKL 5CJXC 1UB5B 3DO7A 3DX9A 1OW0A 3SCMD 5LWYL 2B5IB 4O02H 4DK6A 4U1SA 4BSVA 4KZDH 2DLTA 1NGXA 1S7SA 1MCEA 1TZIA 4U1HA 4JN1L 3O9WA 4A6YL 3D9AH 3VGGA 4Q74A 2XWJB 2PO6B 5T5NF 3QRFM 2QQLH 3FOLA 2EIZB 4DKEL 2X9XA 4PJHA 4M43L 5E7BA 2GJJA 4Z18A 1P7QD 4LP4A 5F89A 1EBAA 4KJQC 3O3BB 2EDHA 4MAYB 1JZ4A 2N7AA 1NMBH 3MRLB 3HUJA 1U3HB 4L4VD 4X6BB 1E6OH 2DQHL 5F9OH 4D0BB 1XCTB 4G8GA 1M7XA 4P5TA 1ITBB 1N5YL 4R9HA 1XH3A 1LE5A 4L8CB 2Y23A 5CLWA 2EE6A 1Z3GH 3UZQA 5HDQL 3WDJA 1T3FA 1F45A 2XV6B 4R3SA 4JFOA 2D2OA 2YZ8A 2VDML 5IQ7L 3MUJA 3QUXC 4FQLL 3RJDA 1S7XA 4L29A 5LCVL 5IB1B 2W0FB 3PV6B 2D31A 3DHJA 1NGPL 1RJZA 3BD5A 1DQLL 1MRFL 3SPVB 5FYLL 2BK8A 5EDXA 4YXKL 1UB6A 3TPKA 3TT1L 3GMRA 4NKMB 3U9PL 2FCBA 5M7QA 2OK0H 3FO2B 4QRPE 4XNZB 3UTTA 5HXMA 1NL0L 5DO2D 4WGVB 1BZ7B 2ARJA 3FB7A 5FV2A 5C07B 4GSDL 2ICES 3S5LG 5F3HA 4DCQA 4YZFF 5J1TC 2DQIL 4PB9L 3PNWB 4LPVA 2CIKA 3QQ9D 2FEDD 3CGTA 5GQBA 3K7UA 2WUCL 3VFTB 5HJ3B 2YUVA 2WK2A 1EJ6A 4U2ZA 4Y2DC 1QLFB 4HHAB 3ZDYE 1MWAL 4JDZA 1B0GA 2UZXB 4P49A 4RBPK 2FGWL 4J3XA 1KEML 1R5IB 1MNUH 4RIRA 3U4EA 1CGYA 3MACH 1AQDA 4U4BA 1H5BA 3OKNB 2VDPH 5ETUB 4HWZA 4UOW0 1RK0B 3OKKB 3BAEH 1TTFA 2HTKD 2ID5A 2Z4QA 3JV0A 3MRGA 3G6JF 5DD3L 4YPJA 4HXAH 1NEZG 1MSPA 3QUXB 4P5MB 1QEWA 4LP5A 5IVZB 2H41A 1TFHA 5FK9A 1BPVA 1MREH 1OP5K 1G1YA 4MJ5B 3PWNB 4BSWB 4PJFF 4F33B 1UWEH 1WEJH 3LQAH 5DJZB 4Q0XH 4ONFH 2IFGA 1K4DA 4U1GC 3HG1A 3BJLA 4O2CA 1OARH 2XZQH 1AD0B 4G6JL 4UT7H 2VDQL 3UBXB 4L3AA 3L7EA 1X5AA 4YHZL 2QQKH 2Z8VC 4BQ6A 1BFTA 9CGTA 1K8DA 1EO8L 2NPLX 1JGUL 5I30H 1RJCA 1C16B 1CE6A 3F5WB 4LSPH 1K2DB 4YBQD 1U6AH 5F7DA 3PJSB 5FGBA 2R0LH 4P2QE 4Y2DB 2EDXA 4IBLT 3SDCC 5TPWH 5I66A 3TFKC 1PG7W 3RWIA 4ODWB 2X89A 3IGAA 4QOKA 4X6CF 3ZKMD 4JCMA 4N8CH 3L1OL 4X0KA 4H26A 5IHUL 3K8LA 5D5MA 3ARBA 2V7HA 4FP8H 4Z7UF 1L6ZA 4M9OA 2XZZA 2YMXL 4WFHD 4Y89A 1QTYT 4YHOL 2QQNH 3SKJH 2Y36H 1K85A 3SGJA 5DFVD 5I17A 4LHUA 5D1QD 1N4XL 2C4FT 5B39A 3OR6B 4N0CC 1N6VA 1O7VA 2QHRL 2OL3A 1AH1A 1OTSD 1VENA 4CW1A 4PGEA 4PJEB 3V6OA 4PD4J 4U1GB 3ZL4H 4ZTOL 3LN5A 4O2FA 4F57L 4ODUB 4OCSL 2DTML 1LQSR 3RVXC 1T1XB 5GJSL 2BY1A 3HZMA 4PJAE 1FZOB 3PGCA 3CFBB 4UBDD 3VD3A 2AK1H 2ESVE 3Q1SH 2ZCKL 5FM5M 2AXJA 1U8IA 3SDCB 1LO0L 4J4PA 4YJZL 4F8TA 3KG5A 3HTLX 1RJYA 4O4YL 4O51B 4XPGH 1AXTH 5I8KL 2CXKA 4ELMB 1IAMA 4KZEL 3GI8H 2XQBL 1OP3H 3SDDA 3OJVC 4OLVH 1TJHL 1H3XA 2Q76B 3DVGA 1F58H 2JIXB 3VFNA 2W65B 3MRMB 4NGHH 1K9TA 3FL7A 4K7FB 5GIRA 5CJBA 4ZAKD 2QSCH 2VDNL 3QEQE 4S1SL 4MVBD 5JPMA 1AGBA 4M5YL 3LEXA 3CVHL 3DUHA 5E03A 2VDRL 4KH2A 2OXHA 5D2LB 5E4EC 3QXDB 4PJ5B 5FYJU 3IB4A 1NBZB 3HMXA 3JWDL 4DN4L 2NW2B 4PP2A 3E6HB 3GGWA 3P73B 3JTSA 2CRZA 3DYMA 4QCIB 1ES0A 1C7TA 5EU4A 4RFOH 1A6UH 1YPZF 2OL3H 4OGYH 4ZMAT 1MI5B 1T04B 2HKFL 4HG4J 1J86A 1CGVA 1DLHB 4G9DB 3VFGL 3C6LC 3PQYA 3MV7D 3S4SB 1XGRA 2FYYA 4TUKL 3CPLA 4YPGA 5IQ9A 4OKDA 2UWEE 5E8PB 1Q9WA 3ET9F 3W82A 1H3UA 5KVGL 1WT5A 4TPRH 2AQ1A 1IQWL 3OHXB 2Q8BH 4WI5A 3QHFH 1OAYL 3GBLA 4QF1A 1I9RH 8FABB 5EWIH 3MODH 2ITCA 4FQXA 2OS7A 4Z7WE 4WCYH 1F00I 3TBTA 4G43B 2WSKA 2VLLB 2AABH 5CZVL 4FQPA 4NKIL 4LF3B 5C8JA 3NABH 4NDMA 5T33H 5J8OA 5ILTL 4RA3A 1R24B 3GSWA 3WE6B 3HNSH 1FVDA 5BQ7A 2SEBA 1ZHNB 1DQDL 3O3EA 5E4EB 3L6FB 4QWWD 3G5ZB 1CFNA 3DTXB 5DUML 1JHKH 1A6PA 4NO2A 1KELH 2E6PA 2EDOA 4PJBA 1A7BA 3MFFA 4LKCB 1MRDL 3SKOA 4NQVA 3C6LB 3MLVH 5JQ6L 3VU2A 5HHOD 1A6TA 2LU3A 2UUDK 4L4VE 1OB1B 1W72B 3CX5K 5C6TH 4OF3A 1EEUA 1FNAA 3MCG1 5HHXL 1BBJA 2AI0L 3QDMA 2Y1VA 3QZWG 2R23A 3WIFB 5DHYB 1JNJA 3TJHD 3M1BA 4RGNC 1J18A 3P77A 4LLYB 3QNXB 4LCIL 5E70A 1JPFB 5EPMA 2WINA 4HZLB 1C5BH 25C8H 5J7CC 3HZYB 5MEND 1Y18B 3OAUL 2HLFC 4KUCF 4UIMB 5IB3B 3GBML 5KS9A 5CINL 2L7JA 5ELIA 4DFHA 4PRPB 3CXHK 3WEXB 1OHQA 3C87A 5DJ6A 5AZEL 4ZXBC 3SDAA 1AFVH 3DETC 1XF2A 3EFDL 5EZIH 1NJ9A 2NCMA 4NBXB 2BY3A 5HGAA 2H2PC 3LKRB 1CXKA 3T4YB 4KVCL 2DKMA 3HC0A 4ZOCA 1E28B 3N50A 3BP7A 4J1UA 5KW9H 4IRZL 4QY8A 2BNRB 2R2BA 3EOBB 1V7NH 3EYSH 5KSVA 1MELA 3DI2B 4RDQG 3GIZL 1D9KC 3HI5L 4JFFD 2DQCH 1D5BA 1KCKA 1S3KL 4XGZB 1KULA 5EOCJ 3D69B 5GZNC 4RGNB 3AFLA 1EK3A 1DBJL 3BP6A 1DLFL 3BH9A 3P0VL 5GGQL 1AGFA 2GFBA 2VXUH 3P9WB 5JLZB 2K3TA 3A67L 5K9QG 5B8CA 2Z31A 1CK0L 4ONHA 2H8PA 2PKDA 2FX7H 5FHAL 3ZYIA 1T1WA 1J0ZA 1FDLL 3QH3B 1HNFA 3BZFA 3TA3C 1WSST 5IKCA 4WHDA 4CJ1A 3O6LH 5F1NB 5ICYA 2YEZA 4ZXBB 4ETQA 1FGVH 2X6MA 5DRNA 3I3EA 1QD0A 3U7YH 4YAQA 3VW3L 1NFDF 4ZS6D 3D39B 3T0EA 3K2UH 3EFFB 1PYWA 5MEPA 4P4KA 4M1CC 3FN0L 5LBSH 1NGQH 1OTTC 5INCB 4QHUA 5C0AA 4BELD 1F4WL 3B3IA 3TJEL 3W5MA 4D2NA 1RULL 1P4LB 1A2YB 1BD2D 4L9LB 3N1FC 3L95B 3HE6C 2COQA 3BX7C 1F4XL 1BVZA 1D9KB 3CNKA 2IH3B 3ARDC 3T3ME 3I2CL 2AJUH 1GGBH 3IVKB 2PYEE 4NNXA 4N0FA 1EFXA 1UQSB 3H9SA 3MREB 4JKKA 1G7QB 1ULVA 3P30H 1T66C 1UEMA 3NFSL 1ITCA 5CGYD 3P4NB 5C09D 3GRWL 4GJTB 4WUKH 4JVWA 1FHGA 4LSSH 3ARFB 2E6QA 1S7UB 2AJXH 4XZUA 5FYJD 4Q2ZB 5DF0A 1W8OA 2HTLC 4X7SL 3GSNL 2VXVL 3HA0A 4LFHD 3TA3B 3CVIL 5MP6H 1RUPH 3HMWL 2XZAL 2AEPH 3MV9E 4JG1H 4L8BB 4HKBA 3P0GB 2XN9B 4PRNA 1HZHL 4PY7A 1Q0YH 5C0RL 4HBCH 1RZIA 1E4XH 1Q1JH 2YOCA 5I1HH 2AXGA 1E4JA 4OFKA 3WFEL 3FQTA 1BX2B 5FO7A 3BMVA 4MDIA 3QCTL 1BFOB 3LEVL 1F4HA 3RI5K 1KUMA 1ZT7B 2DAVA 4MAYD 1NBVH 4J3UA 1B2WH 4X99B 4Z7NE 3HE6B 1U3HD 4UDUA 5CZKA 5F1KC 3QDAA 3QWOA 1HILB 2JK5B 3L5XL 5I1KH 4R97C 3QDJE 1XZ0B 4MDJA 4RMRA 1JE6A 1B6UA 4GW4B 5JR1L 2JCCE 1MIEL 3QG6A 1CU4L 4WV1A 1MJ8L 3FRPA 2FHCA 1MLBA 1IJ9A 4RAUB 3RVWD 1FORH 5EU6E 1CR9L 4Y4FC 5FKPB 1T20B 5HVFB 1HHKB 1IC1A 2W9LA 3L3GB 2MKLC 3SKUD 5BJTB 5I16A 2EECA 1H3PL 1VKXA 4ZSOE 1ZS8B 5I15L 4P3CH 1CF8L 2CKBB 4PY8J 2X42A 1HSAA 4BFGA 2V6HA 2VN7A 1DVFA 2FR4B 4OZFG 4P57A 5IF0B 4RSVA 3K46A 3PDOA 1FH5L 1A4KB 1G84A 5D4QA 3FO0H 4MX7B 5C07D 2ZUVA 3BEVB 2NLJB 4LLDA 3CFJA 2FZ3B 3F7YB 1G1CA 1GAFL 5CEYA 3RGVC 4JM4L 4NCDA 5CP7A 5IB5A 4L3CA 1PZ5A 3EZJB 2Y4SA 3WSQL 2DMCA 4DGIL 4KKAC 5JDSB 4MCZA 3QA3B 2XXCB 1JRHH 5JDJA 1DANU 2A9ML 3O2WH 1M05B 4OFVA 4U1IB 2BJMH 4R97B 3C2SA 1JZ8A 4G7YH 3WMSA 1KLFA 4YQXH 1F4AA 3MR9A 1IC4L 4BQCA 15C8H 4HUXB 1Y6MR 4NBYB 3O3DB 5IJKA 4AG4H 4X5XA 5ADOH 3CDCA 4OV6F 1HIML 5D8JL 4Y4FB 3ZKXC 2H6PA 4ODSL 2VITA 2ZCLH 1K6QH 5E94A 3V5HA 4LSDA 3PWLB 4NQTA 2X4UA 3QUXD 3ZDYF 3GZKA 3KJ4C 5CSBA 1KNOA 5ANMB 3EDKA 3DGCR 1INDL 1PG7H 4NZRH 1KN2L 3BGMB 1FYTA 2CGRL 4XRCB 3WJJC 5T3ZE 5HD8C 1NDGB 4ZYKA 3BPCB 3RUGA 5JXAL 3ARWA 4C57C 2EO1A 1MAKA 4MD5B 2AV7A 3TO4A 3V0VA 3KPOA 3WFCH 1P84J 1KCSL 1BWWA 1IAIM 3BW9A 3Q3GA 4JY5H 1GRWA 5IHZB 1FP5A 1MFBH 1YN7A 2J88H 4O9HH 3RGVB 2FECI 4W6YB 5EG6C 5HHOE 2AJVH 4MB5A 4YE4L 2AQ2A 2EIDA 5ABDE 5ESVB 2Q7YA 3DRQB 1S9WA 4ZFGH 3S34L 1ZGLA 1D5ZB 4JFYA 5IFAL 5DSCB 4NNYA 4W6XB 2B0SH 4M7JH 5L9DL 4JPIB 2DLGA 5F21B 3C09B 4MA3B 1LP9B 3ZKXB 4X9HA 5TE4L 4NRZA 5MENE 3HN3A 3VXTA 1VB9A 1N59B 5CAYB 1CL7L 4HUKB 5CJOH 5D2NE 3IJHB 3TGXA 3KPPB 1S7TB 4UQ3A 5DK2A 1LWRA 2KZ1B 3KJ4B 3RKDC 3TIEB 4DAGH 1J11A 2NZ9C 3HNTL 4OCWH 4G6KL 2I9TA 3KPSA 4D8PA 4NHCH 1QR4A 4NQSA 2AEQH 3MOBH 5CJQL 3UJJH 3L3IA 5D6CA 3RWEB 1IBGH 4JFHD 2NYYC 4MAUL 2VKXA 4TNWF 3RX8A 5HDLA 2ZG2A 1AJ7H 4O58L 2IAMA 3UTPD 5BMFH 3SDCD 4NO3A 1FBIL 4D9QD 1NSNL 4UIKH 3TFKD 1C1EL 1O7SA 2QKIA 4JDTH 5LWYH 5IJVB 3FQWB 1ORQB 4ZO6A 3ZTJH 1R3IL 3KYMB 1R5VB 3DMMC 1WBXB 4JN1H 3VH8B 3HPJB 4HV8A 4PJAF 4RNRB 5FYJL 1GGIH 1U36A 3MUGB 4CRPA 3O11A 1ZA3B 5CZXC 5EIIB 1FG2B 4M43H 3D1MC 5FGCB 1NDMA 1Z5LB 4R4BB 4WHCA 2O5YL 4PJ5D 2LU4A 3M07A 3S37L 1PW3A 2R0KL 2Y07L 4G9FB 2DQHH 2FBJH 4JZNA 2V9RA 1WFTA 5FIEA 3ARSA 4X4MA 1YNKL 1MI5D 1S5HB 2YD8A 4JZJC 3RVXD 3ZKNC 5C0DA 4GH7B 3VFPB 3BWAB 5SWSD 2CUHA 3MOAH 5H35A 3ZHLA 2VZOA 1OAKL 1BD2E 3LKNB 1UZ8B 43CAA 2VDMH 4FQJL 1SJEB 5IQ7H 4P2RE 3G6DH 1RZ7L 4OJFL 2R1WA 1F6AA 3FMGL 3JWNC 1A1MA 5I75B 3UTZB 5HYSA 3ALPA 5J1AB 5GGSA 1NGPH 5F88B 4QRQA 1MRFH 5FYLH 3ILPA 4Y19B 4CN4A 4MSWA 3LRGA 4YXKH 3TT1H 1ZLSL 1RJLA 1I1CA 1CCZA 1NL0H 2W0KA 3SY0B 4RFEA 1RAMA 2W0PA 1JMZA 4OLXL 2CUIA 4KXZH 3AU1A 2UWEF 4PB9H 4NP4L 1L7IH 1A14L 3CSGA 1QRKA 1T0MA 3SJVB 3CH8A 2WUCH 4CUCA 2D9CA 5C86A 3EOAB 3ZSTA 4YHML 4CVWA 1M7DB 1IGYA 4Z7WF 4QRSB 4GKNB 3OAYH 3HI1A 1KEMH 4EEEA 4WEUD 1CDHA 4EDWH 2AGJL 4IOIA 1G6RB 4I0PC 1YY8A 4LOUC 1ACZA 4KMQA 4XPTH 1I1FA 5KG9A 4JANA 4HIJB 1RHFA 4ZTPL 2NY5C 2W07A 5A16A 5DD3H 5C08A 1KIPA 1RUML 3QI9A 4UUJA 1JN6B 2V9TA 5HGHB 3WD5L 1IAOB 3PABA 1J12A 1UXWB 2OSLA 1FVCA 3SQOL 3MLSL 3LSOA 4F7EB 3B9KB 4OFYD 1IAIL 4HKXA 1LDSA 3GMOB 4QT5B 3L3KB 3BEWA 4KRPC 1GYAA 2VDQH 5T1DH 4POUB 1HHJA 1AIFB 3SHSA 3P9LB 1EO8H 1JGUH 3CK0L 2FIRT 2J8HA 1T5WB 4AM0A 1S7VB 1IKFL 1DCLA 5IROC 4PRPD 3ZHKA 4U6VL 1U8PB 3X12A 3BP4A 2NY7H 5D7LA 2BOBB 4MNQE 4X7DC 1NGYA 4JJ5A 5SWQA 4D9RD 3ARZA 4CADB 5CGTA 4XMLH 5C07E 5ESQA 3WUWA 3PWPB 3O2VL 2WLYA 3L1OH 1RHHB 4I0PB 3N1GC 5IHUH 2BNRD 1KN4L 1XCQA 3BP5B 4LNRB 2GAZA 1ZT1B 4UDTA 2YMXH 3K8MA 2X7LA 1QACA 2CDGA 5EC2A 1LGVA 4YHOH 3QUZD 1IGTA 1N4XH 1S9XB 3TCLB 3B4NA 4J3OC 3MRPB 3RZCC 5C1MB 5IK3A 4YHPB 2R2EB 3DX8B 2QHRH 1FQ9C 5TDOA 4U1NA 5T1MB 5EOTB 1LO2L 3F65A 1YEIL 4ZTOH 4F57H 3HR5B 3BIKA 4KRPB 3SDXE 4XCCH 2DTMH 5E7FA 5D7IA 2Q3AA 3BKML 4PGJA 4KHXL 4FZ8L 3GB7A 4ZOAA 4PV8A 4PJ9C 1X5YA 1YEGL 3D85B 1JFQH 4PJXA 2I25N 4K55A 2ZCKH 4LLVB 5IOPB 1CLCA 1VDGA 1F3DJ 5FGRA 1S7RA 4PTUA 3ULVE 2E9WA 1OAZL 2H2PD 3RJQB 2OM5A 4HS3A 5I1EL 3D39D 4KZEH 5JMOC 2XQBH 5EUOB 4GS7B 4LRIC 4L4TD 1MF2L 3TPUB 5MI0C 1SJHA 3MRDB 5J11C 2VWEC 5DS8A 1T2QH 2BNUB 3BESR 1X5JA 4F7CA 2VDKL 2KDGA 4EI5C 1WJ3A 1D9KD 1BOYA 1NBYA 4NN7C 1JI2A 1VFAA 4G80A 1WC7A 2VDRH 3RZCB 3LRSB 1HINL 2VXSL 5GZND 1J05B 1U8NB 2JELH 3EOTL 5E1AB 3LKSB 4OCLC 2EC9U 2PETA 2NY4C 3JWDH 4HQQL 1VFUA 4HFWA 4DN4H 3WL9A 1DUZB 3UMTA 3PWJB 1MHPL 4XCFH 3JSSA 4I18C 3I85A 3ARFD 1TVDA 3MV8A 5T1KA 2HYMA 3KDMA 5F7HA 4PJ7B 2HKFH 1NMAL 1XF4B 3T3MF 1FLRH 3VFGH 4LGSB 3ROLA 3WS3B 4PJ9B 3ALWA 3C60D 3BJ91 3STLA 4U1KA 3QNZB 1I7UA 2HFFB 5JHDB 4TUKH 5IT2L 4R2GD 3IDNB 4PJEE 1F3DH 5IW6B 1V8HA 1WTGT 3GBNL 4PB0H 1OCWL 2HFEB 1NC4A 4I3SH 3VXUE 5DJCA 1IQWH 1ETZA 5T3XD 3CSBA 3O45B 1OAYH 5IBLD 1OTTD 5MI0B 5T1LB 1QA9B 1N8ZB 1T0PB 3K80A 3UTPE 3RY5A 4MA7H 5CZVH 3HE6D 4GRMA 4NN6C 4NKIH 4TULH 4OD3L 3UJIL 1WK0A 1RZ8B 4YDIL 5ILTH 2AJ3A 4FQQA 2B2XL 3S35X 4S11A 1T03L 1RIHL 3U83A 4OLWL 4QNPF 3S37X 1ZMYA 1DQDH 2D0HA 4PJIB 4EQ3A 2AXFA 3L5WB 1MUJA 3TN0C 2HFTA 4MJIE 4EIZC 2W60B 2CLRB 2NY4B 4OD2B 5E00B 4F7TA 4LVNC 1FNEB 3L3OA 3OG6B 4I18B 3QUMA 5DUMH 5L8JB 4GO6B 4Z7NF 2V7NA 5F1OB 3ABZA 1EVUA 3JUYA 3FT4A 4X7TB 5DJAA 2HTLD 4KVNL 1CWVA 4X9GA 1TMCB 1QVOA 3D3VA 4M4PA 3V52L 4NJAL 3PE9A 3DXAB 5GGTA 1UM4H 2JCCF 1XGYH 5JQ6H 2HG5B 1D5IL 2Z93B 1TCMA 1A7RL 4L4JA 2PW1B 1NANH 4XBGB 3UO1L 2EXYD 1T4KA 5L6YL 5ISZA 3OXSB 4HUMB 2VR9A 1MI5E 2YK1H 1VFBA 1CZ8L 1MHHB 2GSIA 3B2UD 4OAWA 2P5EE 5SWSE 1NC2B 3DHMA 5DVOA 1KYOJ 2DYPB 3EJYC 4JGMA 1A6AA 4FFYL 1NLDL 4NN6B 3OAUH 2FJGA 4MCYA 4PRIA 4HIIA 1CFVL 4QRUB 1OAUL 4Y8AA 2RR3A 1Z2KA 5AUMB 1HEZA 4PJCA 3O4LA 5CINH 5GGVL 3SBWA 4I2XA 3TN0B 5AZEH 5I2IB 3WV0A 4FQIL 3EFDH 1KJVA 1O0VA 4JFEE 3U0PB 2VISA 4KMLB 2QR0B 4GRLC 1DP0A 3QPQC 3IETB 1OF2B 4IRSD 4KVCH 2YKLL 5F3BA 2GJ6A 4G8EA 1KPVA 4J3SA 4S2SA 5HHPA 2GY5A 2ZOKB 4Y5YC 4MJ4A 2X4OB 1JGLH 5C9JB 4XNUL 3GK8L 4PLNC 5H2BB 5IEHB 1J8HA 2DL9A 3VD7A 3GIZH 3V9FA 3H7BB 3HI5H 4M7ZC 2QLVB 2XTJC 2WBJD 4ETYA 2NX5A 2IG2L 3HZVB 1S3KH 1YJDH 1FPTL 3HE7A 3K3QA 5CJ5A 4OSUL 4KJYB 2G75B 1DBJH 3RGVD 4HFUH 3REWA 1DLFH 3RU8L 3P0VH 5GGQH 4EDXB 4RMSA 4H25A 4CVUA 3GSNA 4KKAD 4I3RL 1AGDB 1MFAL 2XFXA 5SWZB 5F1IA 1EEYB 1CK0H 2VL4A 3FO1B 3IJSB 2I26N 5FHAH 5IMOB 4YEEA 2AK4E 3V0WH 1T89A 1GGTA 1EEZA 2BNQA 5I8OH 2P43B 5HHMB 2H32A 3AAZA 2MMXA 4NM4L 4ELKA 3MRJA 3PHOA 3VW3H 3MOQA 4HJ0C 4GRLB 1E4KC 1RURL 3NCMA 5JW4Q 2Q6WB 3RY6C 2A73A 4F2MA 3FN0H 1ZHBB 4DTGL 3WCYA 3WNMA 2UY7A 4QHLB 4Y5YB 3B5TA 3AREC 1YMME 4NRYA 1F4WH 3TJEH 4DFIA 4TUOA 2HN7B 3LMJH 5MEOA 1P9MC 5F7NC 4N0RA 4MMXC 1F4XH 2ZUTA 4ZFZB 5IIEA 1YEKL 2XTJB 5D7KD 4YHIB 4XNYL 3I2CH 1XGQB 2DM3A 4YIQA 4NKQB 3MLZH 2VLRE 2DBJA 1XF3A 5E8NA 2GHWB 1G9NC 3WN5A 1IFHL 5CBAA 3L7FA 3MXVH 4OCYL 2GJZB 3OR7B 5TF1L 2P5WA 3NN8A 4RZCA 1KCVH 4UNUA 1UCBH 3T04D 1A7OL 5HGGS 5MERA 4FFVD 4X7SH 3UXFA 3GSNH 1WITA 2VXVH 3V79C 1ZE3C 3HMWH 2XZAH 4HGWB 3IYLW 1HZHH 3ZKSD 1CVSC 1IEAA 4QYOA 1ZVYA 1MCDA 1VPOH 5BRZB 1I7TA 1OW0C 3EYOB 4D3CH 5B22A 1WZKA 3WFEH 2H32H 5E8EA 2FX9L 3GJEA 4IRJC 5FB8B 5EZOL 5F9JB 2Z0BA 4OZHA 4OBSA 2EYSB 5LGJB 1DQML 3RKDD 1INQB 4WW1B 3AREB 1F97A 1U8MB 2NZ9D 3O9WC 4GT7A 5EULV 4PJFA 2A6DB 3L5IA 2IMNA 2A0LC 3ES6A 4ZUTB 3F7QA 4G9FD 4OF0A 4R4FL 5T3XL 5HPMA 5A1AA 4WI3A 5FHBL 4GW5A 2FO4A 2R0WH 4ZNCD 4L4TE 4EBQL 1MIEH 1CU4H 3BXNA 1MJ8H 4MXVE 3FTGA 3MROA 3IKKA 3F58L 3NTCL 2YD3A 1ZHLA 4JLRB 4DGYL 3OAZK 4FXKB 3RQ3A 2A6KB 2X1XR 2FD6L 3QG7H 5DJXA 4M62H 1QKZL 3EGSB 4BQ9A 2ARWA 3MMEB 3OJDA 5I15H 1CF8H 1I85A 4YDJB 3TYGH 3PWVB 1CL7I 4MLSA 4YH6A 2Y5TB 3VDAA 4Y19D 1MCSA 1QHOA 2ICWA 2ADGB 3NACL 4HULB 3RWFB 2CKBL 3AB0C 3KJ6L 3MRRB 3DO7B 5EFIB 4OUUA 5CZXD 4BZ2L 4Z0XA 4N0UA 4EVNA 1NGXB 1QRNA 1E6JL 2RCSL 3KR3L 2ICWJ 3FHAA 3NCFB 3SJVD 1GAFH 1OGAA 3O9WB 5IHLB 1Z6JT 4JM4H 3LQZA 3BKYL 5IW3A 2OYPA 3WSQH 4DGIH 1VGKB 1OOAA 3W9DA 1NAML 1PKQB 2A9MH 3CFIC 2P8MB 4JHAL 1U3JA 5FUOL 2GTZA 2ITDB 3IU4L 5F89B 2IBZY 4NZJA 1IC4H 1MCNA 4U6XA 4HCRA 4Q6YA 4N1CA 4EN3A 3KPNB 3N1MC 5DQDL 3HUJB 1HIMH 5D8JH 1HQ4A 4M7LT 4AEFA 4BM7A 2OQJA 4NNPH 1W8NA 1XH3B 4GQPH 1LE5B 2EIEA 4MB3A 5DQ9A 5HGBA 5D7JC 3VXSE 1INDH 3B9KD 5F7KC 3FQNA 4CVZA 1QUNA 1VEOA 3JV6A 3GSQA 2MWCA 4CKVX 3RBSA 3AB0B 4S1QL 4LPUA 5JXAH 4PLJC 5EORL 1S7XB 1B88A 4ZS7L 3ZT6A 1QLRA 1JF5A 4RWHA 3U4BL 2D31B 5J57B 1RJZB 2IGFL 4R96A 4KKBC 1GH7A 4M6MH 3REVA 1HQRB 1UB6B 4H1LA 4O5LH 3IDIA 3GHEH 1UC6A 5C09A 3DOSA 1TZHB 4X6DB 5GPRA 2JJTA 3V7AE 3WO4C 4BYHA 1FC1A 3TBWA 2YPLA 1UB5A 3S34H 5F3HB 4DCQB 2BDNL 5IFAH 4JM2D 3PWPD 1JP5A 4U3XA 5LGHH 4I0PD 3DX6B 1HYSC 1XFPA 4PJGB 5FGBC 4DW2L 1FV1A 1MCJA 5E2VH 1WFOA 3O81A 2PO6A 1DE4B 4HCRH 3IFPB 5GS0C 2EIZA 4OCRL 1CL7H 2F53E 3RTQA 3U4EB 1P2CA 2EDYA 2VLKB 4YWGL 1T1ZA 4GKOA 1NCUA 4N9OB 1KGCD 2IANE 3ARBC 1U95A 4OCNC 3SE3C 4I4WB 1CFQA 3MRLA 3ZTJG 1REIA 2Z4QB 3MRGB 5CJQH 4D0BA 4KRPD 5KZCB 2DIBA 1QEWB 1DUYA 1UACH 4PRHD 4LCYA 1GGUA 4XHJC 3KHOA 1CTOA 4MAUH 4E41A 4OFIA 3D85D 5DVLA 4Q97A 4L8CA 4O58H 2BVTA 2CDFB 1AKJA 5FM8A 3UPAA 1K4DB 3WO4B 1NSNH 4YX2L 4R6UA 2EDNA 3E3QE 3IFNL 4FOMA 1K8DB 4RCAA 4H1LH 5DA0B 3SDXF 3BRGC 1R3IH 1QSFA 3ROOA 4HWEH 4QHKJ 3CFKB 1R3JB 1B0RA 5JOPD 5FYJH 2J8UE 4D0CB 2ATPB 5I66B 4NKMA 3FO2A 1HXMA 2EDRA 3IGAB 4LPXA 3T2QA 4QOKB 2D4DA 1BZ7A 2VZ3A 1WBZA 3ULVF 4X4XA 3VFOB 3BDBA 1MIML 1UKSA 3MFGB 3RZCD 2J7LA 4X0KB 3QISA 5E99L 3TNNA 2ZUSA 1I1AC 2O5YH 3ARBB 2V7HB 3WS6C 1OSPL 1M71A 3S37H 2R0KH 3VFTA 2Y07H 1LP9E 4HIHA 5DC9B 5D96C 5E56A 1QLFA 3S36L 1X7QA 4R8WL 5DHXB 1YNKH 5I17B 4LHUB 3DV4A 5B39B 1R5IA 4OF5A 3UPRB 2B1AL 4PJ9D 1QSEA 2H9GB 1OAKH 1T1YB 2CMRL 5ETUA 2WAHA 5GSRA 2R4RL 4GFTB 5JXEA 1MFDL 2RBLA 3LN5B 4O2FB 5DJYA 1VGEH 2OTPA 1WIOA 1II4E 7CGTA 1RZ7H 3FMGH 2UY6A 3QUXA 4P5MA 3HZMB 5IVZA 1EV2E 3PWUA 3WIHL 5T1LD 1DL7L 2AV1A 4MJ5A 4NQEE 4F33A 3W39B 4U7KA 2DWEB 2YWZA 5TDPB 4PJEF 1WT5C 4OLXH 2GIYA 3UBXA 4IDLA 5IHBA 1OGTA 4EJ1C 3DVGB 1BVLB 5DVNA 4E5XA 1A14H 2EDEA 5DJ8A 4CU7A 5DK0A 4UNVA 1DBKH 4FQXC 4XCNA 5GIRB 5GS2H 1C16A 1I1AB 3AMLA 3WXWL 4YGVA 3DIFA 3PJSA 3LPWA 4YC2C 2NY4D 4YHMH 4Y2DA 5D96B 4RBPH 5DRZA 2BMKB 2D7NA 4YBLC 3X11A 5JPMB 4ODWA 2O5ZL 1TJIL 1YNTA 2AGJH 1G7MA 2FWOB 1AO7D 3DXAD 4AL8L 4JPVH 3T77A 2DMKA 1T21A 3QJFA 2F8VA 4JO2H 4ZTPH 3GGWB 5IP4A 3OG4B 1RUMH 4HS6A 3WD5H 1ES0B 1G6RL 5EU4B 1PEZA 4XP1H 3SQOH 1OP5H 4U7SA 3OR6A 2YD1A 2B4CC 5C6WH 3QIUC 1XGRB 3F8UB 2A77H 4YNYA 1IAIH 2FYYB 5DMGC 2DYPD 2IJ0C 4YPGB 1BJ1J 2DQGH 5IQ9B 1X5XA 1Q9WB 2FRGP 1UM5L 4I77L 5TH2A 3CFCL 4HX1B 2ED7A 4ODUA 3CK0H 1T1XA 4XC3H 1FFOB 2ITCB 4FQXB 1IKFH 1FZOA 5F96L 4P2OD 3TN0D 4U6VH 2ZUUA 2FH8A 4Y19E 4LGRB 4U6HA 4YC2B 1N6QL 5C8JB 2DLHA 2Z92A 5DXWA 4NDMB 4YBLB 5J9PA 4ELMA 1FVDB 5DD6A 1F02I 2KKQA 1GPOL 4Y4HC 2D7OA 5AWNH 4H0HB 2SEBB 5KOMC 4GKZA 3SJVE 2JIXA 3O3EB 1TJGL 5DVKA 3FB8B 3UEZA 2X1QA 2W65A 1KN4H 3SDAC 2XRAL 4MJ6B 4EXPX 1V3JA 4JN2B 4P3DB 1CFNB 3SDYL 5ICXA 3W11C 1PJ9A 4NO2B 4JQXC 3G9VA 5FA3B 2FEEL 2YN5A 4PJBB 4XPFH 3U46B 3MFFB 2HT3D 2VZSA 3SKOB 3TM6A 4HDIA 3TESA 4NQVB 1LEKA 5FDWA 4Q9QL 3QIUB 4NKDB 4UQ2B 4PJ5A 3K4AA 3EJYD 3ZO0A 2NW2A 3E6HA 4UT9L 1BBJB 1LDPL 5E2TL 2C5DC 4FZ8H 1T04A 4GRWE 3M1BB 3Q6GH 3P77B 1HHGB 1JNLL 5HHMD 1I8MB 5BO1L 2HJLB 4LAQH 5A3IC 1A7PL 1DBML 5B8CC 4Z77A 2Z31C 3QPQD 1F90L 3G04B 1OAZH 3WNLA 5I1EH 2ZUQC 1WAAE 5KSBB 4Y4HB 1MF2H 2EH7L 5KS9B 3S5LB 3B2VH 3LPFA 1OTUC 4LCUA 4WTXA 5DJ6B 3MTRA 1DANT 3SDAB 4K3EL 1XF2B 4G43A 3MCKB 3VG0L 1HSBA 1RZFH 1U8OB 2XTJD 5F7UA 1R24A 3HC0B 3MNWA 2FLBT 3BP7B 1HINH 4OFPA 2R2BB 1P5UA 2WANA 3EOTH 4NZUH 1H3VA 4G6ML 5IVXE 3EKCA 4HQQH 3JTTB 2B7DT 1MHPH 1IRAY 4ZD3H 4PGBA 3DTXA 4KHTL 2P4AB 3UJTH 1VEPA 4QRPA 5GZOC 2HKHL 1YECL 2NTSP 2QSVA 4IMKC 4NRXB 1NMAH 1V05A 1JF1A 4LKCA 1KGCE 4H8WL 4R90L 5EZLA 3BI9X 3BP6B 3MLTB 4WU7B 3RZWA 4XP6L 1AGFB 3C6LA 4CN6A 5A2KH 3CX5J 4PP1C 3GBNH 4HJ0D 5B8CB 1OCWH 2X4TA 1W72A 5ICZB 3F62A 3GFUA 2Z31B 5BRZD 2XA8L 1VFOA 4RMVA 4PRHE 4KUZL 1Q94A 5AG8A 5DHYA 3ARED 5EC1B 3WKNA 5L2JB 1G7JB 4ETQB 5DRNB 1IM9A 3MZGB 5LGKA 2WW8A 4YAQB 3UJIH 4HK3J 1JPFA 2EZ0D 4OD3H 4YDIH 3HZYA 1Y18A 1Y0LA 2B2XH 1FSKB 2GI7A 1PYWB 5GRUL 5MEPB 1U8LA 2WIMA 1RIHH 5CIPA 4UIMA 4OLWH 2CJUL 3CXHJ 4ZDHB 2BY2A 2YN3A 3B3IB 1ZOXA 3S36X 3N9GL 2EDLA 4PRPA 3HB3C 5JOPE 2YRPA 3R1GL 2WWKO 4FTVB 3EHBC 4WDIA 4RISL 2DQFA 3LKRA 5IFJB 3Q48A 3OKOA 3BRDA 1MQKL 3D18A 3SGEI 4NNXB 3GO1L 4N0FB 3V52H 1B9ZA 4F15C 2C4FU 2UUDH 3AGVA 4Z8FL 4MXVF 1A7RH 3V4PL 1RUKL 2IPUG 5K33A 5JW5B 4DN3L 43C9B 3EYQC 2QQQA 5IBTL 3DURA 4XZUB 1MRCL 1T7WA 5F6HI 4XX1G 5HDBE 4HUNB 1ODAA 1CZ8H 4LPCA 3RNKB 1W72H 3O9WD 4HKBB 4PRNB 4Y1AB 4PY7B 4KKCC 5DT1H 3SGKA 1NLDH 5JLZA 4TVPH 4XAKE 2J3SA 5ACZB 1CYGA 4G3YL 3N06B 5C0IA 2Y6SC 5ACMA 4KQ4L 3FQTB 4MDIB 2HFGH 4MHHG 3QH3A 1QFOA 5GGVH 2PYFB 2XY1A 4NCC2 1FCGA 3V0AC 4FQIH 1V3MA 1TCRA 1ZHKB 4ZXBA 1H15B 2FB4L 3GMQA 2IBZX 4MLIA 1IC7L 4GAGH 4MDJB 4P5TD 1RZJC 4QRTA 1M6OA 3QG6B 4M61B 3CCHB 2QADB 4LASL 4XPBL 1PBYA 4PJIE 5INCA 4F15B 1NGWB 4XNUH 4PJAA 2EDBA 3VWJC 5B38G 1A2YA 1EXUA 5KTEL 2ESVA 3L95A 3D2UA 2IH3A 2IG2H 3MLPA 5FYKU 3C6SA 2MNUA 1FPTH 4OSUH 3QIWA 2R56L 2ZJSL 3MUZ1 3U0WL 1AO7E 3RU8H 4P57B 1UQSA 4NM8H 3U79A 3LS5H 3MREA 1G7QA 1D6EA 4PG9B 4WEBL 2VZUA 1MFAH 1G9MC 3P4NA 4LLQA 3UTTD 4KK9C 2DM4A 1BIIB 3TO4C 5DZOA 5B4MD 4LCWB 3ZZ1A 5JW4M 3LVEA 4S1DC 4LLDB 3CFJB 3R0NA 1J1OL 4JFQA 1P4BL 1V7ML 3IFOA 4GAFB 5DURB 3TA3A 3F6IA 5CP7B 2A6IB 4L3CB 2A83B 4MCZB 1Q9OA 1A22B 1NUGA 2XN9A 2YD6A 4NM4H 2ZUYA 4PV9A 3SE8L 2XWTA 1UWGH 1LO3H 4BFIA 5JA8B 1J88A 3J8F7 4IOFD 1S78C 2VLKD 3MR9B 4DTGH 1BX2A 4X4YA 1ZT7A 1I8KB 4F9LA 1PQZB 4X5XB 2BVQB 3VWJB 1A3QA 1IT9H 4N5EC 5HI3C 2VITB 4HC1A 4JR9L 5E94B 3HE6A 1JV5B 3BKCL 1YEKH 1CDBA 4PLJD 1HILA 2JK5A 4DVBB 4XNYH 1XZ0A 3ARDA 3NZHL 4HD9A 3L5HA 4UOW1 3T0BA 1HWGB 5C0FB 1KNOB 2UVEA 4C56E 4L3EB 4KKBD 4K3GA 4LSUH 3QULB 1BEYL 1EGJL 3ULUE 4OCYH 2L0DA 1IZKA 3HNVL 5TF1H 3HG1D 3RUGB 1NLBL 5FKPA 1T20A 1YY9C 2AV7B 3TO4B 1A7OH 3L3GA 3KPOB 1KB5A 3GM8A 4GKSB 3Q3GB 3QZWB 2J4WL 1JTTA 5DEFB 3DYOA 3OZ9H 1HYSD 2Q20A 3ECBA 1MCOL 4OZGE 2IAMC 5IM7B 5I1CL 2H2SC 5IF0A 4DZBA 1EERB 1TVBA 2F74A 5BVJB 1Y6NR 2Q7YB 1A4KA 1S9WB 3Q6FA 2X89D 5GS0D 3VRJA 1GGCH 4QOKD 4MX7A 3BEVA 2DBLH 2Y06L 1DQMH 1XGPA 1R3KB 5HHME 3ARBD 5IVNA 4WY7L 2XXMB 4GQ9H 5JDSA 1SY6L 4R4FH 5CS7A 5T3XH 3VXTB 3FB6A 2J8UF 1ZT4B 5FHBH 1M05A 4U1IA 4FG6C 4P2CG 1EX0A 4LHUD 4UQ3B 5I74C 4HJJH 4XHJD 1V3LA 1RY7B 3F58H 1MHCB 3FFCB 4NQSB 1IQDA 1NMBL 3KPQA 2VR5A 3CDYA 2X4PB 4JAMA 4Y4FA 1E6OL 4MNGE 1AXSA 3L3IB 2FD6H 3HI6L 1LP9F 1QKZH 4YDLC 5D6CB 2NMSA 4NC2B 3TBYA 1F11A 5JZ7C 5ANMA 4HK0A 2IAMB 1Z3GL 4J4PD 4NO3B 1NDGA 1AXIB 3BPCA 4GUPB 3VXME 2VH5H 3H3BC 3UTSB 4JRYA 5EN2A 3S6CA 4BZ2H 1E6JH 1MPAL 2RCSH 3KR3H 4PJ8C 2JTDA 3ESVF 1Q0XH 3ELAT 4HV8B 3BKYH 1FRGL 2WM0A 4LVHC 2VIRB 5L7XH 3Q2CA 4JHAH 5ESVA 5E9DB 5HPOA 3PGDB 3IU4H 1D5ZA 5I74B 3U6RA 5DSCA 2JB6B 1JWMA 4KQ3L 4CDGC 4NQXB 1FAIL 4GMTL 4YXHL 5DQDH 1EIBA 1V5JA 5BOPA 2K9UA 4QRRE 2YD7A 4YDLB 4ZFFA 3LQMA 5BCAA 2EC9T 5H35B 2VDPL 1G7PA 4MQ7B 5L8LB 43CAB 4L9DA 1A21A 2D03H 5EORH 5J06A 3PV7A 3QO1B 2R1WB 3GSRA 4LIQH 2RGSA 3IS1X 4LPWA 3E1F1 4ZS7H 1A1MB 4GW1B 3MXWH 2DI9A 5HYSB 4HEPG 4URTB 5GGSB 1A64A 1BJMA 4QRQB 1MREL 4FQXD 2OP4H 3LQAL 2PTVA 3DUSA 4HIXL 5CEXB 1BQHA 2FJHA 4UT7L 3FOMB 3PP4L 2BDNH 3OB0K 1NH6A 1ORQA 3D0VB 4LSPL 3SO5A 4G8FB 1WBXA 2DQTH 1U6AL 4DW2H 3VH8A 2ZUXA 2R0LL 2F5AL 1IGYB 4DK3A 3MUGA 3H0TB 4PJHE 1DFBL 4OCRH 1ZA3A 5EIIA 4YWGH 5DJDA 3STZB 4N8CL 4TNVF 4LAJH 1Z5LA 1YY8B 3GEWB 2E9IA 1Z0MA 4DOHB 4R4BA 1I1FB 3IRZA 3TEUA 1S9KC 4H1LG 3HUJE 1U8KA 5DMGD 2W59A 2X41A 3RVUD 3MLYH 1KIPB 4G8GE 4UUJB 2F9BT 1LVEA 2R15A 4X98B 1XR9A 4JHBA 2Z8WC 1FVCB 2Y36L 1BBDL 5IR1A 4LFHG 3FQUB 5H8DA 3VFPA 4F37F 2CSPA 4HKXB 4YX2H 1UZ8A 3IFNH 1HHJB 3M8OH 3VD4A 2FGZA 4Y4HD 3QDJA 2JE8A 5HVGB 1RPQA 4CBPA 1NFIA 5FCUL 3WNPA 3DMMA 4W81A 3GJFB 5F88A 4GRWF 3SDAD 3Q1SL 1IGCL 1HHIA 2QJDA 4XVJH 1NGYB 4ISVA 3UTTE 4PRDB 5EU6A 5SWQB 5C0BB 3T2OA 3W11D 1AXTL 4KPHL 3SY0A 5ESQB 4YR6A 3O8XC 4M93C 1D6VL 1MIMH 2VJXA 4I13B 3GJFK 5ID1B 1WAAF 4J6RH 5GS0L 5DGQA 3EOAA 2OI9B 1X6NA 1M7DA 2IH1A 5EC2B 2CDGB 1JNHB 1GSMA 4R8WH 1PLGH 4GKNA 4PBWD 5F7YC 1IGTB 1KLGA 4XBPA 5IFHL 4CGTA 4JZJA 5IK3B 1EH9A 2B1AH 4JM2F 3F6LA 3H42L 5TDOB 2CMRH 4U1NB 5DMIH 5I18L 1KV3A 3CSYB 4P4RB 3I6LE 2X4RA 1MFDH 4HIJA 5E6ZA 5A3ID 1J7VR 1MJJB 1G7IA 1U93B 3BIKB 5IVXF 2Z31D 1WFUA 4HPYH 3RL2A 1IAOA 3MJ9L 4RFOL 1UXWA 4TSBL 3TLRA 3GB7B 1OTUD 5IG7B 3J7HA 4F7EA 4PJXB 2FEEI 3QIBC 1PEWA 1S7RB 3HG1E 1S9VB 3M17A 4QT5A 3GMOA 2YPVL 3L3KA 3BDYL 4OLUL 4HS3B 3T0ED 1LE9A 4M93B 1AIFA 4Z7OE 2AW2A 5DJ2B 1SJHB 3MJ7B 1RVFH 4JGJA 5DS8B 4N90D 1T5WA 5EWIL 3WXWH 4FQ1L 1S7VA 3K4DA 1U8PA 1P6FA 2G5RA 2MKWA 2PR4L 2AABL 1WWWX 4U05A 2E9JA 2VAJA 2BOBA 3NABL 4HT1L 4W4NA 3GM0A 1JUFA 1NBYB 2EEAA 2O5ZH 3HNSL 2VXQL 1A1NB 4RDQF 4NBZB 5CEZD 1D3CA 1WC7B 3WLWD 2BSRA 1B0WA 4XNQA 3PWPA 3MLWH 4G6FD 4WU5A 5D5ME 4AL8H 4JO4L 3ZDZE 1JF6A 5C7XL 4P5KA 3GSXB 4N8PA 4HFWB 3WL9B 1RI8A 3EO0B 2BCKA 3BP5A 4LNRA 4PP1D 2ZG3A 1YEFH 3MV8B 3G08B 4JY4A 5T1KB 1VADA 3KDMB 1G6RH 3UBXG 1S9XA 3HMXL 1JTPA 3KLHC 3MRPA 3IDJA 4FFZL 5DD0H 4LL9A 1A3LL 3STLB 3BPLC 4KKLC 4U1KB 3RHWF 3UC0H 2R2EA 3DX8A 1I7UB 2AJYL 4Y1AD 5EIVA 4V2BA 3V6OE 5T1MA 5EOTA 2BVOA 2NY0C 5K9QI 1NC4B 4I77H 4X5WA 1XGUA 3HR5A 3CFCH 4MXWL 2CRYA 2VZ1A 3PL6C 2P8PB 4NQUA 2X1OA 3CLEL 4C4KO 5HDBF 2X4NA 4YLQT 4GAYB 5IROA 3MJGX 2HLAB 3HB3D 2GEEA 4LLVA 5IOPA 3DROA 4MD4A 1VHPA 1MH5B 2AJ3B 4FQQB 2APXA 5GRJL 2XA3A 1P1ZA 5HVHC 2QADD 2W38A 3TPUA 2AXFB 3GMMA 1TJGH 1MUJB 1KXTB 1U8QA 5HTSA 3BZEB 2XRAH 2BNUA 4F7TB 1IARB 5EZIL 3L3OB 3QUMB 3EYQD 5D72L 5DJAB 1Q72H 3EO9H 5K59E 1FNGB 1NMCC 5LXGL 3D3VB 2C1PA 1DVFD 2DWDB 3SKMA 5A2IH 2NY5H 4Q9QH 3BPLB 1J05A 3NFPB 1FNHA 3LKSA 1KFAH 4PJIF 1G7LA 1WIUA 3MRCA 1DUZA 3LDBC 4IOSD 2VR4A 5ISZB 5BV7C 1LDPH 4LCWD 2Y6SD 5E2TH 1AD9B 2B4CL 5TQ0L 1R5WB 2DQEL 1VFBB 3PL6B 3HE7C 4PJ7A 2AJZB 2E6JA 2UV3A 2GSIB 3QXTA 4OAWB 1XF4A 2OZ4A 4XCEB 5DURD 4RGMB 1JNLH 3R06A 3PQYE 4P46C 4YHLH 4PJ9A 1ND0B 2DIJA 3WS3A 5BO1H 3V6FB 3DVIA 3LHPH 2VXUL 5JHDA 1A7PH 5EOQL 3IDNA 2FJGB 4MCYB 4JFZL 2EYTA 5DTFA 5IW6A 4HIIB 3HLAA 2I27N 1NCTA 1BGXH 2XZCL 2FX7L 2HA1A 3KS0J 4PJCB 2EH7H 4LRIA 5HVHB 3OKMA 3O45A 4I2XB 4XMKL 1QA9A 2W9EL 5CJ8A 5C71A 3NA9L 4K3EH 1KJVB 4HUWA 3VWJD 1L4IA 5T5FL 4EI5A 3VG0H 4HH8A 1RFDL 1C12B 1UKQA 1MAML 1NMCB 3K2UL 5F3BB 2GJ6B 4G8EB 1KPVB 4S2SB 5HHPB 4OT1L 5LBSL 4R0LC 1NGQL 3RWGA 3GMNB 3AM8C 4L3ED 4ORZC 3L5WA 3S4SG 4G6MH 1VACB 2W60A 2FHFA 2CLRA 1J8HB 5E00A 3OKEA 5D9SA 3LDBB 1OAQH 5BV7B 4KHTH 2NX5B 3TO4D 1GOGA 3C5ZC 2HKHH 4PJBE 1G6VK 1YECH 4S1DD 4OZIA 4X7TA 3HE7B 4BQBA 1DJSA 3LS4L 4P23C 3MJ8A 1ZA6B 3REWB 4P46B 3DXAA 5A40E 3ME0A 2XKUA 2DQUL 5CBEB 1OWRM 4CL7A 4HMEA 2PW1A 2OZ4H 4XBGA 3ULUF 1SVZA 3QDME 2XA8H 3P3YA 4JEGB 3OXSA 1S78D 3KS0H 4KUZH 4NFCA 3SE9L 2KQMA 4RRPG 1EEZB 2YSSB 2HVKB 2H32B 3AAZB 4NN5C 4OGXH 1NC2A 2AEPL 4JG1L 3PHOB 5DFWH 4N5ED 1A0QL 1Q0YL 3E2HC 5HI3D 1YEDB 3MRIB 1X3DA 5I1HL 4XP5H 3GSOB 2A73B 5GRUH 3QWRA 4N5UA 4QRUA 1GC1C 4F2MB 3VFVB 1J0JA 1L7TH 4R0LB 2CJUH 5GGRY 1ZGLM 4G42A 4NRYB 1A7NL 2Y25A 4ZOBA 3FFCD 3KPSD 3KPRB 5EUKA 3TN0A 5MEOB 5EU7E 4U6YA 1NBVL 4XVUC 5I2IA 1B2WL 2XKSA 3R1GH 5IIEB 1HDMB 3IETA 1A7QH 4RISH 1OF2A 4YGAB 5E6IC 3C5ZB 4WVRA 4YIQB 1MQKH 4FXGB 5J6GB 3I50L 4GMSH 3GO1H 4LMQE 3RWCA 5E8NB 3T1FA 1YQVL 2ZOKA 4K7PL 2R9HD 3WN5B 2YA0A 5CBAB 3L7FB 3BO8B 4HJGB 1FORL 2IAMD 4Z8FH 2HMIC 3V4PH 2P5WB 3NN8B 2CO6B 5CEZL 3RDTC 5IEHA 5IBTH 2P24A 2R1XB 3ARGC 3H7BA 5IVOA 3UTSD 2JB5L 4MNQA 4YFEA 4MS8C 4ENED 3QHZH 4XPHL 1F13A 2C4XA 3BUYB 3O2DA 4IHOA 2G75A 4NN5B 4U1MB 1KB9K 1SYVB 4AK1A 5GJTL 3E2HB 1AGDA 1IEAB 3G6JB 4QYOB 5E8OB 3MGAA 5HDOA 5SWZA 1CGUA 1I7TB 3U9UA 4G3YH 1EEYA 4KQ4H 5E8EB 3GJEB 3IJSA 4NPYA 3TBVA 4OZHB 2KBGA 1FVEA 3NIFE 4CAGA 4PJFB 4OKVA 2G9HA 5I1DA 3NCEB 4WFEE 2FB4H 3KXFB 1JRHL 2V2WB 1IC7H 4GRLA 4JZOB 2VQTA 3T0EE 2BJML 4DUWA 3MBEC 5E6IB 4I5BB 3OQ3B 3BXNB 1ZHBA 4LASH 4XPBH 1UGNA 5C0AE 3WYRA 4ORGA 15C8L 4Y5YA 5JZ7D 3CAFA 4EN3C 4NQDB 4AG4L 1CFBA 1PX3A 4YUEL 3O41B 3OJ2C 1ZHLB 3QFDB 3RDTB 5DJXB 3ARGB 4X6CB 3RIAK 3H3KA 2BZDA 5FO9A 4LSVL 4JKMA 1K3ZA 3AS1A 2GK0A 1XGQA 3PF2A 1BLNB 4KWUA 4LSRL 2R56H 3RIFF 3H9SE 1W2KT 1J0IA 4Z7UB 4JFXA 4RFNC 4Z0XB 3DVNB 4EVNB 1QRNB 1OGAB 1DBAL 1P4BH 1V7MH 4JY5L 4HGWA 1KTKE 2VL5A 3SE8H 3TP4A 3FFDB 1B90A 1UA6H 2JJTC 5C0GB 2BVEA 2X9YA 1E4KA 5BRZA 3EYOA 2JJSA 3MBEB 3T4AB 3W81A 4ZFGL 3CD4A 1U58B 4QTIL 3RY6A 4BH8B 1SY6A 2F5BH 1EAPA 4ODHL 1IE5A 4EN3B 1INQA 4WW1A 4AIZA 4NQCB 4NHUB 4W4OC 2A6DA 1NCAL 4AMKH 1P9MA 1RZJL 4WUUB 4ZUTA 3VRIB 1MFNA 3QI9D 1TZGL 2IC2A 2Y72A 5F72S 2ERJC 3NZ8B 1BFVL 4MD0A 5J13B 1KF9B 4PJHF 4HW6A 5HGBB 3VXUA 3LIZH 2XIDA 3JWOC 4XNMA 2VB5A 3FQNB 1L0XA 5F7EL 1SBSH 1BEYH 1EGJH 3MCLH 3QDHA 5KVMC 4ERSH 4RFNB 1KOAA 3S96A 3HUJF 5CKAA 2A6KA 4NUGL 1KTLB 5DLML 3EGSA 3MMEA 2BRQA 4MQXD 4JRXB 4OLYL 1QLRB 2F19L 5IMLA 4ZUVA 2YUWA 4WGWB 4R96B 4YDJA 1OD7A 1MCOH 2IWGA 5I1CH 5D7LD 2BERA 2ADGA 3TO2B 4P2YA 4C55A 3RWFA 3TBWB 5C0BD 3WHE0 3MRRA 3BVNA 1YPZB 5EFIA 1YEHH 4JDTL 1JHLL 5KN5B 2Y06H 4IRJA 3V5KA 3BSZL 1VCAA 2CKNA 2VABB 1JMXA 3DLQR 3H7LA 3GIVA 5C0NC 1UT9A 1FV1B 2IPKA 4WY7H 2ADIA 3ILQC 1SY6H 1VGKA 1EAJA 1P5VA 5ALBL 5H37H 1GGIL 1PKQA 3IKCB 3C2AL 2AEIT 2P8MA 3QHTC 4WWKC 3RTQB 1P2CB 1T1ZB 4PJDA 7FABL 3VD5A 3GNML 2ITDA 3GSUA 4B7IA 3O4OC 1A4JB 4XVSL 1U95B 1X5FA 1ONQA 1CFQB 3OAZH 3KPNA 1UG9A 2VSDA 1NCCH 2P5EA 3V7AG 2ADJB 3HI6H 2FBJL 1DUYB 1G9NH 4LCYB 4E41B 2C3VB 2F54E 2BHYA 3V8CA 3MOAL 1FYTE 1AKJB 1RU9L 4EZMA 5JXEC 3SE4C 3RUGE 1T7YA 3MJ6A 4JDVB 3G6DL 5DEGA 1KT2A 1MPAH 2VQUA 1MCQA 5TE7H 5F1SA 1QSFB 3ROOB 1PAMA 5E08L 3EYVB 5DJ0A 3L3HA 1B0RB 2F15A 3IT8D 1FRGH 1BFSA 5KOVC 1HQRA 4JE4B 1HXMB 1TZHA 3B8SA 4X6DA 1NUDA 4UU9B 3LY6A 1CICA 4WWKB 1WBZB 4X4XB 1L9NA 3WXVL 1IKNC 1XGTB 1L7IL 3TNNB 3O4OB 1NGZA 4KQ3H 3DX6A 4Z7OF 1FAIH 4GMTH 4PJGA 4YXHH 1M71B 3VFSA 4HIHB 1U8JB 1KBGL 1X7QB 3VMNA 3D48R 1NPUA 3MV8D 5T1KD 1DE4A 3IFPA 4I9WD 3DV4B 5C2UB 2VLKA 4YXLL 5DC0A 4EDWL 4V1DE 2FHBA 1QSEB 5D7JA 2GKIA 3DNKA 3QEHB 3KPSE 4XPTL 5GSRB 5D5MF 4NC1E 4I4WA 3ZDZF 1T7VA 5DJYB 1NC4D 1N5AA 4KU1A 3BHBB 3ARQA 3PWUB 4FS0A 4QHNA 2I5YL 4L8DB 4EXKA 1DSFL 2AV1B 1H0DB 4HMCA 3UAJC 5D1ZC 5SV3A 2E7MA 2CDFA 3QR2A 4HIXH 2E9BA 3KYOB 2LVCA 5FYLE 2VSCA 3PP4H 5T1DL 1OGTB 1UFUA 5DGRA 4E5XB 2AERT 3QCUL 5DJ8B 5DK0B 3AY4C 4XCNB 4YGVB 3CFKA 3DIFB 1R3JA 2VLRA 2F5AH 2NY7L 3MRQB 1MJUH 2IQ9H 3RVTC 3AS0A 4CMHC 2VLJE 5DRXA 5DRZB 4D0CA 1I9JL 2ATPA 3LAFA 3X11B 1DFBH 4X7FC 1P4IL 2ADFL 2XACC 1YNTB 4XMLL 3D3VD 4DZ8B 1G7MB 1EHLH 3QFJB 2X09A 3VFOA 5LQBH 4J23A 3T77B 4NWTL 1T21B 3QJFB 5E24E 3QJHA 3SE3A 1YA5A 5A2FA 4F7MB 1FLTX 1GHFH 1HNGA 4HS6B 2V5RA 3MGOB 5ISZD 1X5HA 3FAWA 4HZAA 3IXAB 1PGRB 1RV6X 1U0QA 1WBYA 2CXGA 2WWMC 3MLRL 4I48B 4X4ME 1PG7X 1BBDH 5FKAA 5K59F 3UPRA 5J6HB 2H1PH 4OF7A 3MJ9A 3DI3B 4XNXL 1CD1A 4YNYB 1QSZA 2H9GA 4LVEA 3VH8G 1T1YA 3T8XA 2YUZA 1IGIL 4K8RC 4PRID 2AKRA 4J3TA 3OSKA 2NR6C 5J0BA 5TH2B 1U91A 1U2CA 4XCCL 4LGPB 4D94A 4MZ3A 5HYEA 3UX9B 1C8PA 3O4LD 2CK0L 1I75A 5C2BH 5FCUH 4P9HC 4KKNA 1JFQL 4K3HA 1IGCH 4LLMB 4U6HB 2GUOB 3W39A 4XPAH 4OV5A 2Z92B 4CMHB 3TWCH 3WHXA 2A6JA 2DWEA 4PLOB 3OL2A 5J9PB 4KPHH 1BAFL 5TDPA 2IADB 5DD6B 1D6VH 2GJ6D 5FA4A 2DQDL 3V2AR 5I76A 1BVLA 4GKZB 2I24N 1NEUA 3P40A 1I1AA 1T2QL 5GS0H 1HXYB 3WS6A 4B0MM 1J8HD 1WWCA 5ICXB 3N85L 2BMKA 1CLZL 2NX5D 2V17H 1CGXA 2EDWA 2DIAA 2ED8A 5IFHH 3HE7D 3ARRA 1E4WL 4HDIB 1AHWC 1XF5A 5GRYA 1LEKB 5FDWB 2JELL 2FWOA 3H42H 1U92A 3SN6N 5I18H 3W0WE 4Y4KC 2XG5A 5BZDA 1CLYL 5C08E 4XCFL 4TSAL 3MJ9H 1CFTB 4BA8A 3B5GA 4TSBH 4UMGA 5JNYB 3PP3K 2BNQD 1FLRL 4PJBF 4OTXL 2NXZD 1RUAL 4Z77B 2YD2A 4PB0L 2YPVH 3BDYH 1O5DT 2BC4B 4OLUH 3X14A 4I3SL 4N8VB 1ZSDA 4HX1A 4NKOB 3MNVB 5DHVB 4LCUB 1FFOA 4FQ1H 2BXZA 3MUHL 3R8BB 3PXHA 2WBWB 1FN4A 2VYRE 2PR4H 3CC5A 5D7LE 1SYSA 32C2A 4PYGA 4MA7L 4TULL 4HT1H 4OD1L 2AXHA 1HSBB 1KPRB 4CDHA 2NZIA 5K9KB 3MNWB 2VXQH 3C5ZD 5I1JH 4KDTA 4LARH 4EUPB 3CU7A 1AHWB 2RQ8A 2FH6A 3QUYC 4JO4H 5C7XH 3FB8A 2J6EA 2R8SL 4MJ6A 2P42B 1IGML 4HWBL 2ATKB 2P5WD 4JN2A 1RZGA 4P3DA 3BMWA 4PGBB 4W70A 1XIWC 2DOCA 1ZKAA 4QRPB 4C54A 4A6YB 3P11L 1Z9LA 1OP9A 5FA3A 3O6FC 1D5MB 3U46A 1NFKA 1JF1B 3HMXH 3QEUA 5EZLB 4FFZH 1A3LH 1I3GL 3W5NA 1UM4L 5CSZA 3LV3B 1A6ZB 1XGYL 2AJYH 3QIUA 1KXQE 4NKDA 4UQ2A 4JPWL 2X4TB 1IEBA 5J1SC 1N0LA 4DKFH 4MXWH 5D7IE 5C0CA 1Q94B 1KC5H 1I8LC 4K3JL 2YK1L 4Q7DA 3RGHA 4LMQI 1MCLA 3CLEH 1CXLA 3U48A 3WNOA 3ZMRA 4PJXE 1HHGA 2DM7A 1IM9B 4XH2A 3SGKC 1I8MA 4XVUD 2HJLA 4ZUWB 1BZQK 2WWKT 5GRJH 1Y0LB 3S3SA 3G04A 5E6ID 1U8LB 5CIPB 1HHHB 2KL6A 5KSBA 4Y4HA 5FYKH 3RPKA 3S5LA 1TNNA 3EYUH 4NQDD 3NIFF 4WDIB 2D4FA 3PDGA 4XVTH 1XIWB 5D72H 3MCKA 3ARGD 2DQFB 1U8OA 4GBXA 3OKOB 4JQXA 5CILL 3T65B 3ARXA 3D18B 5LXGH 5DYOB 3O6FB 4KK6C 1T5XB 1E4XI 3QUML 3QQ3B 1JGLL 3T0DA 2FNBA 3D25B 2AEWA 2HT2C 3HC4H 4PRBA 4KDWA 1WICA 3JTTA 3DURB 1YEJL 3HS0A 1ZLUK 5GGTL 3QXAB 2B4CH 5TQ0H 1QRND 2DQEH 3X13B 1WISA 1YJDL 3QB7C 3MRNA 2YWYA 4NRXA 2BFVL 3QIWC 1OGAD 3K1KC 1XAUA 3MLTA 4HFUL 4X8JA 2LAGB 4WU7A 2ZP0T 4FQHA 1U41A 4KI5D 5EOQH 4JFZH 5K9JH 3T08A 2V5TA 5ICZA 5KSAA 5C0IB 3MBED 2XZCH 1IMHC 3V0WL 4FRWA 4XMKH 4NIKB 2VRAA 4EN3D 2W9EH 5I8OL 3NA9H 5EC1A 2NY1C 1WFNA 5L2JA 2A1WL 1TCRB 1G7JA 3GMQB 3HAEB 1WUNT 5T5FH 1YYLH 1MCCA 2Z8SA 1JYVA 4BQ8A 1RFDH 1HOCB 3VJ6B 2VDLH 4AQ1B 2EKSA 1MAMH 4QRTB 2HH0H 1M6OB 4XX1E 4OT1H 5CHNA 2D3VA 1IM3B 4BSJA 4NO5A 4F9LC 4ZDHA 2P47B 4PJAB 5A2LH 2OX5A 2OR9H 3LMJL 1EXUB 4OM1L 2ESVB 1N7ML 3D2UB 3NCYP 2CDEB 4FTVA 4NQEA 2NY2C 1BQLH 5IW1A 3BD3A 2MPAH 3C6SB 1DZBA 4FABL 3D3VE 1JRHI 5IFJA 3LS4H 4IMKA 3QIWB 2XWBA 3MLZL 3LB6C 3GUTB 1FFQA 1IL1A 3VXPB 5BV7L 1A6VL 1D6EB 5TDNB 3U2SA 2DQUH 2VAAB 4QGYA 5KANG 3MXVL 4LLQB 5JPNA 3VWKC 1CDUA 4PUBL 5JW5A 3CFEA 2BOCA 2YPLD 43C9A 4WFHE 2DMBA 1KCVL 4XI5D 3VE0B 1UCBL 4ZO9A 4KK5C 3SE9H 5CLTA 4QXGL 4JFQB 1KSRA 4Y7MA 2APBA 3IFOB 3RNKA 4X9IA 4PY8I 2NY1B 1Q9OB 1ADQL 4Y1AA 4PV9B 5DWUL 1A0QH 1FIGH 2A74B 2XWTB 3NFNB 4PRIE 2PO6D 4BFIB 5CD5D 4DQOL 1VPOL 1CD8A 3RTQD 5ACZA 1OD9A 4D3CL 4QNPE 1MY5A 3JV4A 4UT6L 5FUCE 3KGRA 3O4LE 4X4YB 4H88L 1GZPB 1A7NH 4I2XE 5ENWB 2PYFA 5F8RC 1ZHKA 2APFA 1H15A 4BKLB 1CD0A 2NY2B 2YRZA 3BD4A 2R4SL 3ARDB 3U36B 1JPST 4U31A 2E3VA 2R0WL 3I50H 2NTFB 1CD9B 4M61A 1YQVH 3CCHA 4E41D 2CPCA 4K7PH 5JOEA 5ERWA 4LHQB 1AKJD 1HH6B 1NGWA 3LRHA 3LN9A 5CEZH 2OTWA 3VWKB 5FGSA 3QG7L 2JB5H 4M62L 2W0LA 1KB5B 5I71C 4XPHH 3MRHB 3UTOA 4KDVA 4A2MA 4LEXL 1QSFD 4UV4L 5B3JE 4IEFB 3TYGL 3ECBB 5C0ND 5EH1A 1CN4A 3G5YA 3ZT5A 3BZ4B 5AG9A 4DZBB 1TVBB 4PG9A 5GJTH 2F74B 1CT8B 5GS2D 3V5DA 3Q6FB 5KSUA 3V95A 3VRJB 3VA2C 4M8VA 1BIIA 5DO2C 4LCWA 3RUGF 2EE2A 1TETL 1XGPB 3TH4T 2BNQE 2YZ1A 3QRGH 4RWYH 3MV7E 4KJQD 2FEDC 2A6IA 2A2QT 2A83A 3FQRA 4F3FB 1GC1L 2KPNA 3FB6B 5F70A 2E8YA 4KUCD 3TZVA 3N1QC 1QSED 1I8KA 2QSQA 2ED9A 5DMJB 1IQDB 1PQZA 2HJFB 1FNSL 4YUEH 3VXOA 5JXED 3KPQB 4NZTH 2BVQA 4JAMB 3VWJA 1SBBA 4KK8C 4JO3H 1AXSB 1FZKA 3I3DA 1JV5A 2HTKC 4LSVH 4NNPL 3AMKA 4DVBA 5I71B 3VFRA 4K07A 3MV01 3U4AA 3G5XB 4GAJL 4LSRH 3TBYB 3JZ7A 5C0FA 5GSVA 1F11B 5F8QC 4HK0B 4L3EA 1JGDB 1M1SA 2XQYK 3QULA 4M4RA 2H3NB 3QEGL 4R7DA 3BGFC 4YHKH 2OMBA 1JYWA 4JRYB 5EN2B 5I19H 4M48L 1FIEA 1FZJB 4GKSA 1DBAH 1CGSH 1RK1A 3QZWA 5DEFA 1F4YH 4JFPA 3VXQB 4M6ML 5IM7A 4Y2DD 4O5LL 4YBQC 2X4SA 1UENA 3GHEL 3O6KH 2VMFA 4NUJA 4U3HA 3DUUB 5BVJA 4Z7QE 1IC5H 3CSPA 4QTIH 3U6RB 3ZKMC 3QFJD 1JWMB 4ODHH 4U1JB 5LGHL 1R3KA 3RWDB 5GISH 1NCAH 3MRKB 5F9DC 5E2VL 1RZJH 3MRBB 3W9EA 5CCKH 3K81A 1TZGH 4HCRL 3U1SL 2E8ZA 1A02N 1ZT4A 4ZFFB 1FFPB 3G5VA 1BFVH 3IAGC 3VXRA 5D1QC 4J7RA 1URLA 1G7PB 4KXZI 5F7EH 1A47A 1MHCA 3FFCA 1FCCA 5HI5C 3BGFB 2Y7QB 2X4PA 3T0XA 4NUGH 5D1XC 3GSRB 5DLMH 2AAVA 3I9GL 1UACL 5H37G 4OLYH 2F19H 1QFWH 2IQAA 3KLAA 4WENB 3WFZA 1C5DB 5IMMA 1GOHA 5JOFA 2I07B 1TVHB 1NKOA 3PGFL 3DUSB 1I7RB 1MCPH 3P9MA 1AQKH 2XOTA 4Q9RH 1CTNA 1I4FB 1P7HL 4GUPA 1BQHB 2FJHB 4LVOC 4JFFE 1BOGB 1MEXL 1BECA 1JHLH 4N0UE 3UTSA 1QRNE 4M7LL 1DQJB 3HRZA 3BSZH 5IB4B 1OGAE 2JIXD 4HWEL 5F7LB 4D9LL 2PYEB 5CGMA 2QEJA 1SEBA 2YBRB 3DX7B 3VCLA 5JORB 3RKPA 5ALBH 4O2EB 4KI5E 1WWBX 2VIRA 2W1NA 1TLKA 3CDFA 3FB5A 3C2AH 5DJDB 5E9DA 7FABH 3PGDA 4MVBC 3GNMH 4HEME 4N0CD 4XWOC 3B9AA 2JB6A 4XVSH 5I1GL 4NQXA 4ZPVB 1U8KB 2XICA 5HGDB 2P48B 3MV9B 4U2YA 2VZVA 2WP3O 5B38B 2NR6D 1LEGA 5F9WC 2VE6B 4OGAC 5D1XB 1XR9B 3JWOL 4KY1H 5EBWB 5IR1B 1YQ2A 1SEQL 1RU9H 2E5EA 1K5NB 3DWTA 4MQ7A 4G5ZL 4OF8A 3EJZC 3QPXH 4FNLH 1VGEL 4LVOB 3P4MA 3QO1A 4Z7VA 3QDJB 5EB9A 4IJ3C 4IS6B 2VZTA 4GW1A 1Q9KB 5E08H 4PJ8A 1NFIB 3DMMB 5ALCH 1HHIB 4G8IB 1QBLH 4ISVB 5C09E 2I9LB 5EU6B 1F3RB 5CEXA 2BXYA 2YPLE 3WJLA 4YR6B 5FYJE 4JKLA 3UTQA 1I7ZB 3FOMA 3WXVH 4UV7L 3RWJA 1DBKL 2DM2A 3CLFL 3D0VA 4G8FA 4U6TA 3L5JA 1KCUH 3WFHA 1KBGH 1JPGA 2IH1B 5FM5O 4ZFOB 1LD9A 5C0EB 2YD5A 5F9WB 1RIUH 4ODXB 3H0TA 1MCFA 1H9VA 4N68A 4QRPD 1KLGB 4JPKL 4XBPB 4NCC1 4WO4C 2YA1A 4JZJB 2D7PA 4YXLH 3STZA 5C6PB 4XP9L 3C6LD 4JPVL 4LQ1A 2X4RB 4AT6A 4JO2L 4NOFA 3NA4A 1G7IB 3LPGA 4MMZC 2Y5EA 3RL2B 1KIQB 3TC9A 1ACYL 3EIFA 4X98A 5JIPA 4XP1L 4TVPD 1FL6B 2I5YH 1YMHB 4E41E 4AH2A 1DSFH 1WZMA 3OGCB 3W2DL 3FQUA 4I1NB 3P2TA 3TJHC 1J5OL 4XT1C 3A6OA 1IM9D 1UVQA 2A77L 2AJSL 4GG6A 4Z0BL 4OZFA 1RD6A 2DKUA 2FSEB 3M17B 2DQGL 3LD8C 5M95B 2OJEA 4IIQC 4CNIA 3I75A 3T0WA 1LE9B 1NBQA 3OB0H 2P8LA 2R1YB 2BRRL 3D0LB 3QCUH 1S7WB 1QSFE 5D2NC 5D7IF 4XC3L 3OKYA 2CR6A 5GGVY 2GK2A 4LRNH 3GJFA 3M45A 3S98A 1I3RB 4PJXF 3DGGB 2R69H 5I73C 1I9JH 4PRDA 1JUFB 5C0BA 1T6WA 3VFMB 1MY7A 1P4IH 1ZK9A 2D7TL 1CI5A 2HP4A 2ADFH 5I0ZA 1AGEA 2BSRB 4WO4B 4XNQB 4X6EA 2D0GA 5AWNL 1HYRC 1I9IL 4WU5B 2VDOL 1VFMA 5ID1A 4NWTH 4P5KB 5KJRL 4WW2A 3HZKA 3MPCA 5KAQG 2BCKB 4M02A 3KAAA 3CH1A 5HHOB 4OCMC 4OZGA 4JY4B 1VADB 5JHLH 1JNHA 5F97E 4RMTA 3MLRH 4WI2A 2X9WA 4XPFL 3IDJB 4RGND 4ZQKB 4XNXH 1WF5A 1ZVSB 5GS1C 4C4KT 3CSYA 1IGIH 4P4RA 2BVOB 3C5JA 3T2NL 3QDGA 3LD8B 5MHSD 4X5WB 1XGUB 2HLFD 1YC7A 2VKWA 1MJJA 1U93A 5BVPL 1JZ3A 2E7LC 2PUQT 3V4VL 4KGLA 4NT6A 1AI1L 3DYPA 1QLEH 5D2NB 2CK0H 1ORSA 3Q6GL 2LTQC 2X4NB 5IG7A 1JK8A 4M6OL 5L88L 4ZXBD 4LAQL 2C7UB 3DETD 3DROB 2YUXA 4JY6B 4MD4B 3QQ4B 4PTTB 4HLJA 3THML 1S9VA 1FL3A 1P1ZB 1BAFH 1X4ZA 5INDB 4WFFD 4LHUG 5B39G 2DQDH 3GJFH 3O8XA 1NANI 4KK6D 1K8IA 3GMMB 3B2VL 5DJ2A 4Q9CA 4X80L 1U8QB 3MJ7A 1UYWL 1KJ2A 1PFCA 3E0GA 2R2CA 3LZFL 2HT2D 4KJWC 2ESVD 4M9PA 3QUKA 3D2UD 3N85H 2RIKA 3SGDH 1CLZH 1RZFL 3GSVB 3K74B 2C1PB 4HWBA 1A1NA 2CLVA 3VGFA 1E4WH 3SKMB 1WZ1H 3QIWD 2RFXB 4NZUL 4NSKB 5GS1B 1BJ8A 1G7LB 3GSXA 3MRCB 2VQ1A 1CLYH 3EO0A 2BSSB 4L5FH 2DQJH 4ZD3L 3G08A 4TSAH 3UJTL 1GOFA 4Z95H 1IGJA 3R06B 4X6FB 3TA3D 1NKRA 2LTQB 3HC3L 3JUZA 4PR5A 2VNCA 4OTXH 4F9PA 2IPTL 4OM0H 2NY1D 1HKLL 1RUAH 2XN9D 1UJ3A 5FECA 3QIBA 4PS4L 2ORBL 5DTFB 2EYTB 1DEDA 2HT4C 3HLAB 4XAWL 3MYJA 4LLWB 5DA4A 4QRRA 1FAKT 1KCRH 5LKNA 2FDBP 1ZLWH 3MLUH 4JFHE 3OKMB 4M1CD 1SVCP 1NCBL 2P8PA 4MHHI 1A9BA 4MWFB 5J11B 5KBNC 1CXFA 4HUWB 4GAYA 2HLAA 1WVZA 4EI5B 1BM3L 4D9QE 4OD1H 1QBML 4F58H 2DD8L 1E27A 1BD2B 1MH5A 2NY2D 1CS6A 4ELME 3BWUC 4NFBA 3ARDD 4NN7B 3I02A 1X44A 4N9GA 4P2RB 4UAOC 5F9AC 3RWGB 5ACLA 2R39A 3LB6D 4HXBH 5SX4I 3CFDA 3H9HA 4Y5VC 4PJCF 5AEAA 1T66D 3BZEA 3WFBH 2R8SH 1IGMH 3OKEB 4HWBH 4PFEA 5D9SB 5JA9A 3P11H 4XHQA 4OZIB 4KK5D 1EPFA 1FNGA 1VA9A 3MJ8B 2BVUA 3BQUC 2DWDA 4PLKC 1I3GH 5D2LE 5KVFL 2FATL 4PJ5E 3NFPA 4JPWH 1SQ2N 1F8TL 3QO0B 2ZOLA 3FRUA 4XNZC 1J0YA 4K3JH 1AD9A 1R5WA 3PL6A 2F8OA 1KIRA 2AJZA 3A6CL 3IDUA 1Z9MA 1W72L 4XCEA 1MCHA 1EJOL 3ZE1E 1ND0A 4MJ2A 3V6FA 5B3JF 3SKNA 5DT1L 3V4UL 4HS8L 2CK2A 4FHBD 4TVPL 3B6SA 4XMPL 4Y88A 4F7PB 3RRQA 3BZDA 4UAOB 4QXWA 1FG9C 4WNQB 2HFGL 4X4ZA 1HN1A 2FECL 4G42B 1F2QA 3I6GB 4PBXA 2YS4A 4Y5VB 2ICEA 5EUKB 5HHNA 4U6YB 5BZWB 5DR5L 4Y4FD 2EYRB 4LVNB 4ACPA 3DJ9A 2FIKB 4GAGL 5LG1A 1DEEB 1C12A 1QPXA 5I0DA 5CILH 5EO9A 3RWCB 3T1FB 3HKFA 1QO3B 3IDXL 4J3WA 3BQUB 3QUMH 4HPOL 3GMNA 2DI8A 1VACA 3H9YA 2HJKA 3DSNA 1CIDA 4WJ5A 4P9ML 2P24B 1YEJH 2WQ8A 4JRYD 4MNQB 5GGTH 3ULVC 1GCFA 1EMTL 4XCYA 2BFVH 3IRPX 4IHOB 1ZA6A 2AP2A 4P46A 4NM8L 1ZWIB 3LS5L 3S8WA 5CBEA 4JQVA 1CDIA 3U9UB 5SX4H 2MQ0A 4OBRA 1ADQA 1UWXK 4NPYB 3TBVB 4TVPE 1WCQA 1FVEB 2MJWA 1J8KA 4JGUA 4OKVB 2G9HB 2YSSA 5I1DB 2HVKA 1CXHA 2A1WH 1G0DA 4KK8D 2RAMA 4DKDC 3AROA 1YEDA 3MRIA 1UWGL 1LO3L 2CRMA 3OKDB 5I1LB 2JJSC 5IESL 2G5BA 3GSOA 2ZSWB 3SDXB 2MCPL 5AAMA 4Z7QF 2HAZA 3VFVA 4ORGB 4R0LA 3X3FL 2B8OT 4OZHF 3IDGB 3AM8A 4PRPE 1AR1C 3KPRA 4OM1H 5K9OB 1J1PL 1IT9L 5HD8D 1N7MH 3INUL 4MB4A 1HDMA 4M7ZB 4D9RE 4EI6A 3U0TB 5FO9B 5FF6A 1KACB 1KG0B 2OR7A 2GK0B 3EYFB 4K9EC 4FABH 3C5ZA 4FXGA 5J6GA 2ZNWA 2BVYA 4P23A 1NCDH 4J8RA 5FO8A 4X7CC 5JQHC 3RIAF 2BNRE 4LDLB 1A6VH 4LSUL 5BV7H 3BO8A 3P4OB 4HJGA 4ONGL 4JFXB 4GXUM 3QWQB 4JRWA 1CDCA 1T83C 2Y9RT 4PUBH 3WIIL 3VFWA 2R1XA 4R7NB 4M00A 1OQXA 4QXGH 2MTPA 4M1DH 3BUYA 3OZ9L 1KB9J 4RGNE 4LDOB 5KVEH 2PYED 5CWSB 2VL5B 4U1MA 1ADQH 5DWUH 1SYVA 3KPLA 1GL4B 3SOBH 5MHSE 5BOZG 2Z91B 3G6JA 2VUYA 5E8OA 5AD0A 3OX8B 4DQOH 5ESAA 1GGCL 3PIQA 1D5XA 2WIIA 1EAPB 4UT6H 5E5RB 4H88H 2DBLL 1QQDB 3CDGA 4BK5A 4AIZB 4U1LA 3S7GA 2ICWI 3TBSA 4GQ9L 1ZTXH 2IBBA 3MV9D 5HI5D 4YHNB 1Z0NA 3WNKA 3KXFA 4BJLA 5E8DL 5I8CA 2V2WA 4ESKA 2R4SH 5D1XD 5ITBH 4KI5F 3D39E 4JZOA 4RGOH 5D70L 4MD0B 4WFFE 5I1IL 3OGOE 5E6IA 4I5BA 3VXUB 2NYYD 4HJJL 4M5ZL 1G9EA 4XNMB 4HC1L 5I1AA 2I60L 1MCRA 2ZSVB 5ADPL 2CD0A 3OMZA 4NQDA 3O41A 5E6YA 4FXLA 1HI6A 3S96B 3QFDA 3RDTA 2CLZA 3ARGA 4TN9A 4OI9A 4X6CA 5IMLB 4ZUVB 3QDJD 1FFNA 5EA0H 1YC8A 2BVPB 4LEXH 5TJWK 6FABH 4OZ4B 4UV4H 3CIQA 1BLNA