5KG9A

Crystal structure of the gp120 v2 antibody re505-22 fab from igh- and igk-humanized mouse
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
215
structure length
206
Chain Sequence
VQLVESGGGLVQPGRALRLSCAASGFDYAMHWVRQAPGKGLEWVSGISWNSGSRGYADSVKGRFTISRDSQYLQMNSLRVEDTAFYYCARMNGTFDYWGQGTLVTVSLASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody RE505-22 Fab heavy chain
publication title Immunodominance of Antibody Recognition of the HIV Envelope V2 Region in Ig-Humanized Mice.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 36
structure length 206
sequence length 215
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kg9A02
2BXZA 4XTRC 3W11D 5JW4N 2ATKA 5DRXB 3KPSB 3BFOA 3FAWA 4TUJB 2BMKA 2E6JA 5TDNB 1WT5A 3BOVA 5D8JH 2AEPL 2CSPA 4WTZG 1OTTC 2VAAA 4FXGB 4IDJH 1TFHA 5T3XH 1Z9MA 3EJYC 4J3SA 4OF5A 2F54B 4Z95H 2DLGA 3LEVH 5IIEA 1OWRM 3OAUL 1RUQL 5BVJB 1R3KB 1X9QA 4RX4A 4XPFL 1J8KA 1W72L 1GIGL 4L1HA 5E94B 4OM0L 5J12B 2N56A 4U6VL 1S3KL 4NCC2 4NO2A 4BK5A 1JGEB 3O6ML 5DA0B 5KSBA 4NO5A 4P3CL 2OI9C 1HCFX 4PJXE 1N0XL 5EORL 2ATPB 2BVPB 4KK6C 5J11C 35C8L 5BRZA 4PJ8A 1YZZA 1WAAF 3QO0A 3RWIA 1R3HA 2ZCLH 1BD2E 1S7TB 4UILH 1IFHL 3HPLB 5D7KD 5CSZB 5HYSA 2QBWA 4HKXA 4XP5L 4Y4KC 1BQHB 3S34L 3CSYA 2XWBA 5DEGA 2IAMB 5L6YL 3QUYC 1GZPA 4U3XA 2MKLC 1NLBH 3FHQA 5B39B 4HMEA 1U3ZA 1JTOA 1HCVA 3MLPA 1AHWA 5IFAL 4X6EA 4JM4H 1U92A 4M6NL 3WLWC 1CFTB 2VQ1A 1KELL 2A9ML 3PWPB 3SKMB 2UUDH 3DMMC 2DBLL 4PY7B 5F9JA 4QRRB 5C0FA 4KTEL 3WYRA 2Y7QB 4YHLL 2GJJA 3LS4L 2AAVA 3MPCA 5FGCB 2P5ED 1WCBA 1BBJB 1OSPL 4HS8H 3UTTB 3NN8A 5C0RH 2PCPA 1UJ3C 3AAZA 3LS5H 4NO0B 1TXKA 5I71B 2FO1A 4H20L 4JANA 2FSEB 1UQSA 4KUZL 2IANB 4PJHE 4FA8A 2ZNWA 3BI9X 3MA9H 2UVEA 3AUVA 1YUHA 1TCMA 2FWOA 1ROWA 4JQVC 1MQKH 2B39A 4XVSL 1W72A 4WY7H 2ZUQC 1YNTA 2MCG1 5KSUA 1JNHA 3L3DB 4X83A 1UB6B 5IMMB 3PP3H 3AREC 4LLUB 2OSLB 4KKBD 5H94A 4YE4H 3IETB 1MFEL 5DJDB 3AU1A 3F7YB 4OLUH 4NNPL 5DYOB 3R8BB 2Q3ZA 2YBRB 4ZFOL 3G6AA 5C0BD 3VFSA 4DN4H 4P2OD 4OZIE 3V6ZB 1I3UA 1J5OH 1IGFH 2DQTL 3JV6B 2WBKA 1ORQA 3ARDB 1I8LA 1KN2L 1R6VA 1YMMD 5BJTA 4YHIB 3GIVB 4GBXD 5MP6L 2HT4C 1SBSL 5D1XD 2R4RL 2OL3B 3HI6H 4FQPA 1T2QL 2B2XH 5C0AB 3MLXH 5HVHC 5GRXG 3SKJH 1CD9B 2NNAB 3O8XC 3P30L 2P5EA 1KGCE 2J88H 3IVKA 3L3JA 1Q0YH 3MOBL 4XXDB 5FM4A 3SDDC 2QQLL 1QSFE 2PYED 1C5DA 1CLYL 5CEZE 3RGVD 2OJZL 3QG6A 2CUHA 4R7NA 3LKNB 4GG8A 5A40E 1Q94A 4YHPA 4KAQL 2EDTA 5LJYH 1AQKH 4NDMB 4BZ1L 3M07A 4RDQG 2OTWA 4OTXH 2QHRL 5DUPH 1FYTD 5F7UA 1JGDB 1RUPL 5F1NA 4HKBA 3FN0H 4HPOH 5EUOF 1WF5A 4KRMB 1A3RH 4FQIL 1LQSR 4HLJA 2IH1A 4PRHB 3RIAF 4NGHH 4ZFFB 4P2OA 2B8OT 3EZJB 5E6ID 3O45B 5KSBF 1EO7A 5DR5L 5F6HI 4X7TA 1Z9SA 2Y9RT 3PWNA 1QTYT 1S7RB 4NOBA 1EEYB 1YMMA 2VWEC 4OM1H 4F15C 2DKUA 3MRFB 4GBXA 4HWBL 4BQ8A 3FO9B 2IBBA 1CXLA 2JJVA 2VNCA 2YWZA 5D1XA 1FVDB 1VKXB 1X44A 3U6RA 3U83A 4OZIA 5HYSG 5IW1B 3CMOH 2ZG3A 1A7RH 5B4MD 4RSVA 2NY0C 2NY2B 5L8LB 3L5JA 3B3IA 3BW9A 4JB9H 5CD5C 5JW5B 1UB5A 1SBBA 4N1CA 5INDA 1M6OA 2Y07H 4WO4B 3L95A 2MQ0A 5E9DE 3O4OC 1F6LL 2BOBA 1A6TA 5IHBA 2PYEA 3V4UH 2VZSA 4LQ1A 1T7VA 1EO8H 3BKCH 3WFBH 5L0QC 2J5LC 3TIDA 3RGVA 2ADJB 4JLRB 4M4RA 1A1NB 2K9UA 2WW8A 4WUUE 3MV01 3OQ3B 5JW4R 1WCQA 2QR0A 2YD2A 2UZXB 3GKWL 4WV1B 1RZJL 5CEYB 4NKDA 2VMFA 4UUJA 5DUBB 1IGIH 4PJ7B 1RJZA 4UIMB 1TTGA 1ND0A 4FXKA 1ACZA 1FYTA 1DQJA 5TE7L 1H5BC 4AG4H 1KT2B 1IEAB 3GHEH 4XWOD 4M6OH 4KK8D 2E7CA 4RQQA 4WCYL 3ESVF 3FMGL 1HYSC 4YBQD 3E6FA 1OTUC 2VXUH 4CN1A 3TT3L 1X5AA 2GTZB 1PYWB 5E6IA 3CC5B 5IWLC 1F6AA 4JY5L 1MAKA 1X5XA 3JVGC 4OIBA 2P8MB 2DQIH 1S9KC 5JOFA 1DQMH 2YMXH 1VACB 4FTVB 5I8CB 1JCKA 3IDIB 3W0WE 1SEQL 4R2GD 1U95A 1QBML 1RZIA 3UTZB 2M26A 4EDWH 1H15B 1IEHA 1T1XB 2APTA 5DFVD 4PJXF 4K3EH 2OI9B 2LU4A 4HUXA 4PRDA 4L9DA 5HHXL 4U6HA 5J11B 3W0WD 1UYWL 4UU9A 3V0AC 3D39E 1A0QL 4JQIL 5DWUH 4XPFH 4WI9A 1W72H 1EXUA 1G7HB 1LK2B 1KXQE 3DXAB 3H0TB 4OM0H 4NRXB 2V9TA 1S3KH 1AY1L 3UXFA 2X70A 1PW3A 3NGBB 4Y4KB 5GJSH 4G5ZH 1H8SA 3O6MH 4HFWB 1FC2D 4KKLC 2C1PB 5EC1A 3U4AA 2WUCL 4P3CH 3OF6D 3PL6D 5E9DA 3RWGB 5F3BA 3QUYB 1N0XH 5GZNC 1YA5A 2Z0BA 1XR8B 4LPWA 35C8H 3K2MC 2W65B 1DBJH 5ENWA 1IFHH 4XPAH 3I02B 5FV2A 4XP5H 4ZUWA 1F97A 5CBAB 3S34H 2DMKA 3D5OF 4FQXD 1H9VA 4PRAB 3DMMB 5L6YH 4U1SB 4P4RA 2F5AH 3P4NA 5E8NB 1B3JA 4H25A 2XWJB 4TNVF 3DETC 2VC2H 3AROA 3MV8D 1OAQH 3C87A 1MJ7L 4OCRH 4D0DB 4ELMB 2EZ0D 2RFXB 3EYFA 4MQXC 5ALBL 1NFDE 4UDUA 1UJ3B 1XGQA 4OZFA 4FQLL 3BUYA 1R3IL 4I3SH 4M6NH 2B7DT 2A9MH 4PJHF 3V79C 3BQUD 3HAEB 4LCUB 4TUKL 1H3PL 3G9AB 2DBLH 3N85L 2VOTA 3VFVA 3VDCA 1FZOB 1HIML 5IESH 3SE8L 4YHLH 1YY8A 4R4NC 3LS4H 5LGJB 1A4KA 3W0WA 5ACZA 1G7JA 5JW3L 4XBPB 1MI5E 2YK1L 1OSPH 5D70H 2ZUQB 4PB9H 2NW3B 2CKNA 1AGEB 2FHFA 3PIQB 5E2UL 5HYFA 1NCBH 1EO5A 4HJGA 1LO3L 1RHFA 2YD7A 1S78D 4KJPD 4X9IA 5DGQA 1MCKA 4H20H 5CINL 2AQ3A 3FT4B 4U31A 4P5MA 1FNLA 4ALAH 3UJTL 1DQLH 5FOBA 3EOBB 4IS6A 3OF6A 4OZIF 4LSSL 4OLXL 3PL6A 2XFXA 3DI2B 1VFOA 1AGCA 3KYKL 4W6XB 1MI5D 2GK0A 3BZEB 1ZTXL 4NQXB 1DLFL 3FONA 2WQ8A 4MD4B 4EVNB 5I1IL 1F02I 3C9NA 2PETA 1DEEB 4I3RH 2H32B 4MJ5A 4L9LC 3EGSB 4QHLB 5LGHL 4NUJB 1J05B 2Q1EA 4GAJL 2R29L 2RHEA 5C6PB 1BQLH 3IXTB 5I1HL 4RGMC 3K7UA 2VSCA 5TQ2H 3UTSD 1T20A 5J13C 1JIBA 3MV8A 2ADGA 4QXTA 4JJ5B 3FZUC 3B2UD 3DX8B 4P9HL 4P9ML 2X4OA 4DKFL 3P73B 4NQDD 3SDDB 3MCKA 3W9EA 1MRCH 2YZ1A 4EI5A 3GSNB 4LCYA 3NAAL 3BQUA 3MO1A 1WIPA 4MLSA 5TE4L 1L6XA 3B5TA 4HIIA 3CFIC 4UBDD 4E41D 2AERT 1OP3H 4JN2B 5IB4A 3FT3B 5SWQA 3LVEA 2ZCKL 3GIZL 3U46B 4WU7B 1NFDA 1NCCL 4Z7WE 4ZODA 5EB9A 3RZWA 5FF6A 1H3TA 3VJ6A 4ONOA 3C60D 4XMLL 3ULVE 1NKRA 3S6CA 3GNML 3H7BA 3WIIL 5CEZH 2IPTH 1CLYH 1ZAGA 1OP5H 2OJZH 1OPGH 3W81A 1RJYA 2DTSA 1IGCH 3QI9C 3K0WA 3VXOA 4AEFA 4TNWF 2CKBL 1JNLL 4QRQA 4AIXA 3FRPA 3RWDA 1MI5A 4AM0B 2Y6SC 5F7HA 4BSWB 4Z7UE 4A2MA 1DBML 1F3DJ 4QTHA 4U6YB 1J1PL 2W0FB 4GUPA 4PRPB 4F15B 4FFVD 3UBXB 9CGTA 4X4ZA 2DN7A 2E27H 5K59E 1QVOA 5DLML 3QQ3B 1F45A 4FQIH 5C07B 2IEPA 4OFYD 3QCVL 3OKDA 5IMLB 4MA3B 1JZ3A 1WUNT 2C3WA 3UTSA 2E7HA 1E4JA 5DR5H 3G5VA 4Z77A 1QPXA 5ALCH 3SCMA 1RK0A 4PJ5D 1P53A 5C0DA 3LIZL 1DVFC 4NQDA 2AP2A 3O4OB 3BZ4B 3O2VL 3P77B 3QNYB 2ZG2A 2R0WL 4JM2B 4OCLC 3HMWH 4HKJB 3QQ9C 2VWEE 1J0HA 1NGZB 5BS0B 1BZ7B 1CDCA 1OAZH 3SQOL 3W39B 3CFBB 3FTGB 4E41A 5L7XH 3CVHA 5BMFH 1AO7D 3EO0A 4X6FA 1ZLVH 2VQTA 3C60A 4UTAL 4Z76A 2NYYD 5DVMA 4TOYL 1QFHA 3TV3H 4NZDA 2HTLC 4NN5C 4HD9A 4F7MA 1KPVA 1H5BB 5SX5H 5T33H 4MSWB 4TULL 1U3HA 3QJFA 3SKNB 3LRSB 3FN9A 4LGSB 4OZFG 4LDEB 5FDYA 1CZ8H 5SWSE 3GKWH 3IF1A 2E7LA 2DQEL 4YQXL 2YKLH 1DFBL 4M43L 2EYSB 4G7YL 5DVNA 3OSKA 5F7YC 5IB1B 1MJJB 5FM5O 5TE7H 4P3WA 4JRXE 3IDMA 1LO5B 3LKOA 4J1UA 1FIGL 2F53D 4OZFH 1XIWB 4CMHC 4OFYA 5I30L 2BZDA 4M61A 3DVIA 3HC4L 4WCYH 5CCKH 2ICEB 3TM6A 4X9GA 1RPQA 3QJHA 3LCYA 5DD0L 4UOJA 4Z7UA 1KJ3H 1G7IB 4X5LA 3DRQB 4PJ5A 5DQ9B 4O5LH 2J6EL 2P46B 5C6WH 3GB7A 3IAPA 2Z4QA 4JRXD 2F5BL 2PTVA 2VDPL 1ZT7B 3IYLW 3MRIA 3MRCB 5CSBA 5ESQA 1ES0B 3KPMA 2X1WL 2APXA 2B4CL 1EAPA 1N59B 2VDQL 3GGWB 3IAQA 2DM2A 3OPZH 4Y1AD 2R1WA 3QUXC 1UKTA 1QFUH 1KYOK 5GRVK 4X7DC 4HCRL 5TDPA 1R5VA 1AO7A 3QULB 5A3IC 1KJMA 3EW3B 1NBZA 3GMLA 4YNYB 5HHXH 4ZO6A 1EA9C 4AIZB 3B9KA 1JTPA 4PJFB 4TPRL 3VMOA 4IRJC 1T22B 1BVZA 4I48B 1QQDB 3SPVA 1T03L 3HI1B 2IWGA 2D0GA 2HN7B 1WVZA 3H2WA 2ID5A 4S1QL 3ARUA 4S1DD 3K8MA 3M17B 3VFMA 5IEHB 4ZOAA 5DK2A 3RPKA 3HUJB 5GS0C 1NFDF 4M1GH 3IRZA 5FA4B 3LKRA 1ADQA 3HE7D 1FZMB 2WNGA 3BYYA 4J4PC 1X7QA 1S9XB 4N0FA 2YD3A 2ZUYA 4JZJA 5HDBE 2AXFA 1VGEL 4GW1B 2X4RB 4OCNC 2F19H 4ODHH 2HWZH 3TO2B 4TSAL 5FO7B 5GGSA 3BVNA 4ZMAT 4BZYA 4XVTH 1Y0LB 2UWEA 2CUIA 3MRDA 2FCBA 3UYOD 3FRPG 4JRXA 3QEUB 5F6HJ 1PD6A 5DD5L 3G6JB 4FQLH 4HBCH 3O6FB 1R3IH 4LHUA 4Y1AA 1U8JB 1HINH 1XF2B 1YJDC 2CRMA 4TUKH 2IQ9L 4Y2DC 1HIMH 2J6EA 3VWJB 1BX2A 1UVQA 2EO9A 3VXTB 4HMDA 5DHYB 5IB3A 4UOW1 1DUYB 3THML 5IQ7H 1ZT4A 4ZTPL 3PV6B 2QQNL 3FQNB 5GJTH 3QFJE 2BC4B 3U7YL 2NLJA 4NYLA 3VE0B 4AL8L 1K8DB 4MAUH 1UWEH 4LSSH 5E00A 5E95B 4RGMB 5IBTL 1VADA 5J1AB 1AXTL 5F9OH 1AGFA 4G43A 3UJIH 3HE7A 5I1IH 5JXAL 4YPGA 3LQZA 4ETQB 3ORJA 4JY6A 2QQKL 1WFUA 4PLKD 4XCYB 1IAIH 5LGHH 2JJTA 5K9QG 4UT6H 2R29H 2GKIA 4K7FA 1JMXA 4L4VB 5I1HH 2DRUA 2NY3B 3CU1A 4Z7WF 5BV7B 1MWAL 3CVHH 1NLDL 4BUHA 1I1YA 1AD0A 3ULVF 4G80B 4DKFH 3BE1L 3I6KB 1T7XA 5E24E 1IC5H 5ISZB 5AD0A 5GSVB 1QSEE 4H26B 3L3IB 3C5SA 4P23D 1HHIA 5FYJD 1F4HA 1DR9A 3QI9B 3T09A 3W5MA 1VPOH 3UPAA 5DJZA 1JF6A 1U8QB 2BRRL 1TNMA 4S0SD 1ZT1A 4Z18A 4Z7UF 4YAQB 1Z3GL 4XRCB 5BW7A 4Y4HC 5CBEB 3ULVH 4DEPB 5I1CL 4YDIL 3FQRB 3VFWB 4G9FE 5K59F 2N7AA 5T3ZD 2V5RA 3WIIH 1S7WA 5CP7A 4C58B 1T4KB 1SY6A 1M7IA 4G8GE 2R1YB 4PLJD 4ZPTA 3IDNA 1FZKA 4MA1B 1KTRL 1BVKA 2ICWI 4KKAD 2X6MA 4AH2A 1MCIA 1YECH 4OGAC 4G9FD 1HQ4A 3L5WB 3H42L 2D7QA 1QPPA 4LSUH 1DVFB 2MHAA 4RAUA 5C9JB 1MHCA 3D3VE 43C9B 1VHPA 5K93A 3DHMA 2K7QA 4G8GD 4PJ9B 2GUOB 1DJSA 2NZ9D 1T83A 1MFCH 2EIBA 4F9PC 3QCVH 1ZVHA 4TN9A 5BVPL 3P9WB 1A2YA 4MAYD 2W9EL 2OR9H 1KTLB 2AXGA 5DJXA 3S35X 2FH6A 2O5ZL 4UQ3B 1FL5B 4HGMA 1E4KC 3HG1B 1ZHLB 3NTCL 5BQ7B 3MBXL 3C5ZA 4RNRB 4FABH 2FJFB 4LBEA 1MHEB 3IU3A 1HXYA 3ALWA 3BP7B 1EHXA 3CAFA 2R0WH 3VFOA 3DV4B 1HOCB 4K3DH 4NN5B 2NXZC 5F7DB 4P23A 4X9BA 5FYLL 3S7GA 4O58H 2GSGB 3QEQB 3GBLA 2UZIH 1A9EA 1MWAA 5FKAA 1K5NB 3TP4A 4I18A 5T1LB 4J3TA 5IVXB 4G9DB 3HNTL 1N6QH 3RY6A 2Y25A 4HUWA 1FFOA 1A7OH 4LNRB 2XA8H 1ADQH 1LE9B 3D0LB 4OD1L 1KTDB 4UT9L 32C2A 3HNSH 4DUVA 3RVWD 1U8PB 1KLFA 1U8IB 1YNKL 3I2CL 4LHUG 3MXVH 1QKZH 3WS3B 5EOTA 5DMKB 3EYVB 4WJ5A 1RU9L 3QXWA 3NZ8B 4RFOH 4JDTH 4M43H 4L8BB 3BRFA 4G9FA 1DLHB 3VXME 4LCWD 1S7XB 2A6JA 3T4AB 3TO4C 4YDJB 4PG9B 4G8GA 4PGCA 1FIGH 2HRPH 3VRIA 2P24A 3VXPA 4D8PA 4LSTH 2BVQB 3K2UL 3QUXB 3HC4H 3GMRA 3WS6C 1G9NL 4MAYA 3JWOL 4DAGL 2Y72A 1CE6B 1XF5A 5CMAB 5JDSB 1DE4B 4AZ8A 2O5YL 1FL6A 2GJ6D 5EUKB 3CCHA 2VDPH 3BRDA 3IXAB 4S2SA 1B0RA 5FCSH 1NGYA 2VDQH 4L8SA 4IRJB 4X6BB 4K3HA 1E6OH 2VYRE 1JBJA 2XQBH 2Y4SA 1WITA 3RWJB 5F9DC 1QYGL 3DUUA 1X5ZA 2OTPA 1Q1JL 2ZOKB 1U8MA 5F9WC 3SGDH 4XCFL 2OMBA 5HDBF 4RFNC 1KB5L 2AEQL 5DJ6A 1TVBA 1W0WB 1UZ8A 1A4JB 2AJXH 5GS1A 1I9RH 4NQCB 1OF2B 2XRAL 3OB0K 4OFKA 5EU5A 1Q9KB 1T6WA 5I1AB 3CFKA 1BLNA 3MRRA 5AEAA 4LCWA 4JFXA 1P2CA 3RVXC 1MCQA 4F58L 5F89B 2FX9H 4NQVA 4QF1B 1ZVSB 3REWA 1MEXH 3BP5A 3IJSB 1MLBB 3IFPA 3U2SA 4JFEE 4ODTL 1P9MC 4D9RE 3ZL4H 4GAYB 2OK0H 3B9EA 1JGLL 4P4KC 5I17A 3SGEI 2OR8A 1CL7L 3VXMA 3HZKA 4OJFL 4Y2DB 5B3JE 1UWXK 3RNQB 3KR3L 1GJIA 1NUNB 5JOPE 4XZUA 2GJ6A 2Z35B 2AJ3A 2W60A 5CZKA 3HZMA 2FH8A 5DD5H 4NWTH 3ARBC 4CNIA 5DD3L 3HFML 1F3JA 1MAMH 5DA4A 1TVHA 1U42A 4MB5A 4DCQA 3FT2A 5KW9H 2D7PA 5I76A 4LLQA 1XZ0B 2DB8A 1SY6H 3VDAA 3TH4T 1L6ZA 5IQ9A 1KCSL 4LOUC 1ZA6A 3DUSA 1YN6B 3PWUB 1F3RB 4G6FD 1HEZA 5DRNB 1FNFA 3RZCD 3FO2A 4AL8H 3HE6D 1IM3A 1MHHA 1RUAL 4X4ME 2I07B 4R9HA 1YC8A 1OSZA 4M02A 2JCCE 3KPRE 1AXTH 1YY9C 3FOMA 4NCDA 5GPRA 4PRIE 5C70A 1AIFA 4GRLC 1KJ2B 1S9VA 1FG2B 4U0RB 4NT6A 5AUMB 1KB5A 1PZ5B 4WWKA 4XPBL 1OGAB 3NBNA 5IVOA 4M8QA 1G1YA 3LKPA 4U1NB 2Y06H 3D1MC 1A6ZA 5FYJH 3MJ7A 5GSRB 3JV4A 4U7MA 4KPHL 1FAKT 3KPRD 4QNPE 1EK3A 3KPSE 4NO3B 3MLWL 2YA0A 3T2QA 1MWAH 1NLDH 1MJUH 4W6WB 5MEQA 1M05B 3DROB 5F7LB 2XQYG 4Y4HB 1BBDL 3STZA 3BE1H 4IIQC 3FQUA 2O5XL 4LHJB 3RBSA 5DQDL 3MLSH 3ARZA 5TQ0L 5KBNC 3GMPB 4ZYKB 1I7RB 4QOKD 5T3ZH 1CT8B 3GMOB 3FL7A 2B1AH 4NRYA 3KPSD 5KG9B 5B22A 4LVEA 1CVSC 4QRPE 4Y89A 4DW2H 2IADA 3LN4A 3RWEA 4LARL 2BRRH 5LKNA 1X5JA 1NCWL 2UV3A 1JUFA 3OZ9L 4PREA 5TF0A 1KIPA 5H2BA 4PP1C 5I1CH 1C1EL 1NL0H 3OKMB 2F54D 4TUOA 4C4KT 1YPZA 2FATH 3SDXB 3WFDH 2FZ3B 3KVQA 3X14B 2XNAB 4GFTB 4TSCH 2CDEA 3WFEL 3RZCA 5JW4M 4HV8B 1TLKA 2V9QA 5E8PA 3HE6A 4GAGH 3U4BH 2X1PA 2XWTB 1KENL 5CJXA 3IFLH 2V7HA 1EJOL 2ESVB 1BJ1H 3W9DA 1RZKC 1OHQA 1L7IH 4F8TA 4ORZC 4IMLA 3QSKB 3KPOB 1S7QB 4N8VB 3D69B 3MV11 2HYMA 2NXZB 4U1GC 4XHJD 4IRZL 4FMKA 5BVPH 3KPRA 5A2LH 2Z93A 1RZFL 5C2BH 3ZKXB 1JPFA 1KCVL 3H9SE 3T1FB 3OKLB 2IAMD 4GRMA 1XGRB 2R0KH 2HP4A 3MBXH 1ETZB 4EQ3A 4GRWB 1B0WA 5DGRA 5IVZB 4DOHE 5DRXA 3T2OA 3UAJD 1Q9WB 3FQXB 3MV7E 2I26N 4KHXL 4MD5B 3T0EE 3AY4C 5MERB 3KPSA 3K1KC 3KYAA 4TUJA 5TDNA 2IFFL 5LVEA 3LB6D 4JFYB 4DKDC 3GSUB 3PWPD 4FXGA 1MJ8L 2K1MA 2DLFH 4MD0B 2NY1C 3P9MB 3BO8B 3TVMC 4QRRD 2F54A 4YHYC 2AGJL 4LK4A 1GL4B 3TO4B 1K3IA 3LPWA 5BVJA 4GLRH 1R3KA 3O4LE 5M94B 3QQ4B 3UTTD 4QRPA 4IOFC 4HWZB 2FBOJ 5I15H 4NO0D 5E94A 3VXNB 4EDXB 1JK8A 2IBZY 4XP4L 2DTMH 5MEPB 5D93C 3ULUC 4FP8L 1JGEA 4PIRF 1LDSA 1N5YL 1AI1H 2VR5A 2IAND 4CRPA 5HYJE 2X40A 2BDNL 4YHZL 4TVPL 1XGUB 1S7TA 3O0RH 5FO9B 5CSZA 5CEXB 3JWOH 5HHMD 5EZIH 4ZUSB 1BQHA 1EV2E 2V17H 5KVDL 2MPAH 2IAMA 1G0YR 2VXSL 1ZEAL 2OL3L 3IDXL 1IGTA 1YDPA 2WSKA 5I1LB 1CQKA 1T66C 2L7UA 3TBSB 1RURH 4TVPD 5F9WB 1DBBL 2RCSL 1KXVC 1JPGB 3ARDD 3FRUB 4FQCL 1HHHA 4LCIL 5B39A 2BHUA 1GYAA 4RFNB 3QRGL 5EIIB 1PLGL 5JOEA 3QUMB 1CFTA 3GKZA 5B3NA 3HTLX 1UH3A 3PWPA 3HLAA 2BSSB 3SKMA 4N9OB 1KUMA 4PY7A 3SJVE 4QRRA 5HHOB 1NGXB 5C0AD 3MNWB 3MV7A 4KXZH 5E4IA 3T0EA 2BVYA 5I8KL 5M7QA 4JG0H 1BBJA 3UTTA 3CX2A 2C3GA 4NO0A 4HUVA 4L4TB 2AABL 2MCPH 2FSEA 3P11L 4OZHE 5D6CB 1AXSB 2XRAH 1QLRA 2AVGA 5IW6B 2IANA 2R9HD 2A9NH 2A1WH 4EOWL 4RIRB 1I9EA 1MCDA 1HWGB 2ICWJ 3O4LA 4F58H 4FMFA 5FXCH 2VE6B 4YUEL 2GIYA 4NZTH 4JKKA 2PN5A 3EOTL 3O41B 1UB6A 5ICXB 3WO4C 5IMMA 2OSLA 1TMCB 1C5CL 3IETA 1IGML 3GSRB 1JGLH 5DJDA 3F7YA 3EYOB 3OAZK 5DYOA 3BPCB 3F7VB 3GBML 2YBRA 3ARXA 1H8NA 3KR3H 5CJ8A 3NIDF 4PRHD 3ESUF 3K81A 3PQYE 5GZOC 3V6ZA 4XNQB 4OLEA 3D0VB 3JV6A 4X7FC 3ARDA 3FO0L 5ITFB 4ZAKC 3UEZA 4YHIA 3UYRH 3R4DA 4Z0BL 2VZTA 2EDHA 5E99H 3DOSA 2GSIB 4QGTA 1ORSB 2OL3A 1YQ2A 2JCCF 1ZLSH 5C0AA 4URTB 2NY2D 3RY5A 2DJSA 3PHSA 1M7XA 5F7MC 3EYQC 2NNAA 5BXFB 2R2BB 1UADC 1I7UB 1C5BH 1UXWB 5J4MA 4WO4D 4XXDA 5ESAB 5T5NF 2EDRA 1QFWL 4PJ7E 3RGHA 5T5NG 5LWYL 3MRGB 4QNPF 3TBWB 1JNNL 3SJVA 4XX1G 4UT7H 1ZWIB 6FABL 1H3GA 3ARFC 4FOMA 3VFUB 4JFFE 1V8HA 4N0UB 3MLRL 2GAZB 5CZVL 1CLZH 5DEFB 5SX4I 4XTRD 4Z0XB 1DANT 2ZJSH 3RPIB 1JGDA 4PJCB 4OLWL 4R96B 5DK0B 1P4IL 1NCAL 1U36A 2WINB 4PRHA 1OTTD 2A77H 3CLFH 4ZFFA 2V7NB 3H9HB 3O45A 2HJFB 5GRWA 2ADFH 1BBDH 3EJYD 1F58H 1UH4A 3WHE1 1S7RA 1EEYA 1L7TL 1P84K 4FTVD 3MRFA 3FO9A 5FK9B 1FVDA 1VKXA 3PQYA 1SJXA 4OAWB 2DDQL 3DO7B 3SE4C 2BXYA 3TC9A 5IW1A 1CDHA 3OMZA 1BQHG 5FUZL 5JW5A 2J8UE 1C1EH 2X4NB 2DOCA 4WO4A 4YDKL 2ZOLB 4KK6D 1WEJH 3MOAL 3T8XB 5IEKA 3PP4H 3W2DL 3RWCB 5B39G 1MREL 1U8HA 3DXAD 2CH8A 4L4JA 4BH8B 2ADJA 4S1SL 5HDLA 4OSUH 2HVJA 4JLRA 4Y4KD 5I75C 1A1OB 1A1NA 1W2KT 4WV1A 5F71A 4JGJA 1INEH 1IKFL 5DUBA 4DKAA 1L0XA 3QUYD 4PJ7A 3G6DH 4UIMA 4N5EC 2XTJC 5D71H 1CICC 4JRYB 4ELME 2ZCHH 3CUPB 4Z5RB 3X17A 4ELKB 1KT2A 4JFFA 1IEAA 1KCVH 3WLWD 1L9MA 4PV8B 3DBXA 3DMMD 2GTZA 1PYWA 2EDOA 3CC5A 1BIIB 3O3BB 3OXSA 1S5IL 1TITA 3GSOB 4H0GA 5E8DL 2P8MA 4NRZB 1BQSA 4JAMA 3CDGB 3M45A 1VACA 4FTVA 5E4EB 4XWGL 4KHXH 3IDIA 5KS9B 1J0ZA 3TGXA 1U8OB 4KTDL 1PG7L 4OGYL 3CH1B 2IF7A 3S35H 5D93B 3QDMB 1K3ZA 2DQJL 2PF6A 3IT8D 2D7OA 4XAKE 1I9JH 2VZ1A 4DTGL 1LK3L 1OARH 1T1XA 3BPLC 3V0WH 2NTSP 2AGJH 1UA6H 4HUUA 3WHXB 2NY5C 3S4SB 1A7PH 2FL5B 1NAKH 4NWUH 4APQC 2WMPA 1G7HA 1A6PA 1LK2A 5LAXA 3X3GL 5JW4Q 4IEFB 1J0JA 3H0TA 1RAMA 4NRXA 4PY8I 4OF7A 3VG9C 4CKVX 2ZSWB 3KLAB 2UY6A 4FP8H 4HFWA 2VTFA 1RHHB 5GHWL 5J3HC 4WDIB 4G3YL 3BWAA 1ACYH 2XV6B 3RWGA 4CBPA 1CS6A 1HZHL 1XR8A 1WBXB 2EDFA 1YMHB 1PQZB 2X4UB 2DWDB 4EUPB 4TVPH 2W65A 5EU4B 4RA0C 3I02A 2Y1VA 3MRHB 2CUMA 4B0MM 3HKFA 3OGCB 5CBAA 4HT1L 3GSNL 2KDGA 1NGWB 3N9GL 4PRAA 5JMOC 3DMMA 5ICZB 4U1SA 2NY4C 2OL3H 3IDXH 5E8NA 4F3FB 4BSJA 1UACL 3GK8H 3MNZB 2XWJA 1CFQB 4KMTL 4U1JB 4ELMA 4D0DA 2RFXA 4KKCD 4LCIH 3QDJB 1BOGB 2FDBP 2VUOA 3SDDD 4JO3L 3SKOB 3UO1L 1G6RB 4IDLA 1QFWM 3NIGE 5E03A 3LN5B 1IMHC 4LCUA 4UOW0 1Y18B 1RV6X 4NM4L 2XPGB 1FZOA 4OIIL 1HK6A 5LGJA 1VFAB 1MFNA 4NQEB 4JQVA 4TNVK 2EDKA 1KF9B 2NW3A 3ROOB 1AGEA 2W0KA 1OTSC 3PIQA 3WO4B 4J2XA 4WFFD 1KYOJ 2P47B 1PFCA 1K4CB 1HWHB 1SEBB 2NZIA 3FT4A 5C09E 1FN4A 3EOBA 4ZO8A 4D0BB 4KRLB 2P8PB 1DSFL 4MJ4A 1A3LL 2QQQA 1J11A 3BZEA 3A6CL 3UTOA 4D9QD 1KEGH 4NQXA 4MD4A 3P4OA 4EVNA 3T77B 5F1KC 5TE6L 4ZAKB 2R15A 1DEEA 1C5CH 1UCBH 4PRPD 4P2RE 5C0CE 2H32A 3EGSA 4YC2C 3RQ3A 3QG7L 1J05A 3GBMH 4NUJA 5TGBB 2XOTA 5C07D 3T2PA 4U1MB 1J0IA 5JDJA 2QSQA 4N8PA 3IXTA 3PJSB 1QR1B 5I74C 4MJIE 1XGPB 5CD5D 15C8H 4K3JL 4JJ5A 2MQ3A 3DX8A 5EIVA 4ZSOE 5KSVA 2VLJE 4PJ7F 1QG3A 3P73A 3X13B 3SDDA 1QZ1A 5CWSB 5HHNB 3F7RA 4Z0BH 4JM2D 3EOYG 4YR6B 1P4LA 1K6QL 4HXAH 1N8ZB 5FKPB 4YBHA 4YBLC 1MF2H 4M5YL 5BS0D 3FJTA 5FHBL 4JN2A 4NC2B 1P7KB 4BQ9A 4WU7A 4UV4L 2YSSB 3OAYK 3N1MC 2CMRL 2E9JA 3ZE1E 4X80H 1WV7T 4JFDB 3GJFB 3BGMB 1JNNH 4JHWL 1MCLA 1FAIL 6FABH 4X99B 5E2WL 5FYJU 5EOCJ 1HYSD 1EHLH 4NHUB 1OTUD 2XN9B 3CH8A 1CGSH 2HLAB 3MLZH 4WIQA 4AM0A 1N7ML 4M1DL 2DI8A 4BSWA 3HR5B 2X41A 3D18A 5D7IB 3CPLB 2Q8AL 4QXWA 4U6YA 2W0FA 4PRPA 4XBEL 5C09A 3UBXA 4R0LC 4PP2B 4FFWD 5D2LB 3RI5F 1KXTB 3QQ3A 1XIWD 2FX8L 1NDMB 5C07A 3QPQC 2LVCA 5FYKD 2HFFB 5IMLA 4WHDA 1R3LB 2J8UF 2AXJA 3VXSB 2K3TA 4Q6IB 4TNWK 4I9WD 3TFKC 1BAFH 1MUJB 4IOIB 3PGFL 5I66B 1CLOL 1L7TH 5C0CA 1A6VH 3BZ4A 2EDJA 2YZ8A 3P77A 3QNYA 4ZFOB 1AGBB 1EHNA 2D0FA 4JM2A 4U2ZA 5GRUH 3E3QC 2Z31B 2PW1A 2X44D 4HKJA 3RU8L 1CGVA 3D25B 1NGZA 4KHTL 4UDTB 5BS0A 1BZ7A 3W39A 3IAGC 1OQOA 3CFBA 5I75B 1B6UA 3FTGA 2F9BT 5FUZH 5EA0H 1OQXA 5LCVL 2VLJA 3UJJL 2ADIB 3ILPB 4P57B 2VDRL 1RIHH 5CGYC 1GH7A 3QO1B 4ELMF 3MOAH 4TSBH 2N1KA 3DUHA 3M1BB 2XTJB 3W2DH 2JB5H 3CFEB 5D1ZC 4MSWA 3S96B 5DC9B 1AP2B 1JGUL 5F9AC 3SKNA 1NSNL 3LRSA 3BX7C 1T0MB 4R7DB 3CSPA 1AE6H 1WIUA 4GXVH 3TNNA 3KWWB 3KYOB 5CSGA 1QNZL 2VUYA 1F6FB 5J1SC 2EYSA 3DETD 4KZDL 3GMQB 4YIQA 1ZHNB 1MRDH 2NTFA 5IB1A 2GFBB 1XMWA 1MJJA 2LQRA 3JSSA 4EI6B 4TRPL 3INUH 1LO5A 1XIWA 1OB1B 4NP4L 4KFZC 3MV9E 2ICEA 4JVWA 1HQRB 1UKSA 5C0EB 4ZFZB 4DZ8B 1MNUH 3BPLB 3DRQA 2KZWA 3GSWB 4M7JH 5DQ9A 5E8DH 2IH3A 3BPNC 1I3RB 3QFDB 5JUEH 5EG6C 2EKSB 5F8RC 4FZ8L 4GG6B 1ZT7A 1NUFA 3I9GL 3MRCA 4XWGH 4APQB 5ACLA 4KTDH 1N59A 2XI9A 3VG9B 1BEYH 3O6FD 3T0XA 3KLHC 3GGWA 3GSQA 4QXGH 4K8RC 2DQJH 2GTWB 3LHPL 2LVEA 4DTGH 2DLEA 4QRTB 1LE5B 1TQCC 3N0PB 3QULA 1TQBC 4HGKC 4GT7A 1G7LB 4ERSL 3VWJD 5DDHB 3MBEC 4YNYA 1G0XA 1RUKH 2EDNA 2ARJB 1DUZA 2D4FA 4AIZA 4MVBC 3BD4A 1PKQB 3TWCH 4PJFA 4L8CB 4LDLB 2E8ZA 3SGJC 1T22A 2P5WE 1MRFL 4I48A 1QQDA 1CXKA 5ABDE 3HI1A 4DUXA 2E9IA 1B88A 3CVIL 3LRGA 2HN7A 2H32H 4CMMB 3C6SA 4DVRL 2D3VA 3M17A 4GQ9H 1G7MA 5HY9B 4K07A 4MNGB 4AYFA 2NXYB 3UTQB 1HZHH 3HUJA 1EMTL 4L4VE 4WI3A 3MZGB 4WFGE 4J3WA 5FA4A 3FZUD 4X8JB 1Z0MA 2A74B 1S9XA 1CU4H 1D9KC 1RZ7H 1YEJH 2YPKB 4OCSL 4F57H 2AEWA 5L9DH 4GW1A 2X4RA 2D31B 3OJDB 5DO2D 3PHOB 3FN3A 2G60L 3N9GH 4ENED 1FJ1B 5IBUB 3T65B 2FD6H 2Q6WB 3TO2A 5FO7A 5DHVB 3HPJB 4L4VD 3HI5H 2NY3D 1Y0LA 2YXFA 4KMTH 3JV5A 4KUCD 2H9GB 4XNZB 4WI2A 4OCMC 4WEUD 5HYIA 3QEUA 3LQMA 4PJAB 2FECI 5ISZD 3G6JA 3OG6B 3VXQA 3BDXA 2D03L 3O6FA 4Z78A 4LGPB 3RIFF 1U8JA 3U48A 3S98A 1XF2A 2B20A 2X9YA 3MYJB 5DMIL 4Y8DC 2VJXA 1SM3H 5HSFA 1TZIA 5L2KE 3IDUA 3QI9D 3OJMB 3OTTA 4NM4H 4OIIH 3U0PB 5ANME 3VWJA 3WJJA 2DQUL 1GC1H 1OT1A 1U0QA 4XGZB 3H9YA 3WBDA 3RHWF 1QO3B 5E6ZA 2GCYB 3QHFL 3VXTA 1X4YA 4N8CL 4P3DA 4BELD 2BRQA 4M7LT 4YHKL 3ECBB 1UKQA 3PV6A 3JXAA 3FQNA 4IRSC 5IV2B 1T0PB 1BF8A 2BC4A 5KVGH 3QUZA 1K8DA 3SEPA 2BHZA 4POZD 4Z7VE 5CZXC 1J1XH 4LPTA 1YEHL 1K8IB 5J1AA 4UMGA 3EYUL 3UP1A 1QBLH 4KDTC 4WRLA 4ZUUB 5TE6H 3TJHD 1KEML 1BFTA 5ITBL 1YEIL 1DVFD 4BFBD 4ETQA 4FQXB 2ZSVB 4CADA 4PJ9D 4AK1A 4XCYA 5FB8B 1T7ZA 3MRNB 3QQ9D 3QG7H 5T1KB 1KC5H 1GRWA 3UTPD 1T21B 1AFVL 1GPOL 5JHDE 4L4VA 4NN6C 3E6HB 4NHCL 3HG1D 2H6PA 2AQ2A 4G80A 3ZE1F 4GKZB 5IVXE 5ISZA 1MAJA 2HTLD 3KGRA 1K6QH 3QH3B 2P44B 3VFTB 1T7WA 5K9KB 1ITBB 3QEQD 3H3PL 1OAKL 1IZJA 4H88H 4G7VH 1U8QA 5T1LD 1ZLWH 1HDMB 5I0DA 2R2CA 4I3GA 4UV4H 4YAQA 4I2XB 1NFKA 4XRCA 5CBEA 1O5DT 4OV6F 5KVFL 5HBBA 1QRNB 4KTYA 3FQRA 4RFEA 4HAGA 5DT1H 3VFWA 4AENB 1WZMA 1AGDB 3WXWH 3DSFL 2OYPA 4QKXB 2Q7YB 1T4KA 3MRJB 1U93A 1FAIH 2HJKB 2YHGA 2PR4L 1YEEL 2R1YA 3Q1SL 4PY8J 5FYKH 4D2NA 5EU6B 2XICA 4X4YB 4BZ2H 3SHSA 4AQOA 1YQVH 4QWWD 4NKOB 3CGTA 1IJ9A 1G9EA 2X09A 3L5WA 4LNVA 2Q8AH 1DVFA 1MCOL 5GRZA 1A8JH 2L4OA 4XBEH 5C9JA 43C9A 5AAMA 3F7PC 4PJ9A 2GUOA 1PG7W 4J23A 1Q72L 4WNQB 3NPSC 2OM5A 5IR1B 2C4FT 4F80A 3QUXD 4GAFB 1KTLA 1JRHL 4UQ3A 4YXLH 2EDQA 4Z7OE 3QQNA 1FL5A 5A3ID 2EYRB 1Y6MR 3HG1A 2DS4A 1ZHLA 4KJQC 5BQ7A 3PGFH 4XT1C 4RNRA 3KS0H 2XZCH 2BSTB 2FJFA 4RBPK 1MHEA 1Q9OB 3B5HA 5GS0L 3BP7A 1F4YL 3DV4A 1HOCA 5F7EL 4X7SL 5JHDA 3EFDH 5F7DA 5D1ZB 4LSRL 4IRJD 4BQ6A 2YOCA 4E0RA 2GSGA 3QEQA 3E3QE 4OCWL 5HI5C 3UJJH 3C6LC 5T1LA 2PNDA 1ZHKB 1B9ZA 5IVXA 4G9DA 1NANH 2VDRH 4GKSA 1NMBL 2FYYB 4KI5C 2MMXA 3LKSB 5GS0D 1V7ML 2J8HA 4LNRA 4N0CC 1LE9A 4J4PD 1JGUH 3G6JF 5DRWA 5GGQL 5A1AA 3KPLB 1U8PA 4MWFB 2D9QB 1U8IA 3FKUS 4FQ1H 5E2VL 3V6FB 3WS3A 5DMKA 1YJDL 3EYVA 4NQCD 3DYPA 4P2QB 5F1IB 2KBGA 3U9PH 3QDAA 1QNZH 2AKRB 4S1RL 4L8BA 3X12B 1X5KA 1DLHA 3BPNB 1B0GB 4KZDH 4Y16B 1S7XA 3T4AA 2AW2A 4H1LA 1JWSB 4PG9A 3F58L 5GS2D 2CKBB 3KXFE 1IC4L 4NP4H 2BVQA 4F37F 1YEKL 3QUXA 4WU5B 3NMEA 4RMSA 4DN3L 1CE6A 4Y2DD 5CMAA 5JDSA 1DE4A 5JHLH 1KB9J 1CGXA 5EBMA 4FZ8H 4MJ6B 5EUKA 3VD7A 2FLBT 3CK0L 3IXAA 3UC0H 3QDGE 1CK0L 5LBSL 1WZKA 1N64L 2FRGP 2E6QA 2H1PL 5CJOL 3LHPH 4X6BA 2P8LB 2B1HL 1HILA 3VGFA 4XPTH 4K23H 1E0OB 1LDPH 5KOMC 4OLZL 3RWJA 2IALB 4A6YL 4KZEH 1Q9LB 4XP9L 2X4SB 4KUCF 4OF0A 1I7TB 4JKMA 1OT2A 4X0KB 5I19L 5D2NB 4UIKH 5C08B 2YEZB 1KJ2L 1S7SB 5JPNB 3CVIH 3O2WL 1A4JA 3BSZL 4OB5L 2A6DB 2YPLE 4HPYL 4UQ2B 4DVRH 4NQCA 1OF2A 1Z5LB 4OD3H 4U1IB 5FUOL 1Q9KA 5I1AA 5BV7H 4EXKA 2I5YL 2YWYA 3MJ8B 1A47A 3F8UB 4U7KA 5F89A 4J3UA 4QF1A 4I5BB 1ZVSA 5EN2B 2HG5B 2NPLX 4OCSH 1MLBA 2IQAB 1S7UB 1OGAD 5L8JB 5C0JB 5JPMB 4GAYA 4ZFGL 4MA8L 5AZEH 1N6UA 4HUKB 1UH2A 4GW4B 1U91B 1NBVH 4Y2DA 3RNQA 4YHOL 1WZLA 3QIUC 2FGWL 2HT2C 1QR4A 4PJIB 4Y4HD 1FV1A 4M6MH 1FZJB 4PV9B 4YHNB 3RBGA 3BN3B 4PGBB 1JF1B 5B8CC 2D03H 4XMPH 5INCA 4IRSB 2HFGL 5KZCB 4KJWD 4LIQE 1XZ0A 4MB4A 3ARRA 1NH6A 1MCPH 3QDGA 2BY2A 2HKHH 4F2MB 1YN6A 3PWUA 3U36B 4NZUL 4OGAD 3TPKA 5FECB 4XNMB 1GGIH 1O7SA 1MELA 5JQ6L 1I75A 2X4QB 5DRNA 3RVVC 5HHVL 2HH0H 4N1EA 3LQAC 4OF8A 1T1WA 1FIEA 4K55A 2I07A 1TJHL 1WTLA 1E4WH 4Y5YC 1TVDA 2ESVD 3GO1L 4EN3C 2HMID 3EYUH 1T7YA 4AT6B 2CJUH 5IVXF 3V4VH 4MQ7A 1EFXA 1D5ZB 1J10A 1KJ2A 4M1CC 3TA3B 1FG2A 2YN5A 5D6DC 5AUMA 4UNTA 4NFBA 4JG1H 1U2HA 4PR5B 1OGAA 1WT5C 2NXZD 3RA7L 3U0WH 4U1NA 4HIXH 4OLYL 1AFVH 5GSRA 1MIML 3O2DA 1YEGH 3WHE0 1NC4B 4NO3A 4XCCL 4XH2B 5H35B 1M05A 2EKJA 3DROA 2WV3A 4JJHA 4Y4HA 3NCJL 3D85B 1R5IB 3BXNB 3GMPA 3P4MB 4ZYKA 5JR1L 1CT8A 4WENB 3GMOA 4H1LG 2C1OB 3QZWG 4Y19B 3IKCB 3MLUL 1T2XA 2WLYA 4N68A 4PJBB 1CN4A 2ORBL 2X1QA 4BM7A 4KRPC 2A6KB 1FPTH 3KPNB 5IHZB 1CXEA 3QPXL 4ZOBA 1F2XK 5KVFH 2C3XA 4PJ8C 5JNYA 2B5IB 3OKMA 3SDXA 2FZ3A 3X14A 2OQJB 2XNAA 4MA7L 3TO4D 2BVOB 4H1LH 1J1OL 4HV8A 5D7JB 3BKYH 1H3UA 4QGYA 3NPSB 5LG1A 1P1ZB 5IP4A 4L5FH 4Y5VC 2XWTA 3DX7B 4KC3B 2YD6A 4Z7OF 4PRBB 5LQBL 3ZO0A 3BP6A 1HSBB 3W11C 1E4KA 1LMKA 4C56E 3QNZB 1HN1A 1OW0C 3GHBL 4P46C 1D3CA 3WSQL 4O9HL 3WE6B 3HZVA 4MGXA 3PABA 1S7QA 1AHWC 4N8VA 4L3EE 3ARGB 5K9OB 2LAGB 1D5XB 4TTGA 4ODVH 4C83A 1FO0B 4BKLB 3HR6A 5EZLA 4F7EB 2QSTA 5FCUH 5CD3A 5IMOB 1JRHH 2EIZB 4Q0XH 3T1FA 3OKLA 3QUML 4NN7C 1XGRA 4NZRL 3S97C 1ETZA 2P42B 4IMKC 4XVJL 1PZUB 1FSKC 4X6DB 4M00A 5GS0H 2AJVH 3G5XA 4D0CB 4X7SH 2OS7A 1Q9WA 3VA2C 3FQXA 4MD5A 4Z8FL 1JF5A 2VLRB 5EFIB 4JFYA 2BVTA 2YN3A 1GGBH 2MFNA 5T3XE 1N3NA 4ZS6C 4MD0A 2W1NA 3DI3B 3VDBA 3PGDB 5BO1L 3UZQA 2EECA 5HHOD 1MFAL 4DQOL 1CFVL 1XAUA 2YD4A 3VRLE 3RVXD 3TO4A 4P59L 2LTQC 4KI5E 4HQQH 4XNUH 3WFCL 4RWYL 2DWEA 1T1YB 3QQ4A 5GS2H 2DF3A 5DMJB 1MCEA 1TJGL 1C7SA 3QCUL 3VXNA 4EDXA 2Q76B 4L4TD 3WS6A 5MENB 5MEPA 4CL7A 4J6RL 2R0ZL 3LKQB 1YJDH 3VRJA 3S3JA 4L3AA 3MQIA 4OCXL 3A6OA 2EYTB 1B2WL 1NMAH 4S10A 4GMSL 5EBLB 1WWBX 3B9VA 7FABL 4S1RH 3WDJA 1AD9B 3F58H 3VXRE 3UCRA 1MH5B 1QUNA 3NCCB 1XGUA 2EXYD 3S88L 4XC1H 5FO9A 2HFEB 2ICES 1VENA 3BKML 1A7NL 4PJGB 4RAVB 4WW2B 1TZGL 2VDNH 1MIEH 3CDCA 4ZUSA 1K85A 4XXCA 3VU2A 3LPGA 4XNYL 1CR9L 2YPVL 1DQTA 2ZWLT 4ODXB 3FB6B 4LOUD 4E5XB 3GDBA 5I1LA 4XC3L 5JMRA 4JHAH 5KANG 3UZVB 1BECA 1CK0H 5LBSH 3FRUA 1IAII 1JPGA 4M7ZC 3WIHL 4ODSL 2J2ZA 3L3GB 3T4YA 5EIIA 3TBTB 1KACB 1P5UA 2KPNA 5TFSH 4P99A 3QUMA 1F90L 1FNHA 5JLZB 1RJLA 2BSSA 4OLVH 3MACH 2VSDA 5K33A 4LDOB 4R4BB 5HHOA 1NGXA 4LL9A 2D0HA 1YY9D 3DURB 3LD8B 3MNWA 3WN5A 5BZWB 3ZDXE 4KKBC 3HNVH 2VLKB 1KJ2H 5K9QI 4OKDA 4EBQH 1A1MB 3C2SA 2VL5B 2W9LA 2ILLA 4L4TA 4DK3A 5KTEH 1P9MA 2KH2B 3RVTC 2JELH 4E42B 5A2KH 4O02H 1F4WH 4P2OC 4JFPA 2Q20A 5D6CA 1AXSA 5FUOH 3O2DH 5IW6A 1X5HA 5B38B 4NKQB 1JFQL 1FL3B 2I5YH 2VXTH 4MXWH 3L9RB 2FBJH 5T1MB 1DBAH 2VE6A 1FNSL 1X3DA 4LLAA 3O41A 4KROC 5ICXA 3MRPB 1BP3B 3NFPB 3GSRA 2NX5B 4WEBL 2BNRE 3R1GL 1JZ2A 3BPCA 3F7VA 2VDOH 5J6GB 4LLMB 1W8NA 4JVPA 3VXRA 4XNQA 3D0VA 2IBGA 1RZKL 4PP1D 3MXWH 1N4XL 4EIZC 5ITFA 4XP6H 3RGVC 5I1KL 3B6SA 4LIQH 3O3AB 2MTPA 2DQGH 1JHLL 3BMVA 2Q86B 1ORSA 3KLDA 4Y5YB 1UM5L 1LO2L 2QHLA 3BKJL 4NZUH 1DEDA 1X5YA 5BXFA 1RVFH 3WIHA 2R2BA 2VH5L 1I7UA 3DARA 1UXWA 5FHAL 5ESAA 2DLIA 1XF4A 3ISWA 2FJGB 2EH7L 4HAFA 3BDBA 5DTFB 2VAAB 3MREB 3TBWA 1GSMA 4G8EB 5IT2L 1DP0A 1TJHH 4JRYE 1ZWIA 2DYPA 5F7KC 3GZKA 2X9XA 4N0UA 5DD1L 4NC1E 4XI5C 2GAZA 1VGKB 4B50A 3HC3H 5DEFA 1NCNA 4GRWH 1IM9B 4TTDD 3S3SA 5IFHL 3EOAA 5EUOB 4YPJA 4Z0XA 1RFDL 4RGNE 2I27N 3Q5OA 3RPIA 4JRYD 3Q6FA 2AK1L 4CJ0A 1ZSDB 1BFVL 4LASL 5B4MC 1MIMH 2KQNA 5KSBB 4BFEA 4Q9QH 1G7PB 4IBLT 1WFOA 1JZ8A 1ED3B 5DC4B 4Z6AT 5CJQL 1ERNA 4UI2A 3DWTA 2VQUA 1WBYA 2P43B 3ULUL 4FN0A 4ZD3H 2V7NA 2HJFA 5J6HB 3NCJH 2ZP0T 4PJ8B 2ENSA 1J8HB 4LVHC 3KPPB 1R3HB 1EGJA 4P5TB 3U7AA 3G08B 4XB7A 3SO3C 4JPKH 2A6IB 3UDWA 2BNQB 4UV7H 4PG2A 1I85A 5FK9A 1VDGA 4Y5VB 4PGZA 4HLZG 1WWAX 1FLRL 2ORBH 4OAWA 3QDMD 2QSCL 4FQ2H 1BM3H 5D7SL 2O93L 1GZPB 3QPXH 5FYKU 3WL9B 3ARYA 1VFUA 1T89A 1ZMYA 4P46B 3TCXA 2VXQL 1MPAL 3P2TA 1ZANH 4POYA 1VFMA 5TF1H 4R8WH 3T8XA 5BRZE 1J1OH 3RWCA 1I1CA 2ZUXA 1KBGH 1Y6NR 3AS0A 4HLZH 4BH8A 2G9HA 1Z9LA 3KJ4C 1OAXL 1A1OA 4JN1L 1FBIH 5C0FB 1HH9B 2H26A 2CIKB 4NN7B 3SGDI 2ZPKH 3GHBH 3S37L 3F12B 1B4RA 3CDFA 1FSKB 4R2GC 2OZ4L 4QYOB 1NCUA 2VZOA 4JRYA 2W07A 4JANB 4ELKA 1FLTX 2UYLA 3PNWB 1TJIL 3BH8B 1G6RL 5E1AB 5I8EB 2Q8BH 4PV8A 4YXKH 1BIIA 3O3BA 3VRLF 3GSOA 4ZQKB 4XVJH 4KI5F 4QOKB 3NABL 1JNHB 1KLGB 4NRZA 3B43A 4NKIH 4JHZA 2LTQB 1YEFL 3CDGA 1OCWL 2H8PA 2MNUA 1QEWB 5KS9A 3QDJD 1JPTL 4NQEE 3BMWA 1KCLA 5J8OA 2M8XA 3CH1A 4PJXB 1RUMH 1QLFB 3BZDA 4AEIL 2C9AA 2DQDL 1JNJA 5DVLA 3VH8G 3W82A 1BD2B 5HD8D 3KDMA 3QIWC 1CFVH 1CTOA 3WHXA 4NQED 3BEWB 3S4SA 4AEHL 1A5FL 2FL5A 4RWYH 2Y36L 2QKIB 1CGUA 5D1QB 5E5UB 5DC0A 5D7KE 1EDQA 1H3WM 1TJGH 5KSAB 5ADOH 2ZSWA 3KLAA 4J6RH 1MCNA 5T1DL 1OLZA 3GJEB 1B2WH 1RHHA 4K94H 5HDQL 3LZFL 4WDIA 1NQBA 1UGNA 1GZQB 3NFSL 1WBXA 3DGGB 3U1SL 1PQZA 2CIIB 2DWDA 2X4UA 3K1DA 4EI5C 4EUPA 4MNHB 5JIPA 4M7ZB 3VWKC 8FABB 3NCFB 5EU4A 2OXHA 4ZAKD 5AG9A 1XH3B 1A7NH 4I4WB 2EH8L 1LEIB 2IGFH 3MRHA 1DQQB 3OGCA 3LEYL 3RDTA 4YHPB 3KPQA 4XNYH 1NGWA 3RUGB 1DN0B 2CGRH 1D5IH 5ICZA 3GBNH 1U8KB 4R26L 43CAB 2AI0L 3ZDXF 4XC3H 4F3FA 1CFQA 5EWIL 3EO9L 4TQEL 5EDXA 4U1JA 1N2RA 4W81A 1A6WL 3EYQD 2P5EE 3O11B 5SV3A 3WIHH 4BH7B 5F1NB 4B5EA 1TETL 2ZKHL 3SKUD 4PJHB 1BOGA 3SKOA 1IGJB 1B6DA 2IH1B 1NAML 1V3LA 3VMPA 5KVEH 1F90H 3CU7A 3LN5A 1NGPL 1Y18A 3SO5A 2XPGA 4X7TB 5LXGL 4JFZL 2QSVA 1A9BB 2Q3AA 1UWGL 2Z8WC 1VFAA 1BPVA 4NQEA 4NBXB 2A83B 5D72H 1BHGA 1LO4L 3ROOA 4KROB 1E6JL 4LSPL 3U6RB 4JFDD 1K4CA 3MCG1 4HWEH 5GIRB 4F33B 5JORB 2EC9T 2E3VA 1JFQH 2IPKB 5C0BE 3SCMC 4FQJH 4D0BA 2P8PA 2ZUTA 5INDB 1M6OB 3B2VH 5ELIA 2XN9D 2J3SA 1VA9A 5IUSA 3T77A 2NY7L 5ADPL 1YMME 5HHMB 4EJ1C 1EGJH 3MRKB 4ZAKA 3DPBA 4K7PL 3DVGB 4PUBL 1RULL 5E2TH 4X8XA 4UBDC 1OD9A 2QR0B 3R1GH 4LLDB 5TGBA 2WQRA 4G6MH 1RD6A 4U1MA 4OQTH 5MHSD 2BK8A 2IC2A 1QSFB 1QR1A 3C60C 3VXSD 4UTBH 5E08H 5E6YA 3TLRA 5DI8B 1XGPA 1MFDL 3FFDB 2COQA 1JZ4A 1A21A 4LVOC 4J7RA 5GRJH 3X13A 1RMFL 1U3HC 5I1KH 5CWSA 3AB0B 4JPVL 2PYEE 4YR6A 2Z31D 2OP4L 1N8ZA 4HS3B 5FKPA 5AYUL 4HGWB 3WXVL 4MDJB 5I73B 2E7LC 1UM5H 3BGFB 3ULVC 3WO3B 5CAYB 3V7AE 1ZVYA 4KY1H 3BKJH 1P7KA 4FQQB 3ZYOA 5JOFB 2BX5A 2YSSA 4BJLA 4PYGA 3VG0H 2DD8L 2HKFL 3H8NA 1HHJB 1OGTB 1FYTE 4N5ED 3JTSB 2CPCA 2XTJD 3BAEL 4HF5H 4HMCA 5I8OL 4QHMB 4JFDA 3GJFA 5FM5M 5GRVL 2CXGA 4WFED 2D2OA 3B83A 3B9AA 3RL2B 4R90L 2FHCA 5T5FL 4RDQF 4NHUA 3Q6GH 1RIUL 3FB7B 1E4XL 4FFYL 2XN9A 4PRDB 5EOQL 2HLAA 1QRKA 3PWVB 4NJ9H 1JPSL 4GLRI 5ETUB 3NPZB 4ONFL 3HR5A 5IFHH 1GCFA 3CPLA 4Z7QE 3SO3B 4HKZB 1B90A 1CGWA 1BGXH 4YWGH 2NY5L 3WUWB 4OI7A 3S4SG 4PP2A 3V52L 4K7PY 1KCRL 5C0BA 1CIDA 3ZHLA 2G2RB 3L1OL 1NDMA 2PKDA 4RMQA 2HFFA 4LVNB 1ZLUK 2BY1A 5E9DB 3DNKA 1R3LA 5IOPB 5K9JH 3VXSA 1HXMB 4Q6IA 4BQBA 4OUOA 2I9TB 1CD1B 4QCIA 3S9DB 2QEJA 1MUJA 4IOIA 3B9KC 4O4YL 5I66A 5E8OB 3IDYB 1G9MH 4WUUB 4APQD 4ZFOA 1AGBA 4OGXH 4EUPG 3DECA 2Z31A 3SE3A 3D25A 1FLRH 4UDTA 3KJ4B 2VDML 2QSCH 3P4NB 4XBGB 1U2CA 3DX9B 1JL8A 4H5SB 2AK4B 4DGVL 3FCTA 2YUVA 4H8WH 4QHNB 4QXUL 2ADIA 3EYFB 4GKOA 5JO5A 5CILL 1O7VA 2HRLA 4P57A 3HA0A 5IG7B 4RMVA 3QO1A 1NFIB 1IQWH 2WUBH 3M1BA 4JZJC 1OAYL 4EUPH 2CDFB 3EJZC 3CFEA 4UAOB 3S96A 1AP2A 4L3CB 5HYEA 4PJDB 4FZEL 1AKJB 1T0MA 2VABB 4R7DA 5HYQB 5ID1B 3VFVB 4MMXC 2XT1B 4M8VA 5EOCL 3U9UB 4OZ4B 3IU4L 4GXUN 1A4KB 1XCQA 3FAXA 2DQHH 4KXZI 3DV6B 4NC0B 3KWWA 4YX2L 2HTKD 2NXYD 4NJAL 5J9PB 3V5DB 1L9NA 3GMQA 2VR9A 1ZHNA 5IB5B 4JKPL 2GFBA 1KNOA 3T0WA 4OCYH 4CVUA 1PSKL 4EI6A 1JZ6A 2HT3C 1OB1A 3WKNA 4PJAE 4J3OC 4OUUB 2DKSA 2XFXB 4WFHD 1HKLH 1KTKE 3PWJB 1HQRA 2W0PA 2XZQL 3D39B 4M48H 5EIQA 4RGOL 5MI0C 3KNBB 5C0EA 4ZFZA 4DZ8A 1F00I 4DK6A 5DJAB 4JFQA 3GSWA 4HIJB 3QIWB 4MYWB 3QFDA 1I3RA 2EKSA 1PX4A 1OCWH 4APQA 5AZ2L 2AEPH 5FGSA 5HPMA 1JPTH 3IDJA 3WIFB 1T04B 4S1DC 3TBVB 1AC6A 4QRTA 5I2IB 4TYUA 1LE5A 2OX5A 3OAUH 3IKKA 1G7LA 1E27B 3G5YB 1RUQH 3BDYL 4HWBA 5DDHA 2ARJA 4PBWD 1GIGH 4AEHH 1A5FH 2VLMD 3LRHA 4EI5B 4W68A 5TH2B 1PKQA 4U6VH 5A2IH 2EE6A 4HIEB 3VWKB 4L8CA 2R2HB 2JJTC 1U3YA 1Z0NA 4NNYB 2R56L 3DJ9A 1G84A 5IKCB 1CDYA 4CMMA 5SWQB 1I8MB 4NIKB 5EORH 1NFDB 5D9SB 5HY9A 3V7MA 4MNGA 3QDHA 2CK2A 1JYNA 3UTQA 3MV8E 4WHTB 2FB4L 4PGJA 4X8JA 4NPYA 2YC1A 3D2UB 2LE9A 3QAZC 3F65A 2EH8H 3NCYP 3LH2L 1RJYB 2YPKA 3OKYA 4YHML 2C7UB 3LEYH 1CF8L 2H2PC 4I1NB 2D31A 3OJDA 2J7LA 3PHOA 2Z9TA 1FJ1A 5T1KD 3T65A 2Q6WA 5DJ2B 5DHVA 3HPJA 5BW7C 3NH7L 5EWIH 2YRPA 3ME0A 3PXJA 1A6WH 4W4OA 2V2TB 5IFAH 3P3YA 3C08L 2VDLL 4PJAA 2FR4B 1QVOB 1KELH 1SYSA 1QRNE 2N7BA 2UVFA 3MYJA 1QP1A 1VEPA 5HGAB 4KTEH 3SCMB 1RK0B 3U0PA 5C0DB 5GQBA 2XKNB 4XGZA 1QO3A 2GCYA 4U7SA 4FFZL 4NSKB 4NQUA 5JIHA 4G8FA 3AREB 4PLKC 1QRND 1KIQB 1ZKAA 2I60L 3ECBA 2AJZB 5IV2A 4KUZH 5HJ3B 5I1JL 5CUSL 2CRZA 4KQ4L 3EHBC 3O9WC 3O81A 3KHQA 5EH1A 4X6FB 4XVSH 2VLLB 3UTSE 3C5ZC 1K8IA 5EU6D 4Z76B 3CFJB 1X4XA 1N6VA 4LVOB 4MB3A 4RZCB 4ZUUA 1MFEH 4NQDE 1MY5A 1U3HB 3QJFB 3GI9L 1G7QB 4JDVB 4FQXA 4PUBH 5GGVL 4NNPH 1RULH 2DIAA 3UPCA 4YLQT 5FB8A 3TJEL 3MRNA 4Z7WB 4I18C 4CU7A 5T1KA 4J8RB 5HVHB 4X5XB 1T21A 2FJHA 4E41E 2DQTH 5DS8B 2FEDC 3V7AG 3O8XB 1BFOB 1P4BL 3RY6C 3E6HA 2VN7A 1KN2H 2XKUA 1ZGLB 1WK0A 5CGYD 5MP6H 1SBSH 1ZV5A 2EE3A 2R4RH 2DIJA 4MQTB 3I50L 1FNGB 1I4FB 1T2QH 3HMXL 3QH3A 3VFTA 2YA1A 5D1ZD 3ZHKA 3P0YL 1J86A 5JZ7C 5K9KA 4U6XB 3V6OE 2FX7L 4HEPG 3O6LL 1FDLL 2KZ1B 3P30H 5MEOB 3QXDB 3MOBH 1HDMA 3GB7B 4I2XA 2QQLH 4BYHA 4Z7QF 1CDIA 1Z6JT 2HKFH 1QRNA 4XAWL 2NZ9C 1KPRB 1OD7A 4AENA 3BAEH 5I8OH 1FVEB 1AGDA 4MAYC 3QXTA 2Q7YA 2HJKA 4KAQH 4M62L 3RVUD 1KJMB 3OXRB 5HVGB 4BZ1H 1NBZB 4V2BA 5T5FH 4K8RL 3BJLA 1E4XH 5EU6A 4X4YA 5E1HB 4P2QD 2AV1B 3AS1A 4HDIA 4NKOA 1CCZA 1JPSH 4PJ5E 2QHRH 1CDUA 1MFBL 4ONFH 3B9KB 3GRWL 1RUPH 4Y16D 4M7KL 3E0GA 4LP5A 3N06B 5FA3B 3V9FA 4CW1B 4L8SC 5AAWA 4LPUA 3NIFE 3VFGL 2D7TL 1A02N 3BIKB 1KCRH 4NUGL 1YYLL 5GGVY 4WNQA 1EEUA 3ELAT 1YC7A 5IR1A 2NY0B 3GJFK 4JFHE 3X11B 4GMTL 4RAHA 1AO7E 1LNUB 4Q9RL 1TCRB 4QHKI 4MCZB 4O4YH 4LSQL 5DJ8B 4HWBH 2BSTA 1Q9OA 5SWSB 3L3HB 5L0QB 2J5LB 3GEWB 3RVWC 3GM0A 3QWOB 1FFRA 5D2NE 4JFHD 5GS1C 4F7TB 5GGSB 4IM8A 3D9AL 1VB9A 2ITDA 4PGDB 3MRDB 4KVCL 1ZHKA 1A6AB 5C0IB 4MXQC 1GGYA 2FYYA 1FORL 4W70A 1CBVL 3LKSA 2F58L 2M2DA 4IHOB 5C08D 3HMXA 2EIDA 3V6OA 4PLOB 4PJAF 5DSCB 2F53E 4FZEH 5IBLC 1RZJH 3KPLA 2H3NA 1U9KA 4MWFA 5A16B 4D9LL 3IS0X 3RKPA 4DKEL 3HN3A 5MI0B 3V6FA 4M5ZL 2EC9U 2A0LC 4P2QA 5F1IA 4YX2H 5CJ5A 5DHVH 4KV5E 1KIUA 2AKRA 1MQ8A 2UWEE 3X12A 1B0GA 1ZT4B 3L7EB 2Z8SA 4Y16A 4M9OA 3ULSB 5C0NC 2CKBA 3FMGH 3O6KL 5IB2B 4Y1AE 3TT3H 1EZVX 4WU5A 3BT2L 4OZGE 4JY5H 4N90D 3ZSSA 1CI5A 4C57C 2EXWC 2PO6C 4A2LA 3GRWA 8CGTA 4QTIL 1QBBA 5DVOA 4YPGB 4LEXL 5E5MB 1SEQH 4LLVB 4JY6B 4MJ6A 1QBMH 1BF2A 5D5MB 5AZ2H 3TYGL 4LPVA 1FHGA 3RWHB 4X98B 3VI3E 3SGJA 1OY3B 4IRSD 4F8QA 4K7FB 4HK0A 3ZKSD 5KZCD 2P8LA 4Q7DA 1MCWM 3V5HA 5DK3A 3R8QA 1NGQL 2V5MA 5CZXD 2WWMD 1UYWH 1YYML 1A0QH 2IALA 4JQIH 5KJRL 1IVLA 1Q9LA 2Z8RA 2X4SA 1I7TA 4X0KA 1I3VA 4U1HA 1JWMB 2BJML 4WWKC 2IG2L 5D2NA 5C08A 1AY1H 2EEAA 5ERWB 1FRGL 5D96C 1J0KA 1DBKL 3QAZB 2YEZA 1S7SA 1FH5L 4HK3J 1FGNL 3I6GB 2WUCH 4OQ1A 3TEUA 5C2UB 1BOYA 5JPNA 5D4QA 2A6DA 1HKFA 1Z5LA 1F4AA 4LPXA 4U1IA 1G1CA 1LP9B 2FB4H 3MJ8A 1UJTA 2F53A 3TA3D 3B5GA 4I5BA 3HS0A 1QA9B 5EN2A 1M7IB 2HG5A 4YHMH 2IQAA 1S7UA 1CF8H 3GFUA 2W9DL 2WP3O 4N9GA 5C0JA 3DYMA 2NR6C 4NNXB 4GW4A 1U91A 5F96L 4LLYB 1MJ7H 4MNQD 1NC4D 5EBGA 2CK0L 5ALBH 3QFJB 3B4NA 3RFZC 4PJIA 1MHCB 1UM6L 3T2NL 1NEZA 4PV9A 1FZJA 2VDLH 3D85D 4OF3A 4YHNA 4Y7MA 2XYCA 4PGBA 1JF1A 5BZDB 1F42A 4OZGA 3TBYB 3BD3A 5IROC 1H3PH 3BN9C 3LY6A 3N85H 1AJ7L 4Y19D 3SE8H 2IFGA 3O9WB 4GQPH 4RISL 4YXHL 3REVA 3RJDA 2Y5TB 2YUWA 3NFNB 1REIA 1QBAA 4UINL 2O61B 5CGTA 5JW3H 3CDYA 1MOEA 2YK1H 3C5ZB 4JQXA 4Q2ZB 5FEBA 2C5DC 4XMKL 3SE9L 4F2MA 5E2UH 1LO3H 3U36A 4NFCA 3VFOB 2HVKB 5FECA 3CIQA 4L8DB 4L9LB 5CINH 4MS8D 5DRZA 1NCTA 4HCRA 2X4QA 3UJTH 1XF3A 5I1JH 4K71C 4OLXH 2ZUVA 3HC0B 5D7JD 4FHBD 1WBZB 4CJ1A 3KYKH 5J13B 1FO0L 4IDJL 1ZTXH 3FB5B 1DLFH 2BSRB 1JJUA 4ZXBC 1T80A 1AXIB 1E28B 1QSEB 3C8HA 3V0VB 4Z95L 3R0NA 4HHAB 4AT6A 3G04A 3LEVL 4KJQD 4HH8A 1D5ZA 4HX1B 3TA3A 4HBQA 2GT9B 5SWZB 32C2B 1MY7A 4PR5A 3ARGD 4HSQA 4Q74A 1X4ZA 4GAJH 4X6DE 1PKOA 5FYJE 4O2CA 4WJ5B 1NC4A 1BFSA 4P9HH 4P9MH 1BJ8A 3ARTA 3C6LD 4XH2A 5H35A 2I9LA 3WNLA 4JY4B 1EERB 4AMKL 4WI6A 5F3HB 3TYFB 3D85A 3NAAH 3VFPB 2YD5A 1R5IA 5FIEA 1MCHA 3VXPB 1FCGA 2ZCLL 4UILL 3SY0A 3U0TA 1JHTB 5T3ZE 4ODBD 2IBZX 4N0CD 4LP4A 3BXNA 3P4MA 3HMXH 5J12C 5TE4H 4XB8A 5DFTA 1JV5B 2C1OA 4Y19A 3IKCA 3MGTB 1XF5B 2ZCKH 3GIZH 4QRUB 1FDLH 1NCCH 2VLRD 4PJBA 4MDIA 3D3VB 2A6KA 4XMLH 5MENE 1V3KA 3TT1L 3KPNA 1LGVA 5DD6B 3GNMH 1B0RB 1NLBL 3NIFF 3TN0C 2OQJA 2BVOA 1CWVA 5D7JA 2CKBH 4JM4L 1JNLH 5CKGA 3WJLA 4M62H 1P1ZA 3KYNB 2IAMC 5EO9B 3K80A 5MEND 4PRBA 1QHPA 4PJGE 5AG8A 1DBMH 4KK5C 4MQSB 1HSBA 3TCLA 2N4IA 4HIHB 3BHBA 1MFBH 1J1PH 3GRWH 3QNZA 5EU7C 4M7KH 2DIBA 3WE6A 5C0RL 5DLMH 4J3VA 3VFGH 1ZOXA 3ARGA 3LS5L 1D5XA 4XNXL 4DVBB 5K9OA 1UZ8B 1YYLH 3LB6C 1T6VN 4U49A 2M1KA 1FO0A 1ONQB 3OB0H 2ARJQ 5I9QC 4BKLA 2XACC 5EZJB 3VFNB 5IMOA 4HULB 2EIZA 1KULA 1BLNB 1CTNA 1AQDB 3LIZH 1GVIA 3MA9L 3O2VH 4LSQH 3T0EC 2QLVB 1MQKL 4WY7L 2ZUWA 4Q9CA 2Z91B 4X6DA 2OR7A 3BP5B 1D5MB 3IFPB 2XKSA 4D0CA 3NACL 4WTZA 3SQOH 4H0HB 5CIPB 1UWXH 4KGLA 3JZ7A 2VLRA 5EFIA 4KV5F 4KVCH 4NCC1 4XZUB 2UWEF 4UTAH 3L3KB 4DN4L 3PHQB 4TOYH 2YUXA 4RMWA 1IE5A 3PGDA 2V2WB 1CXHA 2P48B 4LCWE 3CLEL 2JJSA 5IVNA 4TULH 1H0DB 5FYLD 5I1GL 2VL4A 3BH9B 4MHHG 3QIBC 1J18A 4CMHB 3PWLB 2VLKD 1T1YA 1NEZG 3MFGB 4OZGF 2XY2A 4YK4C 4D9LH 2Q76A 5MENA 2DQEH 4YQXH 3HI6L 4W6YB 4NQSB 1DFBH 2FEEI 3LKQA 4QY8B 1AC0A 2OXGA 3MLXL 4G7YH 2EYTA 4LRIC 1KFAL 5HI4C 2PO6B 2IJ0C 2YRLA 5EBLA 3SKJL 2NX5E 4WVRA 2GJ6E 1WAAA 3ARDC 1PDKA 3ROLA 2HT2D 1HEZB 4NFDA 1AD9A 3VI3F 5I30H 3UBXI 5J7CC 1IM3B 1MH5A 1FNEB 3F6IA 3WFZA 2HFEA 4PJGA 3PE9A 5DD0H 4WW2A 2H2SD 4KK9C 3MSPA 2NX5D 5IF0B 2J6EH 1WFTA 1TNNA 3LQAL 1AQKL 1FG9C 4ODXA 4QTIH 1NMCC 3FB6A 2F5BH 4QRSB 4JPIB 2GYSA 3MA7B 4O2FB 4E5XA 3ZTNL 4NT6B 2B4CH 4LAQL 4ZPVB 2DAVA 4WWKB 3BESR 3QBTB 3IGAB 4OTXL 1DCLA 2WIIB 5D96B 4M8QB 2OTUB 3G5ZB 4AQ1B 4HPOL 2FECL 1MCWW 3L3GA 4HCRH 4QT5B 1A3RL 3TBTA 1OM3L 1ZA3B 4XVUD 2WWKO 5JLZA 4M9PA 3V8OA 1SQ2N 5FFLA 2X7LB 3STZB 1RQ5A 1FYHB 3FQUB 4R4BA 3F5WB 3J7HA 4TPRH 4JFEB 3U30C 2BJMH 5BZWA 4U1LB 4HJ0C 4JEGB 1FRGH 1T03H 1TENA 4M1CD 2VLKA 4R3SB 1X5IA 3S8WA 4D94A 3L6FB 1A1MA 5A2FA 4S1QH 1VFBB 5DZLA 2IADB 1F4XL 3MRQB 3Q5TA 1NBQA 3CMOL 2GJZB 1K2DB 1JUFB 4PJBF 3K3QA 5C7XL 1S8DB 5B38A 1FL3A 4X4XA 3L9RA 3TPUB 3ZYIA 5T1MA 5E8PB 1VGEH 1IM9D 1UM4L 1EO8L 3BKCL 1J8HE 3MRPA 4TSAH 1WWCA 2NW2B 4HK3N 1CXIA 3P40A 3GSXB 2NX5A 1ZGLP 3OKNB 2NY2C 1EUUA 2BNQE 2HFTA 1FFPA 2CK0H 5J6GA 2W91A 1LVEA 3SDCC 4LLMA 4WO4C 1S7VB 2VIRB 3T2NH 4QHKJ 4PJ8D 1J8HD 1YPZE 5C9KA 4P5TD 6CGTA 2IQ9H 5KN5A 2YD8A 3O3AA 3GHEL 2JCCB 1AJ7H 4M6OL 4J12A 1EZVY 2BNQD 4PRIB 3QUKB 2EDLA 4WV1C 2VXUL 2Q86A 5IJKA 2CLZA 3NIDE 4Y5YA 4ZXBB 4XMKH 4CAGA 3WEXB 3KLSA 3THMH 4ZTPH 2DQIL 1QD0A 2QQNH 1DQML 4P46D 2YMXL 3U7YH 5D6DA 4X6DF 3NA4A 4A6YB 1RI8A 2FJGA 4EDWL 5IBTH 3DTXB 5DTFA 3MREA 1FO0H 4G8EA 4X6CE 1V3MA 1NANI 1II4E 4K3EL 3OL2A 5JXAH 2PW2B 1BQUA 2QQKH 1VGKA 3O3UN 2HAZA 5DWUL 4QRPB 1NCDL 1IM9A 5EUOA 4QOKE 1JK8B 4GH7B 2KKQA 4XX1E 4G5ZL 5GJSL 4OFVA 2AXHA 1KCKA 1ZSDA 3H7LA 3OKKB 1K4DA 4EEEA 1G7PA 1ED3A 3MCLL 2VB5A 3B9DA 5DHXB 2NQCA 2Z8VC 1IEBA 4ZS6D 1SVCP 4AMKH 5J6HA 3GMMB 5GRYA 2F54E 5B21A 1J8HA 3KPPA 3PUCA 4P5TA 1DBJL 5E8EB 3TN0B 1R3JB 3G08A 4XPAL 2A6IA 2CR6A 3GSVB 3NGBC 2BNQA 4PJGF 4Y5VA 4WW2F 2FLRT 1Z3GH 4Y5XA 4EQ2A 4H0IA 2F5AL 3MR9B 1IGTB 1YDPB 1BWWA 3TT1H 4YDIH 4M3JA 2VC2L 4OCRL 1OAQL 3WL9A 1BD2D 1NJ9B 1OW0A 4P46A 2IPUK 1HHHB 1URLA 3RTQC 3JTTA 1EEQA 3H9SB 1NDGA 3OB8A 4I3SL 5D1QD 3LN9A 5I9QB 5KSAD 3HLAB 3RAJL 3RKDD 4DFHA 3ZKND 3VMNA 5IESL 3H42H 4DOHB 1HH9A 4FG6D 4LFHD 1CXFA 2CIKA 3MV7B 1KB9K 3T0EB 1KJVB 1H3VA 1S5HB 3RUGE 3ZDZE 3F12A 5D70L 5EPMB 4IMKA 4PB9L 4QYOA 1CYGA 2JJUA 4XNXH 5EU7E 1NCBL 4HUVB 1PG7X 2W9EH 4X6CA 5CLWA 3EKCA 2O5ZH 3PNWA 4ALAL 1QLRB 1DQLL 2BCKB 3BH8A 3CXDL 3NTCH 3HZYB 3EFFB 5E1AA 5I8EA 3PWPE 4U4BA 3O4LB 4ZUVB 4YDLC 2X9WA 1F11B 4QRRE 4ZQKA 4ZNCD 5F7WC 4CVXB 5B38G 4QOKA 3I75B 4N0YL 1KLGA 3ZKMC 5FGCE 3NACH 5FYLH 3QIBB 3ZSTA 2W38A 4I3RL 4WW1B 3UTTE 1IT9L 3OAZH 1PEWA 1QEWA 4Q6YA 1OWWA 4YK4B 4PJXA 4YDVB 1QLFA 3HNTH 4U1KB 3RVTD 5HYJB 1BQLL 5TQ2L 2IANE 2P7TB 4LGRB 5F97E 1BD2A 4ZO7A 2APWA 4JO2L 1QFOA 3CLEH 2HJLB 1FVCB 4OD1H 3STLB 5I1GH 4UT9H 3BEWA 1MRCL 1N5AB 1YNKH 3I2CH 2QKIA 5D1QA 1BIHA 3SGKC 4KROD 5KSAA 3DVFA 1LEGB 1RU9H 3PDOB 5HHME 25C8L 3GJEA 1R5WB 1KFAH 1NMCB 2ATPA 2BVPA 4WEMB 4KKCC 4M93C 3S36X 3IB4A 2DI7A 1GZQA 4JPWL 4TVPE 3DGGA 1C8PA 3HPLA 2CIIA 2DJ4A 3K2UH 4Y4FC 4MNHA 1G9NH 5EO0B 5CEZL 2R1XB 2IPTL 8FABA 3OKEB 3RWFB 3ZKQD 3PDDA 1XH3A 3SJVB 4DAGH 1OPGL 4I4WA 1LEIA 5DF0A 4KMQA 1IGCL 1DQQA 3VA6A 2CQVA 2O5YH 3LQAH 1KGCD 3RUGA 4K9EC 1DN0A 5LGKA 1U8KA 5DVKA 3ZTNH 43CAA 5C0AE 4LAQH 1QSFD 3SDAC 1XF1A 3U30B 4OZHB 5CEZD 3O11A 2C3HA 4BH7A 4QHUB 4PJHA 2E27L 1M71B 5DMYA 5JQHC 1OM3H 1IGJA 1I1RA 5C8JB 4Z9KB 4CN4A 1GC1C 2UUDK 2D7MA 1KCUL 1QYGH 1EAJA 2Y7QA 1Q1JH 5ALCL 3C5JB 5KVMC 5JXED 4XCFH 1A9BA 4XI5D 1KB5H 4KJYB 2AEQH 2YR3A 3QWQB 5E7FA 2A83A 3LDBC 3HMWL 1IILE 2W92A 2PYFB 4JO1L 3PQYB 4P4KB 1F4XH 3QEGL 1OAZL 5GIRA 4JZOB 5L7XL 3OBAA 4F33A 5JORA 5DUML 5BMFL 4BSVB 5C7XH 2IPKA 4PRHE 2D9CA 3SDCB 3IS1X 1YPZF 1ZK9A 3ARBB 2CLRB 3L3DA 5IEKB 1EVUA 2QADC 3TV3L 4JM2C 4LLUA 4ODTH 1UM4H 4V1DB 2JK5B 1U8HB 4LMQI 3PP3K 5T33L 1F2QA 3MRKA 4ACPA 2SEBB 3DVGA 1CL7H 2HVJB 4OJFH 1NC2B 1ZS8B 5IGXL 1CZ8L 3MLVL 5DJCB 2AJSL 5EBWB 4LLDA 3DHJA 5E9DD 2YKLL 3U7WL 1QSFA 4DJMA 2JB6B 5DI8A 5DD3H 3CX5J 3HFMH 4RWHA 2AK4E 3FFDA 5JA8B 2C3VB 3GIVA 3H9ZA 2FNBA 4WUUD 1J0YA 4JFFB 2BOCB 3H3BC 2DBJA 1KCSH 1P5VA 1JRHI 3ARQA 4X6CF 5CCKL 3NOIA 4HS3A 5L2JB 3DBXB 1P6FA 4HGWA 4MDJA 1HH6B 3RY4A 4MLIA 3OXSB 1KJ3L 5H37G 3VFRB 3DRTB 3HB3C 4GRLB 3QNXB 3I85A 4PJDE 1M4KA 2AK4D 4O5LL 5JXEA 3OX8B 1KPUB 1CFNB 4FQQA 4JAMB 2GY7B 2NCMA 4FFWC 1HHJA 2F74B 1RUAH 1OGTA 1XIWC 3JTSA 5IK3B 3OPZL 4QHMA 4ZO9A 1QFUL 3D48R 3LKNA 4PD4J 1AKJD 5H37H 4F9LA 1KV3A 4NDMA 3RL2A 4WGVB 4IIQB 3LPFA 3MODL 3FB7A 1IARB 4AIOA 4HUUB 4OFPA 2R8SL 2WZPD 3T1WA 3PWVA 4XPBH 1XGYL 1TTFA 1NCDH 5ETUA 3VXUB 4ODUB 5LAXB 5FO8B 5GGUB 4NBZB 1U8LB 4FTVE 4HKZA 4KPHH 2VKXA 3WUWA 3MLWH 3N1PC 2J8UB 2CDGB 2G2RA 4MX7B 3MCLH 2XXMB 3BWAB 1JHKL 3D39D 5EU3B 1F13A 2O5XH 5EULV 5IOPA 4GXUM 1HXMA 5DQDH 2I9TA 1CGTA 4M1GL 5TQ0H 1CD1A 4LFHG 1SJHB 2ENYA 5CHNB 4OI9A 5ICYB 3QIWD 1BZQK 3EO1B 3RTQB 4MXVE 5E8OA 2GW5A 3V2AR 4WUUA 3BYTA 2A73B 3TZVC 3DXAE 4LARH 2GHWB 2RAMA 2F19L 5E5RB 4ODHL 2HWZL 1NCWH 1LWRA 2XXCB 3OZ9H 4XBGA 3RIAK 4ZS7L 3DX9A 4H5SA 4XVTL 2AK4A 3RUGF 3ZDZF 4PLNC 4QHNA 1U8NB 3WFEH 4G8IB 2BERA 5IG7A 2ITCB 4U1GB 1NFIA 4UZGA 4HBCL 4EI5D 1KENH 1HI6B 2CDFA 3RJQB 3VWKD 1HINL 1EJOH 3ARWA 3BGAA 4L3CA 3RAJH 4PJDA 1AKJA 2VABA 4O51B 4WI7A 5CEYA 5HYQA 2RR3A 5ID1A 2X4TB 4HZLB 2EO1A 3U9UA 4OZ4A 4YDLB 1WISA 1ZE3C 2BVEA 3DV6A 5KANI 3MRBB 1VSCA 3F6LA 4Y2OA 5J9PA 3V5DA 3OG4B 5IQ7L 5KOVC 4IRZH 1J12A 3O6FC 5IB5A 5GJTL 3D2UD 1RZFH 1EBPA 2BHYA 1MCBA 2ICWB 1RK1B 1FN4B