5KG9A

Crystal structure of the gp120 v2 antibody re505-22 fab from igh- and igk-humanized mouse
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
215
structure length
206
Chain Sequence
VQLVESGGGLVQPGRALRLSCAASGFDYAMHWVRQAPGKGLEWVSGISWNSGSRGYADSVKGRFTISRDSQYLQMNSLRVEDTAFYYCARMNGTFDYWGQGTLVTVSLASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Immunodominance of Antibody Recognition of the HIV Envelope V2 Region in Ig-Humanized Mice.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords Antibody RE505-22 Fab heavy chain
total genus 36
structure length 206
sequence length 215
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kg9A02
2AXFB 2R69L 3QYCA 2XNAB 1IEBA 3RKDD 1QFWL 2E7CA 3STZB 3QQ9D 2OTWA 3ZE1F 3O81A 1FG2B 5DT1H 3CSBA 2Q76A 3ZYOA 4OZFH 3L3KB 4PJAB 5ESQB 4UB0L 2CKBL 1FNSH 1UXSB 3GUTA 5D2NC 4EN3A 2XIDA 5ICYA 1BIIB 4DEPC 1DL7L 1DUZB 1WSST 5DLML 4B7LA 4NPYA 3BVNA 4HD9A 1DDHB 5CJ5A 4ONHB 3P9MB 4N1HB 4U33A 4EUPH 4AENA 4WJ5A 1R5IB 1PDKA 4TUKL 2NY2D 5E6ID 4KQ4H 1BM3L 1RZ8B 3VXOB 3MRIA 2VDQH 3VW3L 4NSKA 4JRXB 1I3RA 5FM8A 4U1NA 4Y5XA 4OB5L 3S34L 1CFNA 1PJ9A 5F3HA 3IU3B 3GGWA 5BV7L 3VDAA 1XCQB 4RNRA 2DQUL 4XH2A 3NA9H 1F11B 1AP2B 3SE4A 4LEOB 1FIEA 1J7VR 4GRLC 1LO2H 3GSQB 3DHJA 5C9JB 1A6TB 4HEPG 2IH3B 4QRPB 3OAUH 3QEHA 2LE9A 4PJ5B 5EBMB 4NQCD 1RQ5A 2UZXB 1F6LL 4XMPL 3WHXB 1A7QL 5GSVA 1A0QL 3HUJB 3LKNB 5D6CB 1ZHBA 3UYRH 4UT6H 2P49B 2P47B 2DMKA 4MCYA 3UC0H 1BQHG 2P5ED 4MA1C 3OR6A 4EUPG 2D31A 3H9SE 4DUWA 5ICZA 4XPFH 1A7BA 1WZ1H 1MY5A 3LVEA 4ZFOB 2GY7B 1NC4B 3K1KC 5HPMA 1T7XA 2R1YA 5D5MF 3PGFL 4P3DB 1J9CT 2A6IB 4BSJA 2IAND 4N0UE 1BVKB 4YX2L 1Q0XL 4GG8B 4HS3A 1S7UB 2HA1A 3VI4E 3BKML 2RB8A 5JW3H 2H1PH 2VOTA 2LQRA 32C2A 2MJWA 4XCNB 5IESL 1F4YL 4YNYB 3EDKA 4YXHH 5C0NC 2G5BA 5A16B 4NQDD 1IM3B 5I1IH 4QHUB 4K71C 4CBPA 2ITCB 5SX5H 2IADA 2CKNA 4CN1A 1OAXH 2EDNA 3GBNL 4QRRA 3AXLB 1VACA 5DJ8B 1QPXA 5GRYA 5F9OL 2PCPB 3MBED 4KHXH 1I7UA 4NWTL 4XVTH 3T4YB 3HCVB 2VLKB 1CFQB 1FGVH 3TN0B 2WP3T 2GAZA 3SDDB 4IIQA 2R9HC 3C08H 1C12A 3QO0B 3FN9A 1A1MB 4KJYA 4X8JA 5JOPD 4PR5B 2XKUA 4OZGB 3WIFB 1YEEH 1DN2A 5MP6H 4XPHL 3SBWA 2CK0L 4BZ2H 3TIEA 1UCTA 2PTVA 5C0IA 1AR2A 1KTDA 4ZD3H 3FHAA 4PGCB 3AS0A 2DTSA 2NYYD 2WINB 5AYUL 4NNYB 3TBWA 4PRBA 5JIHA 3UPCA 5CILH 2XXMB 3I02A 3O6FC 4PJBA 2A74A 2Q7YB 3WFDL 4CN6A 4CAGA 2GY5A 3TESA 5C0IB 2DJSA 5C07A 5E24E 2ZCKL 3QXUA 4BFEA 3CAFA 1MRFL 3O6KH 4LPCA 4PGJA 1LO4H 4GUPA 5SWSB 5J06A 4M6AA 3V5DB 1JTTA 3F7YA 4FOMA 1XCTA 4K2UH 2H3NA 1TJIL 2X4QA 2QSQA 5I1GL 4X7TB 4PRDB 1G84A 1CGYA 4G6FD 4CNIA 4Z7UB 4Y5VA 5IW6A 4YUEL 4L4VD 2JJVA 2X1XR 2ADFL 4N68A 3VWJA 5C86A 1RULL 2Q86A 4Z78B 1IQWH 4XNMB 5FXCH 2DQIH 1KJ2H 1FP5A 2ZNWA 2EKJA 5EIIB 1S9XA 3CFIC 5IF0B 1BMGA 4HIIA 5I66A 4D0BB 4AL8H 1OP5K 3H7BA 4ZMAT 3Q1SH 2B1HL 1NLBL 4YDLC 3KR3H 5FECA 1JHLL 2VLKE 4RBPH 3SE4C 1CE1L 3T0VA 3Q3GB 3GBLA 4NO3A 4YFLI 1K8DA 4HQQH 4NJAH 4C54A 4PJGF 4WEUD 1RZ8A 5BZDA 1A7RH 3QUMA 4KUZL 1WFOA 3DO7B 4OZ4A 1VESA 1QLFA 5B39G 5ADOL 3D39A 3ROOB 2JCCB 4PUBH 3MJ7B 1ZWIB 4LCYA 1MRFH 5MEPA 3L6FA 1E0OB 3IJYA 4E0RA 3PHQA 2AJSH 3JV4B 2APXA 2ZUVA 3AY4C 5IROC 1VADA 4A6YH 1BLNA 4YHPA 2EEDA 1MI5B 4OCXL 1KEGL 4RWYH 5TFSL 2NY2C 5E6IC 3JTTB 2DQJH 2A77H 5I1JH 3ILQD 4AEIH 5GRJH 5KANG 3LMJH 3HN3A 3ARFB 4DVBA 4ENEC 3PGCA 4KI5E 5AZEH 4D9LH 3EO1A 4XC1H 3P77B 3FOMA 4YHPB 3V4PL 1VPOH 1J18A 4M43L 4P99A 3GJFA 2W92A 3FFCB 2R2EB 2YHGA 1A7OH 2QHLA 1RU9H 4MZ3A 2EDEA 4IRJC 1HSAA 4OI9A 3B9KB 2FR4A 2NPLX 2VZVA 4I0PB 4P46A 4UOJA 1WBYA 4K3EH 3CFDA 3V0VA 1L7TL 1MJUL 3DGGB 1YNLH 5DR5H 5KTEL 5E8DH 4IIQC 4GAYA 4RFNC 2VZTA 4PGEB 4WUUA 4P4KB 2EDYA 2FD6L 4OM0H 3QEGL 1BVKA 2MHAB 4X9HA 4JPIB 3EGSB 1T2JA 5GHWH 2WBJC 5I73B 4JY4B 4N8VA 1ZV5A 3SBWC 5DWUH 4HWZB 5HVHC 3FRPA 1GGIL 2F53E 4M3KB 2BSRB 1JGLH 4XVSH 2GFBB 5ANME 2ADJB 5HBBA 3MLVH 4OD1L 4AEIL 1RURL 2YZ8A 4JY5L 15C8H 4JJHA 4RGMB 2O5ZH 5GRZA 4Q9RH 2OK0L 3WNOA 3O6FA 4LIQL 1HHHB 4Z7VE 1CBVH 2XZCL 3DMMB 5E2VH 1T0MB 2ERJC 1Y6KR 4UINL 1S7QA 5DMGC 4NKMB 1IT9L 4QF1B 1RJLB 2VXUL 4ZUUA 1CE6B 3MRPA 5EDXA 1KB5A 3LB6D 5I1CL 1NQBA 1ZGLA 3TT3H 2OCFD 1MREH 5CZXD 4FTVB 3IVKB 3P11H 1JPSL 3JUYA 4LEXL 5I75B 3CMOH 3A6CL 4JN2A 4NZUL 4MLSA 1FZMB 1T21A 3MGTB 4OIIL 5K59E 3I50H 2AV1A 2MKWA 5IVXB 1S7XA 2ENSA 5HHOA 1EUUA 3RWJB 4AL8L 1MF2L 5DGRA 4MNHB 3PWPE 2WW8A 5ESQA 4LLQA 2OSLB 1Z2KA 2NY3D 3D3VB 4H0HB 4CVZA 3IKCB 4I48B 5JDJA 1D5ZA 4FXLA 4M4PA 2NZ9C 4PJHE 1I9RL 3RWCB 3QO0A 4O58L 1MJJA 3FOLA 4HJ0C 2DIJA 3L7FA 1HYSD 2W0LA 5DDHB 1CFQA 5HGBB 4JREC 1NC2A 3WS3B 1BLNB 4M48L 1EO5A 4UIKL 4FQHA 3O4LB 2ZUQC 5TPWH 3F58L 3QDGD 2D7QA 3C09C 4XWGH 5CINH 3MODL 1KT2B 3F5WB 1MCWW 4YGVB 3P4NB 5BS0A 3RZCB 1DFBL 3RWGB 1ROWA 4WFFD 4UIMA 4NUGH 2KH2B 2Q6WB 1BAFH 1IC7L 5IB2B 3HR5B 5BZDB 4KJPC 3V6BR 4Y1AA 3K4AA 5F44A 5KVFH 4YHIA 5D93C 5EZLA 3C6SA 4PJ7A 1LMKA 3IFOB 4X83A 3FFCD 2DBLH 1QKZL 2ICWB 3UBXA 1A22B 1BQHB 2VDOL 4FTVE 4QGTA 3IJHA 4G8GA 2ZSVB 4RMSA 3FRUA 5IFAH 4XT1C 3OR6B 1IEHA 1MLCA 4Z0XA 1FPTL 4PJ7F 5DD3H 1KPRB 2WMPA 5D6CA 5H94B 3RWJA 4QWWD 3EGSA 5AZ2L 1JRHI 4TPRL 1UM4L 4K9EH 3P0VL 2BNRB 3R06A 4V2BA 4MD4B 3BKJH 1B0RA 3JV0A 5GGTH 2A6KB 5TPWL 2Z91B 5D1XC 1FFOA 4PJAF 3MZTA 1IRAY 3DXAE 2XICA 4OKVA 2VLRD 2DQDH 5ITBH 3QUYC 1X6LA 3KJ4C 3SDXA 5TF0A 5C6PB 4RGNE 1RZIA 4PPTA 2EDWA 5HGGS 1QSFA 1WCBA 3BP6A 4U3HA 5FM5O 1N26A 1PKQB 3FQXA 1TNMA 3D2UB 4FQPA 4YDVA 1JZ5A 2I24N 1J5OH 2IFGA 4P5MA 5ALBH 4X99A 3IAPA 3DURA 5EO0A 4I4WB 1D6EA 4U6VH 1XR9A 1IC1A 1TVHB 5IW1B 3W2DL 1NL0L 5DA4A 1QFUH 3WNNA 4NQDB 3B2UC 1CFVH 5GS3A 3GMNA 3LRGA 1FBIL 3N1PC 4NKIL 4NQEB 4HX1A 3REVA 4HV8A 1UYWL 5GGVY 2XPGA 1U91B 4RMRA 3BWAA 3KJ6L 3ZYZA 5HI3D 4Z95L 4YZFE 1KTRL 2UYLA 3HC3H 3VG0L 3GSXB 1QYGH 1F90L 3WN5A 4P5TB 5D6DC 5DQJA 4JY4A 4K23H 1Q38A 3FTGB 2AV1B 5C0BD 3HG1B 4EEEA 3QZWA 1JPST 1RZFH 2EDOA 3HNVH 4MD5B 2W9LA 5IMKA 2PYEA 4NN5C 4TTGA 1F8TH 1NFIA 3N50A 1N7MH 3VGGA 1JYVA 3H9SD 2P5EB 3QFJE 3ULSB 1RIUL 1L6XA 1X4ZA 4NZDA 1T1YA 3IDYB 4U4BA 2XG4A 3QJFA 4ZPTA 2B4CL 3PDGA 1C5CH 4Y1AD 2PF6A 1KFAH 3FQWB 2GKIA 1MVUB 1P9MA 2HLAB 1Q94B 1JZ4A 4NCDA 2VXSL 2R0LL 4HBQA 3JXAA 4DVRL 5D1ZD 3OKDA 1QFWH 5F1NA 1ORSA 4WU7B 3V4VH 3T0WA 1KT2A 1ZTXL 2NW2B 1W0YT 1MHHA 4YHOH 2L4OA 5EU4A 4OTXH 1E4XH 4GAFB 4XCYA 3X3FH 4M43H 3VD7A 3H6JA 4EN3D 3RGVB 1QSED 3M17A 1G9EA 4HWEL 5TQ0H 1CLOL 4CKVX 2AQ1A 5LGHH 4K7PL 4IDJL 12E8H 1MFEH 1YMMB 5DJDB 3SDDC 4M4RA 1JZ6A 2XQYG 2ED8A 2AEQL 3JTSA 4HBCH 5HGAB 2CIIB 2HT3C 2NY2B 1MIEH 5E6IB 5DZOA 5SWZD 5B38B 3CSGA 4YDIH 3VGAB 5BOPA 1NC2D 1D9KD 3P40A 5JXED 4YLQT 2HJLB 1EFXD 1H8OA 4HX1B 5A3IC 1C08B 2UWEA 4CUCA 4FS0A 4NO5B 1RUKH 2GT9A 3GZKA 3PWUB 1YN6A 1F4XL 4JG1L 4MAUL 3O6LL 5DJZB 4PJBB 1G9MC 5MEOA 3DVGA 4CDGC 3GI8H 4IRJB 5IESH 2QQKH 4L9LC 3BESR 4G6ML 2Y07H 1UXWB 3F7QA 3INUH 2X4OA 4Q58C 4TVPD 5JO5B 2UWEB 4MNQA 4X8XA 4WW1A 2HG5B 2IPTL 3BGFB 4HGMA 5E8PA 3MRPB 2M26A 2X4SA 4MD0A 4YO0A 2ZJSL 3KPRD 5E8EB 3SE8L 1CLCA 2Z8SA 2VSDA 3OJMB 3TPUB 8FABB 1ADQL 1FE8L 1SEBB 4NO2A 5HD8C 2VAJA 2YMXL 4HUXB 5IKCB 1U8JA 1NUDA 3NABH 5F1IA 5LWYH 5IBLC 3PG2A 4OCXH 3MJ9L 4YQXL 5J12C 5C3LD 3F7PC 5JR1H 3W5MA 5D1XA 4DN4L 5DSCA 5DYOB 2LVEA 2JJTC 4KJQD 3MLTB 3I75A 4KJPD 1T1WA 4NYLA 4MA8H 1NBZA 5HYJE 2ZPKH 4OLZH 4LSSH 1YNTA 4ELKA 4OLVL 5D7JA 3IXTB 3TO2A 5D4QA 3R1GL 3K3QA 5AWNL 3T1FA 3RA7H 5CD5C 5C0GA 4Y4KA 2RR3A 1GGTA 5D1QD 1MCJA 1OTTC 4OCMC 4R97C 4DTGH 4U49A 3ISWA 3U4BL 4NCC2 1ZHLB 4XX1E 4G42A 3LEYH 4JG0H 4UIMB 3QUZB 1GZPB 3IDGA 3WDJA 1N5AA 4Z9KB 3QZWB 2XTJE 4ELKB 3E2HB 1YC8A 1FFPB 1T7YA 5TGBA 4AT6A 3SO3B 5DMJB 1ADQH 1DN0A 5DK2B 4OM0L 2B0SH 3EOTH 1GJIA 4G9FD 1QRKA 3MCKB 4PJGB 2E7LC 2OQJB 4HMDA 2XQBL 2B2XH 1MWAL 3WIFA 4LP5A 5J9PB 2ICES 3DV6B 4R9HA 4ERSH 3QUZC 5IHBA 1YY8B 2C3HA 1D6EB 4XWOD 3QIBB 4FZEL 3WFCL 2OL3B 4LRNL 1EAPA 4P5MB 1ND0A 3PWVB 1HXYB 4PJCE 3L7EA 3HI1B 5SX4I 2HKFH 1ONQA 4PJ9B 4XCEB 4WUKH 4YBLB 2QSCL 5DD1H 4JFZL 5JZ7D 3DUUA 2AV7A 2PO6C 1HILB 4MJ5B 2RFXA 2ITCA 3WXWL 3QT2A 3TZVB 1QP1A 2GJJA 5LGHL 1PQZB 2M2DA 2VRAA 3VH8A 3QB7C 1J8KA 3QHZL 1CL7L 5FA4A 3HMXH 2XQYK 2G60H 1NCDH 1QPPA 5K93A 1G7HB 3OG6B 3V8OA 1YY9C 3WXVL 1HOCA 1AO7A 1J0KA 4LF3B 2MTPA 1FAIH 4MA3B 5DFTA 1OCWL 1LILA 4KDTC 4MXVE 2XRAH 4ZAKD 5GRXG 1PGRB 4BSVB 4YXHL 2ZUXA 3VGFA 1YQ2A 1ONQB 1CR9H 4XPAH 3MOBH 4KVNL 4LLAA 1CDBA 4TN9A 3U36A 5DUML 3IJHB 3RDTD 4WFHE 1IILE 3FT3A 4ODSL 4PYGA 1ZVSA 1AGBB 3O3AB 4FXKB 1HYRC 4EBQL 3D0VA 2NCMA 4XAKE 3SDAB 4ONGH 3RI5F 2PXYB 4QYOA 4G43A 2XTJB 1NDGB 2EXWC 2VTFA 3D85A 4AMKH 5MEND 2A73A 3ILQC 3BPLB 1A7RL 4KUZH 3S37L 1DE4B 1JWMB 1FQ9C 4DFIA 2Z0BA 1CZ8L 4MJID 3EJYC 4EN3C 3AXLA 3JWOH 4U7KA 3FB5B 4OLXL 1ORQA 4U1LA 3VMOA 1QHOA 3NCBB 3B8SA 3U9PL 4AIOA 3P4NA 1FBIH 1BD2A 2DLFL 4M61B 7CGTA 4BM7A 2FJHA 3WLBA 1U8NB 3O4LA 4CDHA 4KHTH 3EBAA 3GJFK 1MNUL 3CZJA 4PGEA 4NRZA 2CJUL 3QA3A 1PVHA 5I75C 3LKSA 4IRZL 1QBBA 1RZJH 1NFIB 3NIGF 1QOKA 4F7TB 5EOTB 4B50A 2GT9B 3NIDE 4P23A 5DO2D 1LEGA 3QQNA 4UI2A 5BW7A 4YHKH 1CQYA 4ZFOA 3MRDB 3NCJL 4O9HL 1BZ7B 2IG2H 3A67L 3S4SA 5CLTA 3QR2A 5DI8B 5KS9A 1YEKL 4YJZL 4KZDL 4I0PD 1A6AB 4LPWA 4M62L 3MRBB 1UCBH 3QWRD 4OZHA 2VH5L 5DHVH 3I6LD 3JTSB 5HGAA 2JLLA 3JWDL 1CVRA 1RHHA 1R24B 2W1NA 4F8QA 3LKQB 3AGVA 1YMMA 2QSTA 5DJDA 5IKCA 2O5ZL 4Y4HA 4K94C 2AABL 4WFED 2FX8H 3RDTB 4QHKJ 4N8CH 4PJIA 4P9MH 2DLGA 2PCPA 3PWNA 5H37G 2P5WB 4W68A 3CK0L 5E8DL 3P73A 4W70A 4J7RA 3ZKMC 1YJDL 4IS6B 2IAMA 4NUGL 4D94A 1DTUA 1NBQA 4P3CL 4PB9L 2ADIB 4IDJH 3IJYB 5L7XL 1JI1A 5FV2A 4NNXB 4LCYB 3SY0B 3RIAK 3PDDA 1N6UA 1GYAA 4D9QD 5IHUH 5ADPH 1WWCA 5GGSY 4BELD 1H3PL 4XCFH 4RZCB 4UDUA 3L5XL 2DDQH 2GSGB 3VFPA 8CGTA 1TPXC 4O02L 1P84J 4KRNA 3U0TA 2F53A 2AJ3A 4XMKL 2ZZUT 2R1YB 3C5JA 4I77H 3RNQA 1FPTH 4XX1G 1ZLUK 1MOEA 2FH6A 2VDNH 3E3QE 1FNSL 1ZHKB 2Z35B 3L3JB 3L9RB 1MPAL 2ARWA 2MOVA 3FRUB 1REIA 4PJ8B 1AR1D 4QRTB 4HWNA 1C5DB 1QACA 1E6OL 4U1MB 2PN5A 1EEYB 1FG9C 4L8BB 4M9PA 1IGJA 3O3BB 5HGDA 1EAJA 1F42A 4HFUL 2AXFA 4JZOB 2YRZA 2YUXA 1NFKA 5IG7A 4JKWA 1IGMH 4OD3H 2DWEB 1U8KA 4QHLA 1QLRB 4RDQF 1BQUA 3W9EA 5F7YC 2C5DC 3Q6GL 1WCQA 2M1KA 2DQFA 2CLZA 4HEME 1SJVA 3QUZD 1MHEB 4XNYH 3KJ4B 3EAKA 1JPGB 1P7KB 2F54D 1AO7D 1KFAL 4PJHF 3DX9B 4K55A 1NCWH 5HHQA 2FCBA 3LEXB 1M4KA 5H35B 4XCEA 2MKLC 1N0LA 1OLLA 3S5LB 3B9EA 5DHVB 3F12A 4NC0B 3OQ3B 3RP1A 2WBWB 2J3SA 2ID5A 3V4VL 5IM7A 4Q6IC 5SX5K 3GMQA 2ARJQ 2WINA 3P9MA 2CRZA 2AGJH 1MCKA 1WAAE 2J1KA 2ENYA 1V7ML 3FO9B 1ZT7A 4O5LL 1R0AL 1XGUA 1W72A 4G9DA 2R0KL 2OQJA 5KJRH 2CDGB 2F74A 4U6XA 3TNNB 4MS8D 1OVZA 4F7CB 4H1LA 5ID1B 4G8FA 3ET9F 3QG7L 1S9VB 3O11A 4AT6B 1HOCB 4CW1B 3PGFH 5FKPB 4FABL 1HH6A 1T22A 4NJ9L 2E7HA 1QUNA 3ZT6A 2FEDD 1UM4H 3GMQB 2IQ9L 5TE6H 3SGEH 1Y6NR 3BH9B 1A14H 5IB2A 1KTKE 4F2MB 1RK0B 5IHZA 2E3VA 5BW7C 1MEXL 5D9SA 5C0BE 1MFDL 2FLBT 5JNYB 2W60B 5DVOA 1X5XA 2DKMA 4OCLC 4NQSB 2BNQD 2OTUA 3KXFE 5F1NB 4OKVB 2OR7A 1RK1B 4KKBD 1QKZH 5EUKA 1T7VA 2NW3B 4B41A 1PLGL 4MAYD 4YHNA 1Q94A 3KYOA 1XF1A 3VXUA 4AIXA 2IBBA 3W9EB 5IVOA 3IU4L 3PL6D 5HDBE 4Z78A 1RK0A 4UILL 4LCIH 2FATH 3BP7A 5IFAL 4RX4D 5BJTB 2FYYB 4M7KH 2N4IA 4GXVL 4IMKA 2D03H 2YOCA 4QRUB 1VGKB 3PDOA 3SE3C 5GGRA 2Y5TA 1JTPA 1J0YA 2PKDA 4PRPB 5CP7A 1BVZA 1QSFE 4K7PY 2BVPB 3MMEA 1KPRA 3BT2H 1GHFL 2RHEA 1T03L 2KPNA 4KDWA 1XF2B 4DJMA 3MACH 4HJJL 2BOBA 3J8F7 4Y4FB 4GUPB 5D1QA 1XGUB 2FB4H 3FQUA 2GJ6B 3QI9B 3WIIL 1P4IL 4Z8FL 3OKYA 5F7FA 1VGKA 3MRHA 1N2RA 1A6TA 1SYSA 2XWBA 4LPUA 2EYRB 3GSOB 1AHWA 3L95A 2QKIB 3PHOB 4F15C 3S6CA 4DKAA 4Y4FC 4EVNA 5C70A 3G5XA 2YC1B 3MUY1 4Z7QE 4QOKB 1AXSA 4J23A 4Z5RB 5KAQG 3QXDA 4JM4H 2VLKD 5E9DA 1CF8L 2BOCB 2GSIA 3BGFC 4WI7A 4U1NB 2OZ4A 4NKOA 1MLBB 4NSKB 4LKXB 2HLFD 1YDPB 1FZJB 3GB7B 4ZS7H 3DVNB 3RIFK 1UM5L 3PGCB 1EIBA 1R5WA 4FQXA 3PWPD 1NGWA 3ULUH 3PABA 5C0BB 1AI1H 1J8HE 4H25B 4X4XB 3DV6A 2DLFH 4WO4D 3T77A 3TF7C 4OV5A 3B5HA 3RGHA 1EH9A 1FFNA 2ZPKL 4MXQD 1KJ2L 2YBRB 1JZ3A 3U4EB 4LKXA 1ES0B 3L3GA 5D7LD 1I1YB 2CO6B 3L5WA 1F4WH 4W6XB 5D7JD 1P2CA 1U58A 2KBGA 3FFDB 1VACB 4N90D 1C8PA 4Z76B 4LGRB 1WTLA 4WO4B 4J6RL 2GYSA 3T8XA 5I73C 4JO4L 3BI9X 3UO1L 5BXFB 4XNZC 2LTQC 4HXAH 3X11A 4YHIB 1SY6L 3KPQB 4PJDB 1PBYA 3VFSA 1D5MA 1UKTA 2R0KH 2NR6D 4HKZA 3QI9A 5FO8A 1IL1B 5TDNB 5JW4M 1KIPB 4FQIH 2UVEA 4Y5YC 1MHEA 1UH3A 5HHMB 4QTHB 1EO8L 4HIJB 3H7BB 5F6IC 4E42B 1A2YB 1PG7L 1T4KA 5KSVB 2Q8BL 3WNKA 1UWEL 2XTLA 1EO7A 3FFCE 1I3VA 3IFNL 5GS0D 1FNEA 1CT8B 3LS5H 3P11L 4XPBL 4NQCE 4YZFF 3CFJA 4LLUA 4CL7A 5I17B 2Q3AA 5L7XH 3NABL 5EBMA 5AZEL 1SVCP 3P9LB 3BOVA 1VERA 1OTTD 5DD1L 5EBGA 3OV6A 4G9FE 4K7FA 3FT3B 3FCTB 5T1DH 4Y4FD 2CKBH 3WFBH 4JPWL 4GH7B 4PJXE 1T4KB 1Z9LA 3EZJB 1AY1H 5E94A 3ZLQC 5CCKL 1MAJA 1IGCL 4KJQC 1BFSA 2HLAA 3MRMA 3VXNA 5T3XL 2D03L 3KHOA 3BD4A 1UXWA 4OCSL 4U6YA 1Q9WB 1JNNL 2NXZC 1XIWC 3UEZA 4OFDA 4WW2A 3TGXA 2FH8A 3WYRA 3SE3A 1HHKA 2DLIA 5C0CA 5JA9A 5FGRA 5EFIB 2Z92A 5FHAH 1N2RB 5D1ZC 4RCAA 1KJVA 1HNGA 3MRMB 2AW2A 5C0AD 2QQNL 4WO4A 4XVJL 1JGEB 1MAKA 5DQDL 2V9RA 4Y16C 4X4ZA 2VDRH 4PRIB 3DBXA 4PG2C 3SGJA 1I9JL 4LLYB 3UYOD 3V9FA 3LSOA 1IQWL 3QIBA 2IG2L 2L7JA 1MCOL 5C0EB 2Y36H 2YUZA 1K6QH 3JWOL 4WGVB 2WM0A 3V7AE 4YPJA 1EZVY 3MJGX 5DD6A 2Q6WA 3WD5L 3EYSL 1U8HB 5D7SL 5C2BH 4HQQL 5KVMC 5E5MA 3FQTA 4QLRA 5IBUB 4GRWF 1FORH 5T1LD 1U8LB 1FL5B 4EI5B 4IRSD 4F9PC 2X70A 3HKFA 4LCCB 5JOEA 4ZSOB 1MCRA 5HVFB 2A6JB 1DBKH 2DRUA 3H2WA 1T7WA 1S78C 4MX7B 5DDHA 4UV7H 1E4KA 2BNRA 2GJ6A 1A3LL 5L0QB 1D5BB 1G7PA 1HI6B 4N5EC 1EEZA 2QHRL 3LQZA 3QUYA 3DX7B 4TVPL 3QDMA 3LHPH 4XHQA 5DUBA 4OBSA 4MSWA 2YPKB 3OJ2C 4MDJB 4KK9C 4EI6A 4QRSA 4XAWL 2HH0L 2B5IB 4M7ZB 5DTFA 3GSVA 3QG6A 4MQ7B 2Z35A 4YAQA 3IETB 1LVEA 4KK8C 1K4CA 2I07A 3MRQB 4QRQB 1XMWA 1LE9B 1J05B 3VXUD 2Y5TB 4X8JB 5KVGH 3IDYC 4Z7WA 1MJ8H 3MGTA 4FXKA 4X98B 2J7LA 1LO2L 1KB5H 1EHXA 3NFPB 4YBQD 1KGCE 4QO1A 2I60L 4GAGL 4OCWL 2J8UF 4Y5YA 3CDGB 5DJ2A 4P57A 2A0LD 3UTSD 4PJIE 1V7NL 4HFUH 3QNZA 3KPSD 5C0RH 43CAB 1CDUA 3BX7C 4PTTB 3V95A 5DEZA 1NJ9B 5E8EA 2MCPL 1GAFH 4NO0B 2NY5C 2XZZA 4WW1B 2NTFA 3OHXB 1N5YL 2W60A 2IAMB 4JFFD 3HMWL 1YPZA 4XCFL 4LHQB 4OGAC 4AZ8A 1QFWM 4KPHL 3V4UH 1EFQA 1IC7H 4MXQC 3CDGA 2Q7YA 5F7EL 1U2HA 4LLWA 4UQ3A 4XMKH 4XRCB 1Q1JH 3OAYH 3TBWB 5HXMA 1RUPH 3QIBD 2NY7H 2BHYA 1N59B 1KJ3H 1BF2A 3FL7A 4PBVC 2R8SH 4FXGB 4NZTH 3WIHA 1U0QA 3VXNB 2VLRE 5JZ7C 1J0ZA 4HC1H 4ZSOE 1IGFH 1VGEL 1H3WM 5CD5D 3DIFB 1HXYA 5HHOB 3DTXA 4PY8I 4GJTB 1E4WL 1IGYA 2CDFA 3CFCH 4IMLA 1HHGA 4OF7A 2HYMA 3MLUH 3V5HB 2DJUA 2GAZB 1CLOH 3SDDA 2V2TB 1RUMH 4RBPK 3ALPA 3OXSA 1FJ1A 4GAGH 1VHPA 2I60H 1C7TA 1RIVH 5J1SC 1WT5C 4FQJL 3RGVA 2X42A 1AKJB 2FX8L 1Q9KA 3NZ8B 4OAWB 2CJUH 3E1F1 5ANMB 3KS0H 5AG9A 2DQGH 3OX8A 3HI5H 1Y6MR 1N8ZA 3IFLL 4NQEE 4LEXH 4TRPL 5IGXH 4NNXA 5E4EB 1J1XH 1JHLH 1ETZB 1U3JA 4KTEL 4S11A 5J13C 4DGIL 1T1ZB 5J7CC 4ZUSB 4NQSA 2ADIA 3VFGH 3E6FA 3SGJC 5A16A 3VXSB 1CGTA 4BH8A 4LMQE 1J5OL 4Z7UF 5CFHA 4AQOA 5HHPB 3OKNB 2BVQB 2AXHA 3MNVB 1W0VA 1OGTB 1IAIM 3L5IA 3TH3T 3V5HA 5FDYA 1AO7E 4HCRA 3S3PA 4YEEA 3BAEH 3JBG7 1F5WA 2KL6A 1EXUA 3TBVB 1C5DA 4CU6A 4G5ZL 1C16A 4HGKC 2EC9T 1CIUA 4O4YH 1W8NA 4KFZC 1MCPL 1ZHKA 2BSSB 1EVTC 4F58H 1BM3H 3TH2T 4LVHC 2EC8A 1K3IA 3JV6A 2K7PA 5EZJA 1F45A 1HQ4A 4F7PA 3UBXI 1M7IB 4F9PA 1RUML 1INDL 1P53A 3QDJE 4LL9A 3T09A 3IKKA 3G9AB 4WU5B 3GM8A 4WI5A 4N5UA 5CBEB 2D7TH 2VXQL 2JCCF 5IMMA 1YEIH 2G2RB 3NZHL 4MMXC 3D69B 5F7LB 3MNVA 2BVQA 1S7SA 2VITB 1BF8A 4OD3L 3TYFA 3TPUA 4I2XE 4Y16D 3K80A 4KTEH 1CG9B 1I4FA 2NY0C 4ONGL 3Q3GA 4XI5D 4XNZB 1AQDA 4YO0B 5DD5H 1JPGA 1I7ZB 3MUJA 3GIZL 4LRIC 4O02H 3T0XA 4NOFA 4F57H 2CLZB 1JHKL 1I8MB 5KVFL 3UJTL 4MB4A 4PTTA 3N1GC 4LNRA 1S9YB 3S88L 3MXWL 2V17H 1J1PH 3L3HB 2G5BB 4Y5YB 5I18H 3BQUC 1H8SA 1Z6JT 4RAVA 5SWZB 3STBA 2CDEB 2G2RA 1T1YB 3GSRA 2E9JA 1MCFA 3PQYB 4HS6A 5JOFA 2VDLH 4ELMA 3RWEB 1CLYL 4H8WH 1JV5A 5GGVL 4LLUB 2BHUA 5DJYB 2MCPH 1P7QB 1KLFA 2R1XB 4XAKD 2FGZA 4PJ9D 4XVSL 3QAZC 1S7VB 3SE9H 3LB6C 4JFYA 1YYMH 3OZ9L 1CFBA 4Y19A 3IF1A 3ARWA 4POZD 1JGVL 2VXTH 4W6YB 1V3JA 3U83A 1BFVL 2VISA 3A0OA 2EDLA 3GO1H 3QUZA 2IF7A 1YEIL 3NZHH 4K7PX 3GMNB 2Z8VC 3CVHL 4JE4B 3ZDYF 1UM6L 1YNKL 4DKFL 5JOFB 5LCVL 3RAJH 4B5EA 2PW2B 4KQ3H 2UZIL 3KNBA 3CDCA 4H20L 4DK6A 2R4RL 4NO3B 2FGWH 2ICWI 2OP4L 3VJ6B 1WBZA 5LKNA 4Q9QH 1F11A 4BKLB 5SV3A 4P46B 2GCYA 5IQ9B 4N0RA 3B9KC 1SY6H 5HYJD 3CH1B 3AS1A 2ZWLT 4LCWB 4JVUA 2R9HD 3JSSA 5C3TA 3GRWH 1EGJL 1JZ7A 1WFUA 1MVUA 1MCLA 2YD9A 1NL0H 2HLFC 3GHEL 2VSCA 5DSCB 3FAWA 1OP3K 3A6CH 1DEDA 4OSUL 1YQVL 4FQJH 2APTA 1G6RH 1VFMA 3O9WD 1A0QH 2AJYH 1DR9A 2Y7QA 3AVEA 1BPVA 2YA2A 4ZAKA 2F8OA 2Z31D 5D1XD 3MJ9H 4YQXH 5DFVC 3WUWB 4LDOB 1DSFH 5HVHB 2NNAB 3JTTA 4P2QA 5FK9A 4FG6D 1OD9A 4MYWB 1XCTB 3BRFA 4IOFD 3VMPA 4AM0B 2CUIA 4NKDB 3UO1H 2PYEE 2YRLA 2F8VA 3RU8H 3HB3D 4OZIE 1I9RH 1K8IB 3LQMA 1FC1A 2HFEB 3GSNL 1XR9B 4LP4A 4LSPH 3U9UB 2PR4L 5D8JL 1G7MB 1IC5L 3HE6A 1AHWB 4KK5D 4QEGA 4PRPE 4X5WA 2R4RH 1BBJB 4H1LG 3VE0B 3P30H 1SYSB 2DI8A 2OBGA 3O41B 1EJOL 2DTML 3B2VH 3DV4B 1YPZB 4ZFFA 4GBXB 5FHBH 2J12B 4ZDHB 2AJVH 5C0CD 1T0NA 3BMVA 1RMFH 4XXCC 2CPCA 4WDIB 4HWBA 1ETZA 5DJAA 3OKEB 1D5XA 1U3HD 4H88L 4P46D 5EU7C 4APQB 4ZOBA 4FQQB 1JZ2A 1JMZA 4PLKD 1R3KA 3U0PA 2WUCL 5CBAA 2DLHA 1KCRL 2F58H 4LASH 1JGUH 2BVPA 3MMEB 4JFOB 3HI6L 3HUJA 3WFBL 1ZS8B 3DSNA 3QIUD 1AC0A 4GRMA 4LSVL 5EO9B 4S1DC 1A6VH 4IBLT 1DN0B 5GS1B 4LRIA 4RNRB 2VAAA 2V5MA 5E70A 1U95A 2R8SL 3SKNA 4JZJC 4JO1L 5D2NE 4TPRH 4LSPL 3UTZA 1YMME 4X7FC 3C5JB 1FVDA 5TDOA 3KYNB 1TITA 4NO0D 4YE4L 3VFPB 1EUTA 3BZFA 4JLRB 5HJ3A 3MSPA 2VDKL 4Y2DD 3TYFB 5MENE 3MRNB 3FN3A 3HRZB 1EERB 5J3HC 5DJCB 5GSRB 1QSVA 3T1FB 2IAMC 2D9CA 4GKZB 4UT9H 5CGYC 1A47A 2HFEA 4NO5A 1P4LA 3CX5K 4P3CH 1M71A 4PGBB 3I75B 5HDOA 4G8FB 4AEEA 1MEXH 2WNGA 4IS6A 5JHLH 1HINL 3BZDA 1NUGA 4Y89A 3IFNH 2A9ML 5IHUL 1ZHBB 2I5YH 1OAYL 2EYTA 4GT7A 1CICD 1WIPA 3HE7B 4JZNB 4KI1A 1G1YA 5CSBA 1G7IA 2ZG1A 1PY4A 5KZCB 3B9VA 3V6ZB 1EMTL 2R0LH 4W4OC 3RWCA 2G75A 3O3EB 3PP3H 4S1QH 4Y2OA 5I17A 3P4LA 1F00I 2WANA 3LSOB 3LEVH 1GCFA 4EXPX 4BUHA 4RAVB 4OLZL 1DQMH 1WJ3A 3OGOE 2RBLA 4U1JB 3MREB 5HPOA 3HZKA 3LIZH 2HVJB 2P24B 4L1HA 1KXQE 3IU3A 5TE7L 2ICEA 5HHNA 1KN2H 2HJFB 3CUPB 4N1CA 5IV2A 3MJ7A 1IM3A 5KANI 4YFLF 2Z91A 1N4XL 1EBAA 2HAZA 4AEFA 4RQQA 3KXFD 3EUUA 1BEYH 3DJ9A 2PW1A 4ZPTB 3ULVF 4LSQL 5DJZA 5FYKE 3WKML 4WW2B 2RJMA 2OJZH 2Z9TA 4LVNC 5HHOE 4ZSOA 1A6ZB 4NOBA 4MHHG 2CUHA 1LNUA 2H8PB 4QT5A 2Q1EA 2KQNA 2F5BL 2LVCA 1KNOA 2SEBB 2DLTA 5EIIA 4PJEB 4HDIA 4P2QD 1P2CB 1U58B 2B5IC 2ZUTA 6CGTA 3UMTA 2HKHL 4YIQB 2MQ3A 1OQXA 1HQRB 4NT6A 4I3GA 5KSBE 5MENB 1I3UA 3CX2A 3IFOA 3T0ED 3BDBA 3PJSA 4Q2ZB 3EYOA 1U92A 1Q72L 3QQ3B 5I1LB 3V6FA 3W11D 4ZYKA 4S1RH 2P8LB 4FNLL 5F93C 1B4RA 3Q5OA 5CIPH 5CGYD 1ZMYA 1BBDH 5IEKB 3TWCH 1MI5E 5FKAA 3W11C 4KPHH 5EA0L 3RZCA 3MA7A 2VLJE 4YDKL 4X6BA 5FUZL 3QEUB 5IT2H 5FM5M 4IOFC 4ZOCA 2DI7A 5KS9F 4YWGH 3VFUA 2NY7L 3G5YB 1ZLWK 3H42H 3O41A 4GAYB 4V1DE 2DQJL 4PJAE 2QR0A 3SE9L 3LZFH 1IGTA 1IAIL 4X5WB 1JWSA 4HUVB 3TJEH 4HC1L 3S35H 4A6YA 1IAOB 4G3YL 1F8TL 1YECH 3PGDB 4XP5H 5IV2B 1DDHA 4OZFB 2ESVD 4JFFB 2RFXB 1I1AB 4QXTB 3QDME 1HH6B 5FV1L 5FCSH 2JB5L 1KSRA 2NYYC 3E6HB 4TTDD 3FFDA 3GJFB 2ZUWA 5GS2H 4DTGL 1KOAA 1XF3A 3LD8B 1I7TA 3U4BH 2J88H 4IMKC 2NNAA 4P2QB 5FK9B 1ZSDB 4QCIA 4PJBF 5CINL 1U3HC 4GXVH 2XNAA 3QAZB 4OLUL 1U36A 3CSYA 3T2OA 2OMNA 1EHNA 4RMUA 4UUJB 2FYYA 3SJVD 4M93C 1D5IH 3MNWA 5IOPB 1A7NL 3ZKXB 3EOTL 3H7LA 3H0TB 1WAAF 4HK3J 5D1QC 3DUSB 1F97A 3JVGC 1Z3GH 2DYPA 3RWHB 3QXDB 1KB9J 2C1PB 4HGWB 4XPTL 3LPFA 4Z7VB 3NH7H 4ZFFB 2VABB 1GXEA 2Y6SD 2AQ3A 2WBJB 3CDYA 1I7RB 4DW2H 4W4OA 3DUHA 4UUJA 3I50L 1HHHA 1LO3L 1V8HA 2V7HB 1CBVL 1KLGB 4U7SA 3ARDC 5I30L 2UY7A 3KPMA 3KPRA 5AZ2H 3KPPA 5HPMB 4ACPA 4E41D 3EJYD 5B3JF 5DQ9A 1DL7H 5FFLA 3UPRA 4WIQA 1CICB 3IYLW 3BMWA 1DLFH 3EHBC 5EU5B 4V1DB 5B4MD 1NANH 3WV0A 1LNUB 3MV8A 4LHUB 5F7DA 2DQDL 3F7RA 4LGPB 2H2SC 4JFFA 1S7TA 1OCWH 4IIQB 4KMTH 1UG9A 4WFGD 1KCSH 4IRSA 2VLKA 5E9DD 4LLWB 3F7YB 3BGMB 4FFZL 1MCOH 4UQ2A 1MFAL 2P4AB 3NCCB 4GRLD 1K6QL 4IDLA 2XWJA 1DFBH 5A2IH 1J8HA 3RWIA 3AREB 4NBXB 1JI2A 4LBEB 1WFTA 4B7IA 3L5XH 3VFMA 2X4OB 2OX5A 3QHZH 4IRJA 5CJXC 4YNYA 2XZQH 4K7FB 4YK4B 1ZA3B 3VI3F 1ODAA 3D6GA 2H45A 3DYPA 3OTTA 3IRZA 3NPSC 1XFPA 3VXPA 2BFVL 3C6LB 2BSTB 4F8TA 4YIQA 4Z0XB 3CVHB 5INCB 1CK0L 3QUKB 2DKSA 2XY2A 3PL6B 2QBWA 3TA3C 1JNJA 1M71B 3L9RA 3MRDA 3VGHA 1EEUA 4TNWK 4E42A 1KJVB 1F3JA 3B43A 4I18C 2EEBA 3QULB 4QXTA 3T0BA 3WUZA 1T3FA 4HAFA 1C12B 4HKXB 2Z92B 3HPJB 3TPKA 2FO1A 5JXAL 5IM7B 4M5ZH 4PJ5A 1YN7A 5IVNA 1ZTXH 4EKXA 3VRIA 2DBJA 5D72L 4OTXL 5ACZB 4BH7B 3RDTC 3S36X 4NQXA 5C0GB 2VN4A 4FZEH 5DK0A 1FCGA 4L3ED 1KV3A 5TDOB 5MEQB 1YNTB 5DD5L 4LCWA 1T1ZA 4D0BA 4G6JH 4Z76A 5CZVH 4M1DL 1N3NA 1G6RL 2DWDA 4JRYD 2AGJL 3HS0B 4P4RA 4XXDA 4Z7NE 3M07A 2NTSP 1U3HA 5ILTH 2XZAH 3IDXL 2R0ZL 1CDJA 3A6BH 5EO1A 2EC9U 4ZXBB 3HPJA 5TQ2L 5D7LA 3DROB 1TVBB 5IK3B 4K8RC 5DMIH 3RZWA 5F1SA 1Z3GL 1XIWB 3HE7C 4POYA 4A6YL 5E56A 1F4WL 3GSXA 2AK1L 4WHTB 5D5MB 1R3HA 2VNCA 1MF2H 3GSNH 5E03A 4AYFA 3S4SB 1LP9E 4X80H 1I9JH 3O6ML 3LKNA 3B83A 4JO4H 4JPIA 3ZE0F 3LN5A 3STZA 3WHXA 1NAML 2EKSA 4S0TD 3QXAB 3O2VL 4D3CL 2NY4B 3IXAA 1WEJH 3U1SH 1DP0A 3ARDA 3MRNA 4KY1L 5TDPA 4PJEF 1WCBB 3BP6B 1OM3L 2FJHB 3MFFA 3FQUB 1ZXQA 2XFXB 4KJWD 5I9QB 4AY0A 4PRNA 3QCUH 1NCBL 1XGRB 1OAUH 3K81A 4XNQB 1T04B 2GHWB 4JFDE 4NKMA 4YGAB 3MNZB 2CIIA 4HPYL 4FN0A 1E4KC 1V3LA 4N1EA 3SOBH 4OZGF 4QRRE 3EZ8A 4Z7WB 4PG9B 4HBCL 4KK5C 3GO1L 5C0AE 1M7IA 3D87B 5FYJH 3EIFA 1I7UB 1P7HL 4WTXA 4GLRH 2C4XA 4Y8AA 4KROC 3PXJA 1IAIH 5DI8A 5KS9B 4PJAA 1HXMB 3L3JA 3MBXL 1ORSB 3MUGA 4PLJC 4X6CB 3T3MF 3NCJH 4O9HH 4RX4A 1I9IH 2DIAA 2ZNXA 5IUSA 1AGEA 5ABDE 4IEFB 4JKPH 2MHAA 1ACYL 3QWOB 4J3VA 4MX7A 2BNUA 4Y1AB 2FBOJ 4EIZC 2VYRE 3BH9A 2NXYC 5HHPA 2G9HA 4PP2A 1I8LA 4GG8A 1U8NA 2AJSL 1JRHH 2APVA 2VE6A 3TZVA 1AXTL 1ZVYA 5EU3B 4ZG1A 1YEGL 3U30B 1HSAB 2H2SD 3ORJA 1OHQA 1BQLH 3MLWH 4X0KB 1F3DJ 1S7VA 4PJFF 3GKWL 5HI5D 4LIQE 3B6SB 4S1SL 2IPUK 3HLAA 5DD6B 4QXWA 5C0JA 5DHYB 1WVZA 2YPVL 3EYFA 4D9LL 4RISH 1X7QA 3G08A 4QOKE 3U46B 2V2TA 2V5SA 1QSFD 2Y36L 5ITFA 3ULVE 1AGBA 2XWTA 4WWID 1KXTB 4FQXB 1DQDL 1NC4D 1JN6B 3LD8C 4QCIB 3WHE0 1HDMB 5E08H 1BGXL 4OT1H 1MHCB 5LJYH 2VWEC 1RFDL 1IVLA 1Z9SA 2FBJH 4XNQA 3BD5A 4Q9CA 2EXWD 3D2UD 3GK8L 4OLYL 1N0XH 1X5GA 4NDMB 4XP9H 3SJVB 3VDCA 3DNKA 4W6WB 4JRYB 5J11C 1NMBH 1I7ZA 2UUDK 2VDPH 4PV8A 1LO0H 5DUBB 4PJFA 3L3DB 4ZUVB 2DQHL 4QRPD 1A3QA 2OJZL 5IQ9A 3PP4H 4DK3A 3ARFC 3WN5C 1BWWA 3RGVC 3P4OA 2FWOA 5I1AB 3ZE0E 1HZHH 2XWBB 4R4FL 3MOBL 4KVNH 4KTDL 2V5YA 3T08A 4YX2H 3ZL4L 1JGLL 4LARH 3WNMA 3PF2A 1NGPH 3VRJA 5GZNC 5FECB 4DWHA 5JHDB 4G8EA 2JJWA 3SJVA 1NJ9A 2NX5E 3Q6GH 2GTWA 4G3YH 4P57B 5HHOD 5EC1B 2FATL 2ZSWA 1X5ZA 1L0XA 2Q76B 3MC0A 4LIQH 1EAPB 5TE4L 5DHXB 4Q6IB 4U1KA 3O4LE 5ESAB 2VLJA 4P2RD 4AJ0A 4FQCL 4KRLB 3ZE2F 1A1MA 4KJYB 3D85B 3BXNB 1EGJH 3WFEH 2WBJD 1U92B 1X6NA 4LVOB 1S3KL 1VCAA 4OZFG 3GSNB 1HIMH 1JUFA 4G80A 4OQTA 4QRUA 5C71A 1PG7W 1MFEL 4RFEA 3QISA 3C87A 5MHSE 3BUTA 1HN1A 4JFZH 2UY6A 3K0WA 3QUMH 5KSAB 4P9HH 1LP9A 2DQFB 5JHDA 3RWHA 1N5AB 3VMNA 5ICXB 3RI5K 3G6DL 4K8RD 4NQXB 1YECL 3V5KB 3QG7H 5I8OH 3BN9D 4CMHB 5FYJL 3OXSB 1KEGH 3IXAB 1UB6A 3ULVL 4Q7DA 3CMGA 2AJZA 3VFRB 3CFDB 2IGFL 2ZKHL 2LAAA 4LVEA 4PV9A 3O45B 4JM2A 1MRDL 2W9EH 3GIZH 2HKFL 3WFHA 4R7DB 4PJ8A 3HAEG 4QRTA 3Q2CA 3OR7B 4WI3A 4M00A 4QGYA 3QIUA 1TCRA 3V4PH 2P5WD 5LBSH 4ETQB 3MREA 3S88H 3X14B 4HZLA 1ZEAH 2AJ3B 4OZGA 4PREA 3S98A 2OL3A 1SBSL 5FGSA 1QD0A 3IDUA 2VUYA 3T0DA 3OAUL 1A6PA 2Y06H 4LCIL 2JE8A 4U6TA 3C5SB 2F58L 4LASL 1PD6A 2DYPD 4LGSB 4YXLL 3OKNA 1YA5A 5T3ZE 3LS5L 3TZVC 3G5YA 1ZHNA 2XZAL 5E1AB 4PS4L 1EHAA 4UAOB 2A0LC 4FP8H 5IBLD 3RTQC 3HMXA 4BZ1H 4EI5D 2YD7A 3HNVL 4HG4K 4ZNCD 4ENED 3QUXB 1G9MH 2CLVB 3PIQA 2AKRB 3W0WD 1AJ7L 5JDSA 3HNSH 1RIUH 2YD5A 3CFEA 3UAJC 1IAII 3ROLA 4ODUB 3T0EB 1S7QB 3FRPG 4OFPA 5D7JC 1IGIH 3W82A 3DO7A 4PGZA 3BN3B 4Y4KC 4MNGB 1LO4L 4OT1L 2JIXD 4ZO6A 3D18A 5IMKB 4DZBA 3BAEL 1C08A 3SDCD 3MA9H 1YMHB 2Q3ZA 3X12A 4M1CC 5MENA 4KKBC 1X4XA 3U6RB 1MCPH 1T2QH 4YBLC 2EIZA 4R8WH 3FB7B 4F7MA 3ZSTA 3SDCB 1CS6A 2BY2A 1E27B 4QRSB 1MFCL 1CD9B 2GTZA 5F1OB 2VKWA 3BPLC 5GRUH 2BFVH 3DROA 3BDYL 3KXFB 3G5VA 2X1QA 5C0ND 4PG9A 4MVBD 1T66C 4TSBH 2E7LA 2A9MH 1GAFL 4FQ1H 2FX9H 3D48R 3DURB 4PTUB 4URTB 3QJHA 4FQ2L 3FO1A 5DJXB 3C5ZD 3UP1A 4RGMC 5I71B 3QPXH 3SDCC 5CMAB 4FQQA 5L2JB 3CX5J 1I1FB 4XPHH 1WF5A 4Z7VA 3HUJE 5F9DC 5ACMA 2BMKA 5CJQH 4LBEA 5DT1L 2DYPB 4NGHH 4ZODA 5F21B 4OGXL 4RAUA 3TV3H 1EFXB 4MZ2A 4R4ND 3NZ8A 4OAWA 1A7OL 2HFFB 2OS7A 3HFMH 3P3YA 3PWVA 3KPQA 1NFDA 4WWKC 5CILL 3BGAA 4F3FA 3QZWG 2H9GA 1DBBH 1WZMA 3FO2B 4UT7L 2GJ6E 4Y4HB 2X9XA 2Q7NA 3LV3B 3S97C 2H2PC 3VCLA 2AABH 2W0KA 1T20A 2BCKA 4PP1D 3I6KB 3RUGA 2G60L 5D7IE 1RHHB 2P42B 3LS4L 4I3SH 5D7IA 2X89D 1YNLL 2NY1B 4N9OB 1NAMA 2FDBP 3DX6B 2WZPD 4EN3B 4NFBA 3DBXB 4GBXD 2R1WB 3B6SA 5C0JB 3FONA 1M6OB 4MA1B 3TBTA 4L1DA 2LV4A 5J89A 1SBBA 1GOGA 2FSEB 3VXPB 3PHQB 3WFHB 3PL6C 1FFNB 1FZKB 5F8QC 4MDJA 5D96B 3O45A 4TSBL 2B1AL 4KV5F 5JW4R 2OI9C 5GS0H 4GKZA 3ULVH 3LQAL 1DBJL 3SCMC 5DFWH 5L9DH 3D0LB 3I3EA 5CSZA 4ZUTB 4JFHE 5C08E 4L5FH 5H35A 1DQJA 1J1OH 4NGHL 1Z5LB 3I9GH 4QRRB 2XOTA 5E94B 2YA1A 4GAJH 1KN4L 3WSQL 2B1HH 5EOCH 3NTCH 1VFBB 3BEWA 3F5WA 5EPMA 3WJLA 3H3KA 4OZHE 4XPFL 2QKIA 3PHOA 3C09B 2K3TA 5EO9A 3FT2A 3FO1B 4Y7MA 2Z8RA 5KS9E 1KIRB 1MNUH 3QQ3A 5I1LA 1KELL 3M8OL 4R3SB 4JFED 5DZLA 5EN2A 4MVBC 2XV6B 3LHPL 5C0CE 1MAMH 4ZXBC 4S1DD 5DC0A 1OAKL 4R2GD 2C4FU 4V1DA 5ESAA 4BZ1L 4JR9L 3M45A 1FNEB 1CICA 1FIGH 3RTQA 5HHVH 5CUSH 3OAYK 3CVHA 3GEWB 2VMFA 5INCA 1D5XB 4APQA 3BWUC 1UJTA 1NCTA 5FOBB 2YS4A 3U7AA 3REVB 1NGPL 4M7LL 1YMHA 4MNQB 5J0BA 3LQAH 4PYHA 4U31A 3VXTA 2CGRL 3I6KA 4XB7A 5ID0B 4R3SA 2VLJD 3DRQA 4P2RA 4UU9B 4G8IB 1G7QA 3FT2B 3QEQD 3KPNB 3S36L 3ZDXF 4MNQD 3WO4C 2HRPH 3EO0A 5T3ZH 3V0VB 3UJIL 1A5FL 4KKCD 1MREL 1L0QA 1LK3L 5FDWB 1QFWI 4QHMB 1N5YH 1ED3A 5D7SH 3HZKB 1RZJC 1KC5L 1QNZL 4YBQC 3DX8A 5E1AA 1F6AB 3CFBA 1DCLA 5D1XB 1UJ3B 4X6DB 1FNLA 2CK0H 5BV7C 3BE1H 4XPGH 3WO4B 2YD6A 5JW4Q 3MOQA 1UACH 4L9LB 2P8PA 3MRFB 4HIXH 2I9LA 3I2CL 1S7TB 3GMOA 4P2OC 4JZOA 5C07E 1PZ5B 1ZA6B 3O0RH 1DUZA 5DC9B 3QFJA 3MV8B 5D2LE 4CU8A 3MLXH 1X5HA 1IGJB 3KLDA 4RGND 1U41A 4PRIA 5DWUL 1MCEA 1TCRB 3C9NA 1TZHA 1T0PB 4HF5H 1ACYH 4JN1L 2EIZB 4DKDC 4U1GB 4X5LA 1M05A 3TBVA 2J2ZA 4GKNA 5K59F 2ZCHL 1BQHA 2DQCL 5L8KB 2E5EA 2OL3L 3FO0H 2D7MA 4KI5D 3L3OA 3SQOL 5BVPH 2JCCA 5JHDE 2YK1L 2NY3C 4WWKA 2I26N 1OARH 3LEYL 4JG0L 1B9ZA 4HS8L 1H5BB 4K3DH 5C0CB 4L4TD 2BC4B 5T3ZL 5DA0B 4ETYA 3F12B 2FO4B 5FO7B 1A5FH 1JVKA 2A6JA 2C7UA 2VL5A 3O2VH 5H2BA 3K4DA 5T5FH 3LEXA 1YEJL 4U3CA 5JOPE 3CFEB 4RAUB 4U1GC 4KMTL 3K2MC 3E0GA 4ZUSA 4HUWB 12E8L 3KAAA 1U95B 3QUXA 2L0DA 2NXYD 5CD3B 3ARZA 3MRLB 1V7NH 4JHAH 2ICEB 2AJYL 4X7SH 3EYUH 3BE1L 3PL6A 3EDEA 5K9JH 1FL3A 3MV7E 4MCYB 1DANU 4XP4L 3C6LA 4OUUA 4GRWE 2ED7A 4NZRH 4WY7L 4PLJD 3LKOB 3GJFH 5FO9A 4ELMB 4M93B 1QFHA 4JRXE 3V2AR 4ZTPL 1DVFB 3SKOB 3M17B 1OB1A 3S96B 1LD9B 3DXAB 4Q6IA 1YEKH 4U1KB 3DTXB 1FL3B 1ZANH 3D3VA 4CVZB 3X14A 1IM9D 5I1HH 1FC2D 4F7MB 2EDBA 1DBML 4P5KB 2SEBA 3OKEA 4J4PD 5D2NA 4BSVA 5L6YL 4KK6C 3E6HA 4PGBA 4RMTA 4F80A 5CJOH 1J8HB 1SVZA 2F53B 3RWIB 4L8SA 1AXSB 4WI2A 3B2VL 2QQNH 3VGAC 1KELH 2OXGA 3VG0H 4P23B 3VD4A 4RZCA 4UDUB 3LRSA 2ZOLA 1BX2A 4LSQH 2FECI 4HK0B 3BIKA 1JF1A 3ARDB 1OAZL 3MO1A 1G0XA 3DYOA 1YYML 3OZ9H 3HE6B 3QH3B 1JMXA 1JP5A 1A7NH 4LPYA 1XAUA 2VXVL 3T0AA 4UOW0 3TEUA 4X9GA 5HJ3B 1MCDA 4FTVA 5E2TH 4UNVA 4NPYB 1K9TA 2C26A 2CLVA 5F7DB 4V2CB 1VENA 4NKQB 4GKNB 4Y5XC 3RIFF 2R56L 1CICC 5GJSL 5ALBL 4RAHA 4PJIF 4ODSH 4ZD3L 3IFLH 1OTUD 1U42A 4MGXA 3ZTNH 4KQ3L 2YUWA 2VB5A 4HLZH 3U4EA 3GKWH 4LLDA 4J3XA 3FOMB 5TH2A 4M7LT 1JNHB 4MQSB 1TQCC 3RX7A 3WEXB 3T77B 4I3RL 1T0MA 5D2LF 4G6JL 1RUQH 1AIFA 5L2KB 3FB8B 1P7QD 2XN9A 3ME0A 4JKPL 2ZUUA 1BECA 5EU6A 4P9HL 3RJQB 1FFQA 3BP5B 5FYKL 4F9LA 4OUUB 1KIRA 3LKPA 4X4YB 4P2RE 3O6KL 1ACZA 3PWJB 2F5AH 5KVDH 2BJMH 2Y06L 3QDAA 1N7ML 1L6ZA 5F7UA 4NC1C 1Y18B 4E41A 5JLZB 5CEZH 1RVFH 1UACL 3O8XD 3U7YH 4HKZB 2VN7A 2Z31C 1JYWA 1QA9A 4KDVA 4PJXA 1IQDA 3SPVA 2CRMA 1QBLL 3MRCA 5B21A 1DEEB 3QPQD 3HZYA 1G7MA 1UT9A 3GMLB 4OCYL 5EWIL 4HH9A 4QXGH 5MERA 4LARL 3CC5B 1NC4A 4ZTOH 4KWUA 5HDQL 5FYLE 4Y4FA 4KY1H 1CDGA 3V52L 3BPCB 4M5YL 2FJGA 3E2HC 4B0MM 1JHKH 5ESVA 4NP4L 3HUJF 1T2QL 3OSKA 5EN2B 1NMBL 1FHGA 3T3ME 1JK8B 4KKCC 5F9JB 4AIZA 5E5RB 3ULUL 4KUCD 3BEVA 1U6AL 3TC9A 2EYTB 3BPNC 3RVUC 2NY0D 1ZT4B 2FZ3B 1NFDF 2WUBL 5I2IB 5KSAD 3N85L 2O93L 1NDMA 3NH7L 3QQ9C 3IDJA 1T5XB 3QDJA 4U1HA 5MEPB 3WIHH 3C6LC 3WHE1 3RVXC 4DAGL 2IANE 1KULA 4OB5H 3S34H 3D1MC 2EE9A 2R2HA 1JZ8A 2X1OA 3RDTA 1L7IH 4BQ9A 2P8LA 2YEZA 3LRSB 3DRQB 4P2RB 5AEAA 1KJ2B 3DSFL 4HS3B 4PGCA 3S3JA 4Y4KB 4D0DB 3BYYA 1D5ZB 1PYWA 4P3DA 4PRHD 4QRQA 3AAZA 3MLUL 4GO6B 5L6YH 3EYSH 3VXRB 3IETA 3IFPB 1HKLL 3O2DL 1GC1L 2CIKB 3TCLA 4D0CB 5T1MB 4OI7A 1U8QB 4EDWH 4Y4KD 4L8SC 4NWUL 3UYRL 1FORL 4BFGA 1JE6A 3DETC 1OB1B 2ZUYA 3S96A 1TTUA 5EOTA 3G6AA 1HCFX 2NXZB 1SBSH 3SQBA 3PNWB 3KLHC 4U0QB 1FYTB 3B8YA 2GSGA 2IH3A 4K9EC 4PJEE 2YPVH 3MLSH 4HUXA 5BJTA 1X5KA 3S5LA 3T04D 5I1KH 4DZ8B 5E00B 3WKNA 4ODUA 1GGIH 4J1UB 1UB5A 4TNVF 1U8LA 3B5GA 2FHCA 4G7VL 3ZZ1A 3H42L 3IGAB 2IFFL 1EHLL 2FX7H 1H15A 4WFHD 2Y23A 1JCKA 5DEFB 2IMNA 4KVCL 3TJEL 15C8L 2X10A 3DUSA 2HVJA 4JPVH 1BOGA 3CGTA 3DV4A 2X2YA 3UTQA 1MRCL 1CFTB 5FYKH 4PJCB 3GMRA 4NNYA 1KB5L 2A6IA 4WW2C 4U1SB 5ETUB 4LQFH 1KTDB 4I48A 1XF5B 4N8VG 4ODXB 1E27A 3U36B 2QJDA 1MWAH 5FHBL 3MBEB 2W9DL 2L7UA 3TBSB 3ULVD 4ETQA 1G6RB 1FN4B 4M03A 4OM1L 1D3CA 1U91A 4OZHF 3UCRA 4LF3A 5D70H 3T0EE 1NGXB 3TYGL 1AQKL 3TFKC 5IVZB 1CXHA 1WWBX 1Q9OA 3BDYH 3QEHB 2F5BH 3SKJH 4OIIH 5I1KL 5LGJA 4L4VE 3GHBH 2E6JA 3T0EA 1CFTA 1WTGT 4FQ2H 1T04A 3VFTB 4DN4H 2V2XB 4HLZG 1MHHB 3WMSA 1EFXA 5I19L 1KACB 3E6FB 4OFYD 5GIRB 4WU7A 3QEUA 5EUOF 4XP6H 3SDYH 4LSSL 1LO3H 1TENA 2W07A 2FZ3A 4NC1E 5I15L 4UQ2B 3LH2L 1FVEB 1UB5B 3PWNB 1F90H 1WBZB 4R7NB 4P3WA 1CL7I 1MY7A 1H0DA 1JYXA 4LAQL 1DBMH 4HIEB 1I8LC 2JB6B 2X40A 2EKSB 5INDA 3QDMD 5A43C 1Q9OB 4PJBE 4PREB 4LQ1A 3KPRE 4TUOB 4WI4A 3QRGL 3MR9B 2FJGB 2QQQA 3K2UL 2C3VB 4NRYB 1CXEA 4XAWH 5KSVA 2D7OA 35C8L 4H0IA 4DAGH 4J8RA 4PRID 3VFGL 3CC5A 2R39A 3KPPB 1ZWIA 5CP7B 4L4TB 5HYQB 1NCUA 5DJ0A 1G7PB 4YH6A 5EO1B 1ERNA 1OAYH 5B38G 5F70A 2O5YH 5IIEA 1IKNA 3OJDB 5E08L 2ZOKA 3OAZH 3ROLB 4NQVA 5K9QI 4OQTL 4HULB 3O6FD 4DQOH 3FQXB 1J10A 2V2WB 3BEWB 4MJ5A 3C6LD 3QDJB 1T5XA 1Y18A 3VWKC 4EUPB 2C1PA 2HJFA 5CSGA 4X6FB 3ALXA 1Z5LA 4XC3L 1KENL 4HCRH 2KKQA 5DFVD 3D9AL 2MQ0A 2DI9A 1TJGH 2ADGB 3I2CH 1OT1A 1I3RB 1UKSA 3HC4L 2X4PA 1NC2B 5F7MC 3WS3A 1VA9A 5MP6L 3V4UL 5EBWB 2F5AL 3KLSA 5KVDL 2ZUSA 5GGTL 2D4DA 5IQ7L 2CRYA 3C5SA 1JN6A 4OLWL 1NMAL 2P5WE 4BZ2L 3R06B 2PUQT 4ZFOL 5I0ZA 2GUOA 3HNTH 3ZT5A 1UZ8A 1J0JA 1A7PH 2GJZB 1FNFA 4LLDB 1H3PH 5MI0B 1FYHB 4JB9L 3GUTB 1A3RH 4MWFA 4X5XB 2CDGA 5C07D 4F57L 3OAZK 2Q8AH 5EWIH 3HAEB 3IAQA 4X4ME 5FCUH 3RVVC 1S7WA 4BKLA 4PP1C 2IBZX 1UGNA 3CNKA 5EZLB 3QI9D 3KNBB 1U93A 1JHTB 2DD8L 5DZNA 4UILH 1CVSC 2DLEA 3CLFL 1P84K 3SDXF 2XKSA 1AGDA 4OCNC 2FEEL 3TNMB 4PJXF 1VFAA 4JQVC 4POUB 1OSZB 3CCHA 1G6VK 3HG1D 5LQBL 1OSPH 2IH1A 4XPBH 3FQTB 4K23L 3X3GL 2KUTA 3QPXL 4EIGB 5KSAA 4IHOA 4XCCL 4J1UA 3MV9A 3N1MC 1KCSL 1YQVH 3W9DB 1R3LA 3EFFA 1QBMH 3VG9C 4HLJA 1SJEA 3KPLA 3MCG1 3RA7L 3H9HB 3L7FB 2F54B 1ZS8A 4M7LH 3D0VB 5F97E 1NCAH 5KG9A 3VXQB 1F4YH 3GI9H 1P6FA 4PRDA 4YR6A 5C9JA 3HHRB 3MV7D 4MMZC 5T5NF 2DF3A 2O5XH 3QIUC 3V5DA 4TVPE 4X7CC 4Z7VF 1S9YA 5DQ9B 3VXMA 1PKQE 5J6GA 3SN6N 5HVGB 3VXRA 1BD2E 3DVFA 4PJDF 4ZOAA 1D5BA 2ATKB 3IDNA 4PJ5D 1CG9A 1I4FB 3I85A 4R26H 2J88L 2VXUH 1N59A 5I8EA 1FH5H 1KTLA 2HJKB 5CGTA 4G9FA 1HZHL 5D5ME 1PSKL 1HINH 1OY3B 5DURB 1IKFH 4RQQB 3QXAA 1PQZA 4XNYL 1TZGH 1BX2B 4OBRA 2ILLA 1XZ0B 1HE7A 3FTGA 3IDJB 4U1HB 3F7VA 3TIEB 3BH8B 2GJ6D 2UVFA 3MRJB 5I6XC 5DC4B 2EXYC 3V6OA 5ECJE 3BJ91 3LDBC 2E9IA 3I3DA 1DQML 3L3KA 5K9JL 3K8MA 1VPOL 3QEQA 4KAQL 5ADPL 1MUJB 2YPLB 2VLME 5HDQH 5FUOH 3EDJA 3FQNA 2Z4QB 1AD9B 2D2OA 5JQ6H 3V6FB 2DDQL 3AU1A 4I2XA 4MB3A 3SDXE 4FFWC 3K74B 1JYNA 3H3PH 4P4KC 4FZ8H 1NAKL 3UXFA 1CL7H 1GIGH 1XH3B 2FIRT 5ESVB 5I6XB 2NXZD 3VXMD 4PBXA 1M7DA 3BHBB 5DHYA 3SE8H 1CDYA 1XGYH 4YAQB 1GGBH 5SWQA 5IJKA 3VU2A 3VXSA 4E9LA 4ODBD 3MV01 4N9GA 5TE6L 3HC4H 3BT2L 1S7XB 1G7JA 3HC0B 5D6DA 1CD1B 3P4MA 3MXVH 3HZVA 4WFEE 4YHZH 3HPLA 3THMH 3ARBA 3VXOA 1JGUL 3MRRB 1QLRA 1A6ZA 4N8PA 2ZOKB 4HWBH 4DN3H 3HI6H 4U0RB 3BZEB 1S7RA 3PWLA 1YN7B 2X7LB 4G8GE 5D7LE 5JW3L 3WIIH 5TJWK 4BJLA 3GM0A 2FIKB 4MD5A 1GGYA 3K46A 4N0UB 1IGYB 2CDFB 4IMLB 5F7HA 4XMPH 4S0SD 5DQJB 5C0FB 2D0HA 2R56H 3GMPA 5GJSH 2IBZY 3IF1B 5I9QC 3UTOA 1TFHA 3U1SL 5I71C 4TUJB 1IAKB 5I1HL 4JANA 4N0FA 2ESVB 2ZP0T 4M6NH 2CKBA 3DXAA 4U1JA 3AMLA 5L0QC 3EOBB 3LKRA 5TQ2H 5FO9B 5DJ6A 4MHHI 1ZGLP 5CJOL 3VFVA 4HMEA 3WFZA 5ADOH 2XZQL 3QUXD 4XPGL 2R4SH 1UM5H 5F71A 1RZJL 4RA0C 8FABA 4LSTL 1UQSA 4FMFA 4FFYL 3MUZ1 4Y0GA 3TVMC 3GDBA 4LNVA 3BKJL 4R90L 4DKEH 5E7FA 2EXYD 1G9ML 4N0UA 1AO7B 4KTDH 2YPLE 2EIDA 4QHMA 1A1OB 5I0DA 1L7IL 2NY1C 3CH8A 4AEHH 3MJ8A 4BH7A 3T65A 3SKUD 2I5YL 5LAXB 2EE3A 1CTOA 1IGIL 1TQBC 5DRNA 3GSOA 1BJ1J 5I1DA 1QLFB 3Q5YA 3P4OB 2HVKB 2N7BA 1WFNA 2YK1H 3HAEA 2COQA 3HZVB 4WU5A 1KG0A 2A6DA 3RNKA 4Y88A 3QXVA 4JRYA 4OLUH 5FOBA 3WJLC 3SKNB 4C59B 4RMVA 3NCEB 4M6NL 2DAVA 1FE8H 3MBEA 3V52H 4BSWB 4EOWL 4MSWB 4GG6A 2X4NB 2ARJB 2D0GA 5C0BA 3VXQA 5E6ZA 1NEUA 5C0DA 2DM7A 4ZXBA 5DMKA 3FO2A 5D93B 3DRTB 1OGTA 2EH7L 3FB6A 3OG4B 3QA3B 2X05A 3ZE1E 5DRZA 3RL2A 1U6AH 3KPSB 5BZWB 5SWZE 3DX9A 1RZ7L 1CD8A 1MQKH 4OF5A 4HZAA 4PRAA 3O3UN 3KYMB 2J6EA 4QRPE 4OGXH 3NCYP 4HUWA 2OTUB 5FM4A 2DBLL 1AKJD 3CLEL 5DK0B 4JQXA 5FO8B 4U1IA 5JNYA 1SEQH 2UZIH 1MFBL 5ANMA 3UAJD 1UFUA 2HTLD 3D85D 5DEGA 4JB9H 3X13A 3WDIA 2VDMH 4PTUA 2OM5A 4G9FB 1WAAA 2P5EA 4O51B 2Q8BH 3LS4H 3DETD 2W91A 1ZSDA 4JFPA 4POZC 2R23B 1F4AA 5TQ0L 1P5VA 3ZKND 2YN5A 1XF2A 3ECBA 2VXQH 1ES0A 2R0WL 4FFVC 4YHLL 1PZUB 3ARXA 4BQCA 1IM9B 1MCCA 4D9QE 4PR5A 2F54A 4FXGA 4NFDA 5FB8B 1KG0B 3NA4A 4D9RE 5CLWA 4AH2A 1RV6X 4X4MA 4TQEH 5B8CA 4ZNEA 5EORH 1ZOXA 5DEGB 4LVOC 4NZUH 3RUGF 4O2FB 5CBAB 1OGAA 2EDFA 4C4KT 4X6DA 5EG6C 2VC2H 3KYOB 1OTSD 2WWMD 3VFMB 1KN4H 3WSQH 1LO0L 3TJHC 4JO2L 3J7HA 4C83B 2PO6A 2R2EA 3PP4L 1CFVL 4P5TC 1KPUB 4MS8C 4EVNB 3O9WB 1KCKA 1KUMA 2EIBA 1GC1H 4TNVK 4FG6C 4PB0L 4MNQE 4O58H 1A4KB 3CSYB 1RUAH 1YY8A 4W4NA 3G9VA 3KPSE 2WIIB 3C8DA 3ES6B 5FB8A 4Q2ZA 4KKLD 35C8H 1KLUB 2E8ZA 1I7TB 3V7MA 1DBKL 3B9DA 3VG9B 1OPGH 4ODVL 1K4CB 2ESVA 5CUSL 1QSEA 2AP2A 5ICZB 3E8UL 5DTFB 2UWEE 5F1KC 4AEHL 2BK8A 3S5LG 1RIHL 3NA9L 1J12A 1GH7A 5TGBB 4YHYB 4YUEH 4EBQH 4OGYH 2AEIT 3UBXB 2CQVA 2O61A 3RWFB 4OD1H 4QKXB 4ZAKB 5F7NC 3QPQC 4JFDB 4HUVA 2VQ1A 3RWEA 3MRCB 1PAMA 1YZZA 1C5BL 4GG6E 2VQUA 1QA9B 2GEEA 3RX8A 3KWWB 4R0LA 5GQBA 3S9DB 1GGCH 1K8DB 3VFUB 1T1XB 3P2TA 4YDJB 3LPGA 1TJGL 3EFDH 2VDOH 3RVWD 4I0PC 4S2SA 5FGBA 2HRLA 4IJ3C 1G7JB 3HC0A 1AY1L 4ZO9A 5KSBA 1RJLA 4ZUUB 4NYLB 5GIRA 1IGCH 4OLWH 4HJJH 4KKAD 2XY1A 4PJ9C 2K9UA 4E5XB 3BZ4A 4TTDC 1S7SB 2VITA 3BP5A 4WUUD 2NLJA 3C5ZA 3P0VH 3GIVB 3AUVA 4H25A 5DURD 1RURH 2VLLA 4GW5A 4CNIB 1N6QH 4P23C 4OJFH 1F3JB 3QBTB 2VZOA 1L9NA 1QO3A 4JDVB 4MQXC 5KSBF 3G6JA 1GZQB 5E8OA 4DN3L 1BZ9A 5LBSL 2BSRA 3W39A 4QXUH 5FCUL 1I8KA 3HZMA 3ZTNL 4MNHA 5GGUB 5C09A 1SEQL 3C2SA 2IJ0C 5J1AA 2X4SB 1C16B 5DJYA 4NQEA 5D7IB 3ARPA 4MAYB 5IVXE 4ALAL 3OKLB 4UDTB 3MJ6A 3MV7B 3NGBB 3JWDC 2MNUA 3GJEA 5C6TH 4F9LC 1TZIB 4DOHB 1ZA3A 2AJVL 4NWUH 4P49A 4M6OH 5CJ8A 2OYPA 1CU4H 3ARRA 3AB0C 2LAGB 2QADD 5FUCC 1FZOB 1S3KH 4H88H 1G9NC 3HMWH 5HSFA 1DJSA 4R26L 3B9AA 3L3IA 1RI8A 1X5JA 1MCIA 1CLYH 4KV5E 4XWGL 2ZCLL 1B4JH 1IKFL 5GPRA 5JIIA 5F6IB 4NJ9H 1FFOB 3SKMB 1I1FA 1WC7B 5TFSH 4RWYL 2X1WL 3NPSB 4XNUH 3OBAA 4LSTH 4MJ2A 1U8KB 3AB0B 3OMZA 2QV2A 4KRPB 4JR9H 1OL0A 3RGVD 2H32A 5B8CC 1XT5A 3RVXD 1JK8A 5C7XH 4PLKC 1B2WH 3FQNB 3U2SA 3VXSD 4M8QB 3OB0H 3G08B 4OLVH 5IVZA 1W0WB 2RCSL 1GVIA 3TP4A 3QEQB 2YWZA 3X17A 5B4MC 4KUCF 2GFBA 4P59H 5HHMD 2CGRH 3SO3C 4GW1A 2LABA 3OKMA 1RK1A 2V5TA 1OAQH 2IADB 4MA3A 1RJZA 1ZKAA 3AAZB 4DGYL 3GMLA 2XN9D 4H26B 1FLTX 1OOAA 4F58L 5LG1A 5HYSB 2OI9B 1BVLB 1KF9B 5CKAA 5K9OB 2WWKO 1BHGA 3SCMB 3FZUC 4JGMA 4IRJD 4FHBD 3RHWF 1XF4A 3ARBB 3U9UA 4CGTA 1FVDB 1RJZB 2AEQH 1A64A 1B4JL 5GJTL 4JZJB 1D9KC 2B1AH 2JJSA 2BRRH 3RPKA 4WV1C 1T1WB 5ITBL 4HK3N 4LOUD 3MJ9A 4ZPVA 1SJXA 5HYEA 5E00A 1I1YA 2OK0H 2F15A 3MTRA 4WCYL 3GSNA 1NCCL 5B3JE 4QHNB 1FCCA 4JG1H 5FF6B 3MXWH 3AU1B 4I2XB 3BXNA 1A6WH 2P8PB 3KYAA 5DD0L 3ARED 5J9PA 1FO0B 1LE9A 3DIFA 1YYLH 3FHQA 3KGRA 4BSWA 2OSLA 2VLMD 2VDML 1NEZG 2DD8H 2XACC 4OGAD 3DX8B 5FGBC 4YHZL 1HKLH 2NY6B 3Q6FA 5DRWA 1QFOA 4HS8H 2YXFA 4IOIA 5DK2A 5GZND 1G1CA 5E9DB 4RWHA 5LVEA 5C07B 3H9SA 1E4WH 3ZTJG 3PWPA 4CVXA 3CIQA 2X4TA 4PJCF 5D1ZB 1Z0MA 3QEQE 3MCLL 3REWA 2BNRD 4JN2B 4RSVA 2DQTL 5I1AA 2WUCH 1G7QB 5AUMA 1ITBB 1A8JH 5JUEL 2PW2A 2MMXA 4OGZA 2BDNL 3PWUA 5E1HB 5A40E 5D7KD 1KPUA 2W0FB 5GRWA 3H9SB 3WFEL 3OKKA 1BIIA 4E41B 5T5NG 2VXSH 1HNFA 1DUYA 3W0WB 4J8RB 4HIIB 5I66B 4OQTH 5D5MA 4G8GD 4IM8A 5IMLB 4M7ZC 5C8JA 3GNML 2BERA 4KC3B 3NFPA 4HH8A 1W8OA 1NUFA 4LVNB 4UT6L 1KENH 4PD4K 2WK2A 5FUOL 1MAML 1JV5B 3FMGL 3O6FB 2F19H 1I75A 2YWYA 3ARGD 1S78D 3A6BL 4WNQB 3ZDXE 2H32B 4DKEL 5KN5A 1H0DB 5FIEA 4KXZH 4UV7L 5HHVL 5EUOB 5I1EL 4J3SA 5ALCH 3MYZA 1BFTA 2CR3A 4I5BB 4O4YL 5IB1A 5KVEL 4XP1L 4GRWB 1XGRA 4HHAA 4WEBH 3IDMA 4GQ9H 2DQHH 1MCHA 3TVMB 4XTRC 1EEZB 1NBVH 3LQZB 2FIKA 3TNMA 3BKYL 4D8PA 2X41A 3PV6B 1S7RB 3PWLB 3RKDC 4LSRL 5IR1B 2BDNH 3ULSA 5DRXA 1UWGH 2BVYA 4X6EA 5E2WH 3VH8B 4M7JL 4Y8DC 5ISZD 4HK0A 4UINH 4L3CA 1DBJH 1DQDH 3KR3L 4ONHA 4QTIH 4ZUWA 3OPZH 5JLZA 2ORBH 2OL3H 4JHWL 5HD8D 3INUL 2OTPA 5FYJD 2HTLC 1RFDH 1AGFA 4X5XA 3F62A 3FFCA 3GNMH 3U79A 2UYLB 2P45B 3LH2H 4K8RL 4YXLH 4HV8B 1R0AH 3QXWA 2FLRT 2F19L 2BXZA 4JDVA 3ULUD 1ZLSL 2AK4A 1FVCB 1LEGB 4ONFL 1NMCB 4EJ1C 1AE6L 1OP5H 5H37H 1X3DA 4ISVB 5KSUB 1LDPH 4TNWF 3VGBA 2X4NA 1G7IB 5GGVH 3GIVA 4NN5B 4YHLH 4YHYC 1JNHA 1NCDL 4HWBL 3O6LH 5J8OA 4HSQA 4HW6A 2ADGA 5JXEA 3BDXA 1FAIL 3VD3A 2DQCH 3RY4A 3SQOH 1W72L 5JO5A 4HIJA 1QBLH 1ORQB 3UROR 1I9IL 2GCYB 3WFDH 4HUMB 3QFDA 3MLYL 4XBEH 1MPAH 1JF1B 2FEDC 4M02A 2UWEF 2CK2A 4CVUA 3MV7A 1LK2B 4WI9A 4YE4H 1FYTA 4DVRH 1MRDH 2W9EL 1AC6A 2YRPA 3QI9C 4K94L 2YD4A 3MLRH 1WIUA 2BSED 1HHGB 1U8PA 2RAMA 1QHPA 2MQCA 3QULA 3LCYA 4M7KL 3P0GB 3UTSE 4H0GA 4K8RH 2RIKA 3QUML 3SO5A 5IF0A 1DBAH 1R5VA 2EDHA 1CLZL 2V7NA 1C1EL 3DI3B 3RPIB 1F2QA 4Q6YA 5FYKD 1NANI 2GITB 2Z93A 1AE6H 1B6DA 2EDXA 1OPGL 1LDPL 3VFVB 5GSVB 5CEZD 1TETL 1A3LH 2V7HA 2N1KA 3BW9A 3MGOB 2WLZA 3N85H 1YEDA 3QCTL 4LPVA 2X9YA 2GK0B 4PS4H 5CP3H 1GGUA 3EFFB 5F6HI 3EOAA 4PJ5E 3KPOA 3DVIA 5FA3B 3V7AG 1BGXH 4GMSL 4PRIE 3NFSL 4HT1H 5E2UL 1J86A 1U8MB 3SDYL 3KYMA 5E99H 1Y0LA 1G7LB 3BO8A 5BRZD 3DO3A 4ZDHA 1AQDB 1GGCL 5DMGD 1T1XA 1WEJL 4WTZG 3P73B 4YXKL 1ZEAL 4GS7C 3MRIB 1FZOA 1MFNA 3VRIB 1C7SA 3HE7D 3I02B 1R5IA 3ARFA 4DVBB 2KQMA 3DMMC 1MI5D 3ZDYE 5BXFA 1OARL 3TIDB 1UH2A 3UJJH 5D1ZA 3N1FC 3ZKMD 2EE2A 2FL5A 4JGJA 3OF6D 3VFNB 4PJGA 4HUNB 2WP3O 5KSAC 4Y16A 1OT2A 5IVXF 5BVJB 1WQVT 1K2DB 2D3VA 1I1AC 4PG2A 4XPAL 1XF5A 1YEHH 4FQLL 2E7MA 5DVKA 5HTSA 4JHAL 1AJ7H 2YN3A 2NY6D 4C56A 4GMTL 4Y2DB 3ETBF 3QIBC 4XPTH 3DX7A 3DGCR 4UTBH 2VR9A 1FZMA 1R5WB 4PJCA 4TOYH 4M9OA 4XRCA 3GSUB 3BP4A 1FZJA 1KJMA 4G6MH 4P4KD 3UPAA 4M5YH 4AMKL 3MBXH 4XBGA 1PKQA 4TSCL 4ZTPH 5JMRA 5L2KD 4M1DH 2NW2A 5E99L 1RZIB 5CJBA 3MV8E 4NNPH 5C6TL 5D7JB 3BH8A 3UTPE 4XC3H 5KSBB 3QCVL 3OKDB 5CHNB 3MA7B 1X5AA 4S10A 4JO1H 4F33A 2P48B 3N9GH 4U1LB 5D2LB 2QADB 4PRPD 1WIOA 2P8MA 4JAMB 5IB1B 1T89C 5BQ7A 1U8HA 5F88A 3ZTJH 3H0TA 25C8H 4QY8A 3AROA 2Q86B 4F2MA 3QDJD 3IDIB 5IIEB 4KZEL 4GW4B 5I8OL 2ZCLH 2BZDA 1AGCA 3GSUA 3RVWC 4G80B 4Y5VC 3CVHH 1UWEH 3HE6D 5C0EA 4I3SL 1R3JB 3H3BC 3SCMD 2J8OA 3O3AA 3QQ4A 3BISA 2IGFH 4QNPF 3LZFL 2RGSA 5SWSD 1S9KC 1QRNE 4H20H 5CIPB 4UAOC 4OIAA 3V6OC 3VXMB 2PYFB 4WUUE 5J6GB 3EJZC 2FSEA 2IEPA 3RTQB 1BIHA 1FSKC 5B39A 1DANT 4JM2C 4JKKA 5JORB 4FFZH 1KNOB 3UX9B 4KZDH 1IAMA 4LHUG 2F8XC 4OCRH 3KPMB 5KVGL 3VRJB 4OFKA 2VJXA 2D7NA 3QNYB 2AI0H 4MQXD 3TWCL 4P4KA 5JQ6L 3HFML 5A2JH 5F9OH 2YD8A 4DCQB 4I3RH 1U2CA 1DVFD 3GK8H 4OLYH 4G6AD 4LPXA 4BZYA 1GIGL 4Z7UE 4YDVB 4U1IB 2DL9A 5GS2D 3REWB 5IJKC 1F02I 2E7BA 4YWGL 3WDHA 1A1NA 1CIDA 1MCSA 3QIWB 1HH9B 4JJ5B 1Q0YL 2HT3D 1BD2D 1KN2L 3L3IB 1NLDL 5IROA 5IHZB 5ACLA 3CFKA 3RVUD 3CSPA 3A67H 3KPOB 3P77A 3BP4B 5KVEH 5E6IA 3QRGH 3RKPA 5B38A 1B0RB 5B3NA 2I25N 3SKOA 1YEFH 4AH2B 2ITDA 2A77L 3BIAX 5HVWA 3ARBD 5EZOH 2GW5A 4X7DC 4HT1L 5E2UH 1EJOH 4YK4C 4XBPA 5C09B 4G6FB 4RIRB 2Y6SC 4U1MA 4XWOC 2BXYA 2DQUH 3MRJA 5GS1C 1W72B 4G9DB 5IJVA 1FG2A 5C0FA 3KS0J 2VZ3A 3L6FB 5E8NB 3JUZA 4GBXC 5F89B 5LWYL 4NP4H 4Z95H 1G9NL 1AXTH 2R0WH 3ZKQD 3EYUL 2CMRL 1I3GL 1IQDB 5FO7A 3X13B 4OM1H 4Z77B 5KTEH 1JPFB 2EEAA 3SGKA 4BK4A 1G7LA 3ZMRA 5EORL 3R8BB 1RAMA 3RL1B 4KVCH 1FNHA 1PX3A 5FUZH 4X6CA 4JO3L 4KXZI 2V2WA 5CJQL 5E5MB 1UQSB 3WL9A 4YPGB 5FA3A 2CLRB 4XTRD 4JPWH 4XBGB 1ZHNB 3EHBD 5DJXA 1A9BA 2NXYB 4YHMH 1F58L 1MHPH 3CPLA 3ESUF 3IAGC 2X4RA 3H3PL 4LQFL 2OJEA 4ALAH 1T5WB 3FB8A 4B53A 3RPIA 2JELH 1L9MA 3GB7A 2YXMA 4LHUD 4XBEL 4M6OL 3MROA 5E0QA 3FN0H 4A2MA 4LLVB 3SGDH 1A2YA 4Y16B