2E27L

Crystal structure of fv fragment of anti-ciguatoxin antibody complexed with abc-ring of ciguatoxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'IQMTQSPSSLSASLGGKVTITCKANQDIKKKIAWYQHKPGKGPRLLIYYTSTLKSGISSRFSGSGSGRDYSFSISNLEPEDAATYYCLQYDNFTWTFGGGTKLEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-ciguatoxin antibody, light chain
publication title Critical contribution of aromatic rings to specific recognition of polyether rings. The case of ciguatoxin CTX3C-ABC and its specific antibody 1C49.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e27L00
1NC4D 3KYOA 1U3HB 3K8MA 5MENE 3OR7A 5JR1L 1HXMA 1MFDL 4NNXA 5F9WC 1D9KB 4K3DL 4O02L 5FCSH 1A2YB 3IETA 4NDMB 4Z7VA 1R5IB 5JW4N 3WJLC 1X5FA 4PJIE 2YPKB 4WCYH 2YD2A 5C0AB 1TJHL 4MA1C 2HFFA 1NBYA 4OZHA 4U6TA 3QUMH 4A6YL 3A6OA 1CBVH 5DHVA 4DUVA 3QUYD 1J9CT 2FGWL 4XCCH 3LKNA 5DJ0B 5HGAA 1I1RA 5ETUB 2GUOA 1T20A 4GAFB 1S8DA 2JJTA 1IAMA 3Q2CA 1UWGH 2XWBA 4MJIA 5EU4B 1J0JA 2AKRB 4QNPE 5CLWA 5HHOD 1A7NL 3VFTB 1GHFH 2NXZD 1AXIB 1NUGA 5GS0C 3E1F1 3KPMB 1A7PH 4L3EE 1VFAB 4M8VA 4MWFB 1SM3L 3AB0B 1YZZA 2ICEB 3VE0B 3QIWD 4HWZA 5HHOE 1J0YA 1UXWB 4X6BB 3JTTB 5IG7A 5HI3C 5DD0H 1W72B 3OXSA 4N0CC 4TNWF 2CSPA 5SWZD 1LP9B 1D6VH 4JG1H 5MP6H 1TZIB 3ULUC 2NZ9D 2F8XC 3IU4H 3NIFE 3BYTA 4FG6D 1T22B 5SWZE 2I5YL 5I8CB 1ZKAA 2LV4A 3QQ9D 3QIUD 3DETC 1I75A 1KCSH 3NFNB 4N5EC 4MDJA 5JLZA 4JANA 3G5YA 4B50A 4KI5C 1QRNB 5DD6A 3TBWB 3C5ZD 1MIEL 3MV7B 5TFSL 3L7EB 5FUOL 3VRJB 4NHUA 3REVA 3JWOL 4PG9A 1U41A 3VDCA 3M1BA 4U6YB 4HH8A 1WT5A 3ARUA 1H3WM 4P23C 4DUWA 3ZDYE 5HVGB 4LEOA 2VSDA 3SBWA 3T1FB 1IC5L 1FYTA 3KYKL 4IS6B 4MVBC 1S78D 3RZCB 1D5BA 3WDJA 3GIVB 1WAAF 3QCUH 3BKYL 3DXAA 3OXRB 5E2TL 3S35L 4PJGB 4QHKJ 5KS9A 4KROC 1EHLH 2J8UA 2YKLL 1K5NA 5D96C 1JGVL 2AGJL 2JJWA 4IRSB 2EDQA 4DTGH 1JHLL 4QRRD 2QLVB 4JB9H 3PDGA 5CWSA 4NQDB 3EAKA 5BJTA 5FYJL 1U93A 3DLQR 4OD3H 3S88H 1TVBB 3HI5H 2H8PA 3QZWG 1PLGH 4QRRE 1I8IB 4Z7VF 4YDJA 3IB4A 2DJUA 5IB3A 4QRSA 3AS3A 2O5XL 3KXFE 5IQ9B 2OI9C 1BFTA 1ED3B 4OZHF 5LAXB 1JRHH 5FYKU 1NLBH 1HCFX 1INDH 4RBPK 2PTTA 1MFCL 4XXCC 5A2KH 1G7JB 4BSJA 5J11B 4M1CD 4U1HA 1P84J 2NX5A 4U1JB 4AH2A 4JRYB 4GRLA 1PEWA 1RFDL 4KK6C 3G5VA 3P30L 3C09C 2FWOA 2C1OB 2EDLA 1MAKA 1IAOB 5C0BD 5C9KA 1SY6H 4UAOC 4YDIH 1CF8H 1KOAA 3VD5A 5KG9B 4EUPH 5FXCH 5BCAA 5FO7A 3BMWA 5C0ND 5GGSB 4CJ0A 3RNQA 4YX2H 2UUDK 4TPRL 1AR1C 1FRGL 3IAPA 2DJ4A 3SJVB 2VXUL 2NXYD 1V05A 4ODHH 3N85L 3O3BA 4GRWE 1HILA 3TNMB 4P2RA 4QHLB 2CDEB 5C2UB 5JPNB 3GUTA 3FT2A 3RHWF 2ZUVA 4UOW1 5IB5A 4Q2ZB 2PXYC 1VPOL 1CU4H 2GI7A 4ELME 1S5HA 4K3EL 3NN8A 1B6UA 1NMAH 1Q9KB 3ES6A 3OHXB 2DQDL 2YUXA 2PF6A 4HMDA 3MGAA 4JFPA 2Q7YA 1WK0A 4KUZH 1WZKA 2H32H 2ZCLH 1FO0H 3ZDXE 1QBML 4R0LA 3D87B 2BVPB 2FO4A 3FB8B 4HXAH 1RJZA 4PBVC 3IXAA 5JPMB 2Y06H 5FYKD 5CJXA 1AHWA 2QBWA 5EA0L 4EDXB 3HE6C 3GO1H 2DQTH 3TJHC 3QSKB 4M7LL 5FYKE 4POZC 3ORJA 1Q9WA 5KS9F 2HJLB 2J8UF 1EMTL 1H5BA 3IT8D 5IR1A 2XFXA 3RY6A 1JGDB 1NFDB 1PZ5A 3QIBD 4HKJB 4N8CL 5DJDA 2OR9L 4U1MA 4LKCB 3SKOA 2I60H 4YXKH 3UJTL 5E8NA 5GGVY 2MHAA 3P0GB 4OCXL 3MRKA 1CFVH 2DQCL 3V79C 5DFVC 1VEOA 3MV9D 3FRPG 4TVSa 1HE7A 5INCA 3KDMB 2E6QA 3WLBB 3TBSB 1CXKA 2BJMH 1MLBA 3KGRA 4GKZB 4YDLB 2QQNL 2DIAA 4JDVB 3BZFB 4KJYB 1S7UB 4M7JL 4X4ZA 5FK9B 5GHWH 3FQXB 3RPIB 3WE6B 1MVFA 5GRJL 5MI0C 5D7KD 3BJ91 3K8KA 4HDIA 3LS5H 3O6MH 5D7KE 1XZ0A 4FQXC 4GQPH 3U0TA 4PY7B 4M8QB 4PJ8B 3QAZC 4JHWL 5GS1C 1A14H 3TO4D 2Z8RA 2EC8A 5J1AB 3FAXA 1PAMA 4XH2A 2Z4QB 2VDRL 5FKAA 3VWJC 4CN4A 4X80H 1E4XL 1MCOH 2X4TA 2BRRH 3BWAA 1FGVH 2I24N 2A83A 3IKCA 1X4ZA 2F5BH 3FQUA 4W4OA 1C16A 3QHZL 4LVOC 3TA3D 3CFKB 1HH6A 4KRPB 5T5NF 4YLQT 4JDTL 5FGCE 4P5TA 5IMMA 4Z7OF 1KIRB 3IRZA 8FABB 3LQAC 5HGDA 5E2VL 5BZDA 1MQKL 3ARBB 2QV2A 2EH8H 5GZOD 4FQCL 4JKPL 5AG9A 1OAUL 2VL5B 4LSVL 3ILQD 4B7LA 5JOFB 3RWJA 4LEXH 4F9LC 3PWJA 4HQQL 4BFIA 3O6FB 4LPWA 2QKIA 4RAVB 2FR4B 4JQXA 5EO1A 3SCMD 4E41A 4MD5A 5DMGC 1AXTL 3A0OA 3C08L 4DGVH 3GI9L 3DVIA 4NNPH 3VGBA 4GKSA 5B38A 5EO0A 2ATPA 1MHPH 2X9XA 4LARH 1CLZL 2X1XR 3QUXC 4HK3N 1ZA6A 1I7ZA 2X4UA 1TMCB 3V0VB 5EZJB 3J8F7 2Z31D 1HIMH 1IEBB 1Q9LA 3K2UH 4WW1B 2WBJD 3MUZ1 2XWJA 1G6RH 4QTHB 3H6JA 5GGQL 1FL5A 1LNUA 2VDLH 2VE6A 3TNNA 4N0YH 2NR6D 4BM7A 1MJ7H 3BGAA 4K8RH 4J3WA 5EZLB 2JLLA 3CH1B 5DEGB 3ULVF 3WFZA 1HEZB 3BO8A 5EC1A 5EDXA 3FQWA 4S1RH 3OJVC 4HJJH 3G9AB 3ZYZA 5HYSA 3GJFK 4K94L 3E3QE 1U58B 3KPOA 4UIKL 3VA6A 5B39A 5A16A 1IGMH 3TT3H 1OAXL 1B0RB 5LJYH 2BNRD 3NAAL 3FQNA 4F15C 1A3RL 4NHCL 1A1NA 1L4IA 3NPZB 5DS8B 1NEZG 2Y36L 2YD3A 4OM1L 4C56D 4ELKB 4FQLH 4WW2B 5HYFA 4MCYA 5C09B 4K23H 4O51A 5HDQH 3UYPA 1CK0H 4C56E 3AREC 1RJYA 3D3VD 1R24A 4XCEA 1Y0LB 2X4OA 3MJ9A 3QZWA 4PGDA 4KKCC 4MAYD 3KPNB 5D1QB 4G7VH 2FECL 1P53A 3AUVA 3I50H 3D3VE 1MAJA 4R26L 5ID1B 3QXAB 3QEGH 2FX9H 4WTXA 3L5XH 1HXYB 4P9HH 1OTSC 2APBA 4HT1H 5IF0A 2NW2B 3ARDB 4FRWA 5DD3L 2X4NB 1RZFL 2NY1B 4XCFH 2X5PA 4LRNL 4L3AA 3G6JB 1I9IL 1LK3H 3BDYH 3FONB 2AEPL 2F58L 3AU1B 4F7TB 3QH3B 1E27B 4KMTH 3M07A 3IVKA 4U6HB 5HDBE 3TIDB 5IEHA 1WIOA 5BVJB 4EI5A 2Y23A 4EI6A 5KAQF 4X9IA 5TDOA 5CEXB 5J4MA 1IC7L 1HOCB 4OLXL 3NFSH 1YEIL 5BZWA 1FNLA 3RX8A 2MQCA 5K9JL 1E6JH 4AENB 3P0YH 1A5FL 1MVUA 5KVMC 1P1ZA 4HKXA 3HUJA 2XTJD 4ODWB 1XGTB 2MTPA 3ZLQC 4YHLL 2QR0A 3P11L 4F8QA 1DQDL 2XTJE 5ESVA 3CVHB 2HKFH 3CX5J 4H26B 5EIIA 4NBZB 5I17A 4AEIH 4LSRL 4ZUVA 3BP5A 1WVZA 5D9SA 1HKLL 1U95B 3WO3B 4QY8A 3FKUS 1D5IL 4U1SB 2FJFA 1AC6A 4QXTB 2R29H 4OZ4B 3SE3A 2FX8H 4XPTL 5D71H 1QBLH 1FGNL 2F74A 3QUZD 5DD1H 4QF1A 3RWCA 4AEEA 2V2WB 5ESQB 4DKDC 5T3ZL 2R0KH 4X4YB 3BPOC 1IL1B 2RIKA 3HA0A 1MCRA 4AIZA 1AO7A 3HFML 3MCKA 1KN2L 4MXQD 4YHPB 4XMPH 2G75A 4G6JH 1M71A 4GSDH 4X0KB 5FB8B 2Y07L 4OZGB 5HHPA 1XGRB 2R1WB 4JO1L 1U92B 4NKDB 2R4SL 2P24B 2DWDA 3PV7A 3INUL 5IMOB 3FTGB 3HMWH 4LQ1A 3KS0H 1IM9A 4J4PA 3UC0L 1Q0YH 5GZND 1I4FB 3MNZB 2XY1A 5TE7H 3PDOB 3AVEA 4RMUA 4HSQA 1RJLB 2WUBL 3MRLB 3HC0A 3ZKQD 3QI9B 5FYJU 5DJAA 5KSAA 4RRPG 1IM3B 1CI5A 1HHGB 3MV8B 3L3OA 2IPKA 5KSVA 3MRJA 2GK0B 4Q0XL 4OAWB 1MEXL 2ZWLT 1ZVYA 4HPYH 1BEYL 2PYEB 3KWWA 2ZSWA 3QDGB 3EYOA 4JZJA 3T0EB 1EBPA 1CZ8L 3A67H 2NY4C 4RMRA 1U8QA 5CJQL 1G9NH 3MUGB 4ZSOB 5DRWB 4Y4FA 2CJUH 3PGFH 2NY0B 1NMBH 5C0DA 1I7RA 4ZO9A 4YHYC 2RJMA 5E2UL 4BH7A 5BS0B 4PUBH 4AG4H 5HHVL 1EO5A 1VA9A 1FSKB 1MFNA 4KTYA 5DUMH 2HTLC 2CK0L 3MCLH 4R7DB 3X12A 4NFCA 5F72S 4YXLH 3UCRA 3ZYOA 5KVFL 3HUJF 2R9HD 2HVJA 4L4VA 3MJ8A 3PJSA 4APQA 3HPLB 5JXAL 4PJ9D 2R0LH 4V2CB 2Q76B 2HLFC 1F4XL 1NCDH 1RIUH 1ZAGA 4YAQB 4KTEL 5FECA 3EDKA 1NAKH 2Y25A 3EO9H 1KTKE 4PJAE 4GT7A 4BJLA 3EFFB 1FIGL 3JBG7 1A6UH 3BAEH 4FTVD 3UTZB 1A7OH 2LFGA 4LU5L 3UBXI 1OQXA 5ISZD 2B1AH 4OZFB 4H1LH 3V6OE 3WEXA 4ONHB 4FTVE 4H25B 1X4XA 4X5LA 1KLUA 5MEPA 5ISZE 4UIMA 3VXOB 4NCDA 4ODTL 5F1IB 3DRTA 3QDJB 3O2WL 2EDJA 3PL6B 3WUWA 3HZMA 3EZJB 3KPPA 2BVOA 1E4WL 4LSSH 2Y7QA 1QSED 4JGMA 1UEMA 4GXUM 2QADB 2EDYA 3RWDB 4CMMA 1QFWI 4ALAH 3FFCB 2VERN 4HS6A 5FYJE 5ERWA 5F9JB 2R2HB 1XGUB 2JB5H 3WFBL 5I1HH 2NYYC 3OGCB 4FQ2L 2WLZA 1BFOA 1J7VR 5DT1L 4MLSA 5D1ZD 3CGTA 25C8H 3B2UD 4JVPA 3QWRD 1OQOA 3ZO0A 3F7PC 3ARFA 3LRHA 3RKPA 3WHXB 3MMEA 1RV6X 4JPVH 1P5UA 4CJ1A 3REWA 4HPOL 2YMXL 4I77L 4Z7QF 3LY6A 3F6IA 1F2QA 4HFUH 4NJAH 1YYLH 4XNXL 4G9FB 1U8MB 2VXQH 3QUMB 3HNSL 5DJ8A 1YDPA 1NC2A 5JW3L 3DSFL 5B8CA 5JNYA 1RUML 2D03H 3TJEH 3GIZH 1CICC 1FFOA 4L9DA 1PDKA 1LE5B 2VZSA 4ENEC 1PY9A 3CVHL 3JZ7A 1BWWA 3KR3L 4PGBA 4KAQH 4OIIH 3SDDC 1MLCA 4HD9A 1UM5L 5DRZA 1C5BH 3I9GH 4G6FB 3DO7B 1A6VH 1DDHA 1N64H 5D2NB 1UZ8B 3F7QA 4L4TA 4WTZG 3L3KA 1SBSH 4XBEH 3S37L 5IBUG 3S36X 1IGYB 3PWVB 4OF3A 4E42B 2NQCA 1JWSB 3JV0A 5EUKB 4OGAD 1JPST 2VZ1A 1G7IA 1FZMA 4JZOA 1UACL 3PXHA 4JO2L 4K8RD 1U3HD 4PJBB 4L8CA 3BSZL 1XGYH 3KYOB 2YD8A 1G1CA 3IS1X 1NSNH 1B2WL 2AJSL 3PGCB 4TSAL 3O3EB 5DLMH 1QA9A 1G1YA 1HXMB 4I0PA 5IM7B 43C9A 3DVGA 4JRXA 2I25N 1KTDA 2VXSH 3IETB 4Z7VB 4BELD 2ARJB 1BECA 2DQGL 4JFZH 1KJVB 3S9DB 3QA3A 5HHXL 2N7BA 3TWCL 4H0IA 4OZHB 1NBYB 3X13B 1YEFH 1WFOA 3ISWA 4KI1A 3GJEB 3VG9B 1VKXB 1AE6H 4YHMH 4RQQB 4EZMA 1BJ1J 4ORGA 3LKNB 1NKRA 1BQHG 3QEHA 1L9MA 5IHLB 4DKAA 5JUEL 1T20B 1MRCL 1S8DB 2ADJA 1SYVA 2OJEB 3FO2A 4ODSH 4MJIB 1UB6B 3NPSB 3NABL 4LVHC 3MR9A 4D0DA 1KXQE 3DUSA 3X3FH 4P57A 4RGOH 5B3NA 4RISL 3VJ6A 1DQLH 2G5BB 5I1IL 4IRJC 1AQDA 2BVQA 5IVXB 1IZKA 2FNBA 4OLYH 1I8KB 2Q3AA 5T3XH 2CIIA 4NN7C 4OCWL 3U83A 1CIUA 4Y16B 1U8JA 3IJHB 1I7TB 1BAFH 3GK8H 1LP9E 1TQBB 2W60A 4KQ4H 3MRHA 1KENL 3IJYA 1AP2A 5I18H 2R0WH 3LMJL 3VFWB 1MCWM 5E24E 4ZOCA 4HKZA 1XFPA 4LLWA 1CG9A 1KIQB 3HS0A 3QHTC 2GITB 5TE6L 3SN6N 5JA9A 4E0RA 3GSRB 4LK4A 4YNYA 5JLZB 1VENA 1FZJA 4TUKL 3MV7D 4UTBH 4B0MM 5DD6B 3RKDC 4XNYH 4I4WA 1B9ZA 3MV7E 1CGUA 2FHCA 1WBXA 4PG9B 5A2JH 3M1BB 4JHAH 3LEYH 3RRQA 2Q1EA 5BMFH 1JTOA 2P8PA 1Q9OB 2F53A 1ITBB 3P4OB 2FB4H 2APVA 3C6LB 4GUPB 1A3LL 3SOBL 5CGYC 4XNUL 2K7QA 3STLA 2IH1A 5E4IA 1OLLA 1UCBL 4RAUB 1JI2A 1UCTA 3UDWA 1DE4B 2YXFA 3RVVD 3GSOA 3WXWL 4Y19A 4IRSD 4MQSB 4XHJD 4PJGE 2BSTA 4WO4C 4NQDD 3JWNC 5JHDB 1RIHH 4W81A 3BZ4A 1E28B 5KW9L 4D9RE 5BJTB 3V6ZA 1U93B 1QR4A 1KCVH 1KPVA 4NQDE 1FAKT 1OTUD 2H8PB 1X5HA 4G43A 4U1GC 1F6AA 3JWOC 2JJUA 4GW1A 1NGPH 1S5IH 4FABL 5L2KD 4PLKC 5CJBA 3D85B 1IGIH 3D25B 1ODAA 3WN5B 4P3CL 3JV6A 2V2XA 4G8GB 3KPSA 1ETZB 4OTXH 5EO9A 2EIEA 3W9DA 3GJFA 5L2KE 1J8HA 4MHHI 3TBTA 4JRYD 4U1HB 1RUAH 4BSVA 4QRTA 4AH2B 5CGTA 3SDAA 4U2ZA 1MNUH 3W9EA 3SDXB 2A74A 1FC2D 2QQKH 3SGEH 1B90A 4JRYE 4YDVB 1OTTC 3G5ZA 3V8OA 5F71A 3QEUA 3HAEG 4WCYL 3ROOA 3PWPA 3CVIH 5TF0A 2PO6B 3QUML 4CN1A 1CBVL 5JO5A 1BZ9A 4KGLA 1Q8MA 2VRAA 4MB3A 4RA3A 4XCCL 5FO7B 3PUCA 2DD8H 2D3VA 3RNQB 3SJVD 5KSBB 3ULSA 1U9KA 1ZLWH 3L6FA 1QEWA 5IFHH 3E6FA 3SJVE 5D6DA 2XQYK 1HILB 4YZFE 4P2RB 1GHFL 2BVTA 1QSVA 2FHBA 2GTZA 2XQBH 1A7PL 3RDTC 1QP1A 4M9PA 4ODBD 5I8KH 4F7CB 1XIWC 2R4RH 1IBGL 1ZWIA 5T33H 4KH2A 1XH3A 5DWUL 2X09A 5DD0L 4KKAD 5I6XC 1A6WH 1MFEH 1V7NL 5IWLC 5F7HA 3ES6B 3UAJC 1D6VL 3O8XB 4JG1L 5MP6L 3LVEA 3TYGH 5EULV 3IU4L 4JFPB 1VFOA 5FUCC 5ID0B 2AXFA 1A9EA 3OX8A 3VRLF 5I1DB 1TVDA 4DWHA 1RJZB 3QCVH 5FDWA 5I1JH 1AHWB 5DMKA 3OAYH 4R96B 2P4AB 4IOFD 1JYNA 2CLVB 4RCAA 2DBLH 1LEGA 1Q9WB 2IALB 1D7FA 2CRZA 2XFXB 1JPSH 4HUKB 5GGUB 1UWEH 4BUHA 3B3IA 4YIQB 5DJ2B 1PZ5B 2A0LD 5CGMA 1NFDE 2VQTA 3ARGC 1A1OA 1NEUA 4CVXA 5ICZA 4MNHA 3MRKB 2BVEA 3BQUB 3CFJA 1NBQA 2GJ6B 4NO0B 3U2SA 1E4XI 4MQTB 4HGWB 3QCUL 3EOAA 5INCB 3MXWH 1B0GA 4DW2L 7FABL 4W6WB 3WO4B 1MLBB 4DTGL 1C1EH 3I3BA 3K4ZA 4FFZL 3DNKA 1XAUA 4OD3L 3S88L 1LEIB 4RGMB 3HI5L 5BV7C 3WXVH 3WIFA 3H7LA 5HGHA 3O6LH 4LLQA 5DJYA 4D0CA 4WTZA 4HWUA 4HK3J 4H0HB 3M17A 1TNMA 2K7PA 1N6UA 3B8YA 4PJ8D 1XZ0B 5FV2A 2V2TA 1JRHL 2R39A 4WGVB 1NLBL 1G7HA 1TPXC 1LGVA 3IFLH 1INDL 3T8XA 2VDKL 2YN5A 1A6TB 3ILPA 2WINA 1N5YH 2OL3A 5LGHH 4XVSL 1W0VA 3R4DA 5F89A 3MA9L 5BXFA 3MRRA 5IB2A 1ZK9A 3SGKC 2AERT 4K3JH 4XVUD 3FQUB 4KRPD 1SY6L 5DYOB 1HH6B 5GGVH 4JFEA 2ITDB 1CF8L 4J3TA 4FQHA 4OCNC 3T0BA 1DANT 1FNHA 4YX2L 5GGTH 1U8HA 4ONGH 1U3JA 4G7YH 3DX9B 3DX6A 2EICA 1BQHA 2W65B 5EOCJ 5CIPB 4K2UH 3O6FD 4K3GA 5KANG 3G04B 3LKSA 4JPWH 4JVUA 4PTUA 1HDMA 3D9AH 1L0QA 5GRZA 3VH8G 1GXEA 4MD5B 2X4SA 2V17H 3W2DH 1CU4L 4KC3B 4XXCA 5F96H 1MRDL 2Z35A 4JFOB 4LIQH 3MJ6A 4ODXA 1EHNA 3W81A 2YPLB 2Y1VA 3FJTA 1M6OA 1I7ZB 2AJYH 2X4UB 1Z0NA 1FO0L 2HT4C 3A6CH 3LV3B 1KBGH 5GISH 2H2PD 1KJ3L 1Q9LB 2AEWA 4HXAL 4WJ5A 2A73B 3HPJA 2Y06L 1Z3GL 1I8LC 3QFJB 4B7IA 3G6AA 1RUKL 3GO1L 4W70A 1HQRA 1EHAA 1RU9L 1EJOH 2ZUWA 5E1AB 1JWMA 2DQTL 2C5DC 2P49B 3TNNB 5EBWA 5C0CB 5CEZL 2WUCH 4BZ2H 1FFNA 5DRNA 4OUOA 4F80A 2FECI 5AYQA 1JGLH 4CVUA 3T0DA 5EC1B 4TUOB 2NY7H 2ZUTA 1KLGA 2I60L 4M61A 4YXKL 1D5MA 4YBQD 5TQ2L 4KVCH 3QPXH 2RFXA 4HHAA 3SEPA 2E7CA 3A6BH 4JFXA 3LKQA 4S1DD 1CFVL 3UX9B 1MCJA 3OKEA 3FQNB 5DHVH 2BERA 5T3XD 1A1NB 3WJJA 3OAUH 5I66A 1TZGH 2W0LA 5C0JA 2BJML 2NY3B 4U6XA 3X11B 5C09D 5K9KA 5EU7C 1U8PB 2CKBA 5IMKA 4GKNA 2R0ZH 1M7DA 5GHWL 1YMHA 5C09E 2YUZA 1ACYH 3EO1B 1U91B 2JIXA 2VXTH 2VZVA 4CDGC 3WHE1 2EH7H 3LS5L 2X4OB 3O6ML 3BPCA 2DBJA 1J11A 2NY6D 5T1KB 4YE4L 3HE6A 3SPVA 1XGPB 1DQTA 5HVWA 2ADFH 4K94C 3TF7C 1A14L 1ZHLA 3ARDD 5FO8A 1HH9A 1MJ8H 5HYJA 3LDBB 3W5MA 5H37G 2P47B 3BH8A 3K80A 3MQIA 1IQDA 5JORA 4P9MH 5D7LD 4JPIA 3CXHJ 1MCOL 3OKNA 4PLJC 1B4RA 3K4DA 5A43C 1MCCA 5JQHC 2AJZA 1LE9A 4LFHD 2F5BL 4XI5C 4P46B 5D7LE 4BQ6A 5DVOA 3HAEA 1KPRB 5IP4A 5SWQA 5L2JB 1T3FA 1KB5H 4EI5B 5D1XD 4BSWB 4NRYA 3VWKD 4EI6B 5GIRA 3GB7B 3GGWA 5HI5D 5TDOB 2WWMC 2EKSA 3H9HB 4ZO6A 3GBNH 2VC2H 4PGEA 3E8UH 4WFHD 3WD5H 2EH8L 1DQMH 4X6FA 4HKXB 3T65B 4LOUD 3KLAB 3U0PA 4WFHE 2B8OT 4O2EB 4LEXL 4LAQH 3RTQA 4R4ND 4PJHA 3OKLB 4NUGH 4V2BA 5EIIB 2AV7A 3F7YA 2G60H 4FQXA 2XN9D 3QJHA 5GS1A 4DGVL 4JM2B 4NNPL 5F93C 5ICYB 2FJFB 3GMLB 1H0DA 1H3XA 2BMKA 2XN9E 5L9DL 1A7QH 4L3EA 2HAZA 1GGIH 2OTPA 2BNQA 3VWJA 4IEFB 4WWID 4QF1B 1HIML 1BX2A 2VR9A 5CLTA 3HCVA 3K2UL 3JUYA 4N0UB 1CGVA 3QIWA 2OZ4L 1G6RL 3L5HA 1AO7B 2PKDA 4RGNB 5I9QC 4PJ7A 2G75B 3QUKB 1F97A 2VDLL 4N0YL 4RZCB 1H15A 3C60D 1MJ7L 3MLVL 4Y4HB 4OZGE 1NBVH 4C59B 4PJ5A 3KPQA 3FZUD 1B6DA 1R5WB 3O3AA 3OGOE 2DWDB 5DK3A 3QDAA 2F54B 2YA1A 5EBMA 2IANA 4S1RL 3UO1L 4HJJL 1JYVA 1IGML 4M5ZL 1YC8A 4F37K 1CFSB 3QXTA 3TT3L 5JZ7C 2XWTB 4WV1C 2ZNWA 5TDNA 2GYSA 1MRFH 3P2TA 3O0RH 2ITCA 4ZAKA 3QI9D 3RNKB 3IDGA 1S9KC 3HC0B 3MZGB 2QSTA 3FAWA 3PWUA 2CLRA 3V5HA 3L3OB 4FP8H 2IPKB 4L5FH 3MRJB 4LRIC 3VFPA 2PYED 3MV8E 1SEBA 4L9LA 4MNGA 4YDKL 5HDQL 1DVFD 1R3KA 3QDGD 1CK0L 5CEYB 3T0ED 3BKMH 5E6IB 4QRQA 1NQBA 2PYEE 1S9XB 3GSVB 1F3JB 3QDGE 4G7VL 3T0EE 2NY0D 3DGGA 1T2QL 4Y4FB 5ADOH 5L8KB 4ZSOE 3MOAH 3QEGL 2YD9A 1TVHB 3VFMA 3L5XL 3VDAA 4P9HL 5T1DL 4QRRA 3LPGA 2BC4A 4EVNA 4XTRD 4MXVE 4Q9QH 3KXFA 3JV4A 3LQAH 4RIRA 4HIIA 4XCFL 4WWKC 2HLAA 4M6ML 3MJ8B 1LK3L 1YN6B 4XP6H 3S97C 4NQSB 4IRZH 1AC0A 2AQ1A 4KMTL 2YR3A 1JF5A 4CADA 4NZUH 4Z0BH 1TQCB 4PJHF 5CJOH 5IQ7L 1NCTA 1WCBA 3TVMC 4AMKH 3NFSL 3ME0A 3GRWA 3U0WH 4HIHA 3VXUB 1EUUA 1E6JL 2WIIA 4QNPF 3P0YL 3CFDA 2ZUQB 3VGAC 3GEWB 6FABL 2J5LB 1GGTA 3RVWD 2PW2A 3TFKC 3QDJD 4UIMB 1UEYA 2DKUA 5H94A 1AGFA 3DRTB 3VXQB 1NCCL 4FFYH 2HKFL 1IZJA 3WUWB 4XBGB 1ERNA 2BOCA 1Y6NR 3QDJE 4FZ8L 4AEIL 3GSNH 2Y7QB 4PJ7F 4WI6A 3FFCD 3KJ6L 1QFPA 3WIIL 3RWIB 4CMMB 3IDXH 1IT9H 1KJ2H 3V0WH 2OBGA 2HKHL 4HS6B 3VW3L 3FFCE 5E5RB 4HK0A 3HC4H 2FX8L 1IAKA 4GMTH 1QBLL 5D71L 1FC1A 5DD1L 1KEGL 1L6XA 5CMAA 1BFOB 2R0KL 2IQ9H 4JFFA 4WHYH 5SV4A 2XPGA 3EJYD 1N5AA 3O4LB 3GMPB 4XMPL 3ARFB 1Q38A 1ZHKA 2W0KA 3H42H 4ZUSA 1JUFA 3NGBB 4V1DA 5D70H 3QWOB 2XRAH 3Q5TA 2UWEA 4DGYH 2DTML 2GTWB 4KZDL 3LSOB 4TSBL 1FFRA 1OAZH 3HLAA 4L8SA 4G9FD 2Z92B 3B9DA 3HMWL 4OJFL 4G3YH 3MX0A 4X7FC 4QXUH 4G9FE 3QNXA 1NC2B 1JNLH 4OLUL 3GZKA 3OKOA 4LCIH 2E9WA 2J6EH 3W82A 1I85C 3CMOL 4ZUTA 4G6FD 4FZEH 1CWVA 4PGBB 5CILH 1QR1A 3CZFB 2LAAA 3I02A 2I9LB 4OV5B 1MY5A 1A4JA 2VWEC 4ZFZB 2NY5L 4L4TB 4QCIA 2JJSC 2FX7H 3B43A 3LQMA 5D2NE 2UVFA 4HPYL 4TTDD 3S36H 4UNTA 3A67L 2DQIH 1NAMA 5FM4A 2CQVA 2DQEL 2X4PA 1NUNB 3DBXA 2CJUL 1G7IB 3PGFL 3DROA 4JZOB 4Y0GA 1CDGA 1WAAE 5DVKA 4I48B 4U7MA 4YK4B 4AG4L 4WDIA 4MJ6A 1EUTA 4C58B 1FLRH 2HT3C 1E6OH 5DUML 2IPUG 3MCLL 2GAZB 4I0PB 3SDCA 43C9B 4YXLL 4UT9H 5HGGS 4Z76A 4JN2A 4NO2B 4N0RA 2HJFA 3FN0H 4NQXB 2R0LL 4P2OA 4MD4B 4Z7VE 1NCDL 4YFLI 1B3JA 1MI5B 3I85A 1NAKL 1NPUA 3EO9L 5EOTB 4OZHE 1NJ9B 3QCTH 4JY5H 4QRPA 2NXYC 1OGTA 1A6UL 1RZJC 1N6QH 3QXWA 3UTPE 1A7OL 3FRUA 2B1AL 3I3EA 3RGVB 1MCIA 3L3HA 3NOIA 1EXUB 4MJID 2YOCA 2ADJB 3R1GL 4DKEL 1QACA 5D72H 1FDLH 5FKPB 2BCKA 3TA3A 5C86A 2F8VA 3MR9B 5KVGH 2QQLL 5JDJA 4MJIE 3V5KA 2BY3A 4DZBA 3LAFA 4KU1A 4P57B 1BZ7A 2QSVA 3H3PH 4I2XB 3OAZH 3SQOH 1A7BA 2DMCA 3UTSA 3CNKA 4X6CA 1AQDB 2BVQB 4LSSL 1FORH 1NGQH 3T2NL 5J6GB 4ZPTA 2CIIB 4ALAL 3QQ4B 3N06B 1U8JB 3UJIH 2D2OA 4MNQB 3NZHH 2MOVA 2Y6SD 2YRPA 2JB5L 2UWEF 2MCG1 5I1HL 5JIIA 3B9KA 3IFPB 1DFBH 3IJYB 4OKVB 1PKOA 1P4IH 2XOTA 3GFUA 4TOYH 25C8L 3SCMA 1C5DA 2WIMA 1W0WA 2I9TB 2IAMC 4YNYB 2AXGB 1PW3A 1FZJB 4CUCA 1JV5A 4U6VL 5K93A 1OT1A 4KK5C 4PR5A 3SE4A 1A0QL 4ZS7H 4HKBB 4LCUA 1GCFA 5IKCA 5IMLA 2P42B 4LKXA 1WBXB 5DJCA 3CCHA 3IDMA 4BQ9A 1FYTD 4HFUL 2DLTA 4NJAL 3C5SA 1YYLL 2WBJA 4M9OA 2ATKB 2HA1A 1BQLH 5DQDH 4NZRL 1I1YB 4WFED 3PQYA 3ETBF 4P4RB 3DXAD 4CVZA 1JF1B 2D03L 3TJEL 2DWEA 2ORBH 3GIZL 2IH1B 1JMXA 5JOPD 4NBYB 3VXMA 4WFEE 5JW5A 1DUYB 5JHDD 3GSOB 2ZG3A 3DXAE 1VFMA 2JK5B 5KS9E 5JOPE 4KAQL 4OIIL 3N9GH 2J8UE 1R0AH 4EDWH 1C5BL 3BZ4B 4KDTA 3I9GL 5JHDE 1N64L 1Z9MA 4KY1L 3UMTA 3MYJA 2IADA 3C9NA 1SBSL 2IGFH 4XBEL 2IBZY 2JJVA 4K71C 1I1CA 1N26A 3U9UA 1S7QB 4JQIL 2OK0H 3RY4A 3V4VH 3ZT6A 5C6WH 2D31A 4PS4H 1ZT4A 3BDXA 3JV6B 3KPSB 2Z91B 1XGYL 4C56A 3OWEA 3W9DB 2NX5D 3GJFB 1J8HB 4P2QA 3U79A 1NSNL 1XR9B 4BSVB 5DLML 1P7QA 4GRLD 4RNRA 3K1DA 2ARJQ 2GHWB 4G6AD 2NX5E 4IDJH 5C0GB 4R9HA 5GXBB 3K7UA 1X5XA 3MUJA 3SDXE 4JFZL 4U1KA 5C3LD 2PO6D 35C8L 4DEPB 2NLJB 2VZ3A 1V3MA 1YEFL 3CD4A 1CICA 3AS1A 1U8OA 5HI4C 5CEZE 1AE6L 1PG7W 4X6CF 4YHML 2WP3T 5J9PA 1Z5LA 4AT6A 5EU3A 3S98A 3EYVA 4NRZA 3SDDA 2EDEA 3UBXA 1TTFA 2Z8VC 4PBXA 5KSBE 4UQ3A 1M7IA 1FZOB 5HDOA 1QEWB 4P2RD 4ODSL 4DOHB 3E6FB 3MRGA 1JK8A 5HYQA 4XNZB 5F1NA 3X3FL 4WI5A 4P2RE 4XAKE 3EJZC 1DQLL 1NMCB 3EHBC 1BBDL 1ZWIB 3LOWA 1IILE 4OLYL 3MTRA 1PJ9A 1XH3B 2Z31C 4Z7OE 3E0GA 1OM3H 3S8WA 2FGZA 1MAMH 3O2DH 3GK8L 4YFDB 5F9WB 4J3UA 4KQ4L 3TZVC 5I18L 1J0IA 2AXFB 5JDSB 1QFOA 2VYRE 2NR6C 1ROWA 3EOTH 3MRMB 4HZLB 1TENA 5FDWB 1TXKA 5F9OL 3X17A 1PGRB 4MA1B 1RIVH 3E3QC 2UY7A 3V7AE 2X70A 4XNYL 1F42A 1LEGB 3AY4A 3P4NA 1CE6A 1I1AC 1FAIH 4JHAL 5C7XH 1R3JB 4HGMA 1JRHI 3LEYL 4JY6A 3I75A 5BMFL 4KHTH 4IMKC 3O45A 4I3SL 1A1OB 2FB4L 4FXLA 5FF6B 4CVXB 1EHXA 1ZANH 2GJ6D 3HNTH 1ZS8A 4LHJB 4U1LB 3CFJB 1RHHA 3H7BA 4UNVA 5IBLD 3PP3H 1JPGB 2GJ6E 3EOAB 3QXDA 3DYOA 1MFAH 3OB8A 2VKWA 4FN0A 5I8OH 3ULVD 4X6EB 2MQ0A 4JPKL 4CU6A 5FO9A 5C0IA 4UUJB 1RIHL 2GSGB 3GDBA 4MAYC 4TTGA 1RZIB 4TQEH 5D7JC 3ULVE 4A6YA 3CPLB 4EN3C 3B5HA 4O58H 1AXSB 1KCVL 2X2YA 3QNYB 5HGHB 1EAJA 4LLQB 5DJYB 4R97C 5IW6B 1NGPL 1S5IL 1VESA 1IGIL 1A1MA 4Y5VC 1EGJH 2O61A 4F58L 1FP5A 3EO0A 3ILPB 3T0VA 3MLUH 3V7MA 4ZTPH 2O5ZH 1ORQA 2BDNH 1W0VB 4U1IB 5F89B 1MNUL 1GRWA 1Z9SA 5IB2B 2QQKL 4OCSH 1WICA 4P23B 2DQUH 3ZKMC 3BP4B 5AD0B 4WUUB 3KYMB 3CVIL 2VDPH 2AK4B 3MYZA 5I30L 4P5TD 5FAAA 5KZCB 5FM5M 4O9HH 1DL7L 2WM0A 4WEMB 3GI8H 4KROB 2DD8L 5D96B 4O2CA 3MRQA 4WO4A 3OZ9H 5KTEH 4L1DA 2ZCKL 1HHJA 4WI9A 3VXSA 5I1CH 4OFIA 5IFHL 1EK3A 3D18A 2H9GB 4Q6IC 4U7SA 4X4ME 2YWZA 1CFTB 1QUNA 3LKSB 1E4KA 4PTUB 5IVNA 2CLZB 1IFHH 4HLZG 1HDMB 5I8KL 5DA4A 2R4RL 2ZG1A 1K2DB 5ESAB 1H8SA 1NFIA 4YPGA 1PG7X 4LCCC 3ARRA 5DZLA 3UEZA 3QUZC 3MZTA 5LGJA 1U6AH 4D9LH 1JZ3A 1VGEH 1A6WL 1MFEL 2FATH 3GMRB 2Z35B 2YPLD 2A6IA 4NM8L 5K9QG 2BXYA 3TN0A 1GOHA 3TYGL 3O41A 3D0LA 3TYFB 2YPLE 3TCLA 1JL8A 3FQTB 4KHXL 3I6GB 4YQXH 2ZUYA 3C09B 3QCVL 4WJ5B 2E7BA 5I1JL 3OR6A 4UAOB 2ADGA 3HRPA 1R3LA 3G6AB 3LHPH 2VL4A 5HHMB 3QFJE 3OF6A 3VFRA 1JWMB 1XEDA 2DBLL 1J1XH 5DRNB 4OFDA 4AK1A 4P5MB 5GZNC 1UWEL 2ZZUT 3MNWA 2CIKB 3BRFA 1U3YA 5GGRA 1KLGB 3GBMH 4M61B 4DCQA 1D5MB 4HHAB 1KB5B 1VFBA 2UV3A 4CKVX 3DECA 4H1LG 1CLYH 3MXWL 2NY3D 2PXYB 2J88H 4Y88A 2GJJA 4JFQB 8CGTA 3ABZA 4NPYA 3MGOB 3IDNA 5C0JB 4U6XB 1P5VA 3CFCH 2NY2C 1FNGA 5JMOC 5K9KB 3MLZH 4X5WB 3W0WA 1C1EL 4F37F 5L6YH 1H8OA 2LQRA 3Q1SH 2CKBB 3WXVL 2P8LB 1I3UA 2IH3B 3NFPB 1PYWB 2JIXB 4QYOA 3GHBH 4LBEA 2FIRT 5T1KD 4FQ1H 2FZ3A 1ZGLM 4XCNB 2OR7A 3DTXB 5L88H 3HE6B 5EBLB 2R9HC 3IFLL 5A3ID 1NANH 5FO8B 1N5YL 1F11A 1MHEA 5HYJB 4P3DB 5LGHL 4GW5A 4HWEL 1WZ1L 4JR9L 3X3GH 1IQDB 4R3SB 1V3JA 2YD7A 1DLHA 3OKNB 1J88A 4K3JL 3HE7A 1H3TA 2E27H 5IB1A 1LE9B 3V6OC 3N1QC 1U8LB 4OZIA 4NJ9L 3AMLA 1TZHA 4EI5D 2FL5B 2XYCA 4OQTL 5GGVL 1RD6A 4DGIH 5AZEH 5SWQB 1T3FB 4X7TB 4D3CL 3F6LA 3WIHL 3GGWB 2B39A 1D9KA 2EKSB 4C55A 1J0ZA 3LEXA 1ZVHA 1UQSB 4NKIH 2YD4A 4ONGL 4G7YL 2YPKA 2VUYA 5C0AA 4ODVH 3U0PB 1QLRB 5MI0B 4K2UL 3ULUL 3ZL4H 4JPWL 3RTQB 2OMBA 5DJ0A 4XP1L 2AV7B 5ETUA 3F7YB 3W2DL 2V17L 4FQXB 3ARSA 5GS1B 5C07A 3QAZB 5F96L 4PRHA 4Y5XC 4LIQL 4LLUB 3B2UC 3MUHL 2AKRA 1HKFA 3VFTA 2BNQB 3VWJB 4N1HB 2AJYL 3KPMA 4MWFA 1VFAA 3A6CL 5GISL 2ICEA 1BX2B 3HCVB 4XC1H 1AO7D 3FB6A 1UXWA 4RGND 3JTTA 4M1DH 4N0UE 1AO7E 3VD4A 4PJ7B 1EJOL 4RGNE 1LP9A 5F6HJ 1JBJA 1H15B 2WUCL 4BZ2L 1Y18A 2IFFH 1AJ7H 5I8CA 3AGVA 1ZA3A 1IM9D 4J4PD 5FM5O 2NY7L 2IANB 2CRIA 3NFNA 2F54E 1UXSB 2O26U 4FFWD 4KVCL 3QPXL 5C0RH 1QRNA 1U3ZA 1I9RL 1UZ6F 3LPFA 3A6BL 1OD9A 2VDML 3MV7A 4WI8A 3BPLC 1ZHNA 3L7EA 3VRJA 3V4PH 3TIEB 2YZ1A 3OAUL 4HUNB 1TZGL 2H2SD 5KSAD 3IDGB 2YWYA 4Z5RB 3S4SA 3QUXB 3VFPB 4Z7QE 4IS6A 5E6ID 1SEBB 2R0ZL 4MNGB 4U05A 3RZCA 1X3DA 2A38A 4K8RC 1YQVH 1FYHB 3TT1L 3GIVA 2VXTL 3OXRA 1FVDB 4Y4FD 3GSNB 4OZIF 1I8LA 1BLNB 1T2JA 1KJ2B 1OL0A 2ADFL 3WSQH 3MRCB 3VFMB 2XKUA 1MJ8L 4KPHH 4EVNB 3D48R 3ZDZF 1FV1B 3CIQA 4L4VD 4APQD 4HIIB 2W38A 2VLJA 4XBPA 1RAMA 5IQ9A 3LN4B 5DJZA 1CE1H 5LAXA 4L4VE 1YYMH 4PTTB 3VFNB 3O4OC 1G7JA 1MUJA 5IW3A 1KB5L 2C4XA 4CL7A 4F15B 4WHCA 4U1JA 5ACZA 1WCBB 1F4WH 3GBNL 4JRYA 1Q72H 1RVFH 2VC2L 3E8UL 2HG5A 3WD5L 4LFHG 1DQML 1SJXA 5BRZA 1IAOA 4XB7A 3AREB 1UADC 5H94B 4LAQL 4EXKA 3OPZL 4ODUA 3SE9H 5TF1H 4WNQB 1I1FA 2BOCB 2YEZA 4XWOD 5CUSH 2WSKA 4XMLL 1EEZB 3QQNA 3LRSA 2HT2D 3WS6C 2G60L 2VLLB 1LP9F 1BVKA 2EXYD 5ADPH 3PP4H 4D94A 3IFOA 3K74B 4GS7C 4M48H 4Q7DA 1YMMB 1A7QL 5FCUH 2P7TB 4KKLD 1GGIL 4MQXD 2CDEA 3C2AH 1IAKB 2P5WB 2W91A 3MOQA 5JPNA 1ZGLP 4UT7H 2YUVA 5CMAB 3O4LD 4F9PA 4G8FB 4OCYH 3ARZA 4H8WH 3GSUB 3ARFD 2DQHH 1JGUH 1X5KA 3O4LE 3O9WC 1Q9KA 5CAYB 3OHXA 3DHMA 4PIRF 1C5CH 5ACLA 2W9LA 1D3CA 2OL3H 1NBVL 4J3SA 3QT2A 4I9WD 1QZ1A 1WIUA 2BVPA 3FB8A 5DUBA 5BQ7B 4K3HA 4YHNB 5JPMA 3QPQC 4S2SB 4JCLA 4XPFL 4EDXA 1NC2D 5ILTL 4I9WE 2A6DA 3QNXB 5HVHC 1WV7T 4AL8L 2HJLA 3OKOB 4WRLA 1MRFL 3P4MB 4K55A 5T1LB 3MOBH 3O0RL 5IJKC 1OGAB 5J8OA 3O6KH 5EN2A 2R15A 1JGDA 1OTUC 5DC0A 4JKWA 4ZUTB 1T83C 1ZTXL 4POUB 5E8EA 4WFFD 3VXPA 4LF3B 4FP8L 4L4TD 5DUPH 1A4JB 5IIEB 4QCIB 3BKML 1RUQH 4L4TE 1M1SA 4BKLB 3KNBB 5CFHA 5IESH 3SY0B 3BPOB 1XF5B 2EYTB 3KDMA 3MV01 2IQAA 3WLBA 3DBXB 3TBSA 1RZ8B 3DROB 3O81A 2FHFA 1REIA 4GKZA 4MX7B 4QHMA 5HPOA 5TGBB 4I0PD 1JHKH 3BZFA 4KJYA 3FQXA 3RPIA 4JRXD 1DZBA 1CGSH 4Z7WB 4Q9QL 5E8OA 2DLHA 2QQQA 3LQAL 2DMBA 4JN2B 3CSBA 2YD1A 3S35X 3KPLA 3ZE1F 2HJFB 4JRXE 4IDLA 5C1MB 4XP6L 2D4FA 4LSPH 1MI5D 1VB9A 2ILLA 4PY7A 4M8QA 3STZB 4NZUL 4Z0BL 3T77B 5C0EA 1MI5E 1KCLA 5J1AA 3GSWB 5CJOL 2VOTA 2Z4QA 4OSUH 4QRPB 4AMKL 1OGTB 4GRMB 3U0WL 2VH5H 4FFVC 2JB6A 4OCRH 1G9NC 1MPAH 2R1YB 4KFZC 4YZFF 1UG9A 5DTFB 3CFKA 1BD2B 3B9EA 5C92A 3SKNB 3N1FC 4KKAC 4Q9BA 5FYLH 4F7EA 4ONOA 4DN3H 4FFYL 5DEZA 3V5KB 1AH1A 1CVRA 4DZBB 4LSQL 1HZHH 2NY4B 1CXLA 3CDFA 3GSNL 4X6CB 3ARBA 4JQVC 2DAVA 3BN9C 4YHYB 2OYPA 4HW6A 2DDQH 4PPTA 4ZUUA 3T4YB 1IT9L 1KJ2L 2VL5A 4MNQD 3V0WL 3ZHKA 3N50A 1P7KA 4M7ZB 2V7HB 5JOFA 2B20A 3IDYC 5IFJB 4AIXA 5F7DA 4GMTL 1QSFB 2XXMB 3MRFA 5CZXC 4MNQE 2NMSA 1QYGH 1FG2A 4IOFC 1UKTA 3MLRH 2DJSA 4LMQE 4O00A 2IQ9L 1ES0A 2CRMA 5HY9B 1C5DB 1QFWM 5DQJB 1JV5B 5K9OB 4PR5B 4NRXA 3VGEA 5HD8C 1D6EA 3H42L 4JLRA 3TVMA 5D70L 3NCCB 4ZDHB 1O0VA 5I73C 5IKCB 5IMLB 2XRAL 4ONFH 1YQ2A 5EZJA 3TPKA 2X9WA 1OAZL 2F53D 4MCZB 4WW1A 3QEQA 5DJCB 3CCHB 1YUHB 4G3YL 3C5SB 1MCNA 4FMFA 4G5ZL 1PBYA 5IVZB 3KG5A 2F53E 4QXUL 5LXGH 3HAEH 3PQYB 1VFUA 1JNLL 4G80B 1QG3A 2W92A 4CVZB 5EZLA 5E8DH 4UOJA 4LCIL 2J6EL 4Y19D 2KUTA 3CH1A 3VXMB 1HEZA 5DURB 3PWLA 4FZEL 5CILL 4Y19E 3CXDH 4PJFB 4QRUB 5E5MB 4UNUA 4HAFA 3RJDA 4FS0A 4ZNCD 3JXAA 1B0RA 3MYJB 4TN9A 4P4KC 3S36L 3MXVL 2DQIL 5D8JH 3D2UA 1FL6A 2JE8A 1NGYB 3LS4H 5DS8A 1FN4B 3LN9A 3KPSD 1TCMA 4PY8J 1KIPB 1J8HD 2F9BT 5JQ6H 5I15H 1KUMA 3EW3B 1FLRL 4XVUC 3KPSE 1E6OL 4P2QB 5F7UA 4KRPC 3SDAD 5JMRA 4PYHA 1J8HE 4G8IB 5E9DA 1Y0LA 1S7VA 2XZCH 1WJ3A 1ADQL 3KPNA 2EO9A 5D1QA 3MRDA 3FN0L 1GAFL 4IHOB 1S7WB 3MFGB 3PWPD 4DKFH 5JHLH 4ZFGL 4LGPB 3R8BB 2DM3A 1HXYA 4HUVB 3PWPE 1CICB 3QCTL 1U8OB 4KTDH 2C7UA 1TTUA 1N6QL 1Z5LB 2H6PB 5EU3B 3LB6D 3G6JA 3SDDB 2EDTA 2HRPH 1NCBL 3WNNA 3AU1A 4PJEB 1FVCA 1KCRH 3QH3A 1E27A 4QGTA 4U6HA 1FDLL 2JJSA 4YHIA 3MRGB 5HYQB 5BVJA 4MAUL 5KVGL 1BZQK 5DRXA 5F1NB 1OWWA 3H3PL 3QDHA 1K4CB 3B4NA 3P4LA 3SQOL 4XP5L 4YGAB 5C08B 3OKKB 1HK6A 4AENA 4JRWA 1FORL 1NGQL 2NCMA 5HJ3B 4ODWA 1XGTA 2H2PC 4CGTA 3UJIL 4P2CG 2BSED 2XACC 2E7HA 2XA3A 1NBZB 5F7LB 1T1XB 3RU8H 3CVHA 1DFBL 4H26A 2B4CH 1P4IL 4CMHC 3EOBB 4TOYL 2GSIA 1GGUA 4DFIA 4K7FB 1IGCH 4Y2DA 5C8JB 4R7NB 4GAYA 4U1SA 2V9RA 4QXTA 1KG0B 1TNNA 1V5JA 4ZS7L 4OZ4A 2X70B 2AABL 4YBQC 3WL9B 1CFQA 5I1GH 2V2WA 3RY5A 1S3KH 4X4YA 4N0FB 1HNGA 3QRFM 2HFTA 4JY6B 4OKDA 2F5AH 4ISVB 1T5WA 4YHPA 3RI5K 5GS0D 4LVHB 1BQLL 5DQDL 4PB0H 4X0KA 1I3GH 2NPLX 4WW2C 4OZGA 4ZO7A 1BIIA 3H7BB 3SGEI 1U92A 5HI3D 4IRJB 3IRPX 5FGSA 3EJJX 2P24A 4KJPC 1EO8H 5IMOA 4NN7B 1T03H 5C0IB 3N9GL 1R0AL 2D7TH 4EDWL 2NY6C 4A6YB 1WIPA 1I4FA 3MNZA 2XG4A 2HWZH 2GY5A 2IGFL 3ULUE 4UU9B 4J7RA 2AP2A 2CUIA 2OK0L 3V4VL 4XXDA 5HYIA 3NZ8B 4PJXF 4NZTL 2RAMA 2DI8A 3H2WA 1RJLA 2IAMA 1JPFA 4PS4L 5EB9A 2E5EA 1HHGA 3MV8A 3H9YA 2IWGA 4KI5E 4OT1H 3EO0B 4GRWH 5EZOH 3PDDA 4OAWA 2LVEA 3NTCL 4P23D 3T04D 3G6JF 4IDJL 3OKDB 5D1XC 3MRIB 4WUUD 3QBTB 3VWKC 3MUGA 4KXZH 5HI5C 4O4YL 3DGCR 4MVBD 4U0RC 3S3JA 1FH5L 4JFED 4PREB 4WUUE 1T7ZA 5BS0A 5KZCD 5BO1L 1BJ8A 3MLTA 5I71C 2AK4E 4KROD 4LOUC 1DSFH 4JFEE 1YECH 4EKXA 4JKMA 1U8IB 3DV4B 5E95B 3HPLA 4WO4B 2Q76A 3U7AA 1MF2H 4QTIH 3VXSB 4KK9D 5ALBH 1DN2A 1T1WB 3IGAB 4WHTA 5HGBB 1RK1A 3D18B 3FOLA 5FYKH 1X4YA 1VERA 4U1GB 3WNLA 3OKMB 1OD7A 2UZYB 5FFLA 2YRZA 3SGJA 4PLNC 2W9DL 4HS3B 1PG7H 4YPGB 3CUPB 4OZFA 2D7QA 5EC2B 1FE8H 4ONHA 1OM3L 1LO5B 2V9QA 1MAML 1HWGB 5T5NG 4NFDA 1A64A 2A6IB 3O2DL 4XRCB 3U4EA 3VXOA 2GKIA 3IYLW 4NQVB 1EV2E 3D0LB 2BY1A 3PL6A 4LCWB 3MRNB 3TCLB 2WW8A 3C60C 1PZUB 3BD4A 1NAMH 5HHMD 5LKNA 3OR6B 2KPNA 3FZUC 3MLSH 1RIVL 1BOGA 2ADGB 4OZGF 3RWDA 3KJ4C 3VD7A 1JYWA 4YGVB 2C3HA 3FFCA 4ZYKB 5ANMB 3MCG1 4U3CA 5HHME 4X83A 5F9JA 5E2JA 4NCC2 1WWWX 4JZNA 3AFLA 3ESVF 3MUY1 4KV5E 5C7XL 5H37H 3MNWB 4LCYB 2MMXA 1PFCA 1JZ7A 1LK2A 2W9EL 2OTUA 3ZE0F 3V7AG 1RPQA 4KHTL 3KPRB 1K3ZA 32C2B 4DCQB 5IBTH 4HV8A 3HNTL 4G6KH 3WHXA 3Q6GL 2E7LC 2XZQL 3HR5A 4QOKB 3RDTB 5D2LA 3GMNB 1XIWB 2R56H 5I8OL 1DVFC 4DN4H 3GMOB 4I3RH 4NPYB 4N8VA 5I6XB 2IJ0C 4TVPD 3IDNB 2BSSB 5DFWH 1UJTA 1MCEA 1U8MA 4TQEL 3QUMA 3W0WB 1JZ4A 3L1OH 4O58L 1DANU 4TVPE 1AD9B 2JIXD 2VDQL 1BJ1H 3F12A 4LBEB 4W68A 5CSZB 1AD0A 1AR2A 3CLFH 3HE6D 2Q8BH 3T4AB 1IQWH 4YFLF 3TJHD 3ARQA 1EGJL 2ED7A 2D7NA 2K9UA 3DO7A 3MODH 5HYJD 4UMGA 3DMMC 2O5ZL 4ZTPL 1AFVH 4GW5B 2BDNL 5HYJE 3PWVA 5E03A 4Q74A 4E42A 1JWSA 2ICWI 5EUKA 1IGJB 5IB1B 2RBLA 2YN3A 4IMKA 1KYOK 3ARGB 1WBYA 3MLXH 3B9AA 3THML 4OZIB 4PJBA 2VDPL 1TZHB 5DFVD 2EEAA 4YBLC 5IJVA 3JVGC 1YY9C 3PGCA 3O3EA 5IM7A 4HZAA 4TRPH 1Q0XH 3LEXB 2ARJA 3OZ9L 5KTEL 5D7JA 1KJVA 1JMZA 3QHFH 5I1CL 4EN3A 5F7NC 3X13A 5BV7B 4RWYH 1XT5A 1ZSDA 3RTQD 4RSVA 3GJEA 1VKXA 1ZLSL 4WUKH 4XCYB 4RQQA 3RWEB 1IFHL 4X5XA 2ZOLB 1QQDB 4FQXD 4S1SH 1F8TH 4KRLB 4PJHE 4Y5VA 3KHOA 1U6AL 1TPXB 5C07B 4OF5A 1VGEL 4PRHB 5CBAA 4L3ED 2OJEA 4BQ8A 4S1QH 5IHUH 2BNQD 4XPAH 3TV3H 1UB6A 3VWJD 5DSCB 4M4RA 3EJYC 4XGZA 3NMEA 4PRAA 5FOBB 3I3DA 5KAQG 1A3QA 2LTQC 1RZ7H 3EYSH 4Z8FL 4KJQD 2BNQE 1JPTL 4Y1AB 2VNCA 3S5LA 2G5BA 4BZYA 3FB6B 1F6LL 5IVXA 1I8KA 5B38G 2MPAH 3GSQB 3Q0HA 3GHEL 2MCPL 2PCPB 4YXHH 3LHPL 1OOAA 3RZWA 5D2LF 4Y16A 2PW1B 3IJHA 4J23A 4U33A 1I7TA 2PTVA 4PJ7E 5BVPH 4PJ5D 1Y18B 2OP4H 1J1XL 3ALXA 5DR5L 3S3SA 1BVLB 3VFWA 1GC1H 2IAND 3MRPB 4PJ5E 2DM7A 1KIQA 1YN7B 1ZA3B 2GITA 3GSRA 3GBML 2IANE 2ZCHH 3WLWC 4AM0B 5E99L 3AS2A 2E8YA 3WCYA 3FB5A 1N0XH 4LSDA 3MSPA 1XCQB 1OSPH 1ULVA 1ZHNB 4ZAKD 4S0TD 1CLYL 2Y5TB 4LCCA 4MSWA 1JN6A 5JA8B 5HYSG 3MBEC 4TTDC 1T80A 5B39G 4Z6AT 1SY6A 1Q9OA 3CFCL 5TE4H 1T4KA 2O5YH 3IAQA 3P4OA 3MLZL 4LP4A 3S4SB 3BHBB 3Q1SL 4PFEA 2JCCF 5J06A 1HI6A 3LEVH 5DC9B 3C6LA 4GUPA 4M3KB 1CD0A 4EUPA 2E3VA 4MNGE 5D7SH 3GHBL 4UILH 3O11A 4FQ1L 4RAUA 1DE4A 5LBSH 4PJBF 1LO2L 1G7MA 1WZLA 3TC9A 4WFGD 3VG0H 4K9EH 2JELH 5JHDA 5AYUH 3UJJH 2X6MA 1E28A 3GNML 3SO3C 3ZTJG 3LPWA 4WFGE 3VFVB 3KXFD 4PD4K 5I1AB 2BFVH 1YEEH 5D6CB 3TBYA 1UB5A 3X3GL 5KOVC 5LCVH 4XBPB 5JXEA 2VLJB 1MHCA 3I6KA 5DJZB 3T3ME 2E27L 5DFTA 3VXTA 3D85A 3D25A 4MDIA 3WN5A 4G8GA 4JO4H 1ETZA 1N8ZB 2JJTC 1MUJB 5AZEL 4DGIL 5GS2D 1OVZA 1FO0A 3O2VH 1QFUH 5ACZB 4I18C 4LHUB 4Y8DC 3SDXA 4HIJA 4NQEB 4YDVA 1YPZA 4NKIL 2HG5B 2DIJA 1JYXA 1LWRA 5J89A 2ADIB 5BRZB 1INEL 4HJ0C 4XNMB 4ODVL 1OP5H 2PO6A 4N1EA 2W59A 4X9HA 2O93L 2DM2A 3ZL4L 2CH8A 5ITFA 5IVXF 5D93C 4ODUB 3KLDA 3RQ3A 1ZT7B 1I1FB 2YEZB 3GM0A 3HR6A 2Y6SC 3LRSB 1DEEA 5KSBA 2Z8SA 3GSXB 2FEEL 1BVKB 4M5YL 1FLTX 1OTSD 3DHJA 4L29B 3IFOB 4NKMB 3MREB 4RFNC 4OIBA 3WHE0 2RGSA 4JFFD 4OLVL 4F7CA 4XC1L 2H26B 3SQBA 1WCQA 1VSCA 2AJUH 1UKSA 4JFFE 1WT5C 1ZEAH 4OFYA 4M1DL 5TH2B 2VABA 1NUFA 3SBWC 1BGXH 3O8XA 4V1DD 5DEFB 5F1OB 1F6FB 4WEUD 1VADA 1OP9A 3FQRB 5J57B 2B1HL 2IFFL 1T1ZA 5ID0A 1A8JH 3OJMB 3CFBB 4V1DE 4ZXBC 5CJ5A 3N1PC 5I1DA 5C71A 5DUBB 2UWEE 4HXBH 1QBBA 4Y5YC 1IEHA 3RBSA 4R96A 5C0RL 1EVTC 3V6FB 2CLVA 2A6DB 5BV7L 4HWBH 4Z7NE 3PF2A 3HZVB 2IALA 3V4PL 2ESVB 1EDQA 2OLDA 2YBRA 4HF5L 4S10A 3WNOA 4F8TA 1KEMH 3BT2L 2BOBA 5GGUA 5EN2B 1FNAA 4YIQA 4G9DA 5DJ2A 5E8EB 3VXPB 4I3GA 3EYUH 4LLDB 3V52H 3BQUA 4UDTB 1MIEH 1Y6KR 1YQVL 2GJ6A 4NO0A 4G8EB 4R4FH 4HGWA 3CAFA 4OLZL 3WS3B 3DYMA 1C7SA 1WFTA 2IQAB 4GRLC 4B5EA 1QHOA 1T21A 5TPWL 4K7PY 5DXWA 3WSQL 5EOCH 1PKQA 4QHMB 3ZTNH 5DD5H 1LEIA 2OCFD 3KYKH 3SDCD 4KPHL 3RA7H 3SDXF 1YPZF 5E8OB 2GK2A 3UPAA 4P2OD 4Z7WE 3S35H 2FH8A 3KPLB 1IE5A 4JHZA 4OLWH 1L0XA 1YYML 4H88H 1A6TA 4QRPD 5FYJH 5C0EB 4WV1B 1FQ9C 5FGBA 5IOPB 1F4WL 5KSBF 3UYOD 1Q72L 1U8NA 4QRPE 2BHYA 4OGXL 3N1MC 2JB6B 1DQJB 1N4XH 2OZ4A 1G6RA 5F6IC 4POYA 1AIFA 3D5OF 4NUJA 4YJZL 5DYOA 1GYAA 2AQ2A 2Y9RT 4PRBB 1VEPA 2ITDA 1BD2E 2KDGA 4F7EB 3MJ7B 3UTSD 1OP3H 1E0OB 3SE9L 3L95A 2FSEA 3E6HA 3KLHD 5IROA 3QG6A 4R0LC 3UTSE 1EEQA 4X6CE 3DX9A 5ADPL 2L7UA 3PP4L 4ZUUB 4K7PX 5CJXC 4X4MA 4X9FA 1P7KB 2V5YA 4PRNB 2W65A 5CIPA 1S9YB 3B9KD 5FCUL 3WUWG 3C2AL 5F7DB 4UTAH 3G04A 3IF1B 4MB4A 3MRFB 1YEGH 4KMLB 3RIAF 1FG2B 4WWKB 4UT7L 1QSFE 3R06B 1TETL 5FA3B 1H5BC 4JJHA 1ES0B 3RY6C 1JP5A 4OCYL 1Q1JH 4WI4A 1FRGH 2DQHL 1JGUL 3R0NA 4HEME 4JFOA 2VXUH 4OFKA 4AIOA 1C5CL 1R3IH 2GT9B 4NRXB 1D6EB 2EXWD 4JLRB 2YPLA 3MNVB 3TVMB 5DMIH 4M1GL 5JW4Q 5HHOB 1K3IA 3B8SA 3H9SA 2X40A 3LV3A 1FL3B 5J12C 3BZEB 1ZLWK 3W11C 3RVXD 3QEQB 2A73A 3VGAB 4MZ3A 5L7XH 3QFJA 3RX7A 4LDLB 3RVUC 3PQYD 3ULVC 4NYLB 3WFEL 5E1AA 3U4AA 1LD9B 5C0CA 3G6DL 1YC7A 3T08A 1LO0H 3VXMD 3PQYE 2LU7A 2D4DA 3ZE2F 3MOBL 1L7TH 3NCEB 3GKZA 3O6KL 1KJMB 4AYFA 3VXME 4TUOA 3PWLB 3ROLB 2I07B 1CTOA 4X99B 3RI5F 2WQRA 3NA9H 2VO5A 5DUPL 4PJFE 3NA4A 1KB9K 4PGCB 1FFPB 3VRIA 4HBQA 1RUQL 2VLME 3E2HC 5IESL 1IMHC 2R69H 3V5DA 1FBIH 1X7QA 1FL6B 3D2UB 5JOEA 2DF3A 2VLKA 3OAYK 1YY8B 4XVJL 3X11A 1UC6A 4GBXC 3U6RB 4P49A 4P2QD 4WY7H 4KGJA 4W4OC 3UJTH 1WF5A 1U8PA 4XP4H 1G9MC 1P7QD 1ZVSB 4GAJH 2BZDA 4X4XB 4P2QE 1U91A 3EO1A 3CU1A 5E9DB 4PB9L 1S7VB 4P5TC 3C8KB 4D8PB 3MRDB 5T1KA 1S7RB 3AXLA 4WEBH 5EFIB 4LSPL 1XGPA 2CDFB 4UQ2B 1P9MA 4PJXB 1BREA 1W72H 1F3DJ 1CICD 4GXVL 2Q86B 1GIGH 3ZKXC 4ENED 3ZKND 1GGBL 4M7JH 4HEPG 5GRJH 4OSUL 5IJKA 2C7UB 3DVNB 2XI9A 4YO0B 3SDDD 4DVRH 2VH5L 1P6FA 1T83A 1EVUA 3K1KC 4OCRL 4GG8A 1MPAL 4JQXC 4P46A 1FVCB 3WNPA 4PJEE 5C3TA 1KPRA 3NACL 4YWGH 4YHIB 5L2JA 2VR5A 3P9WB 5FYLL 4BSWA 3ARTA 1A9BB 3GB7A 4Q9CA 5DRXB 3H9HA 1HZHL 4L1HA 3MA7B 3PGDB 5IHZA 4H20H 3NIGF 5F3HB 3V6BR 3U1SH 2YHGA 5DK2B 2VUOA 2XZAH 3ALWA 3T65A 3KLAA 1B4JH 3LN5B 4O2EA 5C0BB 4WIQA 2ENYA 1SEQL 4JDTH 4U31A 1QYGL 1UFUA 3T1WA 2RCSH 3OKLA 1MQKH 3RVTD 2GSIB 1W0YT 4JM2A 3HI6H 3D1MC 4N9GB 4Y2DB 4GAYB 5GS3A 1OAUH 5ICYA 1HHIB 3GMLA 1LEKB 2J4WH 2NXYB 1Y6MR 4QXWA 4ZODA 3ZMRA 1CFQB 1KXVC 3BKCH 3HMXH 4N0UA 4N90D 2AW2A 1UKQA 3BW9B 1T5WB 4NP4H 4TULH 3QUKA 5LXGL 4N90E 4RZCA 4FXGA 4RFEA 2FLRT 4GW4B 4Y4HA 1BIIB 4QHUB 3NBNA 1R5WA 3D39A 4ZG1A 4JQVA 3K46A 1JFQH 2F54A 2X42A 5GJSH 3HZKB 3CXDL 5CSGA 1QHPA 4NQCA 3PHQA 1CFSA 2DM4A 2XWTA 4HC1H 5A3IC 3LDBC 4N68A 3GMMB 4PRDA 5CD5D 1JZ6A 5D8JL 4XXDB 3RNKA 3LS4L 1RURL 4LNVA 2IAMB 3ZKSD 5F88B 1JPFB 3RKDD 4HLZH 4RMVA 2FBJH 5JQ6L 3ALPA 4PJDB 5CEYA 4BA8A 2FD6H 4I13B 2EDNA 5E6IA 4EI5C 4Z77B 4H0GA 2APTA 2E9JA 1G0YR 1S9XA 3CJJA 1F3JA 3GSVA 4TNVK 3MV9B 4DKFL 2Y36H 1KCUH 5JIHA 4M00A 5CGYD 1SMOA 1TVHA 5E6YA 3K2MC 5L0QC 2ED8A 3BD5A 3BESR 1OPGH 3H9ZA 3MLTB 3FHAA 4KTDL 4P0DA 3S96A 1RI8A 3DX7A 4WO4D 3BP7A 3U7YL 4CU8A 3VXSD 1YN6A 2HRPL 1XR8B 4NQSA 1KCRL 5DDHB 4K07A 4QT5A 4WU7A 2X4QA 4WHTB 3VXSE 1RK1B 1T5XB 2J3SA 3FOLB 4QWWC 4K71B 4RMQA 2X1OA 5C0FB 5CINH 4JM2F 5CHNA 3MLPA 2WANA 3VXUA 3GKWH 4LRNH 1AGBB 2F58H 2ICCA 2EDBA 4C83A 3TN0D 3RWHA 3VFGL 4BFGA 3C2SA 2VLRA 3OJDA 3U4EB 4XMKH 1M4KA 1OTTD 3VXQA 4L8BB 3RU8L 1OAYL 4XBGA 4ZPVB 2B4CL 1IGTA 1HYRC 1A5FH 5FYJD 4RA0C 3OF6D 1BOGB 3RWIA 4OFPA 1OW0C 2QJDA 4HULB 4KKBD 3MLWH 3WBDA 4BK4A 5M95B 1UM4H 2EDOA 5ANME 1HINH 4JZNB 1EEUA 3BPNC 5I1GL 1S3KL 3TESA 4WI2A 4LSRH 1LK2B 2OTUB 1CLOH 2N56A 3O4LA 2VIRA 3GMPA 4X8XA 1QNZH 1K6QL 4QOKD 4HV8B 5KSAC 4PB0L 3P9MB 1I3GL 3BXNA 4EJ1C 5F7EH 3HR5B 2FLBT 5D2LB 5KJRH 4KDWA 4XPTH 3QWOA 4QOKE 3UYRH 4FQIH 2GTWA 3LSOA 1FNFA 4JZJC 1EO8L 2WV3A 5KSUB 3UAJD 2Z31B 4N8VB 2V5SA 3W0WD 2Z92A 4Y4FC 1KN2H 4Z7UA 5EU5A 3H0TB 4GKOA 3W0WE 2Y5EA 5CSBA 5E1HB 2HWZL 3TZVB 4R2GC 4OI9A 2B2XH 1UA6H 3F12B 3U82B 4O5LL 1AD0B 2R4SH 4WU5A 1UZ6E 2ENSA 3INUH 2C4FU 2DI9A 4APQC 3UZVB 3LIZH 3CZFA 5A2LH 5J3HC 3BJLA 4XVTH 4OT1L 2I9LA 4OV5A 5EZOL 4ZFZA 4Y4KC 3V0AC 2VAAB 2QSCH 5SX5H 1I1AB 4DQOH 1I3RB 2JCCB 3TPUA 1NDMB 3HE7D 1RZJL 2BNRB 2C3GA 2G2RA 4ZOBA 3U36A 3Q3GA 1C8PA 3ARGD 3RL2A 3LKRA 1WBYB 4I48A 3PABB 5GRVL 4OZIE 4Z95H 1G7LB 1QO3B 5IJVB 4Q0XH 1D9KD 1DSFL 2GAZA 4YR6B 4GH7B 5IW1B 4NO2A 4NQXA 1DBJH 5C0AD 4MAYB 4MD4A 3ZDZE 5D7JB 1MF2L 5E00A 4QTIL 4XWOC 4EN3B 2AJ3B 4LGSB 5ALBL 1MI5A 2HT2C 5FYKL 1ZSDB 5C0AE 1JNHA 2Z9TA 5EOTA 2EXYC 1NJ9A 1SYSA 1ZMYA 3EZ8A 15C8H 3L3JB 2X1PA 2KQMA 4R97B 4X5XB 5J7CC 5KVFH 4NO5A 3NCYS 4XP9H 4KKLC 5C07D 1NCAL 4MQXC 1PG7L 1JGEB 4KK8D 4OGYH 4PRHD 4ZQKB 4Y5VB 1SBBA 3RGVA 1EXUA 3QULB 4GG6A 5E94B 4DVBB 2J2ZA 5CBAB 5C07E 1J05B 4HUMB 5FKPA 4PRHE 3DX8A 4XGZB 4PRAB 3S34H 3T09A 3N1GC 1F3RB 2DOCA 4C54A 4I2XA 1MCPH 1FIGH 4LASL 4FQQB 3S5LB 4RAHA 4MS8C 5CBEB 5E5UB 4Y1AE 4YFEA 5J6GA 1LDPH 3LKPA 3QQ4A 2BY2A 3HRZA 1A4KB 4MNQA 3OTTA 1UM6H 4NN6C 3IFPA 5B8CC 3O2WH 1S7XA 4OKVA 1EJ6A 1P4LA 5ECJE 4Z7UF 1E4WH 3OQ3B 1NANI 1QRND 2ZPKH 4GLRH 2I9TA 4Y2OA 4E5XB 2AXGA 5IBTL 5HXMA 2NTSP 4Q6IB 4G6KL 4HKBA 3FB5B 1QRNE 2CMRH 1ZHBB 4KJWD 3BKJH 3WFBH 1J86A 3C6SB 2C26A 3R8QA 4LCCB 4MSWB 1K4DB 1JN6B 4DN4L 3QUZB 3CZJA 5DT1H 2Y72A 4I3RL 2MQ3A 4ZD3L 2CK2A 1T4KB 2UY6A 5C2BH 1NCNA 2ATKA 3RZCD 3L1OL 1I1YA 1HI6B 4P4RA 4JVWA 1JF1A 4EUPB 3FFDA 3KVQA 3O11B 5DMYA 2Q8BL 3CLFL 1DUYA 4HPOH 1IQWL 2JK5A 1G7MB 3ZYIA 4J8RB 4D9RD 3P0VH 2QEJA 1NDGA 4XNXH 3QRGH 3MODL 4KKNA 5I76A 1IEAB 3TBVB 5DVNA 1AFVL 3OL2A 3TBYB 1UB5B 2VLJD 4LSTH 1P2CB 1S7QA 3CVHH 1N2RB 3VCLB 1MHCB 3I6KB 2FEEI 4HGKC 2A77H 2E9BA 3VXTB 2VLJE 4MDIB 7CGTA 3MLXL 3ZT7A 1T6WA 1UM5H 2Z91A 2X89A 4IJ3C 1XR9A 4KRNA 4QHKI 2H32B 2HTKD 1FO0B 4TRPL 5E6ZA 1UYWH 1Q0XL 4AZ8A 1MCBA 1SHMA 5C0GA 4HIJB 4GG6F 1YPZB 5BRZD 2YK1H 4P2YA 2NY2B 5J13C 5KVDH 3QHFL 1ZLVH 2DKSA 1T7VA 4NGHH 2NLJA 4XHQA 4PBWD 4BH8A 5BRZE 4Q9RH 4RWYL 3ZE1E 4LQFH 2CKNA 1CT8B 2NZIA 2V9TA 4WUKL 5ITFB 4S1SL 4HUWB 2CRYA 1T0MA 1F8TL 1DEEB 3C8DA 3CC5B 1CDCA 3DARA 2FJHB 3VGFA 5HHXH 1A6ZA 4HG4J 5I0ZA 1FZOA 1UWGL 2FRGP 2VISB 4S1QL 3TV3L 4XPAL 3FO9A 4PLJD 3EIFA 4U0QB 4IOIB 4LLVB 2DLFH 1BF2A 4XPHH 2UYLB 3IDIB 5F9AC 4HCRH 4M93C 5H35B 2H3NA 3VMOA 5F3BA 2VABB 3JVGA 4LL9A 1CDIA 1T04A 1VADB 3JTSA 5BVPL 4JGJA 4PRIA 1FIEA 2OP4L 1T1ZB 4NKOA 5JDSA 2BY0A 1GC1L 3MRMA 3WJLA 4HZLA 4J12A 1KCSL 5CKGA 3FOMB 1T6VN 2ZCHL 3ET9F 1S7TA 1FNEA 1QSEB 1FJ1A 2QSQA 3BH9B 1N0XL 3OAZK 5DGRA 1OSPL 2YBRB 3LMJH 1R3JA 2V7NB 1QVOA 2BOBB 1JZ8A 1WC7A 1U0QA 4G9DB 4HFWB 3DURB 4Y5XB 4JY4A 5TE4L 2O5YL 4OQTA 5FF6A 1X6NA 4MA3A 1YEJH 2W0FA 3LEVL 1MWAH 4U1LA 3CSYB 3WIHA 2E9IA 1FVEB 5D7SL 2RR3A 5GSRB 5CZVH 1JPGA 2CDGB 4MA8H 4UILL 1IKNC 3SDAC 4X6EA 1EHLL 5LBSL 2B0SH 2C1PB 3VG0L 4UUJA 4K9EL 1T21B 1QPXA 2GSGA 3OB0K 5AYUL 5D7IB 1RZIA 3J7HA 4JB9L 4Y89A 1BPVA 3CPLA 1PKQB 1AXSA 4UB0H 3VMNA 4OFVA 1YEEL 3FO0H 4P59H 1PLGL 1T66D 3EDJA 3QNYA 4PJCF 5LCVL 2PUQT 43CAA 5IW6A 4CN6A 2EZ0D 2ICWA 2N4IA 3HB3D 4JO4L 5HDLA 2FYYB 3AMKA 1RSFA 1ZT1B 5F7YC 1QSZA 1CL7H 1OB1B 3U46B 3BPLB 5T3ZD 3O2VL 4F7PB 4U1IA 1QFUL 3QDMA 2EDWA 1U8NB 4P23A 5T3ZE 5E70A 1G6RB 1RY7B 3BP4A 1AIFB 4NUJB 5AD0A 4WUUA 3KYMA 5DO2D 4UV4H 2AK4A 2HN7A 3VXRA 4YDIL 2ZUXA 2XNAA 3NVQA 4OF6A 1N3NA 1UWXH 1DTUA 3LKOB 5SWSA 4TSCH 4NQTA 3L95B 3ARBD 5HSFA 2FSEB 3E6HB 1UJ3C 4F2MA 1CN4A 3QG6B 5J1TC 3ARWA 4K7PH 2R2BB 1PD6A 3TLRA 4ODHL 2H9GA 4WI7A 3F7RA 4WWKD 1CFTA 2X7LB 2CLZA 4YEEA 1K2DA 5ESAA 3SE8H 1RULH 4ACPA 5INDB 2AJUL 3TEUA 1ZEAL 2DICA 4XWGH 1T7YA 3O4OB 3GMRA 4CW1A 1NMAL 1BGXL 3TVMD 5E2WH 2P5EA 3PE9A 4I18A 4CDHA 3TYFA 4KUZL 2ZCLL 4ETYA 3FQTA 3H9SB 3I6GA 3QEQD 1F13A 1IBGH 3HKFA 2MKWA 3G5XB 3TFKD 4HXBL 5DWUH 3SDYH 3QEQE 1V7NH 1QLEH 5IT2H 1FG9C 3TM6A 2XQYG 4HS8H 4DJMA 4HWBL 1SJEB 5AAWA 3BOVA 4C57C 4ETQA 3RUGA 4P5MA 3G9VA 1KEML 4HIEB 2CIKA 1GZPB 4M6NH 1CXEA 4OCLC 3SKJH 1CD1A 3ULUF 1QTYT 2BHUA 4FHBD 4GS7B 3EYUL 4H8WC 1G7PB 4H5SB 1GJIA 1KB5A 3V52L 3AAZA 2KKQA 3VRIB 1GSMA 4R4FL 3D2UD 4X8JA 1OCWH 5FHAH 3V5DB 2EIBA 2DQFB 2PXYA 4KI5F 1X7QB 4N8PA 2LE9A 4JFQA 2VLKB 3MGOA 4G6MH 3EBAA 4Q6YA 3O9WB 3D0VA 1SVCP 4PP1C 4X5WA 5EOCL 3PV6A 3WYRA 3VGDA 3X14B 3ZTNL 5DD5L 5IB4B 3RA7L 1NKOA 5E9DD 4A2LA 2P8LA 2IH3A 3NFPA 5D1QD 1PYWA 4Z78A 4ZXBA 3PNWA 4XCNA 1MCLA 5E9DE 2VDOH 3B6SA 3DTXA 3OJ2C 3AXLB 2R23A 4Y5YA 4DW2H 7FABH 2HFGH 4OLWL 5EBLA 1MJJA 5IFAH 4H88L 2YRLA 1EFXB 4MJ5B 3QXVA 3PP3K 5HVHB 4FFZH 4PJXE 1CFNA 2YSSB 4P3DA 2NY1D 4KK9C 4X80L 2ZG2A 4R3SA 4HG4K 4TNVF 2J1KA 2BRRL 4GFTB 1I7UA 1FGVL 1N4XL 4GG8B 2D7MA 3PHSA 1UENA 1P7HL 1LQSR 1U8LA 4KQ3H 3G6JE 4CRPA 5L2KB 2FL5A 3DSNA 1CLCA 2V5RA 2VDKH 4KMQA 3CLEH 2VWEE 4X7TA 4EIZC 1S7SB 1CTNA 4XVSH 2Z8WC 4JKKA 3MA9H 1AY1H 3AROA 3VGHA 1UQSA 3TCXA 5IHZB 2HT3D 5MEQA 3WFCH 2FIKA 2SEBB 1QKZH 3BRGC 1OSZB 1QLRA 2CPCA 3BMVA 4UTAL 5C0BE 1YEGL 4I0KA 1J5OH 3N0PB 1TITA 1BFVH 4Y2DD 1J10A 3CU7A 1Q1JL 2YPVH 2COQA 3T0XA 1SJHA 3BIKA 1FPTH 4LLUA 4NN5C 5I75C 2ZNXA 4KV5F 1R3IL 1MHPL 4LARL 5EWIH 3RUGF 1YEKH 5DMIL 1MREH 4XZUB 3U9PH 3EDDA 4TYUA 4MLIA 4FQJH 5GSVB 5L7XL 3WJJC 1QBAA 1HHHB 4Z0XB 2NW3B 4MB5A 1MRDH 4N9OB 4M7KH 4YC2C 2VXVH 4FXGB 4RFEB 1LO0L 2FEDD 4K8RL 3MO1A 1R5VB 1JVKA 3SKMA 1D5ZB 2W07A 4I8DA 3DUHA 3D39B 1L7TL 1CFBA 3RIFK 1RZGB 1KJ3H 1Z3GH 1UXSA 3NA9L 4NQCB 1RUKH 3PHQB 3IDYB 1RU9H 3EUUA 2Q3ZA 5LQBH 4F9LA 5CEZH 3ZE0E 1WFNA 5AEAA 1JZ2A 2R69L 3RFZC 1KF9B 4PRDB 3ZHLA 2IAMD 3TIEA 1FBIL 4H1LB 1ZGLA 4OB5H 4KK5D 3MV8D 4IBLT 4FQLL 5B4MC 1A7RH 1VACB 4GXUN 4WY7L 4Z5RA 4LNRA 5TQ2H 4XP4L 4K23L 3QUXA 5DZOA 2AJXH 5B3JF 2EC9T 4GAJL 4PJDE 4UBDD 5I73B 4NT6B 1JNNH 1PY4A 1T1YA 5DGQA 1MCFA 1FVDA 3GSNA 5AUMB 1BLNA 4ERSH 3I50L 4WEBL 3QFDB 3VI4F 5BS0D 3MV9E 4F57H 1KJ2A 1W72L 4RMWA 2FX9L 3MRCA 1GIGL 2WQ8A 3DRQB 2OJZH 1ZLUH 5BS0E 5CP7B 4HT1L 1NL0H 2AV1B 1FV1A 5I1LA 3S96B 4KUCF 3DX7B 4DVRL 1IARB 3RTQC 3BP7B 4RDQG 4O2FB 4YEFA 3LN4A 3QUYC 3BDYL 1RMFH 4YE4H 1G7QB 5F7MC 4QT5B 4WU7B 1DN0A 2X4QB 4PTTA 3VFNA 4PGJA 4YWGL 4P4KB 3BEVB 3LQZB 5AG8A 1K8IB 3UBXG 1A02N 4IMLA 5CHNB 1H3GA 2NXZC 4GBXA 4H20L 2XV6B 1FZKB 3U1SL 4KJQC 2XZAL 3QIWC 3QNZB 4DK6A 4C83B 1SVZA 3RWHB 1B4JL 4F7MB 2VLRB 3OJDB 3AREA 4X7SH 1J1PH 3PL6D 2J6EA 4PV8A 1CDUA 1ZXQA 2RCSL 4JREC 4WNQA 1BQSA 1EEZA 2VKXA 2QADD 1IGTB 2NZ9C 5IK3B 3UZQA 5HPMA 3RBGA 4FG6C 2VLLA 3HI6L 2LU3A 3HZYB 5HI4D 3ULVH 3QQ9C 2R2EB 4FA8A 3F7VB 1YMMA 3NCMA 3M8OH 3QIUC 5FA4B 2R29L 2P7TA 2J4WL 4UDUA 2P5WA 1RZKC 1T7WA 3KYNB 4HBCH 5KANI 3C5ZC 2APXA 3BKCL 3HMXL 3HI1B 4G8FA 4ZAKC 2V5MA 2VIRB 1RUPH 3R0MA 3GSUA 1DBKH 4JFYB 4NP4L 4TULL 3V95A 4OF0A 4G6JL 4GSDL 3BXNB 3IFNH 4NSKA 3EJZD 5L9DH 3EHBD 4L9LC 1LHZA 4NFBA 1V7MH 1Z2KA 1ADQA 4KXZI 5D2LE 5M94B 2B4CC 1MCDA 1S78C 4N5UA 1JFQL 5DJ6B 1TCRB 5GJSL 5BQ7A 1BP3B 4YHNA 4S2SA 2OZ4H 2J8OA 5I1KH 4JG0H 1LVEA 4Z7UB 5EU5B 1R6VA 1Q0YL 1G9MH 3TZVD 3DJ9A 4CAGA 1BHGA 1J1OH 4HC1L 3MLVH 4BZ1H 5TDPB 2OR8A 5TE7L 4CMHB 1UH4A 3P4MA 3QR2A 5T1LA 4NIKB 3KAAA 4WU5B 1OGAA 5ALCH 3KYAA 4KZEH 3UO1H 2FBJL 4LF3A 2X1QA 4PRPA 3U30C 3LCYA 1H3VA 2XKNB 4M5ZH 1I1AD 2A6JA 2EDHA 1RK0A 2WLYA 5IIEA 3T3MF 4FOMA 2FD6L 5CIPH 2KL6A 4PGZA 3TPUB 1LILA 4BKLA 3KNBA 2BP3A 3SY0A 3U36B 1DBAH 2G2RB 2JCCE 1XF5A 1KIUA 2EYTA 3Q3GB 4M1CC 3RL2B 1G9NL 2BNRE 1DQQB 1RZ8A 3LKRB 1KCUL 1OF2A 1NMBL 1INQA 1P84K 4GQ9H 4OD1H 3MGTB 3O3DB 3TO2B 4MX7A 4PUBL 5TGBA 1OPGL 4PJBE 5LG1A 4LLYA 4YDKH 4MZ2A 4Z7WA 5TQ0H 4IIQC 2MSPA 1JTTA 3K0WA 2XICA 5D7JD 3STBA 4EN3D 1T2QH 5E00B 3BE1H 2NY6B 2HJKB 1I3VA 1RIUL 5C0NC 4P3WA 5HHQB 3STZA 1P69B 3T77A 5T1DH 1HSAB 1JNHB 3UTPD 3GSWA 1SYSB 2DN7A 3BGFC 4EBQH 5CINL 4NO5B 3BAEL 4GRMA 3GKWL 2OM5A 4M6MH 5D7LB 4OI7A 2R1YA 2L7JA 1AKJA 5DTFA 4GG6B 5I2IB 1BD2A 3QO0A 1XGQB 4JFHD