2P7TB

Crystal structure of kcsa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB-A
molecule tags Membrane protein
source organism Streptomyces lividans
publication title Crystal Structure of KcsA mutant
rcsb
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB01
2ADGA 1U2CA 4KJPD 5HGHA 4MXQC 1IVLA 3LN5B 3D3VB 4L3ED 1J5OH 4MD0A 1A0QL 4HCRH 4JM4L 2NTSP 4J12A 4MHHG 4NM8H 4YDJB 1NUFA 2W0LA 1L9NA 4K3JL 1JGUL 2PTUA 3HUJF 4JFEE 3ZE1F 1AO7D 32C2B 3JWDL 4HLZG 4Q58C 1IAOB 3CMOL 2BNQD 2X1XR 5IFAL 4F33A 1OTTC 5DQ9A 4PJ8C 3NIDF 4WY7H 1MAKA 4KJWD 4HKZB 3TPKA 3I9GH 5F9JB 5D1XB 5DS8B 3SQOL 1A4JB 1EAPB 4FQIL 1Q1JH 5ITFB 5IP4A 4UUJB 4U1HB 2WWMD 5D71H 1NCBH 3MRCB 1U8LA 5DEZA 2PETA 1N5YL 3OKEB 4BQ8A 5I1CL 1QLFB 3WSQH 3MBED 5TFSH 3DV4B 1IKFH 3PP4H 4K3GA 3IRZA 1MREH 4CVZA 3KS0H 4LLWA 4LKXA 4TYUA 3T0AA 4R0LC 1I3UA 1W72B 4AG4L 2Z93B 4Y4KB 5AZEL 3TO2A 5HHPA 5K9OA 1VENA 5CWSB 1WFOA 4HBQA 2R2EB 1PYWB 1F3DH 4H0GA 2ICWI 1DANT 1P84J 5E8NB 4X7FC 1LILA 4ELMA 1RUKH 3ARPA 4K3EL 5ECJE 1R5WB 1FGVL 3AREC 2V6HA 5EZOL 5IROA 4L8CA 5IFJA 3G5YA 3I6KB 3NIGE 4ISVA 3REVA 4EVNA 1U0QA 4XBEH 4RDQF 1CTOA 5C8JA 3VXUD 3CZFA 4PY8J 3HMWL 5TQ2H 1H3WM 5EA0H 4Z7QE 1BFTA 1VA9A 3MV9A 1WWWX 4N68A 1A6AB 2AABH 4IMLB 5HVFB 4IRZL 1KYOK 1PDKA 1EXUB 4KKAC 1FL3A 3X11A 3BE1H 4AT6A 4PLKC 2OSLB 1RUAH 4XP1H 3MLPA 3AY4C 1YQ2A 1LHZA 4BFIB 5IB3B 4PY7A 2OMNA 4EI6B 4KPHL 3RGVD 1Z9MA 4AL8H 1OGAA 3FQWB 2FO4A 4NQEB 1A7QL 1BLNA 1G7LA 2ADJA 4LSUH 5EFIA 3RA7L 4MSWA 5AD0B 1TNNA 3LQAL 4OCMC 5E1AB 4X83A 3CLEL 2GUOA 3CSBA 3EOBB 2VQTA 4F58H 4S1DD 5JUEL 3QEQA 3SGEI 3B9VA 1XGYH 1X6NA 1IMHC 4WU7B 5C71A 5IM7B 2QADB 3U2SA 1EERB 1I4FB 3GM8A 1J8HD 2XKSA 3ZE2F 3EDJA 1P4LB 2WZPD 2ZG3A 1XGPB 4R7NA 3TA3D 1MQKL 2EZ0C 5HHOD 5JQ6L 4P5KA 4RAVB 1JWSB 3S35X 4Y4HD 2DTML 4S10A 4APQD 3LSOB 4U2ZA 4JPVH 1O7VA 3ARSA 3VFOB 2ITCB 4R8WL 1DZBA 5IBTH 4CADB 1YEGL 1U8JB 4N5ED 4XMPH 5B3JF 5K9JL 1XZ0B 2AV1B 4YPJA 1YYMH 4CN6A 5JIHA 5CD5D 3WFHA 4ZO7A 2F5BH 2GJZB 1JGLL 3SN6N 4ONGH 5FIEA 4XCEA 2XRAL 2JIXA 2BOCB 1T1ZA 4ORZC 2DQDL 4MDIB 4W70A 3RL1B 3KYNA 3LCYA 3VXRA 4LEXH 5F1IB 1AHWA 1WT5C 1JK8B 3GMOB 4JDTH 1KB9K 1V5JA 1MRDH 1MVUA 3U36B 2H2PD 3HC4H 2VQ1B 3GGWA 5IR1B 1Q94A 3G08A 2WMPA 1ZHLA 3RZCD 5JZ7C 3KHQA 3MNVA 2AXGB 1OGAD 2C1OA 2HJKA 3ZSTA 4XZUB 2WBKA 5BCAA 4LKCA 1AJ7H 1XCQB 2HMIC 2BX5A 4BKLA 3IFPA 4HLJA 4PR5B 1A7BA 1F4AA 2LVCA 4OIIL 2XN9B 3U7WH 2VXQH 5DVKA 4PRIA 4JFXB 5FYKE 4KROB 4YHKL 4D0BA 5J6GB 1OB1A 1FE8H 1MI5A 1U3JA 4GJTB 4F7TB 1MHEA 4TVPH 3OTTA 1QKZL 3OJMB 3NZ8B 3F7YA 4K23L 4ODBD 4NFCA 4PRHB 3T09A 3LAFA 3O81A 1KEMH 4JM2B 3BEVB 3CFEB 1MFAL 1YEKH 3O8XB 1SEBB 5KOMC 1XF1A 5DJXA 1AKJA 2M8XA 4P4RA 5KSVA 3UTSB 1D6VH 3WKNA 1S9YB 2AXFA 4M02A 3EGSB 4Q2ZA 1JYWA 5D2LE 1B2WH 4J6RH 2DQCH 3MRGA 3BP5A 5FYJH 3HB3D 3B6SA 4B53A 4WU5B 3KLAA 3P4MB 1E4WH 4DUVA 2NX5D 1ZVHA 4GRLB 2XTJE 5E5UB 5TQ0L 3OZ9H 2JJVA 2IPUK 4HMEA 1WZ1L 2EIZA 3LB6D 4EIZC 4U31A 5JMOC 4HPOL 1ORQB 4XNQA 35C8H 4POYA 2ADGB 4UI2A 4P3CL 1RZJC 3FQXA 1KPVB 5DXWA 2W91A 4Y0GA 5DMGC 5HI5C 3QHZH 2CKNA 3DO7A 2DLIA 4OCYH 1RZIA 5MHSD 4HC1L 3K2UL 3BP6A 1ZGLA 43C9B 2OJZL 1QBML 5FV1L 3OKOB 3RL2B 5DDHA 3QXVA 3WEXB 4I48A 1EUUA 2GK0A 2NXYC 4L3CB 1I1FA 3DUSA 1P4BH 1N6QL 3G5XA 1BJ1H 3D2UA 3GI8H 3K74B 4Y16B 4CVXB 4GT7A 3T0EC 3JV6A 3QCUH 2OQJA 5SX5H 1EZVX 1CFBA 1FG2B 3U7YH 2FJFA 5IMLA 4AEHL 4YHYC 4I1NB 3MLYL 2Y36H 4EUPH 1IGIL 3DHJA 4K3JH 1MLCB 3TH2T 3PIQA 1J0HA 5E2TH 3RWFB 3QUMH 4OGXH 4JHAL 2V5TA 3JWDH 3U4EA 5J7CC 1QSFA 4YC2C 4MAUL 1FNHA 1AGCB 2IAMB 3V4VH 5SWSB 3LQMA 3MOAL 3TWCL 5GS0C 4JG1L 4G7YH 1OD9A 5INDB 3MR9A 1W0WB 3VMPA 5IJKA 5DURB 4GMTL 1ZSDB 3I84A 1UWXH 4LASH 4X98B 3BZDA 3F7QA 2F5AL 4HG4K 1G7HA 4LRNL 3OXSB 3AB0B 2E8YA 5J13C 5DJYA 2ARJQ 3ROLB 3FZUD 5KAQG 4KVNH 5KSBA 3IDJB 1T0NA 5FK9B 3OJDB 5GS0L 1QUNA 4UU9A 3W81A 2FJHB 1GOFA 5C70A 1J12A 1DSFL 1HSAA 3RDTA 1KPUA 1R3JA 4FFWC 1X4YA 1D9KA 2Z9TA 4JLRA 1IGYA 5C0NC 2NXYD 4RMQA 5BZDB 4JHBA 1JI1A 4S2SA 5ENWA 2PXYB 4HG4J 3DUHA 1T03L 2VIRA 4G9DA 2DJUA 2BC4B 1IAIL 2FATL 2Q8AL 1HHJB 2FEEI 5FYJE 2MWCA 2VLKD 3JTTA 1U6AL 4OJFH 4OM0L 1FLTX 2W07A 3HZVA 3QWOA 1A2YA 4KK8C 2A83B 4QGTA 3SDXF 4J3TA 1RK0B 2X1OA 4NBXB 1G84A 4PGBB 1VGEL 2ZPKH 3CX2A 4MQXD 4Y8DC 1GZQB 3G6DL 5EPMB 5ESAB 2P44B 2B1AH 5JHDA 2IQAA 4HJ0D 2FEDC 1JZ8A 3LN9A 5IB5A 3PE9A 4QWWC 3OPZH 2EE2A 3VXRD 4DGYL 5AYQA 5H2BA 5IEKA 3BESR 1I3GL 2VLJA 3A6OA 4LHUD 2R4SL 4PRAA 4XP5L 1CXFA 2YUZA 4DZBB 1KEGL 3VA2C 4XP6H 1ERNA 2B20A 2WBJD 3BT2L 2HFGH 4JHZA 3DX9A 1G0YR 4K3DL 4MXWL 2JLLA 1UVQB 2B0SH 1S8DB 4CNIA 5EZLA 4N0UA 5SX5K 1FGNH 3H9SE 2KKQA 4N0FB 3QBTB 5F6IC 3NAAH 4IOIA 2KBGA 3WXVL 4E41D 1NLBH 4JFED 2DOCA 1BIHA 5EBWA 3HPJB 4GH7B 1HHIB 4PUBH 4YGVA 1MHPH 2E7LC 4H26B 5ELIA 1ETZB 1FFNB 5DRZB 1MFNA 2P24A 3OKDB 4JM4H 4X9GA 4XNZB 3RJDA 4JG0L 3SO5A 4MQTB 1YPZB 3DTXA 3UYPA 1KLUA 3KYNB 3OAYH 3I6LE 1C08B 1I9JH 2I24N 4MHHI 5ISZE 3SO3B 1MCHA 5B38A 4XX1E 3HR5B 3MRBB 3LZFL 5C0JA 3LS4H 1FAKT 3FB5A 4X6FB 4QHUB 5ADPH 3MRMB 4WY7L 1J05A 4PJXF 1M7IB 1JPSL 3S36H 4OF6A 4PRDB 3UDWC 2IFFH 3VFUA 1CXLA 1T0MA 1GL4B 4WNQB 5C3TA 3HE7A 4XZUA 3TO4C 1P7QB 1JFQL 1TZHA 4LKCB 5AWNL 4XAKE 3FO0L 1F00I 3GMPB 3TBWB 4GG8A 1A3LL 3OG4B 1HKFA 5C0BB 5IFJB 1MRCH 1VFBA 5CIPB 1K8IB 3ARGB 1RZ7L 3U0WH 4PRHE 4AG4H 2KUTA 4X6EA 4WI3A 3B83A 4OB5H 4G6KL 3TYGL 3O8XC 1KIRB 5D7IA 2CGRL 1X5JA 4M6NH 1NH6A 5IG7A 4JM2C 1KCRL 2CUIA 5J1AA 2ZUTA 4JM2A 4PJGF 4YHOL 2W0PA 1SVZA 5DJXB 3MRQB 3CDGB 5TPWH 2HKFL 2A0LC 2V7HB 3O3BB 5ILTL 2UWEF 1OM3H 1Q9KA 1N0XL 2D31B 4MD5A 1BLNB 2ADJB 4XB7A 3C6LD 2NY4B 3BEWB 5TQ2L 1GCFA 4KZEH 3NA4A 4E5XB 4K7PY 1U8QB 4NO5A 2K7PA 4TVPL 3W2DL 4JZNB 1BBJA 3P73A 3EO9L 4OKVA 4UQ2B 4LU5H 3DIFA 2JELH 4KGJA 3AUVA 2GY7B 4DN3H 3LKNA 1P4IL 1WBYB 2R15A 5DD0L 1AGBB 5ESQA 1Z9SA 3TBTB 2P46B 4NNPL 4QHKJ 3C2AL 1KJVA 1TZIB 1N5AA 3NGBB 1S7XB 2R56L 4OBRA 2K9UA 1IM3A 1N7ML 1SEQH 4YHIA 1A9BB 1B4JH 3LEVL 1XGPA 5ESVA 3SDCA 4ZDHB 3RA7H 5IF0A 1HH9B 4UTAH 1VESA 1NJ9A 3ARDD 3FN0L 2BNUA 3DRTA 2FIKA 1YC8A 5JZ7D 3HZMA 5A3IC 1K3IA 43C9A 3ARFB 4KZDL 4U6YA 5JXEC 2DQIH 2CO6B 3MXWH 4P3WA 4P5TA 3OZ9L 4P9MH 5TQ0H 3BO8B 4ZNCD 2DIJA 1GRWA 3D2UB 1YUHB 5IB4A 3WFBL 1ZV5A 1Y18A 5I0DA 2GSGA 4KXZI 1YMME 1KYOJ 2HRPL 3UPRB 3ZO0A 2H32A 3VU2A 1I3RA 2IPUG 4AY0A 2WINB 2ILLA 3GMQB 1G7PB 4LF3A 3UC0L 2X4UB 5I75C 4QRSB 1A9EA 3IFNL 5DMKB 5JOFB 2NPLX 1S78D 2X40A 4HC1H 1XR8A 2UY6A 1IQWL 4X4MA 4JPIB 4JPVL 3A6CL 3ROOB 2VLRA 3QJFA 5C7XH 3D87B 3LKRB 2P5WB 4FA8A 2XFXA 4P23A 1G0DA 1D5BB 2FLBT 3PWJA 4OZGA 1GGCL 3S37L 4NUJB 1JNJA 4XCYA 5EBGA 3T3PE 1DEEB 1MELA 2QADC 2YA1A 4O9HH 1FAIL 2FD6L 4L8BA 1BGXL 1Y6KR 1CD0A 3D48R 5GSVB 4KI1A 2W92A 1RZFL 1KIPB 2B4CC 4KI5F 4ODTL 3SDAC 4V1DB 1E6OL 5TDPA 1URLA 5GGUB 4YNYA 1MFEL 1WFTA 3VCLB 3SDDA 5HHQB 2BVUA 3ILPA 1ED3A 5J6GA 4WTWA 1M6OA 4G42A 1UACH 2C4FT 1UB5A 1SM3H 3V4VL 2ZCHL 4YE4L 4LEOB 4EN3C 4F7TA 4G7YL 4PG2C 4I2XE 3IXAA 4Q74A 4AIZA 5J9PA 2P42B 5EZJA 4GQPH 2Q6WB 3MLSH 1ND0A 3KLSA 4U1KB 1DN2A 1XGUA 4MNGA 3VFTB 4JFQB 1XCTB 3FKUS 3L5XL 1IBGL 1QSEB 4GG6A 2YZ8A 5J11B 4OCWL 5GS0H 4XPTH 2Z8SA 3O3DB 4HF5H 2FGWL 2ZJSL 3PGFL 5DEFB 3V52H 5JHLH 3L6FB 2X4OA 4UDUB 1PGRB 2NY0B 4ZTPL 4ZFOL 4JVWA 5ISZD 3QRFM 4XC1H 2I9TB 3T2NL 3D25A 3SDDC 3AREB 5I75B 4NQDD 5FHBH 2LAAA 3UTQB 1FRGL 4R4ND 4ETYA 4GLRH 2NY7L 1TENA 3A6BL 3QUYA 1CE1H 1GZQA 5EPMA 3VDAA 1CGSL 4W81A 2APVA 5LBSL 1NCNA 1KCUH 1D6VL 4HCRA 1T22B 4LCWB 1BQSA 2J88H 1T66C 3FQUB 4URTB 1BD2E 4I3SH 4R4BA 2AEPL 1VPOH 1WBZA 4LFHG 1P7KB 4P2OA 5BO1H 4MJID 4CVZB 1FFOA 1I7ZA 1MI5D 4P3DA 3VJ6A 1HDMB 4G6FB 3UTZB 3Q3GB 1I9RH 2MQCA 1JE6A 4YXKH 4Y4KA 5DK0A 2V7NA 3PGDA 5M7QA 4TTDC 5CZVH 3AAZB 1J0KA 5DYOA 3WYRA 5KVMC 4YXHL 3NFPB 1PKQB 1TETH 1E4XL 3TZVD 5KS9A 1CXEA 3QNXB 2CDGA 1R5WA 1G1YA 3IKCB 4LL9A 4ETQA 5KSAD 1U95A 1QEWB 3G5YB 4LCWE 3QHZL 4GKSA 4KV5E 4OQ1A 1F90H 2R1YB 4I18A 3H42H 2FNBA 5IMMB 2DQFB 2JB5L 4L4TA 5FF6A 1QFHA 2E9JA 2VN7A 1P4BL 3CU1A 1G7JB 3GI8L 1H3UA 4HHAA 3X11B 5SX4I 4AT6B 2X44D 1PG7L 5I73C 3LD8B 2YPKB 2PO6B 2IAMA 2R2CA 3QH3B 4EI6A 5I17B 5FDWB 3UBXI 1YN7B 1UENA 5BMFH 4TVPD 2Y36L 2GITA 2PUQT 4QGYA 2EDBA 1C1EH 4YQXL 2VDMH 2QLVB 4X7CC 1SYSA 4CMHC 3QUML 4DJMA 5GZOD 2RR3A 2G2RB 4XVJH 5EUOF 2VDKL 3OKMA 4Q97A 3VXPA 1G7IA 3TIDB 3QDGA 1K8IA 4MB5A 1CYGA 2A9MH 2P47B 5I66B 1WFUA 1RFDH 3TO4B 3DROB 4MB4A 5B39B 1CTNA 1UC6A 4UTBL 1NFDF 2YKLL 2AS5M 4NQVB 4ZS7H 4NGHH 2HN7A 4L4JA 4NIKB 1EEUA 3O6FD 1BZQK 4Z8FL 3D3VA 2B5IC 3BQUB 3CVHB 5CLTA 3SGEH 1T1YB 5GJTL 4F7EA 4QRQA 3E2HC 3H7BB 3F7VA 1FYTD 3AFLA 4EI5C 3TYGH 3U6RA 4BFIA 5J0BA 5IB3A 1X9QA 1EEZA 3GJFB 1W2KT 4U1GC 5GGVH 4PJEF 2OTWA 2DDQH 1UZ6E 1WBYA 1UWEL 1UWGH 3GMLB 4HUVA 4FQ1L 4NOBA 4ZAKD 3HE7C 3JV0A 5D1XA 1A4JA 1AE6H 1EAPA 2BZDA 5B4MD 3RWIA 1QR1B 4MLSA 4D8PA 2DKMA 1N5AB 1S7XA 3TH4T 5F97E 3V0VB 2EDNA 4HJGA 1EGJL 5GJSL 2YPLE 1UFUA 5F3HA 4KTDL 1U8OB 1JPTH 4FXLA 2DBLL 2WW8A 3U2SB 1QG3A 3G6AA 3RU8H 3W2DH 3PQYE 3QIWC 4BYHA 5KS9F 4ZXBB 1BAFL 2PNDA 1P4LA 4Z7UB 4MA7H 5MEOB 4RWYL 5F7FA 1RHFA 2AJVL 5D96B 5HGHB 4HIEA 3RY6A 1YMHA 3V95A 4YIQA 3MYJA 4I5BA 3QJHA 2DWDB 3TVMA 3E3QE 3EYUH 3TLRA 1HK6A 4WUUA 4G3YL 1RJYA 3HI6H 5SWSE 1HHIA 3U4BH 3FN0H 3X3GH 3CFCL 5T1LB 4NHCL 3CMGA 4HSQA 4S0SD 3OKDA 4KKBC 2I07A 2Y6SC 3PXHA 3IJSA 2X05A 4S1RH 4I3RH 2NTFA 4XCCL 4JZJA 4WI2A 4Y4FC 1A6WL 4Z6AT 2E5EA 2VN4A 2HFFB 1NLBL 3QSKB 2DIAA 2WIIA 2IALA 4U3CA 4UILL 2HJFB 5HD8D 4XCNB 4JO3L 1AHWB 2IQ9L 2NY3D 3CDCA 5C6TH 4OD2A 5FCUL 4M8QA 1ADQH 2H8PB 3PWVA 1T0MB 4MS8D 2AXFB 1JGVL 2WLZA 3THML 4ZAKC 5GZNC 1XF5B 2DB8A 1HINL 3B9EA 2Z31B 1V3LA 3MBXL 3QQ3B 2VLJE 5TE7L 3BP5B 5EULV 2DYPB 4XMLL 5E1AA 5K59E 3ILPB 1T2XA 5E56A 4H88L 2H9GA 3AB0C 4PJFF 1UB5B 2GJ6E 5ALBH 3LKOB 4WV1A 4K94C 5IMOB 3P30L 4OZFG 3CGTA 4AIZB 4OZIF 1I1AD 1ULVA 4P59H 4Z7VA 5EZIL 4PRIB 1HEZA 4EUPG 2VL5B 5I8CA 5C9KA 4B7IA 3TNMA 5BS0D 4PGJA 1A3LH 4YC2B 4AEIL 3J8F7 3ORJA 3Q48A 1NSNH 4NFBA 4FFVC 4I9WE 4IMLA 1E4XI 4BSJA 3NCBB 4BSWB 3QUZA 1XF4B 2C7UA 5EU7C 2ZCHH 4YE4H 3QDJD 3SE8H 2ITCA 1TJGL 4GKZB 4Z76A 1LDPL 3KWWB 1U8HB 4JREC 1BBJB 3UTSE 2X1WL 4DEPC 4KQ4H 1PY4A 2X4SB 3LKNB 1UB6A 5FGSA 2YD8A 2VISB 1JGDB 3T0EB 3QCTL 4YX2H 1CL7I 3BGFC 2BOCA 1J1PH 2JCCB 2O61A 4Y19D 1A6VH 4KJYA 4HWUA 3V7AG 1P7KA 1DQQA 4MS8C 1YC7A 4PRPB 5I1EH 3VE0B 2GIYA 1TVDA 5F1IA 1S7SB 4MX7A 1YJDH 3UTZA 3GDBA 2B4CL 3ULUF 1QSFB 4KQ3H 1X6LA 3GKZA 2M2DA 3R1GL 4IMKC 3P9LB 4FQXD 2EE6A 5D1ZC 2R0KH 3FQXB 2Y5TA 4PV9A 1H5BA 3SE4A 4AENA 5C0EB 4DVRL 4M1DH 5L7XH 1ZLUK 2HFEB 3IGAA 1UM4H 3C60B 1IZJA 3ZDYE 1Q0YH 1T20B 2J88L 3CCHA 3MV9D 1DR9A 2E27H 1GZPB 4X5XA 4GRLC 1VDGA 5T3ZD 1CDHA 2FYYA 5KVDL 1ZLVK 3OJDA 3CJJA 2R0ZH 1I9RL 4BSVA 3MLZH 3RTQA 2AK1H 4R90H 2KZWA 4GG6F 5KVEL 3MXWL 2FJFB 1E4XH 5IW6B 4UT9L 4LQFL 4XPHL 5EOTB 2BVPA 1GGIL 2GTZA 5C08E 4PJEA 5I15H 4HC1A 1JIBA 1MCPL 3CPLA 2BOBA 4WDIB 4TUOA 2H2SC 2NLJB 3DVNB 4PGZA 1A1NB 5DQDH 2NW2B 4KROC 1M7XA 4ALAH 1D5XB 4NJAL 1VSCA 3STBA 4XVTL 5H37G 3U1SL 1S7QA 2V2TB 3VI3F 3O45B 1BEYH 1QLRB 4P57A 4TSCH 1YN6A 3WE6A 3IJHB 1GGCH 4XWGL 1PKQE 4NC0B 4PGBA 5C0DB 1PAMA 1VGKA 2QSQA 1JNHA 2R1WA 2JCCE 2CLZB 1FAIH 2IC2A 1EHAA 4EKXA 2HLFD 4OD1L 1GGBH 1T5WA 4ODTH 4PRAB 1E6OH 1SBSL 1KIQA 3FQTB 4PPTA 5E5RB 4P46A 1OL0A 3T8XB 5T1DH 4Q9RL 1OLLA 5I19H 3IXTA 3MXVL 3L3KA 5GS1A 4OLXL 2AEWA 4L8SC 2XWJA 4MAYB 1A02N 3OR7A 4FQIH 3QISA 1U3HA 3T0ED 2D4DA 4GW4B 4ZS7L 2Z4QA 5F1NB 3HPJA 4B7LA 2XA3A 3MACL 5F9OH 3UJTL 2XZQL 3MNZB 3D1MC 3U46A 1A2YB 1U2HA 1JHKL 5E2UL 4FTVD 1A6UH 2OJEB 3QPQC 2H1PH 4HKBB 3SE3C 2Z31C 4LPYA 4OBSA 3BPOB 4H1LG 4P5MA 4HKZA 4P3DB 1A4KB 3VJ6B 4JQIL 3AY4A 3OHXA 5HJ3A 5MEPA 3T2NH 5HGGS 1FL5A 3GIZH 1AHWC 4QRRD 4F37K 1E27A 4LPTA 4ZQKA 5FHBL 5MEOA 3ARGD 2VLJB 2ICWA 3SHSA 3QUMA 3I6GA 3JWDC 4Z0BL 1UJ3B 2KPNA 3BW9A 5D7JC 3NFPA 3NBNA 1I75A 5D7LE 2D7TH 4X9HA 1H3VA 2VDRH 3WIIH 1IL1A 3MREB 3GMPA 2PR4H 4UQ3B 1BJ8A 4MJIA 1VPOL 5HBBA 3D6GA 1LGVA 4RAHA 5JQHC 1ZLSL 1EUTA 4K7FB 1LD9A 3IDJA 1JBJA 3OWEA 1EBPA 1BAFH 4GBXA 3B8YA 3QP3A 4X6EB 4WJ5B 1VACA 3FFCB 5CZXD 3GSQA 1A1MB 3VXTA 1V7ML 5K9KB 2E8ZA 1OD7A 5IG7B 1QFWH 1LDSA 2NY3B 3HR6A 4CJ0A 4F9LA 1GIGL 5BS0A 1U41A 5FOJA 1SY6A 4M62H 3ULSB 1AIFA 1BQUA 4OUOA 3HNVH 4KK9C 4JKPH 4Q6IC 1GVIA 5CGTA 5DRNA 3HAEH 5IBUB 2FX7L 3QIWB 3BH9B 1YMMA 3T1WA 5I16A 5D70H 4KGLA 5T5NG 1RQ5A 1WIOA 1F90L 1CU4L 3FN9A 1JZ2A 3BEWA 2V9TA 4QRPD 2Z8RA 4WI6A 1V7NL 1G9NH 4TVPE 5B4MC 4Q9QH 3SDDD 1DEDA 5AAWA 2W60B 3OKMB 1TJHL 4JZNA 2Z31D 3HG1D 1AR2A 1LP9F 2WLYA 3IDNB 3M07A 3K8LA 4UILH 2EXWD 3B4NA 3TJEL 2QQKL 5E6IA 2JJSC 4F57H 5FCUH 3BGMB 4MJ6A 1DJSA 2VMFA 4PJAB 4WEBL 1GXEA 4MQ7A 4NKOA 1DQLL 3OQ3B 2Q3AA 5J3HD 2BDNL 4ODSL 3MV8B 4Q9BA 3I3EA 1NAMB 4R8WH 3DGCR 2VQUA 2WBJC 3HZMB 3QUKB 4N8CL 1QQDB 4PJHA 5DHVA 2NY2B 3FMGL 4RBPK 3KVQA 2F8OA 3JSSA 1F6LL 4QRQB 3CMOH 4W6WB 1WTLA 2OLDA 5C07A 4UDTA 3HN3A 5KTEL 3WS3B 4ONGL 3LPGA 3VWKC 1XGTB 3OSKA 2YKLH 3TBSB 2OXGA 1MIMH 2F53D 3P4OB 3SCMD 2AVGA 3WSQL 5L2KB 3T0EA 1T6WA 3DX6A 5HVHB 4NKIL 4B0MM 4IDJL 4JFZH 3EFFB 4D3CL 1FZKB 4KKCD 5DF0A 4ERSL 3FOMA 2ERJB 3BZ4B 2XFXB 1NBYB 2CIKB 1RJLA 2DMCA 1CFQB 5JHDB 4OIBA 2I9LB 2ZKHH 1L0QA 4PP2B 4EQ2A 1L4IA 4R3SA 3WUWG 1NBZA 5CINL 1NCCL 4PJHE 2J4WL 1JVKA 3H9SB 2FBJL 5FGBC 1DBMH 4ODVL 4HKJA 3CZJA 3KPSE 4U6VH 4LCUA 2VXUL 3MMEA 2A38A 1FC2D 4PJFA 4HW6A 4RISH 2VXQL 3WL9B 1M7DA 1CLZL 3QJHB 4ZUTA 5JIPA 2ED7A 3MV8D 4U6YB 5E5MB 2F19L 1MCLA 4V2BA 2WAHA 3BDYH 4FQCL 1IKNA 2PW2B 4PREB 5D2LA 1OGAE 3W5NA 4NT6B 4N0FA 5CIPH 1YDPB 2IGFL 2G5BB 2IBGA 4UOJA 1SVCP 1KEML 1EO7A 1ZT4B 3PWNB 1XCQA 4L3EA 3OV6A 1NUDA 4JCLA 2X4PB 2DLFL 5FYKD 3QUXB 3TNNA 3BPLB 3O2DA 3JZ7A 4RFEB 3ZTJH 1LE5A 3O6FC 1ND0B 1NMCB 2CUMA 4LSUL 2C1PB 1WCQA 2BVPB 2GTZB 3P0VL 4MA8H 4RQQB 2EDEA 1AKJD 1BBDL 3KPLA 3IDXL 1E4WL 1MWAL 3FONA 1FZMA 5FB8B 4JO4L 3L5JA 2HKHH 3EDDA 4X6FA 4HIHA 3I3DA 2E7LA 4GAJH 4JQVC 4L8BB 3K2MC 3QXAA 3RGVC 3WFCH 4PRDA 1BHGA 3UTQA 2WQ8A 4LQFH 3F12A 3QQNA 3WS6A 3HG1B 4F3FA 1T04B 5EFIB 2VDNL 5CBAB 3TZVB 3FHQA 3SDDB 1JV5A 4MJIE 1YEFH 2DQGL 3I85A 4K8RH 1ZLUH 1FCCA 1NDGB 2WUBH 5FGCE 4LCCB 5F70A 4BUGA 4HUUA 1NL0H 4GXUN 1I4FA 1IC4H 5FYLD 1IZKA 2Q6WA 3GSUB 4WW1A 5EC1B 5GGTH 3SKJH 3TCLA 4NUGH 2BJMH 3WLWC 3QR2A 4DKFL 1BD2A 3QIUD 1DBAL 1IM9D 1CD1B 3KPNA 1GGBL 1RZKH 4RGMB 3UPRA 2YC1B 2GSIB 3OKOA 1HHKA 4ODHL 2O5ZL 4XBPA 1CS6A 3MV7B 3TBVB 3D18B 4OUUB 5EUKA 3FO2B 1VEPA 5BVPL 3M8OL 4LDOB 2JCCA 4HFUH 4ZUUB 4JDTL 5IW1A 3O2DL 2D03H 1A7OH 1DDHA 2FH6A 2BNQA 3CH8A 1BF8A 1NDMA 4X99A 1INQB 3VRLE 5KW9H 2FHCA 1EFXB 1PFCA 1TJGH 4P48A 3FN3A 5DR5L 1OTSC 1OVZA 1P84K 4YDLB 1Z6JT 1KXTB 3RWJA 5BVJB 4GKNA 1XR9B 2VKXA 3PWJB 4MAYD 4OZGB 4QRRB 4XAWH 4HZLA 3V4PH 2NZ9C 3V5HB 2VLKA 1QFUH 3CVIL 3V0AC 5IFHL 3DI2B 2E7MA 3QAZC 1KJ3H 3H9HB 3VWJB 4NQDB 2HTKD 3QNZA 4FTVB 3BRGC 5DK0B 1TQCB 1RK1A 1I9IL 5ISZB 1J18A 2C3WA 5INCA 3KHOA 1N3NB 2KH2B 3H9YA 2HWZH 3V7MA 2VXTH 1T83A 1IGCL 1YY9D 4EXKA 2DD8L 1M6OB 4G42B 4OQTL 5JW3H 4M93C 3BAEL 15C8L 1RUPL 3EKCA 4LEOA 3MOQA 5GGSA 5DZNA 1CDJA 1XF2B 4NQVA 2ZOKB 4KK6D 4OM0H 1S7WB 1BFSA 3MJ7A 4WFGE 1MCBA 4WI9A 4XWOD 3TVMD 4LLDB 1YNKH 1B2WL 1U36A 1KTLA 2Y9RT 2AJXL 4M5ZL 1FZOB 1JPFA 4Z77B 3GSWA 2F8VA 2ZSWB 4HUWA 5TDOB 1CZ8H 4KWUA 1OOAA 4TUOB 2O93L 2FB4H 4RFOL 1UQSB 2Q87A 2P1YA 4LLUA 5LQBH 3CSYA 4C55A 1V7MH 1V3KA 2FWOB 3DX8B 5HI4D 4HX1A 1DEEA 2QHRH 3NFSH 5DUMH 4QHNB 5HGDA 3BN9D 1CK0L 4ZNEE 3LN4A 1K9TA 1NCAH 3NFNA 3PP3K 4NQSA 5DA4A 3AU1B 4P3CH 4Y4HB 2C3XA 5D7KE 3CIQA 3C09C 4JFDD 5L0QC 2VDLL 3VFWB 2UZIH 3GM0A 4R97B 3OX8B 1NC4A 1L7IH 2XQYG 5E8EA 5C0RH 5JW5A 4ELKB 2NY4C 2WBWB 1G1CA 3VFRB 2DQTL 1KJ2A 1FNFA 4L3AA 4YHZL 2BNQE 3RUGF 2P43B 1FFOB 3K8KA 3NCYP 4J23A 2BSRA 2EIZB 3RJQB 2CKBB 2HT4D 4M61B 1ZANL 2V2WB 4UNVA 3F6LA 4I3GA 4YLQT 3RX7A 4M5YH 4HIJB 1T5XB 3DX7B 5FO8A 1XH3A 4XX1G 4FTVE 5FYLE 1QSFD 3G04A 4PV8A 5DWUL 3I2CL 3DO7B 1CLYL 3LEXA 4U1NB 4XVUD 4I5BB 2DWDA 4MA1B 3TVMB 1RJCA 2CDGB 4PJBA 4MJ2A 4R97C 1R3HA 5TE6L 5DJCB 4RGNB 2YD5A 1QEWA 2X4OB 4UDUA 4Y4HC 4IJ3C 1RU9H 4YXLL 1JHTA 3G5XB 4UINL 1G9ML 5HYQB 1NEZA 2NXZD 4J2XA 3KLDA 3WS6C 3MRKB 4K07A 4OFYA 2CR6A 1I8KA 3DETD 3LS5H 4OV5B 2D7OA 1OLZA 5DVLA 5HJ3B 1UKQA 5MEPB 3UO1L 2GFBB 3PQYB 1F13A 4HKJB 2ED8A 3E6FB 4A6YB 1RI8A 1R5VB 4C54A 3QH3A 3ZKXB 1JP5A 5B38B 4IDJH 2OP4L 4JPKL 1UG9A 4X6CF 1RHHA 3ZE0E 1DVFB 5L6YL 4PB0L 1CCZA 3P4LA 3CFBA 1A6UL 4EN3A 4PRBB 4M93B 3MRPB 2QSCH 3MLRH 5SV4A 1Z9OA 4U1MB 5SV3A 2J6EA 3EYFA 1KENH 4HBCL 5T1MA 3AS1A 4P99A 1WICA 5TPWL 1O0VA 3B9KC 4H25A 1WC7B 3QEGL 1T89A 3GMMA 1G6RL 4Y19E 3HUJB 2VDRL 1J8KA 2HMID 4ELMF 5L2JA 3WHE1 4OSUL 4O2EB 4X9FA 2EIEA 5GGRB 3IVKA 4H20L 4G6JL 5J1SC 3FT3A 5DFTA 1YMMB 5I16B 4P5TD 5K9QI 1MSPA 1N4XL 3F8UB 3H9ZA 2PXYA 4YDLC 5HHVH 1VB9A 5DI8A 3N85H 4RMRA 1MJ7L 4I0PD 5MP6H 3F58H 1C5BH 4DWHA 1X4ZA 3OXRA 5D7SL 1HH6A 3EYOB 1GIGH 4FXKA 3OPZL 3BD5A 2NQCA 3U0PA 3L7FB 4F3FB 4K55A 3ARZA 3BZFA 4QOKE 2C3VB 4DFIA 4JGMA 1QVOA 2L4OA 1H15B 1YEJH 2O61B 3ECBA 3WUWA 1AD9A 2HFGL 3MA7A 4PJIE 4IOSD 1IAKA 3G5VA 4HMCA 2HVJB 2V17L 4WV1B 3ARBA 4NQEE 3WUZA 1KC5L 3NIFF 1ZS8A 5I1KL 1AD0A 2A6IB 3O3EB 4Y2DA 2H41A 2VZ3A 4HWZA 4YHIB 4EBQL 4CGTA 4X0KB 3TP4A 1RULH 4K8RD 3QDJA 3W0WB 5FYLL 1FIGH 4L29A 5C1MB 2PXYC 1EHLH 4PUBL 3KG5A 1VCAA 2YXMA 2H3NA 3IFNH 4OCSL 3QDMA 1DLFL 4U7MA 2DQGH 4Y5VA 2AV7A 2XZAH 1T3FB 1J88A 2YPLA 1U92A 2OBGA 3SKUD 1HHGB 5DRXA 4TUKH 4BQCA 3SKNB 1PZUB 3F7VB 2D9CA 3LKQA 5TF1L 2ADIB 3DVGA 4FQLH 4N8CH 3PHSA 4K71B 5DGRA 1EEZB 5I30L 4X99B 4K7PX 3L7EA 3LS4L 3W11D 4FZ8H 4HUXB 4JFOA 5TGBA 5LGJA 1CE6A 3PGCB 4H26A 1NGZA 2BFVH 2IJ0C 5DGQA 5HI3D 1WCBB 5I2IB 3FB7A 5FA4B 4ZXBD 5HD8C 4P2RE 4PRPA 4XCNA 1FBIL 4RGNE 2NW3A 2FL5A 3OKLB 5BVPH 2BOBB 4WDIA 5GZND 1F97A 1ACZA 3ARTA 3HZYB 1A7OL 1D5BA 1NMCC 1UACL 1YEHH 4NO2A 4ERSH 4OLYL 4FQXA 1SM3L 2WK2A 3MBEC 1FYTE 2QQQA 5ITBL 5KZCB 5DJ2B 3C60A 1BIIA 4LBEA 4J3OC 3CLFL 3RUGA 3MLSL 1FVCA 1ZT4A 4OKDA 5GRUL 3LQZB 1IFHL 2YN5A 5GGUA 3ZDXF 1PKOA 1PSKH 2W0FA 2W9EL 3WFEH 1CFTB 3HE6B 3EIFA 2PXYD 4Z7VB 3WO4C 5DMYA 2IBZX 2FGWH 4MMXC 2IFGA 3BKMH 4K94H 3MCG1 2F19H 2GQHA 1ITBB 3FZUC 3HRZB 1GPOH 4P46C 2NR6D 4JO2H 4ZMAT 2DQEL 3TH3T 2IGFH 4AMKL 5JA9A 1WWBX 1M71A 2HJFA 4TNWF 1M4KA 15C8H 1BOGA 3W11C 2BMKA 1A3QA 4J4PD 4M8QB 1F8TL 2H8PA 4KK8D 5IIEA 1JF1A 5AUMB 5BRZB 1B4JL 3D85D 3PWUB 4S1DC 1UB6B 1Q72H 3SGKC 5F7YC 3WJJC 2AJXH 4M5ZH 5SWSD 4L4TE 4XNUL 2F74A 2FR4A 1KNOA 1JRHH 1CFSB 3FB6B 1FJ1B 1U8KB 2EYTA 3SPVB 2MSPA 1CIDA 1MHHA 5E8EB 4ZODA 3JTSA 1JYVA 1S7TB 4OZ4B 4G6ML 3RGHA 3FO1B 5D1QC 5C6PB 3CDYA 3IF1A 3MQIA 2GAZA 3RBSA 1F58H 1X5IA 4POZD 1OW0A 1RPQA 3B2UD 3WFCL 3C5SA 3VXMB 1TZIA 3P11H 5HYEA 3RIFK 5BV7L 4D0DB 1I8MB 5DFVD 2NY2C 3QYCA 1L7TH 1P5UA 4JRXE 4JY6A 2EE9A 4MXVE 3CXDH 4MD0B 3O9WA 1SY6H 3OMZA 4HLZH 1A14L 1BJMA 1ZHNA 4GRLD 4MJIB 1QRNA 3CH1A 4LSVL 3A6CH 1R3LB 4KMTL 2BSSB 1TFHA 2C3HA 1EHNA 1RMFH 4P5TB 1LD9B 2BVTA 4Z78A 3FFCD 1NL0L 1AXIB 4H5SA 4BSVB 1NEZG 1X5YA 4O02H 1UH2A 5E94A 3V5KB 1I8KB 1RY7B 3GHEH 1A6ZB 5DWUH 3VDCA 4E9LA 1CXHA 4M1GL 4NP4L 2YXFA 4NM8L 5HGBB 3LY6A 3N0PB 4HZLB 5LAXA 4Z7OE 5IK3B 4J4PC 4D9RD 4U2YA 2CKBH 4FP8L 2OTUA 4RMVA 3CXHJ 3AXLA 3C8KB 4P23C 3PL6C 5EC2A 2NX5B 1YNTB 3ETBF 4X6DE 5FM5O 1NGWB 4BK4A 1A3RL 4HWNA 2PO6A 4QOKB 5E8NA 5KSBF 5D71L 2V2TA 1AQDB 3O2VL 5KN5B 2YD4A 5B39G 1N5YH 4UT6L 1P5VA 5IHZA 1VHPA 1J9CT 4UQ3A 5HDBF 4P9HH 2ED9A 3C08L 1QFUL 5TDPB 3BGMA 4NKDA 1PLGH 4N0YL 5EIIA 3O4LA 3PDOB 2MCG1 4DOHE 5HYJE 4LAJH 5IB2A 1E4KA 1S9XB 5CSGA 5D7JB 3FT3B 1QSED 4J1UA 2W65A 1EMTH 4JFFB 4KFZC 4DQOH 3CAFA 5B39A 5CBEB 3MLRL 4OZGE 5J9PB 3OAZH 3MUGA 12E8L 1BQHA 3FQRA 1DP0A 4X80L 1RSFA 5JW3L 5T3XE 4HX1B 1UEMA 1XGTA 3ME0A 4HUKB 3BH9A 3T0BA 1EGJH 4XBEL 1CD8A 3LN4B 3NFNB 5KSUB 3U82B 4HPYL 2YR3A 1J1OL 2G60L 2YWZA 5GISL 3TGXA 4X7SL 4X4ME 1R6VA 5JOEA 2RJMA 3MA7B 3ZDZF 4NSKA 4LSTH 3KYKH 5DJ6A 4RFOH 2VB5A 4JFDE 4HXAL 2BVOB 3V9FA 1ZT7A 4YXHH 5A3ID 2PTTB 3EHBC 4XXCC 5I1DA 2DQUH 2VDQL 7FABL 2AJUH 2RFXA 4ZUSB 1S7RB 2VXSL 2EH7H 3HC3H 1U8OA 2H3NB 2IF7A 2JTDA 1DBKH 2FX9H 4FABL 3PWLB 1CR9H 3C6SA 4U6HA 3Q3GA 2UZIL 4OF3A 1INDH 4XCCH 5IEHB 2HRLA 4K9EH 3C5JA 3H42L 2V17H 4PJ9D 3TT1L 2DQTH 5DJ8A 4NDMB 4UOW0 1B0GA 3IJYB 3GSNH 4ZOCA 3BVNB 2ATPB 5JW4N 5FHAH 1MQKH 2YA2A 3TPUA 1CT8A 3HA0A 3UJIH 1KFAL 4HUXA 5TGBB 5LGJB 4Y88A 2P5EE 4O51A 5E8OB 5C6TL 3EJYC 2XTLA 2XZAL 3ZT7A 2Q76A 4W4OC 2GFBA 3AVEA 3Q1SH 4LLQB 5A43C 3ULSA 5I18L 1MOEA 3FCTB 1JGUH 4JZJB 1KCSL 1QA9A 3NCJL 3C60D 1N2RA 2QADD 2N56A 2R0LH 1J8HA 3I75B 5GSRB 5IBTL 1I85C 2APFA 1K3ZA 2DMKA 2FBOJ 4WWID 4GS7C 3V6ZB 4HXBL 5E2WH 1I85A 1YYML 2W59A 1JI2A 2XWBB 4UMGA 2Z93A 1G7QA 2I5YL 4WFHD 3VFMA 4KK5D 4OFKA 5D1QB 1NUGA 3ESVF 1AR1C 2CK0L 1FQ9C 1Q1JL 4LMQE 1W72L 2J8UA 1BX2B 4WTZA 2C1OB 4LLAA 1IEAB 1G9NC 4NGHL 2MKLC 2X70A 1SYSB 1IKFL 1UEYA 3S88L 1JRHI 1Z3GL 4PJXA 4PREA 3S8WA 4G5ZH 4Z0XA 3FFDB 4UT7H 1NFIB 1KGCD 5C0ND 5J3HC 3V5DB 1Q38A 1RZ8A 5J06A 1P7QD 5ITBH 1FC1A 4UBDC 4PRPE 5GGRY 1QFWM 5FA3B 3HI5H 1IT9H 1RD6A 3MGTA 2VL5A 3S5LA 1YJDC 5F6HI 4OLVH 1QBAA 5ADOL 1UWGL 2OK0L 3T1FA 4FFWD 1MCKA 4PY7B 3QIUB 4YGAB 2X4QB 4JB9L 1KUMA 3OGOE 3EYOA 4FXKB 2YC1A 3A67H 5FB8A 2YRLA 1OF2B 4NQEA 3DWTA 1HSBB 3U79A 2IG2L 1DUZA 2O26U 5C0BD 5I9QB 4OUUA 4D9RE 4F9PA 2W60A 2NXZC 1OPGH 5F93C 4DGIH 3GJEA 5DVNA 1N4XH 3FOMB 5DD5H 4ZFZB 4ZFFA 3D39D 5E00A 4OGYL 5GGQH 4MB3A 3S97C 4M1DL 5L7XL 4LVNC 3MBEB 4U1IA 2DYPD 4GW1B 4E0RA 1F3RB 4Z7WF 1S9KC 5D6DA 2ZUWA 4QRRA 5ICXA 1IGJA 3QQ4B 4IRJD 2FX8L 5T1LD 4KRPB 4NKMA 1T7XA 4J6RL 1GJIA 2YRPA 1HXYB 1OP5K 4LCCA 2CLRA 1NAMA 3QQ9C 1HILA 4Z7WA 5HYSB 5C0BE 1R3LA 2GK0B 3UTOA 1I1FB 1B0WA 4NCC2 3U7AA 2PW2A 1LO5B 2JB6B 3RVTC 1N0LA 3FJTA 2ARJB 3KR3L 4HIEB 3ZSSA 4NNXA 35C8L 2O5XL 4ZUVB 4K71C 1L7TL 4GLRI 5CP3A 4N8PA 1T1XB 1SY6L 4OLZH 4LCYA 2VR5A 3MJ7B 3QPXL 6CGTA 3T0WA 4KC3B 3NPSB 4G9FB 3O6MH 5IBUG 2EDJA 3L3HB 4QXUH 5TF1H 1MPAL 1AXTH 4JPWL 4GKNB 2OYPA 1U8PB 3W82A 3EOTL 4Y19A 5EG6C 3IYLW 3L9RB 1LO0H 4LLYA 3BJLA 5B8CB 5KN5A 3IU4L 5C0FA 5IJVA 5ICYA 5IVXE 3O3UN 1QPPA 3WL9A 1M7DB 4H0HB 1XFPA 2NY6B 3RWCB 5IHUL 5DJYB 2XQBH 1DN0B 4UAOB 5I0ZA 5JHDD 2C3GA 1OCWL 4F9PC 3WV0A 5I19L 3NTCL 3GSXA 4UAOC 3WE6B 2VZTA 5JORA 3MRRB 1P6FA 3WCYA 5C09D 3GBNH 3SE8L 5DURD 2QBWA 3QZWB 4K8RC 5DHYB 5E8PA 5EOCH 5BZDA 1RJZA 4X9BA 4LASL 3RI5F 3LKSB 3QCVL 4WWKD 1HHJA 1LK3L 3RWDA 3MACH 1T21A 3UJTH 1IFHH 5DO2D 3FQTA 2D0FA 2Y06H 5HPOA 2W9EH 3QB7C 3QXWA 3VFVB 4PJBB 3QNYA 4R4FL 2JKXA 3F7PC 4ENEC 1OSZA 4YHKH 1TDQA 4OQTA 3BKML 5JXAH 3QDGD 2FWOA 3RHWF 4P9HC 1MWAA 1VFOA 5D6DC 2G5RA 4GKZA 3W9EB 5IESH 1JPGA 2D7QA 3BUTA 1BVLA 4LSRH 3QDGE 4L9DA 5IW1B 3CVHL 1ZT1A 1JF5A 1TTUA 4QRTB 5EU6B 2V5YA 1MFAH 4Z0BH 1EFXA 5CBAA 4NQDE 3DXAE 1NGXA 3GUTB 2JJTC 1KT2B 4LSQL 3MROB 2R9HC 3WIIL 5GHWL 2V5MA 3MRLA 4KJYB 3RPKA 4LOUC 4JY6B 1KJ2B 3BQUC 3IDMA 2X10A 2DQCL 5DC9B 5FYJL 4YHMH 3M45A 2J12B 1DVFA 1QPXA 3AMLA 2PO6D 1H3TA 4ZQKB 1YNLH 4ODXB 1P2CB 4YBQD 4M4PA 1UJ3A 1T89C 1QFWL 4KJPC 4Z78B 3MRIA 4Y16A 4CVXA 1D9KD 3LEYL 4HWBH 5D7IF 1I3GH 3E8UL 4O00A 4Y4FD 1ITCA 2VC2H 4PIRF 2AW2A 1FG2A 4IJ3B 2BP3A 2ZP0T 2ICEA 1CDUA 2XICA 3SDXE 4ONFL 3CXDL 3RTQC 4TNVF 3OKYA 4M6OL 3VW3L 4MZ2A 4GBXB 1LNUA 5E6ZA 1MCRA 3OKKA 2B0SL 5D2NA 1QBMH 5EBLB 4Q9QL 3RX8A 4LLDA 1OARL 2NR6C 4PJ8D 5DEGB 3VGBA 1EFQA 3V6ZA 3TJHC 2V9QA 4H8WL 5KJRH 2H45A 2I60L 2NY5L 1BEYL 1ZVYA 3QWRD 4U05A 5L8KB 4MJ5A 2WWKT 2LU3A 3UJIL 3SE9H 3NPZB 1EEYA 4PRHD 1VERA 2APBA 2WBJA 5EOTA 5FM8A 3N1QC 4OLEA 2SEBA 2WP3O 3MR9B 4WEBH 4JG0H 1DQJA 3VGAB 3DLQR 3HC0B 2NLJA 3VXQA 5L0QB 2X9XA 3S7GA 5EWIL 2CKBL 2JE8A 4FP8H 5F44A 4OGXL 1J7VR 1F6AA 1MUJB 3ULVC 4EN3D 1ZA6B 5BRZE 3ZZ1A 4P57B 4KUCD 5IB2B 3RDTB 1R3JB 2XA8H 2YEZB 3MRHA 4JHWL 2P7TB 2VDOL 1JNHB 4HIXL 2OR7A 1GHFL 2A6IA 4JG1H 2FSEB 1WC7A 4N8VA 3O2VH 4PJIA 1U3ZA 4EVNB 4NKOB 3V8CA 1NGPH 4MCZA 2NMSA 5CJQL 3UBXB 3U4AA 4YDIL 5DTFA 4TN9A 1Z3GH 4OLWL 2LU4A 1ZE3C 2X4QA 1HQ4A 4QF1A 4UT7L 5TDOA 4XT1C 4FQHA 4OM1H 4ZFOB 5DI8B 5E9DE 4PLKD 5FGCB 2FEEL 4M1CD 4MAYA 1RVFL 3GK8H 4FRWA 5CS7A 1IGMH 1OGAB 2GEEA 2FGZA 2ZZUT 1DBML 1T66D 4ODVH 3RZCB 4JCMA 3LKPA 4NQSB 2MQ0A 2MFNA 2VXUH 5E9DB 3KXFA 4LMQI 1TQCC 2K7QA 3VFWA 1U8LB 4V1DD 4NKMB 3SDCB 2YA0A 2AJ3B 3NA9H 4DKDC 1WAAF 5F7DB 5KANG 2BSED 5C6WH 2ZG1A 3JVGA 3TCXA 1ZLSH 3RFZC 1CI5A 1AD0B 2YMXH 3EO9H 3O3EA 3EFDH 2AEQL 4LSTL 4Y1AD 5C08B 5JXED 2Q7YB 5I6XC 1WJ3A 4P5KB 5CWSA 3EBAA 4PJCE 1A6TB 1T4KA 3ARFD 1YEEL 3O6KH 4FZEH 2B1AL 3VXME 3LEXB 4U1NA 2R69L 1OTUC 2DJSA 2EYSA 2X4TB 2HH0L 3G6JF 7FABH 3TPUB 4WUUD 5GGSY 3EYFB 5EBWB 3VXSB 5J6HA 3MLTB 1DBKL 2EKJA 1MF2H 1ODAA 2D0HA 1EDQA 5EORL 1XZ0A 4WFHE 1JGEA 4JO1H 4JO4H 2UVEA 4K3DH 1RIVL 5L2JB 4K9EL 4IBLT 3GSVB 3L3HA 1OAZL 3FFCA 2Q86B 4L1DA 3TBYA 4G80A 1JYXA 5HHOB 2YWYA 3WXVH 4Y5YC 1U8PA 3MRCA 5L88H 5F9DC 4Q6IA 43CAB 2Y5EA 1DQDL 1KJ2H 2PW1B 4HH8A 4NQCE 4QXGH 1WEJH 5I8KH 1ZHKB 2GK2A 2HFTA 3M1BA 4HK3N 1S9YA 1Y6MR 4QXWA 3FRUB 4DUWA 5BJTB 1IEAA 2VH5H 3NCCB 4WTXA 5F21B 3BMWA 4FQXB 2BDNH 3VW3H 3G08B 1I9JL 2PTVA 1L9MA 3RI5K 5E95B 2VDPL 4QXUL 1RZKC 1LO4H 3EOBA 3MRPA 3GSXB 4RMSA 4Y5XA 5IHBA 5AZ2H 2HVJA 3EO0A 1JMXA 2DF3A 3FRPG 1CG9B 1T04A 3NIDE 3SBWA 2A6JB 3EHBD 2FH8A 2LE9A 3AS0A 5CSBA 5GZOC 1KXVC 5L2KE 1DBAH 1FNLA 1ZS8B 1WIPA 2LVEA 3HE6A 5F7UA 4O5LH 4PJAA 2XQBL 2P5EA 1KBGL 3VRIB 3QIUA 4G8EB 4Y5VB 1JJUA 3JWOC 1OT1A 1RZJH 3UZVB 1HHGA 5DRXB 3U9PH 3ARXA 3WKML 1MWAB 2OSLA 5I8OH 1MQ8A 3RVUC 4G8IA 4KAQL 2BMKB 4I8DA 5E99L 2WWKO 5ALCL 3DSNA 3RBGA 3U0PB 4N1HB 5BOPA 2RHEA 2IPTH 4L5FH 4Z7UE 2VAJA 1NGZB 1MH5B 3CX5J 4OCWH 3QXUA 5ETUB 1S3KL 2JIXB 4HQQH 5JXEA 4JKMA 4FG6C 4DW2L 4XPGL 5HDQH 3BISA 3ULUC 5E2JA 1R3IH 2VITB 3RWGA 3WFDL 1KF9B 2CLRB 2XOTA 3BSZH 3IT8D 5DQJB 1TTGA 4LSRL 1CFQA 3IFOB 2BSTB 3CNKA 1NGWA 4BQ6A 2AK4D 5TE4L 4NQXA 4NM4H 5IR1A 4OGYH 4JRWA 1CGSH 1I8IA 4WRLA 4WW2C 5GGQL 1LO5A 2JB6A 5SWZA 5IB4B 3O9WB 5LBSH 3QDMB 1MY5A 4XRCB 3C2AH 2FX8H 1LWRA 3KPRE 1RK1B 2XTJC 5ISZA 2Q3ZA 3K81A 5DJ0A 3D0VB 1GAFL 3P0VH 4NZTH 2WV3A 2BRRL 4GMSH 4RA3A 1CFTA 2YD6A 1JHLL 3CSGA 2XN9A 5CEXB 1MCQA 5C2BH 4OCRH 4P2RD 1T1WB 1KPUB 2OQJB 1CICB 1WZLA 1JL8A 3VWKB 1EV2E 1D5MB 3D3VD 3B9KD 4L3EB 4MNQD 3BH8B 4JFFA 4JLRB 1CE6B 5GGSB 3C5ZB 3PGCA 4YHLH 3KYMB 1HIML 5HYJA 1U8NA 1AGEB 1G6RB 7CGTA 1FFRA 3W9DA 1FVDB 2YHGA 3KXFE 4HEME 1F4YH 3CFEA 3RL1A 4JJ5B 2WBJB 2VDNH 1MFDH 3QEUA 1CWVA 2FL5B 1AFVL 4JFYA 3OKLA 1WVZA 2DL2A 5KSVB 3ARRA 2UYLB 3GMOA 4OLZL 1AP2B 4K8RL 5CJOL 2V2XB 5AG8A 3U48A 4IOFC 2A77L 2QQNH 4ORGA 4KH2A 3W39B 4F9LC 5I1LB 1JWMA 4D2NA 5BV7C 3ZL4H 2VXVH 1WAAA 2BCKA 3PDDA 5INDA 3VG0H 1UA6H 4XNMB 1IC4L 3QFJA 4PJDF 3SJVA 3VRJA 4NRZA 1VKXB 4OF8A 4DOHB 5GGTL 4M5YL 5F6IB 4KUZH 2RAMA 1H9VA 1KJMB 1F4WL 1A0QH 4HCRL 3R4DA 2W0FB 3OR6A 1JV5B 1TPXB 1AGDA 3L3JA 5JW4R 2VDML 5FOBB 4JQXA 3D9AL 4RAUB 1HSAB 3D85A 5EN2A 4PG9A 3QQ9D 5I1GH 1NDGA 5JW4Q 3PWLA 4YXLH 1QSEA 4GG6B 1S9VA 2BSRB 4PJBE 4HUUB 4GRWH 4NZRL 1QSZA 1FYTB 2YBRB 3O3DA 1YQVH 4YPGB 1QRNB 2V2WA 4E41E 1UH4A 3BEVA 2VDOH 3LS5L 2P8LB 2DLTA 5BQ7A 5C9JB 5DR5H 3G04B 4PV8B 4HS3B 5I1JH 4NC1E 4XC3H 1TVHB 4EQ3A 5KSUA 5DD3H 3V4PL 5TFSL 1BFOA 3SKMA 1MFCL 5LXGH 3MZTA 2GSIA 2N4IA 3MV8E 4BZ1H 2PF6A 4GAYA 4J7RA 5DRZA 3QWOB 1KNOB 4I0CC 2ZOLB 2G75A 5EUKB 4L4VE 1NCWH 4XPTL 3V6OC 5AZEH 3WMSA 1MLCA 2ZJSH 3JTSB 3PIQB 4WGWB 2YRZA 1I9IH 1OP3K 4E41A 5HI3C 4WUUE 2XWTB 4C59B 3U4EB 1X7QB 3O2WL 1IGCH 1OY3B 4RZCA 1YPZF 3SDYH 1FGVH 4L4VB 4LIQL 1MY7A 1FRGH 4IHOA 2VE6B 3LH2H 1CE1L 3GZKA 3QULB 4OFIA 5D1QA 3VFUB 4EUPA 2EIDA 4JRXD 2D4FA 5IHZB 2Z91B 4WV1C 4WVRA 3HMWH 5DC0A 1JZ6A 1ZGLB 5J6HB 1C7TA 3BRFA 5K9OB 5T1LA 5CEYB 4APQC 1UM5L 3RU8L 2ZCKH 4YAQB 2NY6D 4G6AC 5ANME 2AEQH 4E42B 1Q8MA 5CJXC 3BE1L 3EYSL 3N85L 3SOBL 1SJHB 3OAUH 1WLHA 5DRWB 5LQBL 2QR0A 1A5FL 4L4TB 4O51B 1KIRA 5D7IB 3RRQA 5E8OA 4Q7DA 5SX4H 4O2FB 1TITA 4KPHH 2DLGA 3T04D 1NGQH 2CSPA 4PP1D 2K1MA 4AL8L 5FA3A 3MGTB 3VGHA 1NCAL 4MMZC 3LIZH 1J87A 2VC2L 3FAXA 5IVNA 2A6KA 1F4XH 5D4QA 4PJCB 4NHCH 3AXLB 3CLEH 1FNGA 1MJJA 3C8KA 2E9BA 4OFYD 3SGJC 1A6AA 1PEWA 4LVHC 5CP7B 1S5IH 2VERN 5C0JB 5F9AC 4HV8A 1UQSA 2CQVA 3WNMA 4NO5B 4YHYB 3K1DA 3S4SB 4UIKL 2ZCLL 3B9KB 4MNQB 4M7ZB 2GT9A 3VXOB 1P7QA 3MOBL 5IQ7L 2A6JA 4M6AA 4LCWD 3MCKB 2IQ9H 4TQEL 1H15A 4Q0XH 3ROLA 3AS2A 3I2CH 3VGGA 4QY8B 3N1FC 2Q7NA 2RFXB 4LDEB 4ZUSA 2DM3A 1IAKB 3G5VB 5I1HL 3ARED 3B5GA 2VDKH 4FQLL 3O8XD 4YZFF 3F5WA 2FO1A 1UM6H 3HCVB 1XMWA 4JR9H 5DFVC 3ARFA 4QTHA 5IFAH 3A0OA 1YECH 5DJ8B 4JHWH 3P30H 4FOMA 3MRQA 1LEIA 4P59L 1GHFH 1I7RB 5IVXA 2QQLH 3ZHLA 1DLHA 1DE4A 1NCBL 4M7JH 3BVNA 4JGJA 1D6EB 4NYLB 1BREA 1UXWA 1MJ8H 2YN3A 3LKPB 1JGDA 3QO1B 4YBLB 2ITDB 4NPYB 1A9EB 4UIMB 5JOFA 2DM2A 4Z8FH 3S5LG 4JPKH 4HJGB 2VUOA 3TV3L 3GJEB 1LO3L 4OCNC 3DIFB 1YPZA 3HMXH 3L3OA 5F7DA 1SQ2N 1LO2L 2LABA 3LKRA 3VGAC 5D5MF 2GJZA 1HOCB 3OF6D 1K8DA 4P2OD 5E99H 4B41A 2YPVH 3GKWL 4NQXB 4MDIA 4K3EH 2Y5TB 1UWEH 1NJ9B 4M3JA 4HD9A 1M7IA 4N9OB 4WEMB 2XPGA 4U3XA 1QYGL 4YIQB 4Z7QF 5J57B 1DN0A 3BGFB 3VXSA 1YZZA 3BSZL 3TESA 4CNIB 3IDGA 2B4CH 1ZHLB 3C09B 3RTQB 2AABL 3EFDL 1TJIH 3DYOA 2HJKB 3QWQB 4JREB 1Y0LB 4XP1L 3ZKSD 2X4UA 2J5LB 3ULUH 3QXTA 4XTRC 1YEEH 1YY9C 5T1MB 4ZO6A 3O6KL 3VGFA 2J8UE 1GSMA 4N0CD 5HHOA 3I6KA 4LCYB 1I9EA 4MNQE 4R2GB 5CHNA 1FPTL 1T21B 1CQKA 1XCTA 4KVCL 1K5NB 3CDGA 3HRZA 1MHEB 3P3YA 1UADC 3BN9C 4OFPA 3LVEA 5DJZA 5LWYH 3TA3B 1WITA 4M1CC 4XWOC 5IT2L 2CJUL 1XGYL 1DUZB 5JW4M 3V4UL 3E6HA 1BOGB 5F7HA 5GRJH 4KY1H 5IJVB 5ICYB 5FO9A 3QI9D 1A7NL 1Q9OB 3EO0B 1F45A 2MTPA 5E00B 5EOQL 1EHLL 1YEDB 3IFLH 5ESQB 4HGWA 4U1JA 5F89B 5CJ8A 1QVOB 4WUKH 4NQCB 2FDBP 3MROA 4J3UA 3FFDA 1IM3B 1NFIA 1A9BA 3ARGA 5EN2B 1HXYA 4DVBA 2X89D 4G9FE 4OI7A 2BNUB 2GAZB 3DRTB 3ARBB 2VDPH 2XKNB 5BZWB 1RJZB 4TSCL 1NLDH 3IDYB 1INEL 3JUYA 4H88H 3KPOB 4JVUA 4HWZB 4ODUA 4C58B 1X3DA 3UTTB 3RWDB 1ZLWK 4AEHH 2ZNXA 1F4WH 3GHEL 1FV1B 4YJZL 4XGZB 2P49B 1BP3B 3MLYH 5FYJU 3VFVA 3NMEA 3ARDA 1ZHNB 3K80A 3SDCD 2X7LA 3VI3E 4FFZL 4NWTH 3VD5A 1GH7A 1MH5A 2OTPA 4LFHD 2AK4B 3NABL 5D1XD 1RZJL 4PRNA 4OLXH 1YEHL 5B3NA 3EJYD 3R0NA 5FF6B 4WHYH 2EYRB 4RGMC 3U9PL 3OHXB 5F1KC 3EDEA 4MQXC 4LSSH 3TN0D 2C4XA 4L4VA 1R5IA 4ZXBC 2NNAA 2F5AH 1MFCH 3FFCE 5LXGL 3C08H 3D69B 1HNFA 4JFHE 5B3JE 4U6XA 1K4CB 4EDXB 1JHKH 2A1WL 4MDJA 1ZK9A 1J1PL 4Z9KB 3MTRA 3RVVD 2CRYA 3CFJA 1XF3B 3NPSC 3DYPA 1S5HB 1K4DB 3QFJD 3QXDB 4X4XB 1CDYA 3WLBB 3BP4B 1BZ9B 1BPVA 5EBMA 3QNXA 1IC5H 1ONQA 3TZVC 2DI9A 3GMNB 4OZFA 1O5DT 4YO0A 2E7HA 1T03H 3V7AE 2YEZA 4U0RC 3JV4B 5TE4H 3LV3B 4Y5XC 4DKAA 1TMCB 4O2FA 4KDTC 5EUOB 4LF3B 4XMKL 2PYFB 3FT2B 4QOKD 2AI0L 4PJIB 2J1KA 2AJYH 3E2HB 4HT1L 4OJFL 5DMIL 1Q0YL 2D7MA 4JY5H 3KPMA 5GPRA 4JFXA 5DTFB 2BY2A 4PB9L 1Q72L 1YY8B 3SJVE 4YEFA 2EKSB 1JRHL 5KG9A 2CDEB 2CO7B 5H8DA 4CN1A 4F7CA 5DK3A 5H94B 4ENED 3MA9H 3BWUC 3MLZL 3KYKL 3ULVE 1NC4D 4WEUD 1B0RA 3KJ4B 3FTGA 2UZXB 4G6MH 1I3VA 1T7YA 1A7PL 3T0VA 5SWQB 1NGQL 4PJ8B 1JPGB 2SEBB 1E28B 1BVLB 3BPLC 2OL3H 3RX5A 5C0FB 2AJUL 1WIUA 3EO1B 1IM9B 4M6MH 4XI5D 3RZCA 3U9UB 5C0DA 5MEQB 2FX9L 2MHAA 3LMJL 1MFDL 2J8HA 1BD2D 3MRGB 4HWBA 1ZA6A 2VZSA 3QA3A 1U9KA 4POUB 2A83A 1S9WA 3H0TB 4BFEA 4PJDB 1TCMA 2BVOA 1NMAH 1ZKAA 3ZT5A 5ESAA 1AI1H 2MOVA 2PO6C 2ZCLH 3T8XA 3NCFB 4IRJC 1FFQA 2XY1A 2PTTA 2CRMA 4PLNC 5D2LF 5FYKL 1J10A 4FN0A 3H7LA 3WD5H 2YD3A 1UXSB 5D8JH 3RY5A 3U7YL 4TULH 4F57L 3CSPA 4Q0XL 5BQ7B 1U3HB 1HQ4B 1YMHB 2ICES 1ZEAL 3K8MA 3VI4E 1DBBL 1B6DA 2VZ1A 1YA5A 5DT1L 3CXHK 2Q1EA 3U0TB 1YYLH 2J8OA 1XEDA 4ODSH 3D9AH 5I1GL 1BQLL 2ERJC 5EU5A 1LP9E 1JZ5A 2R0LL 3VXSE 4N0UB 4QRRE 4XXDA 3ZYZA 1LVEA 1I1AA 2WUCL 3FMGH 2VWEC 3W9EA 3IJYA 4PTUB 4H5SB 1FO0A 1JUFB 4AQOA 4HKBA 1FO0L 5EU6A 1C8PA 5KTEH 3AS3A 2XWTA 3O6LH 2X2YA 4K3HA 1NGXB 4KDVA 3V0VA 4KKLC 2HTLC 2DQJH 3GUTA 5I1JL 5AWNH 1IEBA 4UT6H 3H9SA 3BIKA 5DD3L 4HUMB 1OQXA 1QA9B 4XNXL 3MRLB 1ORSB 2VLMD 4P2OB 5DUPH 3RNQA 5L9DH 2YPLD 4G5ZL 5E08L 3MO1A 1PLGL 4N0YH 3TV3H 4RBPH 2GITB 3MRBA 2DIBA 2NY1C 3LRSB 3HMXL 1PEZA 5F7WC 4JZJC 5C08A 4XH2A 1V8HA 3UXFA 3T4YB 3HRPA 1G7MA 1CFVH 2EZ0D 4U0RB 2YPVL 4X6BA 1IEHA 1JNNL 1W0YT 5GRWA 2QSTA 3HNSH 3LKOA 3SDYL 2AEIT 3EZJB 4OCXH 4LNRA 4OLUH 4F7MB 3ULVH 2OL3A 5C0GB 5C07D 4NRXA 4TSBL 4OZHA 4XP9H 4RISL 4GQ9H 4C56D 1CLZH 3MLWH 4K7PH 1N0XH 4NRYA 5IB1B 4ZUWB 1RZ8B 4NWUL 2F53A 2D2OA 3BDYL 4FQCH 2HT2C 4YWGL 5T3ZH 3TBYB 4O58H 2EICA 5CBEA 5DHVH 2AK4E 2ADFH 4Q6IB 3MLUL 3EYSH 1P4IH 2WIIB 3BKYL 3E6HB 1WTGT 3S98A 4M8VA 5D7LD 3I02B 3SBWC 4LLMA 4PJ5E 1QD0A 2V7HA 3WDHA 3JTTB 4M62L 3D0LB 2P45B 3UTPD 2Y72A 2EH7L 3HC3L 5C0CD 2AERT 3MCKA 4JKWA 4J8RB 2VSDA 4P0DA 4U1SA 4WHYG 4YR6A 2HKHL 2DQIL 2HLFC 1VFAA 4P2RB 5CILL 3INUL 1YEIH 4GW1A 3ARVA 4KY1L 4E0RB 4BK5A 5C92A 3CDFA 1UJ3C 1KIUA 3NN8B 1TNMA 2PYEE 3CC5B 5BW7A 1AH1A 5IF0B 5SWZB 3UTSD 3QDMD 3ARWA 4GFTB 4ZO9A 3B3IB 2X1QA 1JYNA 2MKWA 4I77L 1C16B 5FO7B 5JTWA 4PGDA 4KRPD 4JM2D 4FQ2H 2C7UB 1GGUA 1FNEA 3C5JB 3VFPA 3NCJH 5F1SA 1KN2H 4W4OA 4QRPB 1U8HA 3FAWA 1J0IA 4CVUA 3QG7L 4Z7VE 4TUJA 2ATKB 3PABB 3SKJL 5ADPL 2BJML 2WINA 5E4EB 4O9HL 2XN9D 3C6LC 4R4NC 4I0PB 1JTPA 3QIBC 2IFFL 5FKAB 2P24B 2RQ8A 3UROR 3BZEB 4L8SB 3MFGB 1LP9B 1X5AA 4S11A 3RWGB 3V0WH 1XGQB 3J7HA 5BOZG 2QL1A 2KQMA 1MRCL 4HFUL 3PL6B 4P23B 5T3ZE 4NO0A 2BY3A 1CL7L 1CF8L 3QXDA 3CD4A 4IDLA 5INCB 4Q6YA 4JJHA 4OI8A 3MRMA 4G6KH 1S7QB 3N06B 3IGAB 2A73B 2CGRH 4ZPTB 1KG0A 3X14A 4IEFB 3NACL 4NRZB 3SY0A 4EXPX 5HHXH 4WNQA 5M95B 2XY2A 3T2OA 5FDYA 1F42A 2J4WH 4HFWB 1CDGA 1LK3H 3DRQB 1KJMA 1AGFA 4HS6B 2Y06L 1WZMA 3TNNB 1JZ4A 2QV2A 1S7WA 5CD3A 3IU3B 5DMJB 5JDJA 3IKKA 3V52L 1DVFD 4PJXE 4FFYL 4ZYKB 3K1KC 3GSWB 1ZWIA 4CRPA 4C56E 4ONHB 3MRJB 5DHYA 5E8PB 1OPGL 2YBRA 4L9LC 1IC5L 3W9DB 3CVHH 1FVDA 5GS1B 1TJIL 25C8L 2OI9B 1OGTA 4Y1AE 2CLVA 3QHFL 3S5LB 1K2DB 2P8LA 2RCSH 4G7VL 4IMKA 4P2QB 3QEUB 2W9LA 3RIAK 5HI4C 3KWWA 5KBNC 2AJYL 2PCPB 4LSQH 3JWOH 4OD2B 4OT1L 1AC0A 2V5SA 4JY5L 2R56H 2VZVA 4WO4D 5BJTA 2IBZY 2Z31A 1YNKL 3L6FA 3S3PA 4P2YA 3P77B 1EVUA 3LPWA 4YK4B 2I9TA 3QA3B 3OX8A 3ET9F 4XCFH 3QUZD 4ZAKA 4ZFZA 4ZFFB 4M48L 5CEZD 1NAML 2DICA 5C0IA 5D2NE 2QHRL 3NFSL 3MUJA 1A4KA 5DUML 1TIUA 4GAJL 3RVVC 2NX5E 2IANE 3MBEA 4LDLB 5FFLA 5DUBB 4HWBL 1AGDB 1KXQE 1IQDB 3SDXA 3UAJD 1G0XA 4NQED 1WBZB 1PBYA 1T5XA 4PJ7F 1XH3B 3LN5A 4N0RA 1HNGA 2P5EB 1TLKA 4P46B 2Z35B 2HFEA 1HDMA 3BHBB 4N8VG 4YDJA 1L7IL 1QSFE 1XIWC 1H3GA 5EB9A 2WUBL 1FVEB 1GC1L 4O2CB 3HE6C 3PV7A 5HYQA 3RPIB 3ZTNH 3IS1X 1NLDL 3BPNB 4M7LH 1RIUH 3IKCA 2DKUA 4X7TB 4DEPB 5DS8A 4JFDA 1C12A 3BH8A 1KTKE 1WFNA 5ACMA 4JRYD 4O4YH 3RWJB 2MNUA 3OKEA 4YQXH 3VG9B 4JPIA 3ROOA 5HYJD 4FFZH 3NCEB 3QIWA 4KMLB 4NWTL 4JRXA 4UINH 1BECA 1I7UB 4RZCB 5F7EH 3DUUB 3WFZA 2BSTA 3IFOA 3NIGF 3NTCH 4QNPE 4OZHE 4XH2B 3S6CA 4QRUA 4PLJD 1AY1L 3EYQC 3RZWA 3QI9C 3GBNL 1I8IB 4PBWD 5C0EA 5EOCL 4I2XB 1P9MC 2EO1A 3MLVL 5T5FH 1N6VA 2VAAA 4JKKA 3JV4A 3GJFK 3PP4L 4V1DA 4JDVA 4NNYA 3IETA 3RKDD 1AR1D 3GI9L 4EI5A 1MREL 3MYZA 5E08H 1IBGH 5GJTH 2ZOKA 2AP2A 5C8JB 2A1WH 1CVSC 5I66A 4NQTA 3IAPA 5GGRA 5DVOA 1H0DB 3L5HA 5CMAB 1D5MA 5KOVC 3OJVC 4U49A 2QSCL 5FUOL 5IESL 4KI5E 4XPBL 4QRPE 2C9AA 2AQ3A 3DXAB 1BOYA 3HNSL 3L3KB 3GO1L 3LKSA 3FTGB 1D5ZA 4M9PA 3DX8A 3GNMH 3WS3A 5DRNB 1RUPH 4FXGB 1IAII 4JANA 1KCUL 4P46D 1P1ZA 1H8OA 3QFJE 4GUPA 1A8JH 1JPTL 2C3VA 4R26H 4WHTA 4NPYA 4UIMA 5T5NF 4PB9H 3UYRH 4H20H 3MNZA 4J8RA 5DLML 5L8JB 2VO5A 1D5XA 5HHOE 4YHML 5D72L 2UWEA 3VXOA 2JJSA 1QSEE 4G8GD 5GS2D 4QLRA 5CZVL 2GHWB 2CD0A 3QEHB 3UTTE 4FZEL 3ZYOA 3EOAA 1A7PH 4ELME 5D7SH 4CL7A 1NFKA 3U30C 3EYQD 4QY8A 2OL3L 4MQ7B 4L9LA 4YH6A 4KHXH 4LCIH 1G9MC 2I27N 1JMZA 3CFKA 3HI6L 1NCUA 3E8UH 1SJXA 4MNGE 4WO4B 1UGNA 3G6AB 1KIQB 1WQVT 2X4RA 4POZC 3T0XA 2Q8BL 2EDDA 3B2UC 4I3RL 3T2QA 1RIVH 4N5UA 3VXMD 4IS6A 3SKNA 1SBBA 4R2GD 5CEYA 1CLOH 4FQQA 5I1KH 4G6AD 2D0GA 3DVIA 3BD3A 1DE4B 2EC8A 3S3SA 4HS3A 3VXSD 1NCTA 4Z7NE 5CEZE 3DPBA 4WUUB 1PG7H 3WD5L 3QO1A 3MV01 1A1MA 3MLTA 1Q9WA 3VXTB 4I0PA 3RTQD 3DNKA 4U0QB 1ADQL 5M94B 3BD4A 4EI5D 1Y6NR 1DBBH 3B5HA 5K33A 3BIKB 2R1YA 2E6PA 2GYSA 3R0MA 4I18B 3JUZA 4MZ3A 5IVZB 4RQQA 4A6YA 3GSVA 4KRLB 2FECL 5DJZB 3QG7H 4OFVA 4XPFL 4XMPL 1HOCA 1X5ZA 4HZAA 2IH1B 3DI3B 5D7LA 3ZKXC 3C2SA 5AZ2L 1A6PA 2EDOA 4ZSOE 3RWHB 3C5ZC 2EDFA 4HS8H 3BMVA 1ZHKA 2F5BL 4KV5F 4P23D 4JFPB 1CICC 1Z2KA 1XF5A 1IL1B 2OCFD 3JXAA 2B8OT 2QTEA 3MSPA 3TZVA 5MENB 4XNXH 3T77A 4Q9CA 4M43L 1U91B 3O0RH 5A2JH 4NRXB 2G2RA 4TRPH 5C09B 1YDPA 4PJ5B 4PB0H 1UZ8A 6FABH 5GGTA 4OLYH 5CJBA 4ZUWA 1CF8H 1MAJA 5DVMA 5JIIA 1Y0LA 5CZKA 1MRFL 3S34L 4ONHA 3MRJA 3GSQB 3F5WB 3CLFH 1MEXL 5GGVL 1HEZB 4RMWA 3JBG7 1Q9LA 5I73B 1HWHB 3MGAA 5EUOE 4IRSC 4AQ1B 4H1LH 4OCXL 4OLUL 2EECA 1QTYT 1PD6A 2OZ4L 4DUXA 1WV7T 4OIIH 1S3KH 4HQQL 1A6VL 3AROA 1FZMB 3FQWA 5IV2B 4F7EB 2ZUSA 4NWUH 2CMRL 4HIHB 1KTDB 1GPOL 1IAMA 3KLAB 1HI6B 4ZUUA 4JO2L 4RIRB 3B9KA 2YMXL 4MNQA 1FZKA 3GSRB 4G9FD 4NCC1 5GRYA 2ID5A 4MA7L 5I1AB 4X6CB 5MP6L 2EDWA 2IMNA 1W0VA 4NQCA 3Q6GH 8FABA 5BVJA 3HI1B 4WW2A 1NPUA 4X7EC 3CX5K 3VGEA 3SCMA 2DL9A 2YK1L 2E27L 2NY2D 2EEBA 4LHQB 1FORH 4GXVH 3MV8A 3U4BL 1RV6X 3K4DA 3VWJA 3KYOA 1F3JA 4WHDA 4WI8A 4F58L 3P9LA 3CH1B 4FS0A 3FQNB 3VA6A 3SEPA 4UNUA 3VFSA 3C9NB 4GBXD 5GXBB 2ESVD 4LP4A 3FO9B 1UCTA 5GIRA 3MNWA 4A2LA 2ADIA 1AO7A 1U8JA 1CD1A 3KPNB 3PF2A 3N50A 1KELH 3BRDA 2VLRD 4NBZB 5BV7H 5L88L 3PABA 4AIOA 3KPPB 3WFHB 5I71C 4NJ9L 4XBPB 1T2QL 4U4BA 2YZ1A 1G6VK 1JTTA 1XF2A 2HT3D 5CJOH 3WJJA 2X6MA 3HS0A 4JRYE 5AYUH 5F7KC 5F6HJ 3H3PH 4JRXB 3V6FA 1XGQA 1WT5A 1KB5A 2B1HL 3GBMH 3NZHL 3VG0L 3QHTC 3QAZB 5J11C 1KCLA 1U8NB 1S7VB 4F7PB 1PQZB 3SKOB 4NO0B 2HFFA 4HAGA 5JPNA 2NZ9D 3GGWB 4X8XA 2YD7A 5IUSA 1YMMD 2PW1A 4DGVH 4H1LA 2VSCA 1F5WA 1X5GA 5F72S 1RIHH 4WTZG 1JGLH 4YBHA 3H9HA 4HGMA 4O4YL 5F7LB 2UYLA 3SJVD 5EZIH 3DVNA 4R9HA 5CCKL 5BRZD 1G7HB 4FQJH 3BIAX 3OXSA 5D5MB 4XP4H 4CU8A 5I1LA 4U1LB 4F8QA 3KPRB 2DYPA 1T0NB 5F96H 4TTDD 2BVQA 4MAUH 5F7EL 4NT6A 3RWEB 1OP9A 4JM2F 4YO0B 2DRUA 1B90A 4G6FD 1CL7H 1MI5B 3S96B 3SDAB 5T1KB 4FMFA 4KKNA 4MVBD 2OM5A 3PWNA 3O3AB 1CG9A 3IDIB 4B5EA 3FT2A 2XKNA 5BZWA 4AIXA 1KLGA 3ZLQC 5JOPE 2VLJD 4LHUA 3MLVH 3I50L 3ILQD 1LE5B 3NACH 1BF2A 2HA1A 4P9HL 4PG9B 2C1PA 4Y2DC 2IPTL 1X5HA 4P4RB 2JF1A 1NFDA 4LCCC 4BJLA 3QUYD 1REIA 1B0RB 3O6FA 3NVQA 5SWZE 4LLUB 3FOLA 2YD2A 3RVUD 3K4AA 4XXDB 3LHPL 3O2WH 1CQYA 4RWHA 5HDBE 5HGDB 2AXJA 2DM4A 2DLEA 2VZUA 3O41A 4KDTA 1IM9A 2AJSH 5I71B 5I1IL 3P4NB 2FATH 3KGRA 3QEHA 5E7FA 4G7VH 1K85A 2XNAA 4DVRH 5IB5B 3VD4A 3RQ3A 5D9SA 5ETUA 5C2UB 3SDXB 2R23A 4R0LB 5H35B 4ELKA 5LCVL 4CW1A 1LEGB 3ARFC 4MWFB 2IPKA 3VD3A 3VE0A 3DBXB 4P2OC 4U6XB 1RHHB 5D72H 3QDAA 1W72A 1J0YA 5FGBA 3MC0A 2QEJA 3BYTA 5IEHA 4YHNB 3QG6A 5JNYB 1UVQA 3CFJB 4Z5RB 1XF3A 5HPMB 4NOFA 2VE6A 1HN1A 1VGEH 3TCLB 3QUMB 4FQQB 3I6GB 3G5ZB 3P40A 5BXFB 3SQBA 4IOIB 3BP4A 2EXYC 3GRWL 2DJ4A 2DWEA 4XGZA 3RVWC 3QUXC 4XRCA 2ATPA 5C0AA 2F9BT 3LIZL 3HNVL 5CP3H 2QHLA 3KPTA 3ZDZE 4JFDB 4OZHB 4KJQC 4H25B 1A6ZA 3GMMB 1JHTB 3REVB 1A14H 1IAOA 2VLME 2IMMA 4O2EA 1SJHA 1INQA 1VACB 3QI9A 3MLXL 4N0CC 1HQRA 1RMFL 5HHNA 4A2MA 2EKSA 4MA3B 4NZUL 3ZDYF 5KG9B 1N6QH 2VXVL 4I4WA 1U8MB 4XB8A 3ZTNL 4UV4L 1UA6L 3UEZA 3ZE2E 1IEBB 3WBDA 3EW3B 1R5IB 3E6FA 3DV4A 4KK5C 2VOTA 3LRHA 4A6YH 2A9NL 3CPLB 4HAFA 3EO1A 4G43A 2E7CA 3P0GB 2FIRT 5E2TL 4PJXB 3GJFH 3ABZA 3ARGC 1NEUA 4OZFH 3VXUE 1T0PB 1FDLL 1CGVA 5C09A 1UM6L 3V5DA 3O45A 4NZRH 2R2HA 5D7JD 4Z95H 3LZFH 3PJSB 4U7SA 4YR6B 5HVHC 4LAQL 3VFRA 5ERWA 1TXKA 1KPRB 1VGKB 3MOAH 5J12C 3HAEB 3KJ4C 1FIEA 3HFMH 4ISVB 2BNRE 1OAXH 1WBXB 3DXAA 4H0IA 5FXCH 4NRYB 3KPMB 1MVFA 4IRJA 3F7RA 1LE9B 3MJGX 4M43H 5F9OL 2BNRD 4L8DB 4JFHD 2X42A 1QQDA 4HUWB 3SO3C 1RZ7H 3U0WL 4KJQD 3WDJA 3U0TA 3L3IB 4QTHB 1LO2H 3F62A 2VLKE 1CN4A 2XWJB 3I02A 3LKQB 4XXCA 3DVGB 5DC4B 3OXRB 5E03A 5C0AE 5C9JA 4XPBH 2UWEB 1HHHA 3ZKND 1TVBA 1MEXH 4PJAE 3GIZL 4TPRL 4ZPVB 4CDHA 4KTEL 1RK0A 1UXWB 2FBJH 3OKNB 4KJWC 5DQ9B 5L2KA 4CMMA 2OK0H 3S3JA 2ICWJ 4PJGE 5HGAB 3L3DB 4KMQA 3GFUA 3L5IA 5F7NC 3TBTA 2RGSA 1QYGH 3L3GB 1VFMA 3LPFA 4U1SB 3V6OE 2ENYA 3T2PA 4PS4L 2IBBA 1GYAA 4WO4A 2BY0A 4R7DA 1UM5H 5HY9B 4NN5B 1IC7H 4J4PA 4DGIL 1TQBB 2ZUYA 5DD5L 3QRGL 2VQ1A 4LRIC 1IAIM 4KXZH 2H6PB 1MI5E 2ICWB 4RFNB 4HXAH 2J2ZA 5DD0H 3G6DH 3T4YA 2JJTA 3HPLA 4PRBA 3U30B 3UZQA 4NNPH 2AGJH 4RGND 4QHKI 3K3QA 2H32B 4C83B 3RKDC 5HHMD 2APTA 3PXJA 4GXVL 4UTAL 1N26A 1T83C 4XP5H 4PR5A 3IDGB 1ETZA 1ZXQA 4CADA 4ZTOL 2CRIA 1MWAH 1D3CA 2ATKA 1KLUB 1JUFA 3L7EB 2XTJD 2CJUH 4CUCA 3HKFA 3PWPD 4F33B 1J0JA 1QR4A 3HLAB 3TT1H 4I13B 4KHTH 5B8CC 5I76B 2GJ6D 1EO8L 1NBVL 5GRJL 3LQAC 5ITFA 3Q6FA 4U1HA 1OWWA 3FB5B 5CHNB 4CU7A 1QLFA 3ZKNC 1LK2B 3ARBC 3UC0H 1MHPL 4LLMB 1AKJB 2F58H 4YFLI 3OAZK 1FNGB 1MJJB 3KPLB 1TZHB 2EEDA 4NO2B 5I18H 1IILE 3O6ML 5MENA 4JQXC 2HVKA 2HTKC 3KJ6H 3WNPA 4WW2F 1CFSA 2DQHH 3VCLA 5HHQA 5C0BA 3QXAB 1AXTL 3RKPA 5E2WL 4LLVB 2X41A 3EYVA 4PJGB 1Q9OA 3IS0X 5J56B 4HWEL 5T1KA 2FEDD 3D39A 4DGVL 4QWWD 5D6CA 4LGRB 5F89A 1RIHL 4LHUB 3H3KA 1W72H 4MJ6B 1IQDA 3IU3A 1EGJA 1MCWM 4NO3A 4D0DA 1I8MA 3FO0H 2O5ZH 5CFHA 1OWRM 3B9DA 2JK5A 3T1FB 5CAYB 3KPQB 2EDTA 5J89A