4I18A

Crystal structure of human prolactin receptor complexed with fab fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
219
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNFSSSSMHWVRQAPGQGLEWVAYISPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSYGYVYWNAYSSGMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody light chain
publication title Engineering synthetic antibody binders for allosteric inhibition of prolactin receptor signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine, signaling protein
total genus 43
structure length 219
sequence length 225
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i18A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i18A01
3DO7A 5IB3A 1MJ8L 3MREA 5AZ2H 4EN3A 3TESA 1NMBL 5E00B 4FRWA 5DQJB 4PRHE 3ES6B 4FFZH 2VXSL 3MO1B 1OAUL 3X14A 4U3HA 3SBWA 3IDIB 1T0NB 2YD7A 1MHEB 4L4TD 4PGEB 3PWJA 3JTTB 3FN9A 1SEBA 1YECH 1J8HB 4XVTH 2BXYA 3PWUB 1FV1A 4LLUA 1YEGL 3NFSL 4Y2DB 1IM9D 1TJGH 2X4SA 1G7MB 3FRPA 4FQHB 3KPRE 2HRPH 2X70B 4DN4L 5IMLB 1PLGL 2WIMA 4QRTB 1AGEA 2VIRA 1C08B 3VXME 2GAZA 5C07E 3IAQA 2VITB 4Y19B 2R2BB 4DN3H 4M6MH 3DX7A 4PGDA 1BQSA 5I0DA 4ZFFA 5TPWH 2FB4H 2X9YA 3O2VH 1IGCL 4JKLA 4X6CB 25C8L 1AIFA 4R2GD 1JGEA 3O6KH 4BFIA 2H8PB 2A74B 1EA9C 1PSKH 5FGRA 1VEPA 3WJLA 5EUOA 1L7IL 2DL9A 5CD3B 2IBZX 4Y4HB 5SWSE 5HYJE 1VFAA 3AS0A 3IGAB 4O2FB 5TE4L 2FO1A 3O3DA 1L0YA 5TQ2H 3IT8D 3PABA 2WMPA 4OD3L 3ARXA 2BVQB 3HN3A 3U7WH 4Z78A 1KYOJ 3O3BB 4JRYD 2ZPKL 3A6BL 2DTMH 1I1RA 1FGVH 3OXSB 4QRUA 1MNUL 1FRGL 3ZYIA 1NFDF 5HYSB 3L3OB 1PKQE 4QOKA 4TPRH 4U6VH 3WE6A 4NNYA 2LQRA 5D2NC 5FDYA 5I15H 4G3YL 4ZDHA 4NO0A 3GUTB 4MDJB 4WFGD 2ZG1A 2OJZL 3CSBA 5CGMA 3U6RB 2Z4QB 3UX9B 3O8XC 1IFHL 5DF0A 3DMMB 4IM8A 5FA4B 4IDLA 1Z9LA 5CZXD 4DFHA 2CLZA 4DEPC 1KLFA 2BOBA 2J6EL 1YYLH 4YGAB 4TSBL 3QH3A 3D48R 4HZLA 5DD6A 4WWKD 5IM7B 2IG2L 4XCNA 5A40E 4LSRH 1WVZA 3QRFM 1FNGB 4GXVH 3D69A 4NQDA 5LGHH 3E3QE 5ALBH 3QRGL 4PB0H 2HT3D 5LWYL 3PHOB 1GXEA 1T5XA 2DQGH 1R3JB 2X42A 2FL5B 4KVCH 1I9JL 2VZ1A 3GJFB 4ZS7L 2QV2A 5EO0A 1P4IL 4JFDB 4AYFA 4PLKC 4ELMF 1WISA 2ESVA 2ICWI 5ANMB 4JDTH 5DZNA 4TVPD 2WV3A 1PY4A 2XQBH 2GTZB 3OHXB 5T3XL 4QXWA 5HI5C 4FNLH 4E0RB 4O5LH 1YZZA 4OZHF 5DC9B 1GAFL 1J5OL 2QQKH 5I1IH 3VWJD 3FQTB 1QLFB 2ZZUT 4OI7A 2XZQH 1VFBA 5FK9B 3HNTL 5E2VL 3FB7B 4B53A 4HG4K 4WFHD 2R1XB 2IC2A 3SDDD 5TDNA 4C56A 4GKZB 1G7LB 3EBAA 1XGRB 5F70A 4JO3H 1R5IA 4FFWC 1QFUH 1ZWIA 3TH2T 3FB5B 2SEBA 1MUJA 2OMNA 1CFQA 3Q5OA 1GH7A 3L3JA 1VFOA 2L7JA 1W0YT 1H15B 4WNQA 3UYPA 3EOYG 3IFPB 2PW2B 2LU3A 3NA9H 4KK9D 2DMBA 2V9TA 2P5WA 4LEOB 3QO1A 5DJDB 2QADD 1U6AL 2BSTB 2BNRE 2XZCL 3GI8L 3VFNA 4S1SH 1CT8B 3BT2H 1EH9A 3AU1B 3G6AB 3TFKD 4PRHD 3GK8H 1DQQB 5GZND 1S3KH 3RJQB 1IM3B 1T03H 2MOVA 5DJXB 4YIQB 2DI9A 2JE8A 4YZFE 5C0RL 5E8PB 5ITBL 3W0WB 1ZGLP 4PJEF 3CFKB 4AM0B 4JQXC 5CMAA 3GZKA 1ZT4A 1G7HB 3EW3B 4X99B 1RFDL 1QO3B 4PRIA 1IKNC 3KPRD 5I18L 5BV7L 5I1CL 5MENE 4YHYC 1B3JA 5CGYC 1DEDA 4YE4H 1Q9LA 3HLAA 5KVGH 3F12A 3VXMD 3QWRD 3KDMA 5C07D 2HLAB 1KBGL 3QUZA 3IU3A 2Q87A 4F9PA 2L7UA 2EYSA 3QEQE 5D96C 4I2XB 2IEPA 5ACMA 4EBQL 3KLHC 4Z76A 4GBXB 3SDCB 2GK0B 2HG5B 1P7QB 1HXYB 3OAUL 2X4QA 3TVMD 5J12B 1I8LA 4XP9H 5ISZB 4I18B 3VXPA 4XXDB 4QXGH 2LU4A 4QY8B 5A2IH 2CK0H 2AJSL 5GGUA 3UPRA 3X3GH 4ETQA 3VXSE 5KSBA 4MA7L 3M1BA 1EO8H 3H7BB 1QFWM 4AIZA 3RKDD 4ZUVB 4XMKL 2XZAL 1KC5L 1ADQA 1EFXD 1HILB 5HYJD 5SWSD 2XTJB 1DBML 3QZWB 4RGMB 4G7VH 5FYKL 4JKPL 4IRZH 5E2TH 3FO1A 1ZVSB 1AO7B 1REIA 2DQIL 3KXFA 2H2SD 1ZVHA 3QFDB 4YR6A 3S35X 2DKSA 4FQ2H 3OTTA 3MYZA 2OJEA 2WQ8A 5KVEH 5E6IB 4KQ4L 1IGIL 3REWA 1RVFH 1BX2A 4NM4H 2R0KH 1VGKB 3RVWD 2BRRH 3I9GL 3NCMA 4GRWH 5DK0A 4OLWH 4WEMB 3S3JA 4HG4J 4FQLH 3F58L 1BFVL 1KCRH 2H9GB 4MJIE 1DZBA 4NC2B 1M71B 5JPNA 3VXTB 3ARVA 3RY6A 2GIYA 1XR9B 3IFLL 3MRJB 2VQUA 4FP8L 2V5TA 3DTXB 3T8XB 4JCMA 4WW2A 2YD2A 3GBNL 2LVCA 2ITDB 1OAZL 3FO9A 5KG9B 4U6YB 1T83A 1UH3A 1MQKH 4PGBA 1F3JB 2QQLH 1SYVA 4JO1L 3BJ91 1Q8MA 2C4XA 1NC2B 4R2GC 3MNWA 4JVUA 3SE3C 1IC5H 1AXSB 4ZPVA 4DFIA 4JB9L 4FQQA 2IPKA 4K94L 4NYLA 5HJ3A 3V4VH 3PWVA 3VGAC 3D2UA 3CVHA 1ZMYA 2VN7A 1V3MA 3IXTB 4LSQH 4O9HH 1MIEL 2BVTA 3ZHDA 4TULH 3JWDC 4LLQB 1EFQA 4FFYL 4OGYL 3GB7A 2HYMA 1BBDH 2DQUL 3K1KC 5M94B 2BFVL 4ELMA 4Y1AB 2QSCL 3LPGA 3FFCA 4MJ6A 3ARGB 2RCSH 4JGMA 1FIEA 4G7YH 1WITA 3QG7H 3NGBB 2NPLX 4I1NB 4OZHA 1RHFA 4PG2C 3QNYB 3WS6C 1LO3H 3LDBC 5CP3A 5CZXC 4HXAL 4NWTL 1IGJB 2ZJSH 1GHFL 3MGTA 1CU4H 1K6QL 2QSVA 4HK0A 5I75C 4WWKC 4LLYB 4UBDD 4W6XB 2NY1B 4CADB 2R69H 2BNRD 5I1DB 2EICA 3MBEA 2NW3A 2HT3C 4H88L 4YWGL 2DIBA 4DTGH 3OXRB 5EZIL 1OWWA 4WDIA 4ODBD 3MACH 5J6GB 4X6BB 1CDJA 2AEIT 4RGOH 1ZT7A 5EOTB 1C5DB 3EYFB 2X4TB 1LHZA 2XNAA 2IBZY 1LP9B 3PQYE 2HVKB 3U30C 2X7LA 4PTTA 1IC4L 3BFOA 5DWUL 1JGDB 2X1QA 4OCLC 2HN7A 3IS0X 1S9VB 4OQ1A 4UDTB 1E4KC 5JHLH 3AMKA 5MEND 3S3SA 3VWJC 3R0MA 3CC5B 4U6TA 2I9TA 5DR5H 2F5AL 1KPUA 4YHMH 4UT7L 1DQDL 1HXMA 1E6JH 2XA8L 3MV7E 4HC1A 3UMTA 1HK6A 1J88A 2HP4A 9CGTA 2XG5A 5B3NA 4PJEA 1H8SA 1GIGH 1VPOL 4GKSA 1HHIA 4M43H 1RY7B 4Y4FD 3RWEA 1CDGA 4X8JA 1IEHA 3BEVA 2Z35A 4WI3A 1DN0B 1AQKL 3VXSD 3C5ZA 2FX8H 4MAUL 5F9WB 3ECBA 3S36H 1M1SA 3DIFB 1I1YA 4KK9C 1FZOB 3HC4L 1S7RB 2GEEA 2VLJE 2VQTA 2QADC 4NZDA 1VACB 4HUKB 4U3CA 2AP2A 3MRHA 4P4RB 3GHEH 1IGFL 5BOPA 4YHNA 3TFKC 1FVDB 5J1SC 2VH5L 3RZWA 3DOSA 5EUKA 4MWFA 4MD0B 5C0BE 2WAHA 5HHQB 4JFEE 3MRLA 1K9TA 3GIZL 4YGVA 4HKXA 1LO0H 5EA0H 3B2UD 3CLEH 3LH2L 4D9LL 1KELH 3NIGF 4X7EC 1NMCB 4WUKL 3PV6A 5D5MF 3FMGL 4OCRH 4WHDA 4H26A 3DETD 4MJID 1ZGLA 2QQNL 1T7WA 3HS0A 1UXWB 1FFOB 1CIUA 2C1PA 3GBLA 3QCTH 5EOCL 3HE7C 3GMQB 1INQB 3TNNB 1N6QL 1T4KA 4KXZI 4Z6AT 5D7JB 4IDJH 2DI8A 4WVRA 1BWWA 1I3GH 1YUHB 1G9MH 1FVCA 2XN9E 2R4RH 1BIHA 3G04A 2X40A 4W6YB 1T21A 2JIXD 3TVMC 4IMLA 2VLLB 4D0CB 1F90H 4YDIH 4WU5A 1CK0L 1BLNB 1S9WB 3TCXA 4JZJA 1QSEE 4UOJA 4HSQA 4P57A 4U1LB 4N0UE 1ZANH 1CXEA 3TT3L 4MQSB 4OKVA 3RKDC 2R2CA 4PP2B 4JLRB 3CLFL 4NN5C 3ESUF 4NUGL 1JRHI 3MJ7B 1V5JA 1P1ZB 5F9JA 4MXWL 3KPQB 4LQ1A 1UB6A 5KOMC 3T3ME 5TGBB 1P84K 2PKDA 2VDPH 4M8QA 1T80A 2H2SC 1A64A 4YK4B 4N0CD 2ICWB 3UJJL 4JPIB 4HUWA 1L7TH 3BD3A 3BZ4A 1U8JA 1QBAA 2R29H 2WIIB 2NZIA 3RVWC 1GRWA 1DBJL 4P3CL 4F33B 3RRQA 4P23B 1UACL 2VUYA 5D71H 5L8KB 3HR5A 4QYOA 4IRJB 1JZ3A 3KLAA 1QRNA 1ZLWK 3SCMB 4ZXBA 3DUSB 1FHGA 4UQ3B 5IVNA 4M5YL 4LL9A 1UJ3C 3CDGA 2XXCB 5KSAD 1SBSH 5TFSH 4BQ8A 3E3QC 1QACA 5E0QA 1JWSB 1H3VA 5D9SA 2MFNA 5B3JE 1U3HB 3O6FB 3VJ6B 1AKJA 4X6EB 4NGHH 2R1WA 3G6DH 4JR9L 4JFZL 4HKJA 3OJDA 3M8OL 2Z8SA 1RUAL 4RMTA 4NT6B 3PQYD 2VDNL 5DD0H 4YXKH 4HGKC 3IDXL 1FSKC 5E6YA 5JOEA 4KY1H 4JFFA 3G5YB 2VR4A 3T0AA 2PYEA 3QB7C 4RAHA 1IAIL 2BNUB 4CVXA 4G8FB 3WSQL 2AJUH 1XIWB 4BKLB 4UB0H 3TF7C 1NUGA 3EOTH 1ETZA 3HE6D 1S7XA 2YEZB 4PD4J 4A6YH 3RWHA 1MWAH 1I9RL 1Z0MA 1IQDA 3MV7D 3LN9A 4PRBA 2W9LA 3VFGL 3CFBA 1NCBH 3REVB 2VZSA 1HHHA 3L6FB 1KFAH 3SE8L 1KJVB 1YEGH 1Y0LB 1JZ5A 3RNQB 5FM8A 3NFSH 1GOGA 4GXUN 5FFLA 5EB9A 1UA6H 2ICES 2R56H 4BQCA 4MXVF 5TJWK 3MLXH 1Q9KA 1DQJA 1ND0B 4PY7A 1G0XA 2O5XH 3GSNH 5HVGB 3UBXG 2EH7H 2B20A 2VLJD 4OZGF 1GPOL 3NIDE 2AJZA 2ZKHH 12E8L 4LSTL 3MJ9H 1JPFB 2E27H 1LNUB 4MYWB 3A6CL 1HHJB 2UWEE 3QEGL 1F6AA 5MI0C 3TIEA 4JFQB 2XWTA 5CEZL 4AIXA 4LPCA 4X83A 2XWBA 3D85B 5ICZB 4KMLB 3T2QA 2JCCB 5F7NC 4X4ME 3C5JB 4ODXA 5C0BD 2X5PA 4JFED 3AXLB 2AJVH 1FZKB 3FTGB 4YHOH 5T1MB 1P84J 1JGLH 7CGTA 3U0WH 3TO2A 2R23B 3D18B 4Q0XH 1A7OH 5DQ9B 3C08H 4X9HA 3WFZA 3R06A 5TE4H 5EU6E 3I02A 2AXGA 4OSUL 1S7VA 4CKVX 4NKDB 4S1QL 2P4AB 4RZCB 1E4XL 3HUJF 2EIBA 4XZUB 1S5HA 3QNZB 4WI8A 4BSWB 3HC0A 5D1XC 1TVDA 2Z92B 4J6RL 2UZYB 3SN6N 5T3ZH 3S35L 4Z5RB 1X9QA 1CGSL 2XN9D 1IGTA 1X7QB 3K2UL 1JZ2A 3FONB 1Y18A 3RVVD 1SY6H 3BE1L 3UTPE 5I6XB 3HG1B 4K3HA 4F37F 3KLDA 4K71C 4OKDA 4ALAL 4Y4FC 5L6YL 5IFJA 1KCUL 1QSED 2UY7A 3EDJA 2B0SL 3EOAB 5D2NA 4I5BB 4U7SA 2R0ZL 1FIGL 3PHQB 1FNAA 3CSYB 4LSVL 3DI3B 2J4WH 7FABH 2C3WA 3GJFK 4OD2A 1KLUB 5ERWA 3QWQB 5LQBH 1FO0H 1A6ZA 3DRQB 1I9JH 3HR6A 2ZUYA 2W38A 1DE4A 2PETA 2IQAB 2VUOA 3V0VA 4NQXA 5JZ7D 4JPWH 1A3QA 1FVEB 1F6LL 3VFSA 3Q6FA 3B2UC 3TBYA 4ODUA 4ORGB 1I8KA 1VKXB 3O0RL 3O6ML 2ATKB 3KYNA 3QO0B 4Z7VE 4PJFA 3DETC 2OTUB 5IVXA 2FCBA 3EO0B 4BSJA 4HFWB 1RZKL 5ILTH 4QHMA 1MRFL 4TUJB 2G75B 3T65A 3VGFA 2WQRA 5L88H 3SDXA 4PY8I 5IMOA 2H32B 1SMAA 3RPIA 4WU7A 4D0DA 4UNTA 5EC2A 3M17B 3RIAK 4JO4H 5DJ8A 3SY0B 2RQ8A 3DV4B 3RNKA 4KUZH 1ES0B 2NY4D 4FQIL 1LDPL 2WINA 4J4PD 4KZEL 2H6PB 5DD5L 3BIBX 3BIAX 1G9NC 4PJ8D 5HHPA 3BZEA 4MQ7B 5C0CA 2YBRA 3NAAH 3OX8A 2XY2A 2YN5A 4MCYA 4KKLD 5F44A 5I74B 3DO7B 5IESL 1OF2A 4KKAD 2AJ3A 1NGQH 3MREB 4EN3B 1KN4H 3GKWL 5DRXA 1LDSA 2DJ4A 4N0CC 1T7VA 3X14B 4R0LC 2ZCKH 4EIGB 5ELIA 1SEBB 2QSTA 3QHZL 3SDAD 5H2BA 1NEUA 5EORL 3KLSA 1FV1B 4LLUB 3RQ3A 5F21B 2R39A 1HIML 3GMPA 2ZSVA 3BOVA 1KLGB 5E5RB 2X4SB 4LNVA 3LRSA 2E7HA 5I17B 2ORBH 2Y5TB 3SQOL 3C9NA 4GRLB 3GSUA 3PWNA 5DURD 3Q2CA 4NDMA 4JQXA 5KSAC 1AGEB 1ZXQA 3RX5A 4PJ7F 4YDLC 5C2BH 2GAZB 2IGFH 3LQAH 3C2AH 3MRQB 4CU7A 3ZKMD 1IKNA 1MCSA 4X6FA 1CGVA 3DX7B 1EBAA 5DVOA 5CEXA 3O4LA 2VLKB 4DK6A 1CBVH 4GG6F 1AIFB 1CICD 5GGQL 5GXBB 5DRNA 5JW4Q 1JGEB 1QG3A 4KVNL 2CRMA 1OGTA 4BFIB 1F58L 1KJ2B 3TPUA 1OCWL 3F7VA 4QHNA 2V2XA 3LSOB 3UTOA 1MPAL 4OFPA 3CK0L 5EU6D 1MH5A 1TJHL 4GRMB 1VFAB 3VXUA 5SWZA 5I1LB 3WIHA 3O3DB 3PABB 4Z78B 2BVEA 4XPHL 1KF9B 3QFJA 3HE6C 4QRUB 5KVDH 4JN1H 3VCLB 3I6GA 3I50L 4QOKB 3DURA 4WTXA 3SGEH 3LRHA 4ZDHB 4LGSB 1NBZB 4NO0B 5C0IA 3UTPD 3V8CA 3W2DH 1J0HA 1BFVH 4U33A 4I0PD 5DC4B 1MEXL 1WAAE 1KEMH 4QXUH 3HUJA 2CLZB 1UKQA 3IDJA 4JM4L 2BOBB 2F19L 2A73A 1CD1A 1RIHL 3IDGA 3OPZL 3ARYA 4L4TA 3KJ4B 3QH3B 4HZLB 5DD6B 3L7EA 1OGAE 2EDQA 5E24E 4AG4L 3WDIA 5HBBA 1Y6NR 3D69B 4NQDB 4XT1C 5GGSA 1FPTL 5D72L 4K3DL 4NRXB 1IM9A 1YPZE 2DICA 4WGWB 4NNPL 4S10A 1BF8A 2DB8A 5HHOE 2J12B 3LZFH 3P3YA 1CS6A 3QIUD 5EO0B 4H20H 3GMMA 3I84A 2J8UF 1H9VA 3CUPA 2ESVB 3MLZL 2B39A 4JQIH 1XR8B 4XVJL 1U8IA 2BHUA 2PXYD 3GDBA 4YC2B 5HDBF 3N1PC 4XNUH 3MOAL 1A22B 3U83A 1D5IH 1AFVH 4XCCL 4OZFH 5HVFB 1QVOA 5J11C 5IOPA 1VFBB 3DNKA 3GM0A 1IZJA 3SKNA 4LCCB 4JM2C 4JPKH 5EO1A 4C56B 5JOFA 1GYAA 2DQEL 1FG2B 4HWEH 1XGYL 3HC3L 2EKSA 3EJYD 3RVVC 4L1HA 5FXCH 4JRYA 3VXOA 1MUJB 1IAIM 1CFQB 2EEBA 5HGBA 3L3JB 4S2SB 3X12A 1AGFB 2R0LH 3H9HA 4LP5A 3G5XA 3PDOA 5F89A 3T77B 4RFNB 3TN0B 1AGCB 4WNQB 3PDDA 4FABH 4LLWA 5CJ8A 3MLPA 2MKLC 2H45A 3MNVA 1AHWB 1XEDA 4X4XA 5T1DH 3QO1B 3U9PL 4PG2A 3WS6A 1ZLWH 4L8BA 3LKOB 2QQQA 4H88H 4EUPH 3AS2A 4NZRL 3VFNB 1XAUA 5E03A 3VFPA 1S5IL 3ARPA 1AR1D 2Z8VC 3K81A 2BHYA 4I77H 4X5WA 4WWKA 1U58A 4BUHA 3MOQA 3BP7A 4YXHH 5KN5A 5HDLA 4YH6A 3OKEB 1KIRA 3Q0HA 4HUVA 1R3KA 3NMEA 3C2SA 4OGZA 3PP3K 2EZ0D 1BEYL 1FZMA 5FUOL 1ZTXH 1K4CA 1RK0A 5CMAB 5HY9A 4MCZA 5DLML 3ALPA 3KYOA 4MNQD 1A0QH 5CJXC 3PWPB 4RGNB 4PRIB 1S7TB 2BJMH 2UY6A 4ZSOE 5KANI 3HLAB 2YD3A 1QNZH 3F12B 4QLRA 1BPVA 3KDMB 4K9EC 4KRPB 3FJTA 2BY2A 3IU3B 1W72A 2G9HB 1VPOH 4AK1A 1E4KA 2EYSB 4XMPL 4P9HC 3RAJH 1FG9C 1CL7H 1VDGA 4M6NH 4R4BA 2X4QB 1PFCA 3VXNA 1ACYL 2XZZA 2NY4C 3VXPB 1WK0A 5L2KA 4J4PC 4XCEB 3ULUE 4ETQB 1N64H 4OFIA 4HUMB 5KSBB 3HNSH 3M1BB 1T20B 5EBMA 3HC4H 4YDKH 4PJ8C 1OOAA 2F54E 3BHBA 3MRDA 4HJGA 3ARBD 1HSBA 3WMSA 2CIKA 1RZJC 1WBXB 4RMUA 5GS2D 1IGFH 5E70A 1V7NH 5IF0A 4KKLC 1QQDA 4PJDB 3BKCH 3FO1B 4GG8B 4YFLI 4KKAC 3CU1A 4WRLA 3RI5F 4Z0XB 3KXFB 4GRWE 5FYLE 3H9ZA 4YZFF 3IRZA 4YR6B 4GG6A 4Q9QL 1EJOH 3GSVA 4ERSL 1MAML 5DO2D 4DGYL 5FCUL 2OJEB 3T0BA 2B5IB 3REWB 5JW5A 5I30L 3EDFA 1LVEA 5HGHA 5DK0B 4K3EH 3SDAC 4JZNA 4PRHA 4PV9A 2VDOL 1DL7L 3ETBF 5CUSL 4F7PA 4C4KO 2A1WH 4M6OH 5TQ0H 1ZLSH 4M1DH 3L3IA 1OGAD 5C0DA 4XX1E 4WW2B 4QCIB 4DK3A 2VLRE 3CMOH 5J13B 4FQCL 3FO9B 5ACLA 4UNUA 3KPRA 5DUPL 4I0CC 5I1KL 4LRNL 4PGBB 1SYVB 5HHOD 3HE7A 4NQEE 4Z7NE 1A3RH 4Q2ZA 3NABL 3VXMA 1CICC 3QWRA 1Q0YL 1C5BH 2IFFH 3LKQA 5C07A 4MB5A 3VRIA 1MCIA 4ZPVB 1OM3L 5J6HA 4NFCA 2NY0D 4FQQB 4NM8H 2IPKB 5DRWA 4NYLB 1QR1A 4YAQB 4DQOL 4QTIH 1JHKL 2HKFL 3V4PH 3Q5YA 2X89D 1I3UA 3UBXA 4YHPB 3CVHB 3TVMA 1TETL 1DFBH 4YLQT 5L0QC 4UAOC 5D7IB 2VABB 2GFBA 5C0ND 4AMKL 5EH1A 4FQJL 3TJHD 3GB7B 4FQXC 2YSSA 4H1LG 3GJFH 1EFXA 3EOBB 5SWSA 3QCUL 2Z93A 2MJWA 3HZVA 3T1WA 4M61B 5I19L 1GSMA 1U91A 4PJ5E 4MJ6B 2FBJH 3BAEL 2JB6A 3RHWF 3KWWA 1A5FH 2CKBA 4MX7B 4I0PC 5FOBA 3VWKC 4WI2A 1PKQA 4M5YH 3BKYL 3K1DA 1KPRB 4M5ZH 4HK0B 4LASH 2EIZA 4UT6L 4FG6D 2NXZD 2APTA 1UWEL 1BVKA 1OPGL 2IBGA 1ZE3C 3EYVA 4BM7A 2E8ZA 4I48A 2NW3B 3I85A 2FRGP 1YJDL 5BZWB 2OP4H 3RUGE 3V5DA 4BQ9A 4JHAH 1A9BA 5AUMA 5I9QC 5FHAL 1TZGL 1U41A 4OQTA 1QSFE 1NC4D 2XNAB 2AQ2A 6FABL 2CSPA 2DQCH 2X7LB 4PTTB 3HNVH 1G6RA 2DI7A 4HC1H 3U46A 2NY5C 2HN7B 4OLZL 2PXYC 4ZMAT 2DBJA 3OZ9H 3WHXA 4YHLH 4PRDA 1KJ3H 5SX4I 3CAFA 4LVOC 1CXHA 2I9TB 3CSGA 4YBQD 5CZVH 3DX9B 3UXFA 1KPUB 2HH0H 4UTBH 1HXMB 3L3KA 1X5LA 3VXQA 3BMWA 1IGMH 2AEQH 1U8LA 3PF2A 4HMCA 1H3XA 4XVSL 5EWIL 1FFRA 4GKSB 3EJYC 2P44B 3CFIC 5J57B 3BO8A 3RWEB 2YUXA 1FNLA 2ADIA 4TNWK 1N0XL 4X8JB 2VAAA 1PQZA 2Z35B 3BEVB 3ULUD 3JTSA 3C5ZB 4L9LC 2F54D 2VOTA 4XAWH 3ECBB 2FHFA 1TCMA 1RZ8A 5DD3H 1ZVYA 1I1YB 4M93C 5FKAB 5HPMA 4NQUA 4U6HB 5HD8D 5EZJA 1CLOL 4P46D 1DLFH 5IEHA 1ONQB 2ZSWA 3O3EA 5FYLD 3L1OH 3LQZB 2X41A 1MIMH 1AR1C 4YHNB 2OK0H 1V3LA 3FHAA 1AJ7L 5EUKB 3T3PF 4MWFB 4LVHB 1UXSA 5JXAL 1NCNA 1S8DA 1FLRL 2BNRA 5DJ0A 4P2QE 1K5NB 2DIAA 1KJ2L 2AV7A 3CXHK 4C83A 4F37K 3GMLB 3TA3B 2EZ0C 5BMFL 2ZUWA 4J23A 4CVWA 4LBEA 2ZUQB 3JWOH 3PV6B 1TTUA 3QIBD 1EEYB 5E99L 3EJJX 2MCG1 4O00A 5I71B 1CVRA 3WIFA 4BK5A 4U2ZA 2Y07L 3BDBA 3E8UL 2B1AL 1K2DA 5CCKL 2OR9L 3U36B 1X5JA 2RIKA 1T4KB 3B3IA 4LP4A 4LDOB 5GS0L 1A02N 4WWID 4JE4B 4PR5A 1MI5E 2XA3A 4XHQA 3VG9B 5MENA 3G04B 1UH2A 4NQED 4R97C 3D1MC 4IMLB 4PBWD 5D1XA 2ERJC 1RSFA 1HI6A 1WZLA 4KRNA 3MUY1 1HNGA 4OZ4B 3FT2A 4JN2A 4JZJB 1A1MB 2VKWA 1N5YH 5EBLA 3QEQA 2R0ZH 3L5XL 4P57B 1D6EA 1TVHA 4KK6D 4XB8A 4UQ2B 2X44D 3FL7A 2P47B 3QQ9D 3ARBC 3EAKA 3H0TA 4ZTPH 1XGQB 4G6MH 4Y4FA 4OIIH 2A0LD 1FAIH 1NCAL 5IMKA 1ACZA 1XH3A 1Z0NA 1UB6B 2VXUL 4LLMA 2J8HA 3VXSA 1WCBA 2DYPB 2HWZH 4M8QB 5F7MC 1RURH 5JLZA 1J05A 5HHNA 1VERA 5IP4A 2YPLB 5DO2C 1DBBH 1JPGA 2K7QA 1UB5B 2CJUL 4HUWB 3TBTB 4PJ5D 3HZYB 3GRWH 3T2OA 2V7NA 1JRHL 2P24B 1T0MB 1KEGL 1QOKA 2D9CA 3HR5B 4CNIA 2YUWA 1CDHA 3NZHH 1QRNB 5B39B 2V5RA 1N2RA 4ZXBB 3D3VE 3GI9L 1UCBH 4PJ9A 4HBCL 3IJHA 4PYHA 1D9KC 3CDGB 1SM3L 5ESQB 4XTRD 2XKUA 2Y06H 3ARTA 2CGRH 3ELAT 1Q72H 4PRPB 4MJIA 4CU8A 5D9SB 4GMTL 4LQFH 4P5KA 3BGMA 4JREC 2CD0A 1AKJB 4HX1A 5DHYA 3BGFB 1BD2E 1NLBH 4NKIH 2VR5A 5F93C 5I73C 3S34L 3AVEA 1MFBH 1OSPH 2OTWB 3H9SE 1QSFD 1MJJA 5E8NB 2FO4B 4XPGH 2B4CH 2NY0C 4QRPE 3MXWH 4XC1H 2J3SA 4P9MH 3UP1A 4JFFB 2DJUA 4CVXB 1J1OL 3LEVL 2B7DT 3BDYH 1MCOL 1WEJL 1FDLH 5JPMA 5C0NC 3BW9A 1YEKL 2E7LC 1PDKA 3IDNA 1ETZB 1S7XB 4N0YH 3TJHC 3RWHB 1H3TA 2AXHA 1IQDB 3FQRB 2RBLA 4N9GA 3BKJH 4PRBB 5FUZL 4RIRA 4YXLH 4J7RA 3CFBB 2DMKA 1MLBA 4K7PH 4BSVA 1HHHB 3HMXA 1IQWL 2YA2A 3O2WL 3C09C 2DD8H 4LDLB 4IJ3B 5JW4R 1WFOA 1Q9KB 3PP3H 5EU5A 4PY7B 4U1NA 3VA2C 1YN6B 3MV11 4CW1A 5EO9B 2NX5E 2IJ0C 5GRZA 5B3JF 1C1EH 5DJAB 2CDFA 4FG6C 2AJZB 4H8WL 1HHKA 2NXZC 4MZ2A 1AD9A 5K59E 2K1MA 4TNVF 1TQBC 4RWYL 5I8EA 4RWHA 4Z7OE 3TIEB 3ZKXC 4G5ZH 1Z5LA 2XWBB 4GSDL 4K07A 3P0VL 4ODXB 5KSAA 4OB5H 5C6TH 2PW1B 2DLGA 1RQ5A 4P2QD 2VNCA 5D1QD 3MMEA 4F7EA 1EK3A 3FO2B 43CAA 5L9DH 1J87A 1JJUA 1QFHA 1V05A 4ODWA 3WLWD 3W5NA 4AL8L 1ADQL 2AXGB 3I02B 3L5IA 4ZOEA 1S7VB 3SJVB 1B0GB 2CUIA 4PJXE 2JB5L 4R4FL 4JGJA 5F1KC 2GJJA 4HFUL 5CJOH 3PQYA 5D2LB 4Y88A 1FYHB 3HC0B 1Z3GH 2UYLA 1MI5D 3GMNA 3F65A 5EG6C 4MHHG 5LAXA 5BVPL 4MA1C 4YFLF 1IGTB 3CVIL 3KYKH 1A7QL 4MA8H 1U93A 1Y18B 3T0ED 1QBML 4PJAE 5K9JL 3HE6A 2F19H 5IFJB 3WO4C 3MV7A 3NIDF 5DHVA 5D2NB 3ULUC 3PGFL 3L3GB 1WZ1L 1YY9C 4YFDB 5F9OH 1HINH 4N5ED 5IEKA 1A2YB 1NKRA 1UZ8B 4QXTA 3WUZA 5FO9A 1FGNL 5E5UB 2BK8A 1I8IA 2FSEA 5HDQL 1W0WA 2P8PA 5HD8C 4P46C 1BOYA 1F4XL 1JF1A 4P2OD 5ERWB 1INDL 2HRLA 1RD6A 3UBXI 1A6ZB 1NMAH 4WI7A 5T3XE 1DBAH 1N3NB 3F7QA 3I3DA 1B6UA 3TCLA 2VLJA 1A7RH 2NW2A 3V0VB 1U92A 3FB6A 4NQXB 1H5BC 8CGTA 4XVJH 3Q6FB 4QHKJ 4ODUB 1I8KB 4NUJA 1KCKA 1S7UA 2BVOA 4O2CA 3KYNB 4PJFB 4JO2H 5C0BA 3QIBC 3CVHL 3BWAB 4JFEA 5IVXB 1DDHA 3U0TA 2I60H 3D3VD 1H3PL 1S7WB 3T65B 1JTOA 1XZ0A 5J1AA 1R5WA 4XB7A 3SDXB 2X4RB 2GCYB 1UM5H 4HXBH 4E5XB 5IMOB 3BPCB 4GQ9H 2PN5A 3P2TA 4JFOA 2R1YA 4WU7B 4WV1C 3RPIB 3JV4A 2R9HD 2ADGA 5DJ8B 3B4NA 1BD2D 2RGSA 2YS4A 2Y23A 1BHGA 3ZKSD 2D31A 3BYTA 3VMNA 1BAFL 4V2BA 4HV8B 4JM2A 1G1CA 2CQVA 3ZTNH 5JIKA 4GLRI 2D0HA 3UZQA 5KTEL 2NXYB 4KK6C 4N8PA 5HHPB 2XN9A 3BZEB 5C0CB 3WUWG 4KTDH 1JMXA 3QQ9C 4G6KH 1XF2A 5LXGH 2OMBA 3WN5C 4JHZA 3GMOB 2A0LC 1JWUA 1QSEA 1JF6A 2CDEB 3UTQA 4N0UA 2J88H 1IEAA 4D94A 5DRXB 3TC9A 1OHQA 5MEPA 1BQLL 1JFQH 4U1JA 4JHWL 1C12A 1WFUA 1RIVL 1YEHH 4XMLL 2Q20A 3FAWA 3TBWB 2ATPA 3S88L 3QUMA 4LVNB 5HGDA 4JY6A 5H2BB 4MJ4A 4LCWE 5IKCB 3GMPB 2A9NH 2OR8A 5K9KA 2NX5D 3LRSB 3GJEB 3L3HB 4ZD3L 3C9NB 3GSUB 3PWNB 4K3JL 3FAXA 1WLHA 4NDMB 4HWZB 4XTRC 3TYGL 5INCB 1A6WL 3GEWB 4KROD 3EDDA 3L3DA 4H1LA 4QHLA 5CJXA 3R1GL 4RFOL 2AJXH 4P4KB 5EZOL 3BESR 3QHFH 4X6FB 3H42H 3OGCA 3KR3H 4WI6A 5CEXB 2BY0A 4M4RA 5EC1B 5HYQA 3O4LB 3WIHH 4ZFOA 3RIFF 5DRNB 3QCVH 3DSFL 5DRZA 1JYXA 1JI1A 4QTHA 4QHNB 3C87A 3F7VB 3AAZA 2FR4B 5AWNH 1CVSC 4G80B 4LHQB 1JPTL 1YNKL 3UJIH 3VE0A 4ESKA 3TBVA 3VXUB 4HIHA 4J8RA 5SWZB 4J4PA 3B8YA 1UCTA 4ZOBA 5FCUH 5BS0E 4PJ8A 3QFJB 1UKTA 3EHBD 4LAJH 4ZQKB 3D6GA 3G08B 5GRVL 3KJ6H 5JW3H 5C7XL 3DURB 2KKQA 4OCNC 4JY5H 3UCRA 5C0IB 4XX1G 3AM8A 4HH9A 1M7DA 1CGYA 4YEEA 5DMIH 1MJUL 1CD1B 2A73B 3AROA 4NWUL 3ZL4L 3IDGB 3D39D 1KCVH 1HNFA 5K9QG 3L7EB 3P11L 4MS8D 3ZDXE 1F4WL 1QFWI 3SDAA 4EIZC 2DDQL 2QSQA 3O45B 1U95A 1V7MH 2ZG2A 5GGSB 4RMSA 2H26A 1HHGB 4UOW1 1MJ7H 1MY7A 1ZEAH 3EJZD 4YBLB 5T3XD 5IW3A 2LVEA 3NABH 4UU9A 2VDQH 1LE5A 5BQ7A 3MJ8A 3QQ4A 3GMMB 2FWOB 2EDTA 2HKFH 3RHWK 8FABB 2UWEA 3BP6A 5D1QC 3WD5L 4K2UL 1C16A 4P48A 1KN2L 4FFVD 1U8IB 4X4MA 2P5EE 3T09A 2ICCA 3MLSH 3WLWC 1CICA 2XOTA 1TCRB 1XF4B 3HI1A 3WFCL 1J12A 1FCCA 1G9MC 3ZE2E 3ULVL 3QUXB 2WBJC 2A77H 2OZ4A 4ONGL 5IOPB 4NO5A 1FYTE 1YNLL 3VGAB 3SKNB 1I7TA 1RU9H 5EU6A 1LD9B 4OF0A 5JOFB 1WAAF 4LHUB 5KS9E 3FQWA 4PREA 2WWMD 4K7PY 4JRYB 3UTSB 5EIVA 4LSPH 1EHXA 2DKUA 4FQXA 3RWDA 4TQEH 5H37H 1P7KA 3BKYH 3H9HB 5F89B 4L1DA 5H94A 5F7EH 5E08H 1JV5B 1UEYA 4AEIH 3MRFB 1A4KA 4ZG1A 4F7TB 4M1GH 5D7SH 4HS3A 3U4BL 4N5EC 4BQ6A 4X4XB 1OPGH 4LKCA 2D9QB 4I0PA 4JJHA 4OV5A 4LARL 3VWKA 5H8DA 2GTWA 4OCSL 1H3GA 2F74B 3V2AR 4P2OC 3OR6B 4PRAA 5FM5M 3J8F7 4QEGA 4WWKB 2FGWH 3DXAE 4NFDA 1NGPH 3MUZ1 1FC1A 2R0WL 3BP7B 4LSUL 4J3VA 1YDPA 3S37X 1OSZA 4HUVB 5ADPL 1YMME 4TVPH 2FLBT 4GXUM 4LCWD 3LKRA 4MCZB 4WHCA 5ETUB 5GGRA 1ED3A 3KYOB 1RZFL 3MLYL 3FB8B 2HJKA 1J8HE 2K9UA 1VGEL 1OTTD 3GIVA 3HI5L 1JGVH 2WUCL 2F15A 3KPPA 1ZHLA 4Z7VA 2FH8A 5IGXH 2YZ8A 2PXYA 3DUHA 2ZOLA 3X11A 1HWGB 5CGTA 1EXUA 1W72B 3BPOC 2R9HC 5T1LD 1MFAH 4U1KA 4U6XA 3B5HA 1N0XH 4R4BB 4JVPA 1JPSH 1N59A 3QUYC 3ZYOA 2Q8AL 4BZ2H 2V2WB 4Y19E 3NH7L 2A38A 5DD1H 5L2KB 4YQXH 3BQUD 4ODHH 3QHTC 5EBMB 5E2WL 3D5OF 3BHBB 1NAMA 4HJGB 1HSBB 1CLOH 4HQQH 4UT9L 3RWFB 4KUCD 4G8IA 5TF1H 1NFDE 1QQDB 5DEZA 4L9LA 1D3CA 1TVBA 4L8DA 5BS0D 2A6IA 1GGUA 15C8L 4GG6B 4OZIF 2NY6D 1U8MA 1FLRH 1KJ2H 5HI4D 4WY7L 5DFWH 3OKNA 3WHE1 2AKRA 3V8OA 4QRSA 3CFJA 3ZE1F 1PW3A 1EVTC 1DANU 4F7PB 5JUEH 4Q9RH 3QNXA 3BPLC 4Z0BL 4N0RA 3L3IB 5ALCH 4FOMA 4N68A 5GS0H 5TH2A 1QZ1A 2AGJL 1YC7A 3UYRL 4Z77A 1D6VL 3VH8A 4KROC 3CZFA 4OLYL 4NBYB 3WKML 4U1MA 5FYJL 3SHSA 4UV4H 4GKOA 3WFDH 1O7VA 4H0IA 3ULUF 3HE7B 1OP9A 4N0FA 3QDAA 4Q2ZB 4JKMA 3VXMB 5C07B 3VRIB 4BH7B 3BX7C 5E8OB 5AYUH 5J6HB 1RUKL 4OLVL 4LGPB 5DRWB 1QR1B 2ADFL 3C8DA 1FZJB 4R90L 1Y6KR 4KAQH 4PJGB 4RDQG 5D4QA 2HFTA 3VW3L 3OKLA 2P5ED 1VCAA 5TE6H 1M7IA 4UUJA 3UBXB 3TVMB 4NQCB 4JFDE 4HGMA 1G0YR 2IANA 4ZPTB 1IAOA 4Z8FL 2Y36L 3I75A 2GFBB 5ANME 3IFNH 5GS3A 2RAMA 2C3GA 5INDB 4G8EA 1FYTD 3MLWL 2JJSC 5IFHH 2R2HB 3OAYK 5I1JH 2G60H 3ARBA 3P0YL 2CXKA 1EFXB 4NN5B 4LEXL 5SWSB 1UGNA 2Z93B 4I9WE 1MFCH 3HZVB 2X10A 1JRHH 2DAVA 1U91B 3PL6D 4WO4D 1UM6L 3WFBL 4P5TB 3KWWB 2CKBB 3QBTB 5DJ2A 1CF8H 2QL1A 1QSZA 1PKQB 2XYCA 3RWIA 2VXTH 5CP7B 4DAGH 1TJIL 4GOSA 3P4MA 2WSKA 4HBQA 3JXAA 1A47A 4MS8C 2EIZB 4OQTH 4X7SL 5BVJA 1S78D 1WAAA 1W0VA 5B38G 4BYHA 4Z7NF 2XACC 3EYVB 5HHVH 4I48B 1G6RH 3TT1L 1HKFA 3TZVD 4JG0H 4ZUUA 1D9KA 1OGAA 3DXAD 3V5DB 3V6ZB 2YD8A 1A9BB 5AUMB 2YPKA 3SKJH 2ENYA 4N8CH 1T89C 1YMMD 4UILH 3MFFB 1YPZA 4TSCL 5BRZE 1I3VA 4L29A 1A7NL 5I1EL 3U46B 1EMTH 3BH8A 4FFVC 5HHOA 1J1OH 4M48L 4NRZB 5M95B 5IBUB 4GS7C 3QDJA 2D7TL 1JTTA 2BVUA 3O6LH 4OM0L 5CEYA 3ULSA 5KSUA 1J8HD 2VN4A 1DQLL 5CLWA 1KENH 5IJKC 1DUZA 1QA9A 1FSKB 2VL4A 5CBAA 4GW5A 2X89A 5F1OB 4JJ5A 1HH6A 4Q6IB 4Y2DD 4CL7A 3L3KB 5I66B 2DWDA 1LO2H 2BSED 1GGIL 3MRNA 2EXYD 2PTTB 2E7LA 2WWMC 3LS4H 1NCDL 1HE7A 3BO8B 5GGSY 2ADIB 3K8KA 3V0WL 4NJAL 4YUEH 4Y19D 4TSAH 4XNXL 3UJTH 2XFXA 2VAAB 1PQZB 3ARZA 5CEZE 1XCTA 4KQ3L 4Y5XC 5LCVL 1BM3H 2BSRA 1DEEB 3BD5A 3MGOA 5ISZE 2YK1L 5HPMB 5IIEA 1CDYA 2VERN 4G6JH 3X3FH 1JP5A 1JN6A 5EZJB 3AB0C 3MRMA 2A9MH 5DJCB 3VRLE 3U4EB 1HEZA 4LMQE 4PB9L 4PJBB 4HKBA 4DGVH 1A7PL 2XTJE 4PGCB 2CDGA 1T66D 3O4OC 3SGJC 2QLVB 4H0HB 1S8DB 5BV7C 1Z9OA 1ZGLM 3F6IA 1AI1H 4XPFL 5DJ0B 4HIEA 4C83B 1QLRA 4D0BB 5MI0B 5I2IA 4JAMA 3HFMH 4NKMA 2N7AA 1DTUA 3WS3A 3WNPA 3WUWA 3RZCD 3HI6L 1MREH 1FP5A 4HFUH 4ZFGL 4HCRH 5LGKA 1NC4A 3DMMD 1C5CL 4HK3N 1N8ZA 1K2DB 1JNNL 1OTTC 3P9WB 1RJLA 3BDXA 3B3IB 1YEFH 3MR9A 3VMOA 1QBLH 4G8GB 4PR5B 4XNQA 3WNKA 2VDRH 5EZLB 2BMKA 3H3BC 2YD6A 4YDVA 5I8OH 1NUNB 5MENB 3SQBA 4ZSOA 1IL1A 3A67L 5AD0B 1FCGA 5D1XB 1HI6B 4ODVL 4JGUA 4F58L 3B8SA 1XGUA 5EBLB 3QEQB 1D6EB 1TVHB 1R0AL 3ZDYE 3MA7B 2IF7A 2WNGA 2FH6A 4S1RH 1FBIL 2E7CA 3H0TB 4JFDD 3E1F1 2GJ6E 4K71B 1AXIB 3MXVH 4Y4FB 5IMKB 5TF0A 1P4BH 1XH3B 4TUOB 4LNRA 3DO3A 3T4AB 2HTKD 3PGCB 3LIZL 5JLZB 1J05B 2F54A 2HFFA 2NY6C 3CFCH 3QI9D 3FZUD 1JPGB 1J0JA 4D3CL 1I85C 3F7YA 1CFVL 3PXHA 4P46A 4MGXA 1M7XA 2G2RB 2R4SL 3UC0L 3WXWL 5HI4C 1J0IA 2DLHA 3GSWA 2V7NB 3MYJA 5FM4A 4LIQH 3S9DB 2IPTH 4CDGC 2X1PA 2V5YA 3E0GA 1ORSA 4CNIB 2W0FA 3BIKA 3BEWA 1J1XH 1A6VL 1T0PB 4Y1AE 3QEUA 4Z7WF 1JE6A 1H5BA 1N2RB 5CJ5A 4PJ9B 1GOFA 1NAKH 3IJHB 1EEZA 4Z7UA 1U0QA 1IBGL 3WNNA 5CWSA 4HK3J 3GSXB 2PO6B 5IBLD 3QIBA 3ARUA 4CMMA 4MJIB 2FX7L 1K3IA 3BGMB 1BAFH 5DHYB 2GK2A 3JWDL 4WGVB 2JJTC 3TIDA 1UJTA 2W1NA 3MCLH 2LTQB 5IHUL 2VLRA 2CRYA 5T5FH 1NJ9A 1EGJL 5D6CA 2VRAA 4ZAKA 3LRGA 3WV0A 5HHXL 1ZA6B 3HPLA 1F4AA 4CRPA 4DUWA 1LP9E 2MPAH 5DT1L 4NN6C 4RDQF 4XP5L 2B2XH 2AQ3A 2IAMD 3I2CL 5JPMB 2G5BA 1JHLL 3BW9B 4I3SH 3ROLA 5DEFB 1BQHA 2MQ3A 4BA8A 1OY3B 4DOHB 1X4YA 4XPTH 1NBYA 1ERNA 3WN5A 4N9GB 4UIKH 3PP4H 4RIRB 2R15A 4DKFL 1MLBB 4JFYA 4ORZC 4BSVB 3S37L 4XP1H 1G84A 4HIXH 1TNNA 3ILPB 3P30L 1OAYL 4WO4C 1MHHB 4OD1L 1UWGL 2MCPH 3MCKB 3W5MA 1L0XA 2ARJA 5KSVA 5JR1L 5CEZD 2FEDD 3I6LE 3T0XA 1FL6A 5EU5B 3VFTA 4WTZG 1ZS8B 4U1NB 3SDCD 1P7QD 4CW1B 1N7ML 1CXIA 3V52L 4PJ5A 5ISZD 2FEEI 1GZPA 1XF3A 2CDFB 3NTCH 4TYUA 4F7CA 1S78C 1AD9B 3MLUH 3R1GH 1SHMA 2Y9RT 5I8EB 4NN7C 3CSPA 1W72L 1VESA 3IFOA 3TZVC 2XTJD 5SWQA 1Z5LB 1RIUH 4YDLB 2VDKL 4HT1H 5CIPH 1B2WL 4X7FC 5D5ME 4MA3B 3OF6D 1QD0A 5L8LB 3NN8B 4K3GA 5HXMA 3MBXL 1X6LA 2E7BA 4X9IA 5FGBA 5E6ID 2E9WA 3CDYA 3IXAB 3RUGA 43CAB 2OXGA 2LABA 4ODWB 3UPCA 4RISL 1DCLA 2DM4A 3MV9E 1QSFA 3HMWL 1A1OA 2I9LA 1UEMA 3PQYB 4XNYL 4MJ5A 1Q0XH 5HGGS 5E9DB 2XQYK 5FCSH 1ZT1A 1EAJA 3GMNB 5TDPB 2FATH 4LF3A 4UIMA 4K7FB 3CXDH 2EXYC 5HYFA 1I1AD 4JFPB 1BGXL 2ED7A 1ORQA 3BZFA 4D9QE 5EPMA 2VB5A 2VQ1A 3MV7B 1BIIA 1MRDH 5DHVB 4PS4H 4LRIC 1UQSB 5K59F 4DVRH 2ITCA 5IR1A 3R8BB 1NC2D 1NGXA 5MP6L 4QXTB 1NDGA 4W68A 2GJ6D 1INEL 3QPQD 5FO9B 4OGXH 1PZUB 4DVBA 1I8IB 2FSEB 4OZFG 2P8PB 2MKWA 1HQRA 1JF1B 2DQDL 5F6IC 3U9UA 3WFEL 3ZHLA 4GJTB 4HWBH 3EYUH 5AZEH 3X13A 3BKML 3OKKA 3IYLW 2W9EL 2VLJB 5KOVC 3TCLB 1T66C 1KTRL 3LAFA 1HQ4B 1U92B 3FB6B 4DCQB 3DROA 1R3IL 1WSST 1Z9SA 1QFOA 2MQ0A 1J0ZA 2Q86A 5DK2B 3THML 2BVOB 4O2CB 4PYGA 3I3EA 4MSWA 1MRCH 1JWMB 4N9OB 3RZCC 3FT4B 4W70A 5T1KB 3B6SA 4Y1AD 1XMWA 4PP1D 4FS0A 3U0TB 4HAGA 3ARGD 2WUBH 3PG2A 4P2QA 4K55A 5D1QA 3DMMC 1MAKA 3MOBH 1R5WB 3N1GC 4I8DA 4OLEA 2NY3B 2FZ3A 3IJYA 4PJAF 2YRZA 1WT5C 2R1YB 3O2DA 3JV4B 3HRZA 2CIIA 3KNBA 4RMQA 1SJXA 2FIKA 3EFFA 3OAYH 2WBJA 3MROA 5I8CA 5J11B 4HPOL 5D93C 3BP4A 4JM2B 5J0BA 2CKBL 1W8OA 4HUXA 3V95A 5JW4N 3KYAA 3TO4D 1MI5A 5DK3A 1F3DJ 1AGDA 4EOWL 2XN9B 4BH8A 1XF2B 1QRKA 1JWUB 4KJPC 4L4JA 4H5SA 4LPTA 4Y2OA 4HEME 4ISVA 3MUGB 4FN0A 2HTKC 4FQPA 3S96A 1W2KT 2GJZA 3V6OE 4GAGL 3EO9L 5MEPB 4U1JB 4KPHL 2HAZA 3QI9C 3FZUC 1QEWA 4F9LC 2LAGB 1IKFL 3AFLA 3QDGE 2EDHA 1K8DA 2EO9A 4ZTOH 2ATPB 3QUMB 4MXVE 3BUYA 1U8HA 4ZFZA 2NMSA 4DGIL 3PXJA 2IQ9L 3HPJA 2JKXA 3DX6A 2APFA 5E4IA 2P7TA 1T2QL 3WEXA 5FHBL 5DTFA 3MLYH 1AQDA 1IAII 2JJWA 3I6LD 4NHCL 3VFMA 4OZGE 3UTZA 1IZKA 1RUPL 4NHUA 3TM6A 2BVYA 1A6TB 3DHJA 3HI5H 2KQMA 1XF5A 3GHBL 5BXFB 4TUKH 1T1ZB 4RAUB 2IADA 3LVEA 2FD6L 2VYRE 1KXTB 1Q9WB 2KPNA 5IBLC 3QULB 4H1LB 2X6MA 4QHLB 1LO4H 2R8SH 3D3VA 3OGCB 3G9AB 4GKNA 5HYQB 1E28A 3AUVA 2Q8AH 2VSDA 3NH7H 3SGKC 3QWOB 1TZIA 4IOFD 4G42A 1PVHA 4KTEL 5E2WH 5DRZB 4R3SA 1HN1A 4G43A 1RZJH 1G1YA 4BZ1H 3QUYA 3GNML 3MODH 1YEJL 2NY4B 3MV9D 3H9SA 3TBVB 5JIIA 4HIHB 1AGBA 4J8RB 4OCWL 3D9AH 3NCYS 4K8RL 2IAMC 4WEBL 3VRJB 1QLEL 2NY2C 4QRPA 5HYSG 1AH1A 5GGTH 2P8LA 5B22A 2VZOA 4OLXL 3WLBA 2GSGA 3QP3A 3GGWA 1A14L 4PJHF 4XPBL 1JYNA 1RMFH 5KZCD 5DVLA 2NR6D 1UM4L 1PJ9A 4HH9B 1M7DB 5D7JD 4D9QD 3LS5L 1DVFC 3ME0A 4M7LT 2CO6B 3HAEH 3HTLX 2FEDC 4CVZA 4Z95L 3GSNA 3SDCC 1AR2A 3UTTE 1U8QA 3B9VA 3H3PH 2OX5A 4F8TA 1ZHKB 3UROR 4DW2H 5GGVY 1R5VA 1LO5A 1U95B 2FBOJ 3T04D 3V9FA 3MJ9A 2H26B 4KZDH 2NX5A 4JPVL 1PBYA 2HTLD 1BF2A 4U05A 4Y5YC 4WUUB 2F53B 2XTJC 3NPSB 1LE5B 5BQ7B 3O3AA 5CJQH 2I5YL 2DQJL 2E6JA 4XNZB 5D1ZB 2NY7H 3S4SB 1QFWL 4CAGA 1MVUA 2UWEB 4KUCF 3U1SH 2L0DA 4PLJD 5GRXG 1C16B 2KL6A 5E6IC 1WFTA 5JMOC 5L7XH 5CD5D 1CFSA 1CICB 3L95A 4MD5A 1WC7A 4R96A 3HI1B 3VFRB 4P23D 3FQXA 4OCXH 1CCZA 3HZKA 4LPUA 5L2JA 3E2HB 2D03H 4NO5B 1MELA 4GAJL 3SCMD 5CHNA 4EVNA 4UAOB 2EH8L 4PJXA 3JVGA 3FQWB 4MQTB 4PIRF 3SGDH 2CLVA 1P7HL 2EIEA 1I1AC 2JJSA 4FQXB 2I26N 5DQDH 3RWDB 1TJIH 1P7KB 4QO1A 4UINL 1U3HD 2UZIL 2XRAH 3O6FD 5H94B 3INUH 4MAYB 3QPXH 1A4KB 3BPNB 4N1EA 1Q1JL 4X7SH 3T2NL 4PJAA 5GRUH 2VWEE 5DVNA 3QPQC 4LKCB 4E9LA 2BDNL 2H3NA 3AMLA 4OV5B 3VWKB 2GTWB 1M6OA 1BZ7B 2DQTL 2F5BH 4OCYH 2DMCA 1EAPA 3LMJL 4P3DA 3S5LB 2AEPL 1OAQH 2I24N 2PR4L 1RZKC 4EJ1C 1YDPB 4NZUL 1XIWD 3NZ8B 5GGVL 2V17L 1OSZB 4WENB 2DLFL 2ZOKA 3Q1SH 1B4JL 35C8L 4LCIL 3ZE2F 3U7YL 1ZV5A 2H1PL 1ED3B 3V6BR 2IFGA 5IQ7L 5I9QB 2EEAA 3SE4C 1OWRM 1J1PH 4PJ7E 3O81A 4PP1C 1T89A 4OV6F 1IT9H 3UEZA 3DBXA 4R8WH 1G9NL 5KVFH 3IJSA 3KPPB 2KZ1B 1ZHLB 5ID0B 4HLZG 4Z7VB 3FN0H 5CILH 1Y6MR 3FOLA 4V1DE 2PXYB 3NFPA 3ESVF 2ZOLB 3X11B 4QF1A 1EXUB 3IKKA 4L3EB 1CR9H 1KCSH 4XCYA 1FNSL 2CMRH 4U1KB 4LVOB 4U6XB 5IJKA 2IPUG 3N9GH 4MNGE 5C92A 2OSLB 3IRPX 5IVZA 4JQVC 3HMXL 3TO4C 1MAJA 5C86A 1U8NB 3D85D 1NDMB 1NCCL 3QZWG 4Y16B 2VLKE 2V2TA 1X4XA 1NAMB 3PIQA 4M7JL 1YQVH 3Q6GL 4X80L 5I8KL 1JL8A 4JFXA 4KMTH 3BXNA 2QTEA 2VXVL 4NRYA 5JNYB 1QKZH 5DHXB 3NACH 2YPVH 3QXWA 4L8DB 1TVBB 4Y5XA 5A2KH 2A6IB 2D0GA 1RZIA 2VDMH 3DVFA 5JORA 3RA7L 43C9A 1C8PA 3NA4A 5T33H 3MLRH 1VA9A 4P2RE 4ODSL 4EDWL 3K74B 1F3DH 4XPAH 5GJSH 3OKNB 3OB0K 5IW6A 1I9IL 2AKRB 5EU7E 4QRSB 3U79A 4FZ8H 1GC1L 2Q3ZA 3EYSL 1OQOA 5LBSH 3TWCH 5I1GH 3SGJA 3FOMA 2QHRH 1MF2L 1A3LH 2YC1A 5A2JH 3UTTD 2FNBA 4Q58C 3B2VL 4UOW0 3MNZA 3NVQA 5FKPB 1MCWM 5TH2B 3VH8B 3QDME 5A16A 3B9DA 4J3XA 3ARDB 4PJIB 3MSPA 4U1MB 3DWTA 2J8UE 1NBVH 4KHTH 3V4UH 1EHLL 4TN9A 3MGAA 5AG9A 4N0FB 2F8VA 1NSNL 5B8CB 3MC0A 1WWWX 4IOFC 4X6CF 5DJYA 5HDBE 4ENED 3KPMA 4WTZA 5T1LA 4ODTH 5GS2H 2FLRT 1TDQA 3AREB 1M7IB 4UUJB 5DJ6A 5EOQL 5J9PA 4O2EA 2ERJB 2IANB 4HF5L 1AD0B 1IAOB 3RP1A 3I75B 2DBLL 5MERA 3F8UB 3V0AC 1NMCC 5E5MA 3S7GA 3N85H 4HJJL 4G8EB 3W9DA 4WW1A 3ARBB 2VDLL 4XP4H 1GZQA 4WCYH 1RZ7H 2XWJA 5JQ6H 3WL9B 3MRCA 1FN4B 2JF1A 5BS0A 5KJRL 2NR6C 1TNMA 2AAVA 2AK4B 5D7JC 3LB6D 1UWXK 4FXKA 3BVNB 3RWIB 3BSZH 1H0DA 1I85A 1CN4A 1FNEB 4HKZA 3P4MB 3RU8L 1CWVA 2VKXA 4KTYA 4GW4A 4KHXH 2G5RA 2FX7H 5LG1A 4XCFL 5DMJB 3KPNB 1W0VB 4P59H 2OR7A 3LKSA 1PZ5A 3DGGA 4U7KA 5F96L 1LK2A 1MVFA 1DBKH 2HTLC 1CFBA 4ZUUB 1D9KB 1OGAB 2HFEA 4TRPH 2AK1H 5JMRA 1UYWH 3ZZ1A 4O4YH 2VMFA 2YPKB 1EGJH 3KG5A 4EN3D 2JELH 4YK4C 1YPZB 5JHDB 4GAYB 4I3RL 4L29B 4X0KA 2QR0A 4U1HA 3BH8B 5HHOB 5DT1H 1R3LA 2JJTA 3RL1A 5I73B 2HKHL 3E6HA 4HS8H 4R26L 3RTQC 3HB3C 3QDJB 4L4VB 5CD5C 1JHLH 1D5ZA 5CEYB 5I1HL 3ULSB 4TOYL 1EBPA 2E7MA 1F8TL 4OZFA 2D7PA 1LK3L 4AEHH 2P8MA 5DMKB 4P23C 1AXTH 4OT1H 1DUZB 1QA9B 1J0YA 2X4PA 1N26A 1MFEH 2VC2L 4NP4H 5CBAB 2P5EA 4V1DD 1HH6B 2C3VA 3PWPE 4XWGL 1E4WL 3C5SA 1RPQA 4PBVC 3SCMC 2VXQL 4GRLD 3IKCB 3MRNB 4JKKA 3QUML 4FHBD 2VZUA 1XGTA 3JUYA 3WDHA 1FYTA 2C7UA 1HDMA 3O3UN 2P42B 4ZYKA 4LOUD 4OF3A 1A8JH 2XI9A 1U3HC 1X3DA 3RIAF 5KS9A 3O6FC 1VFMA 1Q94A 4N8VG 1XCTB 5F88B 4F57H 5DVKA 2O5YL 1CTNA 4LPXA 1DQMH 2VLKD 2BSRB 2KQNA 3KYMB 1OARH 3MGOB 2JLLA 4WO4A 2GQHA 4HIJA 5IIEB 2EECA 3LN4A 1JN6B 1I4FA 4EUPA 3MRMB 2AJYH 3CD4A 2EEDA 4RA0C 3RDTB 1CLYH 5GS1C 4HKBB 1F4YL 3V6OC 2VDKH 3UO1H 1LEIA 1ZK9A 2ZNWA 2KBGA 4JRXE 1U42A 4FZEL 5DUBB 1X5FA 1XIWC 5FDWA 1I1FA 4P2RD 4PJDE 4K9EL 3PV7A 1CGUA 4J1UB 3N50A 3KPOA 1QLRB 4LLVA 1PYWA 1R24A 4JAMB 4ZUSA 5GS0D 5I2IB 3TZVA 3ZKXB 4RFEA 4P9HL 1BJ1J 4YHZH 4QOKD 3WS3B 3DXAA 4XP6H 4NO0D 1X5XA 2BNQB 3RJDA 2CK2A 3K0WA 4YHKL 1YMMA 2EIDA 1N8ZB 2DWEA 3ES6A 5C0AE 1RJLB 1Q9OB 5L8JB 3QDMD 2YMXL 3MR9B 3IDIA 5ADOH 1MHEA 4Y8AA 3QXDA 4XNQB 2BMKB 2IBBA 3V5KA 1ITBB 1J8HA 4M7KH 2AI0L 1FL5A 1IL1B 4PUBL 3MLVH 4J12A 3ULUH 2HFGH 1G7MA 3BZDA 2FJGA 4FQHA 1XGUB 5DGRA 2DM2A 4LU5H 5IMLA 1YEIL 3VRLF 2APVA 5K33A 1RULL 4QRTA 1B0WA 1TZHA 3VGEA 3TV3L 2VITA 5FYLH 3WO4B 4LNRB 3P77B 4LRIA 2AXFB 5DEGA 4B41A 4LIQE 2F54B 1NANI 5GGRY 1JGUH 3VG0H 2DQFA 3VXRE 1DLHA 3OKMB 5D7IE 3ROOB 2DKMA 4OJFL 4LPVA 2EYTB 4NO3A 3VA6A 3F62A 1CD8A 3F7YB 1NFDA 1ZHBB 1HZHL 2O5ZL 4LSSH 4F2MA 5D8JH 2FX9H 4GRWB 2DN7A 4KV5E 3GSWB 5EBWA 3QUKB 2W0FB 3DVNB 4O2FA 4IBLT 2EDKA 3GO1L 2F58L 5C0FB 1KT2A 1H5BB 3MRKA 5D70L 5I6XC 3PGDA 1JNLL 4Z7UB 2OZ4L 5HYSA 3TN0D 1NL0L 2GW5A 3RZCA 3QIBB 2OL3H 4OLUL 4CMMB 5I76B 3BP5A 1NLDH 5GRJH 4HS6A 3EZJB 3DMMA 5FA4A 1RUMH 3ZDYF 5EIIB 1G7QA 3E6FA 2EDXA 4NQSA 1WT5A 5E8DH 4O58H 3LEYL 2VLRB 1A6AA 1NJ9B 5D6CB 4ZAKB 5IM7A 4ENEC 4JZOB 3HPLB 4FQ1L 1DUYA 3C60D 4HEPG 3QXAA 4X9FA 5FYKU 2V6HA 1WV7T 3PHOA 2Q8BL 2FL5A 4GLRH 1BQHB 2EYRB 5HI3D 3SOBH 3H3KA 5F1NA 4JFHE 1FE8L 3GJFA 1NBYB 1IKFH 1MHPL 1U2CA 3PWPD 4S0TD 5DDHA 3VI4F 4JFDA 1RK1B 3LHPL 5IB2A 5F8QC 4DGIH 1CI5A 2IQ9H 2PCPA 2Q3AA 5ANMA 1XGPA 4RMWA 1MHCB 2W9DH 3CFDA 4KRPD 5GISL 3S97C 3C6SA 1GGBL 3B9KB 3LB6C 3QI9A 2QHLA 4F9LA 1JTPA 3VFTB 3ZT5A 3OR7B 3FQTA 2FIRT 3MUHL 3QJFA 4LPYA 4PJ5B 1CLZL 2FD6H 1S9YB 4X98B 3STZA 1N4XL 5JXED 1GZPB 2R1XA 2VWEC 5KW9H 3RGVB 4F7CB 3AC0A 1UZ6E 1VADA 3TBSB 1XGRA 2NY5L 3RGHA 3T3PE 3LY6A 2FYYA 1LEGA 1DQTA 1U3YA 1JNHB 3FB5A 2YRLA 5SWQB 4JRXD 4ZUWA 4W4OC 2DQHH 4LAQH 4W81A 3DARA 2BCKA 1AY1H 4EN3C 1GGCL 2FEEL 3M45A 4OTXL 1LP9F 4YX2H 1HKLH 4Y89A 3SDDC 4POYA 1IC7L 3OKDB 5DJDA 3MLTA 1QR4A 2ZCHL 3RUGB 3FO0L 5SV4A 1NAML 4BZYA 4M62H 2XTLA 3SGKA 2BSTA 3L5HA 4HH8A 2BVPA 5F7UA 3AU1A 2I9LB 5K9OA 4UV7H 5BRZA 5C0AD 2VISB 5AZ2L 1DQQA 4MJ5B 4QRRE 4FFZL 1LEKB 1ZT1B 5C3LD 1X5GA 5E8PA 3MTRA 2D7NA 4GRLC 4UIMB 2Z0BA 2IAMA 5B4MD 3CFKA 4AM0A 4QWWD 3P40A 1J11A 1EJ6A 1YECL 2Z31B 4XVTL 3FFDB 4LGRB 5ICYA 1G7HA 3V5HA 2EC8A 1ORQB 3BZFB 5EPMB 4WJ5A 2X4OA 4LOUC 2HT4D 1OL0A 2VQ1B 3F5WA 4I0KA 3S36X 3OB0H 4K23H 4F15C 1TJGL 2BSSB 4DKEH 5GZNC 2ITCB 5IR1B 1P6AB 3CZJA 1JHTB 1NDGB 3FCTB 3IU4H 1DVFA 3R0NA 4DVBB 1MFDH 4M9OA 1HQRB 1YEDB 1FNHA 3U9UB 4R7DA 1OT2A 4PJCB 2P43B 2GK0A 2HG5A 4PPTA 4U2YA 4JANA 4DN3L 4TVSa 3X13B 1QYGH 3B5GA 3BWUC 5ISZA 3VXRD 3IVKA 5TPWL 2FB4L 4QY8A 5E2UH 3O2VL 1X6NA 1E27A 4JG1H 3O6KL 3WXVL 5D7LB 4ZO7A 1CZ8H 2OTPA 2W0KA 5EU7C 4Y5YA 3O2DH 5H37G 2YPLE 2Q86B 5GS0C 1HILA 3SGEI 1PSKL 3VD7A 4YPGB 1O5DT 4MSWB 3IETB 1Z6JT 1SEQH 1EZVY 4HZAA 1IEBA 1F02I 5TQ2L 4P2QB 5HHME 1JMZA 1NGWB 3RX7A 5EIQA 3U7WL 3ZMRA 2FJHA 2DTML 5E6IA 3IJYB 1FGVL 1FNFA 3FN3A 4ONOA 2B8OT 5DSCB 4KJQD 2CIIB 3RL2A 3KJ4C 3KNBB 4TPRL 4KDVA 4U6VL 1F2QA 5I15L 3EFFB 5MEOB 2WBJB 5LGJA 3MROB 1BJ1H 3MUJA 3BP4B 3T1FA 1QBBA 4PRPE 5GHWH 3W9EA 1H3UA 2O61A 1OAXH 1MI5B 5GJTH 1YYLL 2XPGA 2ZNXA 1AGDB 4UTAH 1OB1B 1UWXH 5HVHC 1I1AA 3T8XA 4LSRL 3DRTA 1SVZA 2PUQT 3BD4A 4CU6A 2ITDA 4M7LH 4GXVL 5LGHL 2AXJA 5ALBL 4H5SB 4ISVB 4PB0L 4UNVA 3GSOA 3LKNB 1F3JA 3S96B 5ID1A 4JFHD 4OM1H 1FORH 2DQGL 4YC2C 3H7LA 4H25B 3O9WD 3MA9H 2GJ6A 1AE6H 1QEWB 4KVCL 1ZLVK 3G6JE 3GBMH 1K8DB 3GRWA 4ZFZB 3BUYB 2V9QA 3HPJB 1T6VN 4JDTL 1NCWH 3ILQD 4LCCC 4DZBB 3EFDH 5DS8B 5DTFB 3IXTA 2XQBL 4D8PA 1TLKA 4FNLL 4O5LL 1A6UL 4LLQA 1XF5B 4X5XB 5FIEA 1L4IA 1X4ZA 2QQKL 5I1IL 3RBSA 2IADB 2XZQL 4OUUA 1MCPH 4RFNC 3TN0C 4NO2B 3SE4A 3ZT6A 5J4MA 4Y1AA 4UT6H 5BO1H 3PWLB 3D3VB 4JO3L 1AHWC 3BUTA 1QFUL 4GKNB 1MJ8H 5EU4A 3QNYA 1NMBH 3DX8A 1NH6A 4U31A 1MLCA 2VXSH 1OAUH 3BPOB 3K8LA 3P0GB 1P5UA 4G43B 2QKIB 3NA9L 1QTYT 3C60C 4B7LA 3QUYB 4JQVA 1B88A 5I1DA 2CUHA 3EYOA 3H9SB 5F1SA 1AGBB 1DR9A 3TA3D 3TO4A 1BFOB 2EDRA 4G9FE 3OXRA 4S1SL 1FFQA 3HHRB 1OD7A 4QRPB 3LD8B 3BT2L 4A6YB 4QRRD 1MWAB 4DN4H 2RJMA 1PLGH 5EOTA 3GK8L 3SJVE 5JDJA 4L3AA 3EYFA 3WLBB 1S3KL 5C08E 1T03L 1HH9A 2GSGB 4M3KB 2X4NB 1RUQL 2BY1A 5D2LE 4NCC2 4H8WC 4UBDC 4XBEL 3EYSH 4Y0GA 3NCJL 1MF2H 1JUFA 5CKAA 3RWJA 4U1GB 1J9CT 4N5UA 4P0DA 3K3QA 3KPSB 4NOFA 1IGCH 3W82A 4CVZB 25C8H 3GSNB 4JVWA 5HTSA 3CC5A 1IMHC 1U8QB 5IVOA 4ETYA 5IV2A 5JXEC 4YE4L 5JIHA 4ZNEE 1X5KA 4TNWF 5KVGL 3FRUA 2OI9B 2AERT 5IUSA 1L7IH 2M1KA 3BPLB 5BZDA 1XF1A 2NX5B 5CSBA 4NKOB 4UZGA 4OD3H 3P9LA 3U0PA 2JCCF 3O3AB 2ZPKH 3A6BH 3ULVD 4AENB 4XP9L 1DN0A 1MNUH 1FRGH 2DYPD 4QXGL 5FA3A 2CK0L 1MVUB 3KGRA 3X3GL 5CBEB 2YPLD 4N8VA 3DIFA 4G3YH 3V6FA 1EO8L 3STLA 2OJZH 4IRSB 1IFHH 2B5IC 4Y8DC 1CFSB 3L95B 4XRCA 3DVGA 1WC7B 4G7VL 4RNRA 4R96B 5D5MA 5EU3B 2YWYA 4IRZL 5HHMD 5H35A 2J6EH 3HZKB 4POUB 5L2JB 4TSBH 4MD0A 3ARFB 4FQ2L 5HHQA 2IG2H 3C8KB 3KS0J 1HCFX 5KVEL 1KB5B 4EVNB 4IIQB 3MV9A 3O8XA 4PJXB 5F7LB 1RVFL 1KXQE 4NM4L 3QRGH 2R0KL 2DIJA 2BRRL 5LWYH 4QWWC 4OLWL 1FAKT 3DPBA 1L6ZA 4PRPD 3TPKA 3OAZK 4QHUA 4N90E 2HT4C 4OF6A 3ZE0E 1KCRL 1FFOA 1UXWA 3LV3B 4ZS7H 1AKJD 1P4IH 4H0GA 3GMQA 1INQA 2UZXB 3LCYA 4M4PA 3PE9A 4CN6A 2H3NB 3MFGB 1YUHA 1OLZA 1M6OB 5T3XH 5E94B 3NCBB 1FO0B 1M05A 1GAFH 4JDVB 1EAPB 1PX3A 1J5OH 4P3DB 1MQKL 4D0CA 4OI9A 2QQLL 1SJHB 2YWZA 2EDBA 3HNTH 1S9WA 5DZOA 5E2VH 3CMGA 2ZOKB 1IC5L 2KDGA 2Y6SD 5I1AB 4MB3A 4JLRA 3V4VL 4Y4KB 3Q48A 1P1ZA 4ONFL 4S1DD 1UFUA 4O9HL 4LSQL 1X44A 2VC2H 3DBXB 1EUTA 4TULL 2ICWA 3O41A 4OF5A 3IJSB 4DJMA 1BBDL 1EV2E 1KTKE 3NFPB 4GS7B 3RTQA 1RHHA 4KJQC 5DVMA 1KGCE 1U6AH 2EE2A 4XCYB 2XZCH 1PY9A 3GI8H 4P23A 3F7RA 2RCSL 4FTVB 4KH2A 4G7YL 5IB3B 5EOCJ 3QG7L 1MCDA 5HDOA 4HDIA 3DUSA 4UQ3A 2ZJSL 5C0RH 1CU4L 5ITBH 2V2TB 3PIQB 4LVEA 3VDAA 4RX4A 1FFNA 4JFXB 3PWJB 3BXNB 4NRYB 2N7BA 4KI5E 3FHQA 2R69L 4PBXA 1U3HA 4G9FD 2NTFA 3O6FA 4X6EA 4QGTA 1RFDH 4GT7A 4Y5XB 4M1CD 5I18H 4C54A 4DTGL 5BV7H 4MNQE 5I1CH 3SJVD 3MACL 3VDBA 1IGYA 43C9B 3O9WC 5C08D 2BOCA 4AH2A 1KBGH 5HVWA 2VIRB 1BREA 1WCQA 5IW6B 5GS1A 3V6OA 3G5YA 3ILQC 4EBQH 2IPUK 5A3ID 2BNUA 2C4FT 3OAUH 5FYJD 3O4OB 3FOMB 2D7MA 2WANA 4PGDB 1XIWA 3QDGA 4BKLA 4ZFFB 2YC1B 1ZHNA 5JHLL 4QT5A 2AJSH 3TEUA 1OTUD 4MZ3A 5FV1L 4MA7H 3N1MC 5DR5L 3B9AA 4XMKH 2XZAH 5A16B 1KC5H 4YHML 4KKCD 2PTUA 1L9NA 4OZGA 1E6JL 1DBMH 5FYKH 3QXUA 4HHAA 1BZ9A 4JKPH 1KJVA 5EUOB 4X8XA 2N56A 4AZ8A 4NJ9L 1T22A 1CFTA 2DQIH 3WIIL 4XC3L 4IS6A 2EC9T 4KQ4H 1IGIH 5GZOD 3KPMB 2FX8L 4R7NA 3WE6B 1PEZA 3I9GH 4LVHC 4NNYB 3S36L 5DJ6B 5J9PB 2VJXA 1JPFA 3LKPA 3F58H 3TA3C 5FO7A 5E5MB 3GHEL 2ZUQC 3D85A 4YNYA 3TGXA 1EX0A 5ICZA 3W9DB 4WW1B 3AXLA 3IFLH 1T1WA 1FZKA 4JKWA 4KRLB 4FP8H 2XWJB 4XCNB 5IT2L 1LO0L 5EA0L 5JA9A 3D18A 2MMXA 3GBNH 1KULA 2F8OA 1OAZH 3CLEL 1AC6A 4GAFB 4EEEA 4GQPH 2WLZA 5JW4M 1KELL 1LILA 2NY6B 4N90D 4FXKB 4JO1H 1T5XB 4OCRL 4M03A 5C9KA 1JK8A 4LCUA 3VG9C 2EDNA 4HKZB 2CH8A 3UTSE 4BSWA 4JB9H 5JQHC 3U82B 3OKYA 1I8MA 4K94H 3QCTL 3RY5A 2QBWA 2Z8WC 4Z5RA 3IAGC 1PZ5B 2NXYD 3DGGB 4IDJL 1A6PA 4ZO8A 1I3GL 1LK2B 1MIEH 2UVFA 3UTTA 1G9ML 3T2PA 2Q76A 2R4RL 2HFEB 3SE3A 4FFYH 4OGYH 1F90L 4G9DA 4YDIL 2DQUH 3NCCB 1PG7X 2BFVH 3T0WA 4P2YA 5C0EA 3PHQA 3CSYA 5TDNB 4X0KB 2QSCH 1ZANL 2CXGA 4U1HB 2FGZA 1R3LB 1KSRA 1R5IB 5ICXA 1ZWIB 3TJEL 1D5ZB 5JR1H 2SEBB 4OZFB 1CE1L 4HXAH 2P8MB 5E4EB 4NWTH 1JYWA 4AEFA 2VDPL 1GHFH 1K6QH 1IAMA 4KGLA 2EXWD 2HJFA 1II4E 2C3VB 1DP0A 3C5SB 1KGCD 1L7TL 2P5WB 2HVJA 5GISH 4ORGA 2R29L 5CSZA 4NQTA 2GHWB 1XGTB 1G0DA 1FYTB 2AEWA 1ZLVH 4YWGH 1HDMB 2YA0A 5EZIH 4F80A 1GL4B 5D71L 1KIUA 4P4KD 4RSVA 4X6DE 3TNMA 5KS9B 4TUJA 2G75A 2BHZA 3K4AA 4HW6A 2APBA 5F3BA 3WFHA 4D9RE 3B83A 3TH4T 4LLDA 4WO4B 5JZ7C 1IC4H 4HIJB 4OZIE 1SBSL 5TFSL 3KS0H 5DWUH 5L2KE 3LN4B 3M17A 4KI5D 1I4FB 5F6HJ 4EUPB 4R6UA 1ZT4B 2J7LA 4E42A 1LEIB 3DV6A 3VXUD 4NGHL 2DM7A 3G6DL 3ZE1E 2F5AH 5FDWB 1I1FB 4UT7H 1DQDH 1Q9LB 3B5TA 4X7TA 2XA8H 4KJYA 4NN7B 2V7HA 4LLVB 1R24B 4ZUSB 5DD0L 2Y6SC 3QUZB 4YXKL 4RFEB 5D7KE 4ZUTA 3Q3GA 4W4OA 3DXAB 4KY1L 2C4FU 4Z76B 3VWJA 4S1DC 2YOCA 3BMVA 2AJUL 4J3UA 1YMMB 4UB0L 4CDHA 1AQKH 2DWEB 1OP3K 3SDDA 3EOTL 4MAUH 5GGUB 4IJ3C 3UPRB 4A6YL 1MWAL 5IFAL 5IBTL 3QXDB 4PJ7A 4AIZB 1CD0A 2YRPA 4OFKA 3V5KB 4WFEE 5C0GA 1QHPA 1NCBL 1FL5B 1ZSDA 1KFAL 5IQ9A 4J2XA 4Q7DA 1KLGA 2VH5H 4V1DA 2ZWLT 2FJGB 5I17A 1UA6L 1EUUA 2R56L 3MLXL 2Y5TA 5J89A 1N6UA 4GRLA 1TITA 2EC9U 2O5XL 3GIZH 5KSBF 3GSNL 3D87B 1CG9A 4MNGA 4L8SC 1WIUA 4J3OC 2EH7L 3LH2H 1BX2B 4D9LH 1TZHB 1NBQA 3MRQA 2C3HA 4WUKH 3S3PA 2ZKHL 3FMGH 1G6VK 3MJ9L 2E27L 1BBJA 1OTSD 5DEGB 2QQNH 2WZPD 4PJDF 4PJGE 3T4YA 2VLKA 4M1CC 4NQCE 4DZ8A 2DQFB 5EOCH 1DLHB 5JPNB 3WXVH 3QQ3A 1N6QH 1KJ2A 3D0LA 4Q74A 3QUXD 4NO3B 2AJVL 1NFDB 5GSRA 4YHOL 5F6IB 1JGLL 3LSOA 2HJLA 3U0WL 4F2MB 1PEWA 5EBWB 4JY4A 2CKNA 4Q0XL 1A7OL 3C08L 5A3IC 2ARJQ 4HUUA 3U7AA 4GRMA 5B39G 4LHUD 1WZKA 3ZKMC 5I1LA 3DJ9A 4P2RA 1KT2B 3MRKB 1CK0H 3UTSD 5JO5A 3PGDB 3MNWB 1OTUC 1YEEL 1KPVA 3UYOD 3MRPA 3VCLA 3TT3H 2PNDA 3RZCB 3CLFH 4KKCC 5HJ3B 4WW2F 3BP5B 4NUGH 1NBZA 5T3ZL 3PWVB 1KB5L 2LE9A 3D2UB 2ENSA 4HS6B 4MXWH 1AC0A 1SY6L 1G7QB 1TMCB 4C4KT 3E6FB 4NQSB 3QDMA 1JPST 2X09A 3UJJH 5FGCB 1A6AB 2J8UA 5GZOC 1BJ8A 5HYJA 3OAZH 2NTSP 3QYCA 4ELMB 1DUYB 1DBJH 5D93B 4P3CH 2V5SA 3QXAB 3NCFB 2D7OA 2J4WL 3FFCB 1UACH 4NRXA 1T6WA 7FABL 5D7IF 4MQXD 4HMEA 4OZHB 5LQBL 1FO0L 5F1NB 4NC0B 4KV5F 5DDHB 3MGTB 2APWA 3R4DA 5IB2B 5IW1A 5DUML 2PCPB 4BUGA 1F97A 1XGPB 4JPWL 4F7MA 1XR8A 3CFDB 5KANG 1I3RA 3MBEB 3C6SB 1A6UH 3QI9B 3MRGA 4JR9H 4WHYH 4WDIB 4JFZH 1UJ3A 3M8OH 3QJFB 1RUAH 5ILTL 4D9RD 3P4NA 1ZT7B 1JNJA 3QIUC 3STZB 2VDNH 4LCCA 5L88L 2P46B 3IDXH 5L2KD 1VADB 1KTLA 2NXYC 1IAIH 2FYYB 1FG2A 1LEGB 3WSQH 4JO4L 4ZUWB 1TENA 4S2SA 1AGFA 2AABL 4KUZL 3T77A 3TN0A 2BCKB 4ONHA 1AGCA 1I9RH 4PJBE 3VFGH 3MV8E 2LFGA 4GUPA 5D7KD 1AHWA 3MLTB 3HAEG 3NAAL 1LMKA 3SE8H 1J86A 4PJEB 4YJZL 3LKOA 4OCMC 4WI5A 5IB1A 1RJYA 2BVPB 1HHIB 4LVNC 2Y25A 5K9OB 1NGQL 4S11A 5BRZB 1KN4L 4XHJD 2EXWC 3OKEA 3C60A 1F2XK 3SDYL 1RUQH 1KJMA 1GPOH 2XV6B 1JZ4A 2ZCKL 12E8H 4WFED 4XBEH 2W65A 4LSTH 2IAMB 3NCJH 3A6CH 2NY2B 3QEGH 4HLZH 5ICYB 3MRHB 5CEZH 3V5HB 3K46A 3OG6B 1N6VA 4G8GE 1V3JA 4WJ5B 1BFSA 4AQ1B 3CCHA 2X4OB 3PWPA 3F5WB 4P4KC 1S7TA 4P5MA 2ICWJ 1UZ6F 3HE7D 2ORBL 4ZO9A 3MRLB 3VD4A 4YGVB 4HKXB 5C0JA 1DVFB 2DJSA 3I3BA 2G9HA 3U48A 4KI5C 5C2BL 2IGFL 3LQAL 3C2AL 4I4WA 3ZDZF 3SO3C 4OSUH 4R7DB 1A4JA 4MVBD 4S1QH 5FM5O 1E4XH 4H26B 4JANB 1ZGLB 4NQCD 4OFYD 5JXEA 3HS0B 3IVKB 1KG0A 1CBVL 4XCEA 4OFDA 2C1PB 4J6RH 2AS5M 1E27B 1T20A 3S35H 1MY5A 4Z7WE 1CGSH 4Y5YB 3K2UH 1WBXA 4JRXA 2CO7B 4GMSL 3BE1H 3C6LD 1FVCB 1MCHA 4PJDA 4GG8A 4ALAH 5L6YH 4HCRA 1T21B 1IEBB 3T0EE 4Z0XA 2Q6WA 1KCUH 4P5TD 2B0SH 5JA8B 4WU5B 1T3FA 4L3CA 2FJHB 1EO7A 5KVDL 1FIGH 4LSVH 4HJ0D 4JN1L 3RL2B 4OKVB 3SO5A 1G7PA 5LGJB 4CMHB 5C0AA 5F9JB 3IB4A 2DLEA 3SKUD 3W2DL 3T1FB 2E6QA 3W9EB 2O61B 4N1HB 1KEML 4YBLC 3J7HA 4QXUL 1D5BA 2XPGB 3RVUD 3BZ4B 3GM8A 1I1AB 1U8JB 3O0RH 1M4KA 3O6MH 3DRTB 4QCIA 5DI8A 5AAMA 3ULVF 1KCLA 1A9EA 1OTSC 3GSOB 4QYOB 4RCAA 1RZKH 4DUXA 5ID1B 2C1OA 5DJZA 1MRFH 3KLAB 5F3HA 2GJ6B 2YUZA 3LZFL 2XKNA 2OQJA 3QUXC 4H20L 2DM3A 2D3VA 4YAQA 4DOHE 2EDYA 4JQIL 1WTGT 1PG7L 4MD4A 4ONFH 4YHPA 1EHNA 3VXRA 3RVXD 3ARSA 5D7IA 2QEJA 2VABA 4FQIH 4D8PB 1LDPH 5F7DA 4XNUL 3CPLA 2R1WB 1D5IL 4KZEH 1AFVL 2GY5A 5DD5H 4HKJB 2CRIA 3OJDB 1LE9A 1VEOA 4P99A 3EOBA 4OUUB 3VI3E 1UENA 4CN1A 4JPKL 4M61A 3DYPA 2PYEB 3MQIA 2JIXA 2AV1A 5IESH 4LLAA 3RWGA 4HWEL 4HMDA 5EU4B 4KI1A 4MX7A 1YNTA 5F97E 3RWCA 3GKWH 3CXHJ 4K8RD 3DX8B 3KVQA 1MLCB 5C09E 2R0LL 5BOZG 1FC2D 2ID5A 1KPRA 3MV8D 4FABL 4G6AD 3EYQD 2WM0A 3QHZH 2KZWA 5T1DL 5EORH 3EYOB 3EGSA 1X5AA 5E8EA 3L9RA 1HIMH 4FXLA 3TO4B 3G6JF 4X9BA 4MQXC 5BZWA 4R0LA 1DQJB 5DMGD 3SQOH 4I77L 4NZTL 1WWBX 4K7PX 5C71A 5AYQA 2E3VA 5DGQA 4YXHL 1HH9B 2XQYG 5E9DE 1ZTXL 4G8GD 1JUFB 2JK5A 1F6AB 3NOIA 4QHKI 3RWJB 2YA1A