2E27L

Crystal structure of fv fragment of anti-ciguatoxin antibody complexed with abc-ring of ciguatoxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
IQMTQSPSSLSASLGGKVTITCKANQDIKKKIAWYQHKPGKGPRLLIYYTSTLKSGISSRFSGSGSGRDYSFSISNLEPEDAATYYCLQYDNFTWTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-ciguatoxin antibody, light chain
publication title Critical contribution of aromatic rings to specific recognition of polyether rings. The case of ciguatoxin CTX3C-ABC and its specific antibody 1C49.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e27L00
3QISA 3VG9C 3D6GA 1GOFA 4JY4B 1JGUH 3A67H 4S2SB 4JGJA 7FABH 1HHIB 1U6AH 1H8SA 3TBWA 1H5BA 2EDKA 5T1LA 4PG9B 3X3GL 3BKMH 4HUNB 4U05A 5CJQL 2X4OA 1NC2D 4H26B 4P3CL 4F7CB 3V52H 3MODL 2ESVB 2D31A 2IAMB 4JAMB 3PDGA 3WCYA 3HI5H 1G9EA 3QRGH 2GJ6A 3GB7A 3PHQB 5IFHH 4PJFA 1KV3A 2FX9L 4UU9B 5I8KH 1K4DA 2L4OA 5D7LA 5ALCL 4IHOA 1I3VA 4RA3A 3QZWA 2D7TL 1XGTA 4YDLC 4D3CL 2IBBA 3L3OA 4GXUN 3W9DB 4NJ9H 1RPQA 2HJKB 4LPYA 4Z5RA 2QADC 4PG2A 3D0LB 4N0UB 5LAXA 2YN5A 3PP4L 4Y8DC 4BH7B 3BIKA 3W81A 3DHMA 3DV4A 2B2XH 4RGOL 5IHUH 4OF8A 1YN7A 4POZD 4RFNC 3VFPA 5KSUB 2XWBB 5D1XD 2HG5A 2YD9A 1SVCP 4FMKA 3FB6B 3PQYE 3QWQB 3LHPH 1WCQA 3GJEA 4XMKL 1YPZF 5HXMA 2F74B 3HAEA 4P2RA 2E7LC 2CJUH 3B2VL 5DJXB 4OFDA 2RAMA 4Y4KA 3PJSA 1I1AD 4G6FD 3TT1H 5E03A 4AEIH 2B0SL 1IM9D 1GGBL 2Y72A 5FDWA 3VXTA 4D0DA 4YZFE 4UZGA 4OGAC 2EXYD 1URLA 3TN0A 1Q0YL 2XQBL 3RIFF 5ID1A 4YPJA 3TJEH 2OK0H 2K7QA 1T5WA 3G08B 1OTSC 4JKWA 3V7MA 4OSUL 5D70H 4QXGH 1HHKB 1OGAA 1QNZH 2C5DC 2MPAL 1LGVA 4I5BB 3VE0A 3T0VA 4HKZA 2F19H 4HSQA 2EDFA 4L9LA 2VH5L 3O6KH 5IKCB 4F3FA 1FJ1B 1WBZB 4ETYA 3QUML 1F00I 3QXUA 3HI6H 4HHAA 1ONQA 2ZPKH 5GGUA 3REWA 3QUKB 1P7KA 3MXVL 4JDVB 4ELME 4EUPA 1PZUB 1SMOA 3ULUH 1CFNB 4NKMA 4V2BA 2JB6A 1CDJA 2Z31C 5HI5D 5J3HC 3MLVH 1LO0L 1WIPA 2ARJB 4AIXA 5CZXD 4BFBD 3NZ8A 3BRGC 1A6AA 2R1WA 4I18A 3HE7D 3KXFA 3S35L 2IPUK 1QFUL 3HMWL 3S4SA 3ZE1F 1QP1A 5F71A 3T0EB 1V05A 1VADA 3N85L 4GAGH 1X5KA 5K9KB 5FV1L 4OCMC 1BZ9B 4HW6A 4QNPE 3CFBB 1EX0A 2OL3L 3T2QA 1SYVB 1C1EL 1FGNL 4WUKL 1TCRB 3QFJE 2ITCB 5TH2A 1DTUA 3S37X 3EJZC 4OIBA 32C2B 3DOSA 3UJJL 5DA4A 1KG0B 4NQVB 1WFNA 5IMOA 5DJYA 1IGIH 5SWSE 4HF5H 4GG6F 1T3FA 4KTYA 2NZIA 4KVNH 4I0PC 1CDHA 4NWUH 5TF1H 3WIFA 3EO0A 3MBEB 4MXVE 4OGXH 2NY3B 5L2KE 2UYLB 1SYSA 3QQ9C 4NO0D 4WUUE 4OCYH 3UDWA 3D3VB 4G6ML 2J8OA 3F58L 5FM5M 5J9PB 1C5BL 3P2TA 3LEVH 4NYLA 4HKJB 5DD5H 4KK6C 2PXYA 1XZ0A 3G6DH 3RTQD 4F9LC 5LGJA 5C0CD 1NFDB 4UBDD 3FT4B 4KKAD 3BPNC 5I74B 4J4PA 2ICCA 3IKCA 3O41A 3GRWA 2BSRB 3U79A 2IFGA 4YHLL 4HG4K 1QRKA 5BMFH 1EUTA 3L3GB 1NDGA 2HT4C 2BHYA 1L0XA 3MYZA 3MRHA 1NGYB 3GKWL 4PRAA 4PUBH 3SDDA 2B1AL 3HLAA 1QQDA 2C3VA 4OUUA 1F2XK 1OP3H 2BVUA 3C2AL 3JUYA 4KDTA 1F97A 4UT7L 2W65B 4OLUL 3SJVE 2JJSC 3A6CL 1SY6H 3CLFH 1OP3K 2FIKA 3P4MB 5H8DA 1EZVX 2ZJSH 5CEYB 4FNLH 3RU8H 3PGFH 3WD5L 4HJ0C 3PWJB 1TLKA 4KJQD 1SJVA 4HWBA 3OJMB 3NOIA 4MXQD 5DQ9B 5EO9A 1LP9F 2H45A 5EU7E 3P4LA 1T0MA 4U7SA 4XZUA 4JJHA 4EN3C 2X7LB 5TE4H 4H5SA 1MEXL 4U1NB 1IAIL 2O5YH 3UZQA 1HCFX 1NKOA 1PZ5A 2ADFH 1AP2B 2GK0A 3E3QC 5LWYH 1DBKH 4Q6IC 4H8WC 4WW2F 3HMXL 1QFWM 2E27H 4PJ9A 4JM2A 1FH5L 1AQDA 2AJZB 1JF5A 3MLTA 1PEWA 2YWZA 2V2XA 5GISH 1PG7L 1JIBA 1FGVL 2YBRB 3PWUA 5IW1B 1VKXA 3K1KC 4QYOB 3U4EB 2Z8VC 2LE9A 3L5HA 5GGQL 5I16B 3H9SA 1AC0A 1JNLH 3UX9B 1JNNH 5AUMA 2FJGA 3JWOL 3OPZH 1MCBA 2IGFH 1D9KB 2VWEE 4IRZL 1KJ2L 1CLOL 4V2CB 4HPYL 2QQLL 5CILH 2DL9A 1TDQA 3NACH 1KEML 4YHNB 3IAQA 4BSVA 1XFPA 1UH4A 2YD5A 1XF2B 2OJZL 5JHDA 4XNYH 3WLBB 1KELL 3L7EB 1F6AA 3SE8H 1I7ZA 1T0PB 3D2UD 3U2SB 5H94B 5HHOD 1I8IB 1NAKL 2WUBH 3UMTA 1EBAA 3T3ME 1MCSA 4FXLA 5EOTA 2PYFB 1TETL 4GRLC 1U8JB 2FBJL 3HRPA 5HYJE 4QY8A 4S1DD 1KXTB 4PJ7A 4NRYB 1FL6B 3F6IA 4AYFA 3CMOL 5KJRL 1UQSA 2RFXA 3VWJC 2VDNL 4Y19D 4UTAL 3LV3A 3JV5A 4HX1B 4X6DA 3L95B 1LWRA 1BZ7A 4WW1A 5DJ6B 2CDEB 3ZKMD 1A1MB 3IFNH 2FJHB 2GK2A 5F7KC 2FEDD 4GKZB 4E9LA 5E94A 2YKLH 1LDPL 3M1BB 1V7ML 4MWFB 1S7QA 3DJ9A 4YR6A 1L6ZA 3PL6D 5IEHA 1NGQH 2H32A 2EKSA 4LLUA 4FQXD 2Q6WA 5KZCD 4XNZB 2J6EA 4XX1E 3QA3A 5KSVA 3H9HB 2Q8AL 4R90H 2R0WL 3V4VH 2YA1A 3SPVA 4P46A 3OGOE 2NY6C 5JPMA 2Q8BL 3DMMB 1A7RH 4WW2B 1A3LH 1RULH 4XAWL 3LKQA 3WJLC 4HUVB 3VFMB 5DEZA 1A4JA 4U1JA 2IJ0C 4JRXE 2JTDA 1I3RA 3OWEA 2D0FA 5E95B 1ACZA 2DI8A 4QRRB 4WFHE 3KLHD 4OD2A 4ODTL 4TVPD 3K8MA 1OAKH 3AREC 5I8EB 4JRYE 1EEZB 2D2OA 3B5GA 1OARH 4D2NA 1KB5H 4U0RC 5I9QC 3C5SA 2CLVB 2FSEA 3SCMA 3TPKA 4OLVL 1FZMB 3IFPB 4O9HH 3UTZB 4PJBF 3EYQC 3DX9A 3D39E 4J3SA 4M62H 3BVNA 5E8OB 3VXUA 1NBZB 3K4DA 4M43L 5D7KE 4CADB 5I73C 1AFVL 3TIEB 4UV4L 5I1CH 4LVHC 5FECB 1W0WA 5K9QI 5CWSA 1BJ1H 1VFAB 3PP3H 2VDRL 1RZ8B 5IMLA 3X3FL 3AC0A 4GG8A 1NLBH 3UTTD 1JI1A 1G84A 1GZPA 1NCTA 1LO5A 5D7IA 3O2DA 5E7BA 4G7YH 4UT9L 3PP3K 4NJAH 1CZ8H 4XGZA 3HE6A 3TV3L 2XIDA 3SY0A 1UKQA 2X44D 4WFGE 3BGMB 3TO4B 5DJDB 2JB5H 2NY2B 3O4OB 4JO1H 1EO7A 5I15H 5CGYD 5I1HH 1DUZA 3HNTL 2GW5A 1H3TA 3JWOC 3CFKA 3MNWB 3IJYB 1V3MA 3QIUB 4GSDH 5JXED 2JELL 3O4LB 3MR9A 3FTGB 1U3HC 1Z9SA 2EE2A 1JN6A 4PLOB 3PGCA 3RA7L 1ZSDA 2X4SA 3L3DB 5D2NA 1O0VA 1U95B 1BHGA 3JXAA 2ZG3A 1VGKB 2DIBA 5I8CA 5HYJA 4AT6A 1QSFB 4HG4J 3VGGA 2QQKH 3ZKXB 3R8BB 3BH9B 5I2IA 1LEGA 2R0ZH 1BVKB 3QJHB 5IVXE 1KFAH 4GLRI 4O2FA 4ZG1A 1KPRB 4M48L 2FBOJ 3TH2T 1FL5A 5EO1B 1FNEA 4ZFZB 2JKXA 4ZO8A 4Y0GA 1PLGH 2IAMC 4F7MB 3BWUC 2XA3A 2XYCA 3GSVB 1QBML 5FDYA 5D1QA 1AHWC 1UXWA 4GMSL 4X7TB 1OPGH 4LDEB 3GSNB 1JWUA 1KTLA 1OW0A 1I9EA 4UINL 2R29H 3MRFB 5JOPD 4K7PL 1NC4A 1MCPH 1CK0L 4KRLB 3BHBB 1KIUA 3TBSA 4L5FL 2XZCH 2MQ0A 5T1DH 4PJIF 4JFXB 4E41A 2BNRD 2KKQA 3FQTA 4O5LL 1X5XA 2VLMD 2P48B 3NGBC 2AGJH 3LIZH 4PJEF 2V7HA 3DX8B 4KRPD 4XMPL 2CK0H 1HXYA 1IL1A 5F89A 1UWGL 3BP4B 1A6ZB 1G7JA 1Q72L 2ZWLT 1KN2H 3KYAA 2BC4B 4X6FA 5F7DA 1FNFA 1TENA 2WWKT 1YQVL 3FONB 4KKCC 4ORGA 4KI5F 3HN3A 5T3ZE 3GBNH 3G6AB 4RNRA 4KK8C 1H3VA 1NCWH 4JRYA 1EO5A 1XR8A 4R2GD 2E7BA 4HS6B 5EU4B 4RWHA 4YBQC 5J11B 4U1MA 5ICYA 5T1LD 4P5TB 3D39A 3QEGL 4HGWA 1VENA 2FL5B 2HFTA 4HS3B 1ZMYA 4Q7DA 4R96A 1FFOB 3ARBA 5H37H 1WCBA 1NCCH 1WZ1H 4U7KA 1P53A 2I25N 1E4WH 2GJ6D 1TIUA 4U1LB 3QT2A 3T77A 4AIZB 3OHXB 4IDLA 5D7LD 2OQJB 4NCC2 4PLNC 3E6HB 3QIBB 2VZOA 4G8GA 4YHKH 5FCSH 2EIDA 1T4KB 1ES0A 5F9JB 5C8JB 1B9ZA 4G9FA 1AY1H 3R1GH 5GGTH 3X11A 4YDJB 3D1MC 2AV1A 2DLHA 3T1FB 4HMDA 4QRPD 4KZEH 4O2EA 3RZWA 4NUGH 5I19L 1TVHA 5EBWB 4JFHD 3T0BA 1YEDB 2EH7H 3BZEB 5DI8B 5IWLC 5BVJA 2ARWA 4XAKD 1DJSA 2DMCA 4JY6A 4TVPH 3UPRA 1T0NA 1I1FA 1TNMA 3D18A 1J87A 3TA3A 3DVGA 1NSNL 2HKHH 5CJXA 4Y4KD 1GH7A 1FCCA 4HIJA 1XCTB 2GSGA 3T0EC 3JV0A 1H0DB 3NFNB 3I02A 1OCWL 2VRAA 4WV1B 3ZDYE 4F15B 3SDAD 2W60B 3Q6GL 1H9VA 4OTXH 1A6TA 2QSTA 4YHML 3TN0D 1FNGA 3OJDB 2BNQE 4XWOD 5GS1A 1WC7B 1E28A 3QG7H 4M7ZB 4Z0BL 3E3QE 4M6AA 1DUYA 3MA7B 2YR3A 4YXLH 5GZNC 1OGAD 5B38G 2IQ9L 1I8KA 3QSKB 4M1CD 3MBEC 3ZYIA 3BQUA 4WCYH 4F7EA 2NYYC 1CD1A 4XB8A 5JW4M 1GGIL 3UYRH 1XH3B 5BJTB 3F7PC 4ACPA 4HXAL 4LHQB 5D7SL 2EC9T 1DR9A 3VRLF 5C7XH 1V5JA 4HBQA 5I74C 3VXSA 4E42A 1TMCB 2IANE 1MLBB 1YMME 2IH1B 5DD6A 5IF0A 3QJFA 4C59B 1WAAE 2XTJC 3RQ3A 4DUVA 1RJLA 5GGSY 3S96A 2NX5E 3HA0A 4XPHL 3DLQR 1CR9H 1A1NB 2NY0B 1B4RA 1JF1B 3FOMB 1JPSL 3KXFD 4MVBD 1HH9B 3MMEB 4KKLC 2QQNL 3I85A 5I66B 4ZYKB 4DQOH 1KC5H 2X4PB 4G80B 2EDEA 1P7QD 4F7TB 5JQ6H 5D2LB 4GRWE 2X9YA 1IAIM 1FVEB 4Y4FA 2AJXH 4Z7WA 43CAB 5C0BE 2DQEL 3WXVL 4JO3L 4PRIA 4YEEA 3HZMA 1BFVL 1U8KB 3E8UH 3S5LB 1A47A 1BJ1J 5DGQA 2ZUUA 3TNMA 3L3JB 3MBXL 2VZSA 4CMMA 1OAZH 5DVMA 3PUCA 5F1IA 4NC2B 2B20A 4NQCA 1ZLSH 1CGSH 2DWEB 1F4WH 4ZPVB 3RUGF 4YNYB 4LMQI 2JB6B 4HK0A 1Q9KB 3CPLB 3ZE0F 3P77B 1A6PA 4M5YH 4LCYB 4OM1H 3IU3A 5CCKH 2ADJB 2BDNH 3T2PA 5JTWA 1GGYA 5IEKA 3S8WA 5IB2A 2PXYD 5T3XL 3RP1A 3OKDA 5FK9A 1MI5B 1QVOB 2E9IA 3WEXB 3W0WB 4J4PD 3U7AA 1P7HL 4NT6A 3DETC 3MUJA 4K9EH 1F3DJ 3U46B 1LK2A 4OZIA 4HJGA 4M02A 4W68A 5FXCH 2IFFH 3FRUA 2AVGA 2XFXB 5E0QA 3L5XH 1NLDL 3ARVA 3SQOH 4BK4A 2Z4QA 1OSPH 2V2WA 5DRNA 1C7TA 2VLKA 4PJGA 3GK8L 3SDDD 2P8PB 3D85A 2Q7YA 1VHPA 5GRUL 4ZTPH 3PWNB 4KKBD 1D9KC 1DBBH 1YEGL 1YNKL 4JHAL 1OT2A 4LCWE 4RGNC 1NDMB 5EO0B 1A7OL 4OIIH 2FX8H 1U8PB 3PQYD 4ZFOA 2PTVA 5K9JH 4NRZA 4OLZH 1RIVL 4NZRH 2IQAA 1YY9D 1ZOXA 3BYTA 4LKXA 2FRGP 5CJ5A 1WWWX 4M9OA 2DQFA 3O41B 4WDIA 2P24A 1BIIB 3FQRB 2YD4A 5GRJH 5D71H 1KPVA 3QUXA 4X9FA 1CDCA 3UTSE 5ADOL 4X7SL 3CC5A 4JFEE 5H2BB 3OAYH 4X4YB 4LOUD 1FSKB 1JZ7A 4JM2D 1QKZH 5MHSD 5IQ9B 2AEPH 1YEEH 4H0GA 3OAYK 3RKDC 3WFCH 2ITDB 1HI6B 4JFPB 3E6FA 1I3UA 1RZ7L 1BBJB 3STLB 1NBVH 3ZSTA 5K59E 4NQUA 1D5MA 3H9SD 1QR1B 4PGJA 2DI7A 2CLZB 3GSNL 1E6JH 3EOYG 4KHTH 1RFDH 2ZUVA 1FFNA 3VDBA 2E8YA 2EZ0C 2NXYB 1YN6B 3OV6A 1KIRB 4MDIA 1IAKB 3V0VB 1IQDB 1JGEA 3SE9H 1J1XL 2BVYA 3QIWB 3RUGB 3RZCB 3HAEH 5C0AE 3VH8A 3CUPA 5IR1B 1EEQA 5EU5A 5ACMA 1J05A 3WHXA 1JWSA 5LGHH 3NIFF 4KZDH 2FB4H 2YOCA 5JHDD 5DK0B 4ODUB 3DMMC 4G9DA 4XPFL 4PV8B 4WW2C 3BSZL 5C2BL 3FCTB 5C0RL 1RURL 4HUWB 3ZT6A 3IYLW 3SEPA 5SV3A 4N8VG 2F54B 4N0CD 2DM3A 4P4RB 3U9PH 3T4AB 1BVLA 1XR9A 4K71B 1IBGL 3FB7A 4J3TA 2CPCA 5BV7B 3NA4A 2DQIH 4OV6F 4ERSH 1LE5B 2BVEA 3ZT7A 1MFNA 4UT6H 1WZMA 3P30L 5J6HA 3NTCL 2Y5TB 4RCAA 3MV7E 1RUKL 1T1ZB 3RWDB 4O4YL 3QDHA 3T0AA 1RK1A 5I1JL 2VC2L 3OQ3B 5FO8B 4I48A 4MNQB 5DFTA 3ULUF 4LSSH 4NM8L 1XF3A 3PDOA 3MFFB 1YEIL 5HDBE 5B39G 2DTMH 4U2YA 2FATH 4EUPH 3TCXA 3CX5K 4C55A 3A6BL 4KY1H 1A2YB 4XXCC 2IPTH 1EMTL 2AJUL 1P5VA 3IFLH 2W1NA 1TZGH 4M5ZL 5HD8C 2XPGB 4V1DB 1WIOA 1NEZB 3HG1E 4XC1L 1U8QA 2A6IB 2CGRH 2GJZB 4UQ2B 5D1ZA 1BD2A 4QRQB 5GSVA 3QI9B 4LK4A 5IB5A 2FX7H 3BKJH 1MY7A 4ZUTA 5IK3A 1AKJB 2NY2C 3O4OC 5HVHB 2NCMA 3GEWB 5IP4A 1ULVA 2XN9A 3TYGL 3CFEB 3FO9A 1LO4H 4OCRH 1AGBB 4PRBB 2YC1A 4MB3A 3KHQA 2J8HA 2WQ8A 5CGMA 4P4KB 1HSBB 1DL7H 1OY3B 2EDQA 3TJHC 4JFDB 4NP4L 2DN7A 4PGEA 3RWIB 4YK4B 1LVEA 1JK8B 4LLYA 3SCMD 3H42H 2AJ3A 3VFGH 1EHXA 3LN4A 4P2OA 3DYOA 5K33A 1HYSD 1I8MA 1AO7E 4LVOC 1SM3L 3BDYH 4LL9A 3SKJH 3LQZB 3ARUA 4N5ED 3MJ6A 1VFBA 3SDCA 4QHKJ 1AR1C 3QCVL 4MA7H 5KSVB 1Y0LA 4X5WB 5E2WL 1MCJA 2WW8A 3CU1A 1WJ3A 3FO1A 4N0YH 1JFQH 1FVCA 2AI0H 2VXVL 3VWKA 4YXHH 1CFVH 1CDBA 5D5ME 3T04D 3ZMRA 3ESUF 4K8RL 1TVBB 4XPBH 1PSKH 4WFFE 4Y1AB 2AKRB 3T4YB 5CSZA 2LTQB 3UC0L 5C1MB 3DX7B 5ITBL 3HE6D 4EVNB 4P9HL 3G5XA 4MD5A 1KOAA 3MRQB 4R4FL 2E7HA 3P0YH 4M7LH 3WS3B 4P9ML 1IZKA 4TN9A 4HV8A 1K8DA 5I1DA 5SWZA 5EH1A 3GHEH 2P5WE 4Q9QH 3ARSA 3RPIB 5TDNA 1FO0L 4H25A 4QRSA 4OB5L 5ERWA 3MRDA 2YMXH 1UJ3A 4RQQA 1T89A 3OBAA 5KVDL 1Z9LA 2HWZL 2HN7B 4BFIA 3B8SA 1JTOA 1N26A 2QHRH 3DV6B 3B43A 3O9WC 4KMTH 4H88H 5CWSB 1VB9A 4FQ2H 2XTLA 4GG8B 5FYKE 1N2RB 4Y16C 5FEBA 2AQ1A 3ZSSA 3V2AR 1CL7L 2WM0A 2AQ3A 2AJSH 5DUPL 3WIHA 5HYJD 5BS0B 4LPWA 1YUHA 1PJ9A 1CU4L 3G5YB 5KSAA 2XA8L 4HPOL 2DICA 4MQXC 2AXHA 4UIKL 2ZOLB 4HFUH 2Q86B 3QXAB 1S5HB 3GHBL 4OKDA 4H0IA 4RWYL 3SO3C 4PRPB 2CDFA 4LCCA 5KAQG 3WE6B 4OI7A 4RAHA 1MJJA 1RHHA 5KVGH 2J5LB 4KK9C 3DGGA 1EAPA 1MJ7H 4G8FA 4ZTOH 5JW5B 5ITFB 3C09B 1YPZE 5D1QD 5SX5H 1Z3GH 3A6OA 2XZZA 5F1OB 5IROA 5GS0L 3UBXB 1G9ML 4MMXC 3QIBC 5SX5K 2XTJE 4UIMB 3PWPA 1NC4D 4IEFB 1ZEAL 4IIQC 2YUWA 4KDWA 4ZDHB 1K6QH 3ES6A 3QUZB 1G0YR 1UWXH 2CDGB 2VLJE 1RV6X 2D7OA 3QDME 4FQCL 4YHZH 4E41D 2PTTA 4L3AA 1QFPA 4JRWA 3GNML 4MQ7B 4N0RA 1DVFC 5D93B 1OF2A 1YNTB 3LEXB 1UWXK 3JBG7 4D9RE 1FL5B 3ULSB 2GT9A 1YYML 3OKNA 1R3IH 4L29A 4EZMA 4KKNA 5MEOA 2R4RH 5E6IC 1PEZA 3AFLA 3TESA 2YD2A 4OZFB 3UYPA 3T09A 1DQQB 2VUYA 3DURA 1EXUB 1MHEB 1R0AH 4JRYD 1NGPH 2LAGB 3O3AA 1HIML 4XI5C 4MNGA 3LCYA 3O3BA 4PJHA 4PJXB 3MXWL 1S7XB 5I18H 4UTBL 5E6YA 3KPRB 4PTUB 5D6DA 2CKBB 3D39D 1JNHB 4I77H 5C07E 1IEHA 1NMAH 4CN6A 1A6UH 2X09A 1Q94A 3IKKA 1B0RB 4M7ZC 1R3LA 3C6SB 3O11B 4M8QA 5L88H 3VFVB 2D9QB 4HUMB 1FFQA 4DZBB 1MIEL 3CH1A 2H32H 5IT2L 1LQSR 2BK8A 4XNQB 3U1SL 2V7HB 1R24B 4NO2B 2HH0H 4K8RC 3V6FA 4KI1A 4WFEE 1A7QH 5GJTH 4NO5B 4BZ2H 4X6FB 1IILE 2DQUH 3KNBB 5FYJU 3KPLB 4G9FD 1JZ8A 2E5EA 4UILH 3WS6C 4P9HC 4WFGD 5AAWA 1N4XH 3N9GH 1J0JA 1YC8A 5I8OL 4ZOCA 5C3LD 3RAJL 1T20B 3I2CH 4Z7VF 5ALBH 3UJIH 4RGNE 1KT2A 4PJCB 5TQ0H 4AL8H 4XWGH 4FQ1H 3TA3D 5D1XB 5T33L 4XVUD 3LKOB 4PRDA 1D5IL 4LEOA 4X4XB 4YFLI 1N3NB 2C7UA 1EPFA 4U6YA 2J8UA 3CGTA 1A5FL 3OKMA 1CFQB 2I07B 1I1AB 5T1MB 1X5AA 2CMRH 5HDQH 4G8GB 3QUYC 4GH7B 4MB4A 3ELAT 4K3EL 5AD0B 1ERNA 1F4XH 3GMQB 1J1OH 3TZVC 4WGVB 1DQJA 3WFHB 3CFCL 3EOTH 3U9UB 1OTUC 5IBUG 4GS7B 4JFQB 4XP5L 3VXRA 1U3ZA 4GKNB 4MXWH 1ZHLA 1MWAA 5C0GB 3BQUD 5CEXB 4JZJA 1M1SA 3BMWA 4AY0A 1OLZA 2HJFB 3UO1L 3A67L 1T04B 3ZKSD 3L5IA 7FABL 3GMMB 3IGAA 2NZ9D 1CGTA 4WTZG 2Y6SC 5FA4A 3QCTH 3M17B 3BKML 3GMNB 4LHJB 5CEZE 3GIVB 4YPGA 1M7DB 4HWEH 1PFCA 3FQWA 3VXSD 2C1OB 1T5XB 4QXUH 4YDKH 4UNVA 3HI5L 3KPMB 5IJVB 3QRGL 3QG6A 3NABH 1AQKH 1KB9J 3FKUS 1NCAH 5I8KL 3OKEB 4JJ5A 4ODVH 5GS0C 3RIAK 1G9MC 3VCLA 1X6NA 1GGCH 3FOLA 4JQXC 3IVKA 2VDOL 3QCUH 1IGTB 5C0DA 5E8EB 3P9LB 1I75A 2VLJA 1UWEH 4M61B 2CRMA 4YHPB 2DWDA 5H35B 3KPSE 3BYYA 2RJMA 4GT7A 4Y4FD 3JV6B 1JRHL 2B2XL 5IHUL 4PRID 3F7YA 2GTWB 1K3IA 2V9QA 4X6BB 1N59B 1NBYB 2EDBA 3LHPL 2OZ4A 3VFTB 2Z92A 4UAOB 2J12B 4LAJH 2ZOKA 1G7MA 4LDOB 2CJUL 3CVHA 5CMAA 3MRMA 3W39A 4EDXB 3TT1L 2OTUA 2YUVA 2MKLC 3DYMA 3GMRA 3S3JA 1RJLB 4KJPD 4Z7VB 3MC0A 1ND0A 3FT2B 2JK5B 2R2BA 5TE7H 4E0RA 1EUUA 2H2PD 5I1EL 1OM3L 4KQ4H 1I85A 1X4YA 3RWEB 1Z0NA 2E9JA 3LN9A 3BH8B 4ZD3H 2PO6B 1NUDA 3QH3B 4OT1L 3BO8A 3MGAA 1XGRB 4FN0A 1OB1B 4RSVA 1QNZL 4NN7B 5GGSA 2G2RB 3L3KA 4ZSOA 2KQNA 4FFYH 2W9DH 5E1HB 3QPQD 1MHPL 1QLRB 2D7QA 2VLKD 1UZ6F 1DN0B 3MV8E 3HI6L 1IC5H 4BUGA 3D85D 2DI9A 4FFWC 4JVUA 1G7IB 2XNAB 3ULUL 2NQCA 5C0IB 2ICWB 4HK0B 5GZOD 4U1SB 2ED9A 5D4QA 5FYLE 1S7SB 1DDHA 3GI9L 3QXTA 5F6HI 3MLVL 4NN5C 2VLLB 4KC3B 3RY6A 2BVPB 4PJDA 2CUHA 1UENA 5DT1L 4KROB 2F53A 4LSUH 5DJ2B 1ZKAA 2QV2A 4YAQB 4WWKC 3ROOA 5DD1H 2YD3A 5HYQA 3QUXD 3TC9A 2GSIA 1E27A 1NCDH 3EDDA 5F96H 1HQRA 1EFXB 2VQ1A 4X0KB 2VSDA 1G9NC 4P57A 3ULVF 1D5ZA 4J3WA 1IGIL 5FHBL 3SKOA 4KVNL 3KAAA 1JZ3A 5TF1L 4HQQH 2J4WH 5JNYA 2IEPA 1CICC 4FTVA 4I9WE 1HDMA 5IIEB 2WINA 1GZQB 4BQ6A 1I1YA 2Y7QA 3GSRB 4G8EB 1QFWI 3HFMH 1YEHH 5DD5L 1QRNA 2I5YL 3D9AH 4JFYA 3BEVA 3G6DL 1KNOA 2YPLB 2NY1C 5CUSH 2IAND 1I4FB 2ZKHH 3HUJF 4GAYA 2EC8A 2P24B 4PP2A 2X4TB 4PJBE 2V17L 1A14L 3NCBB 3H0TA 4D0CA 1UM5H 5BMFL 4PJ8A 1P69B 5EUOF 5HVHC 1AD0A 1DQTA 2C3WA 4CDGC 1XGPB 3AMKA 5FUCC 2CSPA 3L3HA 5HBBA 3LZFL 4HLZG 4WEUD 3B9KA 3EDKA 4PUBL 2ID5A 4L8SB 2NY4D 2HLFD 5C0BD 2ATPB 4LCUB 5HHOB 3C5ZA 1A9BA 4XRCB 1CFBA 1SY6L 3CLFL 1U93A 2ZJSL 4HBCH 4OAWB 4FNLL 3RU8L 3PGFL 5DQDH 1V8HA 1UM6H 1JZ5A 2N56A 1CE6A 4Y5XA 2L7JA 2CKBL 4G8IB 1M05A 4ETQA 3OKLB 5ISZB 2OTPA 5D72H 5JOFA 5JR1L 2FYYA 2AK4B 3MYJA 4J12A 4P3WA 1C08B 1HINL 5J6GA 2G5RA 4IRSB 3BAEH 2O5YL 1JI2A 2ADFL 4TQEH 5LWYL 1F90H 1BQLH 4Y2DC 3SGDI 2E27L 1HHGA 3MRCA 5DHYA 1H15A 2O61B 4FZ8H 1UVQB 1QHOA 1KXQE 5EUKB 5HI3C 4P2QB 5D1ZD 4XXDB 3OG4B 1BD2D 1MNUL 4L8BA 3AS3A 3FFCE 3NN8B 4B50A 5D8JL 5GISL 1H8OA 5IOPA 1CVRA 3BP6A 5KZCB 1MAMH 1S7TA 5J6HB 1JNLL 1WEJH 5FA3A 2P43B 2ZNXA 4R4BA 1WTGT 3OPZL 3ILQC 3QHZH 4LCWD 4I4WB 5TDOA 3ULUC 4TULL 4NQEB 2BOCB 2VABB 1ZS8A 1U8OB 3CXDL 1ORQB 5T3ZH 4W4OA 4O2CA 2VDKH 3BD4A 4M7LT 5IB4A 3NACL 3DXAB 5DRWB 1BFOB 3BZ4A 1FVDB 1GOGA 4LLWA 3OR7A 4P2OD 8CGTA 4LFHG 3SE8L 4QOKE 4MA8L 2WUBL 1B6UA 3HUJB 4S1QH 3SDCD 1KULA 3GSUB 43C9A 3VD4A 4LGRB 2P7TB 2GTZA 5IK3B 4MAYA 2X70B 1GCFA 5E00A 4L4VB 4CJ0A 1DANU 3B6SA 5DJCA 2B4CL 2D03L 5FFLA 4NOFA 3D69B 2N1KA 5JDSA 2R2HA 4MD4A 4PJEE 4L3EB 3WUWA 1YECL 1I9RH 3Q5TA 4KMLB 3VGHA 4DK3A 2I9LB 1T2QH 1H8NA 4XBPB 4X98A 4HZLB 4X99A 5HPMA 3IFNL 1QEWB 2X4UA 2C26A 3H3KA 3MQIA 4WHCA 5HGBB 5SWZD 3HRZA 4C83B 2PW1A 1CD0A 4N0FA 1A22B 3OKKA 1XGUB 4NQDE 1ZHKA 1JPFA 3VXMB 2WBJC 5HHVH 3K80A 4GKOA 5CZVL 2VL4A 2ZZUT 4OLWL 3X12B 1PDKA 4PV9A 2ZUQB 4ZUSA 5BRZB 1NGQL 4IBLT 3PHOA 4PJ5A 3RWCA 3H8NA 4JPKH 3B9DA 3O8XC 3TT3H 3RGHA 1FL3B 4LIQH 3O45A 4R90L 5FKAB 3V4VL 5F88A 5D93C 3B8YA 2K7PA 3CZFB 3CDGB 1J8HE 3TBTA 5INDB 1A3LL 1S7WA 3H2WA 1RIHH 3IU4L 4NHUB 5CBEB 1KIPA 4LLVB 1J18A 1WWAX 3MACH 4BK5A 4KAQL 3NIDF 2R0LH 3GSQA 1IC4L 4M6MH 5KSAD 4NC1C 3NVQA 1BX2A 2C4FU 4R7DB 1OD7A 1OAKL 1KCSH 1PKQE 4MJIA 2WUCH 3MV9A 4FZEH 1OARL 4U6HA 1KB5L 1NKRA 2LU3A 3ZYZA 1CT8B 2PNDA 4C54A 2JCCB 4PLKD 4RAUB 1FZJB 4ZUVA 2GITB 4ZUUA 5FUZH 5K93A 1T7XA 4HIIA 1G7HB 4OCWH 3U0TA 4BZ1L 4Y5VC 2KH2B 1X5GA 5CSBA 1IGCH 4IM8A 1ZLVH 1RZJH 1ZWIB 5E9DE 3F8UB 1P84J 2BOBA 4HCRA 4N90D 4PRHE 1ZLVK 1ZA3A 3K74B 2XWJA 3IF1A 3PIQB 3TGXA 4NBZB 4JZOA 4WO4B 1CLZH 1NLBL 2X6MA 3BPOC 4OZHF 1QLFA 5I0ZA 3LRGA 4G7YL 4JGUA 5D7JB 3FN0H 3K8LA 5F70A 4Z0XB 2FZ3A 4APQB 4EJ1C 2LFGA 3M45A 3LH2H 4O00A 3NCJH 3STZA 3OJVC 4OV5A 1RK0A 4M1DH 3SDXA 1S7VB 2JB5L 1OAYH 1NJ9A 4JO1L 3FB8B 5I15L 1WFOA 2ERJB 4MA3B 5I1HL 3U36B 3NCFB 5B38A 1VACA 5D1XC 2NY5H 5KVEH 3X13B 1CGUA 3PABA 1MUJB 4HWNA 3BP7B 1IARB 4PJAF 2G5BA 3MLZL 1Z9OA 3I6KB 3HI1A 5A16B 4JREB 2PW2B 4Y4HB 1I1AC 3EOAA 5KS9A 2A6DA 4QHNA 3TVMB 2XXCB 1S8DA 2H8PB 4TNWK 1FYTB 2RQ8A 2XG4A 5C09B 1LE9A 3TBVA 3B3IB 3PWPB 5KSBF 4R7NB 3U30B 4LQFL 1U92B 2P5EE 2E7MA 3GIZL 5CKAA 2QQKL 3PGDA 1KJMA 4YFDB 1CCZA 5DRXB 2OM5A 3LKRA 4F2MA 4K7PY 2E7LA 5IMMB 35C8H 2DBLH 2LV4A 4N1EA 2KBGA 3BXNB 3AM8A 2MCPH 3CSGA 4HUUA 4R3SB 5ILTH 5C08E 2WZPD 4LPCA 1P4IL 3I9GL 1BJMA 3O6MH 3FFDB 3CNKA 4RMTA 1C7SA 5E70A 1DSFH 4UV7H 1X5ZA 4LSPH 5MENA 2OYPA 5ESAA 1PX4A 4YQXH 3GMOA 2VZ3A 2P5WD 5JXAH 3F5WA 1KJVB 3TNNA 4JY5H 1BGXH 1OPGL 4B41A 4QRPB 1BWWA 3DECA 4ZAKD 3BN9D 4Z7QF 1ZGLP 4AENA 4WNQA 5DUBB 1IEBA 4OUOA 3D5OF 3ZE0E 5HI5C 3MGOB 2R29L 2FEEL 5CZXC 3O6FB 1MCPL 2UUDH 1DEEB 3LSOB 4ONHB 3B83A 4PGCA 5T1DL 3S34H 1T2JA 5C9JB 1Q9LA 3ZTJH 3HE7C 1GSMA 4DUXA 3IXAB 5FYKD 5FGBC 2OR8A 3QNXA 4Y5YC 3QZWG 3LIZL 4MAUH 2NPLX 2CIIB 2YZ1A 2CK0L 2AXJA 4PBXA 5KOMC 2QL1A 2YEZB 3C60A 4OZHB 5DDHA 3LD8B 1KN2L 2HTLD 3BZFB 2Z31A 1JPTH 3DIFA 1U8MA 1ACYL 3VXRD 3ILPA 2ZUYA 4O02H 1FBIH 3GBNL 1JZ4A 1NCWL 5A2IH 3OKYA 1UA6H 2BVQA 4JN1L 4FS0A 1C16B 3ARFA 1XIWB 5B8CC 2G75A 3W5MA 2QR0A 1MQ8A 5CIPA 1ZE3C 3AAZA 4HEME 2DDQH 4HGMA 4ISVA 4BFEA 4DOHE 3LN5B 2DOCA 4OFYD 2HVKB 1WZ1L 2VLRB 3RTQC 1E4WL 4JFZH 4PJAB 4UBDC 3KYKH 4KKAC 3MJ9H 3LMJH 3G6JA 3N1QC 1N8ZB 1RMFH 1CFTA 1INEH 4YZFF 4NZUL 1X4XA 4MA1C 2EIBA 2Y9RT 3FHAA 5HHXH 5DMYA 1KCVH 1U2HA 2VLJD 3MLRH 1D5BB 5EPMA 3R1GL 5FUCE 4FOMA 3SGKC 3S88H 4NHCL 3ULVL 3FB5A 1OAXH 3ZL4L 4JPWH 3KYMB 4WEBH 1E4XL 4OCSH 4EI6A 3WIHH 1E6OH 1TZIB 4TUJB 3M8OH 2A77H 4JHBA 4KZEL 1FZKA 1BOYA 4NUGL 5DEGB 2YA0A 1DEDA 1RVFH 1P7QB 2D9CA 4JFFA 5IV2A 5EORL 3S5LG 5E56A 2W0KA 1IEAB 5SV4A 4F7PB 4YBHA 4X6CB 4X7FC 3TPUB 5ID0B 1U9KA 1JGDA 3P11H 4PIRF 2BY3A 4CVXA 1UZ8B 1F11A 4ODSH 3WIIH 2X1PA 1IAII 4QXTB 4KJQC 4IMKA 3EYOA 4MXQC 3BGFB 4HMCA 4NKDA 3OR6A 5FYJL 3PWLA 2VIRB 4OTXL 2ZUTA 1NGWB 2RBLA 1R5IA 3NIFE 3QG7L 4CU8A 3MRGA 4YXLL 3LKSB 1XT5A 1PBYA 4YE4H 3WN5A 4ZOBA 4HWZA 2H9GB 1WWCA 4QNPF 3UPCA 4WCYL 1ZA6B 4Z7NF 1N5YH 1EVUA 3LEYL 3NAAH 4PJ7F 3UYRL 1PY4A 4N8VA 2OXHA 4NOBA 3S36H 2P4AB 5C7XL 5FUOH 1QOKA 5IHZB 2YZ8A 3VMOA 5BW7C 3LPGA 4B53A 4X6DF 4NPYA 4ZXBB 4MXVF 5BO1H 5F1NA 4ELKA 1Q9WB 3ULUE 2AAVA 3BPCA 3WKMH 2BCKB 1ITCA 1CR9L 3E0GA 5F3HB 1K2DB 1MQKL 4OZGA 1UB5A 3PQYB 3OF6A 1QPXA 4PD4K 3BO8B 3LPFA 4L8SC 3HPJB 5T5NG 3QUMA 1KC5L 2DQJL 5JQ6L 5I1LA 3H7BA 2AJXL 3BUYA 4KXZI 4AH2A 5LJYH 3SE3C 3E8UL 4S1DC 4M7KH 2AXFB 4DWHA 4YXKL 2NTFA 3IDUA 3MRNA 2EDJA 5ESVB 3W2DH 3LS4H 4HDIA 2WIMA 1UXSB 3MLUH 3QDGA 4UDUB 1XMWA 4G43A 5GHWL 3SKMB 3NCCB 1CGSL 1U3JA 1QD0A 3HZKA 4LLQB 4HT1H 6CGTA 1JPGA 1VEOA 3GSXB 5E2VH 1BQSA 4M5YL 3F7RA 4R6UA 1QPPA 4J8RA 5CCKL 3ZKMC 4LF3A 1MCOH 1UEMA 2FEDC 3G04A 1QRND 3ARGA 4ORZC 4EBQH 3G5ZA 2I9TB 2OL3A 4CNIA 3KPNA 5IGXH 4DEPB 1Z5LA 4KH2A 5DC9B 4TTGA 4K9EL 1NANI 3W5NA 4ELMB 3PL6C 2PYEA 5FCUH 1MSPA 1TQCC 4NNYA 3WXWH 3V79C 2HFFB 1YEJH 5IBLD 1CDGA 3F12B 4FQXC 1HHJA 3WSQH 1MCNA 4M93C 1NH6A 1PYWA 4PJ8D 2IFFL 4LKCA 4LLMB 3SQOL 2XV6B 3FT3A 3X17A 5E8DH 4GBXB 5FYKH 3B9KD 2F15A 2VXSH 3WFBH 5LQBH 3KPSD 3EZJB 3EO1B 3VDCA 1KJ3H 4ZTPL 3C5JB 5D7IF 5C9KA 1KCKA 5EU6E 3C5ZD 1M6OB 4FTVB 5E24E 4GXVH 5JUEL 5AG8A 3K1DA 2AS5M 4J1UB 2KPNA 4OIIL 4S1RL 3RDTA 3TYFB 4NC1E 4A6YH 3KLHC 2P8MA 3STBA 1MWAH 5K9JL 4LSRH 1E0OB 4OLZL 3QFJB 4NZRL 5TF0A 1FORH 5GSRB 5F9AC 1IFHH 3JV4A 3L7FA 2G9HB 5SWSB 2H26A 1DBJH 3RIAF 5EC1A 1KLGB 1C5CH 2P47B 2YSSB 5J0BA 4G42A 5BVPH 3WJLA 5L2KB 3JWDH 5D71L 4MZ2A 4WUUB 1AD0B 1QLEH 2W0FA 4U1GC 2BY2A 3ARWA 2MSPA 1MCFA 4ZFGH 4TUOB 4D0BB 1YEEL 5TQ2L 4LSQH 1BLNB 1NEZG 5EC2B 4LDLB 3T3MF 15C8H 2UWEA 5JORB 1SEQH 1X7QB 2DQTH 5EWIH 1VCAA 3CDFA 2Z91A 3RGVB 5IJKA 3MV8D 3D0VB 1E6JL 4YO0B 1VESA 1J1PL 1RFDL 4LGSB 3EO9H 2DB8A 5CGYC 1T21B 2ZUQC 1J5OL 2AV7B 2FWOB 2JIXD 1NBQA 2OZ4H 4RFOL 1B4JH 5GGVH 3SE9L 2ZSVA 5FYLD 4QT5A 2XKUA 4PBWD 3CVHH 3SJVB 5F7UA 3BJLA 4RISH 3IXTB 5JXEC 5LGHL 4KZDL 2FB4L 3EYSL 4DUWA 2KZWA 4Q0XH 3ZLQC 2R1YB 4JHZA 1GGUA 5GPRA 1IE5A 5F9DC 5DJ8B 1BIHA 4L8BB 3H9ZA 5A43C 4YHIA 4IRJB 3V5DB 4CGTA 1M7IB 2YD8A 3U9PL 2CRZA 1INQB 4RIRB 3T8XA 2HRLA 1ZT7A 2DQIL 4ERSL 4UT6L 1KJ2A 3THMH 3MRLA 1BREA 3GSWA 3UZEA 1U8IB 2K3TA 5C86A 2BVOB 2CR6A 4LSSL 1JV5A 3P0VL 4WI5A 5EG6C 3DRQB 3QEUB 5DMKB 2DTML 3MREA 3MTRA 1EJ6A 2FATL 1G6RB 1I7TB 2Q76A 1FN4B 3VRIA 1I7UA 2IPTL 5EIIA 1D6EA 1WICA 1Y18B 5INCB 4EOWL 3V8OA 1QSEB 4JY4A 4K3JL 5D7JC 2CGRL 2LQRA 4K9EC 4PJ5D 2GCYB 3D3VE 4S2SA 2QBWA 1HHIA 2VXUL 4OFIA 3RVWD 3BKJL 4PG9A 3AU1B 5HTSA 4Z8FH 1HKLL 4H26A 1X5JA 4F7CA 3K4ZA 2ESVA 2IAMA 1MFDL 1LO4L 4OCRL 4KRPC 3PHQA 2F9BT 4UU9A 1DL7L 4X98B 4A2MA 2XKNB 5K9OB 5JW4Q 2DKMA 1AD9B 3W9DA 4MJID 3MV9D 5IW6B 2HJKA 3LKNB 3RBSA 1FV1B 3D0LA 3H42L 4N0UA 1GC1H 3VFGL 4BH7A 4PBVC 4R2GC 4CU6A 5ETUB 4ZUSB 2Y36L 3UYOD 4JQIH 3BDYL 3VXNB 2VXQH 1F42A 3SKJL 2FR4B 5KSUA 3VW3H 1R5WB 1LMKA 2WNGA 5DUMH 3SE4A 4MA7L 3FB6A 3GMPB 1WV7T 4N0YL 4LAQH 2PUQT 5J13C 5L7XH 1JFQL 1NPUA 2F74A 4AK1A 3ZKND 5DJXA 1HCVA 4BQCA 4E5XB 3IDXH 4XPBL 1X6LA 3P4NB 1UB6B 3U4AA 2XACC 2X9XA 3J8F7 2R4SL 3QR2A 5IVNA 1J86A 1OGTB 2UV3A 3P0YL 4PG2C 4M7LL 1DQLL 5JMRA 4RDQG 1A8JH 1T1YB 4M9PA 5IVXF 4Q9QL 3G08A 3CFDB 3DVNB 5E2TH 1F45A 2VN7A 1HHKA 4OF7A 2YMXL 4XPGH 3HZVB 1S9KC 4I5BA 4OZFG 3S6CA 4JRXB 3T2NH 5IKCA 4XVTH 1HH6B 4U1KB 1FJ1A 1WBZA 1FFPB 5DVLA 4Y4KC 5A1AA 4KMTL 3KS0H 4H88L 4JVWA 3Q1SH 3KYOB 2XWJB 1S5IH 4J6RL 2I27N 1AGDB 4FQ2L 4Z7UB 3QUKA 4JDVA 3SDAC 5L8JB 1YA5A 4UQ3B 1CFNA 3TN0C 3TWCH 1WZKA 1W72H 1NL0H 5IWLA 2ARJA 3MCKB 3WDIA 1C8PA 2XZAH 3T0DA 2FLRT 2VE6B 1IGYB 4Z7WF 1A1OB 2QHLA 2FLBT 4HFUL 4PP1D 2X10A 3T0EA 4NKOB 1R3JB 5K9KA 3W82A 4LSVL 3CFBA 2VL5B 1QFHA 4OGAD 1NUNB 1SYVA 1DFBH 2D0HA 4YDLB 1MJ7L 5MEND 3V4UH 1TCRA 4OFVA 2QADB 2Y1VA 32C2A 1KG0A 1Z3GL 4NQVA 1WK0A 1S8DB 1OTSD 3TF7C 5FYLH 1S3KL 1MRCH 5KTEH 5AYUH 5DGRA 3V4PH 5CJ8A 3MBEA 4RFNB 3VXQB 2UYLA 3N50A 3D3VA 4P48A 3DO3A 1K6QL 4I18C 2L0DA 5J9PA 4YHZL 4HKJA 3FO0L 5KANG 5KN5B 1J8HD 3EFDH 1NFDA 1W8OA 3FT4A 4OZIF 1IC7H 1L4IA 3C60D 4QWWC 3LPWA 1JYNA 1R3IL 2EO9A 1MFCH 2HKFL 2BSRA 3JTTB 2R4RL 2Z31D 4MCYB 5GIRB 4DAGH 5EZIH 4F58H 3L3GA 1HEZB 4W81A 1R0AL 1MIMH 1T6WA 2VKXA 1NGYA 5IM7B 2NLJB 1QHPA 2IH3B 4ALAL 3ARFD 3PNWB 5IVXB 5L8LB 2X4NB 5I18L 1G1CA 4Y19E 3DYPA 4I77L 2W65A 1A6UL 3OSKA 3TM6A 1IKFH 2PXYC 3EYUH 1WFUA 3P4MA 5CEYA 5L88L 3EJZD 5K9QG 5DJZB 3PWJA 4J4PC 4K23H 4HKXB 2HH0L 5DQ9A 2BMKB 3QDJE 2DQUL 2YPKA 2X7LA 4HH9B 2BSSB 4U1NA 5L6YH 4KFZC 1X5IA 4HJJL 4XP6H 5E2UH 5J4MA 1N4XL 3N9GL 4JHWL 3SDDC 3Q0HA 3HNSH 3S37H 3BX7C 4KDTC 4JFFD 3UJIL 5EBLB 2AJZA 3SKNB 4MMZC 1S9VB 5TQ0L 1QFWH 4XWGL 4FQ1L 4AL8L 3LQAH 5JLZB 5EZLB 2YBRA 3E2HB 4TVPE 5CLWA 5IW1A 5DD3H 4QYOA 3U4EA 1MRFL 5I16A 2ARJQ 4JR9L 4I2XE 3BKCH 3BW9B 2CMRL 3RVUD 4I0PB 2ZG2A 4KK5D 1D9KA 3R06B 1MHHB 1XF4B 3B5TA 3UAJC 5EUOE 1J1OL 4K94C 2C1PB 1XAUA 3O4LE 3EOTL 4LOUC 4X7DC 4YHNA 4YEFA 3IS0X 2UVFA 1XF2A 1G0XA 4QO1A 4HJ0D 4IMLB 3WLBA 4MXWL 5H94A 2O93L 1I8IA 3IETB 2PYFA 1GXEA 1CS6A 1ETZB 1U8JA 3QCTL 2GUOB 1RIUL 2A38A 4RMWA 2Q87A 4TNWF 5BZDA 4DEPC 4QXUL 4HIEA 5DRZB 4JG0L 4NRYA 3N1PC 1RSFA 4YDKL 3KYNB 1FL6A 3NABL 1JGVH 3RHWK 1A7NH 2HRPL 3NFPB 5IQ7H 2F5BH 5FGSA 1NCAL 3QAZB 4ODVL 2AEQH 4HX1A 2EIZB 4YGVA 1ZV5A 3L95A 1YC7A 1GGCL 5DJ6A 2CDEA 3WNPA 1WTLA 5L2JB 1A1MA 2FJHA 3QCUL 4XPAL 4BH8B 3MRRB 4GKZA 1UWEL 4JVPA 1F6LL 3M1BA 1U8LA 2X9WA 4MWFA 4R0LB 4DN3H 5IMKB 3LRSB 1JHLH 3ORJA 3VGEA 4WU7B 1ZGLB 1OD9A 1G7QB 2D7PA 4N0CC 2WANA 1O5DT 1JYWA 4EN3B 2BNQB 4BSWB 3H9HA 3QDGD 4Q6IB 3DMMA 4UOJA 3ZT5A 4YX2H 4WW2A 5TE6H 4X4ME 4JE4B 4HUVA 4KPHH 3VFMA 2DLFL 3I6GB 3TEUA 5TE7L 3RVVD 1F13A 3ARGD 1UB5B 2CO6B 4QRRA 2EDTA 3OKOA 4BUHA 4HC1H 4MJ6B 1L9MA 5C3TA 1XCQA 5E99H 2V7NB 5I8EA 1EEZA 3BE1H 2DM2A 3NZHL 2CLVA 5I1LB 2IANB 1FZMA 1YMMB 1F58H 3IFPA 4K7FB 4U6XB 3UTZA 1MCIA 5JOPE 3KS0J 3TO2B 5L0QC 4X9HA 2R1XB 1IMHC 2NX5B 5E8OA 4FFYL 4YWGH 1T1XB 4FQIL 1K3ZA 1NBZA 5AZEH 2OP4L 4CADA 4OQTA 2BNRE 3TIEA 2PCPB 1FDLH 2DIJA 1IGJB 3HS0B 3IJHA 4NGHL 5FECA 1VFAA 4GW5B 3NIGF 4NNPH 1RZ8A 4LU5H 4EDWL 4GRWB 2NY4B 4QGTA 5C0BB 3RDTD 2OI9B 1OAUH 5K59F 3AY4A 4GRLB 4ZQKB 3G04B 2G60H 4FQJH 3T3PE 3SCMC 3BGMA 4F9PA 3TO4A 4X9BA 5DJDA 1EVTC 2ZCLL 4LSUL 3VI4E 3BWAB 3VGFA 3H3PH 5CIPH 1HYSC 5IB3B 2PYEB 5EULV 3ROLB 3MA9H 5JIIA 1BQHB 5DD1L 1HNGA 4N5EC 1A64A 3VWJB 2A73B 4QRTB 2APWA 3MCLH 2EDWA 1NCDL 2FECL 5F96L 3MNWA 3IJYA 3QIUA 3I75B 2A83B 2GJ6E 5SX4I 3FTGA 4L9DA 4PJFE 3WFZA 5F97E 5D7LE 3L3DA 2GAZB 2J4WL 2AXGB 2AQ2A 3HE6C 1VGKA 1EH9A 1UACH 2ADGB 1MVUB 3MUHL 1QSFA 3HFML 5F9OH 1YEHL 3MUGB 5ICXB 1D3CA 3BH9A 1NAMB 3D9AL 3N06B 1TNNA 2NY6B 1BVKA 3QJHA 4FFVD 2ZKHL 3F7QA 2X4RA 3O2VH 4JFHE 1YDPB 2VWEC 3Q2CA 1KPRA 4YHOH 1ZTXH 4XAKE 3NPZB 4LCWB 5ALCH 1CL7I 1UM5L 4W70A 4D3CH 2RR3A 4ZFZA 4P2RE 1EGJH 3IDIB 3U0WH 1I8LA 4F7MA 5F6HJ 3GSVA 1Y6KR 3AREB 3MJGX 5D2NC 3VI3F 4DGYH 3QQ4B 4U0RB 4RGMB 4X7TA 3VG0L 3GSNA 1B2WH 4PPTA 2X1QA 4N9GB 4ZS6D 2V5MA 2HMID 1N5AB 3MRFA 2VYRE 5MERB 2UVEA 3BHBA 2WAHA 4XMKH 3UTSB 3CDCA 3O0RH 4JFEB 4JFXA 5I73B 4WTXA 3B2VH 1U3YA 5DSCB 1OGAE 4KGLA 4LVHB 1N6QH 3KPPB 5D2LE 4W6XB 1EBPA 1GGBH 3DX8A 3MOQA 1CXEA 1KACB 3BP4A 3CFJB 5C0EB 4UUJB 5ENWB 2BC4A 5IVOA 3O2WH 1ED3B 1EDQA 3IDYC 4JLRB 4YC2C 4ZO6A 2WMPA 4LHUB 5D1QC 1QO3B 1U36A 2E3VA 3FONA 4N8PA 4TQEL 4PR5B 5KOVC 1VEPA 3V6OA 3G6AA 4PTTB 1OW0C 4FZ8L 3CCHB 4HS6A 5EU4A 2DYPB 4PS4L 5C0AB 3OXSB 4P5TA 2EYRB 1MAML 3QUMH 2FL5A 1FNSL 3BMVA 3KXFE 4HS3A 1WIUA 2ESVD 2IAMD 1FFOA 1MELA 3WLWD 5D5MF 1OVZA 1U3HB 3MXVH 4U1LA 5EOCH 5F1KC 4BYHA 4AIZA 3OHXA 1MHCB 2OQJA 2HT3D 3L9RB 3QHZL 1UM4H 1P4BL 1HILB 3E6HA 3QIBA 3C9NB 1T66D 5F1SA 2IG2H 5T3ZL 1T4KA 5F9JA 5C8JA 4XNXH 4LLDB 4YDJA 5KBNC 4U1IB 1CQKA 4WI2A 4XB7A 5HGDB 3GKZA 3MV7B 3T1FA 1A6VH 4U33A 4KV5E 5JIKA 5EBWA 9CGTA 4Z7QE 4U4BA 4S1QL 5HHPB 1G6VK 1YEDA 3D25B 3VFRB 5DI8A 3SDYL 3BZEA 1TQBC 2OL3H 2BRRH 4WUKH 1MCEA 5BOPA 5E6IA 4TVSa 3B9EA 2UZIL 4H1LB 4FXKB 1XCTA 1A3RH 4KK8D 1AHWB 1H0DA 3FHQA 3NFNA 2VAAB 3SOBH 2X40A 1I9RL 4WV1A 2FO4B 2YPVH 2W60A 3W11D 1TJIL 3HG1B 2ED7A 3GJFH 4P5KB 1IAOB 3OJDA 3V95A 5DWUH 1WC7A 5T1KB 4IOSD 4DVBB 3C8DA 1T1WB 4G7VH 3GJFK 1WBYB 3MA7A 1NGZB 3KPOB 4O58L 2PR4H 3Q5OA 4ZOEA 3NGBB 4ZFOL 4HGKC 3UTQB 2A74B 2NW2B 5MP6H 4YHLH 3TA3C 3MX0A 4P23D 3FL7A 4JPKL 5CJXC 1A7PL 4XVUC 3TT3L 1XH3A 4IOIB 5BJTA 4LIQL 3WS6A 1QFOA 1ZHNB 2ZCHH 2B1AH 5L9DL 1MLBA 1RIHL 2IH1A 2MJWA 5HDLA 2E9BA 1AO7B 4NC0B 3WJJA 1CGYA 3MACL 5GS1C 3LRHA 3KLAB 4Z7OE 2R0LL 3BIBX 3A6CH 1A1NA 4M6ML 3VXPB 1JF1A 2CH8A 4H8WL 3FOMA 1YZZA 3QEHB 4LASH 1KCSL 2WUCL 3R4DA 5MHSE 1HH9A 3MMEA 5I66A 3T0ED 4ZYKA 5D5MB 5D96B 2X4PA 1OQOA 4G80A 4F7TA 5D2LA 2R39A 1FVEA 5FUZL 3B2UD 43CAA 1TPXC 2C9AA 4OCWL 1PD6A 2NZ9C 4GW1B 3S5LA 1U8KA 5HGHB 3H9SE 3QO0B 4XH2B 1RZJL 1KCRL 1IAIH 3L3JA 3QEQA 5DVNA 2VN4A 3QFDB 3H9YA 3LB6C 3MOBL 4N68A 4YUEL 4NN6B 3I3DA 5FIEA 5TFSH 2DWEA 3SBWC 3MBED 4ZPVA 2NY3D 2VNCA 4UNUA 4YNYA 5DHVH 4ZAKB 1JRHI 2R23B 1Q9KA 2EEDA 3CPLA 3D3VD 3P77A 3FN0L 2WP3O 1PG7H 1FGVH 5C71A 4IDJH 4LCYA 8FABB 2ADJA 3LH2L 5JHDE 3IFOB 4JKKA 1TFHA 4M1DL 5TPWL 3QHTC 1OAYL 4PB0H 4WI7A 1MI5A 1QVOA 1AXSB 4QEGA 4Y4FC 5C0ND 3WEXA 4MZ3A 4WEMB 1HZHH 3W0WA 4V1DE 1P9MA 1D7FA 2DLEA 3U46A 4NCC1 1X5FA 4Z7NE 4IRZH 2XXMB 2NY5L 1KJ2H 1CLOH 5FB8B 3MFGB 4WHYG 3E2HC 2XFXA 1F4HA 3QB7C 4F8QA 4PJ7E 2VXTH 1DQDH 3AVEA 4TUKL 2FGZA 1KEMH 3C08H 4JQXA 1GL4B 3MROB 4TTDD 4A6YB 2P8PA 1TVDA 1MLCB 4TSAL 4U7MA 3PWNA 4N1CA 1NAKH 4X6DE 4KJPC 5DURD 2BP3A 5EO0A 1NDMA 5GRWA 1TETH 2FBJH 4PJDF 2H2PC 1YMHA 4ODXB 1U8PA 2D4DA 5LKNA 1MOEA 1Q1JL 4CBPA 1Q9OB 1YPZB 3ZHDA 5TDPB 4NSKB 35C8L 2DBLL 2FGWH 4KXZH 3CMOH 5KJRH 3MJ8B 1XF5B 4KVCH 5ILTL 2XTJB 1BIIA 3FQRA 4I3GA 4CDHA 2W07A 2VUOA 3O6ML 1NAML 1DSFL 1UYWL 4LSPL 3QDMB 5H2BA 1WT5A 4X4YA 1JTTA 1V7MH 3BZDA 3OGCB 4KRNA 5IQ9A 2Z93B 4AIOA 2IADB 3QAZC 3C6LB 3WDJA 4HUXB 2ITDA 1HI6A 4JFPA 5C2UB 3FO2B 5B3JE 1BBJA 1LEKB 3STLA 5IB1B 3QXDB 1FHGA 2GHWB 3HPLB 5FF6B 1QR1A 3GGWB 3S34L 1UJTA 1IKNA 4R0LC 1MH5B 2CLZA 1LO2H 1NANH 1K4CB 3GBMH 1YN6A 1KIRA 4AEEA 1IAKA 1KLUB 3V0VA 4MAUL 1IQDA 3MLSL 4ONGH 3QIWA 2YPKB 3BN3B 3RUGA 3VXUE 5ANMB 3RZCA 5C07B 4NM4L 5KVFH 5IR1A 1JPTL 2IALB 3P73B 2JJWA 5DK0A 4ODUA 3P9WB 1FBIL 4YDVB 4M3KB 1NCNA 2DMKA 4PV8A 3EDEA 3FCTA 3LKPB 4OLVH 1UA6L 3UBXI 5D7IE 1Z9MA 3EW3B 4HUWA 3CH8A 5E8PB 4D9QE 2DDQL 3QYCA 2F54A 1PW3A 1LK3L 4P4RA 3T4AA 3E1F1 5JO5B 5EOCJ 1LE5A 1RZJC 1F3RB 5D6CB 3KYKL 4BKLB 2Y5TA 1D5XA 3MJ9L 4NKIL 3LMJL 1T1ZA 3RWDA 1VPOH 3HR5B 3X3FH 3VJ6B 1DQML 1RMFL 4AMKL 4GG6B 1NQBA 4PRPE 5FO8A 4MNQA 1SBBA 4RGNB 4UT9H 5HHXL 1CICA 5E4EC 3TV3H 3MFFA 1KCVL 4QHLB 3MLRL 3NFSL 3ISWA 3S88L 1PAMA 1OAXL 4P2CG 4JPWL 1A2YA 4P5MB 4WEBL 4EQ3A 5D2NE 4XP9H 5GRVK 4GFTB 4OCSL 1BAFH 3WIHL 1E6OL 4HXBH 3M8OL 2A77L 2NY4C 2HLFC 1T7ZA 1N64L 1I7RB 2MFNA 4LPXA 1HYRC 2OI9C 2XPGA 4V1DA 1C5DB 3IJSB 5I6XC 1NEZA 3VFWB 4OFKA 4UQ2A 2A6IA 2GJZA 3W9EB 2P8LB 3FRPG 1ZVYA 4QRQA 5CP7B 3QI9A 4C4KO 2NY5C 5BZDB 1AKJA 4N9OB 2F5AH 4HIEB 3WIIL 3K46A 4ODSL 3QPXL 1RZGB 5IHBA 3CFEA 5FHAH 3FQUB 5CGTA 1CLYL 1AGBA 4PGDB 2P42B 4PRBA 3F62A 4YGVB 5L8KB 4P4KA 1HSBA 1NFIB 1J0IA 4JFDA 4OD1H 4X6EB 2HJLB 4QHMB 3RWIA 1FC1A 3KJ4C 1JK8A 1U8LB 2EYSB 5F3BB 4DK6A 4LPUA 4PJXE 1FE8H 4YE4L 3OB8A 1IGMH 5D1ZC 4LFHD 4G6JL 1B0GB 3LQZA 4KDVA 4I8DA 1LP9B 3QDJD 1GHFL 3VFUB 1N5YL 5HPOA 2QKIA 3NAAL 4EKXA 1HWGB 4NQSB 1JCKA 4E41E 2FIRT 4X5WA 3ARDB 1M71B 5KVMC 4LVNC 1RHFA 3S36L 4OQ1A 5FUOL 3KPSB 1CE1H 5T3XD 5KANI 5JW4R 4CJ1A 1TVBA 3VXOB 2EYTB 4Y1AA 2FHBA 2AKRA 3T4YA 3DX7A 3WKML 4ZFFB 4UINH 4EVNA 4K7PH 3MRQA 1CK0H 1FYHB 2P49B 3OKOB 5DJ0B 2WIIB 2CD0A 1JUFB 2MMXA 3WS3A 3TO4D 1XCQB 4NDMB 4FMFA 1V7NH 4P2OC 2NY7H 5CD3B 4RGMC 4O5LH 2LVEA 2W9EL 4RA0C 3RPIA 3PV6B 4XMPH 3N1GC 3GBLA 4PJCE 3U7WH 1ZHBB 1LILA 2A0LD 1Q72H 3QIUD 2E7CA 2NTSP 3O4LD 2HN7A 1W72B 2RCSL 3DV6A 3IJHB 3W2DL 3LS4L 2VQTA 3ZDZF 1QBLL 1XF1A 1IM3B 5IUSA 1N2RA 4G8GE 4HT1L 5E2VL 3L6FB 3PG2A 3U48A 2Q1EA 4MHHI 5EIQA 3QEGH 4G9FE 5BS0A 3GM0A 5MEQB 4EBQL 3G5YA 5EZOL 3RI5K 5DVOA 3MV8B 1AGFB 2BERA 5HJ3B 5IGXL 4IOFD 1B90A 2ZOLA 3C2SA 3OG6B 2Q86A 3QXAA 1S5HA 3UTPD 1HQ4B 2AEWA 1MCWW 5FCUL 4PRPA 5C6TH 3WSQL 4U1HB 3WE6A 5E5MB 1F3DH 4AZ8A 2MQ3A 3TLRA 1KPUA 4PY7B 1L6XA 5E8DL 5I1IL 5FYKL 5JW5A 4L4TB 5ITFA 3U4BH 4ZO9A 2VXSL 3BDBA 5LQBL 4S0SD 5GJSH 1WGOA 3IAPA 3MUZ1 4DTGL 3DVFA 5DR5H 1KJ3L 2DQDL 4JKPH 3UBXA 4GXVL 3RL2B 4LVOB 5KW9L 1OWWA 1S9XB 4UIMA 2NXZB 5KSAC 1BQUA 2WWMD 4ZDHA 4A6YL 3SDXF 3QUZA 4LEXH 1AXIB 3WFEL 2H6PB 5AWNH 4LSRL 2CDGA 1ZT1B 4HLZH 3SHSA 3RHWF 3CSYB 4NFDA 1AGCB 4MQ7A 1IFHL 5JW3H 1GRWA 2X4RB 4PLKC 3CMGA 1DBJL 1YNTA 3T0WA 3LEXA 4LCCC 1C5CL 3ULSA 5BVPL 3MLPA 3JTSB 3JWDL 4JFOB 1I3GL 3S35X 5EU3B 2R2CA 1QLEL 4Q9RL 4KJYB 4OZFA 1DQQA 5GS2D 1WQVT 1EXUA 1MHEA 3VXSE 1NGXB 5IROC 4C4KT 1T83A 1AH1A 4GUPB 2ICWI 4PJXA 4S1SH 1S7XA 15C8L 1TJGH 4WHTB 1REIA 1SEQL 3KPRA 2DQTL 5EWIL 3O6LH 4PTUA 1U58B 4P5TD 2CKBA 1JNHA 1EHNA 4PJBB 4ENEC 1ZANH 1X4ZA 1ZGLM 2OSLA 1HHHB 4CKVX 1OSZB 4LVEA 1B0RA 4FQHB 5ABDE 3C6SA 3O11A 4ZPTB 3VFVA 3O9WB 4UB0H 3WUWG 1NC2A 4DZBA 4FFZH 5C0FB 4Z7WE 4XNQA 4U0QB 1CGVA 3RVXD 1R24A 4NO2A 4PRIE 4L8CB 3UROR 1B4JL 4Y16B 5GGVL 3QIBD 3DTXB 4NO5A 3MLXL 3CVHL 7CGTA 5HYSB 2GFBB 3KNBA 4RISL 3KPLA 1KBGH 4GXUM 3KWWB 4P99A 1JPSH 4NQCE 3T65B 2QQNH 2ADIB 4C56B 5IBTH 3OX8B 1T20A 5D6DC 4BM7A 2PF6A 4PJCA 3SO3B 5LBSL 5HYIA 4D8PB 4I0KA 4L1DA 4GAFB 5D1XA 2CLRB 2UZXB 1TZHB 3LKOA 1FQ9C 4X4XA 1N3NA 2HFEB 4JKLA 5D96C 3DX6B 1CFQA 2I07A 4MD0B 4OZIE 1I1AA 5T1MA 4EXKA 1A9EB 4OQTH 2VISB 5DK2A 1KTDB 3FFCB 4K2UH 1BF8A 3I6LD 5AD0A 3CXHK 3DUSB 3CIQA 2VLKE 3GMQA 4IIQB 4PJGE 3HR6A 3AGVA 1RAMA 2FEEI 3WFHA 4X5LA 5T3XH 1D6VH 4QF1B 3U9UA 4NN6C 4JFQA 4CRPA 3KPQB 1NCBH 4ZUWB 3DBXB 4GKNA 5C0GA 1FCGA 1TXKA 1DVFB 4UDTB 2J2ZA 4XTRD 5CEXA 4ZAKC 5DJAB 3BN9C 5MI0B 2HJFA 4M6NH 1T04A 2B1HH 2W92A 3GMMA 2HP4A 2DF3A 5E6IB 4P2RD 3M17A 3GMNA 4Z8FL 3BRFA 2HVJB 3EYVB 3GIVA 3BGAA 1M7DA 3G6JF 4KI5D 2C1OA 1T5XA 5FO7B 4LIQE 3GSOB 5EB9A 2A6KB 2XRAL 3KPMA 1PG7X 5IJVA 2VJXA 2AERT 4ONFL 4QOKB 4JHAH 4X8JB 3OKEA 1A7OH 2NY0D 4XCYB 1DLHB 1T2XA 2Y07H 3LVEA 2HTLC 3QO1B 5J1AB 1U91B 1PVHA 1IGTA 5E8EA 3P9LA 4M61A 4PJIB 1S9WB 4JZJC 4YHPA 5H35A 3WMSA 4DW2H 3JV6A 1JMZA 4JQIL 4PJEB 2VXQL 1DZBA 4RRPG 2GTWA 4DJMA 5CEZL 5GGRB 5ICZB 4X6BA 1N59A 3HC0B 5DUML 5CP3A 1NBYA 4X7SH 1VFMA 3JWDC 3VFTA 4KHXH 4LAQL 2NNAB 5DS8B 3L5WB 1NUFA 4NQDB 4EDXA 3BEWB 2VSCA 4HIXH 1E4XI 2LU4A 2V2TB 5I76B 3U7YH 4Z7VA 1FO0B 3FT2A 4OKVA 3RNKB 2DTSA 1ADQA 2JK5A 2PETA 5BZWB 4JB9L 5C0JB 2Z8WC 4FQQB 1MI5D 3GSNH 5CAYB 3RWEA 5JZ7D 3W0WD 3BH8A 3C6LC 2M2DA 3CLEL 2PO6A 1VFUA 3QH3A 4XCEB 5E2TL 5CD5D 1J8HB 5C0CA 1A3QA 1XGRA 1S78D 2JJVA 4BQ9A 1OB1A 1J1XH 3EJJX 2G2RA 3QUYB 1GIGH 3QEQB 2J88H 3BISA 4XVTL 1SBSL 1QLRA 3V7AE 1RI8A 4HK3J 1JHKL 3TZVB 1DN0A 3QWOB 1N6VA 1PKQB 4XPFH 1BOGB 4R9HA 3Q1SL 4K3GA 1S5IL 1RURH 3OZ9H 1G7IA 2J7LA 1A0QL 2XNAA 3DRTB 5C0IA 2ICWA 2DAVA 4U1SA 2W0PA 3EYFB 4JZNB 3TWCL 2VDLH 4BELD 1FRGL 4DKFH 1W72L 1NL0L 5GS2H 1S7SA 2ICEB 5C6WH 1DLFH 2EECA 2FD6L 2VLLA 1IBGH 3V0AC 3V5HB 2BVPA 1N0XL 2XZAL 5E9DB 3V6ZA 2MHAB 3NTCH 1RUKH 5DJ2A 4PRHB 1SMAA 4YAQA 3PF2A 1CDYA 1HOCB 1UCTA 1BD2E 2AABH 2VC2H 4JN2B 3CVIL 4NM8H 2R9HD 5ACZA 4Q9BA 4MSWB 1DFBL 5FV2A 1EFXA 4NQTA 4L4VE 4X0KA 3V4UL 2XN9E 3A6BH 4W6YB 4JPIB 1TITA 25C8H 3MPCA 4M1GH 4LRNL 5FYLL 3DHJA 3DI3B 1MRCL 4LMQE 4YDIL 5AYUL 4MJ2A 4JM4H 3VGAB 3U6RB 5IIEA 1YMHB 1ZT4B 2CIKB 3BKYH 1GZQA 3Q6FB 2D7NA 5CJOH 5DTFB 4CN4A 5J7CC 2IC2A 1SJEB 3GSRA 3R0NA 4G8EA 2V5SA 4XCFH 2NXYD 1AGEB 2YPLA 3OXRB 4TSBH 5B4MD 1IC7L 2MTPA 1I4FA 3DROB 3OL2A 2DRUA 3QIWD 3QNZB 3RZCD 5BW7A 4WI6A 2X4TA 2ZUWA 1MFCL 5E5RB 2WK2A 2P5EB 5JMOC 4AG4H 4F57L 3NMEA 4NP4H 4DAGL 1XGPA 4U6VL 1MIML 2VITB 5FGCE 4PJ9D 5ACLA 3O3EB 3C8KB 1T7YA 5AEAA 5J12C 3NIGE 1GC1C 3QNYB 4ZODA 4L8SA 5HHOA 2ATPA 4LCUA 2NW3B 1HNFA 2F54D 5C08B 4XRCA 5JPNB 4RFEB 3QCVH 1LNUB 5E2WH 4LARH 1IKFL 4L3CB 5SWZE 3EYUL 4OAWA 4CMHC 1FAIH 3ME0A 1IT9L 2VXVH 1QUNA 4Z78B 1R5VB 4K23L 2P1YA 4G8IA 4F37K 4MNQD 3MLWH 5ISZA 3OKLA 3UP1A 5IBLC 3UC0H 4YBLC 4PJ8C 1FLRL 2AK4A 1KEGH 1GGTA 4J3OC 3ARDC 4NN5B 5EBMB 4QCIB 5SX4H 1C08A 3B9KC 4IRSA 4XCNB 5F7FA 1FP5A 5E2UL 5B39B 3ARTA 2UWEF 3HNSL 3S37L 1WUNT 1FZOB 2O61A 3C5ZC 4V1DD 2H1PH 1UVQA 5EUKA 1EHAA 4I0CC 1U8HB 1J7VR 1Z6JT 4P2QA 4WWKB 4XXDA 1E4KA 1R3HB 2BRQA 3NN8A 3QI9D 3AS2A 2OLDA 2R0KH 4DN4H 3CXHJ 1GOHA 4Y5XC 1SJHB 4ODHH 2YRLA 1D5XB 2OJEB 3MSPA 4K7PX 5BCAA 3REVB 4GW4B 1BM3L 2X4QB 5DQJB 4P4KD 4I4WA 1CICB 5KAQF 4JFDD 4NQEA 3MUY1 2BOCA 2VABA 1U8OA 1EO8H 1ORQA 4DOHB 4Z18A 1A7BA 3NCYS 3DXAA 2XA8H 4N90E 1DBAH 4NO3B 5GS3A 1IAMA 5DRWA 3VI3E 1BFOA 1FVDA 3BP5B 2NY1B 5C09E 4MB5A 3EOBB 2JE8A 3PWPE 3G5VB 5D9SB 3HUJA 3GSUA 4Z77A 4QHUB 1QYGH 2P7TA 3MO1B 4P46D 4YLQT 2X70A 3GJFB 4L4VA 3WBDA 1YEFH 2VR9A 4MNHB 2N7BA 4Y1AD 1JGVL 1A7NL 4WI3A 1VSCA 3D69A 3FN3A 4L3EA 4FQPA 4NUJB 2XI9A 3VDAA 2XQYG 3V0WL 2H2SD 4XP4L 2I9LA 4XBPA 4HZLA 5DLMH 1PKOA 3RWFB 3VRJB 1QEWA 2QLVB 2Y23A 5HGBA 4C83A 3GNMH 1RJZB 5FOBB 4MNGE 4PJHE 4WY7H 1XGUA 3K4AA 4MCZB 3RVTD 3SGJC 1KB9K 3VXMA 5EN2B 1F8TL 1S7UB 4R97C 3S9DB 3X12A 5BRZA 3HNVL 2NXZC 1EJOL 5CLTA 3VXUD 2QKIB 4F33B 4N5UA 3GMLB 1OL0A 1OHQA 5I75B 1CG9B 4LSDA 1FL3A 5CJBA 4XVSH 5FKAA 1OTTD 2EEBA 1AR2A 5FM5O 3GRWH 1HIMH 3RWGB 1CYGA 3CZFA 4Y2DB 3CDGA 5INDA 3M07A 4NHUA 4UTBH 5CBEA 4KPHL 4FQLH 4LLVA 1KIQB 5BS0D 4MS8C 4D9QD 3FQNB 3NH7L 1J10A 4R7DA 4HC1L 3EJYD 4HFWB 2EE3A 4XPTL 5E99L 3BE1L 5JA9A 4QRUB 4L8DB 1CT8A 4TPRH 2JCCA 4RAUA 1FZJA 2GITA 4PRPD 3RWJB 1F58L 1CF8H 2C3GA 1G7HA 3KLDA 1CN4A 3KDMB 3PDDA 3RVWC 3QULB 4HWBH 5DHVB 5AZEL 1F2QA 2J8UE 1ZWIA 5E6ZA 4AJ0A 2BJML 5KG9B 5I8OH 5LVEA 3RAJH 3PIQA 4WO4A 4LU5L 1F4AA 1FPTH 1OAUL 4K94H 1CXIA 5D7JA 2F8XC 3QUZD 1AIFB 4Z0XA 2IF7A 4APQA 4FQJL 3VMPA 3VXRE 3LQAC 1Y6MR 1YY8B 1S7VA 1A5FH 3FB8A 3H3PL 2APTA 4MA3A 2ZSWB 4HAFA 4Q2ZB 2Q7NA 5EIVA 3HKFA 3U36A 2ZP0T 5BV7H 4K3EH 3MCLL 1GYAA 4LHUG 3X13A 1KPUB 3QBTB 1RZIB 1MUJA 3BP7A 1INDH 3FMGH 4JO4H 1JPST 4XP5H 3ZKNC 4OD3L 3I6KA 5A16A 4BQBA 2PW2A 4Y4HA 3EGSB 3OTTA 3TVMA 2RB8A 2H8PA 2WBJB 3KPRD 1FYTA 1G7PB 3QQ3B 5C09A 3UO1H 3B3IA 1HKFA 4Q97A 1UACL 4R7NA 3K81A 1U92A 5DC0A 1LEIB 3GO1H 3O8XB 5F9OL 2YD6A 5HGAB 2LAAA 5DRXA 4OF5A 3DGCR 5MI0C 5IMMA 2QQQA 1EEYB 4G6KL 3U82B 1UGNA 3O2VL 3BXNA 5EU6B 4YHOL 1ZTXL 4R3SA 1J8KA 3FFDA 3TCLB 5HHNB 4EI5B 1EGJL 2VDOH 3U0WL 1I9IL 5DD0L 1T03H 5A2KH 4DGYL 4IS6B 2ED8A 4DZ8A 1WBXB 1JRHH 1KJVA 2BNUB 2IBZX 5J8OA 4QRPA 1B2WL 2O26U 5EFIB 5DUBA 4RZCB 3RL1B 3MGOA 2OSLB 4H1LG 1L9NA 4Y5VB 3ARBD 3O6FA 1RY7B 1DEEA 3LSOA 4ONHA 4TYUA 3O0RL 1NC2B 5AZ2H 5F7EH 1NFDF 5C9JA 5J1TC 3P9MB 4PREB 1FG2B 1FFRA 3AM8C 4PP1C 1N6QL 3IXAA 3WO4B 1X3DA 2J6EH 3VFSB 2OTWB 4G8GD 3DO7B 2CIIA 3BPOB 4ZSOE 3SDAA 4ODBD 2YEZA 4OZHA 4PGBB 1PY9A 2A6JB 4XMLH 3O2WL 4PYHA 4WJ5B 5I1EH 1OM3H 3BZFA 4LBEB 5F72S 1V3LA 2ZUSA 3JSSA 4MJ5B 5IBUB 4OT1H 4OLXH 1VDGA 1X5YA 1C16A 2H41A 3EDFA 5JDJA 1XIWA 1XGYL 2MQCA 5BXFB 3QP3A 3DUUA 3MRKB 4PJDE 3ZZ1A 2B5IC 4P23B 1MHPH 1ZLUH 2Q20A 3Q48A 3ARQA 3BOVA 3LN5A 2F53E 5DHXB 3KLSA 2HVKA 1OT1A 2VLRA 5HHQB 4NZTH 4PJAA 1ZVSB 4LP5A 1KCUH 4G6FB 5EOCL 3QDAA 1ZLUK 5IG7B 3PWVB 2HYMA 5LXGH 3C60C 1N8ZA 1IM9B 4J2XA 5DK2B 1CDUA 1UM4L 4JO2L 1XGQB 4NWTH 1G9NL 1C12A 3GI9H 3RJQB 2BVTA 3LDBB 3RI5F 5KSBA 2IG2L 2GJJA 2F58L 1FNAA 4XNXL 4ZNEA 1D5BA 4M4RA 5DT1H 3O2DH 3KYMA 5ESQB 3ARFC 2PN5A 4TUJA 1TZIA 1A6VL 1JGUL 4FTVE 4QTHB 4DCQB 2HTKD 3NA9H 5DEGA 3VD3A 2OXGA 1P7QA 2JLLA 5JW4N 5FKPB 1IEAA 1U6AL 2BRRL 4F7PA 4KJWC 4X6CA 3TPUA 2VB5A 1QRNE 4AM0B 3ETBF 1SEBB 5ID0A 3ARXA 3V52L 3VFNB 3JZ7A 2R2EA 1UZ8A 2COQA 5E5UB 3ZTNH 4QXTA 1A3RL 5FHBH 2DJSA 5IFHL 2BHUA 3SOBL 1NMBH 5DO2D 2LABA 3F65A 3MRJB 4FXGB 2YPVL 2VIRA 3RWHB 4AQOA 1BJ8A 1UT9A 5DWUL 1NGWA 3ALXA 4NJ9L 4NFBA 1KN4H 4G7VL 4W4NA 2UY7A 5DYOB 2I5YH 5MEPB 2OBGA 2PO6D 3HE7B 4HH8A 4YIQB 2AP2A 3LKSA 2PR4L 4P3DB 2H9GA 3WL9B 4Y5YB 3VGAC 4Y2OA 3HZYB 1ZA6A 4RAVB 5MP6L 2V17H 1A14H 1DN2A 3FZUD 3CD4A 4D9LH 4NBXB 1RJYB 3WV0A 4OCXH 4W6WB 4DKEH 3LZFH 2EDNA 4IMKC 4NQCD 1MFEH 3BJ91 5EOQH 1R3KB 2IBGA 2EIEA 2ZCHL 4AEIL 5IHZA 3RVUC 4FG6D 1KB5B 1T7VA 2Z0BA 4KK5C 4ZXBA 4OZFH 5HHME 2BSTB 1Q9WA 4OKVB 5DURB 5B8CB 2BCKA 4NO0B 1K8IB 1CFSB 3T08A 1ORSB 5F3HA 1K2DA 1U8NB 3PQYA 3AXLB 1X5HA 4LASL 3TJEL 2OK0L 1EK3A 4KROD 3WN5C 5DEFB 1AJ7H 3RTQB 2VOTA 4X5XB 5D70L 2CKBH 4QXGL 5C0CB 1IJ9A 3HPJA 3AROA 1HE7A 2DJUA 3HC4H 1P4LB 5IFJB 2AK1H 2F19L 5JR1H 3O6KL 4MA1B 4GO6B 4Z9KB 3VFOB 1EFXD 1HINH 3UXFA 3FRPA 2AXFA 2ZPKL 4Z95H 1F3JB 1O7VA 5ESVA 2JJTC 2VR4A 1AXTH 1L7IH 4NFCA 4ZOAA 1UXSA 3X14B 4UDUA 1VGEH 3SKMA 2P45B 5TFSL 4LRIA 4LLQA 4UNTA 1MNUH 1LD9A 3GSXA 4NNXB 1JP5A 2RGSA 5D8JH 4GRMB 4OFPA 4OLEA 4IDJL 1QA9B 4J7RA 1P84K 4LNRB 5DXWA 4B7LA 4XNMB 5F8QC 3OAUH 3V6ZB 3INUH 3FQXB 2I9TA 2YPLD 4PB0L 4YHYC 3GUTB 1HZHL 1QSEE 4GAGL 3VD5A 4ELMA 3S3PA 5ACZB 2HFFA 3F12A 4TULH 2WBKA 1T7WA 4LLMA 1H3PH 3CXDH 4KQ3H 2VXTL 1DQDL 1QSZA 3C08L 4GBXA 3D48R 3IDNB 1BFTA 4HF5L 3EO1A 4NWUL 2ATKA 3C5JA 4MA8H 1M6OA 4OGXL 3AMLA 1UH3A 4OCYL 3RVVC 3EHBD 3L3IA 4J1UA 3ARGC 4NZDA 3DSFH 3TYFA 5FM8A 3LEVL 2VR5A 1JL8A 3QFJA 4JDZB 5GSRA 2B4CH 4UMGA 2D03H 1A02N 5ISZD 2FGWL 2G9HA 5SWSA 1UH2A 4R26H 1KLGA 1YECH 3VGDA 3MRPB 4KVCL 2EEAA 2J3SA 4PJ5E 2FJFB 2AK4D 2YSSA 4JKMA 5L2KA 1K85A 4WUUA 2CKNA 5LGKA 4IRSD 5J89A 3FAWA 5EA0H 4JPVH 3EAKA 4CW1B 4TUOA 3ZDXE 4D0BA 3OJ2C 5EZJB 3ZDZE 4H20H 4P2QD 1BLNA 5CZVH 4OLWH 3D2UB 5EC2A 3PXHA 3UZVB 4DGVH 5JORA 4Z76B 1X7QA 3RDTC 1MAKA 1IGFH 2WWKO 4GKSB 3RGVA 4MJIE 4WGWB 3MV9E 1GAFH 1X9QA 2FECI 2FDBP 1LO2L 3D0VA 4YO0A 3MGTB 5B3NA 3GBML 3RFZC 5JQHC 4G6AD 3ULVD 1K9TA 4JANB 3VU2A 1T21A 3IU4H 2AV7A 5CP3H 2FWOA 2OR9H 4XVJH 4ONGL 4Y19B 4NQED 4KAQH 1YNLH 5TE4L 3ABZA 5KVFL 1RUQH 1IC4H 3SJVA 5I75C 1DE4B 3DXAD 3IXTA 1II4E 5BQ7B 5GRXG 1K5NB 2YUXA 4ONOA 1DBKL 3KR3H 3OMZA 4ESKA 4J3XA 1QBAA 4Z7UE 2R1YA 2SEBB 1ADQH 2YHGA 5DJ8A 4PFEA 4MX7B 4OF0A 2ZG1A 3CK0H 3PL6B 5FOJA 1TQCB 5IJKC 1F5WA 4BZ1H 5FYJD 4FQXB 4IRJA 4M93B 3V5DA 3QDJB 1VA9A 1M7IA 2MNUA 4L4VD 3SDXE 1INQA 4RIRA 5GXBB 2XN9D 5CBAB 4GLRH 3MRIB 1JNNL 2OR7A 4I3SH 5IVZB 3MRBB 4CVZA 4FFVC 1VPOL 4L3ED 2IGFL 1VFOA 1U8IA 2R56H 4M6OH 3QRFM 4PRNB 2FNBA 2BVOA 1T22B 5GRVL 2WBWB 4EIZC 3DRQA 3QEUA 5CILL 5DMKA 3I50H 5KS9E 5F6IB 4XNYL 1G6RA 3VXMD 1I7TA