2P7TB

Crystal structure of kcsa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords FAB-A
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB01
2CK0L 4G5ZH 1N3NB 2QHLA 3QUMA 4OQTA 3VXTB 3BH9B 5DRZB 1UWXK 2V5YA 5J6GB 2IG2L 3WFEH 4XPAL 1GZQB 2EH7L 4NSKA 4QRRE 1I1AB 2FX9H 3L1OH 5I8KH 3IFOA 1AQKL 5C08A 1KCLA 1NCAL 4YUEH 1MRDH 1U8IB 2JB6A 5FOBB 4KTYA 2WBWB 4JHWL 1I9IH 4JO1H 3DUHA 4RNRB 3UO1H 4HIEA 4RFNB 4L4TE 4P5TC 5DJYA 3QFJA 5EIIB 5AD0B 3P0YH 5FGCB 3QWRA 2UUDH 3IDXL 4L8BA 4DFHA 4JY4B 4JVPA 2LTQB 4I8DA 4XPTH 4HEPG 2J5LB 1VPOH 1CLZH 3ISWA 4TRPH 3WHE1 1G1YA 3GBNH 3EJYC 4FFYH 3DETC 2XKNA 4MX7B 2JB6B 1MCBA 3NCEB 3DURB 35C8L 1DVFB 4UDUA 3BPLC 1H0DA 2MMXA 3QIUB 1TQBC 4EDXB 2X4PB 5IG7B 4PTTB 4DOHE 4GG8B 2MQ0A 3DETD 1UM5L 3F7YA 4DGIH 2R2HA 5E2UH 4M02A 4MXVE 1PG7H 1WJ3A 1AY1H 3KPTA 4PLNC 2EYSA 2VLJD 4PBWD 5EOCJ 3O6FB 4GRLA 3F5WB 3UJIH 3U4AA 4MHHG 3OTTA 3NN8A 1OAQH 4NQVB 3TGXA 3OKEB 5C2UB 1LWRA 1UXSA 2A9MH 5C2BH 15C8L 1OTSC 1RUAH 1ZT1A 4OD3L 4P57B 1JUFB 5DFWH 5D1QC 4MAYA 4EN3A 4XP4H 2BY0A 5CMAA 5IOPB 4WFHE 2CKBL 3A6BL 4XPGH 1GGBL 4PJCB 1OW0C 2RCSL 1PAMA 4ELMA 1CI5A 4KGLA 3GGWB 2UWEF 4GUPB 3L3KA 5CEZE 1CE1H 1MJJB 1JPSL 3B6SB 4PUBH 3LHPL 1A7PH 2XG4A 3EGSB 1AGCA 2XZQH 4K7PX 3QIBB 3VRLF 3KPPB 4JO2L 4O4YH 3L5HA 3LQAL 2VQTA 2EKSB 5E24E 3MFGB 3RX7A 3V0AC 1IM3B 1R3IH 3GSRA 3MACH 4U6HA 3B9VA 1DFBL 2ESVA 3F62A 4P9MH 4P46B 3RU8L 2OZ4A 3WKMH 3HKFA 2GSGA 4QHNB 2ZSVB 4Y2DB 3WBDA 1QFHA 2H32B 1VB9A 5CEXA 1FG9C 5KN5B 4XNUH 2EIZA 5J89A 4LEXL 2A6KA 2HKFH 5CD3B 1XGUA 5F1OB 5FF6A 5EN2B 4EI5B 1IAIL 1Q72L 1INDH 1UYWL 1A3RH 3NVQA 5EU3A 5L8LB 3W0WB 3RWIA 1I3RB 4GKSA 2DQDH 3WXWL 3RVUC 4ORGB 3TBWA 1XR9B 5GRYA 1DLHB 3TO2B 2AJXL 3SDDD 1JPFB 4JFXA 1FV1A 3SGDI 4MA1C 2H32A 5CEXB 2X4UB 1J7VR 4JKPL 3MGTB 2X7LA 4UMGA 3MRPA 4JG1H 2IPUK 4RAUA 3R0MA 1B6UA 1EH9A 1WFUA 5DRNB 2CH8A 2RBLA 1IGYA 3T1FA 3MMEB 3MNZA 3EO0B 5C0AA 1HHJB 3JXAA 2A83A 1DQLL 5IM7A 1YYLL 4LLDB 3S6CA 4HXBL 4N1HB 2FZ3B 3VWKD 3KPNB 1YMHB 1JPTH 4F7CB 3CFJB 3D25B 5D6DA 3RIFK 5KTEL 1KCRH 3QO0A 5E94B 3TNNA 2DQHL 3CXDH 4ESKA 1ZAGA 4ELMB 4U6XB 3AMLA 4QWWD 2ZUQB 1OGAA 1ZKAA 2G2RB 2UUDK 2KKQA 4G6AC 1NMBH 1S7XB 1LP9B 1RSFA 5GGQL 3S4SG 5DLML 3IDMA 4J6RL 1MI5E 3MV7A 4U6VH 5IFAH 3T3PE 1R3KA 1YZZA 3M8OL 4U1LB 5EPMA 2LU4A 1LEKB 3ZKSD 3X12B 4YAQA 5BS0E 3C5ZD 5DVOA 3NABH 4HUXB 2OQJA 5TF0A 1KJ2L 2OR8A 1QFPA 4PJHE 2H1PL 3CGTA 4U3CA 1CIUA 4X7DC 4M03A 3LH2H 4XNXH 1MFEL 4MDIA 1QFWM 1QSEA 4YDVA 3V0WL 3V4UL 3KYAA 1OF2B 3GDBA 4XNMB 3MUJA 4AMKH 4G8IA 4XMLL 1MJ7H 1U8NA 1X4ZA 4KVCL 3WIHH 5CEZD 2VLMD 1FE8L 3FQTA 4X4YB 3QEUB 4RA0C 4OKDA 5DQDL 5JOFB 4Y5VC 3STLA 1A6AB 5HI5D 4MXVF 5IFHH 1JFQL 2EYSB 2EE9A 3MV9B 4RBPH 2A9NH 3BMWA 4YDJA 4JN1H 3VFGL 5HI5C 1A7OL 3RVXC 1RD6A 4I0PA 1BQUA 4GG8A 5FA3B 2J4WH 2OK0L 3VG9C 3ARYA 3BZFB 4Y5YA 4YPJA 5C0GA 5I1HH 4Y4KD 3FN0H 3O45A 2AJUH 1QRND 2BC4A 2HT3C 1HOCA 4X4ZA 4N0YH 4KPHH 3BPNC 1IC7H 3GBLA 1JF6A 5LBSH 1AR1C 3O4OB 1JNNL 3HC0B 5TDNA 4AK1A 4D3CH 5KOVC 4EDWH 1OAXH 4MAUL 3P11L 1FO0A 3O9WD 4E41D 3I2CH 5T3XH 5KSUB 4LSUL 5C0AB 1KELL 4GJTB 4R9HA 4Y2DC 3VH8G 2ZCHL 3BDBA 4XAWH 2ZJSL 4MB4A 3OV6A 3KYOA 2ITCA 3LEVL 4OGAC 1W0VA 3SKJL 3BDXA 2W92A 3FZUD 1ZS8A 3MRPB 5ICZB 1HXYA 4C59B 1M7IA 2VDNH 3AREC 2YR3A 4OSUL 5C6WH 5FO7B 3STZA 4HT1H 3LMJL 1VGKB 4XC1L 3E3QC 5ALBH 5A3ID 2O61A 3VCLA 2IPUG 4NM4L 2DLEA 3L7EB 3WJJA 4ORGA 3TBVB 4GBXC 1AGDB 1PKQE 4PJ5D 3LD8B 3VGAB 2R0ZL 1SMAA 4N5UA 5F3HB 3HN3A 5DJAA 3VJ6B 4IHOA 2CKNA 5EPMB 1NC2D 2C4FU 4MQ7A 4ZXBC 2XRAL 4PGJA 2E7CA 2VLKD 2HG5B 5DJ6B 2NZIA 1XH3A 4KRMB 5F96H 3UJIL 4YHPB 5DRNA 4KDTC 1WBXB 2BCKB 1NFDA 2H3NB 3QRGL 5FM4A 1ZHLA 2P49B 5IV2A 43C9A 3IDXH 3F8UB 1CXIA 4RGMB 3OJMB 4RBPK 3MBEC 4PJXF 5K9OA 2EE6A 4Z7WF 4R8WL 1B3JA 3GBNL 5E8NB 3R06B 4LPYA 2PW1A 3RZCB 2YXMA 3ULSA 4K8RH 1JZ5A 5HHMB 1S3KH 4XNQA 2EO9A 2FATH 5C08E 4LK4A 5F44A 4AT6B 2DQJL 2ZUQC 4GMSL 4BZ2L 3PGCB 5C9KA 3IGAA 1MFAL 1HHHA 2VE6A 4BA8A 3HMXA 1A1OB 5E9DD 3V95A 1U36A 3AGVA 5E00B 5I76A 4ZO7A 1NBVL 5DEGA 5D4QA 4L9LA 4O4YL 4ZUUA 3W5MA 1KTKE 2NXZB 4H88L 1EMTH 2R0KH 4K07A 2ZSVA 1G7HB 2NTFB 3VFVA 1XIWB 3SCMD 3CFCL 2FHCA 1SY6L 1EVUA 2F8OA 1A7BA 4MA8H 3ARBA 3F7VB 4MMXC 4YDLC 4U1SB 5I19L 4OZFG 3AS0A 1M7XA 3IJSB 4OZHF 2FBJL 4WI5A 1ZLSL 3JV4B 5H37G 3TVMA 5FUCC 2QSCH 4HWBA 2Q86A 5DRWA 5EZIH 5B38A 2RCSH 4M43L 4Y16C 5JOPE 1FIGL 1QBLH 4PRAB 4QRRB 2E7LA 1ZVSA 4APQA 5DYOB 2R2CA 5DVKA 4YR6A 4J4PD 3HZKB 1MFDH 4PUBL 1F45A 4PJGB 4N8VB 1OP5H 4LCUA 2AK1L 4WW1B 5MI0C 1RUML 3TBVA 3TWCH 1LP9E 3JZ7A 2PYFB 3RDTB 4WUKL 4XHJD 2P8PB 3ARQA 1EHNA 4GQ9L 5EU7C 2DYPB 5D1QB 3REWA 1CG9B 3L5XH 5I18H 4DKFL 3CDGA 3PWUB 4XPHL 1BEYL 4P23A 3QCTL 5F8RC 3SJVE 1CT8B 5FEBA 5DJXA 2KBGA 2VXTH 1U8OA 4MLSA 1D5XA 1CF8L 3G08B 1N2RA 4M7KL 5DJYB 4NQTA 2YBRA 3GBML 2CGRH 3OR6A 3VFMB 3B5GA 3UYRH 4I9WD 3T1WA 4P2QA 4D94A 2BOBB 3EYVB 1UXWA 3FMGH 4O2EB 3UTPD 4P2OC 2X4PA 5IG7A 2AK4B 4HC1A 2YWYA 3F7YB 1JRHH 3B3IB 5AYUL 3NCMA 4TUOB 3V5DA 3MRDB 5E8NA 3HNVH 4S1QH 1UENA 1VHPA 2AV7B 2C3XA 1AGBA 1R6VA 2KQMA 3ILPA 1D7FA 3QIUD 1DBJH 4Y5XB 3UDWC 4BQ6A 4ZO8A 3MBXH 2BVOB 2BSTB 3VRJA 2VISA 4MNGB 1GGCH 1P4BL 2R2HB 5D6DC 2VSDA 2BVPB 1QSVA 1FQ9C 3MLZL 2YRLA 1WEJH 5CCKH 1T2QH 3KPSE 4OFIA 4QHUA 5GGVH 5AZEH 3LH2L 1YQ2A 3X14A 5JW3H 1YYLH 1HKLH 4KV5E 3NFNB 4ZDHB 3L9RA 5EBLB 2ORBL 2OR7A 4XMLH 2B1AL 1HIMH 2F58L 5CSZA 4G3YH 5FDYA 2Q8BH 1U3ZA 2ILLA 1N6QL 5C0RL 2FIRT 3MCG1 5J9PA 1A3LH 5D70L 5C0BA 4OLYH 4LCYB 1Q0YL 1CDHA 3GSOB 2X5PA 2COQA 4KMLB 1JZ6A 2JJUA 1ZT7B 2YZ1A 2NY0B 2NY2B 3U46B 3E2HB 5CJOL 1FN4A 4DUXA 1YEFL 4JAMB 1OM3H 2A74A 2V2WB 3O11B 1MH5B 3TIEA 1I7TB 5HSFA 1KJ2H 3TBTB 4FQ2H 1PG7W 3MLXH 4PGZA 3C08H 1NANI 5I1EH 4XMPL 5M94B 4HKZB 1JN6A 5GGTA 3RX5A 1XGPA 3GFUA 3BYTA 5C0NC 3CFKA 4L4VB 1AIFB 3HI5H 4KROB 1P7QB 2DLTA 5J57B 4JVWA 1BOGA 4IOFC 4M6NH 1ZLUK 1BLNB 3IAQA 5GZOC 4NM8H 1KPUA 4X6DB 1CFVL 3VI3E 3IRPX 2FEDC 1A6PA 5HVWA 4KHTL 1L7TL 4JN1L 1UB5B 3REVA 4PV9B 4UNVA 1JV5B 1HHGB 1IT9H 4FNLL 2AKRB 1Y6MR 1LO5A 4XVJH 3OGCA 4FRWA 1EGJL 4NC2B 5FM5O 4DKAA 2YD9A 1TVBB 4NQSA 3OJDB 3WFEL 4JZJC 3DUSB 4G8GD 4B41A 5BV7L 3WL9A 3HZVB 5KVGH 4OGXL 1S7SB 2AERT 5BS0D 4V1DB 4FQQB 5DD3H 1F13A 3G6JF 3KYNA 4QXGL 4JHWH 1I3RA 1S5IL 3O6LH 1U8OB 4MCZA 5T3XL 3SY0B 3IJHB 1AGFA 4HDIA 3JSSA 1LK3L 4PJBB 5JW5A 3P0YL 3BP7B 3P77A 3ULVD 5JR1H 5LGKA 2DTSA 3LKQA 4BJLA 1CG9A 4EUPG 5ADOL 1R0AH 5SWSD 4WHTA 3QUZC 4ZG1A 4FFYL 4C56E 5HHVL 1EAJA 4NM4H 4O02L 1OAZH 1DLHA 1GRWA 2W9DH 4N9OB 1PKOA 3DGGB 3GSVB 4PJAE 3ES6B 1QLEH 2ENSA 5IMLA 4HJGA 2YZ8A 4CU6A 1NKOA 3M07A 2YPLE 5MENE 2FJFB 4WI4A 1TZGH 1CICA 1BFOB 2NTSP 1MHEB 5F6HI 5JHDB 4UINH 5MHSE 2DTML 5F9WC 3MRNA 1QP1A 3LIZH 3PNWA 4CAGA 4DN3H 15C8H 1SY6H 3MLTB 4LSVL 2ADJA 3QUYB 1SM3H 1KTLA 4TTDD 1Q9KB 4NNYB 3GSWB 2FBJH 4NCC2 5IVZA 3CLFL 3QEQA 1R5IA 1S9VA 1HILB 25C8H 1MPAL 5KSVB 4XPGL 1P7QD 4U1GB 1WSST 3F58L 3RIAK 5FUZH 3MYZA 3TYGH 5CZXD 1HSBB 4S2SA 4WTWA 3LRSB 4LNVA 2D3VA 4BELD 5D6CA 1AGEA 5EN2A 2HFEB 3T2QA 4GLRI 4NJ9H 3MUZ1 3ZKMC 2G75B 1MCOH 3FAXA 5EO0B 2UY6A 4AIZA 4B7IA 4P2YA 1RUMH 2R1YA 4ODSL 2UY7A 1FP5A 4R3SB 4UTAL 4F57L 4JO3L 4YQXL 1DFBH 4DN4H 4WW2A 5D7IE 5IJVA 2R23A 1DUYA 5C0AD 3QHTC 3ALWA 5C0CB 4ZAKD 5EO1B 5DJ0B 3ZYOA 4HJ0C 2LAAA 4Q9BA 1BQHA 1EEZB 3P4MB 1F4YL 3CFDA 4H8WC 2QSCL 2A77L 1BP3B 1WICA 3GSOA 3LN4A 5DDHB 5ADPL 4YZFE 3SGJA 4M5YH 4TQEH 2UV3A 3D87B 4KY1H 4PJDF 3ZT6A 4P23C 4MJID 3GEWB 4N0FB 3AXLB 3SDDA 1KEMH 1M71A 1N8ZB 3VXUB 4JM2D 3JTTB 5IGXH 3WLWC 2XY2A 3HUJA 4LLMB 3O0RL 3DOSA 5C09D 5KVDH 4Q7DA 4O51B 4TULL 1T21A 1SJHA 4LSDA 1ZLVK 4M7LT 3D9AH 3S34L 4HGWB 1OY3B 3GHEL 4YDLB 4F7EA 1OAYH 4PTUB 3MRBB 1QO3A 4LHUA 5DRXB 1BEYH 1QVOA 5BW7C 2X1QA 3MRFB 5FYKE 3MLZH 4NO3A 3STBA 1QYGH 3C87A 2FGWH 3T0ED 4NO2A 3OHXA 3T0BA 4BSJA 4KV5F 1JHTB 4FP8L 3VXUA 3OSKA 4PBXA 3VGDA 1N0XL 2CDEB 3ZSTA 3O3BB 3GSXA 2BVQA 5GRZA 1I8IA 4X98A 1RK0A 4OIBA 1YECH 5IW6B 3V6ZA 1U8MB 3O3UN 1SJVA 1ND0B 3OKLB 4HIHB 5JORA 3LKOB 4NPYB 4QRQB 4PRIB 1YEHH 4WFGE 3L6FA 3UTZA 3FO2A 4JE4B 3ME0A 1D5MA 5I16A 4HLZH 1Q0YH 2BZDA 4KK8D 3L3IB 3RJDA 3K1DA 1HZHL 5C7XL 3S96B 3C6LC 5EC2A 1A14L 5DRZA 3NA4A 3DV4A 4HJJL 2HRPL 4GOSA 4GAFB 4PRPD 5DJZA 4AY0A 1GGCL 3IJSA 4MZ3A 3DV6A 3EYUH 2EC9T 2Y5EA 1U8JA 1HI6A 1YNLL 3H9SB 2VDOH 2W0PA 5DC0A 4LBEB 3QQ9D 5F7KC 1TJGH 4KKLC 4PP2B 2IQ9H 4ETQA 3H7BA 3S3PA 4HMEA 4S0SD 4YHLH 4FZ8L 5B3JE 2ZNWA 3BGAA 3C8KB 4MYWB 3B9KA 4IOIA 4AMKL 1JZ4A 4PJGA 1S8DB 2DQFB 2VQUA 4JFDB 2OX5A 1X7QA 4XP9L 1PD6A 1RZIA 5IBUG 2EXYC 1NL0H 2QADC 1J1PH 3ZTJG 2AJSL 2B20A 2P8LB 1K2DB 3OB0H 2HFTA 2P5EE 5F89B 2R0WL 4Z78B 5IVXE 2NX5B 3PWUA 3K2UH 2P8MA 5F88A 2AJ3A 3SHSA 2H2SD 4UBDD 3O4LE 5SX4I 2OM5A 4NC1E 2C1PA 1J88A 2YD1A 3D1MC 1ONQA 4IM8A 2APWA 1WFOA 2OXHA 2OK0H 5D7LA 4U1SA 2VZSA 2FJFA 2D31A 3WFCH 4PJ9C 3TF7C 2R1YB 3JWDC 4N0YL 1IFHH 2GUOA 3RVWC 3L3GA 1XGQA 3JWNC 5KVGL 2J88L 1YY8A 3RA7L 3IJHA 2EYTA 3LKPB 4OQTL 3VFTA 1BZ7A 1QFUH 4MXWL 3WO4C 3ZTJH 4QF1B 5IB4B 2NX5A 4LSUH 3DXAB 3PP4L 5LG1A 3MZTA 4XCCL 3U4EB 1CFQB 2VLJB 2AS5M 5DJAB 4JM2A 1JTTA 3OJ2C 2NLJA 1TCMA 3OZ9L 3MSPA 4KHXL 3PP3H 1JHKL 2YSSB 2VLRA 1NGQH 4YFLI 1X5GA 1LE9B 5JXED 1HQ4B 1EHXA 3TZVC 3T0DA 4X7CC 3WFHA 4GS7B 3G5YA 1MCSA 3QDME 1RHHB 5DQ9A 1N4XL 3TBSB 4JG0H 2Y07L 3T08A 4PJEE 2BXYA 3C5SA 2JE8A 4NRXB 5DS8B 3AS2A 5IK3A 1A0QH 5IB4A 4XHQA 4WRLA 3VFSB 3I50H 1T22A 3PV6A 3UC0H 4QXWA 1QNZL 1RUQL 5I1GL 1ZVSB 1NAMA 4APQB 3UZEA 2CSPA 2FBOJ 1HE7A 3HMXL 1X5JA 1HCVA 5HVFB 4U4BA 5KN5A 3U4BH 1FL3B 2FX7H 4RCAA 5GJTL 3QRGH 2D7OA 2Q7YA 5EO9A 3MRMB 4ONHB 3IFPB 3ZL4L 1FYTD 2HFFA 2CDEA 4X6DF 5DJDA 5EOTA 4B5EA 1IE5A 1EVTC 5IVOA 1SM3L 1ZTXL 5I15H 1MAMH 4Y19D 4AJ0A 3U7WL 5ITBL 4PJCE 1OT1A 3P4LA 3B6SA 4K8RL 5HHVH 3QH3A 2FATL 3MV8A 1MUJB 3TVMD 1MWAL 2ZG1A 1AHWB 1SYSB 1D5ZA 5I1DB 1SJEA 2Y25A 5BV7C 4G6KH 3MRBA 4HLJA 5ALCL 5DRXA 4PV8B 1T03H 3EOTH 1XCQA 3QEUA 5B4MD 1KT2B 5T3XD 5E03A 1OLLA 3CAFA 3D5OF 3HI6H 1TZGL 3PWNB 3ARFD 4YEFA 2PO6B 4NKIH 3CVIL 4NKQB 4OD1H 4WUUA 5E6YA 5HJ3A 2IPTH 3QXAB 2IALB 2OR9H 2HT2C 4DN3L 3OAUL 3MOBL 2VC2H 4NQEA 3TV3L 5A43C 5DJZB 3EOBB 1E6JH 1SEQH 3SDYH 4AENB 1MPAH 2XY1A 5J9PB 5E08L 1T66D 5EZIL 5FUZL 1CGYA 4F37K 2JB5H 4P5KA 2G5BB 4XWGL 4KDWA 2XNAB 4HK0B 1T4KA 5K9JL 3E3QE 4ZOAA 4S1SH 1BVLA 1DZBA 1JN6B 5KVEH 2DQEL 3BW9B 3MRCB 3K0WA 2GIYA 4GW4B 1JTOA 3ARGC 2AK1H 3I3DA 3GZKA 4UOJA 1QA9A 3IDJB 4TULH 2YPKB 1I7TA 1QG3A 5C6TL 5HHPA 5M7QA 3AM8A 2J8OA 3CMGA 3DROA 5TGBA 4AENA 4NQCA 1IGYB 3T1FB 4X80L 1DBBL 4L4TB 5J6HA 1QBBA 2Z31C 5GS1C 3QZWA 1IEBA 4JZJA 4G80A 2RAMA 5TE4L 4CMHB 3GBMH 5FYJL 3V2AR 2CJUH 3DO3A 2A77H 3FT3A 3P30H 1IKNA 5EU6B 1U8HA 5JXAL 5EB9A 3VH8B 2ICWA 2FSEA 3U1SH 4M6ML 1MRFH 4PGEB 1S9WB 1UEYA 2QQKH 1ZHKB 5FA3A 4JGMA 2WBJB 3UTSD 1BPVA 5C07A 1OAYL 3MO1A 4BK4A 4L5FL 4R96A 4JRXB 4Y19E 1OGAB 1H8NA 2G2RA 1JGEA 1BD2A 2YUXA 3EYUL 1MY7A 5ENWB 4O5LL 3CU7A 5B39B 3SE3A 1OB1A 3PIQA 5D7LE 5I8EB 1REIA 2VKXA 1OWWA 3WHXA 4PREB 5EUOF 5FYJE 1Q94B 4PRDB 5KJRH 5DUMH 3U30C 1MF2L 4YK4C 5DEGB 2OYPA 1N6QH 1T89C 3GMMB 5H2BA 1XMWA 1ZANL 2UWEE 4ZXBD 3BJ91 2I26N 4CVXB 4GRWH 5ACMA 1WIPA 3MUGB 1U0QA 3VRIA 5TJWK 1QLRB 4NBYB 3QA3A 2EXYD 3C5ZC 3UJJH 1V7NL 3JVGC 3CX2A 4WY7L 5F9OH 4HZAA 4HUVA 3S37X 2NR6D 1DQML 4NUGH 1AHWC 5C0CE 2MPAH 5LAXA 4X7TA 1BQSA 4OF7A 2H8PB 5DTFA 3REVB 1ETZA 1UQSA 4R7DA 5I2IB 2AKRA 1BQHG 3THMH 3O6FC 2BSRA 2WSKA 1IC5L 1OAKL 3U4EA 4JDZA 3GSVA 3ESVF 4LRIA 3HI5L 4JRYD 1QPPA 4PD4K 3U7YL 3RPKA 1J1PL 1A4KA 5SWSE 4JRWA 4DCQB 3RL1B 4C56D 4KHXH 3WNPA 4U1IA 4G9FA 3MCKB 3S36H 1L7TH 1UM4L 3X11B 5INDA 2EDQA 4IMLB 3DX8B 2XIDA 5F7DB 4RWHA 1IAII 4QHMA 3KPRD 1AQDA 1N4XH 3BP7A 4JG0L 5F7YC 5ICZA 5GS2D 1I8MB 5FYKU 3QIBC 4CVWA 3MRRB 4NHCL 2F19H 4Z7WE 8FABA 5HHOB 2CO6B 1IFHL 4XVTH 1UWEH 1C08A 3S8WA 1NMCC 3UC0L 3GGWA 3BGMB 2IBBA 5JIHA 2C3GA 1TXKA 3QXAA 4UI2A 3MCLH 1LO4H 4AH2A 4JFEE 3QUKB 2F54B 1UB6A 1FZOB 1CWVA 1GCFA 2DIBA 1VEMA 4EDXA 3QULA 2ESVE 1E6OH 1TQCC 1MFCL 3EYFA 1J5OL 1H3UA 3W0WD 4F7MA 5CSZB 2O5ZH 1LO0L 4M93B 3PXJA 5HDOA 4RMUA 1TIUA 5DUPH 3VXQA 3BI9X 4YXKH 4GBXD 2XN9E 4L8SC 5F72S 1ZTXH 5IB5B 1MAML 1NAMH 3LSOB 1V3MA 3JWDH 3PWLB 2YUZA 4YHNB 1YEKH 5C0CA 1G84A 1JF1B 5I1KH 4WO4A 1HYSD 2WWMC 3PP3K 1EZVX 3OPZH 1NPUA 4QOKA 5KS9F 2CMRL 3CSPA 2F5AL 4LHUB 1GXEA 2NCMA 3HB3D 4U1MA 2IGFL 4P2CG 5KOMC 5HJ3B 5DC4B 5ELIA 5C0JB 4OBRA 1RMFL 1BGXH 3BDYL 5DK0B 1QSEB 5JQHC 1IM9A 3HE7C 4Y1AB 4ZUTA 5D1QD 2DB8A 4AG4H 4LLVB 4XNMA 2R2EA 4AL8L 1UVQB 2NXYC 3QB7C 2AV1A 4XI5C 3OAUH 6FABH 1PGRB 3TBYB 1QEWB 2DLFL 4YE4L 2VH5L 4Q97A 3VXUE 2HLFC 3GB7B 4JM4L 4WU5B 3JTSB 2EE2A 4NKOA 4KJWC 1BOYA 1F11A 3MR9B 3TN0B 1IGJB 3OR7A 4PGCB 4MGXA 3DX8A 1JPSH 1QA9B 4PRHD 4MAYD 4ZDHA 4EN3D 1A7PL 5B8CA 1A2YA 3IDIB 4YFEA 2ZPKL 3CFJA 3D25A 4OFDA 5BQ7A 3X12A 3MV01 2JLLA 1SHMA 1MREL 4OB5L 2VB5A 5BCAA 4G9DA 3CVIH 4LQ1A 4RWYH 2A83B 5FOJA 5IM7B 4OD1L 5BW7A 1BZ7B 4DZ8B 4LASH 4WWKA 4O9HH 3LS4L 4NO0D 4GFTB 3WKML 1YDPB 1EJOH 1T2XA 1ZHBB 1R3HA 2Z35B 1O5DT 3B83A 3EFDL 5C0AE 1CGVA 1KN2L 4OCRH 1K3ZA 1BIIB 3D39E 5E5UB 3SDYL 5L2KE 3ARDB 5D72H 5E2UL 1H9VA 4MDJB 2UVFA 2JJSA 3B43A 4WI8A 4GQPH 5HYIA 1PZUB 5ADPH 1T0NB 1PW3A 2QJDA 3FQWB 4WFED 2AV7A 1YQVH 2DLIA 2GITB 3CNKA 3EOAA 3W9DA 3I9GH 1JNHA 3E1F1 1JPFA 4U0RB 5IGXL 1U2CA 2PO6C 4HFWA 3A67L 2DAVA 1AD9B 1A9BA 3BQUB 4DZBB 2OCFD 2QQKL 4GG6B 5D71L 3DVGB 3QO1A 1SEBB 1I8KB 1NCCH 5BVJB 3MRKA 5T1MA 1I8MA 1ETZB 4IRJB 1A6TA 2HRLA 1KFAH 4W4OA 4IEFB 2Y7QB 4R0LB 4FFWD 1ZA6A 3ARFA 3F6IA 5INDB 1G6RH 4P4KC 1FZKB 3AROA 4O5LH 1GH7A 1MHEA 4PJ5E 2ZWLT 1GPOH 3DHJA 1QSEE 1KXQE 4JANB 1C16B 1JYWA 4PP1C 4H20H 2E6JA 3LQAH 3HPLA 4U1IB 2F15A 4F80A 3I6KA 1NDMA 5DURB 2H26B 5HGAA 1J86A 1B4JL 5DXWA 2VQ1B 2EYTB 3LKPA 1YEHL 3MACL 3U1SL 5C09A 2P7TA 1FVEA 4HWZA 3V7AE 3VRLE 3DPBA 2XOTA 1FFRA 4Q6IB 1GGUA 5DK2B 5SX4H 5F1NA 4Y0GA 4D8PA 2HH0L 4HJJH 1RZIB 3PDDA 4NFCA 3U36B 3O8XC 5J1AA 1KTLB 5EOQH 2H8PA 2F74B 1JPGB 2X40A 1NGXA 4NBXB 1F3DJ 5GS0L 3WNMA 3DMMD 4OM1L 4E9LA 2FYYB 1NCNA 4JZOA 2DM2A 3L3OA 3WNNA 1NFIA 5FYJD 1XF2A 1NGZA 2FJHB 3MUY1 3V4UH 5IJKC 5JDSB 2ITCB 5FHBL 2A6IA 2KH2B 3CLEL 4AQOA 3DMMC 2CIKB 3GJFA 4LRNL 5CP3H 3WIHL 2XWTB 4V2CB 4POZC 3QYCA 2NY3D 3LV3B 4IRZL 2GJJA 4OZIA 1U8KB 4GXVH 1P2CB 3V4PL 3V7AG 4N5ED 2IANE 4GRWF 1Y6KR 2CRIA 5FB8A 1HINL 1FFOB 5EU4A 4M4RA 1JMXA 5F7NC 5F1SA 2H32H 3CH1B 4XVUD 1U58B 1V7NH 1DQLH 3BKJL 3DURA 2VLRD 3MA9H 4WY7H 5F9OL 2ICEB 5HGDA 5IV2B 4JRXD 1Q38A 1VEPA 4JJHA 1EERB 4TPRL 3UJTH 4PYHA 1CR9H 2IH1A 3P4MA 3MQIA 5CGTA 3C09B 4QYOA 1RZGA 5LXGL 2IBZY 1FAIH 5BO1H 4FOMA 4Y5YC 4FABH 4MCZB 5E8DH 1DVFA 4UZGA 3MCLL 3QG6B 2IALA 1EGJA 3QFJB 4PGEA 3BKMH 3U2SB 5EUOB 2FEDD 4G43A 3TBYA 3PP4H 1KXVC 4XCCH 3T2NL 3CVHH 2YHGA 5KBNC 2QEJA 1XGTA 3ZDXE 5I1AB 3GSUA 5IMKA 1OTUC 1IL1A 4WIQA 1T1YA 4ODUB 2JCCF 5DJCB 3S36L 3L95A 1UM4H 4U33A 4Y16B 3IVKB 2UYLA 2O5YH 2M1KA 2Y06L 1XFPA 5FKPB 4DQOH 1DLFL 4HT1L 2G5RA 4OGYL 1MJ7L 3N1GC 3FKUS 3DV4B 4P48A 4FQHA 5CKAA 2R0ZH 2J8UF 4Z7NF 5EC1A 4LSPL 5HHPB 5DUBB 2BVPA 2WNGA 2CMRH 1XGTB 1V05A 4WJ5A 1FGVH 2HFGH 4GXUM 2XTLA 3R4DA 3PHOA 4JPWH 5J11B 1SYSA 1VA9A 4WI9A 1T3FA 4KZEL 3VGHA 1RMFH 3I6LE 2XYCA 2HTKD 2WIMA 4AG4L 3ZL4H 1BFVH 3SE8L 3IETA 2HYMA 1T1ZA 2W0FA 3V5HB 1MHHB 1M1SA 2O5ZL 2I5YH 4OKVB 2EDBA 3SO3C 3P0VH 1TVHB 1S7WA 2E9JA 1AO7B 1C7TA 2MQCA 4H8WH 3CSYA 4R8WH 1WAAF 4D3CL 4Z5RA 5HHXL 1IVLA 5I1KL 2BSRB 4GRLC 5EA0H 3QUYA 3QEGH 5FA4A 5L6YL 4JANA 4L3AA 4D9QE 2NY5L 1SJHB 5IVZB 5HGDB 2G75A 1XF3B 4JPIA 2ZZUT 4Y5XC 3FCTB 4QRPE 3QFDB 3SKJH 3KNBB 2E7HA 1BX2B 3O8XB 1YEDA 5JOEA 3MCKA 2DQTH 4OB5H 3CX5K 2J6EA 4LPXA 4CVXA 2APVA 2GTWA 1NGPL 4ZD3H 3QNZA 4YO0A 2R29H 2NY6C 4R90H 3MJ7B 3ZE0E 1WTLA 5IBLD 2XFXB 1OP3K 3BD5A 3ZLQC 1NGWA 5I1IL 1ZLSH 2ED8A 3CDGB 3VGFA 3FCTA 3BIKB 3LEYL 5IBLC 3WKNA 3EO9H 3RVTC 4JFHD 3TJHD 1BBJA 3BPCB 3S4SB 3NACH 4XC3L 5JPNB 3MV9E 1MIML 3GKWL 5DK2A 4WW1A 4UT6L 1A9EB 2FEEI 2OJZL 1MFDL 5EZLA 1NUNB 3QDAA 1SBSH 2NY0C 4ZNCD 1UWGL 1KB5L 1OPGH 4YJZL 2VERN 2NXYB 5D71H 2QADD 3MJ9H 4B0MM 2ZUWA 3G9VA 5CJ5A 1NCCL 4RGMC 4P5TB 3GI8L 3MBEB 1F3DH 1BAFL 4L4VD 4ZQKB 5HD8D 3RTQA 3OXRB 5HYSG 4QRUA 5EUKB 1ZT4A 2FGZA 4GKZB 1U42A 4G7YL 2ZUUA 4NKMA 5BJTA 7FABH 4M7KH 4OCRL 2VABA 4KTDH 3D0VA 3MNVA 1GPOL 1YN6A 3HG1D 1P69B 5F70A 2PTTB 5FYKH 5EC1B 2CLRA 5GZOD 3IDUA 5D2NA 2YMXH 5I1LB 5IB3B 1T7XA 1NCUA 1HHIB 5HHQA 3LN5A 2Y6SD 3OG6B 4RMTA 4WV1A 5ESVB 1J8HD 3GK8H 3SBWC 3TCLA 4NCC1 3RX8A 2YD5A 2NXZC 1TQBB 1MCRA 4CW1B 4P5TA 4I0PD 4CN1A 4PRNB 5C08D 1TENA 4ZPTA 4MA8L 4QF1A 3I85A 4PREA 2W59A 2JJSC 2D0FA 3BKYH 2FH6A 4BM7A 5E70A 5T3ZL 2EEAA 5F7MC 5ISZE 1G7MA 1S78D 1WZLA 4V1DD 2XTJB 2GUOB 1ES0B 3K3QA 1UEMA 2CRZA 4PRBA 4M43H 4XCFL 4PY7B 5K9OB 2PXYD 4HH9B 1S7VB 1NJ9B 2H41A 3QCVL 1WEJL 5JIIA 5E9DB 3PL6A 4Z8FL 1GOHA 5D2LA 4NQUA 3O4LD 2VN4A 4PGCA 4ZFOB 5IB1A 2XG5A 2IMNA 3MJ7A 3GMRB 4FMKA 3T77B 4G3YL 5E00A 1CU4H 4R2GC 5D9SB 4MZ2A 5F3HA 3UROR 1OT2A 4P4KA 3WXVH 4DAGH 3VXQB 2QSVA 4MD5A 1LEIA 4Z7UA 4JQIL 1G9NC 4GRWE 3C8KA 4PJBF 1U8IA 1C7SA 1JK8B 1CLYL 3KYMB 3RWHB 1IRAY 4K3DL 2O61B 4TUJB 5EZOH 1P53A 4GAJH 3L7EA 5A2FA 3BN9D 1CGUA 1L0YA 3A6OA 4OUUA 1I1AA 1L0QA 5DZLA 5B38G 3BE1L 4R4ND 4EEEA 4C56A 1CR9L 4U1JB 4Y4FA 4QT5B 2P48B 5M95B 5JHDD 3UX9B 1JWUA 3FRUA 5GS0D 4OM1H 4GW1A 4F15C 4QOKE 1I3GH 1MEXH 4XP6L 4NQCB 5C71A 5I1EL 3MRIB 4NOFA 3RDTD 1QUNA 3FO0H 3O41A 1NBYB 1YUHB 1BLNA 5MEOA 3SN6N 3ARRA 1QHOA 4GW4A 2EICA 2XWBA 2HAZA 2RHEA 5J13C 4H1LH 4IRZH 3S3JA 3MROA 4KXZI 4UUJB 3U0WL 3EDFA 4YFLF 4Z7OE 3S37L 4OI7A 4M1DL 1MLBB 5HYSB 4RSVA 1YPZF 5CBAB 1E28B 2Z91B 3ULVH 2O5YL 2Y06H 4KUZH 2WZPD 3RQ3A 4GW1B 4DQOL 3HLAA 5IROC 4KJPD 4K8RC 2DI9A 3NIDE 1EGJH 3LQZA 3FTGA 3Q6GH 3ZKMD 4LEOB 2D9QB 4R26L 2A73A 4WV1B 1N3NA 4PTUA 5BV7H 3O2VH 3MGTA 1QPXA 3BP6B 3AY4C 4NNPH 4K3GA 1RZFL 2QKIB 4XB7A 3RVVC 4UT9H 3C5SB 3S98A 1XIWA 4KI5E 2XTJD 5EFIA 5TF1L 1MCPL 4RFOH 2BNUA 2LVEA 3BEVB 4ONFL 2ADJB 2IANA 4MD0A 4TVPD 3W39B 2CLZB 2PXYB 1TMCB 2PW2A 3V0VB 1INEL 5CJOH 5JIKA 4HX1A 3QG7H 5C0DA 1KUMA 3E6FB 2NY1D 3U36A 5DFVD 5SWQB 1N7MH 1B2WL 2LABA 1A7RH 3QCUH 4M1CD 3P0VL 1RAMA 3C09C 2MNUA 4XMPH 4P23B 1CFNA 4ZOCA 5C09B 3ECBB 2DDQL 4JM2C 4ENED 4UV7H 1OOAA 4AM0B 5FGBA 3W82A 2GFBB 3MNWA 3JV4A 4W6YB 4KROC 3MODL 5JQ6L 1BBDL 3QISA 1BVZA 3TFKD 3FL7A 1FGVL 2HFGL 4X7TB 2OTUB 4L1HA 3O9WB 5CJBA 2BNQD 2AJZA 4WI3A 1OCWH 2GSIB 2GKIA 4PRPE 1NGPH 1SEBA 4GAGH 4E41E 5K9KB 1V3KA 4PJ8D 4JFDA 4NQCD 4R90L 3IJYA 4BQ8A 2R1WB 5T1LB 5L2KA 5IQ7L 3GO1H 2QQNL 5DTFB 25C8L 1L6ZA 3WNOA 4P3CH 4LFHD 4YUEL 1CLOH 4X8JA 1CDYA 5JNYB 2EYRA 4MQXD 2VUOA 2QSTA 1LEGB 3NCJL 1ZA3B 1ZXQA 3BXNB 3L3JA 3QUMH 1AP2B 2YKLH 4LIQE 1J1OH 3HAEA 3ARZA 1LO2L 1NC2B 2R39A 3G5XA 3TJHC 2GTZA 3GSNA 3MBEA 2WINB 2WQRA 3DROB 5TGBB 1VPOL 3MRLA 1F8TL 2W1NA 4KQ3H 3CXHK 4UTAH 3RWGB 1MI5A 3MV7E 3K8MA 3IU4L 1MCJA 4H26A 2XQBH 5EC2B 3QIUA 3ZHKA 4N9GA 1ZMYA 2D4FA 4O9HL 4ZOBA 1KTDB 5FYLL 4XNZC 5BZWB 4HJ0D 1NDGB 1UKTA 1OAZL 3VFWA 5SWZA 3GMOB 1AXIB 1FNEA 2R56L 2AXGA 4G7YH 7FABL 1S8DA 4HIHA 2AGJH 2FDBP 3MV8E 4KTDL 1UM5H 4MJ6B 3UTTD 5J13B 4RAVB 1MH5A 3WIFA 4K9EH 4OT1L 3WLBB 5SWZD 3NACL 4KY1L 4K7PL 1ZVYA 4WO4C 3LD8C 3VGAC 3QA3B 1QBML 2NYYD 1UZ6F 1CFNB 1ZHKA 1G9NH 5CLTA 2OP4L 3SGJC 3KPRA 4BFEA 1CFSB 2ARWA 1UWGH 4A2MA 4QNPF 4ZXBB 4UAOB 4P2OD 4P23D 3Q5OA 1AGDA 1PQZB 4OIIH 1BZ9B 2QSQA 1V5JA 2Z92B 3SKMA 4DTGL 3QUYC 1K8IA 5E5RB 3PF2A 5ID1A 1BAFH 4X4XB 3UTTA 3TYGL 1D5MB 4WV1C 3ARTA 3PWPD 5ANME 4ODUA 3RIFF 5C70A 3FOLB 2RFXB 3G5ZA 2DQUL 4F7PB 4HS6B 2GJZA 3GIVB 3QPQD 2EDOA 4KUCD 4AEEA 2VXVL 2PXYC 2CR3A 2BNQB 2EH8L 1KXTB 4LEOA 2C3VA 5HYEA 5HBBA 4QRRD 1MJ8L 1YECL 1S7WB 4PJCF 3EBAA 2ICES 2HJFB 5DJCA 5L7XH 4J1UA 3WUWG 4DN4L 2Z91A 5T5FL 1LP9A 2NNAB 1XZ0B 2P5EA 5GISH 1AXTL 3BD3A 2OI9C 1KJMA 2DM3A 4YDKL 1UACL 4LKCB 1JGDB 2HKFL 2JTDA 4OCSH 4OGAD 1MHPH 4N1EA 3NBNA 4XAKD 2EE3A 5EU4B 3CC5B 1HH9B 4HW6A 5D7IF 3UBXI 1OGTA 1M7IB 5GRUH 2LAGB 1E4XI 3O41B 2X9WA 4P2QB 2WMPA 4HWBL 3U6RB 2A2QT 2FB4H 2X7LB 5DR5L 2AJXH 3EYFB 3ZYJA 4L8DA 1QSZA 2ZUVA 3MRDA 2GJ6B 4V2BA 1WVZA 1LO3H 3ZHDA 4WEBL 4YDVB 3TPUA 1N6UA 5BOZG 3SE3C 3C60A 2Z0BA 3WE6A 4UQ3B 1QR4A 2VZ1A 4WFFE 2FR4B 1LD9A 2V7HA 4ZQKA 3BWUC 3P0GB 3RTQB 2AEQL 1D6EA 3RGVA 2VDQL 5SWZB 3BKJH 1N0XH 4OZGA 4F7CA 2NXYD 2V5SA 2VYRE 5DWUL 1UCTA 2K7PA 4JFFB 1F4WH 5D2NE 5I1JH 4GKOA 4D0BA 1KPVB 5D1QA 5LXGH 2BDNH 1FAIL 3QBTB 2R15A 4PJ5A 1GHFL 4NRYA 3WFZA 4XP6H 1RZFH 3RA7H 1UCBL 3C2AH 3ARGA 1YJDC 2OJEB 4WUUB 5CAYB 3DHMA 1Q1JH 3M45A 5GGQH 1Q9LA 2Q6WA 3PWPB 4K3EH 5C0EA 1YYML 4D0DA 2CDFA 4PFEA 4PB0L 3UCRA 3AM8C 1R5WB 1FRGH 2V5MA 1KENL 4NJAL 4LVNC 1JWMB 1R3LA 1T1XA 3N1QC 3RWGA 3NFPA 1X4XA 4G6FB 5IT2L 1P6AB 3FFCA 1PLGL 4NRXA 3L3KB 5MP6H 4WW2F 4LIQL 1EO7A 3L5JA 2CXGA 4QY8A 3ARBB 4KKCD 3B5HA 5HVHB 4NIKB 3P4NB 3KPMA 3JV0A 4KDVA 1U2HA 5KZCB 4OLXH 4P0DA 3NIFE 4B53A 3DJ9A 2X89D 5J1AB 4X6EA 5E0QA 4YWGL 2V7NB 1RUQH 5I1GH 1JPGA 4UT9L 1JPST 3HHRB 3SQBA 2H3NA 2Z31D 4YC2C 4OAWA 3MLRH 3S36X 1MWAB 4K2UH 4LCWA 3T4AA 1XGUB 1UA6H 3UYPA 1MCWM 3WFCL 2DQGH 1XH3B 4HXAL 1Y18B 5IVXA 3DGCR 5C8JB 2VWEE 2HWZL 1RQ5A 5IW1A 4MHHI 1IAOA 2YD7A 1QHPA 5EU5A 5CIPH 3GO1L 5LBSL 3BW9A 3ILQC 3MRCA 2YUWA 4KQ4L 3L3JB 3EO1B 2XICA 4GW5A 3UTSB 1E4WL 1OAXL 4MAUH 4YH6A 3VFPB 5HHXH 1I7ZA 1HXMA 1CDBA 1P7KB 4P49A 4HGKC 1D6VL 1OSPL 4OIAA 2ZJSH 5E4IA 4G6KL 3AU1B 3OKYA 4PJDA 2Q87A 1FFPA 3HE7D 4LVHC 3SDCC 4UTBL 3NCBB 3OJVC 3SY0A 5DHYB 1KCSH 1V7ML 1FYHB 2AXFB 5ICYA 4PJFF 3HI6L 1F8TH 4HWEH 3QJFB 2E9IA 3UP1A 3IU4H 2CUHA 3SJVA 1CGSL 1P9MC 1DQJB 4TVPE 4U6YB 5I30H 2VXSL 2HLFD 3SDAB 2A6KB 3ZDYF 4TVPH 3I50L 3WHXB 4X7SL 1LE5A 1S9YA 1E6JL 4QO1A 1RI8A 2KZ1B 4EJ1C 1T4KB 1T1WB 4NWTL 1U8JB 4APQC 4K55A 4QWWC 3ALXA 3AB0B 5HY9A 1B0GA 2VLKB 2NW3A 3V6FB 3EDDA 5K9JH 3VE0B 5BZDA 1BF8A 2YPKA 4MNHB 1WT5A 1KB5H 5CEYA 3LKOA 4PJDE 1AXSB 4ERSL 3MXVL 1DANT 5GJSH 3U0TB 1XGRB 1I4FB 2DL2A 2FR4A 3EDJA 2GJZB 1QLFB 5TE7L 3RZCD 4MNQE 1A8JH 5HVGB 1S9XB 2DQJH 4DK6A 1UB6B 3BO8B 1NUFA 3MRJB 3FT3B 2ICWJ 5TE4H 2X4QA 4LDOB 1QR1A 1NC4B 3KLSA 3BESR 1VKXB 3PWJA 3R8BB 2D9CA 4BFBD 5FM8A 3PV6B 1GC1H 4UU9A 3MRFA 4YHZH 4P4RB 1MJ8H 5TDPA 4K7PH 4U0QB 3Q48A 5JXAH 3VD4A 3T0EC 2YEZA 2GT9A 1U8QA 2MKLC 5HDLA 3S96A 1AR2A 1U8NB 2APFA 4U1HB 1HXMB 4G9FE 1FNLA 1ZE3C 2VAAA 4MB3A 1JMZA 5I19H 1S7TB 4K71C 3BPOB 5IMMB 1ZLWH 3OKLA 4DTGH 3N0PB 5DJDB 3QO0B 4HLZG 4MD5B 5E08H 5EULV 4HMCA 3HC4L 1B6DA 4XCNA 2DQCH 4N8VA 4CMMA 4WDIB 1BQHB 4ELMF 3MV7B 5HYJD 3VFUB 2Q76A 3QJHB 1WZ1H 5A16A 1EFQA 5I73B 2V5TA 1CTNA 1LP9F 1O7VA 4U31A 1RJZA 2W60A 1EEQA 1G0DA 3U0PB 1Q0XL 4G6JH 3SE4C 3VXSA 1UH4A 5DR5H 3FRPG 3O6KL 1T22B 5AAMA 1FIEA 2CXKA 4OF5A 3KVQA 1S9YB 5KS9E 1MF2H 3NH7L 4TSAL 4X9IA 1MNUH 2EIDA 5IW1B 3RU8H 1DBBH 3VW3L 1CLYH 1NFKA 3F7RA 1YC8A 4PJEF 4HIJB 5D6CB 4HDIB 5J6GA 1MAKA 1YC7A 2YSSA 4OCSL 4Z7QF 1MHPL 1IBGH 3UYOD 3DVIA 4ZYKB 1FZJA 3RWFA 1F6AA 1UZ8A 3ROLA 3WEXA 1CYGA 4NZDA 2H2SC 4QOKD 4MNQB 1S7UB 4M6MH 4EXPX 5F7DA 1I3GL 1MEXL 2GSIA 5TE6H 1I7ZB 4L3EB 1AI1L 4Z76B 4GSDL 1GC1C 4QRUB 1G7JB 4EVNB 1JZ7A 4WTZA 3RNQB 3FAWA 3RFZC 1WBZA 3T0EE 4E5XA 4XXCC 5DQJB 5FYLD 2JCCA 2DD8L 4N68A 1WCBB 4Q9QL 4IRSD 2EZ0C 5BXFB 5HPOA 2OMNA 1T2QL 4XPFL 2IWGA 1RULL 4KH2A 4K94L 4HK3J 4OV5A 5JW3L 1CS6A 4XH2B 1ORQA 5EU6D 5DD0H 2VR4A 3M1BB 4ODWB 3ZDYE 2V2XA 3OKKA 3IS1X 1DBMH 2ARJA 2V7NA 4JCLA 3H9SD 2B2XL 3HI1B 2AABL 2DQHH 1CXEA 3CXDL 1TETH 1UWEL 4LLAA 2X4SA 1UKQA 4PJCA 2R4RH 2F54E 4R7NB 5JNYA 4KI5D 3OX8A 3JBG7 4X7EC 4Y2DD 5F1IB 1TVDA 4JZNB 4S11A 5EDXA 4FQHB 4LF3B 5IFAL 1YYMH 2ZSWB 1INEH 1OGAD 1I3UA 43C9B 5DMKA 5H94A 5HYQA 1R3JB 4V1DA 3PL6D 5DVLA 3P9LA 1E6OL 4FQLL 3S35H 4G9FD 4N90E 4OLVL 4TSBL 3VU2A 1ZWIB 4XHJC 3ARDC 5D1XA 1KULA 2H1PH 1A7RL 3QCUL 1WC7A 1P5UA 2AJZB 2QTEA 4OZHB 1XCTB 1BOGB 4ZMAT 3LKNB 3U9PL 4QHNA 4Y2DA 4X6DE 2BC4B 4X5XB 4R6UA 1BF2A 4KUCF 1N26A 4NP4L 1J10A 1I8LA 1OSPH 4W70A 3UBXB 4K7FB 4BUGA 1JYXA 1GAFL 1FJ1B 5CBEA 3PQYA 4JN2B 4Z7UF 1F11B 4DGVL 1TFHA 4IOSD 1G7IA 3KJ4B 1CCZA 3FRUB 1G9MH 5E2VL 3HG1A 5BMFL 1H0DB 1OCWL 3WLWD 1IT9L 5D96B 4HWEL 2O5XH 3GIVA 2DOCA 1GZPB 5BVPL 2XZCH 3I3EA 5HGHB 3TM6A 5I1HL 1JE6A 2DQGL 2F19L 4HXAH 4TVPL 4LVEA 3T09A 3WDJA 4E0RB 1U8HB 2B4CL 5IF0A 4NN5B 3LZFL 3KLAA 3MR9A 4OGXH 3TN0A 3G6JE 5JHLH 3SDCA 2CK2A 3DNKA 5MENB 4G80B 1MVUB 2HJKA 4NWTH 2B5IC 1OTSD 3I2CL 5MERA 2GY7B 4WU7A 1U95A 3NCJH 4YHKL 5D7JD 2W60B 3DBXA 4GH7B 2DI7A 1JI1A 3DUUA 4JHAL 1JNLL 3CFDB 5H35A 5EORH 5IIEA 1S7RB 5IUSA 1S9KC 5E7BA 4FQXC 2VL5B 3UAJD 3D69A 1HH9A 2VUYA 2QHRL 1F3RB 5DK3A 4E0RA 2XKNB 1ED3B 2R2BB 4M93C 5ADOH 3C2SA 1MRCL 3RIAF 4K3JL 2DLGA 3QDMA 5I75B 4Y5XA 3MPCA 3L9RB 3IDYC 4PJXA 2NY3B 4Q9RL 1IGFH 5CFHA 3RKDD 1AKJB 2GCYA 2X70B 4Z9KB 5DYOA 1I1FA 1MCQA 4LLQB 4OZFA 1CFTB 4S1DC 2XRAH 2F54D 2Y5TA 4K9EL 1RU9L 2GT9B 5TQ2L 5IIEB 5EH1A 4CVZA 2XWJA 5DGRA 4LF3A 4LAQL 4Z7VA 4NNYA 4AL8H 1U58A 3O2WL 4RMRA 4L29A 1JCKA 2VJXA 6FABL 5CEZL 1JWSA 2DLFH 4AYFA 1UH2A 1EAPA 4ZO6A 1QFWI 4J3UA 4PJIA 5CKGA 2BOCB 4XZUA 1ZA6B 3ARFB 1EBAA 4JM4H 3N1PC 1BHGA 3CK0H 2FLBT 1NAMB 4JY5L 2DIAA 3LRHA 2PNDA 4PRPA 1FL6A 1QFWL 2YBRB 3EYOB 4IMKC 5BS0A 3F7PC 3MA7A 4XH2A 4M1GH 2WUCH 1LNUB 3TT3H 3P9MB 1PKQA 1MHCB 1WZ1L 3ABZA 1W8OA 1NBVH 1H3PL 4K23H 1ORSA 4JKLA 3NMEA 5EOTB 1FJ1A 5CBEB 4Y1AD 1UJ3C 1WAAE 4JO3H 1B4JH 3WD5H 3WUWA 1ONQB 4RGND 1AXTH 4BKLA 4EZMA 1KN2H 1HYRC 1QRNA 3QXVA 5ESAA 3WS3B 2E6PA 1MCNA 5F97E 4MD4A 4EUPH 4Z7OF 2GTZB 3GSNB 5GGUB 4OTXL 5FUOL 5D1ZA 3QDJA 5I8CA 4PRHB 4I48B 2AJYH 1LDPH 4NGHH 5GIRA 3UDWA 3RPIA 1G0XA 1M6OB 2BVUA 5TE6L 4PJGE 3MRGB 2R0LH 2BRQA 5FK9A 3VXPB 1QTYT 4GSDH 3UPRA 4GRMB 1I1YA 4I18A 5IJKA 4NRZA 4XPHH 3GMPB 3D3VE 2DQIH 2BNRD 3TFKC 4YNYA 1S5HA 4RX4D 3A6CH 1KJVA 5DT1H 2PYEA 1VENA 4WEUD 3ARGB 3L5WB 2W65A 1II4E 4HAGA 4AZ8A 5I66A 1OL0A 4PV9A 4PB9L 1HEZB 4ODWA 4JFZH 3RL2B 1QYGL 3TO4C 1EFXA 4JB9L 1CZ8L 5FIEA 3MLSL 4LNRB 1UVQA 1IBGL 3ARUA 5GS0C 1K3IA 2DJ4A 5E5MA 4BZ1H 4HG4K 4NQSB 3ZE0F 3S5LA 5A2IH 5IEKB 4TPRH 1I1FB 1DEEB 5GS1B 1F4WL 4OZ4B 5AYUH 3JWOL 3HNVL 4S1QL 5I8EA 4R97B 4ZFZA 4CMHC 1JV5A 2E7LC 1KIPB 3NFNA 5BO1L 3QDGD 4EI5C 4YXLH 3FOMA 3DX7A 1C5DB 1QSFB 5E8DL 4A6YL 1ZHLB 3PQYD 4MVBD 1JHLH 1YEJH 2F53D 3MBXL 1K5NA 3BPNB 5H35B 1RZ8A 5EOQL 4U49A 1K9TA 1FYTA 1HXYB 5D8JH 3IFLH 5GRJL 1BJMA 3L3DB 3QRFM 2APXA 1TJGL 2EDDA 2EDNA 5IT2H 3B9AA 3QDMB 3GI9L 1DBAL 1RIVL 4HIXH 2GAZA 4FZ8H 1DN2A 4X4YA 2BVEA 3QNXA 3VXOA 2OLDA 4YIQB 2OXGA 1LMKA 3TIEB 3KNBA 3U9PH 2FH8A 4LRNH 3SE9L 1DBML 2MQ3A 2AABH 4CKVX 2E3VA 2R8SL 3ARDA 4GXVL 3ET9F 2PTVA 4NKOB 4CNIA 4WHYG 1KPRA 4IRSA 4CVZB 1TTFA 4Z7UE 3K2UL 1ERNA 4P59L 1KOAA 2NYYC 4JY6B 1RZ7L 1N5YL 1WWCA 1JGUH 5DFVC 2YD3A 4LLVA 4Z7VF 3GSNH 4EBQH 4ZFGL 1INQB 2X2YA 1KPUB 2AQ2A 5ERWA 5EO1A 5A2LH 2NY1B 5BVPH 3FN3A 2P8PA 5HDBE 2XN9D 2VMFA 5C0JA 4PJ7E 3MLXL 4JR9L 1RVFL 2W0KA 2HTKC 2J88H 2LVCA 2PO6A 3C60B 2NXZD 3FOLA 4Z77A 4Y5YB 4U6YA 4JY4A 3BKML 1AGEB 4OCYH 4M6NL 5HHOD 1N5AB 4HUWA 4WWKC 4X8XA 3V8OA 2RB8A 5CIPA 1N59B 1IGTB 3FB5B 1MUJA 4DGVH 2RFXA 3G5ZB 3RRQA 2W65B 4KJQC 4PJ8C 5E2VH 4HS6A 3QULB 5IB2A 1AD0A 1AE6L 1GGIL 4U1KA 2VXSH 3EYVA 1ZHNA 4LPTA 1OVZA 1M7DA 5GSRB 1HHKB 4MWFB 1HSBA 5I8KL 1MY5A 3U83A 2DWDA 3VD5A 4F58L 2IADA 4R2GB 4PRHA 2NNAA 3RL1A 3SCMC 5BZWA 4JO4L 1JJUA 2FIKA 3Q3GB 3HMXH 2LFGA 4QGYA 4QXGH 5TDOA 3VG9B 3EOYG 2H2PC 1TJIH 3QP3A 1FVEB 5B39G 1DE4A 1SVZA 2Z9TA 1MIMH 3GKWH 3IXTA 4JFEA 4XCEA 4ZFOA 4UT6H 3MV11 1AJ7L 5D96C 2VISB 3BT2L 4CU8A 2J8UB 4D0DB 2Q86B 5B38B 3RDTA 5JR1L 1QKZL 1Z5LA 2CKBB 1CL7H 2FHFA 1WBZB 2ERJB 4HPYH 1CLZL 4YNYB 3LB6C 4E41A 4NNXB 1M05B 1R0AL 5JW4M 1NCBL 4Q9CA 1FFOA 5IROA 4R97C 2X9YA 1BD2E 5E1HB 2DI8A 4W6XB 1YEGH 4O02H 4OUOA 5FK9B 5TE7H 3VXPA 5L6YH 4KAQH 2B5IB 4Q9RH 2I9TB 4HH8A 4ZUUB 1T5XA 4ZS6D 2B4CC 3GMNB 3HPLB 4MQTB 3SE4A 3EOTL 4PJHF 3DYOA 4EQ3A 4F9PA 5HD8C 4TUKL 5ECJE 1W8NA 3B9EA 1RU9H 5TQ2H 2FSEB 4NQED 3TN0D 3CFIC 3PGCA 4GBXB 5E2JA 4F2MB 1FNHA 4MJIB 1FZKA 5DO2D 2X4SB 4R7NA 2JELH 1DN0A 1FORL 4MAYB 3OX8B 4ZD3L 4EN3B 4ISVB 2E27L 5FKAA 4P2OB 5L0QC 4QRPA 2F53A 3PWPA 4KJYB 4OD3H 3W9EA 2B8OT 2VKWA 1CFBA 5AZ2L 3W0WA 1PJ9A 5JA8B 3ZKXB 3ULVF 4CBPA 3QDJB 5I8CB 3HAEH 1WT5C 1IC1A 1U3HA 3JUZA 5FCSH 4WTZG 1O0VA 1J05B 5I17B 1ZHBA 3QPXH 3L3IA 5HPMB 2WWKO 3KPPA 5CBAA 3ARVA 5JMOC 2P47B 4WI7A 4YHML 3TT3L 4S1SL 5C0EB 4NGHL 4IBLT 4JLRA 2YK1L 4IJ3C 5D7LB 3C6SA 3BHBB 3H3PH 3MGOB 1H3PH 4P46A 3GRWL 1I85A 3IFNL 2JCCE 1PY9A 2NY4B 1S7UA 4TSAH 3NIGE 4JRXE 5IMOB 5J12B 5KG9B 4WJ5B 3CUPA 5FV2A 1EIBA 3BN9C 3ECBA 4PY8J 1DE4B 1FN4B 5IR1A 4LSRL 1QO3B 2A73B 3V9FA 2DICA 5SWZE 3MLSH 5EU7E 2OL3L 1CXHA 3K8LA 3LKRB 5I74B 3IDIA 1N5AA 4HUWB 1INDL 4OTXH 3U9UB 2RGSA 4MXQD 1UYWH 4NQCE 3RNKA 5IKCA 2BNUB 4LLQA 5DHXB 3OAYH 1KEML 5IVNA 4AIXA 5TFSH 1UJ3B 4WI6A 2WAHA 3FHQA 2P24A 1TCRA 4P46D 2I9LA 4PJ8B 4G43B 3FO0L 3KPRE 4UT7H 4LAJH 4G42B 2X44D 2YPLA 1IJ9A 4JFDD 1X5YA 4HFUL 3RY6A 5IR1B 1TNMA 5EOCL 1FH5L 5MEPB 3A6CL 3BQUC 1J8HE 5CD5D 4MVBC 5ILTH 3CFKB 4L4VA 3RTQD 2JF1A 3VGEA 2FIKB 3Q3GA 3WN5B 3QIWA 2HJLA 4PJAB 3KLHD 4EIZC 5JLZB 4MX7A 3CDCA 4IS6A 3VFOB 1BIHA 4ZPVA 3TH3T 1I9JH 4N0UE 5HI4C 4NDMA 4BK5A 1A1NB 5IMMA 1V3LA 5KSBA 1FC2D 3LOWA 3NZ8B 5C08B 4OZHA 1FFQA 5EFIB 1JGLH 3ROOB 1OD9A 4I0KA 3T0VA 4X4ME 5F7EH 3SGEH 3U46A 5MEPA 4NBZB 4K3HA 1INQA 2Y4SA 4JM2F 1B0GB 1P84K 2L7JA 1CK0L 2VLKA 3V6FA 3AAZA 4HIEB 4RFOL 1I7UB 3DUUB 4JHZA 1RZ7H 2XQYK 5IK3B 3VFSA 1N5YH 2OQJB 1D9KB 2C4XA 3TYFB 4HWNA 3ARGD 1EHLL 3VWKB 1HQRB 4HCRH 1J0IA 3LY6A 2N56A 4MJ6A 2IQ9L 3HMWL 4N8PA 3WLBA 4PD4J 32C2B 3EO1A 1E4JA 2XKSA 4YHLL 1DBAH 4NZRH 2H6PB 4TYUA 1WWAX 4XXDA 3WMSA 5AG9A 4ONHA 5F21B 2GJ6E 3ZE2E 3MYJA 5C0GB 3IYLW 1Y18A 3WS6A 5LCVH 5EO0A 1T5XB 4AIZB 4XP9H 4HJGB 2WUBH 3KPLB 5DQDH 1KCVH 1J8KA 2VLLA 4XBGB 2VWEC 2IBZX 3QUYD 1KGCD 1I7RA 1IKNC 5EIIA 1P7KA 1J05A 5I17A 2PUQT 1A6ZA 3HTLX 2M2DA 1QBAA 1JGUL 3GSNL 4LRIC 4QRPB 5D7JA 5T33H 1CGTA 4M7JH 1WIOA 3HNSH 2J4WL 1Z0NA 4GAGL 1MCLA 4UV4L 2VR5A 3ULVE 3IFOB 1NGWB 3G5YB 4F2MA 1W0YT 1A4JB 4XBEL 1TZIA 5IEKA 2B4CH 4HS3A 4OZIB 1YPZE 1FNGB 3SJVB 3OB8A 5C6PB 1KNOB 4XP1H 1OP5K 4MNQA 4P3CL 1NEZG 1AHWA 1LO4L 4PG2A 1EFXB 2VOTA 2MHAB 3HCVB 4L8CA 3KYKL 2CLRB 1RK1B 4H1LB 5KW9H 4U1GC 4XAWL 4UDTA 3LN5B 2LTQC 3BT2H 4JPKL 5D7SL 1MFCH 4MD4B 3ZO0A 2P5WB 5CZXC 1U8LA 1OD7A 4C4KO 1I1YB 5I74C 1T0NA 4KI5F 5FHAH 4YXKL 4KQ3L 1RJYA 4QTHB 4OSUH 1NAML 5MHSD 3RWEA 4Z7VB 1NCBH 4TSCL 4UV7L 5GZNC 1FZMB 1Q9WB 2IAMA 4LCCA 3QDJE 4X5WA 1H3TA 4L3CA 5FGCE 3BVNA 1AO7D 4DEPC 1UH3A 2D7NA 4WO4D 1MJJA 4WWKB 1IKFH 2GITA 1JNJA 1N6VA 4ZAKA 1B0RB 2C5DC 2GSGB 1F4AA 1D5BA 1TJIL 3DX9A 5D5MA 4EXKA 1MLCA 2NX5E 2JELL 1QBMH 1QQDB 3V52H 3W9EB 4L3EA 3O6FD 5GGSY 1QSED 3O2WH 4IOIB 2PYEE 1TTUA 4JFXB 2EO1A 3MLPA 4JFOB 5ESQB 5J11C 1I9RL 3KXFA 4YE4H 5CILL 5DJ8A 2WP3O 1D3CA 3CK0L 4I2XA 4WUUD 1OTTC 3D39D 2B7DT 4NZUH 2YOCA 3ULUC 3SCMB 4XXDB 4X9GA 4Q2ZB 1HNFA 4F33B 1E28A 3D0LA 3OBAA 3VWJC 3L3HB 2BHUA 1Q94A 3CU1A 1A1NA 3QUZB 5DJ2B 4RFEB 1X5FA 3QIBD 3L6FB 3NIFF 4LP5A 4NRYB 1JK8A 3NIGF 5L7XL 5CJ8A 5T5FH 2OR9L 4CVUA 4OFVA 5FECA 3GSXB 3ZTNL 5T1LD 2WW8A 1T2JA 5E99H 3FRPA 2X4TA 4FQ1H 5JW4Q 2VL4A 3FO2B 2DYPD 1ULVA 3WJLA 1X9QA 4QT5A 3SQOH 5F3BB 1F2QA 4PJFE 4OT1H 1FIGH 4ELKA 3OAZK 4S1RH 2EDXA 2XZZA 1OSZA 5D1XC 4FTVE 2V7HB 5GRUL 3B9KB 3IU3B 2ZG3A 4I3RH 4IIQB 3H3PL 4EUPA 2R0LL 3TWCL 2YN3A 3MGAA 2OL3B 2FB4L 2ADFL 2V2WA 1U6AL 3HR5B 5GS2H 2BNRE 3GIZL 5LGJA 2DL9A 2FRGP 3X14B 1JZ3A 2DQIL 1CD1A 2VLKE 1IGTA 3EW3B 5FKPA 3OKMA 1H8OA 1T21B 1R3KB 2CRMA 1DBKH 2WQ8A 1WWWX 4Q0XL 1PZ5B 1R24A 3CZFB 4GG6F 4N1CA 1K8DB 5DMYA 3NZ8A 1CD8A 4YFDB 4NPYA 3DXAD 4QRQA 1KB9J 4PJEA 4XI5D 5DWUH 1I9EA 5E9DA 2CRYA 1VFAB 4N90D 4Y89A 1JRHL 3G5VB 3ILPB 2EDTA 3V6OE 3BGMA 5E6ZA 5F9AC 5TFSL 1R5VA 4JFQA 1C5CH 2VLME 3FT4A 4XT1C 1BWMA 5GISL 5J12C 1MCEA 5EZJB 4HUMB 5F7EL 5HI4D 3D18B 3C8DA 4BSWB 2A6JB 4RMVA 1CK0H 2V9QA 3DGGA 4PJ9D 5DA4A 2UWEA 5EBMB 1T5WB 3P4OA 4C54A 2QLVB 3CIQA 3RVWD 1SJXA 4M62H 1FH5H 3H9ZA 3QQNA 1EXUA 4KKBC 4F7MB 3MREA 2VLRE 4IRSB 4LVOC 5FGSA 1FRGL 1KENH 3GKZA 5DGQA 1MFBH 3PDOB 3TPKA 5ESVA 3B2VL 1T66C 5GS0H 3RWEB 3KPQB 3FB7B 5AZEL 12E8H 5FGRA 1FZOA 2UVEA 1DQJA 1TJHL 3M17B 4NZRL 3D0LB 5AUMB 3MRHA 3ZE2F 3CLEH 1ITBB 2ORBH 5T1KB 2P5WA 2GW5A 2OTWB 2B1AH 2EC8A 4GKSB 3AS1A 5DC9B 5DHYA 1YPZA 5D7IB 1ZANH 5KSVA 3C8HA 4PS4L 2R8SH 2E9BA 1B0RA 4H25B 1CQYA 3T0EA 3TBSA 1HINH 4I2XB 4AIOA 5IMOA 1PSKL 1ITCA 2X4UA 3CFEA 3DUSA 4FQCL 1W2KT 4ZFGH 1NFDE 3C5JA 2D31B 2AXGB 4CADA 1XF3A 2PKDA 3FQUA 1YEFH 1P9MA 1OM3L 4BSVA 1P84J 4G9FB 2NY7H 3HNSL 5T1LA 4FZEH 1Z2KA 1KLUA 3C6LB 3QUXB 4YBLB 1KYOK 3HMWH 1FCGA 1B0WA 5I71B 1GHFH 1SYVB 4G8GE 1KCUH 4FABL 3HZKA 2FJGB 2P5ED 3IKCA 3HRZA 4PLKC 3EYSL 3V5HA 3ES6A 1NLBL 5TH2B 1W72A 1YJDH 3HB3C 4YBQD 4F15B 3ILQD 4NM8L 1FZJB 1HILA 4HEME 4P3DA 4WHTB 3FQUB 2ZOLA 3VWKC 4YBQC 1OAUL 1LEGA 6CGTA 3OF6A 1JNHB 3CSGA 4NQXB 3AS3A 3VFVB 4JFEB 2E6QA 4XCEB 3OJDA 4WVRA 1IAKB 4LGPB 3QFDA 3CCHA 2QBWA 1XR9A 3I3BA 2XTJE 1GGIH 1S7RA 4F8QA 1CGSH 1ZS8B 5I30L 4IIQC 1XF4A 2J8UE 4Z7NE 1BIIA 4FFZH 3VXME 4DVRH 1JI2A 2OSLB 1RJCA 4LKXB 4LARL 1P4IL 4AT6A 4OV6F 5C9JA 5D7JC 4G8EA 3WSQH 4FFVC 2BSED 1BREA 3FB7A 3IETB 3HE6B 2ZCKL 3MLRL 3CDYA 3WJLC 5KS9A 5E4EC 1LHZA 3FB8B 1LK3H 3CXHJ 3F6LA 1J5OH 3I75B 3KS0H 3HG1E 4MDJA 1IGCH 4ZNEE 4LQFH 2YXFA 1A64A 4PJEB 5DUPL 4YHPA 3MFFB 4ERSH 4I5BA 5ISZA 3RZCC 4NC0B 2BXZA 5GJSL 5ITFA 1AGCB 1KGCE 2UZYB 3D85B 4KQ4H 4PJ7B 3FT4B 4WGWB 4M61A 4NN7B 1YEGL 5J4MA 5C1MB 3D18A 3DVGA 1AKJD 4G42A 4XX1E 1B88A 2W9LA 4Z7WA 1PBYA 1RJLB 4TNWF 2WBJD 4C56B 1WF5A 3DIFB 3EKCA 3QNYB 2Z31B 3BP4A 1KCSL 1V7MH 4OFYD 3WE6B 3JTTA 2YS4A 4XPBL 1BM3H 3QHFL 1TCRB 1XCTA 3HUJB 4LLMA 3MRIA 1JUFA 3GNML 1G7PB 5SWSB 5JXEA 1KIQA 4GO6B 4LKCA 1FDLH 2KL6A 1GYAA 1AC6A 2BNRA 1LK2B 4X7SH 4QCIB 3RBGA 3ZE1E 2DF3A 5I6XC 4DWHA 3EHBC 3PHQA 4PBVC 1JVKA 2NW2B 5IHZB 1YNTA 2MJWA 3BSZL 5IJVB 4NZUL 1YA5A 3FZUC 3EHBD 3LVEA 4M48H 2IAND 2DQCL 1F5WA 1MCFA 4TUJA 4Z77B 1AR1D 4ZPVB 3UTSA 3UTPE 5JIPA 2OJZH 2DMBA 2YK1H 2Q20A 3ARED 4PRBB 5GRXG 4NJ9L 2DN7A 3SDXB 4HH9A 1VFMA 1MOEA 1OPGL 3H0TA 3PL6C 2XNAA 3O3EA 3IDGA 2BY3A 5I9QC 1U6AH 4TN9A 5IW3A 4F57H 3N50A 3NH7H 1WC7B 1YMMB 2CDGB 2HVJB 5FUCE 4U05A 1CE6B 2G9HB 4LASL 4X7FC 3RL2A 3VXRE 2DKSA 3TEUA 4HKJA 3WNLA 4YHIB 3QJFA 3WCYA 3VFMA 1DBKL 2ICEA 5A3IC 3ZKND 5H94B 3BXNA 4U1LA 4E5XB 4QHLB 2P5WD 4XBPA 5LAXB 1G7LB 3HE6D 5L8KB 7CGTA 3VFRB 1DL7L 1NEUA 4XNZB 4PG2C 1I75A 2ZOLB 3C5ZB 1IGML 4J8RB 4AH2B 5F9JB 1KACB 4LNRA 2F54A 3IAPA 4WCYH 2DMKA 5GXBB 3GJFB 4DUWA 5HYQB 3NZHH 4RA3A 3KDMA 1N64L 1KB5B 1RZ8B 3BKYL 1VADA 1PFCA 4NO5B 3GHEH 1E4KC 3GIZH 5CS7A 5EOCH 5T1DH 2VIRA 4ETYA 1KFAL 4PJDB 4NZJA 1XGQB 3FOMB 3Q6FA 3MNZB 2FJGA 3HC4H 3MJ6A 2BVYA 1YY8B 4XVUC 4UAOC 2I25N 1MSPA 3X11A 1RUKH 1A6WL 1NUGA 2Y36H 5D7JB 2IFFL 4GRLD 1YMHA 5A2JH 5HGBA 3PGFH 3WIIH 4KRPC 2ADIB 4HQQH 1IGIH 3R1GH 1IEHA 2I07B 2P8MB 5F88B 4X0KA 5JW4R 4M6OH 1JYVA 3LQAC 4LLDA 1JGLL 5FV1L 5F7LB 2XA3A 3VW3H 3BZ4B 2EDHA 5ACLA 3HCVA 3EYOA 2NY2C 2IJ0C 3E2HC 3D3VA 1FZMA 2X4NB 1G9MC 4P2OA 2HH0H 5ABDE 3ULUF 1HN1A 2R9HC 3AU1A 2W9EL 2P42B 1CT8A 4M62L 1F00I 1HHKA 1U8LB 1S7TA 3ARDD 4JKKA 2NY2D 5DHVA 3O4OC 4UIMA 4KMTH 3HC3H 3WFHB 3MJ8A 4ZO9A 4Y16D 2WV3A 4F7TA 12E8L 4Y4KA 1MLCB 3QNZB 3W81A 1TJHH 1UT9A 1HH6B 2J8UA 1X4YA 2G60L 5A16B 1RZJL 4XWOC 3B2UC 1MHHA 2FHBA 1A4JA 4YPGB 4OJFL 4PS4H 2AJSH 1EAPB 3PE9A 3VFRA 4NP4H 4MJ2A 1XGPB 5FGBC 4XWOD 4QTIL 4PPTA 2X05A 1HYSC 1I8LC 4K94H 4P2QD 3SGDH 3BZFA 3ULVL 1G0YR 2Z35A 3TCXA 1XGYL 3BP5B 1TVHA 1K8DA 2JJTA 4UV4H 4BFIB 3PHQB 3CVHB 4XBEH 4P4RA 5IHZA 2P5WE 3O3EB 3JTSA 1CD1B 4BQBA 1KIUA 3D39A 4MQSB 1U3HC 5CWSA 1FLTX 2GTWB 1WITA 4Y88A 5JHLL 3V79C 1WLHA 5D5ME 4F7PA 3EYSH 4DZBA 4NT6A 4PJ8A 4RGNC 1M7DB 3ARSA 2VAAB 2YRZA 5JA9A 1LE5B 3KYKH 5F93C 4IIQA 2X89A 1WBYB 3QG7L 1QOKA 3Q2CA 3OZ9H 1TDQA 1YNTB 1A21A 1VERA 4JJ5A 4XRCB 4APQD 4DVBA 2PR4L 1N7ML 2JKXA 1A5FL 2ENYA 3G6DH 3BH9A 1OAUH 1C5BH 3NA9H 1OSZB 1CICD 4LMQI 2N7BA 5JLZA 1MRCH 2WLYA 4NCDA 3OHXB 4ODXA 3QUXD 1R3IL 3QXDA 3G9AB 5JDJA 2FCBA 3IDJA 4FQPA 5IHBA 1CFTA 2BVOA 3O2DH 2VDKL 2A38A 3NPSC 1QNZH 5JQ6H 4R2GD 3UEZA 4PRIA 4XNUL 1IC4L 4WGVB 5DD6B 4JDVA 3VFWB 3QQ9C 1G9ML 3CDFA 3OKOB 3N06B 3GM8A 5FAAA 2O5XL 2FX7L 3TO4B 1JL8A 3K74B 5LGHL 2WK2A 3RY5A 2FNBA 3PQYE 5C0ND 4FTVD 4WU5A 4KRPB 4HIIA 4QXUL 4Z7UB 2BSSA 3LZFH 4HUNB 4U1JA 4WUUE 1DQDH 1L7IH 4N8CL 4S2SB 2QQNH 4CW1A 4NN5C 4POYA 4M9OA 2I9LB 5DJ0A 2F53B 4KJYA 2Y1VA 5EA0L 3QEGL 3RDTC 4O51A 2N1KA 2R1XB 3UPRB 4OUUB 4JG1L 2EDLA 5D2NB 2WUCL 1K8IB 1DJSA 3U82B 1FPTL 1FNAA 1J1OL 5E4EB 3W11C 5GQBA 3K80A 3LV3A 3I02A 3DYPA 1YEIL 4P4KB 1FLRH 1BQLL 3HI1A 3BN3B 4I48A 1LEIB 1ADQA 2P5EB 3G08A 1F2XK 5GS3A 3QAZC 4P2RE 3SGKA 5I0ZA 1KNOA 3MXWH 5EIQA 2R29L 5TH2A 4C55A 1IAKA 5CD3A 2VC2L 3TVMB 4X9BA 1NDMB 4FQ1L 2R56H 4ACPA 3IDYB 4MS8D 1B4RA 1SEQL 1FC1A 1JYNA 3TNNB 2ITDB 3HE7B 4LSTL 2N4IA 1TPXC 1F4XL 3LEYH 1ODAA 1KJVB 5B39A 2CLVB 1RIHH 4Q6IC 4PJ7F 4IDLA 2EIBA 2Y72A 1YEEH 4M1CC 3M8OH 1IGMH 4LU5H 2AJYL 3CFEB 3D0VB 3MNVB 2MCPL 1G9NL 3MLVL 5TPWH 3UPAA 4Z76A 4WCYL 4Z7QE 1SMOA 3MZGB 3SKMB 5LWYH 1VCAA 5E5MB 5CEZH 2ICCA 1CICB 4XMKL 5F6HJ 3HPJA 1IM9D 5I1CL 5JZ7C 5DMIH 1U91B 4HUXA 3V0WH 2NY1C 2PYEB 2IMMA 4LKXA 3RWIB 2HMIC 4MSWA 4JZOB 4JREC 1S7SA 5I66B 2XXCB 1AD9A 2NPLX 4JY5H 3IGAB 1ZEAL 1QFWH 4P2RA 2K1MA 3TO2A 4PRDA 5FO8A 3S7GA 3MJ9A 4HS8L 1JFQH 1KC5H 4NQEE 3AREA 1KN4L 1H8SA 3OKKB 4JDTL 5FYKL 1KLUB 3C6LA 4K23L 2I60L 4HUUA 3HZYB 2Q1EA 3BRGC 3WIIL 4FG6C 1JGEB 4OCMC 3T65B 4P3DB 3R1GL 5SX5H 3HPJB 2BSSB 5KSAB 1FNGA 3U79A 4N0CC 5DMGC 2XZAL 4OV5B 3QI9A 5CP3A 3WD5L 5D5MF 2AQ1A 3PWVB 3NZHL 4PGBB 1MWAA 4PG9B 4JFFA 5C0FB 4YDKH 2BERA 4KK5C 5HGAB 3UMTA 2P8LA 3EYQD 4BFGA 3PWPE 3NTCH 5GPRA 1X5ZA 2MWCA 2YA1A 2ESVB 4Y4FC 5ENWA 3E6FA 5IESH 4ODHL 4XCFH 2J5LC 1QFOA 2W0LA 3SDCD 4RAHA 3FQRA 3P73B 2YN5A 3GSQB 2ZCHH 3WV0A 2Y36L 5DSCB 5JMRA 2YEZB 4IRJC 4ODXB 4YO0B 3P40A 2NLJB 1BJ1H 1MQKH 1BJ1J 3DBXB 1IGIL 3ROLB 3WEXB 2IAMC 4LCCC 1LGVA 1F90H 2QADB 5D1ZC 3SE9H 1KPRB 2MOVA 4DAGL 4M6OL 1H5BB 2HN7B 1YEDB 3RUGF 2L0DA 5ID0A 3MLUH 3L7FB 3QR2A 4FQQA 4HIIB 4U7KA 1MVUA 2HJKB 4JQIH 2IANB 2Y5TB 4MD0B 2DS4A 3W39A 5KSUA 2C3HA 4JB9H 3VXRB 4FQCH 2XV6B 5FO9A 5E8PB 1V8HA 2IQAB 2W9EH 4PJXB 4W4NA 4P2RD 4PIRF 1TTGA 1XGYH 5CIPB 1HOCB 5JHDE 1ADQH 4BQCA 3EJJX 2YA2A 3FB5A 3RY4A 4XCYA 5GRVK 3CSYB 4P5KB 4UIKL 3KPSA 4I0PB 1T0PB 4WHDA 4PRHE 3HLAB 2CO7B 2D03H 3CUPB 1NMAL 1DUYB 5HHNA 1UCBH 2J6EH 1IC5H 2VZ3A 5HTSA 1K4DA 1Z9MA 1RIUH 3IU3A 1ND0A 4HKXB 1Q1JL 2ARJQ 3SO3B 4ZODA 3TT1H 4IHOB 3QXWA 3UTZB 2BNRB 3MV9A 4XRCA 1YJDL 1ZSDB 1DDHB 3K81A 4RFEA 3RP1A 4D0CB 4BZ2H 3UTOA 3TZVB 2PR4H 1ED3A 2R2BA 4J3TA 3QUKA 1I1RA 4MNQD 5EBGA 5FO7A 3STZB 1IGJA 3GI9H 4Q74A 4KUZL 3BMVA 4YBHA 3HFML 3DV6B 5MP6L 3ETBF 4GT7A 4LIQH 1LK2A 3DI2B 4YAQB 4NKDA 4M3KB 3PWJB 1NC2A 3G5XB 3NAAH 1NSNH 4UU9B 4R26H 1R5IB 1S9VB 4FQXD 4KJQD 1HHIA 4HD9A 2XA8H 1E27B 3BX7C 2VDML 5FOBA 5JW4N 3WIFB 3B9DA 2X4OA 1CIDA 4HZLA 1PDKA 3TA3A 1KTRL 1VACB 5FECB 4P59H 3MC0A 2QR0A 3DVNA 4EBQL 2ZCKH 5GIRB 3RKDC 3BHBA 3QQ4A 4LLUA 3D3VB 1QBLL 4KK9D 3VFOA 5CEYB 4KTEL 1IZKA 1AJ7H 3M1BA 2YUVA 3GJFH 4GKNB 4MA1B 2DMCA 5EU5B 1IGCL 1D5BB 1QKZH 5DJ8B 3QDMD 3HG1B 1FYTB 4PJHB 2HWZH 3L5IA 1B9ZA 1BJ8A 4KK6D 4QRTA 3TA3D 1A7QL 2A6DA 3LEXB 3C60C 3OKDA 3HA0A 1FL5B 1XF5B 3T3ME 2AJVH 3SKUD 3KXFB 3QUZA 5DJ2A 3GSWA 3TC9A 3HZYA 1KBGH 3OPZL 5IFJA 5I1LA 5IB3A 4OZGF 5KVFH 2E7BA 4GAYA 2F5AH 4EQ2A 4M6AA 3UTTB 4Z0XB 5FM5M 4P2RB 1IC4H 1G7HA 2NTFA 5JOPD 3QHFH 1BM3L 1WWBX 1LILA 3LDBB 3FMGL 1MHCA 1MCHA 1A1OA 5JDSA 5F1KC 3HAEB 1FORH 2EXWC 2NZ9C 5I76B 5LGHH 5BVJA 4W68A 2EDRA 1F6AB 4Y8DC 2I07A 3SDXE 2LV4A 4LHJB 2FWOA 5DHVB 3MRNB 4OI9A 3GJEB 4JO4H 5CJXA 1F4XH 3BSZH 1RZKH 4R4FL 2OZ4H 4DFIA 4L1DA 5L88H 4KKAC 1M6OA 5T3XE 2A1WL 2XTJC 4G8FB 2MCPH 3U0PA 5GGRY 4D8PB 3MLVH 5TPWL 3BIKA 1DEEA 5GS1A 4YDIH 1NANH 1KLGB 4Y5VB 1EJ6A 3QHZH 2ERJC 3L3GB 4Y8AA 1MREH 5EZLB 5I16B 3IFNH 4KI5C 3KG5A 1OB1B 3PIQB 1H15A 5IBTL 5FYLH 1Z6JT 4BH7B 2H6PA 4GG6A 1EJOL 2BY2A 4BH8B 5D70H 1RK0B 1I1AD 2CLZA 2PXYA 4OLYL 3V0VA 4L4TD 3C5JB 4U1KB 3UTTE 3P4NA 1OWRM 2YPVL 4LSRH 1KC5L 3ULSB 3RZCA 4PJXE 4UDTB 1KN4H 3IRZA 1HQRA 3I6GB 5KANG 2Y7QA 4R0LA 1HI6B 4N8VG 5J1TC 3BP6A 5EUKA 1RZJC 2FD6H 4U3XA 2NY6B 1LNUA 1UXSB 4F3FB 4OZHE 1HHHB 2VE6B 1F97A 3D2UA 1EEUA 3KWWB 4MJ5B 3QAZB 4K7PY 4PJAF 3GMMA 3VGBA 4XMKH 4P99A 5I1CH 1ZGLM 2CDFB 3D2UD 2WWMD 1QRKA 3TVMC 4DOHB 4JEGB 5KSBB 5F9DC 5IFJB 4HFUH 5CD5C 3IXAB 4XB8A 5GGSA 3IAGC 3PJSA 1ZEAH 4BKLB 3DIFA 3QNYA 2J8HA 5B4MC 1MI5D 1WGOA 4HBCL 3TNMB 1TPXB 1QRNE 3QPXL 2DQUH 4CDHA 4Z0BH 1G6RL 3ZMRA 1RJZB 1I8IB 4HS8H 2MKWA 3ARFC 3MTRA 3WFBL 1K85A 2EC9U 3T77A 4JDTH 2CR6A 4OZIF 3BQUD 4D0BB 4IJ3B 2M8XA 3CC5A 5IHLB 3VWKA 3H42L 4X6DA 1I9JL 5D7KD 4Z78A 4NO3B 1F90L 4XVJL 3F7QA 3NCCB 5D2LB 1MJUL 1X5XA 2V2TB 3C9NB 2IADB 2XZAH 5AAWA 2DWEB 2QR0B 1T04A 4M7LL 2IQAA 1IAIM 4ZUWB