2E27L

Crystal structure of fv fragment of anti-ciguatoxin antibody complexed with abc-ring of ciguatoxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
IQMTQSPSSLSASLGGKVTITCKANQDIKKKIAWYQHKPGKGPRLLIYYTSTLKSGISSRFSGSGSGRDYSFSISNLEPEDAATYYCLQYDNFTWTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-ciguatoxin antibody, light chain
publication title Critical contribution of aromatic rings to specific recognition of polyether rings. The case of ciguatoxin CTX3C-ABC and its specific antibody 1C49.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e27L00
4M6NL 5LGHH 1CLYL 4KJWC 3RIFK 3ARFB 5LWYH 2GJJA 1B0GA 4JQIH 1YY8A 2PW1A 4CVXB 4WEBH 4K7PH 1U8NB 2GKIA 2P1YA 1P4BL 2ZNWA 3DUHA 1ACYL 4AM0B 4YHYC 3LPFA 2RCSL 2VC2L 4WO4C 4LRNH 1JMXA 5JOFA 3P2TA 4XMLL 4E41B 1T2XA 1I85C 4XP9L 3PP3K 2V7NB 4PJDA 1ODAA 3UZEA 5IWLA 3WEXA 5HD8C 5FV2A 4YHIB 4P3DB 4JO2L 4OJFL 4CVUA 4QRSA 3BKMH 3V0WL 4JJHA 3QPXL 4ISVA 4I48A 4R90L 4S2SB 2I5YL 4OM1H 3HRZA 3MLUL 3HC3H 4LLWB 2H6PA 3IDYB 2NYYD 3PWNA 4WU5A 1T66C 5IB3A 3L5WA 2YUWA 4G6AC 4FNLH 4R0LC 2LFGA 3JV5A 5M7QA 1J8HA 2QJDA 4ODVH 3RWJB 5IF0A 4E0RA 1NCUA 3SDDA 1K6QL 3GMQA 4GG8A 1TJGH 2XY2A 5J12C 5T1MB 3WS3A 4JDTH 4AZ8A 1RZKC 2DQJH 2VLLB 5KVDH 3QXDB 1BVZA 1JRHI 1MCLA 3MBXL 4DCQB 4X4YB 4ZDHA 1XF4A 3ARDB 1P9MA 5TH2B 5I73C 3VMPA 2AEWA 5C0BB 2FGWL 4JFPB 5JR1H 1NDGB 5F7LB 3MLXH 2XZAH 2R23B 1KELH 3H42H 3TVMD 1A3LL 5I74C 4O4YH 3PF2A 5I9QC 5JA8B 3VI3E 3LKSA 3QEHB 4OLZH 3X3FL 4LKCA 4N8CH 2EDRA 4PJ8A 4F15C 2R0LL 3W0WE 3SJVA 1JGEB 3H9SE 5C0JB 1EGJA 1NANH 2P47B 2ZCHL 2HH0L 5EBWA 5FO8B 2CLVA 4MAUL 5HI3D 4NDMA 2QV2A 1T3FB 1EO5A 2C1PB 3INUL 4WWID 3SCMA 1F4AA 3GMLB 4RGOL 5DQJB 4QTHB 5GISL 3RWFB 4PTTA 3ZDZE 4OLWL 2X4OA 4QOKD 4U1HA 4XCEB 5MHSE 4PJCA 1IAIM 5DEFB 1YQVH 4M48L 1R24A 5K9KB 3TM6A 1A6AB 3DSNA 5AZEH 2VITA 5SV3A 2BVYA 1OQOA 1D5XB 1F45A 1MWAH 1A4KB 2D7TH 3MRBB 4XVJL 3R1GL 3P9MB 4PB9L 3TZVC 1G0XA 4HC1L 4KGJA 5ADOL 1TQCC 1RURL 4FZEL 1HNFA 1JGVL 4QHLB 3MUGA 1NBQA 5EOTA 5EO9B 1NC2D 4ZAKB 3H9YA 2AJSH 4NO5B 3TH4T 3D2UA 1JI1A 1U8LB 4ZUVB 5DYOB 1MI5E 2OM5A 1WAAA 3RNQA 1YY9D 2ZOLA 4WDIB 4WW1A 2CLZA 1TJHL 3WO4B 1RVFH 5DD6A 3OGCB 1JPSL 3CCHB 2HMID 4BQCA 2R0WL 4UU9A 2E7CA 4I3GA 3P4NB 3RDTB 4C56B 4XTRC 4K71C 5FCUH 4MSWB 1IL1A 3HNTH 4L4TD 4M61B 5TE7H 1N4XL 3VXPA 4H0HB 2VZOA 2YD1A 3SDDD 1C5BH 3IT8D 5GIRB 5T33L 4TNVF 1DQTA 3H9HB 5C0RL 4PJIE 1L4IA 2CUIA 2XKNB 5EO0B 2BJMH 1VSCA 2F19L 1PQZB 2YUZA 5EIVA 5HY9A 1R3IH 5K9OA 5D8JL 1CICC 3TIDA 4WRLA 5KSVA 3NACL 3BKYL 3V6ZB 5EBLA 1Z3GH 2R29H 2HT2D 1TJIL 4TQEH 2IH1B 2G60H 1XIWB 4YK4B 1JGDB 1QSFB 6FABL 1Q0XH 4RWHA 1UH2A 4BZ1L 3CFBB 1X3DA 3CDGB 3KWWA 1KENH 1VHPA 3BP4B 3DRQA 1AJ7L 3QXTA 2YK1H 3HLAA 1C1EH 4KI5D 3G6JB 2Y7QB 4PJ8D 5DT1H 1FDLL 1LEKA 3BGFC 3GHBL 1YNTA 3KYOA 3QZWG 3SJVD 3TH2T 3GBLA 2YD4A 5E70A 1G7QA 3RZCD 3V6OA 2EE6A 3C5JA 3REWB 1CIUA 4A2LA 1S7QB 2D9CA 1BFVL 3EYUH 4JZNB 1YJDL 4KPHH 4W6YB 5B4MC 3SCMD 2OTWA 2DD8L 4O2EB 4XZUB 3KDMA 5FYJE 2HJKA 1F00I 3V4PL 3Q1SL 4JLRA 2Z31A 3UYRH 5D2LB 2MNUA 4M8QB 2ZUYA 2VUOA 4X6CA 4LLQB 2C5DC 2D9QB 1CLZH 3FQRB 1VFBA 1G7PB 1AGFB 4HFUH 5IJVB 2DQDH 4GMSH 4U6VH 5IBTH 2VRAA 4LIQH 5DHVH 2VXSL 5DVOA 5DJCB 4RX4A 1AD0A 2YHGA 1G9ML 3WUWG 4KTDL 3WS6A 2XWTA 5C0GA 1G6VK 5DUPH 5F3HA 4X7EC 5D1ZB 4CU7A 4JO3H 3OQ3B 5E2JA 4LCUB 4KVNL 3MTRA 3JZ7A 3SKMA 3BWAB 2CO7B 5LJYH 1RFDL 1EBPA 1DUYB 2X1XR 1JV5A 1JCKA 4LASL 4YHZH 5L88H 4OFVA 4LGPB 4NFDA 4R4BA 4PJAE 4QHMA 4XH2B 3FZUD 3PG2A 1DBAL 1FZMB 2XT1B 1EJOH 5CP7B 1WZKA 2YBRB 2BVTA 4QRQA 3S8WA 3T0WA 1I4FA 5TE4H 2ZJSH 3ZYIA 3CDYA 5TF0A 5FGBC 2OI9C 2ORBL 4UQ3B 3BZEB 3W5NA 1CWVA 1P6AB 3PQYD 3K2UL 4BK4A 4YFEA 3GMNA 2CMRH 4R9HA 3QXUA 3CVHH 3UZQA 3JWDH 5F7HA 4QCIB 4H20L 1NJ9B 1GPOL 4WUKL 2F74B 2O26U 1FIEA 2VXQL 5CINH 2EEAA 1RAMA 3B43A 1II4E 3CUPB 5IEKB 2CKBA 3HC0B 1BAFL 3OB8A 1CE1H 2L4OA 1QLFB 4HS3A 3MQIA 3UO1H 5IBUG 4DZBA 3GJFA 4PG9A 4ODXA 3EYVB 1QKZL 1U3ZA 3TVMB 3T3PE 4Q2ZB 1ZGLM 4F58H 4ERSL 2HP4A 3KYKL 1JWSB 4I0CC 3D85A 4K2UH 4N8VB 3M17B 4PLJC 2OMBA 5KZCB 5D5MB 3T1WA 5JHLH 1WSST 4IIQA 1HNGA 3N85L 3HZYA 15C8H 5TDOA 1RJYA 3ZKXB 2XQYK 4Y16C 3WFZA 3MODH 2DM4A 1I8KA 1MF2L 1I7TB 4N0CC 5DTFB 1ND0B 1JF5A 4JZJB 3PWUB 1S5HA 3OAUH 4GSDL 2W0LA 1JNNL 4IOSD 2DM2A 4XI5C 2OS7A 5C0AE 1MFNA 1DBML 3VFTA 2HLFD 3V5KA 5MEPA 1T5XB 4P5KA 4GW5A 2LTQC 4TSAL 2IH3A 1J05A 5I0DA 4Q9QL 3I75A 4Y5YC 4EDXA 2JK5A 4AEHH 3GSQA 1A6ZA 3L7EA 2B39A 1J1XL 1KJVA 3MRRB 1HH9A 4BKLA 5IFJA 1FAIL 2H2PC 1CGXA 4KVCL 1UYWH 2WWKT 2Z31D 3GK8L 5E0QA 5BV7H 5E6ID 3UTPE 4ZPVA 3MOBH 5EN2B 2K7PA 2YPLB 3U79A 2HAZA 2EDYA 1PEZA 4JJ5A 2NY2B 4LVEA 1S7VB 2ILLA 3EO9L 4RX4D 5LGJA 3TFKD 3QQ3A 4Y4HD 5C08B 1B4JL 5CP3A 4JRYA 1U8QB 1AR1D 1IAOB 3O8XA 4JQIL 2PTTA 2W0FB 4KZDH 1FBIH 2VXUL 1NC2B 4K7PL 3VRIA 2DQEL 4XP1L 1AHWB 2VDLH 3MV9B 1WZ1L 5HGBB 4LRNL 2IAMA 3S88H 1H3UA 2P8MA 3WEXB 1M7XA 3QR2A 3MUY1 1XGTB 4JAMB 2FYYA 4CDGC 4QRSB 4HS6B 3ZYZA 3HCVA 1RJZB 5CJOH 3ARQA 4PRBA 5ENWB 1G7LB 4EBQH 2IPTL 3L9RA 4OCSL 1VPOL 3JWDC 2QBWA 5D72H 3FT4B 3RHWF 4XX1G 2R69H 3JTTA 2NQCA 1T7VA 2HFGH 3ZT5A 3V7AG 4L4TB 1T1WB 4OM1L 5MI0C 4OZHF 4U0RB 4MCYA 2WZPD 2EIDA 3O9WC 1BFOA 3RFZC 2IADA 5I1JH 1MFEH 3CFKA 4L3EE 3RWDA 3ULUE 4ODVL 3TT1L 1EUUA 3GJEB 4J3WA 1LGVA 4JDTL 2DQJL 3F5WA 4ZDHB 5KVDL 4EUPB 5JLZA 4O2FA 1CG9B 2A0LD 4FTVE 3DHJA 4FQXC 2LE9A 3VMOA 5IMOA 2XWJA 3WNMA 3GKWH 5GGVY 1Q9LB 1FLRH 2GSIB 3DSFH 4DZ8A 5JR1L 3FRUB 1KPVA 2XTJD 1QG3A 4FFZH 2PO6A 1QEWA 5C0CD 1T0NB 3H42L 2OTUA 5IV2B 3RWIA 3VG9B 4K7FA 1ORSB 1CYGA 4O4YL 3W9EA 1HQ4B 1MCDA 4A6YB 4IRSC 3R8QA 1NEZG 3MRGA 4Y4KD 1DQLL 2C3VB 1FO0B 1YMMB 2EO1A 3RZCB 2A6DA 5K9QI 4Q0XH 5C07E 4M1CC 3I6GB 2BVEA 4PJ7F 5BV7C 3BD3A 3WD5H 1GGCL 3GB7A 1ZVYA 1E6JL 1HZHL 3CSYA 1K8DA 1TENA 2P7TA 5DWUH 2BX5A 3PHSA 3ZE1F 4NKOB 4Z7WA 4WGWB 4ZOAA 1N5AB 4NZJA 4DKEL 5FK9B 5M94B 4EVNB 2V2TB 4LCWA 2Z35A 2ZCKH 4K7PX 4LOUD 1EPFA 1N7ML 5KSBA 4DEPC 1CFVH 1UZ8B 4HHAA 4KKNA 5IVZB 4P5TD 2NTFA 2X4NA 4OD1H 4DGYL 5JIHA 1RMFL 4UZGA 3TV3L 1A6PA 4P2QE 4PJBA 1MWAL 3G5YB 4NWUH 4LVHC 4X98B 5E8PA 4AIZB 3KYAA 5EZIL 3L5JA 2DDQL 3QI9C 5EU6B 5EZLA 4JRYD 3EOBA 3F12B 3MLYH 3O8XD 3GSOA 5E00A 1CD1B 3CPLB 5HHMD 5FM5O 1RJLA 2NMSA 1FRGL 2YOCA 4XPBL 2Q8AL 1OAKH 2AJSL 2IAMD 4L9LC 1IJ9A 4U1SB 4YEEA 2I27N 1MH5A 2JCCE 2DL9A 2R9HD 4HX1B 5CHNB 2PF6A 4DVRL 4QTIL 4R7NB 4XPAL 2XQYG 3HE7B 1RVFL 3L3OB 4YIQA 4PJFA 4WV1B 4DOHE 4MA7H 3C2AL 3PQYB 1SBSH 1MQKL 3VFNB 4FFWC 4JO4H 4TTGA 2F9BT 3CXDH 3VFVA 1G6RB 4KK5D 3B3IA 3FRPA 2FCBA 3O41B 4X8JA 1UWEH 1ZLSL 5ICYA 4ZUWB 1T6VN 3F62A 3HNTL 5GS0D 3NOIA 1MEXH 5TE7L 4P4KC 5ELIA 4F7MA 1GVIA 1F4HA 4JM2F 4IOFC 3DETC 4MAYC 4ODWB 3Q48A 5FDWA 1U8IB 2BNQB 2V5TA 4O02H 1OF2B 1N2RA 1RIHL 3SBWA 4HS8H 4I9WD 1KBGH 3C6LC 5HGGS 1R3IL 1CQYA 5J11B 1G7MB 3ETBF 4OF7A 3WFEH 5FDYA 1Z3GL 1J8KA 1XF2B 3AS3A 2GJZA 4W4NA 5KSUB 1U95A 4TQEL 4LDLB 2PO6D 4YHKL 1Q0XL 4LP5A 4PD4J 1AQKH 1H3GA 4IS6A 1KENL 2Q6WB 5EU5A 4GG6B 3WFDH 5LBSH 4I2XB 2QEJA 1AXSA 1WCQA 4PBWD 2P49B 1YNTB 3FQTA 3B2UD 3P77A 1BZ9A 2DWEA 1PX3A 4NKIH 5HYQB 4M7ZB 4X4XB 3UJJH 4BFGA 3BKJH 4BH7B 4C58B 5HBBA 3EYUL 4QLRA 1OT1A 3KDMB 3DV6B 4NQCA 2FSEB 3F58L 4JLRB 4LHUG 4L3AA 2A6IB 1PKQA 3KPLB 1BBJB 5E6IB 4HUWB 2VQTA 1FZJA 3RGVD 3UYRL 5FO9A 1F3JA 2YXMA 3E0GA 3TYGH 4LCWD 3WNNA 4Z77A 1CLZL 4LHQB 5J0BA 4UUJA 3TBVB 3PV6A 5HYIA 4JEGB 1SJEA 3D69A 5BZWB 1RZ7H 3C09C 2OXGA 1KLFA 5F9JA 4Y4HB 2VL4A 1IBGH 3TJEH 5HDQH 4G5ZH 2NY5H 1NGPH 2GFBA 5F3HB 4R4ND 4HSQA 5H94B 3OBAA 2PYFA 3NMEA 3NABH 1NKOA 4KY1H 4N0UB 5DUPL 1DQMH 4G9FA 4F7EA 3VFMA 3MGTB 1TCRA 3A67L 1F13A 5EU4B 4JO3L 1W72A 1XGUA 5GRWA 4QHNA 4W4OC 3UBXI 4BELD 2GEEA 4NM4H 3UZVB 3T77A 4XGZB 2V5YA 1NBVH 4EIGB 1T03H 5GS1B 5DFVD 4F8QA 1UVQB 4ODTL 5L88L 4OAWA 5DC0A 4MVBD 4D9LH 1U8HA 3EYOA 4NKMB 4PJDE 4EI5B 5ESAA 4HWUA 3WXWH 5TE4L 3QO0B 2ZJSL 1EX0A 2XNAA 2IBZY 2VN7A 3QUMB 3GMNB 3MLSH 4OM0L 4S1RH 4ZFOL 3RY4A 3BYYA 1YECH 4QY8B 4GKZB 4FQQB 3L3IA 2CMRL 4M6OH 4OD3L 4I4WA 3CVHL 4NN7B 1NGXA 1UXSB 3HPJA 1AY1L 4OV5B 3SDXA 5CINL 2FJGA 4AENB 2G5RA 5ALBH 2VUYA 1J8HE 5ILTH 4L8DA 3PWPA 4DGIH 2R1YB 4XCYB 1JPGB 2IBGA 2YA2A 5DRNB 2P24B 1GCFA 5DMIH 1JMZA 3KXFD 3EFDH 3BN9D 4G8GE 4TUKH 4RAUB 3SY0A 3WE6A 4YO0B 2OK0H 2IPUG 5C0CB 1WIUA 3V6BR 4OF3A 1KC5L 3PWVB 4F58L 2WBJD 5C0FB 3U0WL 3K1DA 4OTXH 3VWKA 5JHLL 3IDXL 3GSWB 4Y4KB 5CIPB 4MZ2A 1U8JA 4HZLA 5D7IF 15C8L 4ZQKB 1WFOA 4B50A 5FF6B 2BFVL 3MODL 4Q74A 3WKMH 1CR9H 1J0KA 1INEH 2BSRB 5C0NC 3MYJB 5JUEL 5FM5M 3EOAB 3FT3B 3OAUL 4HF5L 3SO5A 4XVUD 1CGTA 4XC1H 2HTKC 1DLHA 1QOKA 5DD5H 4HFWA 1ZHLA 3FMGH 2ICWB 2E7LA 4HH8A 2GITA 4LRIC 1KIPB 4S0TD 4HGMA 5B8CB 4JZOB 4NQCD 3EYQD 2EXYC 2FL5B 2Y23A 4OCNC 1KF9B 4DUWA 4C83B 3MXVL 5BV7L 1UYWL 4P5TB 3RVVD 3LRGA 3MJ8B 2OL3B 3LD8B 1BOGB 3MOBL 3HB3D 1A7PH 1A21A 1V5JA 1YEHL 1OP9A 2V9QA 4AT6B 1F2QA 4PJCE 1QVOA 2E27L 1A9BA 7FABL 1J5OH 2Q76A 1BQHA 3MMEA 4MA8H 1F5WA 3MACH 2X4TB 3WBDA 1ZTXH 2DKUA 1OTUC 1KXVC 1CL7I 1RK0A 4I18B 2GUOA 3MUJA 1BM3L 4PIRF 4G9FD 1FVCB 4HEPG 1FBIL 4OQTH 1KN2H 3B2VL 1KGCD 2IAMB 3L3KA 3QIWA 2VDLL 5ALCH 5EUOF 1VCAA 3FQWB 4FQ1H 1IKFH 1YEDB 4OB5H 1OAXH 1KCUL 3BEVB 4ZODA 1RUKL 1DL7L 2BNUB 4I0PD 2AGJL 5CJOL 1CT8A 2FH8A 3NA9H 5FAAA 1FSKC 1Q9WB 5D72L 5JW4Q 1WAAE 3BSZL 3CX5J 2R69L 2C26A 3ROLA 2HFGL 1WC7B 5D9SB 4ZMAT 1SQ2N 5SWQA 5CEZE 1DFBH 3B83A 3DURB 2Y36H 1UB6B 2IALB 3BO8B 4ZPTA 5FYJU 2ATKA 4UTBH 1J88A 1KNOB 4P2OB 4HD9A 2RBLA 4HAFA 4NRYB 4M7LH 3ULUC 4YWGH 2Y1VA 5JIIA 2A6KB 4P2RE 4NQXA 1AIFB 3BZFB 5IMOB 1NDMB 5JW5B 4JO1H 1LP9E 2VNCA 5DFWH 5EC2A 2EYSB 1VFOA 2XA3A 1EFXD 3GI9H 1FLRL 3AM8C 1BWWA 3DSFL 5F88A 5CSZA 2AJZA 1H3PL 4DKFH 1C5DB 1HI6B 1UACL 2MKWA 2Y5TB 3VWKD 1T20A 4P99A 2D31A 4X4MA 3SE9H 3QULA 2ZUWA 4GMTH 1NCWH 2QQKH 4HIHB 4LVOB 2Y4SA 1DTUA 5TDNB 2EYTB 1U36A 4JFFE 3QIBB 3T4YB 3QUYA 1S8DB 4ETQB 4UT9H 4YHMH 3UPRA 3GB7B 4Q0XL 1RJCA 2VL5A 3AREC 4X80L 4FXGA 1GGTA 3I2CH 3MRIB 4K8RD 3JWOL 3WD5L 3VXSA 5F3BB 2WUBL 4GS7C 3VU2A 3MRLA 3NZ8A 1OAQH 2CH8A 4WWKA 5DWUL 3RGVB 3LAFA 3SQOL 1VGKA 4V2CB 3BPOB 2JKXA 3FT2A 4N90D 43C9B 1B3JA 4PRPA 3STLB 3WL9B 1PX4A 3BP5B 1MCNA 1CDGA 3CU7A 3MPCA 5F9DC 4XXDB 1NGWA 3HZVA 5E8EB 3K1KC 3ZLQC 4X6CE 5KAQF 4HUVA 4KMTH 1OCWH 2CLRA 3BJLA 1KCSH 5GZOC 2V5RA 3F6LA 2A77L 5JMRA 4YBQC 2K3TA 2X4RB 1ZV5A 5EC1B 4L29A 2ICWJ 2DQHH 5GS2D 1E28A 2KQMA 5JW4M 4Q58C 2DKMA 3HUJA 3ILQD 3MUZ1 3QIWD 1FVEA 4MB3A 3BW9B 4WFED 2CR3A 2I9TA 2B5IC 4LLMB 1OAKL 3CFDB 1D6VL 4PYHA 1A02N 1HHKA 3VFSB 4XMPH 4PR5B 4NRZB 5I1DB 3TJHD 3CAFA 2O61A 2WV3A 2ZKHH 5T1KA 2O5ZH 4Z7VF 3HNSL 2FIKA 3MRMB 3D18A 4OIIH 3VFVB 3HR6A 1PYWB 1ONQA 3SGKC 4MA7L 4CNIB 3BMWA 5JW4N 4JO4L 1D5BB 1I9IL 3MLPA 5FHAH 1J9CT 2R2CA 1XR8B 4XNMA 4YDJA 5FYKH 3EGSA 4OGYH 3TC9A 4LLDB 3FO9B 1OAUH 3VXRB 4K9EL 4I77H 2NYYC 3RQ3A 3KXFB 4OZ4B 4APQA 5SWZB 1E4XI 5FKAA 5IB4B 3D48R 3RWHA 2VQ1A 4MJIB 4ACPA 4Q9RH 5IQ9A 4GAFB 2MHAA 3MBEA 1KUMA 2WBJB 1DEEA 1IC5H 1KBGL 3UEZA 1FZKA 4M7JL 1WBZA 1B4RA 3AUVA 1DZBA 3WFEL 4PFEA 3H7BA 4JGUA 2OBGA 2Q87A 3WLWD 3MRHB 3SDAA 4IS6B 3TT3H 5IEHB 4V2BA 2XTJE 1UWGH 3TPKA 2M2DA 3DNKA 5E03A 1AQKL 5CMAA 2A6JA 1JPFB 4NJAH 2J3SA 3BPLC 2Y5EA 3TVMC 1MFBL 5IW3A 1KPRB 2HT4D 3QUYD 1FL3B 4NKIL 5DJXB 2VN4A 4EUPH 3UJJL 3BKJL 3LKOA 2XN9B 1E4KA 3OJ2C 3VXSD 1B6DA 1MFAH 3ZKXC 2EIBA 2XRAH 4MXQD 4RGNB 4HKBA 4GKNA 1TNNA 5FO9B 3O11A 4JZJC 2AXGB 3KPSA 3LV3B 3QWOA 4PRPD 5HI3C 3TYGL 3QFJD 2HVKA 1IGTA 2VYRE 3SKOB 1L7TL 2XG5A 1RUAH 4WFGE 4A6YH 1XR9B 1LEIB 4ZUSA 4R96A 4UQ2A 3UTTA 5IW6B 1KPUB 1A6VH 1XF5B 3DVGB 1FO0H 4I3SL 5ICZA 1EGJH 3TJEL 3B5GA 5HDQL 3NIFF 4G5ZL 2NY5L 4XT1C 3BFOA 1ZA6A 3MROA 5DDHB 1CLOH 1AR2A 1B2WH 1KB9J 4KY1L 3E6FA 5JTWA 4XWOC 3EO1B 3QP3A 4RFEB 1CD0A 4HPOH 1AE6H 1DQJA 3V4UH 5F6HI 3W11D 3D0VB 4ZFGH 4JRYE 4AH2A 1XH3A 3CC5B 4NM4L 2GSGA 4RFOH 1BVKB 3N1MC 2V2WA 1KIRB 3R06B 4I0PB 1ZT7A 5DSCB 5HHME 1T03L 1J0IA 4JN1H 4MYWB 2IG2H 4ZTPH 2EDHA 4OZGE 5I30H 3QQNA 3B6SB 4JFQB 4JANB 1JGUH 1M71B 3BD4A 3D9AH 3QDGB 4HKXA 5BXFB 1IQWL 3QISA 5IHUH 5I71B 1W0WB 5IWLC 1YY9C 3MLSL 3L3IB 3O81A 4S1RL 1JZ3A 4HCRL 1WIPA 3QAZC 4Z8FL 2HMIC 3C2SA 1YECL 1U3YA 3HPJB 4KDVA 5IVXB 5HGDA 3QNYA 2FZ3A 4XBGB 3RWCB 5IR1A 1F4XH 5ILTL 5ALBL 5E56A 5IP4A 4APQD 1DQDH 1Z2KA 5EBMB 1EFXB 3DROA 5I1EH 4NN5B 1CFNB 5GRJH 5KTEH 3DIFB 1X4XA 3SDDC 4ZSOA 3MBED 1FP5A 3SPVB 3SEPA 1NH6A 1N64H 2FDBP 1ZGLP 1RZFH 1EERB 3DYMA 5EIIB 3KG5A 4U1MA 4OTXL 3SDAD 1P9MC 3GSXB 2A74B 3PL6A 4X7SL 5B39G 5JPMA 5IB1B 5DJ0B 4FP8L 2X4PA 3QQ9D 3WKML 5HYJB 3OHXA 1BVLB 4X9BA 4XXCA 4NGHH 1JPTH 5A2JH 3IKCB 1EXUB 4NN6B 1KG0A 4XC1L 1ITCA 5AZ2H 4LF3B 1AGCB 5DD5L 4HWZA 1MCIA 5DJ6B 4KI5C 3ZDYF 4PJ8C 3FMGL 1GC1H 3D3VA 4PRNA 2EDTA 5E4IA 3CDFA 4S1DD 1AP2A 5IG7A 1T4KB 2R2HB 3RZCC 1JZ7A 3PXHA 2KDGA 3W9DB 4Y19B 5IHBA 5C6PB 5I8EA 1FC1A 3L3DA 5JORA 3TIEA 3KPSD 3P4OA 3DX6A 1UB5A 5F9OH 1TITA 3VA2C 1U3HA 3SCMC 1QA9A 1UEMA 4GAGL 5D7JB 2HVJB 4I1NB 3EIFA 1HWHB 1ZVSA 4LCWE 3RBGA 3DVNA 2I07A 3BQUA 3V5DA 4JDZB 1FZOA 5KSBE 5F96L 5F6IB 1S7TB 4RQQB 1A1OA 4FXKA 3BKCH 2E8ZA 3QHFL 1Z5LB 4X6DF 3RNKA 3MACL 4MX7B 3O4OB 3T08A 4PJBE 4S1SH 1CGVA 1IGYA 1MCSA 1ULVA 4HLZG 2XV6B 1F42A 5DD3H 5E2VL 1RPQA 5A2LH 1NFIB 5ALCL 1YPZB 3FQXB 5CUSH 4I3RL 3FCTB 3ARXA 3GMOA 3W82A 2BXZA 1CT8B 1MFCL 1RU9H 4GRWF 4F33A 4GW1A 4M8VA 1GHFH 4QHKI 3T09A 1BFSA 4YAQB 3OKOB 3FQNA 1H3WM 1ZT1B 3FZUC 3P11H 1SYVB 3QXWA 4L8BA 1OVZA 2HJFB 3HR5A 4LAJH 2MJWA 2EXWD 1K4CB 2Y36L 4PJFE 4LCCA 1A3QA 2R4SL 2YWYA 4LVNB 4P2YA 2BCKA 3VFRB 5EOQH 4RNRA 5GRXG 2EDJA 3ULSB 4UTBL 4NQXB 5DI8B 2B2XH 2HN7A 5DZNA 1HSBA 5EU3B 4YWGL 4WNQB 5EC2B 2APWA 3MGAA 1NFDB 1WWWX 1AFVH 5F21B 2PXYB 4OZIF 2C3HA 4QHUA 4NNXA 4UV4L 4NC1C 3O2DA 1JRHH 5E8OA 3LZFH 3OWEA 3IS1X 4JB9L 1V3MA 5I75C 3QEGH 3MCG1 4DKFL 7CGTA 3T2OA 3QUMH 3O3BB 3KPPB 3GI8H 5I2IB 3N1GC 1KJ2B 2JJTA 1CE6B 4P23B 1IAII 3SE9L 3MCKA 3PL6D 3KPMA 4GMTL 5L2KB 2QQKL 3LKRB 1S7UB 4OZFG 3DHMA 4F3FA 2IGFL 4LPCA 3MV7E 3WFHB 2UYLB 4LFHD 2CKBH 4WTZA 4YHML 4Z95H 3AS2A 3EZJB 3VXQA 1GZPA 5GGTA 2DLTA 5E8NA 5C0EA 3BAEH 3E2HB 3T4AA 1P1ZB 5DRWA 3T0EB 1VGKB 4LLYB 4Q9BA 1JWMA 3ULVH 2PNDA 1TCMA 4AEFA 1U92A 4EOWH 3D3VD 3OKMA 4Z0XA 3X12A 3QFJB 2F5AH 2HLFC 2ZUQB 5BQ7B 3V6OC 4P3WA 5E9DA 5D1QD 3GJFK 2EIZB 2BOBB 4PGCA 4NQCE 4PJGF 3LQMA 1KB5B 2QTEA 3NPSB 3UBXB 5CIPH 1FFQA 4JDVB 1PKQE 3B8SA 3DV4B 2DYPB 5DVKA 1U3HD 1I1FA 1QSEE 4RMTA 5B38B 4BFBD 1S9XB 3N50A 1AO7B 2Z31C 1CDHA 3QHZL 5FUCE 3ZDXF 1HWGB 3GDBA 5MEOB 2ADIB 1KCSL 1T5WB 1IGMH 1ERNA 2V2XA 1J1PH 1VESA 1TPXB 2R2BB 4FQHB 1T1YA 2P5WA 2DQHL 1MCWM 3DO7B 3TFKC 3DXAA 4C4KO 4MNGB 1AI1H 2NZ9D 2AK4A 4G9FE 4JFDA 5J1AA 4JHAL 1LO4L 4CKVX 5IT2H 1XGPA 4QRRA 1KN4H 3L3GB 5DK0B 1AR1C 2Y06H 2EH7H 2QKIA 1KGCE 3MRQA 3QXAB 4ZXBB 3TBYA 3UCRA 2OL3H 3QUZA 2IANA 3KGRA 3LN4B 1GGUA 2CGRH 2NW3B 4NUGH 2O5ZL 1SHMA 1CXKA 4HJJL 4MCZA 3KJ6H 4PGZA 5JDSB 3JUYA 3VFPB 1WCBB 5L8JB 1QPPA 4WHYH 1FNFA 3PP4H 5FYKL 4PJEB 4TUJA 1IQDA 5ID1B 5JMOC 1KXQE 2RB8A 2HYMA 3GSRB 3PDOB 1G7HA 4KKAC 3X17A 2R2EA 4JKPL 1KCRL 4D0BA 4I77L 1JGLH 1F3DH 4G7YL 3SGEI 1I9EA 4PV8B 4PGJA 4JRWA 5HHOD 4L9DA 2EKSA 1E0OB 1DVFB 4Q9RL 1D5IH 2IFFL 3MRCB 3SDXE 4OZHA 4OCYL 1IC5L 4V1DB 3PWPE 3QRFM 1EHAA 5HYSB 3X13B 3VWJA 2FWOA 4TSCH 3SDAB 4M5ZH 4MD4B 2AK1L 2A6JB 5GS0H 1Q1JH 1UWGL 1QRNB 1OOAA 3OG4B 2XTJC 3GMRA 3DX8B 3J8F7 1NCAH 4NJAL 1U6AH 3HG1A 3JBG7 4U6HA 4IIQC 3WIHA 4LU5L 3JUZA 1MRCH 4W68A 4MDJB 1A1MA 3UTQA 2QSCH 4Y4KC 1WWBX 4HXAH 1MFAL 2XRAL 1A4JA 4MA1B 1JYVA 2ARJA 4O9HH 4DJMA 5EO1A 4D0DA 3BDBA 2V9RA 1DQQA 5ID0B 4OGXH 5E9DD 3ARRA 1INDH 1R3JB 4R96B 1Q72H 1V7MH 3OV6A 4PJ7A 3OJDA 1RUAL 2IQAA 4A6YL 1X5YA 2VISB 3TO4B 4BSVA 4W6XB 4WU7B 2DI8A 2HTLD 3QDMD 1A6VL 3MO1B 1FO0L 3WNKA 4O2CB 4LOUC 4DN4H 3VRLF 4ZFFA 4QXTB 3LB6D 1IEBB 4P5TC 3T2NH 1V7NH 3CFIC 2VDOH 1OM3H 3RTQA 5DJAB 1F6AA 4HPOL 1EAPA 2P5WD 3I3BA 3DXAD 1QSFE 3D25B 1BQSA 4XPGH 2P48B 2ADFH 2AK4D 5DZOA 4JFDD 1JYXA 5IQ7H 4X4ZA 4RFOL 3QCTH 4NZDA 4G80A 4AIOA 3O8XC 3QUZD 2OZ4L 2IAND 4JN1L 2IG2L 4WFEE 4FQCL 3B9KA 5DJ8A 5I30L 4U7KA 3WNLA 1F11B 1FE8H 3F7YB 2J7LA 1J18A 3NCMA 2IAMC 5TDPA 3ARTA 3WN5A 5IHUL 2R9HC 1ZHNA 1QO3B 4DUXA 3DTXA 3TBSB 1XGQB 3EDEA 2UZIH 5D96B 1CU4H 5FGCE 1EBAA 4N9GB 3I02B 5INCB 4B7LA 1RZ8A 2KBGA 1A7QH 4JPVH 2CO6B 4YLQT 5LXGL 4HWNA 3DROB 4KK5C 4W81A 2ZZUT 4HBCH 4BQ8A 3FN0H 3IFOB 4S1QH 5TF1H 1DQDL 4K3DH 5F9WC 5GS0C 5I1EL 2Q8BL 5F7EL 4L3CA 1BFTA 4ODUA 5KTEL 4IJ3B 4TRPH 1QQDA 1PSKH 3VWJD 1MNUH 1RZGB 4UDUB 3RVWD 1N64L 1PKOA 5L2JB 3IDMA 1RZFL 1FNGB 3PL6B 3KPOA 2DQIL 2OJEA 3QZWA 4NSKA 3L3JB 4PUBL 3T0DA 3QEUA 4H8WH 2Q86B 2HFEA 1G6RL 1NEUA 4JM2A 4NZUL 4CU8A 3FO1A 2GHWB 1N0LA 1ZE3C 2H9GA 3P30L 5IM7B 5JQ6H 1F4YH 2OX5A 3PGFL 1K85A 1S7XA 4HUMB 3SE3A 2PO6C 5I18H 4K94C 4X4ME 1KCKA 4NGHL 1I1YB 4PG2A 4YPGB 4ELMB 5EZJB 4UTAH 2B1HL 1QUNA 3C60A 5AZ2L 1A0QH 4TTDD 1UCTA 2GT9A 1QNZH 4LSTH 4X0KB 1QACA 4PRIA 1OSZB 2AJYH 2UUDH 1FG9C 2J5LB 4DTGH 2A9NL 4ZUTA 5D1QB 2JIXD 1GC1L 2W59A 2JTDA 3REVB 1YC7A 5JORB 1FNEB 3VXSE 2EZ0D 2ZCLH 3BPCA 3GSNA 1FVDA 5F8RC 1FH5H 4H26B 4ZS6D 3WUWA 3X3GH 4JKLA 4DKDC 5F9OL 12E8H 4HGKC 1SY6A 5EFIA 5M95B 2OR9H 4PRPE 3OR7B 4FABH 3KLAB 5ESVA 2FECL 3BPOC 3JV4A 4H25B 5EOCH 2EC8A 4H1LG 5HJ3A 3BKCL 3HI1B 2EDKA 3WIFA 5HGAB 1ZVHA 4UAOB 3NIDE 3D39E 5T1LA 3Q6GL 4J3OC 3RTQD 4DGVH 4NFCA 1LO5A 2G9HB 1ZHKA 3BE1H 5E94B 4R4NC 2VDPH 3U9PL 1T1ZB 2PR4L 4Z7NE 1OGAA 1S9KC 5CILL 4DFIA 2APTA 4JKWA 3BPNB 4IRJA 4TNWK 1UZ6F 3DUSB 1JJUA 1OARH 2DIJA 3IRZA 2RGSA 3O4LB 1EHXA 2FX7L 1DR9A 1FFNA 4OZIB 4RIRB 5GGUA 3P73A 3H3KA 2C7UB 3T65B 1DUZA 3BZ4B 3ESVF 4BFEA 2FR4B 1QFOA 1PDKA 5H35A 3SGDH 1A2YA 3CFJA 3MLRH 4OCXH 4MVBC 3HAEB 5D6CB 4RNRB 3K7UA 2AXFA 1KJMA 2LVEA 1I9JL 1Z0MA 4XNYH 2EDDA 5KW9L 1MCFA 3O6FA 1HN1A 4FQIL 3DRTA 2VR9A 1I8MA 5ISZB 4JHBA 5HHOB 2B2XL 5DQ9B 4Z7OF 1LK2A 1NLDH 5HGHB 3S7GA 2VXTL 3VD7A 1IGJB 5FM4A 5SWSB 2DAVA 5AUMB 2DQGH 1AKJB 1IAKA 3BVNB 4H8WC 1WQVT 4HUXB 1JUFB 4NYLA 3S6CA 3OAZK 2ZSVA 3IDNB 3ARUA 4NCDA 1LVEA 4EXPX 3MUHL 3VE0A 2V7HA 5JOPD 3LZFL 2GCYB 1I3GH 2UWEF 2PCPB 3EO0A 3QEGL 1B0RB 3SBWC 3SDYH 3BN9C 3QUML 2W9DH 3QCUH 4GFTB 1KTDA 3LDBB 3NFNB 4JM2D 1W0VB 4UILH 3RU8L 2G2RB 4BFIA 5C09A 1BIIB 3CLFH 2LAAA 3HC4H 3Q3GB 1MHEB 2QR0B 5INDB 1A6TA 3BEWA 3KYNA 4Y1AB 3VXMA 5BVJA 2ZG3A 4U1LB 4E9LA 3FB5B 2YMXL 5KS9F 1RHFA 4KC3B 1MCPH 3C60D 1JYNA 1BREA 4F7PA 1R5IB 1H0DB 4PRID 4DWHA 3OKMB 4BZ2H 3ULVL 5D7IA 3QNZA 5GXBB 1XGRA 1NAMB 3OX8B 1KTLB 1S9YA 1JNJA 4YE4H 5T3XD 4B53A 3PHOB 3C8HA 4QXGL 2DI7A 5T5FH 2JLLA 4YDKH 1KULA 3QDMB 1GGBH 1F6LL 2AQ2A 5L0QC 3MA9L 3EYQC 2H1PH 1QFWH 2BVPA 1RD6A 1UM5H 3MNZA 3GMMA 1D5MB 4K8RH 3RVVC 1U93A 4CDHA 3O2WL 1H5BA 3O6KH 4HWEH 1KT2B 3HB3C 3UTTE 4WY7H 1LP9F 2DQFB 2DTMH 2NY6D 2AABH 3UDWA 1B6UA 2FO1A 1MIEL 5T1LD 5CD3A 3RPIB 5I19L 3QIUA 5IOPB 1KLUA 4LSRH 4QF1B 3TA3A 3RKPA 5BJTB 4KU1A 4MJ5B 1WK0A 3FAWA 3GIZH 2CUMA 1NGZA 2QADD 1HILB 4IRJD 2Y06L 2EH7L 3WLBB 2OL3L 4YZFF 1JNLH 2CIKA 3KHQA 3FFDA 1MCKA 1U8KA 5JHDD 4OBSA 2DQTH 1N5YH 3OKKA 2FX9L 2BC4B 4JN2A 4LLAA 1CF8H 3VGAC 4HLJA 3IU3B 2J12B 2CDEA 2ZG2A 1CD9B 2FHCA 2VDRH 3IAQA 2O5YL 2NZIA 4FQ2H 4DVBB 2GJ6B 5GS2H 5IK3A 5EUOA 2OMNA 1JZ2A 1PEWA 4UB0L 3ARGD 4Y5VB 2R2EB 4ONHB 3VJ6B 3O6FD 2HJLA 2X70A 5I16B 1UC6A 4CN1A 2ESVA 3HS0B 1OLLA 5DHYA 1AGEB 3RUGF 5J9PB 1LK3H 5F8QC 2PYEB 1JGLL 1BD2B 4BYHA 1NGYB 2CR6A 3K8MA 1RI8A 4JPIA 4ELKA 1U42A 4U0QB 1Q0YH 5DMGD 1VADB 1NEZA 4PJ9B 3BESR 4MDIA 4LLUA 1G7IA 3E3QE 4UIMA 5B4MD 3MR9B 3V5HB 3RX7A 5F1KC 4YFDB 3O3EA 4M5ZL 5I8CB 4JFEA 1BQLL 3QDAA 4ZSOE 3TCLB 4YDVA 4L4JA 3KPTA 4OLYH 1AQDA 5CZKA 2KQNA 4E5XB 3ILPA 1NLBH 3WO3B 1A1NB 1T04B 2VH5H 5J06A 5HDBF 2KL6A 3ES6A 3U46A 5I1IH 3V95A 5TGBB 1NCAL 4NUJB 3FB8A 5HPMA 5LAXA 1U6AL 25C8L 3MV11 2H8PB 3MV8A 4JGJA 3VWKC 4F2MA 4OKVA 3VXMD 4NNYB 3NN8B 2VSDA 3LIZH 4XPFH 5IMLA 1OLZA 1MRCL 1DE4A 2JIXB 3GSVA 2FO4B 4JPKL 2QSCL 4LCIL 1Y0LA 1ACZA 4HPYH 5IVOA 4KFZC 3V6FA 4HIXH 4WO4B 5EORH 4O9HL 4K8RC 4RA3A 1K5NB 1NCCH 4R2GD 3FTGB 4MMZC 4TVPL 4OGXL 4OD2B 3RZWA 5IMMB 2RR3A 3MJ9L 4NN6C 1EHLL 1KJ2H 1NMBL 2E7LC 1Q72L 1V7ML 1L9NA 3I9GH 4R7DB 2ADGB 5I1HH 3QQ4B 2Z93B 3VFOB 2WP3T 2FD6L 3BHBA 4DN4L 2H3NB 4NKQB 3TPUB 1GZQA 3LEXB 4MD5A 1BF8A 2EDLA 2JJVA 1MELA 4R0LB 1YYLH 3DYOA 1V7NL 4K7PY 2BSTB 2VDOL 1OM3L 1YEIH 5F72S 3VD3A 4KKLD 5J12B 2Z4QA 3QIUD 2P8LA 1JBJA 1LWRA 5E5RB 3LOWA 3TA3D 1ROWA 4XPGL 3N06B 1FFOA 1OW0A 2ADFL 4R8WL 3QCTL 4FHBD 5I73B 4I2XE 3O4OC 5FKPA 5C1MB 1QYGH 2DWDB 3AU1B 5TQ0H 2X4UB 1C08A 1JP5A 3BGMB 2GTZB 3ILQC 3QIWC 3T1FA 1FE8L 1NBZB 5F1NB 3I6LD 5I74B 3VH8B 5I9QB 5EA0H 1IGCH 5DJYB 2F8XC 3KPNB 4WENB 5DJ2B 3TJHC 3IGAB 4N5ED 3WFBH 2BNRD 1JF1A 2VIRA 1CXEA 4H88L 2UZIL 1YEGL 4YUEH 4F15B 1MCBA 5DA0B 3BN3B 5C7XH 1CU4L 3IJHB 3KJ4B 3NGBC 3V52H 4OUUA 2NX5A 2ESVD 1F4WH 1A7QL 4Z7VA 2BY3A 4JPVL 1G7JA 1LEGA 4G6ML 4D0CA 5K33A 1VKXA 4S1QL 5TF1L 2W92A 4WW2F 3TYFB 1MCHA 2AVGA 4RZCA 3ZTJG 4UIKL 2XPGA 1JVKA 1MNUL 2NR6D 3PIQA 1NL0H 3DVFA 5EULV 1UM6H 3NCJH 2WAHA 4JFED 2A83B 1ZANH 2FIRT 2I60H 2NLJB 4P4RB 2XOTA 4RMSA 2ZUXA 5E2TH 3AY4A 5DK2A 2EC9T 5DS8B 1LE5A 2MPAH 4M6MH 5FA4A 5C9JB 1MCOH 1F4YL 3WLWC 2ICEB 4R26H 4YXLL 1U8OB 3MV8D 2WIIA 4JFXA 2UVEA 2GAZB 1TQCB 3I3EA 4UTAL 4P9HC 3PGDA 2NY3D 1A0QL 3CH1A 4KTEH 3LSOB 4LSTL 4Y5XA 4AEEA 2AJYL 2HT4C 1Q9KA 3QUYC 3LHPH 3BIBX 4M7KL 1QBMH 1WBYB 2ZCLL 4EDWH 2EICA 1HDMB 1I8IA 4MHHG 3PDDA 1FH5L 1OB1B 5FO7A 5E5UB 3X3GL 5I17A 4KV5F 1A5FH 4MXQC 1EVUA 12E8L 4WWKC 2YEZB 2Z91B 4NQTA 3CXHK 2DMBA 5E9DE 4KHTL 4GKOA 2OR9L 2CDFA 5J6GB 1HKLL 4PS4H 3QFDB 3UX9B 3GGWA 2LV4A 2R1XA 4U1NA 3DPBA 2C3GA 3EDKA 3MNVA 2Q7NA 4PP2B 3HZMA 4K71B 1LO0H 1A47A 5GGSY 2FLBT 1Q94B 5FYLL 3NPSC 4PRHA 4XNQB 4U6YB 4DGVL 1MREL 1A14H 2WQ8A 2NXYD 4P49A 1UWXH 5JO5B 3GSUA 2SEBA 2HRPL 5JOEA 4PD4K 5E5MB 5JHDB 4JFYB 2A1WH 4PLOB 4TUOA 2FJFA 1T89A 3DXAE 3W11C 1I7UA 1OARL 3FOMB 2Q7YA 1CICB 2AK4E 4PGBA 3QPQD 4JFDE 1DUZB 4U6TA 4YXKH 5ACZA 4QRRE 4UT6H 1FL5B 4U1JA 3UP1A 3PGCA 2YPVL 2IANE 1H8SA 2C9AA 4L8SA 1K3ZA 43CAB 3QG6A 5H2BB 4QKXB 3HPLA 4JY5H 3GZKA 1VDGA 4NCC1 1VFUA 3MLRL 3ARGB 2YC1A 1CFTB 4OCXL 4PJXF 3U4EA 4PJHB 4PY7A 3MRFA 1DCLA 4XNYL 4RMRA 1UJ3A 3BGFB 4H5SA 1HHHB 1MJ8H 2MCPH 4XPHH 1NUDA 3BWUC 1EEYB 2NX5D 1YMHB 1RK1A 3O3DA 4PGEB 4G6JL 3QT2A 3MLZH 1BLNA 3T3MF 1TMCB 1MVFA 2W65A 2IQ9L 3WNPA 4MQTB 2DLGA 1D7FA 2VLKA 5BCAA 4APQC 1JN6A 2J4WH 2PW2A 4OZHE 3DLQR 3C08H 5MEQB 2AV7B 2VZ3A 5I76A 3CZFB 4PJ5A 1YDPB 1RQ5A 3MBEC 3LS5H 2W9DL 3QCUL 5MHSD 4ZYKA 5CZVH 1UJTA 3FB6B 3X11A 4CW1A 2B4CC 3HC4L 2XKSA 4LHUD 4GBXA 3SDAC 3T8XB 2YN5A 4J6RL 4XWGL 4S0SD 3F7VB 2ATPB 4LQFH 1KEMH 5J6HA 3I50H 4YBHA 3HG1E 3MGOB 2L7JA 2MQ3A 5I1AB 3QQ9C 3FL7A 1Y6NR 1JPST 4YFLF 3VG0H 5GGVH 4R2GB 4I5BB 2P5EA 3W39B 4BZ2L 4NO0A 5CFHA 5ANME 3MLWH 1XGYL 1OP5K 4LAQL 1E4KC 1I7RA 3ZTNH 1FL6B 4XP5L 4YDKL 1NC4A 2BSED 1LDPH 4S1DC 3OKLA 4HGWA 5DJZA 4J12A 1QFWL 1YNLL 1SJVA 1TZGL 1UM5L 5F89B 1MJUH 2BY0A 1ZA3B 3S5LB 4N8VG 3OZ9H 2OI9B 4PJ7E 3H6JA 5DRXA 5E8DL 4TNVK 4F7CB 4NQEB 1I3RB 2H41A 4HWEL 4Z7UF 4PGDB 1RZJH 2F8VA 4YJZL 4WY7L 1P7KB 2DTML 2AABL 2VLJA 3ZE1E 4PRHD 1ZGLB 5C0IB 4GH7B 1HH6A 2DN7A 32C2B 4JY4A 5HVHB 1JHTA 4PREB 4RBPH 4F7TB 2LABA 4BH8A 4R3SA 1YN6A 4ONGH 5JQHC 3GIZL 3FFDB 4YGVA 2ICES 1IARB 3QJHA 3EYFA 2A73A 3BUYB 3OKKB 4NRXB 4CADA 3AXLB 2X1PA 3QUXA 4X6DA 2XI9A 2I24N 2DQTL 1N5YL 3VXUA 2R56H 4Y0GA 1CF8L 2FJHB 2GTWA 1M05A 2BNRB 4NKDA 3G5ZB 3LKQB 1E27B 4FQ2L 4QRUB 1WBXA 2Z9TA 3U0TB 3V8CA 3KS0H 2ZSWA 3DARA 4Y16B 5T3ZD 1JFQH 4QRPB 4HWBH 3UTSA 3GFUA 3UC0L 4CVZB 1SEQH 3ISWA 3LN5B 4MNHA 4X5WB 3TBWB 3ZHDA 5CEXA 2B8OT 4M1GH 1MLBA 4M03A 4FQLL 2EXWC 2NY0D 2Z8SA 4MB5A 2AXJA 2LTQB 3STZB 4LMQI 4G8IB 4Y5YB 5A2FA 4F9LA 5ITFA 1H15A 2J8UB 5ERWA 4ZOBA 4IHOB 4JQVA 3IVKA 4JFEB 1E4XH 5C6TH 5D2NA 5IJKA 2VLKD 4NBYB 3E3QC 1DBKH 5D7KE 2AV1A 2CDGB 3O6MH 4AEIL 3NTCH 5FYJD 4OLYL 4N0FB 1XZ0A 1IM9A 1MPAH 5JOPE 5HPMB 5L6YL 5CLWA 1NLBL 3NFPA 2VH5L 3BT2H 3V7MA 3C6SB 5I1IL 1FC2D 3L5IA 4LPVA 4M1DH 2CIIA 2ITCA 3LH2L 4GUPA 1HXMA 4RDQG 2NY3B 3MNWB 4GBXD 3DBXB 3FHAA 5ESQA 3PL6C 4BJLA 3LIZL 4Z7QF 4LEOB 3TBTA 3RIAF 3PJSA 1JK8B 3KVQA 4OI8A 2Z92B 4XC3L 4XXCC 3CX5K 4G8EB 4HPYL 2P5ED 2YR3A 3IFPB 4HIXL 4LARH 3S4SB 3IDIB 5EORL 4PRIE 2VKXA 2LU7A 1AGDB 2E9JA 1NCCL 4MNQA 1GGIH 2BSSA 5DMKB 1VEOA 1RZJC 4J8RB 1IC4L 2G5BA 1KJ2L 3MXWL 2QSQA 1U91A 1OPGL 3I9GL 1K8IB 2GK0B 2VE6A 1M4KA 5MI0B 1AGBA 4MJIE 5BRZB 3O9WB 4JFOB 1U3HC 4H0IA 3MFFA 1WGOA 4HC1A 1YYLL 4TULH 1V3JA 4PJGA 3BQUC 5IHZA 1YEIL 2DJSA 5E1AA 2XG4A 4I8DA 4LGRB 4CMHC 1NAMH 1JTOA 4JY6B 4D3CH 4LKXA 3L95A 2VDNH 2AEPH 1ZWIA 1C08B 2VDQH 1KB5L 2DLFH 4NHUB 1OGAE 3GBMH 2NZ9C 5TQ0L 3QUXD 3CU1A 1CN4A 5EPMB 3VDAA 2AI0H 4GRMA 3RWEB 4ESKA 3QH3B 4KMLB 3S96A 5HHXH 2XN9E 4U05A 5EA0L 1IGCL 3EAKA 3PABA 2J6EH 2JB6B 2OP4H 1YUHA 3N1FC 4IRSB 2XA8L 4YHPA 4MWFB 4RGMC 3QO1B 5D4QA 4HK0A 4YUEL 3RL1A 4DN3H 2IPKB 3QB7C 1I3VA 1AXTH 5GPRA 3W0WB 4OCRH 3DGGA 1F4WL 2IMNA 3MJ6A 5IESH 3H9SB 5GGQH 3G08A 2WBWB 2XFXB 3CD4A 4LCCC 5D7SL 5C07A 4HV8B 1DBBL 4X6EB 1MQ8A 1T1XA 2RFXA 5C0AD 2XPGB 2VLRA 4CN6A 5EU7E 2BVOA 4KKBD 3AC0A 4EI6B 4U2YA 3TNNA 4J3XA 2EXYD 5BS0A 2DOCA 1NL0L 1UM6L 2BXYA 1C16A 1ZANL 3U30C 4YH6A 2H26A 5DD0H 4OLUH 5IB2A 1IM9D 4LHUB 1A6UH 1NCNA 4NQSA 1IAMA 2OQJB 1MCOL 2YSSB 3K2MC 3C87A 3BZDA 4LVHB 4NOFA 4R26L 1FQ9C 1NMAL 2V17H 3MREA 1P4LA 4RFNB 2JJTC 4Y5XB 3THMH 4U1GC 5C09E 5GSVB 3F6IA 4YNYA 4D8PB 3VFWB 1OTUD 3HRPA 3VXME 4PRAA 3G6JF 1MCJA 4ONFL 3I6KA 3QDGE 3AS1A 3RHWK 2NY1D 4RWYL 5ETUA 2P44B 1QBML 5HHNB 4L9LB 1I7ZB 4EDWL 5BVPH 3OR6A 5AG9A 4MNQD 2R1WA 5D7IE 1A5FL 1MI5B 4ZFZB 3CLEH 3NCYS 5J3HD 4P9MH 3RWGB 3LCYA 3LKNA 1DDHA 5CJ8A 4WGVB 2YN3A 4AG4L 4FQJH 5D2LF 4KRMB 3U1SL 2XQBH 3IF1B 4DW2H 1NAKH 3K8KA 5FB8A 4OF5A 2D3VA 3BH9A 4KJYB 1CFSA 4OT1H 1SMAA 4QWWD 2HTLC 4P4KB 3PE9A 2DMKA 1I1RA 2CJUH 4NO2B 1FG2B 5DQDL 5GRVK 3KPRA 1A14L 3LB6C 4MAYB 4J3SA 4HJGA 5AD0B 1S9VB 3ME0A 5ADPH 1YN7A 2VKWA 1XCQA 1FNLA 2A1WL 1HINH 5DK3A 4PJIB 3C6LB 4U1JB 5EUKB 3MRNA 2N56A 4LBEA 1U8MA 3SE8H 4YXKL 3S37H 1R3LB 1A9EA 5IKCB 2ARJQ 4FTVD 1VB9A 3V7AE 4CAGA 4Q6IA 2YD7A 4WI8A 3IETB 2XWBB 4NZTH 2Y07H 1QHPA 3QUZC 5F1IB 4U7MA 3L6FA 1W8NA 4JY5L 2OSLB 5CGTA 4M5YL 3I6LE 4WHTA 3ARBA 4NM8H 1MY7A 3GUTA 5KN5A 1KXTB 3V0VA 3VCLB 4AQOA 1RZKH 1CGSH 1RK1B 2NY0B 5DUBB 1P53A 1FJ1A 5EUOE 1S7RB 1VFAA 3WFCL 1T0PB 3VXTB 3EFFB 3ARED 1MJJB 1IM3B 3QWRA 5C07D 1FORH 5B39A 2HG5A 5I1CH 4LSUH 4EN3A 2VLRD 1SJXA 3RY6A 2C4XA 1Q9OB 4CMMA 1KB9K 5F93C 4LK4A 4OSUH 1MHPH 4K3JH 4ZYKB 4KXZI 1M6OB 4JPWL 3V4VH 1OAZH 3C09B 3LS5L 5CBEB 1GAFH 1EH9A 3PWLB 3BIAX 2G75B 4ZO6A 5DJDA 3VWJC 3RVWC 3EDFA 5TQ2L 1M7DB 5C2UB 3HNVH 5D5MF 1FPTH 1NSNL 1U8PA 5A40E 1HCFX 5DGQA 2AKRA 1IAIH 4ALAH 5FECA 1K4DB 4YR6A 3M1BA 4LQFL 5EWIH 1KEML 5DMYA 2BHUA 4YBQD 1A3RH 3MV8E 5KANG 5LQBL 3PHQB 3GMPA 3EOTH 3TO2B 2HKHL 1I7RB 4LSSH 4KJPD 5DR5L 5I1LA 4TTDC 1M7IA 5KG9A 5IIEA 1T21A 3O45A 2AJ3B 4XAWH 3OKLB 3BRFA 2Y25A 3AB0C 5DEGB 3PP3H 1ED3A 4PJAB 3OPZH 1AC6A 1OAYH 2EZ0C 1I8LA 1LDPL 4YHNA 1TZIB 3ESUF 2YZ1A 4LNRB 2B20A 2AS5M 4ZS6C 1ZEAH 1UA6L 5C0DB 2XZCH 5KBNC 5IW1B 5L7XH 2ITDA 4PV9A 3RRQA 1HXYA 4UDTB 3IJYA 1OGTA 3RA7H 3L1OL 5TFSH 4E42B 2BOCA 1GRWA 3GSNH 2NY7H 2ZOKB 2HKFL 3MA7B 2K7QA 3KPRD 5T3XH 3QDHA 5A3ID 3U0PB 3NCEB 2W60B 1NMCC 1X7QB 2BMKB 2ZP0T 4M62H 1SY6H 4P46A 4ONGL 3VXNA 3RTQC 5J4MA 4O58H 3QUXB 2NNAA 3HMWH 1HOCA 4HIEB 5CEYB 1MOEA 4MQ7B 3GRWL 1CK0H 4G8GA 3QJFB 5J1TC 1FNHA 1MVUA 3SKNB 5DURB 4WUUA 3T0EE 4WFFE 1K3IA 3B9KC 4JCLA 3G5XB 3GIVB 3ARBD 3IDGA 5HYEA 1CFBA 1JFQL 5KVFH 4HWBL 4RDQF 4D9QD 5GGRB 3U6RA 4NQVB 1UQSB 1WFTA 1MHCA 3WN5C 3CFEB 5I6XC 4M1GL 5F7MC 3FJTA 1LD9A 1RSFA 1HHGB 3FQUB 4NT6B 4PRDA 3OMZA 4Y2DD 2CD0A 5C0AB 1HSAB 4N0YL 1CFQA 4Z5RA 5ERWB 2NX5E 3FO2A 1T22A 4Z7VE 1AO7E 4KAQL 1FN4B 3FAXA 4OZFA 2WINB 1QLRB 4N8PA 3SGEH 4EN3D 1IC7L 3KJ4C 5CWSB 3U4BL 1HE7A 1MAKA 3LS4H 3QA3A 2EDQA 3OKNB 3HZKA 4U1IA 1DBKL 3O6ML 3OXSA 3WHXB 1EO7A 4GRLA 1LO3H 1JWUA 1E4JA 4GUPB 2YD6A 3G6AB 3G04A 3BT2L 4GXVH 4JFZH 1FGNH 2CRMA 3ARZA 3FOLB 3KPQA 3LKPA 1R5WA 1HHJA 3BIKB 3B5HA 1NBYA 3CZJA 3IDJB 4Z76A 4FFVD 4KZEH 4KI5F 4JM2C 3EDDA 3ECBB 2YUVA 2QL1A 2UWEA 4ODHH 2QHLA 1UKTA 4XWOD 2DF3A 3MLTA 4XMKH 3EJJX 3SE3C 1HHIB 1D3CA 4PG2C 4XNZC 3FFCA 5FUZH 1SYSA 3C60C 2G5BB 1JTPA 1ZHBA 1GGIL 1EO8H 1ES0A 3SO3C 2ZPKH 3U48A 4X5XB 3AAZA 4L8CB 3KNBA 3VDCA 3SDCA 5KS9A 1QHOA 2EDXA 1FSKB 3MRJA 1XCTA 3E6HB 5BZDB 1MWAA 2NY4D 5D70L 3NH7L 3B9VA 5IGXL 8CGTA 2Q20A 2W07A 5KSAA 1D9KA 3QUKB 2LAGB 4MD0B 3ZYJA 4TULL 1EEZB 5GGSA 5LGKA 1UXWB 4L3EB 1RUPH 2X7LB 3H0TB 4NOBA 2A9MH 4PRHE 4XBPB 1KLGB 1ORQB 2NY6C 5FA3A 5C2BH 1PG7H 3RBSA 1NAML 2X2YA 4D3CL 1QR1A 1CZ8H 1QRNE 2YRLA 2BDNL 4P46D 1X4ZA 3IJSB 1X5JA 4FTVB 1C5CL 2E5EA 2VDQL 4P2RA 5HDLA 5MENB 4OBRA 1F97A 3HFMH 3P0VH 1J8HD 1LP9A 2HFFB 3Q6FB 4RMQA 3NBNA 3S96B 4RISH 1LO2L 4P5MB 3NIFE 1R3KA 1DJSA 2QADC 3BDYH 2AI0L 4GQ9L 4G42A 4IRJC 5L9DH 4FS0A 4G8GD 3X14B 4BSWB 1FYTB 5CBAA 2J6EL 4WUUD 2WM0A 3O2VH 4N9OB 4HDIB 1XF3A 3DUUB 2X4SA 3GO1H 4NQDA 1CVSC 4L4VA 1CTNA 5T3ZE 4LCYA 3AREB 4J23A 1AXTL 4JFFA 3K0WA 4OCRL 4YHOH 5IESL 4GS7B 1IEAB 5GGQL 4QT5B 2PUQT 3ARGC 4YBLB 3ARYA 3O6FC 1VFMA 1PBYA 1R0AH 3P4MB 4UNUA 4M43L 1MCEA 1PY4A 4NC0B 4P3CH 4HG4J 1E6OL 4J1UB 3S3JA 5EU7C 3IXAA 4AMKL 4ZTOH 1QTYT 5ICXA 2HLAB 2YPKB 1DN0B 4DQOL 2CPCA 5DMGC 3RUGA 4IDJL 2VLKE 3MRDB 4KK6D 4HIIA 5D7LA 4GRLD 4OLUL 1A6UL 4PJ5E 5TPWH 3LRHA 4P2QB 5I66A 1JE6A 4ORZC 1R5VB 1DLFL 4GG6F 1S7SA 2QQLH 1U58A 4Y4FA 2FATH 3KAAA 3SKUD 3MRPA 2EDBA 1BJMA 4Z0BH 3DX7A 3ARSA 1EA9C 3G5VB 4C4KT 2B5IB 3DX9A 1JNHA 1MLCA 2P5EE 3JTSB 4OLXH 3VFUB 1T7XA 2JCCB 4P9ML 1S9WB 3SDCD 3P9LB 1H3TA 1CXLA 1IC1A 1MFDH 4R2GC 3UYOD 5DHVA 2XQBL 4DW2L 3ZSSA 1NAKL 3OJMB 3D2UD 2R4RH 4ZUUB 3TNMA 3OKDB 5KSAD 4HIJA 4BUGA 1D9KD 4I0KA 3ZDYE 4OT1L 4GAYA 4RAVA 4XRCB 2VDMH 1UKSA 5CEZD 1PZ5B 3BXNA 1H5BC 2ED8A 2VLJE 1KACB 3WKNA 1C12A 5ADPL 3UDWC 3QDJA 3VRJA 1EHNA 1ZT4A 2P8PB 5C8JB 8FABB 4QRTA 2VWEE 4KKLC 1FFPB 1HINL 3PNWA 3QIUC 2I9LA 1T2JA 4P2RD 4KH2A 1ADQL 1ETZA 1UM4H 3TA3C 5I0ZA 1A7BA 3BUTA 2ZUTA 4WI6A 3P40A 1H3VA 1N3NA 2E6JA 2UVFA 5HVHC 5BMFH 1CVRA 2B7DT 2F53A 4NNPH 1YEEH 3FB7B 4NZTL 4X6DE 4LL9A 2LU3A 1I1AA 4L5FH 3OKEB 3VXUE 4ETYA 4ZFOA 4R97C 3WDIA 3GEWB 3BPLB 3L3HA 1SM3H 3WIIL 3KYMB 1OWRM 3CVHA 4XAKE 4Y2DB 1RZKL 1CGSL 4HKZA 3U7WL 4L4VD 5GSRA 4ORGA 4N5EC 5DMJB 5FGSA 4JFFD 4ZO9A 4R4FH 2ADJA 3U2SB 3UTSE 3U9UB 3LRSA 4X7TA 1P84K 3HMXL 3MRKB 4GRWE 3RL2A 2ED9A 1N8ZA 4JHWH 1D6EB 4LSUL 2HA1A 4KHXH 4RRPG 3QEQA 3O3AA 2W0KA 1LNUB 5H37G 1QFUL 2DQUL 1TFHA 4K3JL 4WEMB 2D4FA 4XNXL 3UJIH 2W9EH 4QXUL 5MERA 3ULVF 4OCWH 5D2NE 1OAZL 4QOKB 1GAFL 4U1KB 3QNXA 1T7YA 2NR6C 1U8PB 3F7PC 3HNVL 4WW2A 1B90A 5HHQA 3M1BB 1FPTL 5KJRL 3C8KA 2CSPA 3G6DH 4HUUA 4OZIE 2VO5A 1HEZA 3LQAH 4Y4FD 4JG1L 3L7FA 5ECJE 4JG0H 1RHHB 1RIVL 2Q1EA 3BP7A 3O45B 4LSSL 1B0GB 1YY8B 2NY3C 2PW1B 4TPRH 2M8XA 4H1LA 4KK8D 5LGHL 2APBA 5HXMA 2F5BH 4QNPF 4YHNB 4XAWL 5F7FA 5LWYL 5IB5A 1GSMA 3OPZL 4WEBL 5T1DH 5JOFB 4MNQE 1BX2A 4P57A 2D7NA 2EKJA 4JRXA 1ZEAL 4OZGA 4PJDB 2XZCL 2AJVH 3S35H 1YEKH 3QAZB 1CDJA 5GRUH 4RSVA 4QXWA 4ISVB 4I48B 3LN9A 3UTZA 3BKML 1UFUA 1BP3B 3HRZB 2NY7L 2WP3O 4Z78A 5A16A 2FEEI 2H6PB 3PWNB 4X6BA 4WU5B 5IB3B 3OG6B 3L5WB 4KKAD 4HMDA 4PJGE 4M62L 3HC3L 2XY1A 5DRZA 1J8HB 3BRDA 4XHQA 5IF0B 1RV6X 4E0RB 3QDJD 5CCKH 3LQZA 3QI9A 3GMQB 3SDDB 5F7UA 4X6FA 4GG8B 3HMWL 3WS3B 4FNLL 1H8NA 3PWJA 2NXYC 4KROD 1INQA 1YEJH 1TJGL 1TVHA 1OW0C 4NHCH 3ZDXE 4ZD3H 1XF4B 3VGEA 1BJ1H 4WJ5A 3NCFB 3QPQC 5CJBA 1I1AD 1ZS8A 4OKDA 3IXTA 4IOIA 1HYSD 3MLXL 2XZAL 1P2CA 3D85D 1HQRA 1KELL 3FONA 3LKSB 4X7FC 3BX7C 5DD1H 4LGSB 1DSFH 4LKCB 5CKGA 4PJ8B 2FEDD 1UCBH 2BHYA 3F7RA 4OLZL 3SJVB 4N8CL 1S7WA 1TZHA 3TCXA 2NXZD 1RZIA 4PJXA 1UKQA 3K4ZA 3MJ7A 4MGXA 3VA6A 5EBWB 2CLVB 3C5ZA 1Z6JT 3QEQD 3LS4L 4WCYH 1ZLWK 4NDMB 2VLRE 3O6LH 3SCMB 4HH9A 4PTTB 1ZSDA 1A6WH 2F54A 2X4OB 5IBLD 3LQAC 4PBXA 4U1HB 1QFHA 5BS0E 2VABA 4PJCB 4JFZL 4WFGD 4U31A 3UJTH 5EG6C 1R24B 1JHLH 3AY4C 2CRZA 4G6FD 1EK3A 2BVQA 2IPUK 2VITB 1JHKH 1YQVL 4ODHL 2N7AA 2EDFA 1VACA 2FBJH 3RAJH 4XMKL 4GKSA 5AZEL 3ZYOA 2D7TL 2QQQA 1QBLH 4JHZA 1FV1A 5FYJH 5E08H 5FUZL 3T2QA 3AAZB 4MA3A 4Z7WF 4MHHI 4RFNC 4Y5XC 1EO8L 4G43A 1N6UA 1P6FA 3MUGB 5EOTB 2CUHA 4LQ1A 5KVGH 1QLEH 1L0YA 4GO6B 2H32A 1WFNA 3JSSA 5CJXA 3D2UB 2JELH 3QYCA 3RGHA 1BD2E 2FBOJ 3RNQB 4XCNA 3TF7C 2X42A 1X4YA 2ZOLB 4WW1B 2CLZB 3BP6A 5DD6B 4U6XA 4UU9B 1N59A 4YHLH 1T0MA 4CVWA 4P0DA 4LSVH 1K2DA 1BEYH 1RUPL 4N5UA 5KAQG 1KV3A 2A9ML 1L7IH 5C2BL 1IL1B 5FM8A 1CZ8L 3KPRE 3VXPB 5F7DA 1T83C 3OXRA 4LPUA 4HKJA 5FCUL 4KGLA 4OLVH 4Z7UA 5JNYA 4AJ0A 3HFML 3JV6A 4LLVA 1MRFH 4RISL 1C5BL 5I75B 3VRLE 4M6NH 3BDYL 5L9DL 1CLYH 1Q8MA 1KIUA 1T89C 5HY9B 1IKNA 5K9OB 1XF3B 3TIDB 5KSVB 5JPNA 5JZ7D 3OB0K 1X5LA 5EBLB 3SE4A 3HI5H 2BJML 3O2VL 3ARFA 3SGJA 1P4BH 4LCYB 1ACYH 4CVXA 1YEFH 2RCSH 2VC2H 4L8SC 5B38G 1U8NA 4LMQE 4XMLH 2R29L 4P59H 3H9ZA 1NCBH 4AM0A 4XP9H 2G60L 3KWWB 4YHOL 3DRQB 4D9QE 3BGAA 3MV7A 1VENA 3HLAB 3F8UB 1MSPA 2GQHA 1LILA 2V7NA 4JO2H 3V0WH 1LEKB 1UJ3C 4F80A 3QPXH 2YK1L 5HSFA 3KYOB 1R0AL 4P3DA 1C1EL 4P3CL 4R90H 5DT1L 1G7QB 5E7FA 3C5JB 2NY0C 1OP3H 3MLUH 3QXVA 3C5ZD 3BDXA 4S2SA 4ZTOL 5DEZA 3WJLA 3QHTC 4LLWA 2OTWB 5AG8A 3ZE0F 3U4AA 4A2MA 1K6QH 2HJKB 4KPHL 2F54D 2Z31B 1OP3K 1MCRA 3RWJA 4X6CB 5TPWL 5T1MA 1VFBB 1QSEA 2VLLA 3NZHH 1N6VA 3QXDA 4DCQA 4X4YA 1X5AA 2FGWH 4HFUL 2QQLL 3ARDA 4MZ3A 1AD0B 2FATL 2DQDL 4EIZC 4MJ6A 4GMSL 4U6VL 4Z0BL 5IBTL 2EO9A 4LIQL 5DFTA 5C0BA 4JFPA 2XWTB 4GBXC 5C0GB 2O93L 1NDGA 2EE9A 1A3LH 2R23A 4KJQD 3P4LA 2GK2A 3P0YH 4OLXL 2F15A 3X3FH 3SKMB 5I1GH 2R0LH 1J86A 3QEHA 5HYSG 1JV5B 2XZZA 4NJ9H 1MFDL 3CGTA 4R4BB 4QHMB 3ALPA 4BA8A 2HH0H 1JGEA 4YHZL 5C0JA 5FFLA 2R4RL 4QRQB 4AEIH 5F71A 5FO8A 5CGMA 1I4FB 1EJOL 3RP1A 3C8DA 1T3FA 2C1PA 2VDML 2NW2A 3GMLA 5DQJA 3T0XA 2X10A 1A7NH 2MFNA 2IEPA 5JIPA 4XCEA 4LPXA 4KROB 2C1OA 4ODBD 4PP1D 5DEFA 2VWEC 3UAJC 3JWDL 1UM4L 5DXWA 5K9KA 4MJ2A 2CKBB 1A6AA 3BD5A 1D5XA 1A4KA 3MRBA 4HS3B 5BMFL 4RCAA 3P9MA 4XP6H 4DZBB 4G6KH 4HC1H 1YEEL 3GJFB 1A7RH 4PG9B 4ODXB 4DFHA 3L3HB 5ADOH 3VDBA 1RURH 1CE1L 4FZEH 2XTJB 3QUXC 3UO1L 2N4IA 1JGVH 4HCRA 3D85B 3ARFD 4WUUE 3ULUH 4QHLA 3NIGF 4IIQB 1Q38A 1OHQA 3HZYB 1KYOJ 4K2UL 5TDOB 5EO9A 1RJYB 2DIBA 2GY5A 1UZ6E 4ZAKA 3RL2B 1E4WH 3MV7D 4NO5A 2K1MA 4S11A 1I8KB 1U8LA 4ZUVA 5DYOA 1EMTH 4JKKA 5IVXF 2V6HA 1S5HB 5CD5D 2R0WH 5SX5K 2X89A 4WDIA 5B22A 3VFTB 3OGCA 3CCHA 1BECA 3V5KB 4KHXL 5MEPB 5C3LD 4HQQH 4P5KB 4GW5B 3P4NA 3RDTA 4C56A 3VD4A 2IH3B 1IZJA 1J05B 2DM3A 5D71H 3I75B 4URTB 3UJIL 2W9EL 2JK5B 4EDXB 4F9LC 3GSQB 1A6ZB 3L7EB 1KJVB 1HH9B 4BKLB 5IFJB 4JQVC 4KKBC 4MSWA 2ED7A 5HHQB 5D2NC 1C8PA 4AEHL 4M61A 5IJKC 4Z7OE 4GJTB 4N0RA 5T33H 4ZPVB 4LPWA 5C0RH 1QSED 5GIRA 2F19H 2E9WA 3H9HA 4NZRH 4JJ5B 3BKYH 2XKNA 4TSBH 5EO0A 3ARDD 5LGJB 1PQZA 2WNGA 3QQ3B 4JG0L 1TJIH 3V6ZA 1H3XA 5C0BD 4JRYB 4D9RD 6FABH 2UWEE 4H1LB 4BZ1H 4K23H 2MQCA 3O8XB 2IH1A 1XIWA 2PTTB 1JGDA 3ZHLA 1QSFA 1UT9A 2YKLH 5HHMB 3VRIB 2VLMD 3CFBA 2D03H 4OCMC 3CDGA 3FFCE 2NY1C 3M8OH 4WI4A 4KZDL 3BP4A 4UINH 1L0XA 5FUOH 2YZ8A 2P8MB 2IFGA 2Y7QA 3G6JA 2FYYB 5J3HC 2AJVL 3S88L 5KS9E 4CGTA 3HCVB 4OF0A 4PRBB 4ZNEE 3L9RB 3S35L 1YEKL 3REWA 5GRUL 2ID5A 1S7QA 3A6CH 4TOYH 2DLEA 3JTTB 1KIQA 4JZNA 5DO2D 4EBQL 3V4PH 3Q1SH 5JA9A 1BF2A 4MCYB 4O2EA 4XZUA 1BFOB 2AJUH 2IADB 1CTOA 5D2LA 4QWWC 5F9WB 2FH6A 4M8QA 1OY3B 3CFKB 3RWDB 4KUZH 3FQRA 5I1JL 1MFEL 1G7PA 2D7OA 2IWGA 1AGFA 3F5WB 5IJVA 5JLZB 4O2FB 3K4DA 2Y9RT 1YPZF 4KTDH 5DJCA 1H9VA 1WVZA 2XWJB 3IXTB 3PWPD 3TGXA 4DZ8B 5D1ZA 1T7ZA 1KPVB 3FO0H 4KVNH 3GKWL 4LCUA 1RFDH 2PO6B 1QEWB 2OTUB 3RWIB 4K7FB 3BWAA 4LASH 2UY6A 4FFZL 4N68A 3W9EB 1DUYA 3MRGB 4NQDE 4YZFE 5DD1L 4ZAKD 4L4VE 1ZXQA 3WMSA 2A6DB 4XH2A 1UCBL 2J88H 1FZMA 3IAPA 5CP7A 3B8YA 2YBRA 3OL2A 2EE2A 1NFDF 3CSYB 1K8DB 2ORBH 4YEFA 1PJ9A 3RDTD 2P7TB 4WCYL 4Z7WB 2FLRT 4UQ3A 4YBLC 3BZEA 5B3JF 3WDJA 5FV1L 2B1AH 1TVDA 4WUKH 5DF0A 3NVQA 4LCWB 2Z35B 1GIGH 4QCIA 1NJ9A 2EC9U 3RUGE 1BAFH 1J0YA 5KSBB 2F74A 5D7LE 4HHAB 4K3GA 2ZCKL 3CUPA 5IEKA 2NTFB 3I84A 1JHLL 3HC0A 2X4NB 1NCTA 3HAEG 1CFVL 1JHKL 1QLFA 4PJBB 2OR8A 4P2CG 2ZUSA 4OD1L 3EYVA 3KYKH 5E8PB 3S35X 3TVMA 3D39A 4Q2ZA 1QBLL 5EZLB 5FYJL 3N85H 3EOBB 1JWSA 4G43B 4N8VA 4NWUL 4OF8A 3M17A 5JXEA 5D5MA 1XIWD 3GSOB 1J10A 1F2XK 1YJDC 1IZKA 1QSFD 5E00B 3MLYL 1RJLB 5HDBE 4NFBA 5A2KH 2JJSA 2UY7A 4KJPC 4WFHD 4GSDH 3IDUA 4OFIA 1I7TA 3OJVC 1TXKA 4OUOA 5DTFA 1ND0A 4JZJA 2JELL 5IUSA 3PWUA 1MH5B 4TSAH 4JQXA 2KZ1B 4LIQE 4YIQB 1T5XA 4PJFB 3BH8A 1FAIH 1LMKA 2Z8VC 2HFTA 5E99H 3GK8H 4LSVL 2YUXA 2FECI 1SBSL 2PKDA 5F7DB 3B3IB 1QBAA 5ICYB 4X8JB 3CXDL 2R15A 4AY0A 1X44A 3AS0A 4KMQA 4F7MB 1UWEL 4QGTA 2YPLA 2YD8A 4OLVL 4HLZH 5A3IC 1MEXL 3QDJE 3N1QC 3EO9H 5FDWB 4F9PA 3VFGH 1B4JH 1F3DJ 1N2RB 1S7VA 5JPNB 3MJGX 5C08A 3RI5F 3RVTD 1ZLUK 4O02L 4LEXH 2VXUH 4HS8L 3HI5L 2DQEH 5D1ZD 1U8QA 2F53E 2GJZB 4XP1H 1IAOA 2VZ1A 5F1OB 2W0FA 4Q6IC 1U95B 1WZ1H 1YEFL 4JREC 1NC2A 2BZDA 3MV7B 4XP4H 3IAGC 1AHWA 3ABZA 4P59L 3MV9A 1NCBL 3ZE2F 3ROOA 5HGBA 5EU5B 1MCQA 3ALWA 4PJEF 3ARBC 1AXSB 3ZZ1A 3FQTB 3P77B 1XGTA 1BZ9B 2IPTH 2DWEB 4JAMA 3S3SA 4OCSH 1VPOH 5FGRA 3WFDL 4HS6A 5LBSL 1RJZA 5ENWA 3U7AA 1G7LA 4M3KB 4Y2DC 5BRZE 3FT4A 1WV7T 3IB4A 1X5IA 4NQCB 4L4TA 1T1WA 5L0QB 1BGXH 3TT1H 1PKQB 3QEQE 4EN3C 3AGVA 4WWKD 4G3YH 1FZJB 4WI2A 4XB7A 1ZK9A 3RY6C 1WITA 1F3JB 1QSEB 2RIKA 4Z77B 3GJEA 4UUJB 3PV6B 3NZHL 1SJEB 3D69B 4EUPA 1CG9A 4MJ6B 1IILE 5F9JB 1KTRL 4J3VA 4OZFH 1RZ7L 2GFBB 1X5XA 1PG7W 5KANI 2EDEA 2ARWA 2PYFB 1IBGL 1Q9LA 2GSIA 4FFVC 2UZYB 3D39D 3FRUA 1NGPL 4G9FB 4F7EB 3VFMB 4UI2A 1TCRB 5MP6H 2COQA 3NABL 1W72B 1T0NA 1XGUB 2FGZA 5KZCD 4QHNB 5IV2A 1DQML 5JXED 4YPJA 1ORSA 2D4DA 3P0YL 4LHJB 1DQLH 3T77B 4XVTH 5I1GL 1HQ4A 3CSGA 3RVUD 4A6YA 3VGAB 2C3VA 1FO0A 1YMMA 4NJ9L 3RZCA 1GGCH 5GQBA 1NBVL 1E6JH 4MS8D 1HZHH 1S3KH 3I6GA 4OAWB 5I1KH 1U8HB 3EYOB 4MXWH 4JRXE 1I8LC 2NW2B 1X6NA 4D9LL 5ESAB 5T1KD 2NY4C 2XNAB 3ZKQD 2M1KA 4DKEH 4NKOA 1A7NL 3WXWL 3RX8A 1BOYA 2C1OB 2MCG1 1N5AA 1N7MH 4IEFB 2V2TA 5FK9A 4KV5E 4EVNA 1F02I 1XAUA 4I4WB 4WI5A 2OZ4A 1NGXB 4DGYH 1RMFH 4OQ1A 1UZ8A 3TV3H 3SDXB 1J0JA 5IVZA 4M6OL 2YPLD 5DUMH 2FJGB 3QG7H 4IM8A 4O51A 4L8DB 2ICWI 3PWPB 2PTUA 4P46C 5EZIH 2EDWA 2DDQH 2CKNA 4W6WB 2NY2D 5J13C 4XP6L 3VD5A 3G5YA 5DVMA 4DGIL 4G6KL 3SY0B 4QEGA 4X98A 3WE6B 4AIZA 1A7RL 3BMVA 5CLTA 5C08D 3ZSTA 4KQ4H 5B3NA 5CEZH 5DZLA 5DMIL 5EU6A 3EFDL 3F12A 4TUKL 5FYKD 2OK0L 4GXUM 1KCLA 5GHWH 1FRGH 3VWKB 4XPBH 2Q8AH 3ULUL 1CD1A 3CPLA 3GBNH 1U8JB 4HZLB 4BUHA 3MV9D 2WLYA 4DVRH 3HTLX 1E4WL 4QTIH 3UPCA 3JVGA 4ODSH 4U1SA 2BY2A 1EMTL 4XPAH 3V9FA 4HX1A 5CHNA 4F37K 3C2AH 1CR9L 4R7NA 1EFQA 1INEL 1MQKH 3HE7A 4OF6A 1DLHB 2VMFA 3L3OA 4GXUN 4WV1A 1FFRA 1EVTC 4HQQL 4HFWB 1ZHLB 3PQYA 3VFNA 1F3RB 3ZT6A 2GITB 4WHCA 1ZLSH 4PJXE 5D71L 3DYPA 1G6RA 3CVIH 3O41A 2VXVH 4ZUWA 1A7OH 1WISA 1IMHC 4KXZH 2IC2A 3VH8G 2F54E 2YWZA 4KK6C 1RIHH 4ODWA 4HBQA 3NAAH 4GRLC 2AQ1A 1U8IA 1QVOB 2BNQA 3T3ME 1A7PL 1A9BB 2GY7B 4NZRL 2Q76B 1OF2A 1BQHB 1ZKAA 4TSBL 5F7NC 3MMEB 2X1OA 3UTTD 5D93C 5HTSA 1J5OL 1G7MA 5EOCJ 3CNKA 4ELMF 2D7MA 1RK0B 4YHKH 2D0HA 3E8UH 2GUOB 1XF2A 4K23L 1GL4B 4MA8L 5KSUA 1ZTXL 2RQ8A 4KKCD 1J11A 2YKLL 5L8LB 3L3KB 2D03L 3QIWB 4XCFH 2Q6WA 3M8OL 4GG6A 4OQTL 1KN2L 4UINL 4I2XA 5FUOL 1YMMD 1WLHA 4FQ1L 5HYQA 4X4XA 4J3UA 1IKFL 4OB5L 1OAXL 1WF5A 4BH7A 1KIQB 3SDCC 1IEHA 1J1OH 3F58H 4KTYA 4JKMA 3VMNA 3A6CL 1DN2A 4TOYL 2J1KA 3NGBB 3ROLB 4POYA 5FGCB 3NA9L 3DV6A 2FSEA 3EZ8A 3ZO0A 5SWQB 2A6IA 2NTSP 1YZZA 2BRQA 1BBJA 3KPLA 5E6IA 4HUWA 5KSAC 2AJUL 1D9KC 4ZPTB 1DFBL 1WEJH 3S9DB 2ATKB 4KUZL 1Z0NA 5ITBH 1CDCA 3CFCH 3TBVA 5BZWA 4Y4HA 3A0OA 4M7LL 5FCSH 1KJ3H 5EDXA 4Z7UE 4JO1L 5H94A 3A67H 2H45A 4N0UA 1OTTD 1U2CA 4ZOCA 5F88B 5CSZB 3FO0L 3MGTA 5EU6D 2DRUA 5EU4A 2AJZB 1RY7B 3GI9L 2MWCA 4OFDA 1T20B 2D31B 4ODTH 3QULB 4XGZA 1TLKA 4OI9A 1X5ZA 3Q0HA 5GS1A 1UVQA 1W0YT 3QUYB 5GS3A 1NCWL 3UPRB 3VI4F 5C92A 2J88L 2VL5B 5HI4D 3R8BB 4FXGB 4E41E 4UT9L 1B0WA 2W9LA 3VXSB 3HE7D 4NKMA 4EI5A 1MUJA 3MRLB 4OM0H 5AYQA 3NZ8B 3QO0A 3I2CL 1PVHA 3GJFH 4WWKB 1BHGA 3QUMA 3MSPA 1XFPA 2V9TA 2XKUA 4OD3H 5C9KA 3FT2B 1OAQL 1U2HA 4WTXA 3I85A 2B1AL 1KSRA 4QY8A 4GKZA 4FQQA 1AY1H 4PRPB 2BP3A 1NGQH 4IBLT 2ZUVA 1S78D 1GIGL 1UXSA 3T2PA 1FNSH 3ET9F 5F7KC 4OV5A 1NGWB 3HZVB 4AENA 1CD8A 2R1YA 4XCYA 1JPGA 4M9OA 4HUVB 2BNQD 3TLRA 5DRNA 1FHGA 2P24A 3D39B 2CLRB 2OCFD 1A64A 4LSPH 1KC5H 4RAUA 4YO0A 4U3HA 3BQUD 3U0WH 1CDBA 5C0CA 4KMTL 1OCWL 1OTSD 5IHLB 1VA9A 3IDXH 3PWVA 4GOSA 5C0FA 4Y8AA 4L29B 5DVNA 4Y4FC 5C0BE 1E28B 4D9RE 3GSWA 4Y4KA 5CIPA 2BFVH 1W2KT 4U33A 1J87A 3HUJB 4ZQKA 1FVEB 5FF6A 1R3HA 5JUEH 2I9TB 5HHPA 2VLME 4HF5H 3WS6C 4KK8C 2BSRA 3MYJA 1HHKB 3EOAA 2O5XH 3FT3A 4Z7QE 2O61B 5T1KB 4N1HB 3BH8B 2FIKB 4G8FA 3D18B 2Z0BA 4XMPL 5EZOH 2D7QA 1CGWA 1K9TA 2ZKHL 4NIKB 1ONQB 2DKSA 2VR5A 2ICWA 1KIPA 5B8CA 4J7RA 4OIIL 4JZOA 5CP3H 3MXVH 5E99L 4XNMB 2FL5A 4H1LH 4YDJB 1YQ2A 4C83A 3EGSB 5FHAL 2WLZA 1YEHH 4P5TA 3MJ8A 2OL3A 1BOGA 2E27H 7FABH 4OGYL 1XF1A 1OD7A 4AT6A 2OJZH 4APQB 4X7CC 1OAUL 5FKAB 3RWHB 1OSPH 2VQ1B 3DVIA 5IQ9B 3VFGL 1FNAA 2MHAB 5A1AA 3MBEB 4O00A 1BM3H 1DEEB 2X4TA 1FZKB 4KROC 5TE6H 1WBZB 4I18A 2DS4A 3B2VH 4LEXL 2WWMD 4XPTH 3H7BB 1FVCA 1VGEH 1FYHB 3ROOB 4PB0H 3S5LG 4XP4L 1I1AC