5KG9A

Crystal structure of the gp120 v2 antibody re505-22 fab from igh- and igk-humanized mouse
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
215
structure length
206
Chain Sequence
b'VQLVESGGGLVQPGRALRLSCAASGFDYAMHWVRQAPGKGLEWVSGISWNSGSRGYADSVKGRFTISRDSQYLQMNSLRVEDTAFYYCARMNGTFDYWGQGTLVTVSLASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody RE505-22 Fab heavy chain
publication title Immunodominance of Antibody Recognition of the HIV Envelope V2 Region in Ig-Humanized Mice.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 36
structure length 206
sequence length 215
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kg9A02
4HUWA 2VDNH 3W0WE 3GSWB 1EEYB 2VZOA 5T5NG 2XTJE 3VI4F 1IRAY 3T1FB 1F5WA 4I3SL 1RZKL 3SDYH 3UTTD 3X12B 1IARB 5T1MB 5F8RC 4PRHE 3QUYB 4PD4J 3VXSA 1R0AH 2J6EL 3PV6A 5BRZE 4NQEB 3MBED 3E6HB 2WZPD 1NH6A 3FQWB 1MCKA 4Y19D 4M1DH 2EKSB 1UH4A 1KXQE 5CUSL 1C5DA 3QPQC 4LEOA 3GI8L 3T2QA 4YE4H 1BVZA 1JF1B 2AQ2A 4JLRA 3MV9B 4EN3A 1JMXA 1Q9OA 2QQNH 4GG6B 1YY8B 1CZ8L 3LPFA 1NCAL 3QI9D 5KW9H 1FGNH 4LEXH 3GO1H 5I6XB 3GMRB 3WIFB 3VFPA 1GHFL 5LQBH 4ESKA 1HWHB 5DJYB 3KXFA 4LSUH 5CSBA 2DQEH 4P5TB 3HNSL 2PXYA 4MX7A 1ZHBB 3HC4H 4X7SH 4U6HB 5JOEA 4AT6A 4K3EL 5I75B 4HIIA 2JJTA 1H3UA 2FH8A 2B39A 4WW2C 1U0QA 3GK8L 2YHGA 5E2WH 5DC9B 5TPWL 1RZ7H 3TT3L 2JTDA 4PBWD 2FSEA 3HI6H 4L4VB 2DLEA 3B8SA 3L3GA 4L8SA 4PIRF 4HUVA 1W72L 1D6EA 4OKVB 4MLSA 4TTGA 2VQ1B 2Q3AA 4XP1H 4Q74A 2VE6B 2BNQB 2X10A 3LHPH 4X8XA 1DQMH 2DLFL 3GJFA 1QSEA 4DTGH 4NFBA 5HYSG 3DRQA 3VG9B 3WXVL 4FZ8H 4LLYA 3P0YH 3WFZA 4Y2DB 2N7BA 1D5ZB 4LVHC 3U9PH 4QRRD 5EULV 1RZ8A 1DBAH 3LKRA 3F12A 1FYTD 5TGBA 1GIGL 3FT3A 2VZUA 3PQYE 1VFBA 1XGRB 5FYJL 3EKCA 4YXHH 2MPAL 1IAKB 1EAJA 3I02B 3O6FC 3LKPB 5D7LE 3MRBB 1MF2L 4K8RL 5EO0B 2QBWA 4KROC 1ZWIB 5I30L 2VNCA 4IBLT 5CD3A 3QUMA 3RDTA 3HUJB 3PABA 1IAIH 4CUCA 4KJPC 2HJLB 3QIWA 4JR9H 4DKFL 1CQKA 3HFMH 3DETD 3C5ZA 4DGYL 2PO6C 3KPOA 4LCUA 4JFPB 3JUYA 5I0ZA 3FQUA 2A74A 1TETL 4NPYA 3NVQA 2M2DA 2VXTH 4ODHL 1A14H 4MQXC 5EC1A 1KCSH 4TUOB 3AS1A 5GS1C 5D7KE 2D31B 1I1FA 4NNPL 1JF6A 2Q20A 3T2OA 3SGJA 1T2JA 5I17B 1HYSD 3STLA 1I9JL 4OCMC 5L2KA 3A6CH 4JFDB 4UTAH 1HOCB 2VQUA 4ZFZA 1MSPA 4J2XA 1TFHA 3DARA 4YEFA 1M7IA 4LKCB 5DHVB 1NCBH 1KJ2B 3DNKA 4FQXB 3C60B 5C07B 1Q1JH 5DSCB 3KWWA 1SY6L 2NYYD 4QHNA 5MP6H 3VXMA 1VERA 1V3LA 3TEUA 2VRAA 3STZA 2MKLC 1SMAA 1VADB 3MA9H 2L0DA 1YDPB 3DV6B 3MLSL 3FO0H 3OF6A 2XACC 1QBLH 2VXVH 5IB3B 3I50H 3RWIA 5CFHA 2A6JB 3V4PL 2YEZA 4OCNC 5I1KH 4K7FB 4CN6A 1V7NH 2B5IC 1JPFB 4JJ5A 1OT1A 4NBYB 3O45A 4CGTA 1A7PL 1I1AB 1AO7E 4XAKE 4UQ3B 4H0GA 4M7JL 4XHQA 3RVXD 4OD2A 5C08A 2A9MH 4H0HB 2VMFA 3B9KD 3RZCB 2ZG2A 2Z4QA 4YFDB 3MRNA 1JTOA 4QXUH 2GSGB 3BH9B 5GZND 4WW2A 5C3TA 5BZWB 3QQ9C 3BEWB 4I13B 2IALA 3MXWH 4OJFH 4WO4D 3MROA 1AD9B 2V9RA 3CFDA 4R9HA 3X11B 2HFFB 2JCCA 2DQHH 1GOHA 3FFCB 5A3ID 4LU5L 1MLBB 1CK0H 2Q87A 4JPVL 1MJJB 1INEL 4LBEA 3DUUA 4PUBL 1HHHB 2YXMA 4PJDF 4F33B 1TMCB 3PHOA 3IJYA 2EC8A 4FFZL 4FOMA 5IB4B 1EBAA 1VHPA 4ZSOB 1KXTB 1EFXB 2XKNB 4ODVL 1FE8H 1P84K 4LCWB 4MVBD 5ESAA 4PRIA 4XC3H 4XMKH 1NUGA 5DMGC 3VXTA 3ARFD 1WC7B 3OAUH 4U6TA 3MRMB 1GAFL 1JGLL 3O6KH 2EIBA 4HKBA 4OGYH 3RNQB 1DFBH 5HGHA 2Z0BA 3ALWA 3JWDL 4Z5RB 3O6FA 4E5XA 4N0FB 3U48A 4ACPA 1T7XA 1U8QB 3P0VH 3QT2A 1BJ1J 5LXGL 1U93A 4K9EH 4ELMB 4G6JL 1IGIH 3MJ9H 4YDLB 5C0FB 4IDLA 3GI9H 5B21A 5HYJB 4KTDH 3RY6C 3BZ4B 4J7RA 4X80H 1SBSH 4ZQKB 3T77B 2DB8A 3OGCA 3NCMA 5DO2C 2PO6A 4LHUB 2QADD 2X4TB 3S9DB 1S9WB 5KBNC 1IAMA 3RGVC 2EXWD 4P2QA 8CGTA 2F54E 1A7QL 3U82B 3RPKA 2R56H 4LIQE 1RIHH 4OAWA 5GJTH 5GS1A 1DVFD 1L7TH 3QWRD 4U1JA 2GIYA 2W9DL 4N9OB 3ET9F 1QFWL 4NJ9L 3RVVD 4ZD3H 5D1XD 2P5WD 2FO4A 2J3SA 4YHIA 3BP7A 4DEPC 4XCEA 3MLYL 4N90D 2X4PA 1CGXA 3K0WA 3MBEC 2NY7L 2VXSL 3BPLB 5EFIA 1W72B 3H6JA 4M6MH 1A6ZA 3PXJA 5EU7E 2ZUQB 4QWWD 4UV4H 5ALBL 3BPOB 2NTFB 1FLTX 3QHFL 4QRPB 4ZOEA 1AGCB 4PJCB 4YHNA 4MCYB 4HT1H 4OCXL 4BM7A 5DD3L 1Y0LA 3QI9C 4DGVL 1P5VA 2IBZY 4MJ6B 3REWB 4RISH 1BGXL 4UT6L 4I77H 5J6HB 5MENA 4TPRH 2VJXA 1UYWH 4NFDA 1Q9KA 4JFXB 3O8XB 1XF2B 4RCAA 4XBEL 1I3RB 4OLVH 3MNWB 3GMNA 1IFHL 3P30H 2AXJA 4POZD 4G5ZH 5D5MB 1KTLA 3GZKA 4DZBA 1G9EA 4PJHA 3CU7A 2X42A 2YR3A 3V7AG 4S0TD 4W6WB 1XF5B 4HFUH 3VMNA 3A67L 3HZMB 3VJ6A 1EUTA 1MCPH 4OUOA 3MLTB 3KPLB 4GXUM 5HHOA 2J4WL 3ULVE 1K6QL 1A3LH 4PGDB 5FYLH 4ZOBA 5C0EA 5C1MB 3PP3H 2IEPA 5EO9B 4MJIB 3SQBA 2XA8H 3KNBB 5GRWA 2YKLL 1XZ0B 4OCYL 5I19L 1JNNH 3X14B 2DTMH 5DDHB 1DL7H 5ICYB 2GCYA 2AJSL 1WAAE 2PYEE 4WV1B 2NY1B 3CC5B 3V79C 2A9NH 1KLGA 3PWUA 1EJOL 4WUUE 3S97C 3E6FB 1NC4D 1JBJA 4L4JA 2I27N 3QDMB 4HS6A 1F4WH 1B6DA 5CINL 3ECBA 2DM2A 1QFWI 2BNRB 2HFEA 4M7KH 5CEZD 1QP1A 5J12C 1RJZB 5CILL 4PLNC 5IBLD 2QR0B 3DETC 4F7MA 5CEYA 2GUOB 4JJHA 1EEZA 2Z92B 2X1WL 2VDML 3QYCA 2FCBA 4LNRA 3ARWA 3VGHA 1MCQA 3JTSB 4D9LL 2VTFA 4D8PB 4YO0B 3NZ8B 4IRJB 3UZEA 3RY6A 4XWGL 1FNLA 1U8PB 4X6CE 5L9DH 3MACH 2Y36H 4WTWA 3HR5A 1IKFL 4F57L 1HYSC 1NMAL 2CDGB 1BVKA 1N0XL 5IGXL 5SWSD 3RGVA 4NO3B 1YMME 4KGLA 3RL1A 3T3PF 4ZFOL 3C2SA 4FP8L 4I48A 2GFBB 3G5XA 2VAJA 3UTTA 1MAKA 2NYYC 3KDMA 2XG5A 1J05A 4MNHB 3QZWG 3NPZB 1BIIB 5FA3B 4TSCL 4G6KL 1ZS8A 5C0ND 1B4RA 1KTDA 1MFAL 4Z7VE 2DBJA 3L1OL 1JL8A 4JO4H 4Y19A 5AG8A 4HWBA 3QXWA 5HI4D 3PP4H 1O0VA 3V8CA 4Y16B 1GRWA 3OKKA 1OM3L 1OAUH 1LVEA 2JB6B 4D3CH 5F6IC 4HIXL 1T7WA 3D5OF 3QI9A 3QXUA 4OZFG 5GRVL 1NGQL 4Y1AB 2K9UA 3FB7A 4ZOAA 3RVXC 1VB9A 5D93B 1ZGLP 1RURL 1N3NA 2EEAA 4TSBL 4GRLB 3L5JA 1XGPA 3B9KC 5TF1L 5C2BL 1KT2A 5JMRA 4BFGA 4IMLB 1ZVSB 4JGUA 4NJAL 5GIRA 4MCZB 5GZNC 5BOZG 2AEQH 4YDJB 5DD6B 2EE6A 2VIRA 3KYMA 4WO4C 5JO5B 2EYRB 5E7BA 2D7OA 3H9SB 4CDHA 4JY5H 3IJHB 2EYTB 3LS4H 5A3IC 1C16A 3GSVB 1U8KA 1M6OA 1Y6MR 1N59B 5DRZA 2VZVA 5E8EA 2G2RA 2APWA 4P5MB 4Y5YB 4PJ5D 3P11H 4MVBC 4PRPD 2MHAB 4RAVB 5SWQA 5CJQH 1CICD 2ENYA 3MJ7B 4GO6B 2ATPB 2AJVH 1U3HD 3ARFC 5CWSB 5I1CL 2XWTB 4QRRA 3OJDA 1QACA 4RMTA 3LKNB 5C92A 2ZJSL 1B6UA 1CD8A 1FYTA 1TJIH 5C9JA 2OQJB 2CO6B 4J23A 5IMKA 4BJLA 1XGUA 3BT2L 1N5YL 5FA4A 1R3IL 5F1NB 3BP4A 1V7MH 3KJ6H 2Q8BL 4HUWB 3WDIA 4WUKH 1FVCA 1Z0NA 3OKYA 1KJ2H 2ZKHH 4TNVF 4I18C 4TVSa 5SX4I 3V4VH 1JPTL 3R1GL 1MCIA 1JZ5A 1UG9A 3EZ8A 3QJFA 4PTTA 2FGWH 5I1LA 5BQ7A 3TO4B 1JFQH 4JFOB 4R4FH 1AP2A 3VXSB 3IKKA 2QADC 3H9YA 4P3CL 4P2YA 4EDXB 3PIQB 4IM8A 2EXWC 3W2DH 3K8KA 4S1SL 3QHTC 4JRYE 5MI0B 1DVFC 3HE6D 4LSSH 5DJ6A 3V2AR 4AMKH 4XCNA 1MIEH 1J5OL 3RVVC 4X9FA 1AKJA 4NC2B 4LEOB 1CGYA 3TNMB 5D1XC 4WGVB 1IM9D 5LGHH 4JLRB 4B5EA 3OG6B 4EN3B 1Q9OB 4F58H 3MLRL 1CDYA 5IBUG 2VO5A 4P4RA 5FUZL 2VH5L 5BV7B 5HSFA 2FX7L 4UT9L 1G7PA 1C08B 3UBXG 4WFHE 3VFPB 2X40A 1YEDB 1RIUL 4H20L 2I9LA 4QWWC 3UYRL 3KXFB 3IDJA 3L7EA 4XP4H 3JWOL 2EDNA 2PXYB 4MX7B 3QAZB 5FHBH 4AQ1B 2E7LC 3S4SG 4XP6H 4HIIB 1J87A 2UZIL 2VR4A 1UCTA 3IU4L 3PQYD 3BOVA 5IKCA 2H2PD 1V5JA 3B6SA 3BP5A 5D7LD 2FSEB 1EGJA 2R2BA 1B4JL 4L8SB 5FYKU 5I1HL 4R90L 3ZTJH 2IPTL 1QNZH 3E2HC 4JM4L 4L3CB 4LCYA 4OZFA 2LU4A 3BKYH 4BSJA 3OAYH 3NCJL 4POZC 2F15A 4P2RE 3H7BA 4I3SH 1G9NL 1GH7A 2DLTA 3TJEL 5IESL 3BIBX 1RZKH 2EDJA 5LGJA 5IFAL 5DURD 1FN4A 4WU5A 3DRQB 3CSGA 1AI1H 3GRWL 5DFTA 4LLYB 3RY4A 4UTBL 3B9KA 1VFOA 3TO2A 1RZ8B 1A6UH 5F7NC 3UO1H 3WO4B 3LKRB 3F12B 5E99L 2YPLE 4OM1L 5TGBB 5GSVB 3FAWA 3TGXA 4J3UA 2FO1A 4OLEA 3HC3L 4BZ1L 4LPYA 1KYOJ 1A5FL 3GI8H 3HTLX 2IJ0C 5I15H 4KZEL 4WO4A 2O5ZH 3IKCA 1JWUA 1UZ6F 1IGCH 2MJWA 4JQIL 1DTUA 2HN7B 1MHEA 1EHLL 1CZ8H 5CD3B 3QUMB 1Q0XL 1NCAH 4LSQL 3RDTB 1EERB 2VWEE 4U4BA 4LHQB 2XZAL 1QA9A 3MV7E 4OM0L 3AROA 3KPOB 4YUEL 1U92A 1W8NA 2APTA 2NXZB 4K94C 3FQUB 4JREC 4BH7A 3BIKA 3ALXA 4A6YL 3HNSH 5FUCE 3DX9A 3S5LG 2EKJA 4WFED 4E41B 2EICA 1I9EA 3ARFA 3ELAT 1I1FB 2PF6A 4HKXA 4JPKL 5DUPL 3DO7A 4NHUA 4PJEB 3GK8H 1IKNA 3DXAE 1J1XL 5TPWH 3TT3H 1PJ9A 3STLB 5IHZA 4X6DE 3BE1L 5IBLC 5L2KB 4JCLA 3LQMA 1W72H 1IE5A 3N1QC 4ZFZB 1CLOH 4RIRA 4HGWB 2VLKD 1FFQA 2HLAA 1M7IB 4OZHA 1NBZA 4I18A 1XEDA 2Y07L 3QFJE 3Q6FA 4XAKD 4JO1L 4HC1L 2DLFH 3L3DB 1NGWA 1WFTA 4QHNB 3VXMB 4QY8A 4AG4L 4JY4A 3QG6B 5CMAA 1MHCA 3WXVH 4WDIA 4YZFF 1MCCA 1H5BC 3STZB 3DX8A 2F19L 4HW6A 4UNTA 3MRIA 3NMEA 3S37X 4U1MA 3UYPA 3VGBA 1P5UA 5T3ZE 1DVFA 5KS9B 1KIQA 3QWRA 1LNUA 3WFEL 3RWIB 5D1XA 1I9RH 2P5WA 5EZOH 1MF2H 4K8RH 3WIHH 2RIKA 2YEZB 3MA7A 4PGEB 3EDFA 4MA8L 5C0NC 1YEKL 2X4SA 4WI6A 3BH8A 4JJ5B 3G6AB 5K9OA 2AQ1A 1I1RA 4OFYD 4EQ3A 4PJ7A 4V2BA 1FORH 5TQ0L 4DKFH 3WUWG 4DGYH 5HI4C 5EU5A 1VDGA 3GJFK 1L6XA 4U6VL 1WT5C 2ZZUT 4YAQA 1T1ZA 3S4SA 5CP3H 2ZSVB 1ZHKA 1EK3A 1TETH 4UUJA 3ES6A 2Z4QB 4XVJH 3MRNB 2E7LA 2CLVA 5JHDD 2D0FA 1ZLVH 3OJ2C 4WW2B 4NNPH 2YMXL 4HJJL 1EV2E 2AAVA 3WS6C 1I9JH 3CFDB 5HHMB 3MSPA 2YA1A 4NKQB 5K9KA 2JCCB 3CFCL 4ZS7L 1BHGA 1YEFL 4NGHL 2CK0L 4NNXA 2BSSA 1F2QA 4GKOA 3DUUB 4LBEB 1UADC 1I7UA 3MLPA 2GT9A 4OV6F 5TE6L 4DOHE 1CF8H 3IJYB 5HYSB 3H2WA 1SY6H 5ESAB 3N1FC 3MREB 4PRIB 4L3AA 2F54D 4Y5VC 3G5VA 1FFPA 1N6UA 4XHJD 4HKBB 2F5BL 3MLSH 3QIUA 1EMTH 2W91A 1DQTA 1S7TA 2YXFA 5HGHB 4DK3A 3ULUD 5H35A 3O6FB 4E5XB 3QUXD 3ARGB 4WVRA 2WP3T 1AE6L 3BAEL 1H3TA 2MTPA 1CICC 1U93B 3TVMC 5GQBA 1U3HC 3WE6A 3QQ3A 1HE7A 3TYGH 4Y4KB 3VWKD 5ACLA 4I0KA 3OGCB 4M7JH 3C9NA 4X7FC 3TLRA 5JW3L 5F7UA 4U2ZA 2XNAA 5T3XH 1KENL 3NZHH 1CVSC 3ZYJA 5FKAA 1KJVA 1FNEA 4P2QB 2VLME 4J3OC 4OCRH 1UWEH 4EI5B 4OAWB 1NC4A 3P4MB 3WCYA 1RJCA 4U1JB 3VXNA 3CX5K 3QHZH 2A77L 3CX2A 3O9WD 2FO4B 3DUHA 2BOBA 4M7LH 3BP7B 4YHIB 2X4PB 4NCC1 4J3WA 4DZ8A 1GC1L 3D48R 4JPVH 5EFIB 3D69A 1INEH 1RIVL 5I16A 4PUBH 1A6ZB 4R97C 5JMOC 3E3QC 3B4NA 3HE6C 4B7IA 4F8QA 2YD3A 1PX3A 4FG6D 4YHNB 2W60A 4ODVH 3RUGF 2BDNH 3RWHA 1X3DA 4OD3H 1JP5A 3ULVD 1H5BA 3I2CH 5E6IA 5SWSA 1Y0LB 3G9VA 1SJHA 3S34L 1JGLH 3O2VL 4L5FL 5JOPD 2AW2A 3L9RA 5I1IL 2XRAL 1CGTA 2FECL 5KSBF 1DQJA 2AJZA 1WWBX 5DJAB 3IB4A 1X7QB 1Q9KB 3JWDH 4KQ3L 1FC1A 3TNNA 4OCWH 3GMNB 3JZ7A 3LN9A 4HKZA 4PJXA 5CGMA 5LXGH 4D9RE 5EU6E 2B5IB 1NBYA 2UWEF 5LBSL 2PYED 3RI5K 3VXRD 4DZBB 3H42H 3WUWA 4PJHB 4LFHD 1MI5B 2IH3B 2EH8H 5F1IA 2H6PA 5F7KC 2H2PC 3MRDA 4J6RH 3VJ6B 1G7MA 1YEHL 1CBVH 3ARED 3HMXL 2NNAA 5C6WH 5HHOB 5FYKL 4LLQB 1G7HA 4GW5A 1MLCA 5FK9A 1QFWH 4NJ9H 1FO0A 1RZJL 1J8HE 4LMQI 3MQIA 3VD5A 3WS6A 3ZHLA 3VDAA 3F7RA 3V5DA 2EDDA 1ZVYA 3BZEA 3MLYH 3WKNA 1UKQA 3MOBH 1HHIB 1E4JA 4HXAL 5I8EB 4LQFL 2NY7H 4YHLL 2X4OA 1J0YA 2B20A 3OXRA 1IGMH 3NAAL 2BXYA 1MAML 1UM6L 4Q2ZA 2EDTA 4JZNB 3TBVA 1KLUA 1XF3A 3QHFH 2Q6WB 5JXED 2OI9C 1KLGB 3IDXL 3MLUL 2N4IA 4OCXH 3FHQA 3CIQA 5CS7A 5DD3H 4Y5VA 4HS6B 1JHLL 3ECBB 1NBQA 2HFEB 1KN4L 1BFTA 5LJYH 4MA7H 4KUCF 4FFYH 4OBSA 4UT6H 4F7MB 5FXCH 5CEYB 2EEBA 3OV6A 5TH2B 2NX5D 1EEZB 2L4OA 4DAGL 2ZCLL 3OKMA 4LNRB 4PJ5A 4J3XA 4K3GA 5IEHB 2F74A 1X5IA 4P57A 4PRPA 1IFHH 2J5LB 5D7IF 4DFHA 3TVMA 4Z8FL 3DPBA 1G6RL 5DMKA 1U3HA 4PPTA 4PJ8B 3K1KC 1MCNA 1B88A 3TPUA 2DQCL 1EVUA 5BV7H 1CLCA 1BVKB 4BQ6A 4UAOB 4HBCL 1IEAA 4RMSA 1A7BA 3EFDH 3RL1B 5AEAA 1FNSL 4OCSL 15C8L 4I48B 3KVQA 3SE3C 2J12B 3G5XB 5IW3A 1A47A 2QSQA 4HIEA 4ELKB 2YKLH 3KDMB 2H45A 4OCYH 1J05B 2XTLA 4DEPB 1WJ3A 4XP9L 4DWHA 3UPRA 4R7NA 1RUAH 3BDYL 1YPZE 3QH3A 3VD3A 2AGJH 4YQXH 1I8MA 2ESVD 3DGCR 2FJGA 1F6AB 1LEIA 4QXTA 5FUOL 4XPFL 3HE6A 3GEWB 3LY6A 1L9MA 3OKKB 2BY3A 2OR9H 4W4OC 4ZS6D 1EJOH 5K59E 4LVNC 1IM9A 2UY6A 1CIDA 4HLJA 2DL2A 3JXAA 3QI9B 5CINH 4MAYD 5ITFA 1DLHA 4RMVA 2R0KL 3DUSA 2Y5TA 1LO4L 2EDRA 2FEEI 1VKXA 3FB7B 5ISZE 1LP9E 2DRUA 4JO3L 3T0WA 5FKPA 1IMHC 2OLDA 1N3NB 2VDMH 5JNYA 3DO3A 4K71C 4D9LH 1OAZL 4QTHA 3HHRB 1YECL 3VFTA 4KZDL 1NAMA 4WNQA 2DD8L 2QSTA 3PQYA 2NXYD 2XWBB 4GKZA 2GAZB 4KKCD 1BQSA 2VIRB 4FQIH 3V6OC 4V2CB 4GG6E 1JWSA 4QKXB 3QUMH 1NMAH 5D7LA 3MRCA 4XC1H 4MA3A 1C16B 1H3PH 3TWCL 1U8KB 1M6OB 1BF2A 1I75A 5E8EB 2G2RB 5SX4H 5LCVL 2C9AA 4DQOH 1M7DA 4ZNEE 4WTXA 1YJDL 1INQA 4O02L 3P40A 3HZVA 5SWQB 4TSCH 4G6KH 5AYUL 2QQQA 1MFAH 1UXSA 3FMGH 3RNKA 4QRRB 4N0UE 1YEJL 4PV8B 2NZIA 4QXGH 1JJUA 4G7YH 1FYTB 4FFVD 5C9JB 4NCC2 3CFJA 2R15A 4TOYL 3ULUC 2KZ1B 1OM3H 5IMKB 3L7FA 1XGUB 1UENA 5FA4B 3QUXC 1KPRA 1GYAA 3BP4B 4L8CA 4PR5A 1FVCB 3IXAA 4U1KA 5A40E 2M1KA 3ZE2E 3OKOB 4HIXH 2V7HA 2BNQE 4XPTL 5HHXH 35C8L 1CL7L 4EUPA 3SDXF 25C8L 4E42A 1R6VA 4AEIH 5IROC 1NGQH 3BN3B 3VWKC 5ICXA 3QJFB 1U8LA 3G6JF 3KR3L 5I1LB 1OQXA 5JOFA 1RURH 2VZ3A 1BOGA 5DD5H 1AP2B 2I25N 4N9GB 2X70A 5C0BD 4X7DC 2HT2C 5TF1H 3QCTH 4S2SA 5C2BH 1GVIA 1EEUA 4KKNA 5GS0D 5GGSA 2V5MA 4UIMA 5DJ6B 4OLWL 5IHLB 2P7TA 1AKJB 1FL6B 3O0RH 3O9WC 3DSFL 3TBWA 3HUJE 3PWPD 5L8KB 4P4RB 1ACZA 5HGDA 1TPXC 2AEPL 3C8KB 4P2RD 2VLKA 1LO2L 1G7PB 3SE3A 5DT1L 2QSVA 1WZMA 2I9LB 3OL2A 3QZWB 1MWAA 5GZOD 3KPPA 3L3IA 3IDJB 3L7EB 4YXLL 4FG6C 5IBTL 5F97E 1G9NC 5FAAA 4FXGA 1P84J 3ULVC 4PJFF 4JHZA 1I1CA 1JPGA 1DLFH 2YPLD 1RHHA 2EO1A 4JAMA 3PHSA 5IKCB 1AD0A 2ZJSH 5I73B 1CFVL 4KWUA 3B6SB 5AYQA 5HHVL 2AXHA 5IMOA 3UBXI 1JYWA 5JQHC 1E27A 1N5YH 4W4OA 2Q8BH 4OZFB 5F6IB 1UVQB 2CKBL 4OI7A 5IHUH 4WFGE 1SYSA 2WUCH 3H7BB 2FJHA 3QSKB 1NLDL 1F4YL 4WFFD 4OFYA 2XZZA 2KBGA 1T7ZA 5F9OL 3SKMA 1FN4B 3UJIL 5M94B 2VLLB 1CGSL 5HPOA 1T1WA 4TVPL 5AG9A 3AREC 3MLXH 4P3CH 2OBGA 1NCUA 1E4KC 1BWWA 3B9KB 1AFVH 1GOFA 3TO2B 3UTQA 5JHDA 1BD2D 3DXAD 2PTUA 1J5OH 5IMLA 4U0QB 4Q9RL 3V6OA 5HJ3A 4WO4B 5BVPL 5D2NC 4ORGA 1FZKA 4LOUD 1MHEB 2EDFA 3GSRA 1DQLL 3WLBA 4GQ9L 3H0TA 2FX7H 4UT9H 3QFJD 1C1EL 5TDPA 3TH2T 1QA9B 4H20H 1RIUH 3T3MF 3UYRH 4NRXB 2IH1A 4YC2C 1U92B 4P4KD 3MLVL 4CNIA 5JXEC 4BH7B 3BIKB 4AJ0A 1IT9L 1QFHA 2HFGH 3OPZH 3DX9B 1DBKH 1U8JA 2JJVA 2F54A 5DMIL 4YHOH 4HKXB 2UZIH 3DLQR 5T3ZD 3NIFF 5BZDB 3DO7B 4HHAA 3I3DA 4L3EE 1CQYA 4NHUB 4PJIA 1B0RA 1SJVA 2D9CA 3IDUA 3NCFB 5IHZB 4HWEL 1NLBH 4FQCH 3F6LA 4WHDA 1S9YA 4U1GC 3QUXA 4Z0XB 1QG3A 2EC9U 4MDJA 2IPTH 4XGZA 1TIUA 4JM4H 4UZGA 2HLAB 1CCZA 4OZHB 3NCJH 3TV3L 1KV3A 1NBZB 2PYFA 4I18B 5GGVL 3OR7B 5D72L 2YPVL 4ZSOE 3TJEH 5IESH 3Q6FB 5IROA 4PTUB 4X0KA 3VWKA 5CCKL 3LB6D 4QY8B 4JY4B 4Y8AA 5CMAB 3QBTB 1MHCB 3GRWH 2QADB 4W81A 1CXKA 3DX8B 3CLEH 3LDBC 3MRIB 3UTPE 4U1MB 1OAYL 1A6PA 4OM1H 3DROB 4HH8A 1LNUB 3L5WB 1KCUH 1FSKC 2CJUL 5IBUB 4BZ1H 1TQBC 3EZJB 5SWZE 1A5FH 5D1XB 1JNHB 3O9WA 4ELME 4MNGE 2WV3A 3QRGL 3MA7B 1CIUA 1AC6A 3UBXB 3WN5C 3BH8B 4NHCL 1NDGB 3T4AA 4PJ7B 4X6FA 2YRLA 4F3FA 1RFDL 1RZIA 5EU5B 4YUEH 4YAQB 1J1PL 3S4SB 1ZHKB 4UUJB 3ES6B 4ZS6C 2PN5A 1S3KL 5EDXA 2CLVB 2XXMB 4HS8L 4QRQA 4OF6A 4JPKH 1N2RA 2KQNA 4MAYC 2B4CL 1J1XH 4XRCB 2FJFA 4U7KA 2XG4A 3RKPA 4GFTB 5L2JA 2I5YH 3AXLA 3E2HB 4NNXB 2BSSB 5IQ7L 4R26L 1KFAL 3DJ9A 1JMZA 1H0DB 4LLMB 4OIIL 2XV6B 2PYEA 1EHAA 2Y07H 4JO1H 4HC1H 1KBGH 3SE4C 2YD6A 3HI5L 2NXYC 5D71L 1S7QA 4AG4H 4KKCC 4X9GA 4X4ME 1UT9A 3U0WL 3AREA 4FXKA 1E4KA 3G5VB 3IFLH 3VRJA 4Z95L 4ZODA 5FDWA 3QWOA 3QDJD 2NY4D 1GPOH 4NQSA 1UA6L 3QIUB 3IVKB 1PQZA 1S7TB 3NIDE 1REIA 4A6YA 1E4XL 43C9A 5CD5D 5J6GB 3WFEH 4PJCF 1S5IL 1RUPL 3OKNA 3D3VD 3O4OC 3LQZA 5D2NA 1KSRA 1YNLL 5D5ME 3RWEB 2R1YA 4BFIA 3VFSA 3WE6B 2EE3A 3QQ3B 2EIDA 3D1MC 5C9KA 4M43L 1WZ1L 2AJUL 3C9NB 1JGDA 3LEVH 4FFVC 1NEUA 3S5LB 3WJJC 5K33A 2Z9TA 3K8MA 4U6VH 2CO7B 3RX8A 5JXEA 5IUSA 1FNEB 4HKJA 1ORQA 4MJIE 1T80A 4P9HC 3HRPA 3VXNB 3M17A 1M7XA 2WWMD 2FRGP 2YMXH 3MYZA 2FL5A 2YUWA 2WW8A 3QEGL 2BOBB 4H8WC 3RQ3A 2NX5A 4ZS7H 4DZ8B 5DJDA 2EIEA 4C57C 1JUFA 2IAMD 3F7YA 3NFSH 1CFQA 5I16B 4NIKB 4P3DA 3NFNA 4R96A 4Z7VA 5GS0C 2ICWA 3HI1A 2Q7YA 1HXMB 2W60B 3RWHB 1U9KA 1KUMA 1S9KC 1FIGL 3QDME 3IDIA 1RUKL 3EYQD 5E6IB 2BNRE 5IQ9A 5SWSB 4S10A 5JTWA 5C0GA 1SJHB 1J11A 3TZVD 3NABL 2EDKA 3K4DA 4M8QA 3L9RB 4KI5D 5I8KL 3FRPG 3K4ZA 3DRTA 2CK2A 3CXDL 4R8WL 4YHZL 1OSPH 2ICEA 5GZOC 1RUML 4JN2A 3TNNB 1AE6H 3BAEH 4RRPG 4PG2C 1MJ8L 3WN5A 3MRPA 4AM0A 3WUWB 3T08A 2BVTA 1EH9A 2ESVA 3EO0A 3DIFA 4M62H 4RQQA 1L4IA 2H6PB 4Z78B 5CZXD 1D5XA 3D2UD 5JW3H 1G7MB 1ETZA 4OV5A 4BFEA 1F58L 1KENH 3BW9A 2WQRA 1OARL 1NUNB 2NNAB 2VLRB 1G7HB 1PKQB 4IOIA 4X98A 5FK9B 4MAYA 3E0GA 2DMBA 1FO0B 3LMJH 1Z6JT 5B38G 1MNUL 4OF5A 1LK3L 1VACA 2VLJB 1M71A 2WBWB 3BZEB 1YYML 4XNYL 5FUCC 2FX9H 3HKFA 4OLUH 4QF1A 3QISA 2J88L 3OXRB 1HQ4B 4H88H 4I3RL 3VFUA 1RIVH 5IIEA 4Q2ZB 3KG5A 1JTPA 4FMFA 4ZFFA 4OQTL 5D70L 3TBVB 1KLUB 5FECA 4OZIF 3HC0B 1XF3B 1HILB 3SE4A 3P4LA 2EDQA 2A73A 2E8YA 3HAEG 5DVMA 1JI1A 3TT1H 1TTUA 4G8GD 2MKWA 3AM8C 1MPAH 4LOUC 4Y5VB 5FHAL 4QXWA 1R3JA 2YZ1A 5CSZA 2R2HB 4K2UH 3NOIA 2XTJB 3VI3F 3S34H 5DFVD 1CE1L 2CUHA 5DD0L 2R69L 3U9UA 1X5KA 4XPGL 3HZKA 5F9DC 1FL5A 2XQBL 4FZEH 5IB2A 3V5KA 4ZOCA 3U4AA 2WNGA 3OKMB 4P4KC 2F74B 4P57B 4PRPB 1ADQA 4QRSA 1QRNE 2Z93A 3O41A 3TVMB 5GGQL 5A2FA 5DMKB 5T5FL 3QP3A 4JRYA 1JNLH 3S96B 5I8CA 1IILE 3ARDD 4TRPL 2RGSA 4GXUN 3TPUB 1VA9A 4LLUA 1S78D 3H9SE 4RNRA 3DMMD 3WJJA 2BNUB 1F8TL 5ANMA 1RK0A 1EX0A 4G9DB 4OZGF 2XZCL 1A7RH 2V2XA 4K7PH 3K1DA 2ZUVA 3RHWF 4HF5L 4HMCA 4HIEB 5IVOA 5GGUA 1RZJH 1IL1A 2NY3B 3LB6C 4R7DA 4NQDE 3UPRB 1OAQL 4PJGE 4R7NB 5LKNA 4MQTB 3UDWC 3QH3B 4HXAH 5J57B 4ZDHA 5C0BA 4YHLH 1WCQA 4AEHL 3WD5H 5BJTA 4S1QL 1F02I 1MEXL 3NAAH 4MJ2A 3MUZ1 1MAMH 3CGTA 4QXTB 2C3HA 2DIBA 3HE6B 3FCTA 5DJ8A 2XFXA 5A16A 5I66B 5L7XL 4LLDA 1CLZL 4OZFH 3VMPA 4HJGA 3IDXH 4JPIA 3MLUH 4O4YH 1IM9B 4CADA 3O2DL 3PWPA 3FRPA 3OQ3B 5D7JD 1JHLH 5IW6A 4AL8H 1DLHB 1DUYB 4P2RA 4G6ML 2Y5TB 4NM8L 3MUJA 1VKXB 3R0NA 3L5XL 3WHXA 2RAMA 1RJLA 5AZEL 2UUDH 1Q72L 1ZLUK 4ZUTB 2IADA 4ODWA 1YQVL 3GSXA 4DK6A 2YPKB 4QTHB 3UZVB 2HP4A 5GGVY 3NCCB 4PG2A 2FZ3A 1G6RH 3VFTB 1NAMB 3GIZL 2CH8A 2FLRT 1NMCC 2YPLA 3DVNA 3PQYB 2VERN 2L7JA 1BPVA 3OKEB 1AQKL 4GKZB 3W81A 2DQCH 4M61B 1JWSB 1OPGL 5D7LB 1F3DH 2ZPKH 4HIJA 2BVQA 4MA3B 3BZDA 3RVTD 3V5HA 2RCSH 4MWFA 3VE0B 5HHQB 3C8HA 4BQ9A 1U58A 4LP5A 4DUVA 5B38A 15C8H 3KXFE 3QCVL 4HPOL 3C5JB 5K9JL 1MCDA 3RU8L 1INQB 5DURB 3HZVB 4XP9H 3Q3GA 5D6CA 4RFEA 1UXSB 3RNKB 2Z8VC 1NCNA 1H3GA 2DN7A 2X4QA 2NY4C 3O3AA 2LAGB 4XPFH 4N5ED 5FUOH 5JUEH 3HAEA 4HWNA 1BD2A 4EOWL 3CFJB 2VR5A 3DXAA 3T1WA 1EZVY 5CD5C 3L7FB 1QPPA 2OI9B 1EHXA 3MNZB 4L8CB 1KC5L 1J0JA 4PR5B 4U1KB 1BFSA 3AM8A 1PX4A 3OB0H 3BESR 2IQ9H 2GTWA 2GYSA 2BVUA 1QSEE 3QFJA 1LO4H 1U8LB 4PG9A 2E27L 2YN5A 5JOFB 3DX6A 2VR9A 2FLBT 4P4KA 4G6FD 4S2SB 1OAZH 4U0RB 1YNTA 3P73A 2ADIA 5GGSB 2OM5A 1CD1B 4NZDA 3VG0H 2PNDA 1CU4H 3F62A 4UIMB 5IW1A 2WWMC 2P7TB 1X5LA 2ZCKH 5DGRA 5GGRY 1OSZA 3SO3B 1HHGA 1DBMH 4EKXA 4RBPK 3S7GA 4RX4D 3HNTL 5GRYA 2OL3A 2ARJQ 4KI1A 2IAMC 3LSOB 1YUHA 1FH5L 1U8NA 4YLQT 5LCVH 5IJVB 1MWAB 3ARXA 3D85D 3KPPB 1JGEA 3L3IB 4BQCA 1F3RB 4ZTPL 3C6SA 1QOKA 1YJDH 1OLLA 4JFHE 4O02H 5KG9A 4FTVE 5D8JL 3JV4A 1RULL 4FXGB 3UDWA 5AYUH 5JA8B 4Q0XL 1EBPA 1SQ2N 3FB6A 3EYQC 2LVEA 4PJBE 1RHHB 2PUQT 4ONGL 1YEJH 4JAMB 3TZVC 3FQXA 1AD0B 4KI5C 1X5XA 2ZUXA 3VXPA 2E9BA 4MSWA 1JRHI 4X6EA 5IMMA 1BQUA 5IMOB 1W2KT 3LEXB 1E27B 1KB9K 1MCWW 5L6YL 1T89C 2AK4D 4YHPA 5E9DD 1E6OL 1QUNA 2NY6D 1H3XA 3QG7L 3SQOH 1SYSB 4XPTH 1GZQA 4UBDD 4S0SD 2FJHB 35C8H 4PJEF 25C8H 4OB5H 5I1AB 2ITDB 3SKMB 2SEBA 5CZXC 3KR3H 4MD5B 4F7PA 4WEMB 3MBXH 4K71B 2NY5H 3FOLA 1T5XB 2DBLL 3SKNB 5FO8B 3UTQB 5JR1H 5EU4A 4L3ED 5DHXB 3NGBB 5DEFA 2ZUWA 4JKPL 3GMMA 2MWCA 1TENA 3JUZA 3SPVA 3CX5J 3K2UH 1ZT4B 4MNQE 1FZKB 2D7TL 4TNWK 4F2MB 4P3WA 2AEPH 3SGEI 3GSRB 1K5NA 2FWOA 3WLBB 4UILH 3H0TB 1VCAA 3B9EA 5KS9F 4P0DA 5TDPB 4HWZA 5C08E 4JHWL 3KLHD 3GMPA 5I18H 1XGQA 4CNIB 5IBTH 4XP5L 4WU7A 2IG2L 3DURA 5KSAB 3IJSA 2Q8AH 1U8JB 2F54B 4RGOH 3GBML 3UTPD 4GBXD 1OAXL 3CDGB 4HHAB 5M95B 1IQDA 3LPGA 5DFVC 1LE9A 3ZKND 4XVSH 3EYSH 5F3HA 5GRUL 5IB5A 1H15A 1CFVH 4PJAA 4PRDA 1NL0L 2P44B 5B8CC 1KJMB 4OIAA 4NKDA 1S9YB 4LLWB 3QUXB 5GGTL 2QQKL 3D3VA 4U1SA 3EJZD 4XGZB 4N1HB 2ZNXA 1HZHL 4JZJB 3MRHA 3OKDA 1BM3L 2EDBA 4WW2F 2PYFB 3U1SL 3IDGA 4QHKI 1F4YH 4JFFE 5JLZA 1CXHA 5FM5O 2X89D 4X0KB 3VWKB 3ARDC 5SX5K 1PKOA 3VD7A 1S78C 2JCCF 3UJIH 3IDNA 1CGSH 3DMMC 4GKNA 4TVPH 5DJ2A 4KJWD 5GRVK 4M48L 4KQ4H 3V0AC 4XXCC 5ID0A 1CD0A 2VZTA 4DN3L 2YD1A 2IFGA 3ALPA 1WSST 1NFIA 2KH2B 4YPJA 3SCMA 4Q9RH 2XN9D 1BQHA 1PAMA 1OQOA 3JTTA 4NRZA 3LAFA 3S88H 4DN4L 2ICWI 1TPXB 1M05B 2H8PA 1NEZA 4GAJH 1FLRH 2A1WH 3BI9X 1DQLH 3DBXB 1I7ZA 2IAMA 1MOEA 1P1ZB 3EYFA 4FQ2L 4F3FB 1RZIB 6FABL 1O7SA 3GHEL 1A1NA 4P2QE 5EC2A 3MLVH 4QNPF 3T2PA 2H9GA 1F97A 1IT9H 5CZVH 3SDDD 5DMIH 5D7JC 1N2RB 3IFNL 2DQDL 1TXKA 2XICA 3KLAA 3TZVA 3VFRB 3ZE0F 5B3NA 2FJFB 2CXKA 3E8UL 1NGYA 4HWEH 1MFCH 5DJXA 2QJDA 1T7VA 3AXLB 1T89A 4Z7QF 3FTGA 3VGFA 5C70A 1KTRL 3WFBL 3F8UB 4ZUSA 1B3JA 2JIXB 4JANA 2PYEB 2BRQA 1J0ZA 3DI2B 1YNKL 2I24N 4NKIH 5D72H 1SEBA 3KYKL 4U2YA 3NA4A 3CK0H 3GKZA 1QSFE 1FVEA 1JZ7A 1FNHA 1S7QB 1XR9A 3D2UA 4HDIA 3X3FL 1TNMA 4C83A 1G7LB 4HMEA 3AREB 5DZLA 4FXKB 1TVHA 4XCYB 4KRPD 1R3HB 3RVTC 5JIIA 3VRJB 2ENSA 3LVEA 4Q7DA 5FDWB 5MENE 3QWOB 4CBPA 4NQSB 2KPNA 1OAYH 1PQZB 2H41A 5D9SA 43C9B 5E6YA 1R0AL 2ED9A 5C7XL 3LQZB 5D2NB 5B3JF 2VDPH 4R6UA 3J8F7 4YNYA 4GMSH 3FB8A 4GJTB 4N8VG 4OTXL 4PJHE 4OIBA 5JHLH 1MAJA 2R1YB 4BFIB 3RWJA 3PV7A 3VFSB 5FDYA 1T20A 2AEIT 3EOBA 4UV7H 4N5EC 1RFDH 1JGDB 1QKZL 5FCSH 5IOPA 4J3SA 4WI3A 5HHOE 1NCCH 2AEWA 1OP5H 1AIFA 4LEXL 3GO1L 4RFOH 3ZKXC 1EAPA 4HKJB 1ORQB 1X6LA 4IS6B 4XNZC 2WIIB 4NQCE 1JI2A 4UINL 5LQBL 5TQ2L 4HCRL 5BMFL 2B4CH 2FL5B 1W0WB 5B8CA 4X7SL 3HC4L 5GRJH 3BZFA 1P4LA 4U1GB 1JGVH 2PR4L 1A1MA 4WI9A 4A2LA 4DVBA 5DJDB 4R26H 1KFAH 5ID1A 1CFBA 1CFQB 5E2WL 3UEZA 4P3DB 3NFNB 1RZ7L 3I75B 4NBZB 4R96B 4Z7VB 4EXKA 2ICWB 3HI1B 2Q7YB 1LMKA 4P2OD 2A6KA 3RWGB 2R4SH 2BHZA 4CL7A 5D71H 4WRLA 1NFDE 1MCEA 3DMMA 4GH7B 3U0WH 3O81A 3QEUA 3PDOA 5IQ9B 4I9WD 3NCBB 5C0GB 1A6VH 4Z95H 1HHJA 4M8QB 4XXCA 1DQML 4OGXL 1UA6H 4DTGL 3LPWA 1HSBA 1E4XH 1FSKB 1LP9A 2ICEB 3VFMA 3GBLA 1S5IH 3UP1A 1KPVB 3U9PL 5I9QC 4XNUH 4PY7A 4QCIA 3O3DA 3WN5B 3MRPB 3BJ91 4YXHL 2YD8A 2ESVB 3EO0B 1VPOL 3DIFB 1AGBA 4RQQB 4M43H 4IRSD 2AJUH 4XAWH 1ETZB 4XMLH 2E6JA 3BKML 3BW9B 1IAIL 2HH0H 2FHBA 2GW5A 1GCFA 4J4PD 3EOAA 2NY6C 3OHXB 1FJ1A 4IOIB 3QDGD 3HFML 3I85A 4X98B 5D7JA 5IVZA 3UTTE 4MAYB 4UBDC 3QO0A 5F6HI 2HWZL 5HHPA 2QKIA 4YBLB 5GGRA 4K7PX 5DK0A 3N85H 4Y4HB 1UC6A 4J3VA 1VACB 1QLRA 3FONA 1A14L 2VKXA 1WBYB 2GSIA 3EJYD 1CDHA 5SV4A 1CDBA 2X41A 4QF1B 4Y19E 3VFUB 1EEQA 2QTEA 4PGBA 5IIEB 3U4BL 4U6XA 3IFPA 4GG8A 2W9EH 1XCTA 5CJOL 3CMOH 3F6IA 3SGDI 1A2YB 2B1AL 2DIJA 4Z7WF 1R3JB 5KJRH 5GS3A 2V2TA 5MP6L 3AAZA 1YA5A 5C3LD 3IT8D 3RL2A 3HZKB 3V5KB 1LE5A 4R8WH 3KLHC 4YHZH 4N8VA 3O4OB 2WBJD 3MA9L 3OWEA 4MMXC 2G5RA 2Z93B 3O41B 3FO0L 4CU6A 3VMOA 4GBXC 4JRYB 3O6LH 5I8CB 3UPCA 4OFPA 3ZKNC 4ETQA 4LLUB 4RNRB 2Y6SC 5HVFB 1OARH 2HVKA 1RK0B 4L4TD 3EJZC 5CIPB 5GISH 2IBZX 2YRPA 1KACB 1QHPA 1ZVHA 5FGCE 3EGSB 1MWAH 2C3GA 2YD2A 3F58L 5DVOA 5GGUB 1VEOA 3T09A 1IL1B 1MNUH 3O4LD 3ZDYE 2UYLA 1LK3H 3BN9D 1W0YT 4FABL 4LHUG 2BC4A 5IVXF 5EOCJ 3LQAC 3ZKSD 2P49B 4O2EA 4XNYH 4QXUL 3UTSD 1WBZA 3SKOA 4ZDHB 2CRYA 4KJWC 1FYTE 5BJTB 1V3MA 2HKFH 2CUMA 4WEUD 3MXWL 4OJFL 2ADGA 3FCTB 4KTYA 5DJ8B 4KXZI 2XFXB 4OQTH 5D70H 3TIEB 5HYFA 3D0LB 4LRNL 2DQHL 4GS7C 2DYPD 4JPIB 2DQIH 5GRXG 4LCCB 5IF0A 3SDCD 4CADB 3BGAA 3VXOA 3PWPB 4IHOA 4PV9A 5FHAH 4RX4A 2YBRB 2ADJA 5EUOF 4AENB 4P2RB 3S3JA 1CE1H 1V8HA 1L0QA 4V1DE 1FE8L 5E8PB 4XPGH 4NKMA 1CG9A 4RMUA 2IQAA 1RJLB 5DZNA 3WHXB 3WYRA 1XF1A 2EIZA 3D85A 4XMKL 3S37L 2F5AH 2IADB 3OAUL 4ODWB 1U8HA 1BJ1H 3GSXB 3V6FA 5DJ0A 3O6KL 1WIOA 3SDDC 1A9EA 5GGQH 2FZ3B 1DFBL 2YPLB 5HVGB 3DVNB 4CKVX 3ROOA 1KOAA 1MRCH 5J13C 4PJDA 3P0VL 1UKTA 3F5WB 1A6AA 1R5WA 4K9EL 4QO1A 5E8OA 1IGIL 1EIBA 2BVQB 3MJ9L 4G7VH 4HIJB 1E28B 2DM3A 1PEWA 3V5HB 4MWFB 3OAZK 5TDNA 2OR7A 1U58B 2AK4A 5E9DA 3TCLA 5B38B 1JZ4A 3KGRA 2K7PA 5FEBA 3ARPA 1YY9D 3VH8G 3VD9A 3MV7B 4C54A 5F1KC 4ODUB 5CLWA 1DSFL 1OAQH 1G1CA 1RIHL 4LIQH 3Q3GB 5GJTL 3RIFK 1OTUD 1UH3A 4RFEB 1QLEL 1L7TL 2R1XA 4KRPC 4P46D 2X4QB 3O3AB 4L3EA 3HAEB 1LQSR 1D9KD 3DXAB 5L7XH 3Q48A 4X6DB 1XIWD 5ELIA 1QVOA 1Z9MA 4J8RA 5HDBF 1Q8MA 1MCJA 2RHEA 2X2YA 3O2DH 3MJ8B 4LSPH 2GTWB 4UV4L 3UAJD 1T0NA 2E9IA 4JRXD 1U6AH 3QFJB 5DWUL 4YHKH 3IF1A 4PG9B 1N4XL 5AZEH 3DX6B 4U1NA 3CXHK 1QSZA 2NTSP 4FTVD 2ERJC 4P4KB 2Y72A 1YNTB 3P73B 3MOQA 2ADIB 1MHHA 4I77L 4DW2L 2GITB 4GBXA 4NQUA 4TPRL 5IW1B 1CTNA 4EIGB 1OSZB 2H2SD 4OLVL 3A0OA 2OZ4L 1HHGB 1JZ2A 1JRHH 4Z7UF 1OPGH 1G1YA 3ZDXE 2D4DA 3X3GL 1S7RA 3LV3A 2E7MA 3V7MA 2OL3B 4ZO8A 4P5KA 1UWXH 1U8IA 1YUHB 2AV1A 1IAOA 4HFUL 3KS0J 3U7YL 2C1PA 1U8NB 4YX2H 3V6BR 4M9PA 1F3DJ 1DANT 2Z8WC 3QCVH 4XT1C 1JGEB 4P2OC 2X89A 1N8ZA 3C6SB 3DI3B 4R2GD 5T1DL 5K9JH 1P53A 4KAQH 3ULVH 5KG9B 1T7YA 1F45A 2YUXA 3JV4B 1N5AA 3FB6B 1J7VR 4XZUA 2G60L 1I8LC 2XA8L 3FQXB 5L88H 5TE7L 3VXPB 4MSWB 4EOWH 1JNNL 2BVYA 5FB8A 3ARBD 1TCMA 3HNVH 4K3HA 1DL7L 2DI7A 2XN9A 2HRLA 1KC5H 1XT5A 2OMBA 3MGTA 4YHPB 2AQ3A 2X4UB 4LAJH 2RQ8A 1GZQB 5HGGS 4R4BA 4DOHB 5EZJA 1T1YA 3NTCL 4FRWA 2OTWA 2SEBB 4IRSC 5ITBH 2E27H 4F7PB 1MVUA 1SEQH 1KPUA 4FHBD 2D3VA 3FOLB 1OGTA 1NMBH 4OZHF 4M7KL 3GHBH 3SDDA 3VRLF 3S98A 4J4PC 5EU4B 2Z91A 1BAFH 5DEFB 1NMCB 3GMMB 4JHBA 1SM3L 2P5WE 1DBJH 3SPVB 3MRQA 1IBGL 3UC0H 2CLZA 3G6DL 3G9AB 4FS0A 2DLHA 3EJYC 4C58B 4TN9A 3K7UA 1QYGH 3BEVA 4PJ7E 4B50A 1K5NB 2FWOB 2H1PL 1BJMA 2YUZA 4G8FA 3VH8A 5L9DL 3EW3B 5DVKA 4JFFD 5C0RL 2Y36L 4HWZB 1S7UA 2VDQH 4BZYA 1J88A 2EDHA 3P9LA 4ZXBD 3W9EB 1A4JA 4Q97A 1XGQB 4WU7B 5H2BA 2YD7A 1RULH 1X5JA 2Z35A 4Q0XH 4JB9H 4ONGH 1IQDB 1RSFA 2C26A 3TP4A 1LE9B 5F3HB 2NY4B 3FQRA 4Q58C 1JK8B 3C08H 1EO5A 2PKDA 5MHSE 2DWEA 4PRDB 1KXVC 2EO9A 4NKDB 4Z6AT 3VFGH 2Z8RA 4U1SB 5FYJE 2XOTA 3HE7D 4O5LL 2WBJC 4KC3B 3C6LD 4NO0B 1K8DA 5IFHH 1S9VA 5E1AA 3QG7H 1IEBA 3IDGB 4HAFA 3GFUA 4FQ1L 3LIZL 2AABL 1NKOA 3TESA 4C4KT 3SY0A 1OP3H 5C0CD 1OAUL 1G9ML 4D3CL 2DQUH 1LK2A 1MCSA 4JQXC 4MDIA 4GKNB 5E4EC 5DJ2B 5BVJA 5EB9A 2DBLH 5F88B 3ZLQC 1JPST 1C8PA 5ID0B 3ARYA 3GSNA 4HIHA 5EPMA 1R24A 3AC0A 4MXVE 2F8XC 5T1KA 2ZUSA 3SCMB 2I26N 3L3HB 3QJHB 4BUGA 2CDFB 1BQHB 3HR6A 2QQLL 4UMGA 4KGJA 2NY0D 4NRZB 3BN9C 1I8IA 2D7TH 3VXQA 1EVTC 2H8PB 3F7QA 5EU6B 3WS3A 1A0QL 3KPRE 3RZWA 1KB5A 1MCLA 3EYFB 5GS2H 2IFFL 1F2XK 4P2OA 5DJZA 1DUZA 1A1NB 5EC2B 1QEWB 3MRFA 4JY5L 2FBJL 2H9GB 2IG2H 4KH2A 3SDCC 3IXTA 1J0KA 1BOYA 5CEZE 3BRGC 4ZTOL 1I8LA 4YWGH 3TZVB 4OFVA 4D0BB 4H1LG 4NZUH 4UB0L 5E00B 5GRUH 3QNXA 3O6MH 3P11L 4CMHC 5I76A 1NGYB 2OXGA 5DJXB 3BVNA 2J7LA 4MGXA 1UGNA 5GGTH 2QQKH 3JSSA 1BZ9A 3FTGB 3FL7A 1FCCA 5ECJE 2EDWA 1BM3H 2QL1A 4UDUB 4ZUSB 2WLYA 1TJIL 4JANB 3U1SH 1U8MA 1SEBB 2ZCHL 4KUCD 1PFCA 1FVEB 4JM2D 1BWMA 4IRSA 1XR9B 3D2UB 4WUKL 1ZGLM 5SWSE 4C83B 3D39E 2E9JA 1TVHB 2IBBA 4LPWA 4M48H 5F7HA 3P4NB 4J4PA 1GSMA 3GMLB 2VABA 5ACMA 3QDGA 4LARH 5D9SB 4JDZA 1JFQL 1YY9C 2P8LA 1DN0B 1Q9LA 4PJXE 1F42A 5EA0H 3FRUB 1DBBL 1HHKA 4U1LA 1HQRA 1N6QL 5E8DH 2VDKH 4DN4H 1OTUC 4LSSL 1X6NA 3RWJB 1MIEL 3D6GA 4P46C 7FABL 4O2FA 3VI3E 1T20B 5E2UH 3LZFH 4JDVA 3EOBB 4MD4A 4KKAD 1VGKA 6FABH 5IOPB 1D9KC 5CIPH 4F9PC 1XIWC 1AIFB 4AZ8A 4P9HH 1EAPB 4U05A 3FN0H 2ZP0T 1AR1D 3R06A 1U3JA 3IFNH 3TJHD 2P5ED 3UAJC 4OZ4A 5FYLD 1VFMA 4XP4L 1I9IL 4H8WH 4U6YA 4F37F 3SBWC 5DK2A 5B8CB 5BO1L 2V6HA 5SV3A 3BZFB 4TUJA 1A1MB 3X17A 2WBJA 2CSPA 3KPSD 4PJGA 4DVBB 1A9BA 5D4QA 5GS0H 5ID1B 3DX7B 5J1TC 2PTTA 1PVHA 4GAYA 1YNKH 4PGJA 2A6KB 4RMQA 4CAGA 4D0DA 3O3BA 4JQXA 3SHSA 3BKYL 4YPGA 3X3FH 4CVUA 5LVEA 5ILTH 1KULA 3LKSA 3PDOB 1SVZA 3QEUB 4L4TA 3EFFB 1HHJB 2IWGA 3DOSA 1TVDA 3D18A 1NQBA 4X7TA 2VOTA 1HSBB 5ISZB 4PJ5E 1LP9B 1AI1L 3VFMB 3ZE1F 4PRPE 3O4LA 1TLKA 1IVLA 4R2GC 3QUYD 4RA0C 1WGOA 5EG6C 1PBYA 5C7XH 1G84A 4NQED 5JPMA 1A6UL 3B5HA 4PY7B 4QCIB 3UO1L 3V0VA 4OTXH 3O3DB 2XWJA 2XY1A 3GDBA 3UTSA 5DA0B 1NAKL 4ONFH 1R3KB 3BISA 5I15L 2O5ZL 1QKZH 1IGCL 3MCLH 1R5IA 2J1KA 3ARBC 3MLZH 3AUVA 2DYPA 1A7NL 3SDCA 4NZTH 4H1LA 2C4FU 2R0WL 3EOAB 1FJ1B 4LSRH 1TZIA 3K4AA 5IVZB 3H3KA 3ME0A 3CPLA 4UINH 3QO0B 5TQ2H 4HCRH 5BMFH 5DHYA 5DK0B 3TC9A 5GSRA 1CWVA 2DJSA 4JZOA 1FG2A 3FONB 4LAQL 4XVUD 5CJBA 4K55A 2EZ0D 2PR4H 4X6BA 4KVCH 1ZLWH 1GXEA 1TZGL 1OGAD 3E3QE 3HAEH 3NFPA 4M6AA 4N0UB 1UB6A 5D1QD 5ABDE 1U8OA 1CFNA 3IFPB 4U6XB 9CGTA 1QRKA 4M03A 1P7QD 1CLOL 3U4EA 1ZAGA 1OB1A 4XNMA 3EHBD 1TDQA 4APQD 2N56A 4Q6IB 1QR4A 5M7QA 3BD5A 4F15C 2V2TB 4OGXH 1G7JB 4M6OH 3RL2B 2JELL 1LE5B 4PD4K 4ZXBC 4N8VB 3VWJB 4X4YA 5KVEH 1HDMA 1ODAA 3QO1B 4Y2DD 3FT2A 4ALAH 1Y6KR 2UY7A 5T3ZH 3BO8A 2LU7A 4P46A 4WTZG 1VPOH 4XBGB 3S6CA 4ETQB 1I9RL 5EZOL 3WIHL 1UM4H 4KXZH 1D9KA 1FBIL 3UPAA 3BKMH 4Q9QH 4XWOD 2HVKB 4F9PA 1XIWA 1FFOA 3U79A 3PG2A 3C6LC 2ZNWA 3ZKXB 1KB9J 2QV2A 4XNZB 1FORL 4PGCA 4O9HL 4MQ7A 3RAJH 4V1DD 2HWZH 4JRXA 2G5BB 3CVHA 5C0DA 3GB7A 4YK4B 2B0SL 2UYLB 3SBWA 4JVUA 4XVJL 2UV3A 4MD0A 1TCRA 2DWDB 5C09E 1HEZA 4FTVA 1WBZB 3BPCA 3QXAB 1SYVB 3SKOB 5CAYB 1EO8H 4G6FB 2GJ6D 4PJBA 5F7WC 1QO3A 1S7WA 4M3KB 2X7LA 4KY1H 3U4BH 3C09C 4XCCH 5CJOH 1C12A 3LD8C 3V4UH 1H8OA 3MTRA 1ZSDA 5IF0B 5HBBA 5F8QC 2AI0L 4JFDD 3VXOB 2NY0C 2B1AH 4IHOB 1P9MC 4PV9B 4JGJA 3VD4A 2ADJB 1CF8L 5T33H 4FQXD 2Q1EA 4NKMB 1CG9B 1B2WH 2IQAB 2J8UE 4Z7OE 2XKSA 4QOKD 3WNMA 1U8HB 5I9QB 5DJ0B 1T1XB 4WFEE 4YR6B 4HUUA 5EZIH 1JVKA 1A9EB 4JDTH 1HINH 1F3JA 1EMTL 3MV8E 5IV2A 1OCWH 5DJCA 3ROOB 3T65A 3VFVB 1D5BA 3DGGA 4MXQD 1A6AB 1G0XA 1PG7H 1R5WB 5E8OB 3JVGC 3ARBA 5E8NA 4MNQA 1MCWM 2RJMA 2VLKE 5TDNB 3R8BB 2I07B 3TYGL 1QR1A 3TCLB 4UDTA 4KRNA 5DC0A 2H3NA 3F58H 1I1AD 3REVA 5T3XL 2LABA 1T0MB 2Q76A 3NZHL 5IJKC 4W6YB 4JM2C 1HNFA 1HIMH 4QRUA 1KCVH 4M4RA 4OCRL 1UWEL 4FABH 5EOTA 2CPCA 3B2VL 2IC2A 3RZCD 5DFWH 1FPTL 1HYRC 2C1OA 3QHZL 2R1XB 1PYWB 4WHTA 1LHZA 3QIBD 2AJYL 4LLAA 1CN4A 2ZOLA 4L3EB 4B53A 1LO3H 4M7LL 1I7TA 1LILA 3PGCA 4LRNH 4Q9CA 4J8RB 4Y88A 3ZHKA 4RSVA 3FFCD 2K1MA 1U95B 4G9FE 3O11A 3NA9L 1OAKL 3FO1A 1XGTA 3LKOA 5F7LB 4JFFA 2BDNL 4HSQA 3IF1B 4OD3L 1ZHNB 4KKAC 2EYSA 1U2HA 3DVFA 4GKSA 4ZXBA 1URLA 4NZRL 4U1NB 2F53D 3I2CL 5KVDL 1NDMA 1TVBA 3S37H 2DI9A 4YJZL 5EU3A 5JHDE 2ZUUA 4WTZA 4EI6B 1CTOA 5F7FA 3CJJA 1G0DA 4GBXB 3QDHA 1AR1C 4RDQG 2DKUA 3BGMA 3TJHC 3V6OE 1OD9A 3LOWA 4XX1E 3MYJB 4OCWL 5SWZB 4OGAD 3FFDA 4MNGB 3RUGA 1S7RB 3LV3B 2EEDA 3H42L 3C6LA 4E0RA 5F21B 2EH8L 4HZLB 5IP4A 4LSTL 1TZHB 4G80A 3Q5OA 5HYJD 2CUIA 4KVNH 4J6RL 5L0QC 3H3PH 1CBVL 1FVDB 1V3KA 5AZ2L 5C0CA 1N8ZB 1FP5A 4HZAA 2VXUH 4F8TA 3TFKD 1DSFH 2AXGA 3GIVA 3KYOA 1N5AB 1QLEH 1K3ZA 4PJIE 2BSRA 4XZUB 1WWCA 1JHKH 2UWEA 3IRZA 3ULUE 2GEEA 1J10A 2CR3A 5JW4R 2P48B 3MOBL 2PTVA 4GS7B 3GMOA 2WINA 3I6GA 2XN9B 3N0PB 3MRGA 3QUYC 4H26A 1IGML 1BEYH 1RJYA 3WNLA 1P9MA 2VXQL 1KG0A 4R4BB 1I3UA 4FMKA 1AR2A 5EZJB 1T1YB 3L3JA 4G8IB 2FGZA 2OTWB 5DWUH 3B9VA 1N4XH 1QSFA 3BYTA 4M5ZL 4WY7L 1A4KA 2ILLA 2DQGL 1MVUB 1S7SA 2I60H 1YN6B 3CFKB 3H9HA 1OGTB 3SDDB 3HLAA 4MA7L 4FFYL 2IPUK 2Z91B 4DW2H 3I9GH 5I6XC 3TPKA 5J13B 5MHSD 3MRQB 2CLZB 2OCFD 2OZ4H 3O8XD 5FYJD 4I5BA 3JVGA 3PWLA 4XVUC 1U91A 3X3GH 2EZ0C 7CGTA 3HS0A 4K8RD 3V95A 5HYEA 4G8FB 3VH8B 1CXIA 3U7YH 5GXBB 1S7UB 5D1QC 4NO5A 3SEPA 3P9LB 5BV7L 4LASH 4U1HA 5IJKA 1A4JB 4JM2A 5T1DH 3EFDL 5CBEB 4NC0B 5H2BB 4UT7H 1NANH 5B3JE 3KYNA 4YIQA 4I2XE 5IK3B 2Z35B 5JOPE 3EHBC 4APQC 4OLZH 4KRPB 2G60H 2MSPA 5DD1L 3WFHA 4NQCA 1MCOL 3KPQA 1PD6A 5TE7H 4NUJB 2WUBH 4MLIA 3TIDA 3PJSB 2DWEB 1RUAL 1T4KA 2Y23A 1CDJA 5D2LE 2AGJL 4YQXL 1K8DB 1S9VB 4Y2DC 5E1AB 3VXRE 4LQ1A 1IEBB 5MEOA 3KPRD 5JIKA 3B43A 3RA7H 3MCKA 2YA0A 2OR9L 4ZYKA 3NTCH 1LK2B 4NZJA 3F7PC 4MDIB 3RX5A 1CYGA 1KN2H 5BVJB 1NFDA 2ERJB 4XWOC 2M26A 5EWIL 1IGYA 1WCBA 4M93C 1WAAF 5FV2A 4A2MA 3GSNB 4HIHB 5EPMB 1R24B 3VA6A 3FO9A 1SBBA 1UKSA 5T1KB 1SM3H 5D2NE 1IBGH 3G6DH 4I0PD 1I8IB 4LGPB 3VXQB 3KPSA 5E94A 2H1PH 2R0LL 3WS3B 1RK1A 3SJVE 3GGWA 5ACZB 1KB5B 4IRJD 5C0RH 4FQIL 5F9WB 1X4XA 3DVIA 3QUML 3QQ4A 5DJZB 4XC1L 3MRFB 1WQVT 3C5SA 1H3PL 4GSDL 5F9AC 3D39D 3IXTB 4JY6B 4LPVA 5E5MA 4OGZA 3MX0A 2P46B 3MV11 4J12A 5DVNA 4QHKJ 2P47B 4S11A 4XNQA 1BFVL 4DQOL 3ZYIA 4BZ2L 4X6CF 3QNXB 5I76B 1T3FA 5DGQA 2NX5E 3BVNB 5T1MA 3WDJA 3FMGL 3MBEA 4O5LH 1BZ9B 3QUYA 4S1DD 4QXGL 4G7YL 1IGFH 3SOBL 4JRWA 4KDVA 1U8MB 4FQ1H 3LIZH 2AABH 4KTEH 3WEXA 2D0HA 3VDCA 4NQVA 3N9GH 2NY2D 1QQDA 1G9MH 5TFSH 3OX8B 4MXQC 1L0YA 2VSDA 2ICWJ 1KTKE 1JF1A 1Z3GH 5HHXL 1YY8A 1NFKA 4AEIL 2F8VA 4Z7VF 1R3LA 5DUML 1BREA 5DI8A 3GMRA 3WIFA 1I1AC 5DD5L 1Q9LB 1NSNL 1HXYB 4TYUA 1HHKB 5DJYA 4U1LB 1CR9L 1HQRB 2QQLH 3QCTL 1G7IA 4NQTA 3RZCC 2ESVE 4FA8A 1QRNB 1OGAA 1A0QH 4O2FB 3QIBC 4JDVB 4UQ2B 5KOVC 4MD4B 3WXWL 3O0RL 5D1QA 4WEBH 3SDXA 1TTFA 4ENED 2IFFH 2BCKB 3GKWL 1B0GA 1NBVL 1P7QA 4ISVB 3G6JA 3T4YB 2FBJH 4G43A 3WKML 3TA3D 3EAKA 5BS0E 2BFVH 3QA3B 5HGBB 4APQA 1QD0A 3R06B 2VQ1A 3S36H 2F58H 2YRZA 4ZTOH 4OZ4B 4O51A 4UB0H 2VB5A 4U6YB 1UB5A 4TUJB 1RZKC 3ZTNL 4NQDB 4PJGB 1T2QH 1DLFL 1A9BB 3A6BL 2CMRL 4Y2DA 4AEEA 4QGTA 2PTTB 2DMCA 4F7CA 3L5IA 5BXFA 1MCRA 4GAYB 4KJYA 4AEFA 1QSVA 2ZCHH 2LFGA 3CCHA 4D0DB 1J8KA 4JHAL 3ARRA 3IAPA 2IGFL 3O3BB 1IAKA 5DHVH 4YPGB 3L95A 4OGAC 5E4EB 3PWJA 2FNBA 5IHUL 3WIIH 3LKSB 2WUCL 4L4TB 1D6VL 2G9HA 4CVXA 1NPUA 4PJFA 4EVNA 3T0XA 3TH4T 5HVHC 3D18B 4PP1D 4V1DA 5E95B 3MLXL 3PV6B 1DBBH 3TO4D 2DQJL 4YDIH 1AFVL 3VXSD 5JPMB 3DTXA 4KHXH 5JZ7D 4DVRH 3V0VB 3TFKC 1N6QH 2XWJB 5KSVA 3SE9H 4Y89A 3W9DA 5TDOA 3UTSB 1C5DB 2X9WA 2YD4A 2GJ6A 4Y4FD 2D31A 7FABH 4IRZH 2NLJA 1SVCP 4Z7NE 1R5IB 5ANME 4YGVA 5ADPL 3SDCB 4P23D 1YC8A 4H1LB 1HOCA 3Q6GH 2G75A 3EYUH 3CPLB 5EIVA 2DKSA 1KJ2A 5F71A 5AD0A 2ZUQC 1I9IH 1XGYL 5GSRB 4CMHB 5JW5A 3OPZL 1FG2B 2HFGL 4JZOB 5BO1H 3WNNA 1DBKL 4QOKA 3BIAX 5C0BE 4AT6B 4YHOL 2P24A 3KLDA 2GHWB 1QBMH 4X6BB 5IEKA 2D7PA 3NFPB 1UB6B 4L8DA 1Y6NR 2K3TA 1WBXA 1YDPA 1U8OB 1CFNB 5AWNL 1NLBL 4FQCL 4TNVK 4HMDA 5CGYD 5J89A 3L3GB 3QUZD 4HUVB 1D6EB 3PWPE 4LL9A 5ESQA 3U4EB 3O8XC 1OB1B 3W5MA 3PUCA 4XNMB 2W0FA 2DDQH 5DC4B 4K8RC 4ODTL 1AQDA 3KPNA 5FYKE 3GJFB 1QSEB 1GGBH 3EOTL 3H3BC 1I1AA 4M4PA 4X4YB 1FZJA 1RQ5A 5IG7A 3CLEL 1FL3A 1HDMB 2WIMA 5C09D 5FCUL 3FT2B 3O3UN 3WL9A 3RZCA 3BO8B 3FT3B 1VFBB 5F6HJ 4P46B 3FOMA 1KCUL 1NAKH 2Q86A 3QIBA 2V17L 4XPAH 1YYLL 2C3VA 3BEWA 1D9KB 2L7UA 3D87B 1AD9A 3PABB 1FFOB 1A7NH 1PG7X 3FFCA 3M45A 2R0WH 3QIWB 1MLBA 4WFFE 1RHFA 2E6QA 3C5ZB 4MQ7B 4OT1H 4YHML 4LCUB 4JRXB 3CVHB 5C0DB 2AV7A 1HKFA 5IB4A 2A74B 1C5BH 1BBJA 2FB4L 3LQAH 4KPHH 4NPYB 4NWUH 5FFLA 1VSCA 4KV5E 2XKNA 4LAQH 3IDYC 3LRSA 5EC1B 1TCRB 1HEZB 2F53A 4FTVB 4RGMB 4E41D 1TZGH 1KCLA 3MV8D 4PJBB 1UEMA 1BD2E 3ETBF 2J6EA 1QO3B 4PRNA 4I1NB 1LDSA 1FGVH 1LDPH 2I5YL 4LPUA 1ZSDB 2GJJA 4N0FA 1U8QA 1XFPA 4I0PC 3IYLW 3LKQA 1VGEL 5I1DA 5JW4M 2XXCB 1KBGL 2D7MA 3KWWB 3SDAD 5HYJA 4GRWE 4IRJC 2JELH 4RMRA 2D03L 1T66D 4X6DF 3AS0A 1W0VA 2XT1B 1I1YA 4R2GB 1J86A 3IFLL 4HUUB 1GPOL 1F3JB 5TF0A 3MMEA 5IV2B 4DUWA 5DJCB 3LEYH 4L29A 5IVNA 1D5BB 5I2IA 1FBIH 3P77A 1DJSA 5E8NB 4MNQB 4NC1E 4L9LC 4G9FD 3VFWA 3CNKA 3O45B 2P8PA 4N0CD 4S1DC 5E08L 1QR1B 2R0ZH 4UDTB 1W72A 3LEVL 4O9HH 3REVB 4OD2B 5C08B 2Q76B 2H26A 2NY2C 4NOBA 2NTFA 4QRUB 2B0SH 3B3IA 3FT4A 3GSUA 2C1OB 3UXFA 1PZ5A 1FFNA 1EFQA 5HI5D 3L5HA 2ZOLB 2IALB 3MROB 3HA0A 1RUQH 1I7TB 2CGRH 3PGCB 2R39A 4GAGL 5HHMD 4J1UA 5D93C 3PGDA 4JFXA 2AI0H 4HWBL 3I6KA 3NFSL 1KELL 3JWDC 3O11B 3NIGE 5DQDL 3PHOB 3FO1B 1XGTB 2MCG1 3LKOB 4F15B 4JFFB 4FQPA 3BKJH 4BA8A 4GKSB 4ENEC 1BP3B 1WTLA 3HZMA 3VXTB 1NDMB 1TVBB 4LVHB 3D25A 5EU3B 5KVGH 3KPLA 1CDCA 3TA3C 4M1CD 1HCFX 2EECA 3NH7H 5CP3A 1OTTD 3BGMB 1OSPL 1BZ7A 1V3JA 3V6ZA 4Y5YC 1DCLA 3ARGD 3FFDB 4KROB 4X4XA 5I8OL 4WHCA 2CRMA 3C6LB 1KB5H 5ICYA 5HYIA 2C3WA 4G80B 4M62L 1WF5A 3KPRA 1JHTA 1S5HA 4MXWL 4Y4KD 2PO6B 4ZUUA 3NCYS 3RIAF 1Z9LA 5ALCH 3CC5A 4LVOC 4HG4J 5EOCL 3B2VH 3GIVB 3KYOB 4XPBH 5GS1B 4GRMA 4EI5D 1SY6A 4X83A 1FPTH 2BSRB 3QDJE 3OBAA 2FH6A 4PJAE 2AJYH 3LMJL 2D7QA 1CS6A 4ZPTA 2ID5A 2C3XA 2QSCH 1K4CA 4PP1C 3C09B 1RJZA 3D3VE 4XCEB 3LD8B 3GMOB 3ZDZE 2WINB 2FX9L 3I6GB 4OLUL 4PLKD 2GUOA 3TO4C 3FHAA 3MRGB 4I0PA 4Q9BA 1FG9C 2NY0B 5BOPA 4H88L 5JZ7C 4NM4L 3NA9H 1OAKH 5EBGA 3DHMA 1KG0B 2YD9A 4D8PA 4X5WA 4Y4FC 5C6PB 1JYNA 3NZ8A 4IRJA 1MFBL 1CGVA 3MRLA 1U8PA 5E7FA 2Y7QA 3TT1L 1QSFB 1W8OA 3EIFA 3N1PC 5LAXA 5JDSA 3HG1D 1C7TA 4NZRH 1MPAL 5KVDH 1S7SB 5K93A 4K2UL 4XVTL 3H9HB 3U0TA 3D39A 5FGRA 4P23C 1RU9H 2Z31D 4X9BA 5MENB 1K3IA 1K4DA 4FZEL 1EZVX 4OUUA 2HA1A 5HTSA 1Q0YH 4CU8A 4Z0BL 4OZIA 4CDGC 4I5BB 1WFUA 2W0LA 2XQYK 1U91B 3PE9A 4MNHA 4L9LA 3HS0B 1KTLB 1JN6A 1JNLL 3QAZC 4QRTA 4L1HA 3ZT7A 3MZGB 1N64H 4LSTH 4Y7MA 1MI5D 5FO7A 2ZUYA 4NO5B 2XIDA 4U1HB 4NFCA 1DQDH 5CGYC 1WT5A 5AZ2H 1VEMA 4JM2B 3BXNA 3QUZC 5FO9A 1A7RL 3E1F1 4K7PL 4QYOA 5C0EB 1MELA 3CFBA 4KI5E 3SKJL 4NQCB 4IEFB 2FEEL 3O2WH 3KPQB 4P49A 4DKAA 3BFOA 1X4YA 3VDBA 3WSQL 4WI7A 3UJTL 3EO1A 1T4KB 4LDLB 2GCYB 5JXAH 3WD5L 3I6LD 3SN6N 4RGND 3WUZA 5I1EL 5MEOB 3SJVD 4OZGA 5IWLC 3WO4C 5I1JH 2VXQH 1TJGH 3JWNC 4IMLA 1ZVSA 3MCKB 1RVFL 3EBAA 4MCZA 4ZYKB 5CJXC 3PWUB 4O4YL 4M5ZH 1QPXA 4WY7H 1BJ8A 2HJFA 1E6JH 1NFDB 2DQGH 3K8LA 3CSYA 3LN5A 5JO5A 5J8OA 4AL8L 4XMPL 1IGYB 3TA3A 1WCBB 3IJHA 3L3OA 3RX7A 1N59A 2FHCA 3FO9B 4EUPG 4U3CA 4I4WA 3R4DA 4Y5YA 1ITCA 1CICA 1Q94A 2MHAA 2X5PA 5DRWA 5HDOA 1HN1A 4HPYL 3VI4E 5E94B 1RK1B 3PF2A 1YEIH 4PJ8D 3HR5B 3I84A 5L0QB 2ZPKL 1MFDH 1ZLSL 2D7NA 3FJTA 2RCSL 1BMGA 4G8GE 4H1LH 3RGVB 2FD6L 4KHTL 3QR2A 2VKWA 3THMH 3CVIL 3EYOA 1WIUA 1FNAA 4XNQB 2BMKA 3UTTB 5DD1H 3RKDD 1MCOH 2YK1H 2X1PA 3MJGX 3S36X 3SDAC 1T3FB 4BFBD 3BQUD 1T66C 1ZS8B 1KTDB 3MBEB 3TO4A 4JFOA 3QWQB 2AKRA 5E2TH 4EDXA 4XTRD 2IAND 3PIQA 4Y19B 5JUEL 1GGCH 3GM8A 4HUNB 1DR9A 2WBKA 2IMMA 5DEZA 2OSLA 4DKEH 3ISWA 3WEXB 1XMWA 4NQVB 4Y4FA 1QQDB 1EPFA 1CD9B 3TNMA 1MIMH 1U42A 5BS0D 2IQ9L 4ZUWA 1YPZF 5FGSA 3K46A 5EWIH 4CW1A 3GJFH 3HMWH 4P23A 1R3LB 4N0CC 4LPTA 3HZYA 1UFUA 5FM4A 2WAHA 5DI8B 1C08A 1ZANH 3Q2CA 1YEDA 4UOJA 1XGPB 1B90A 5K59F 1KT2B 1G7IB 5KTEL 2OS7A 3S8WA 3U2SA 4MMZC 4EBQL 1JZ8A 3VG0L 1NGXA 1CU4L 3BWUC 5GIRB 1VENA 2R0LH 1OGAB 2ZCKL 3UYOD 3W82A 3T0BA 5HI5C 5D1QB 3SDXB 3KYMB 1DBML 1LP9F 1YN7A 3V0WL 4TQEH 1B0GB 1P7QB 1G0YR 3QUZA 3G6JB 1IC4L 1YEEL 4G43B 4GSDH 4TSAH 3RFZC 4XX1G 3GNML 4L3CA 1KGCE 5DRZB 3WFCL 2QHRH 4APQB 3CVHH 5FGCB 3QQNA 1E4WH 4U49A 1BFVH 2Y06H 4N8CH 4O51B 4BZ2H 5CSGA 2VDLH 3HB3D 2WM0A 5KN5A 4GG6F 1AGDA 1UB5B 4O2CA 3PP3K 1DANU 2APXA 2X05A 3ULSA 5C09A 3OJDB 4XHJC 3D0VA 1XAUA 4P59L 2C7UA 1MJUL 4M1CC 4F7CB 1EDQA 5BXFB 3SOBH 5IWLA 2EDLA 4KJYB 1OTTC 3S35H 5J56B 5GSVA 2DM4A 1NUFA 1AXIB 1KIRA 3CCHB 5CJXA 3D9AH 4AK1A 3ARTA 3ARGC 3L95B 5GJSL 3PWJB 3SQOL 2BVPA 2CXGA 1MH5A 2X09A 2HN7A 1VEPA 4RWHA 2G9HB 4M93B 4OB5L 4CVXB 4PJFB 4EVNB 5J12B 5DUMH 4PTTB 4Y4KC 4V1DB 4ZFOA 5BQ7B 2V9TA 4YDVA 3MBXL 1NSNH 2J8UA 2R8SH 1LEGA 2NY5L 1CR9H 5A1AA 1ZTXL 4MB4A 3DTXB 5D7SL 5JR1L 5KSVB 3ZE2F 3W9DB 1BVLA 1SJXA 3JWOC 5TDOB 4EI5C 4NN7C 2JF1A 5E03A 3EYVA 4XCNB 4E41A 2GJ6B 5CP7A 3MZTA 3MV8A 1A64A 1NC2D 1UH2A 3C87A 4YBHA 2NLJB 3K2UL 3WXWH 4PJEA 1AKJD 2KQMA 3ILQD 2AXFA 4YGVB 1VFAA 3GKWH 1NBVH 4PLKC 4M5YL 3WKMH 1IAIM 1XH3A 4UILL 1AH1A 3ZKQD 4ORZC 4MB5A 5LGKA 4HGWA 2G75B 4K94L 5FYKD 2VZ1A 3SE8H 5I18L 1MFEL 1MQ8A 5AD0B 2Y25A 3SDAA 1ROWA 5JW5B 2DMKA 1MJ7L 1HKLH 3L3DA 1NJ9A 2Q8AL 3HUJF 4QOKB 3ZTNH 4RGOL 3QG6A 2P24B 5CEZL 2DJUA 5IEKB 2MQ0A 1HNGA 3A6BH 1OP9A 2CMRH 4XVSL 3EYSL 2Z31C 4L8DB 1WBXB 3BP5B 1MVFA 3ORJA 2Y9RT 5KS9A 2R2BB 4JHAH 5ESQB 2IGFH 4LCYB 2W0FB 3VRIA 1MY7A 1NCDL 4G9FA 1INDL 4PGEA 1D6VH 3ESUF 1IEHA 3EDJA 5LGJB 1AQDB 3G6AA 3KPNB 1LO0L 3WHE1 4DCQA 3X13A 4WU5B 3ZYOA 4LFHG 1NUDA 3CMGA 2NPLX 4MAUH 1FZJB 2BHYA 5IG7B 1FL3B 2DQJH 3QFDA 4LGSB 1AY1L 4KQ4L 3WL9B 2ZSVA 1T83C 3T04D 1D5IL 4XBPA 5HI3D 1RPQA 5E1HB 2A0LD 4OFIA 4PJDE 1F4XL 3QCUL 5EBWA 3VGDA 3FOMB 2Q86B 3QIBB 2C3VB 3IKCB 1JWUB 1DQQA 5EIIA 3S88L 3T0ED 4B41A 1IQWL 2HJKA 4MS8D 4GAJL 1FLRL 4F7EA 2AK4E 5E9DE 5ADPH 2A1WL 3HCVA 2D4FA 2ORBH 4RGNC 4YXKL 2HG5A 1P7KA 2D2OA 2AV7B 3BHBA 5HYSA 1JF5A 2O5XH 1XGYH 1BBJB 1OOAA 3TYFA 4CVWA 1KIUA 1KJ3L 5CZVL 3LRSB 2F53B 3MREA 5C0AE 3ARFB 1FO0L 4FQJH 1F6FB 2UVEA 4PRNB 2BJML 3MPCA 3DVGA 1MFCL 5AWNH 3BGFC 3BPNC 4K7PY 3QULA 3ARGA 4RIRB 1F4AA 3LKQB 2DICA 3ZSSA 2J5LC 5I1DB 4NKIL 2CLRA 1GZPA 2GQHA 4ODTH 3K2MC 3CK0L 1NGWB 5HVHB 4PJ8C 3EOTH 4Y4KA 3MR9A 4WDIB 1W0VB 1I1YB 1T6WA 5HDQL 4WHYG 4JO2H 1H8NA 4UAOC 2GK2A 5FCUH 1U41A 1KEGH 4X7CC 1DVFB 1UJ3C 4PY8I 4LRIC 4EI5A 1KIQB 3MMEB 4H0IA 3P4MA 1ZMYA 4L29B 2V17H 3U36A 3RKDC 4BK4A 3TBSA 4LCIL 5MERA 1YYLH 2P5WB 3CUPA 1V05A 2VDPL 5I2IB 2NR6D 4GMSL 3BQUC 3P77B 3IETA 5JHLL 5GHWH 1A3QA 1P4IL 2X4SB 3VFWB 5K9OB 2P8PB 1VESA 2LQRA 4P2CG 4XTRC 2AVGA 2AK1H 4UV7L 4L9DA 4LK4A 2O5YL 4H25A 2X1OA 4YHMH 1BBDH 5DF0A 1NCCL 2H26B 1T1ZB 3IFOA 2FB4H 1T22A 4ELMF 4RFOL 3B3IB 3HG1A 3FT4B 3GSUB 3QNYA 1ZA3A 4I2XA 5T1LD 3LS5H 1PZ5B 4NNYA 3GRWA 3J7HA 1FFNB 5HPMA 2Z31A 4C56D 1BQLH 3IRPX 3CAFA 5GRJL 1ND0A 5K9KB 2XN9E 1JGVL 2VL5A 2CRIA 4J1UB 3PGDB 5DJAA 3WHE0 1X7QA 4GT7A 3PGFL 5DRXA 4OFKA 3I6KB 5D2LA 5J11C 1VGEH 1DN2A 1I7UB 4LPXA 4LSDA 5IHBA 3QEQD 3VXRA 2GT9B 2NZ9D 4ZG1A 4CN4A 2R4SL 4JG0H 4K3JL 3F7VA 1NGZA 2YWYA 4CJ1A 1MI5A 2IH3A 3MODL 3OAYK 2D03H 5DRNA 3MFFA 2B7DT 1FFPB 3UJJH 2OYPA 3D25B 2W65A 4U33A 1A6VL 1T83A 2K7QA 2Z8SA 4LLQA 3BYYA 1AXTL 3QIUD 5H35B 3MUY1 1BZ7B 3GBNH 2OJZH 3HB3C 3V6ZB 4XNUL 2Q3ZA 1NAML 1RV6X 4X4XB 5EH1A 2H32A 3RPIA 4ZFGH 1ZT7A 1HHIA 2ZG1A 4HGKC 1I85C 5I8EA 5E08H 1L6ZA 3SJVA 3KPRB 4XAWL 1JHTB 1S5HB 3NIDF 4HS3A 4ZUUB 4XMLL 1GC1C 2XNAB 4M7ZC 1SMOA 4JZNA 4JREB 5FKAB 1KJVB 2HH0L 2Q6WA 3IDYB 4O58L 3MRKA 4HC1A 2R29H 2NQCA 1NC4B 4M1GH 5D5MF 4GRMB 5DK3A 5EOQL 2AJXL 3B5TA 1P2CA 3N85L 4ZPTB 1N0LA 1P6FA 1K4CB 2OP4H 1QZ1A 2W07A 3PL6D 4GAGH 1EXUA 3QUKA 1OW0C 5TH2A 4AIXA 4I0PB 3D69B 4HWBH 5IEHA 4LNVA 1KELH 3T3PE 3WBDA 1CXLA 3V52L