2P7TB

Crystal structure of kcsa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB-A
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB01
5L9DL 4DGIL 4ZYKA 3MRBA 1WBXA 4KZDL 2CIKA 2ARJQ 5C0IB 3K1DA 2H8PB 3ECBA 2I25N 2JKXA 5EBMA 3K1KC 4H1LA 4MNQB 1YPZA 4IRJD 5J12C 3V4UL 4GBXB 4WFHD 3EO0B 3B83A 2XACC 4EDWL 5HI3D 4ISVB 5IVNA 3BQUD 4WO4B 5M7QA 4G9DA 4OZ4A 4Z7VE 3BDYH 5JW5B 5J6GB 1S9WA 4NKOA 4OM1L 1BPVA 2HT3C 4P3CH 3U0WL 4MSWA 4CU6A 4IRSD 3QUZC 1LE9A 1BBDL 1RJYA 1DR9A 4MB4A 3HB3D 4JM2C 2OM5A 1RIHL 2ZG1A 3LKOB 5GZNC 3BESR 1FL3B 3MOAL 4MNQE 5ESQA 4JREC 1XIWC 3X3GH 5EIVA 3AREC 1BFTA 4HIEB 1S9KC 5M95B 3TWCL 4FZEH 3KLDA 1UB5B 1NAKH 1KJ3H 1G7MB 4YHIB 5FB8A 2E5EA 1J86A 4X7EC 4FFWC 4S1RL 1G7LB 3FFDB 2NX5A 2D9QB 1SJHA 4X7TA 4LCWA 1PG7H 2Q8AH 3S5LB 3I6GB 1JGVL 43C9B 3K4AA 1T66C 2C9AA 2V5RA 1DBJH 3X14B 4RRPG 4YR6A 4Y5XC 4C56A 2EDOA 3OV6A 1AHWA 1AGFB 3Q5OA 1CWVA 4PJXF 2NY5H 4Y1AD 12E8H 1Z5LB 1LEKA 5CJQL 1G9EA 2BSSB 3LEXB 3DYPA 3MNVA 1TVHB 3HKFA 1W0WB 4U1JA 1IM9A 4IDJL 4YUEH 3PGDA 5T3ZL 1MI5E 2FLRT 3IKCA 3QDGE 1GGBL 5EWIH 5GGVY 1HHHB 1OT1A 2R69L 2VC2H 4D9LH 3QFJA 1ZT4B 5BW7A 3V4VH 4NCC2 3EAKA 1ZV5A 3RUGA 1MRCH 3LV3B 2VXTH 4F7EB 3RKPA 1A0QH 3QAZC 3SE4C 4EN3B 4F33A 2GJ6D 1GHFH 5IQ7L 5T5FL 2DI9A 5F9JA 2AV1A 5GGRB 2OMBA 2FEDC 3O4LE 2WZPD 5I18L 5FYKD 4YE4H 2J8UA 4LBEA 5I73C 2FBOJ 2NY3C 3KPMA 4NKIH 5KAQG 1RZ7H 2JIXD 1I1FA 4OFPA 4E5XA 5C0CA 5JXEA 4ZUWA 4UOW1 4FQ2L 4FQJL 3OJDB 4M03A 3RWJA 1PFCA 2BC4B 3TVMC 3C8HA 4L4TD 3OKDA 5DO2C 3QR2A 5CJOH 2QSCH 3AS2A 3MYJB 2HA1A 3KPOB 2VLJB 5DLMH 3H9HB 5EORH 3O9WC 2FO1A 5D1ZD 3O11A 4QY8B 5DD0H 3QNYA 2YD7A 4CVWA 5JOFA 3QPQC 4LLDB 1FIGL 1FYTD 3CFDA 5I2IA 1CIUA 4WV1B 2PTUA 4TNVF 3UYRL 2A6DB 1J1OL 2HFTA 1OTUD 3TNNB 4UT7L 3RWGA 3C2SA 2P8LA 4JDZA 4RFOL 1F45A 4JO1H 1Q72H 1UEMA 4R9HA 4EUPH 3AGVA 1E27B 2VLJE 5GS1C 2Z31C 1RIVH 2F19H 4MVBD 2YK1L 4RGNC 5DRNA 1U3HD 1QLRB 3K8LA 5LAXA 1JTPA 1F90L 4FQXC 2DQUL 1MJ7L 4YAQB 1MHHB 1DLFH 3MLWL 4ZOBA 2R9HC 4ENEC 1TTGA 4U6VH 4G8IB 5IMKB 4TVPE 1KTRL 3WLBA 3I84A 4RX4A 3PJSB 4CN1A 3ME0A 4XZUA 3FTGA 2ZKHL 1X5AA 3ILQC 4JGJA 1X5XA 4D0CB 4P4KC 4W6XB 4WNQA 1YEFH 4NNYB 4GSDH 4YK4B 1OSPH 2V2WB 1P4IH 5EB9A 3BIKB 5E1AB 3L3OB 2P49B 1KLUB 2WBJA 5CSBA 2FHBA 5C0BB 4ZOEA 3I6LE 4JG0H 3LAFA 1NMAL 1JGEB 3CFIC 1QSFA 2E9BA 2EIZB 4RZCA 2NY5C 5GSVA 1M7IA 2JJWA 1ERNA 1WWWX 2YEZA 5IW1B 1QLEL 25C8H 3RX8A 3PGCB 3SGEI 4XCNA 5CEZE 2YBRA 5DMJB 2CKNA 3QUMH 2DLFL 2YPKB 1Z0MA 4S1DD 3ZMRA 2RFXB 4FQCH 1YPZF 4MB3A 3UTTD 1GSMA 2AKRA 1DLHB 4LSPL 1NBYB 1B9ZA 4POZD 4NO2B 5L88H 3OPZL 1CDYA 4BZ1H 5DFVC 2V7HA 2ESVD 5C86A 5E9DB 3RWIA 5J7CC 4XMPH 3D18B 5IB2A 3AU1B 5F7LB 4M3KB 1J87A 2DYPA 4QT5B 4G8GE 5HI5C 2DLEA 4M43H 5HY9B 2ZG2A 4GW4A 3PQYA 1UCBL 4N0FA 4PUBL 3NVQA 2B8OT 3GRWH 3TPKA 2A6KB 3D5OF 3ARGD 4J3WA 4X5WA 1FFPA 1YEDB 5E9DE 3OR6A 4JKWA 3MBEA 3JZ7A 4W6WB 3VXNA 4KK6D 3O6KL 5DK0A 2Y07L 3NBNA 4YXLH 1TJHH 1Y0LB 5GIRB 2ICEB 3LN9A 3OR7A 5ISZD 4UT6H 2H6PA 4PP1C 4M1CD 5GS3A 3MRGB 4J4PC 5IB3B 3WEXB 4X5LA 1V8HA 3RGVC 1OCWL 3ILPA 5EC2B 1NJ9B 4QHUA 1AGEB 3QUXC 1WIPA 4YDJA 1HOCA 2OL3A 2DQHL 3GHEH 1MJ8L 4QXWA 5B8CC 4FFZH 1CGSH 2ZUYA 3CLFL 4QYOB 5SWSB 5I1EL 3RUGF 4QEGA 4LVEA 1CCZA 4HJ0D 2XIDA 3IGAA 4X6EA 4NO0B 5L7XH 2BFVH 3ZTJG 1IFHH 3H42L 2CXKA 5EOTB 3EHBD 4TTDC 1NAMA 3HNVH 1R5VA 5IQ9B 1YEHL 3F7YA 3UTOA 1D5BB 2Y72A 1X3DA 2FX8H 4LDEB 4NQSA 5EC1B 5KN5A 2J8UF 4JRYB 1BQSA 1QQDB 3ARBB 3ARFD 2HKHL 4LARH 5GISL 1NMCB 5I17A 1VFUA 5DJZB 3ZHKA 3LPFA 4TULL 4KK8C 4OFIA 1KT2A 2IBBA 4P59H 4RAVA 3NTCL 3OGCB 4WRLA 2PTTB 2PUQT 3VWJC 1ONQA 1D9KC 3L3JA 1YEGH 1JHLH 4F9LA 4K07A 3T1WA 4OBSA 2CDGA 3E0GA 3DECA 4KRMB 1C1EL 1DANT 3B2UC 4JRYE 1ZLWH 3OHXB 32C2B 3O3AA 1JUFB 3V6FA 1WV7T 3JWDH 4D9QE 2EH8L 3SDDA 4Y19B 1OPGH 3TA3A 4QOKD 5F1KC 4APQD 4HEPG 4H0HB 3X13A 4HT1H 3MFFA 4HKBB 2IBZY 2R0WH 3D0LA 3MNZA 5GGTL 4KVCH 3QIUB 1RHHA 3VWKB 1KG0A 3MQIA 1DP0A 3QIBB 3Q3GA 1P7QD 2GSGB 4PRIB 5TE4L 3I50H 4WW1A 3O3DB 3CVIL 3QDAA 5IM7B 3KLHD 4HXBL 1ZS8B 4S1SL 3QEQA 2R56L 3E3QC 4MGXA 4QTHB 2K7QA 4HQQH 5GS0D 4X5XB 2AJXL 2AK4E 3KLAB 1LNUB 1EGJA 2FH6A 3GSNH 4AL8H 4Y19E 4NBZB 5L2KB 2UVEA 2DJ4A 4OD2A 3HZVB 4ELKB 1BREA 3GIVA 1FVCA 1ITCA 3ROOA 4LHUA 1CZ8H 5DD5H 5C92A 4BUHA 4FQQB 5KSUA 3MNWB 4LFHD 3FFCD 1KTLA 4HG4J 5D6DC 1X5YA 1XR9B 3WUWG 5IVZA 3P4LA 2V5MA 4HIJB 3BW9B 3BDXA 3O3BB 2YD6A 5E0QA 1UFUA 4GKOA 3MBXH 5HHOE 2KUTA 4KRNA 3B6SA 3AREA 5DMGC 1I1CA 5IB4B 1QRNB 4JPVH 5FF6A 3HAEG 3MRLA 4UV4H 5C07A 1L7IH 3MRIA 4TVPL 1NDGB 1YEJL 3BVNA 4LGPB 3RTQB 2E8YA 3TYFB 3TIEB 1A1OA 1FVEB 4AMKH 4ZUTA 3U9PH 5EO0B 6CGTA 4R7DA 3MLSH 4MNHB 4Y5XA 3CPLA 4JO4H 3VJ6B 1CLZH 5GGUB 2C3VA 1VGKB 2W9LA 5A2KH 3ZDXE 2CK0H 3X11A 4ZODA 4WFEE 4D0DB 2AEPH 4YHNB 3BN3B 4U1KA 3ULUH 2NTFA 3NIDF 3KHQA 2E6JA 5BOPA 1UXWB 2V17L 4GAYA 3TN0C 1KN2H 3CU1A 4UNTA 3RWCB 3TEUA 5CEZL 1VA9A 1A6PA 5E24E 1FLTX 3MV7D 2X9XA 1X5LA 3MPCA 5DHVB 1JPSH 1BIHA 3K74B 4XX1E 1A3QA 3SE4A 3TZVB 1VFBB 5GRWA 3QWOB 4HK3N 3MXWH 4NQXB 3RDTC 4NGHH 1DFBL 5FOBB 2O61B 4WI6A 1VDGA 1UQSA 2OX5A 4DGYH 3CK0L 1VEMA 3CCHA 3DURB 4CDGC 2Q7NA 4K2UH 3Q0HA 2E7CA 1GC1L 4KUCF 3UJJL 4NQDB 1ORSB 1YZZA 4WW2A 2R39A 4OCNC 5LG1A 2ICWB 3PWJB 5BRZD 3CXDL 1KLGB 1WCBA 3F58L 3F7RA 4G7VH 2V2XB 4Z95H 4Z6AT 4ERSH 1C5BH 1G9ML 2A0LD 3ARDB 2A6JA 2HP4A 2EDYA 4I3GA 1QFPA 1YN6B 3MRJA 4M6OH 3JWDC 4LL9A 4O2EA 1MH5B 4Y16D 2W59A 4K3HA 4NO3A 2UUDH 5IROC 3DIFB 4GG8A 3ULVC 3UXFA 1BAFH 3EYQD 1L4IA 1N2RA 1K3IA 2GYSA 1QKZH 4R0LC 2IC2A 2O5XH 1SBSH 4LHQB 3O9WA 4OFDA 4Q9QH 4NQDE 3BISA 3QHFL 3OKNA 4JRWA 4QXTA 4L4JA 5IBTL 3B3IB 1I1YA 4YWGL 1JYWA 1UWXH 4NHUA 3DX6A 2NZ9C 3CAFA 3VFNB 1M4KA 4L8BB 3ELAT 1NUNB 2ZWLT 4LSVL 2X4NB 5DJ2A 3QNXB 2BVQB 3MYZA 2D0HA 2NY7L 1ADQA 1IAOA 4JFEA 3UC0H 1CL7L 5CBAB 4JZJC 2VLKB 5HDBE 2AJSH 2EIEA 1WBZA 5GS1A 2Z31A 5DR5L 1WAAA 5HPOA 3KYMA 3NAAH 2MJWA 5JHDA 2EC9U 3H9YA 2J6EA 4KPHH 3U0PB 1A6WL 2ZOLB 3L3GB 3L6FB 4FQXA 1A7QH 1UM4L 1JI2A 2JLLA 3RZCD 3G6DL 3GSQB 4IOIB 4KJWC 2NLJB 3MX0A 4TYUA 4G6ML 3TWCH 1CE1L 4KKCD 4NUGL 1CF8H 1QSEB 1EFXB 3K80A 1NGXB 3MLTA 5T3XH 5CJBA 1ES0B 1JGUL 1AP2A 1D5XA 1FN4B 5F97E 4OGXH 4GRWH 1H3UA 2NX5D 4P4KA 4QGYA 5E5MA 4LCWD 4UT9L 3FHQA 1CDUA 1T7YA 1KN4H 3BRFA 4PG2C 1LDSA 1Z9LA 3VFUA 3L1OH 1NLBL 3QI9A 3RWHA 5BO1H 2M1KA 5CZXC 5DJYA 4NRZB 2F58H 4OV5A 2Y4SA 3CVHB 3GHBL 4PRPE 3C6LB 2NY1C 4NJAH 5HHQB 3LZFL 4F37F 4RGOH 3DSNA 3QA3B 5FCSH 3ULUC 2XYCA 1BOYA 4MD4A 4N1EA 1WISA 3DBXA 1UZ8A 4IDJH 1CK0H 4RMUA 5HXMA 2FWOA 3AXLB 1RULH 4OGZA 3W2DH 1CD9B 1GVIA 3BPCB 4XXCC 5CJ8A 1Z0NA 3QFJD 3OXRB 1U93B 3CDCA 4DZ8B 5E03A 5DJAB 1HWGB 5KZCB 1YYLL 2ITCB 5E6IC 3T0VA 3S4SG 4TUKH 2Y25A 4NQCB 5EUKA 1JP5A 4OAWB 3E6HB 5EZIL 1A6VL 1MLCA 4KMTH 2DLGA 3QDJB 5D7LB 1HXMB 4D0BB 4WI2A 2XWTB 4XPBH 3JV4A 4TUOB 5HGBB 1IAKB 3WDHA 4DUVA 1ZHNB 3A67H 4NSKB 1KJMB 4XRCA 1HH9A 1RUAL 3BKYL 1T5XA 5JXED 4UNVA 4GMTH 2ZCLH 2C3XA 2VLRD 3UTPD 1INQB 4U1SA 5L0QB 1MCPH 5C0EA 3B2VL 3H0TA 5DD1L 2XKUA 2EDHA 2XY2A 4LVHB 4O2CB 4NQCE 5C70A 3BIBX 3GB7A 1PSKH 3KS0J 5DQJA 4MAYB 1CBVL 4M1GH 1UM5L 3FT4B 4YDIL 5IBUG 3QDJE 5D7LE 4DN3L 3THMH 5E8EB 1AGBA 3D3VB 3WSQH 3VCLB 5JOPE 1CTOA 1ODAA 4G6FB 2H3NA 2EXYD 3IXTA 4UAOC 2FYYA 3IDNB 4X98A 3V6ZB 4DKFL 3MV01 3WJLC 4X0KA 1RURH 1BX2B 3QUXA 2X7LA 3H7BA 5DJ6B 4A6YH 2K1MA 5C6WH 5CCKH 1QBBA 3EYUL 5B8CA 3HMXA 1ACYL 4XB8A 1JPFA 1N64H 4EJ1C 1I9JL 3WD5L 4G6AD 2FRGP 5DZLA 3D3VE 4OBRA 1KPVB 1DN0A 5ESVB 4AZ8A 1ZVSA 3SDAC 5B39B 1C12B 2G60L 4JJ5B 1UZ6E 1U8NA 1E4XL 3DMMB 5LWYH 3TT3H 5D7SL 3VGAC 4G9FB 4G3YL 5IEKA 1X5ZA 1D3CA 3LKSB 5DWUL 3TJHD 1FLRH 4JB9L 2EDBA 4B5EA 1U91A 3T1FA 3IDMA 1MAJA 1M05B 4WW2F 3HE7A 4LCYB 5D1XA 3KS0H 2RCSL 4KUZH 3TLRA 4YHPB 2HRPL 3WNOA 2FJHB 1FFOA 4N9GB 5F9OH 2VDPL 4IMKC 4QTIH 1RZIB 2I9TB 1N5YL 1RD6A 4G9FE 1UJTA 2WBJD 4HPYL 5F3BB 1TCMA 4L3CB 1EZVY 2Q3ZA 4G6KH 1IGFH 5ERWB 1QSFD 3K81A 1QLEH 3DXAE 5JDJA 3GM0A 1XZ0B 2IALB 3BWAA 4DVRL 1KJ2H 4N8CL 1T0MB 2XG4A 2NY2B 1K2DA 2ZNXA 3BEVA 3C8KA 4AIOA 1ZLWK 2H1PH 2WUBH 1KXTB 1BF2A 2SEBA 1VKXA 1CU4H 2DMCA 4HIXL 5B39G 5ID0A 1KEML 1IC7H 4QHMA 1K8IB 5I15L 1L0QA 3TCLA 1WAAF 3UROR 4HFWA 2BXZA 2DN7A 4V1DB 3F12B 3SKUD 4IOSD 1X5FA 2EDFA 3MRHB 1NMBL 2F54B 1VADA 1AD9B 1NCBL 2VE6A 2VN7A 2DYPD 3IDGA 1SYVA 5K33A 4M7JL 3C2AH 3F62A 3T2NL 4Y2OA 5B3JE 1KV3A 2W38A 3JV6B 1DZBA 2WLZA 3PQYD 4R4BB 4F9PA 4JE4B 4JY6B 1FNSL 5C0DA 3T0EC 4LLVA 3SJVB 1IKFH 3PWPB 3FHAA 4DTGH 4V1DE 1NLDL 4WTWA 1SEQL 1R3IL 3MLZH 4K94L 3OF6D 1NGYA 3MBED 2F54E 3MO1A 4G5ZH 1PKQB 1E0OB 2VERN 5HVHC 1WZKA 4U33A 2P5WA 3DVGA 5JXAL 1KNOA 3ZKMD 1GL4B 4F7MA 2G75A 4NIKB 3BGFB 4GG6A 1ZHKB 1NQBA 3WL9B 1CQYA 1RHFA 1EX0A 4CVXA 4LSSH 1U8QA 3OAYH 5HDOA 1HSAA 1MQKH 4HD9A 1B6DA 3PXJA 1MCWW 2X4RA 1NFDA 1ZXQA 1PKQE 4WHYG 4EKXA 4WTZG 1GOHA 3RIFF 3HMWL 5IVXA 2HH0H 2R2BA 4FQLH 2WAHA 3CLFH 3EDEA 2XPGB 4YPGA 5ID1B 2VL5B 5FM4A 4M4RA 1E6JL 3D39A 1XMWA 2BNRA 5EZJB 3TN0A 3DRTA 4L4VB 4F80A 1MFDL 3QP3A 5I8EB 1YNTB 2IQ9L 1ZA6A 1YEHH 4I8DA 3GO1H 1IC5L 2IH3B 1I9IL 2HKHH 1OGAA 4JDVB 3S3PA 1XGTA 1OLZA 1MREL 4H25A 4TULH 3RDTA 4DZBB 3V7MA 5DEZA 3VXOA 3ARPA 2DQJL 3SDXA 2R1YB 1CR9L 5JNYA 2Y5TA 5BJTA 2A38A 3QO0B 3U4EB 1FSKB 4YEEA 2AQ1A 5E94B 3QQ3B 4FQIH 1JMZA 4S1QL 5LBSH 1OAQL 3BZ4B 3GMQA 1YN7A 2E9JA 4OFKA 1CICC 3V5HB 5J1SC 1TCRB 2O5YH 1NC2B 4FFVD 5IROA 2EEDA 1DBML 3SDDD 3I6KA 4OCXH 3ZHLA 5AD0B 1DUYA 4UDUA 1FCGA 1JF1A 1CGVA 5FECA 4W68A 3DX8A 4XAKE 5C8JA 2FO4B 3WO3B 5K9QI 2XTJD 1WQVT 3WIIL 2Q76B 4XBPB 2UUDK 5TE4H 3QISA 4F57L 1EHLL 3VFMB 3CVIH 2RGSA 3BKCL 2JK5A 1MLBA 3QQNA 3W0WB 3GUTA 1SJEA 5HDLA 3GSXA 4XP6L 5IB5B 3FMGL 3DRQA 3IDYB 5JUEH 1JPTH 3V4PL 4XP5H 1MJUH 1HSBB 1AC0A 3GJEA 3DI3B 4JZJA 3QB7C 1UWXK 4CJ1A 1G84A 4OKVA 4LHUD 4JPIB 1EDQA 4PB0L 4MDJB 4G42A 3MRPA 2IGFL 5EO1B 3B8YA 2HT3D 4NQVA 3EYOA 3QUZD 4PRNA 3IFNH 1HEZA 4XVSL 3W39B 3W0WE 5GZND 5KSBB 2DM2A 1RK1A 3PNWA 3TO4A 4YFLI 3ARED 1EEUA 3HC3H 2VXSH 1TTFA 2OS7A 4K9EL 2WLYA 2BNUA 3QEGL 5FV1L 3UJIH 3MV8B 2VUOA 4XCYB 4ZO8A 4EBQH 3UYOD 4WO4C 4FFWD 4OB5L 1KIUA 5IFJB 3LMJL 3N06B 4U4BA 1FE8H 1U0QA 1QBLH 5ACZA 3EO1B 4PTTB 3RIAF 1T66D 4PG2A 3EJJX 3ZTNH 1X5JA 2F74B 1V7NL 4E9LA 1NBZB 1MCEA 5KSBE 3RU8L 4KRLB 1NCWH 1DEEB 1GGCL 1K4CA 2MWCA 3O45A 1P7KB 1NANI 5A2FA 4LKXB 4ZTPL 5E8PB 1JE6A 4ZPTB 4ZG1A 3O2DL 1XF5B 5HJ3A 3CUPB 4PRDB 3HR5A 3MV8E 5FYLD 4BA8A 1XGRA 1U42A 2GTWB 3C9NA 4ZFGL 2AQ3A 3UBXB 3VXMD 1W72L 4HGWB 5GJTH 5E08H 3T65B 4R7NA 3ETBF 5DRZB 2O5ZL 1ETZA 4YQXH 3MRQA 2I07A 3EO9H 3M17A 1AO7E 4XXCA 5KSVA 3WFEL 3LN5A 5E56A 2EE9A 4I5BA 1UGNA 3EYSH 4O02H 3CNKA 5E6IA 3IFPB 1U2HA 4J12A 4YFEA 3R06B 4L29A 4ZNCD 2FEDD 2HAZA 2JJTC 4JFYA 4U2ZA 5F7FA 3MV9E 4UQ2A 1GGIL 1FZMB 2Z93A 1GC1H 1AY1L 4OV6F 1ZGLA 1D6EB 3QRGL 1YC7A 5FDWA 4N0UB 2NY3D 4QF1B 5C3TA 3CXDH 4JKPH 4CL7A 4OCSL 5E8DH 4OD1H 1SVZA 5I1IL 2D7MA 2OJZH 5F89B 2DQTL 3OJVC 4GG6F 5H37H 3TVMD 1HHKA 2XKSA 4XPGH 5DO2D 2OQJA 4BH8B 2FGZA 5DI8A 1RUQL 4EN3C 4HWBH 5EA0L 5BVPH 2BDNL 3FZUD 3QEUA 2HJLB 2HVJB 5IJVB 2NPLX 1RMFH 3NCEB 4ZUUA 3RY6C 3UBXG 4C83B 2H26B 3O9WD 4MJID 1FZOA 2ZUUA 4H8WL 1OWWA 1E4XI 5DJ0B 1NFDF 4LFHG 3MLYL 3QPQD 5EO9B 2LU7A 4MYWB 5IVXF 5C0FB 2R2EA 3CH1A 4BZ2L 2XY1A 5DS8B 5EOQH 2QLVB 5FCUL 3V9FA 3S98A 2BK8A 4NHCH 3WJLA 1FV1B 3LDBB 3NZ8A 2OR8A 3G9VA 4KGLA 1TZGL 3KXFE 2QQLL 4JFED 4I18C 4P2OA 4WFFD 3GGWA 2F53E 2Z31D 1JRHL 5DJCA 4RGND 2XICA 3MCKA 1QYGL 3LOWA 5JHDD 4M9OA 2IMNA 4KKLC 1A6WH 2GIYA 1H3PL 1MHPL 4NC0B 4Z7OF 3KPSA 4FQXD 3FCTB 1RY7B 1RZJH 3QIWB 3KPQA 3SDXF 1L6ZA 4BFBD 3MRDA 4JN2A 2WP3O 4FP8H 2PCPB 3AS0A 1OAKL 5F6IB 3RP1A 1CE1H 4ENED 4NUGH 4WV1C 3LPGA 2J88L 3C6SA 4TSCH 4KQ3L 1YC8A 2J2ZA 3V6OA 1YJDL 3BUYB 4KRPB 5L8LB 3LVEA 4H5SB 5F7KC 1A2YA 3MCLH 1NSNH 1YMMB 3MUGA 3ILQD 2AABL 1UVQA 4P4KD 3UEZA 1KJVB 5LVEA 1G7JB 4Z9KB 3MREA 4IMKA 1CFVH 3ULVF 1LO2H 5EPMB 1YUHA 4IIQB 3QI9D 1L7TL 4ZUSB 3S96B 1SY6H 5A2LH 5LGHL 2CRZA 2A77H 3GSOA 4OCLC 3FONA 5TE6L 1NGZA 4LNRA 4JFDA 4Q7DA 3QO1B 1WVZA 5IP4A 3STZB 3IU3A 5DJXA 4Q9RL 3G6AB 1H8NA 3OKLA 4PJFF 1M7DB 2ARWA 3B8SA 2MHAA 1CE6B 1KF9B 5I1LA 4NM4H 3EGSA 3S6CA 3WJJC 4YDVA 1ZHBB 2VLME 1BZ9A 4YK4C 3REWA 3HNTL 3E6FA 1FZJB 1CLYL 1TZHA 4WUUD 1B2WH 4HH9B 5DEFB 4XPTH 4N68A 5TH2B 4XH2A 3WKML 1NANH 4JFHD 1RU9H 3AM8C 1RZGB 5ESAA 4B0MM 5EZIH 3B9KB 3LQAL 1GC1C 5HI5D 1GPOH 1H0DB 3D85A 3DVIA 4K7PX 3Q6FB 4GKSA 3AFLA 5MENB 3NIFE 5DUBA 5A1AA 3OKKA 1EBAA 3HPJB 3S36L 3FT2B 2VN4A 1G9MC 4HK3J 3T0EA 4LGSB 4LPTA 3SKOA 1DBKH 3MRRA 5FGRA 3K2MC 4OZGA 3VD4A 1F4YH 3B2VH 5DD1H 1DVFC 3TH4T 2YD9A 1G0YR 2XQBL 3IAGC 4QRPA 1XGYL 1FJ1B 4NN6B 4TNWF 1FPTH 1NBVH 1KCUL 4YDIH 4XC1H 1CG9A 2Z35B 3WLWC 5IBLC 4JHWL 3KPLB 4RDQG 2VABB 2A74A 4DGVH 2YXMA 4PP1D 1J0ZA 4I48A 2A1WH 5TFSH 4PG9A 5JTWA 4J4PD 4HUVA 1HHGB 3OAZH 4NC2B 5EN2B 3GMRA 3PDOA 1D7FA 3RGVD 5GGRY 2X44D 1N8ZA 4EI5B 1MCOL 3QUXD 5EZOL 5F1IB 1E4JA 1F4AA 3FQXB 2VRAA 3W11C 2ZSWA 2XWJA 4GXUM 3IS0X 3VXRD 3VRIB 4Z8FH 3HR6A 1HZHL 4PJEA 3O2WH 2BSRA 2NXYD 2WWMC 1RUKL 3DGGA 5CMAB 4DCQA 5ADOL 1RZJC 4TTDD 1RUML 3QXWA 4G3YH 5DWUH 2BOCB 4LIQH 2R1WB 4E41D 3ZE2E 5EU6A 1U41A 2IAND 3WN5A 3VFGL 3GMLB 4P57A 3DUSA 4QHLA 2HFGL 1MJJA 1Q9OB 1K8DA 3P0YL 5E95B 1MCWM 1A7RH 3KPPB 2WQRA 4WFGD 4KK8D 4NUJA 4FTVB 4HS6B 1ED3B 5HGAA 4Y4FB 3VWJD 1ZTXL 5DJ8A 5GS0L 2VZVA 3HS0A 1D9KD 5KSAB 1IE5A 2L4OA 3AS3A 2WIIA 3NIGE 3T2QA 3WDJA 1I7TA 4KKBC 4NZRL 5IEHB 4NQTA 2E7BA 3B2UD 4NFCA 4XCCL 4WUKL 1CICA 3HCVA 5E00A 4OLVL 4X6BA 3UTSE 1J1XH 5I16B 5DHVH 3CSYA 3ARBC 3G08A 5KG9A 4CN6A 4UUJA 4FTVE 2HFEB 4OZHA 4GUPB 4WI9A 5D96C 3OAUL 4MJ5B 4ONFL 2G2RA 4ZSOA 5C71A 2OK0L 1U58A 3L3IA 1N7MH 2P46B 3DYOA 3KDMA 4H88L 5HYJA 1MUJA 2FIKA 1MAKA 1FBIL 1S5HB 1EAJA 5CUSL 5K9KA 4P3WA 5F7YC 4P5KA 1W0VA 2XN9D 1JNLL 2YPLA 3R8BB 3SY0B 4HW6A 5CGMA 3IRZA 5K9JL 3HC4L 1Q0XL 1B88A 2OZ4L 5INCA 5I30H 4PJ9A 4PRBA 5HTSA 3D2UA 4NP4L 2VISB 4N5ED 4Z7VA 4XP1H 2WBWB 3QIUC 3SO5A 2APVA 4HUUB 4QRTB 3VWKC 4GRMA 4M61B 3QIBC 5IR1B 1CGWA 1CGXA 1NLDH 1F4XH 5DJDB 4K94H 1OGTB 4KV5E 3GK8L 4U31A 5IESH 3ZL4L 2QKIA 4RRPA 2QSVA 3IYLW 5DMGD 2ZJSH 4QRQA 1HILA 3CDGB 4PJAA 5EBLB 1NH6A 4MA1B 3WO4C 3PWVA 2EC9T 3RBGA 5ALBH 2P5WD 4POYA 4L8CA 1MCLA 3CMGA 2ZUXA 5GGQH 4Z76A 4P2QB 4U1IB 3BXNA 4HLZH 3GMPA 3VG9B 1MFAL 2GY5A 3E2HB 4XC3H 4GKZA 1D5MB 2AJVH 5L8KB 4OLXL 5HHVL 1QLFA 4M62L 2DLTA 5E8NB 3ULSA 1CFTB 5LCVL 3RHWF 4R8WH 3FO0L 3G5ZA 2B2XH 2HVKA 2COQA 2Z4QB 4PGBB 5HGDB 1EO8L 5MHSD 5DMKA 2JJUA 2GTZB 1A9BA 4AENA 4P2QE 3MMEA 1XGPB 2ADGA 2BNRD 4X7DC 3FAXA 3TN0D 1RV6X 2H32B 1GZPB 3FO1B 3IFOA 5D93B 1G7LA 3FFDA 1EVUA 4F3FB 4AIZA 4X6FA 2PKDA 1FRGH 3BKJL 4QRRB 3RTQC 1F13A 2PXYC 1MI5A 5F1NA 1J0HA 3BJLA 3QDGA 3G5YB 5FHAH 4BYHA 2D0FA 2VITB 3X14A 3RI5F 1GGUA 1OGAD 5E2VH 1R3JA 4DOHE 1WIOA 1YDPA 4JO3H 3NFPA 3RDTD 3CVHH 4H0IA 2W9EH 2G9HB 3T0WA 5D2NB 1I9EA 4MD5A 1IC4H 3FB5B 4OZGF 4U7SA 4PJHA 2NW2A 1R3KA 1IQWH 4TTGA 3O4LA 1DQLH 2VXVL 4S1QH 1FORH 4IHOB 3OZ9H 1BJ8A 4QRRE 4J3TA 3SQOL 3P0GB 3ZE1E 1G1YA 4L3EE 4OLWL 3ZDYE 4JZNA 2VQTA 2XXMB 2H2PC 1KIQA 4GMSH 3L3KB 4M8QB 1JRHI 3ALPA 3ULVD 3RL1B 4OF6A 3PDGA 5D2NE 5GGTA 4EN3A 2NY4B 4FRWA 3BO8B 5H94A 4LLUB 3DOSA 4O51B 3ARRA 2HT4C 3SKNA 1TNNA 1EHAA 2QR0B 3OQ3B 1U8IB 1GZQA 2LU4A 4OZIB 4CJ0A 3IT8D 2Z92A 2W91A 2GY7B 2ZZUT 3KHOA 4RFNB 2OP4L 1BFSA 3DHMA 3LKQB 1VFAB 4I1NB 3BPNB 4OUUA 2FB4L 2B4CH 4PJEF 5A16B 4U1MA 5ICYB 5JA9A 3IJSB 2CKBL 4I18A 3FQRB 3BX7C 1R5IB 3F8UB 2R23A 3VFSA 2BC4A 1SVCP 9CGTA 1DBAL 4PB0H 5EU3B 3KYOB 1KELH 4RWHA 1T20B 4PGDB 5L2JA 3HZYB 1BFOB 1HKLH 4JRXB 2UWEB 3LSOB 4LKCB 3RVUC 5I0DA 5GRUL 1G7HA 4M6NH 5DYOA 2A9ML 3VXPB 3GIZL 1A6AA 4QY8A 1T7XA 4YEFA 2NYYC 3R1GH 5E4EC 4K94C 4UBDC 1DTUA 3HHRB 4KJWD 5AG8A 5C3LD 5HHNA 3HE6A 1XGQB 7FABH 5TF0A 3T8XA 4K3DL 4M93B 4MQ7B 2F8XC 2XKNA 3QEGH 5A43C 3ORJA 1AGDB 4J1UB 3QXAB 5IHUL 1NEZG 3LMJH 2UWEE 1JWSA 3SKMB 3K46A 1CS6A 2HKFH 2X9YA 3QDME 1FZKB 3NOIA 4RGMB 1A02N 1HHJB 5TGBB 4OZHF 2B1AH 5CZXD 5DSCB 3QT2A 4R96B 2NY1D 1K5NB 4HJGA 2CLRB 3LEYL 3O6FB 4TOYL 3VFWB 2Q86A 2IPTL 4IMLB 5IMKA 3GMOA 5SX4I 1T2QH 4PGEB 3ULUD 1A9EA 4ZFGH 5ICXB 1F3DJ 2DQGL 3ZZ1A 5I1KL 3VRJB 1NC4B 4N90D 5C0JA 4HIHB 4WWKB 5DK2A 3WFZA 1J8HA 4D0CA 2AI0L 3UZEA 4X99B 4AQ1B 4BH7B 3SDCC 3WFEH 4OCWH 3MLXL 3ZYOA 5JW4M 2HWZH 3HZKA 3LH2L 4Z7VF 3KPRA 5E6ID 1ZANL 3C6LC 3REVA 2FL5B 5D9SB 2DQCH 3U30C 4M7KL 1KCSL 4WU7A 1S9XA 1V3LA 5B3NA 5JR1L 4Q6YA 4KMQA 5DQ9A 3G5XA 4QRSB 4G8GA 1OTSC 4HWUA 2RFXA 1RZ8A 4PJAF 3VU2A 4XVTH 4N1HB 5DQDH 5CP3A 2ENYA 1S8DA 5AYQA 4ZDHB 4P9ML 2BNQD 4FXKB 1AXSB 5D70L 3G5VB 1G9NL 4U0RC 1DVFA 5ACLA 5KVMC 5HHPA 5J1TC 1I8IB 1CD1A 2YD1A 3CFBA 2F8OA 5HYQA 3BQUB 5D1QB 3VXUA 4XBEL 1P53A 3FN0H 1F3DH 5T33H 1VPOL 3JUZA 5IJKC 3I3BA 4BSWA 4WHCA 3NA9H 4H8WH 4FABH 1IAIM 2EDKA 5IHLB 3OTTA 4IRSB 5D72L 5I1HL 3QUKA 4L1HA 2NNAB 3MRCB 4N0YH 4UTAH 3ARQA 5EOCL 2W9DH 3MV11 3DX9B 3BP6B 4X7FC 3C60C 1YEIL 1Z9OA 1LO0H 4NZUH 3NMEA 3PL6C 2EYSA 2EE6A 1BIIB 1AC6A 3IETA 4XHJC 4YHYC 4OLUL 4M5ZL 1IM3B 4PJBB 1WWCA 2EDNA 2CGRH 5EUOE 4ODUB 4PS4H 3LB6C 3OAZK 2YSSA 1X7QA 3P9LB 4LVHC 3QCTL 5KAQF 2M8XA 4UTBH 1YQ2A 4NRYB 5BV7B 4PY8I 5I1DB 3KPSD 5I71B 1MAMH 3SDAD 3UBXI 5I1AA 4NBXB 1KIRA 2CSPA 3DVNA 3CFJB 2VZUA 4Y5YB 5DURB 1T89C 2MOVA 5CP7A 1J8KA 4M3JA 2Y06L 4PJHF 2J88H 1FP5A 4R4FH 2X4TA 4OQTH 3I02B 5J57B 1YJDH 4K9EC 4Y1AB 3F5WB 3FQUB 3U79A 1TZIB 2AXFB 2AJZB 1MCRA 4MWFB 3L3HA 3LD8B 3MGTA 1Q8MA 2BCKB 3GI8L 3DX7A 4MA3A 3VFVB 2FGWL 2WV3A 3PP4L 1DUZB 4ELMA 4KVNL 2X4QA 5F7NC 2VWEE 1AXTH 4OF7A 4PV9A 3HUJB 2YR3A 2R2HB 4O5LH 4OTXH 1F8TH 2ZUVA 3O41A 5KOVC 3UDWC 4GJTB 2DLIA 1QFWL 3DROB 4NO5B 3DMMC 3VG0H 4P46A 4KJQC 2GJ6B 1FGVH 5F7HA 3QCUH 1YQVL 2ZUQC 4JRYA 3IF1A 4F7TB 4WCYL 4Y4HC 4P4RA 3O3UN 2OTUB 2XA8L 1BLNB 3RNQA 1B0GB 3ALWA 3O0RH 2BVEA 4GKNA 5TQ0H 3FQWA 2CO6B 2PTTA 4NYLB 3HUJE 4NWUL 4HAGA 3HRZA 1CGTA 1CYGA 2PYEB 5GQBA 3WUWA 4P5TA 5TE7L 3O2VL 4U6YA 4PGZA 1J05B 2MQCA 4Q6IB 1HQRA 1FNLA 1PY9A 3S3JA 3STBA 1GOGA 2AK4A 2VQ1B 3QZWB 5TDNA 2XTLA 5SX4H 3FB7B 2RIKA 5A2IH 1VESA 3D85D 1T2XA 5D1ZB 3HAEA 4PV8B 4HKBA 3ZDZF 4MXVE 3QIUA 1FYTB 4OGYL 2X70A 1KFAL 3T0ED 2ADIB 2PYEE 4LF3B 3D48R 3CIQA 3BE1L 4LLWA 4JM4L 2YWZA 4MXWL 5F93C 5GJSH 1MF2H 4JHAH 1WITA 3RNKA 2NQCA 3RVWC 5HHOA 4E0RB 2WM0A 4ZNEE 1P9MC 1WEJL 3A6CH 3DETC 5ILTH 4KAQH 3U46B 4H8WC 1NCTA 3EOBB 4TSBL 2QQNL 5FA4B 3QXDA 1FYTE 5E1HB 4HKZB 3SCMB 4GQ9H 3UO1L 1V3MA 4PY8J 4QXUL 3MXVH 5CEYA 2V9TA 4XWGL 3CSPA 1INEH 4NNPL 3S8WA 1YNKL 3OG6B 1MIMH 1LO4H 4K7FA 4PJ8B 5BQ7B 2OYPA 3QQ4A 1NUDA 3HFMH 2F8VA 3SE3A 4JY4B 4E42B 2GFBB 3C5ZC 5D5MB 1MVUA 3DUUA 2R4SL 3S88H 5ADOH 5IOPA 4EXKA 3FRUB 2APWA 3S37L 3BGFC 1UWEH 1GRWA 1QR1B 2DQFB 2PXYA 4XGZA 3TIEA 5EZLA 2AW2A 2BX5A 5EU6D 3VH8B 1RZFL 1YJDC 3TBYA 1A3RH 4XT1C 1VACA 1MWAL 1VGKA 1EEYA 2NR6C 3E8UL 4KDTA 4YIQA 2X4OB 4HDIB 3VGFA 1NDMA 3CMOH 2LU3A 4F15C 5D5ME 5SV4A 3Q5TA 4D0DA 3BFOA 1WZ1L 3UTTB 3WE6A 3GBNL 3TNMB 3L3DB 3QFDB 4PJCB 1HCVA 4X7SL 3N0PB 3A0OA 4HIIA 1B4JL 2AGJL 4X4YB 4XCCH 1T1YB 3QHZL 4V2BA 3R8QA 1CICD 1RJLA 1WWBX 1QPPA 4F7CB 4FHBD 1Z6JT 1JN6A 1HI6B 4NKQB 2BVOA 4LVNB 3HI6L 3W9DB 1KCRL 3OKMA 3V5DB 1TQCC 3GEWB 4OM0H 1YYML 1J0JA 2EDXA 2PO6C 2VLLA 3QSKB 3MLUH 4M4PA 5KS9B 1R0AH 1T83C 3IFLL 5I1CL 4HCRL 2CLZA 1OL0A 4Y88A 3WBDA 2EDEA 3ARGB 5IV2A 2GI7A 3IJYA 4G7YH 4P5MB 1KLGA 3PE9A 2YPLD 4YZFE 5K9JH 2XZAH 1RJZB 1LK3L 2W60B 3CFKB 1ULVA 4LAJH 3PHQB 4JLRA 4NQEB 1BOGA 1Q9WB 2VDLL 1P4LB 2P7TA 1T0NB 4IOFC 1FAIH 3BT2H 4X4ME 4UB0H 1FO0B 4J23A 4WEBL 5EU4A 5ISZB 3BHBA 5T1LA 5DGQA 1JNHB 5F8QC 4XPFH 5BXFA 3FQNB 4Z0BL 5EFIB 3T77B 4ODSH 3CZFA 3SKJL 3OKEA 3LIZH 4NDMB 5HVGB 4JFOA 4JVWA 5CILH 3PV6A 4L8BA 3QG6B 1J5OH 2GSIB 2R2CA 4ELMF 1CFSB 4MNQD 4G8EB 4DKEL 2I24N 3IDYC 4WHTA 4NQEE 4EUPG 4HC1H 4L9LA 5C0AA 1VCAA 4WO4D 15C8L 4HS3B 1MFAH 4XNYH 4YFLF 5JOEA 4LRIC 4GXUN 1JZ3A 1R3LB 3EFFB 1E6OL 1BQLL 2JELL 5HHVH 1C16A 1EXUA 1A7PL 2D03L 2FJFA 3CSBA 4FNLH 4HBCH 4ODHH 4Z5RB 4HF5H 3ARFB 1FVDB 2FSEB 1U8KA 5I9QC 2XZCL 5LCVH 1QP1A 4G6JL 1OF2A 4JDTL 1U9KA 2NLJA 4PRPA 3QUYB 2J1KA 1WSST 2MMXA 4ALAH 1EFXA 4HZLB 5E99H 3S4SA 1PW3A 4XP9L 4J2XA 1I3GL 3BRDA 1DL7H 4LPXA 3TYGH 1JK8B 2ATKB 5JO5B 5HPMB 3BAEL 3BOVA 1BQHG 4YHKL 2ILLA 2X89A 3KAAA 3O6ML 1MEXL 3IU4L 3SDCA 1HDMB 1OB1B 3WIFA 3V52L 1MI5D 1EMTL 1QO3B 3BIAX 3QDGD 5CINL 2Z8VC 3CC5A 3EBAA 1TPXB 4BSVB 1S7XA 5J9PA 3Q1SL 4HKXA 3EYVB 4UILH 4QOKB 4APQB 1A6TB 1HXYA 1SMAA 3U2SA 4IRJA 1IGYB 2HJKA 4N5UA 1NCAH 1F6AA 3QA3A 5DVKA 4WVRA 3BGAA 2B5IB 3HZMB 5FEBA 1OM3H 5JPNB 3D69A 3O4LD 1SM3H 4PJXB 2NXZC 1KGCE 1PDKA 1QZ1A 1BBJA 3BDYL 3EYFB 2DIBA 5FM8A 5C09B 1ZHLA 3V0WH 4RQQB 2NMSA 4P3CL 1JHKH 2QHRH 1M71B 1U93A 4GW5A 4OCRH 3MJ8A 3MRFB 35C8H 3EJZC 1P1ZA 2V6HA 5DJAA 4EN3D 4PRHB 3RRQA 1G6RB 4UMGA 4MX7B 5E2JA 5IJKA 4HULB 1IEBB 3E6HA 4PJXE 3WS3A 1WCQA 3I2CH 4FZEL 5HGHA 1NAKL 2CD0A 4ZPVB 2VXUL 5C09E 3HI1B 4JZOA 3ZDXF 4P9HH 3IXAB 4DW2H 3C60A 1YY9C 5HGBA 1IAKA 1S3KH 1KJMA 4KGJA 3GJFB 1PG7L 3PL6A 4M6MH 4FXGB 2QHLA 1QSVA 2C7UA 3G04B 3RPIB 2ED8A 4PJIA 2H41A 5F3HA 1DBJL 5C0RH 3W9EB 4PRHE 1KB5B 4LPVA 1N59A 3U36A 4MQTB 4RA3A 2XI9A 3U7WH 3IDXL 4KKLD 4LU5H 2A9MH 1EZVX 2BJMH 3L95B 2NY5L 5LGKA 1OW0C 12E8L 3VFPA 3GSRB 1MFEH 3D3VA 1LWRA 3VCLA 2X42A 3VGHA 1KTKE 2VH5H 2A73A 4YUEL 3NGBB 2VNCA 1T0PB 1U8PA 2VXQH 2DWDA 1BJMA 5EWIL 1U95A 3MOBH 1M1SA 2KZ1B 2LVEA 2VC2L 3LDBC 1J11A 1BX2A 4OIAA 2UYLB 4TVPD 5EDXA 3V4VL 5JORA 1KEGH 2I9LA 5D6CA 1MRCL 2VXTL 4NN7B 5J1AB 4ETYA 1BJ1J 1A0QL 5DHYA 5EU7E 1GHFL 4KU1A 3EZJB 2DM4A 3MV7B 1IL1B 1KPVA 4LLYB 4NZJA 3UDWA 4YE4L 1C12A 1EJOH 4JJ5A 3QIWC 4L8DB 3RWFA 1QRKA 2E27H 4LASH 3O2DA 1X5KA 4G9FA 5F9WC 2JIXA 4NKIL 4BFIB 3Q2CA 1AGCA 3M1BB 1FHGA 2IPTH 3BP4A 5GRJH 2ARJB 1RZ7L 3I6LD 1LO5A 2ZG3A 1WTLA 2AJ3A 4Y4HA 4ZXBB 1UG9A 3DXAA 4QHNA 3NCMA 2DQGH 4XNMA 1W72A 1CT8A 4K3JH 4BUGA 2CDEB 1JWUB 3AB0C 4HAFA 4KRPC 5CEZD 3PIQB 4LPCA 4JFXA 3U4AA 5CJOL 2QSCL 2AK1L 2AV7B 4K7PH 5EOCJ 3V5KB 2IADB 2D7TH 4RIRA 5DLML 1ZWIA 4AT6A 5EORL 1LEGA 1OQXA 1XF4B 2DIJA 2D7NA 4LQFH 2D7PA 5ACMA 4XNUL 3VFTB 4IIQC 5AYUL 1S7RB 2G5BB 5DD0L 5TPWH 3RVVC 4Y16B 3BZEA 4LDLB 1ZANH 4FG6C 4GO6B 5IHZB 5IG7B 2IALA 1BGXL 2VDRH 4K8RH 5I0ZA 5TDPA 1KPUA 5TDOA 5K93A 1XF3A 3MRBB 1WBXB 2QL1A 1S5IH 5J6HA 4G8GD 1FH5H 4YC2B 4U7MA 3WFDH 4JO1L 1Q72L 5FO7A 3T0BA 1RIVL 2F19L 4P9MH 5EBMB 3IJHA 2DTMH 5B22A 3BPLB 4H1LB 2A83A 1YPZB 3O81A 2HT2C 3VI3F 1DVFD 2N56A 1LK2A 5FOJA 3UTZB 1GH7A 4JHZA 1DLFL 3X12A 2P45B 4YHLH 3MRHA 4RA0C 4OZ4B 2F54A 3CFEA 3WLWD 2WNGA 4X4XB 1CGYA 3SPVA 2RAMA 3L7FB 4NKOB 5IBLD 1O7VA 5I1HH 3B9KC 4U7KA 4MSWB 1LE9B 2C5DC 4P23C 4P9HC 2X09A 2X41A 4NRXA 5JLZA 3JV6A 5ESQB 5BVJA 1YPZE 4Z7NE 2FX9H 2MPAH 1YEFL 4OLUH 4GSDL 1OSPL 5LKNA 1P4IL 5IVOA 2FECI 3W11D 5FB8B 4ZQKA 4YHML 2CIIA 3TO2B 3C5ZA 4NN6C 4JG0L 1U36A 2NX5B 1T03H 5SWQA 4POUB 3SE8H 1SJHB 4X7TB 2LTQB 4LCWB 4P49A 1MCIA 25C8L 4OD3H 3WUZA 4YGAB 1EH9A 3QUML 3BYYA 5B38A 2BHYA 5T1DL 4C56B 4FQCL 4H1LG 5FIEA 5E7BA 1RZKH 1AHWB 1BQUA 5ITFA 1SJVA 3DTXA 3K2UH 5L88L 1LEKB 4XMLH 1XT5A 1I8LA 2CMRH 2FLBT 3MNVB 2XT1B 2ESVA 2E7LA 4BZ1L 2JCCB 4HUXA 2NX5E 3RX5A 1S7UA 2J3SA 4U1JB 1IM9B 4UU9A 2XNAB 4XMPL 4XWOC 3PGDB 3IKCB 2VL5A 2MCPH 1MHEA 1L9NA 3SBWA 4MS8C 3F7PC 2YC1A 4KKBD 4NO0D 3IVKA 3QFJB 4C56E 3RA7H 3ESVF 3RUGB 4M43L 5I8EA 5C9JB 4PYHA 4N8VG 3TF7C 2IH3A 4F33B 3P9WB 3MROA 4AH2A 5F9JB 4JRYD 3ARBD 2AV1B 5GGSA 3GRWL 4HX1A 4BK5A 1MFBH 4D9QD 2JCCE 4PY7A 2J8UB 5EU5A 4F8QA 5DVMA 2PO6A 4LBEB 5I1JH 3KPMB 3U9UA 1T83A 2W92A 4KQ4H 4J6RH 4PJIF 3VD7A 5KSAC 3U4EA 1D5IH 5C0CB 3RUGE 1TJHL 3OWEA 3QQ3A 5E94A 4ZUWB 4E5XB 4R97C 4NT6A 5H35A 4MA7H 4LVOC 4PJDA 3RWJB 1UA6H 2DDQH 4UT6L 4NNXA 4PJGB 4Q9CA 4KZEH 1A7NH 5GSRA 4U6XA 3OKDB 3WHE0 3JV0A 5HDQH 2N7AA 2AK4D 1IGJA 4K8RC 2AJYH 3D9AH 2J8UE 2NY6C 1HH6A 1IJ9A 1OARH 1N3NB 4Q9BA 3O11B 3QNYB 3RGHA 5JOFB 3GHEL 3QIUD 5D7IA 5KVEH 1OLLA 3LRHA 2Q76A 2DBJA 1CGSL 3CFDB 4FFZL 5I2IB 3ARSA 3QIBD 5C0CE 3DWTA 4JVUA 3WS6A 4JM4H 2XZQH 4K23H 4DVBA 5L7XL 3Q5YA 5FHBH 2BFVL 3W0WA 4PJGE 1IFHL 4UIKL 3RWGB 5C2BH 2P8LB 3DYMA 3JTSA 4JDZB 5HHOD 1VGEH 1WFNA 5T3XE 3V79C 3HNVL 3QHTC 2FX8L 1I3RA 3TJEH 3LKRA 5DRNB 4LARL 3LN4B 5LAXB 3EOTH 1P6AB 2VL4A 4EOWH 4LRIA 3MUZ1 5ECJE 3JWOH 4LPYA 4P59L 1JZ5A 1WT5C 1YEGL 3WLBB 2YUZA 1JHLL 3R0MA 2VOTA 3V7AE 5T1KA 3P4OA 1LP9A 1KCLA 3QCVH 4WEUD 4Q2ZA 1EBPA 5D2LA 3FTGB 3NPSB 4MA1C 4WFED 2AQ2A 4I9WE 2PETA 4NCC1 4WNQB 3TIDA 3MV8A 4HHAA 1RI8A 3H9ZA 1OPGL 1Q1JH 3JSSA 4M1DH 4UI2A 2PW2A 1QA9A 2IQAA 4HT1L 3RTQD 2R0LH 2WBJB 4YNYA 2R0WL 3PHSA 2PXYD 2QSTA 1KTDA 1P7QA 4IS6A 1RZKC 1AO7A 2YD2A 4RZCB 1M7IB 1GAFH 2YEZB 3I50L 4JO2L 4XCNB 4CUCA 2YBRB 4LKXA 4U1HB 2DKUA 4EZMA 1RSFA 3FB8A 3X3FL 2OSLA 1R24A 4TRPL 4HQQL 1NKOA 2EH7H 2AKRB 4AL8L 1QFHA 3RWEA 2FJGA 3MV9A 1RUPH 1J1PH 3UBXA 2X6MA 5FUCE 2P44B 3C09B 4R26H 5GZOC 1CZ8L 5DD5L 3FFCA 4NN5B 2V7HB 3RWIB 3VXQA 3OL2A 2IFGA 1C08A 2H2PD 2NTSP 5FGCB 2R8SL 4LAQH 1ZMYA 2PR4H 5IB2B 1LDPL 4JPKH 4JANA 3M8OH 2DYPB 5AUMA 1NGPH 4L8SA 3MBXL 5D2NC 4HKJA 2HT4D 3V0VA 2Z8WC 4GW4B 1GJIA 1FZMA 4JPVL 4W70A 4XHQA 4GXVH 1EUUA 1EUTA 1BVZA 4N0FB 3IKKA 1K3ZA 4NQDD 1L7IL 1O5DT 4P2YA 5B4MC 4X5WB 1FFPB 1ZGLP 1DN2A 1ZLSH 4Z7UE 1MELA 5FGCE 1RK0A 3MBEB 2E9IA 3VXNB 2OZ4A 5C7XH 1BFVL 4YBHA 4AMKL 4K7PY 3U9PL 4KHXH 4OI9A 5FK9B 1NGWA 5DK0B 1CLZL 3KXFA 4LEXH 4PIRF 2MQ3A 2NY4C 5EBGA 2UVFA 2VKWA 3OR7B 3RVUD 2F53A 2CK0L 5T1LD 2H6PB 2OJEA 2Z8RA 2X4PA 4Z0BH 3NPZB 3WFCH 2AEPL 2BZDA 3AVEA 2NYYD 3ULUL 4UBDD 4QLRA 3OGOE 4G8FA 4AEIH 1KN2L 4QHUB 3LKPA 5EIIA 4YDJB 1HOCB 5BS0B 1I4FA 2OL3B 3BPNC 4TQEH 2VDOH 2BMKA 2AS5M 4NZTH 1Y18A 1JPSL 2WANA 3PXHA 4B7LA 4O2FB 3F7VA 4JFQB 5FYJU 4X6EB 4MJ6A 1UKTA 5F6HI 1T4KA 1UB6A 3MXWL 4NWTL 4NGHL 4R2GC 1H5BA 2JELH 3VI4F 4DGYL 2BOBA 1R5VB 4JFFE 3F7YB 1NBQA 5BV7H 5KN5B 4NQSB 1YEEH 4YO0A 3TFKC 4G6JH 4UQ3A 5BS0E 5I17B 4PJ7A 1T21A 5D4QA 2PCPA 5BRZA 3VD5A 2BY0A 2B7DT 4W4NA 4F58L 4PRPD 4G7VL 1F00I 4RMSA 1KT2B 4WI5A 4RAVB 4Z95L 3WNLA 4ERSL 4M93C 4LCIH 1EFXD 5C6TH 5CWSA 1ONQB 3L3JB 4H5SA 4PJDF 4PRAA 3DV4A 1BAFL 2CDGB 1OT2A 1MEXH 3IU4H 2JB6B 4BELD 1AJ7H 1F4HA 3CD4A 1UYWH 3VFRA 1XCTA 4XTRC 1SBSL 3SDCD 4X80H 4GAJL 5KJRH 4Q9QL 3Q1SH 1CD8A 3O3AB 4GS7B 3V6FB 1SJXA 3PG2A 3SDDB 2P8PA 5D7IF 3NFNA 3GSVA 3TA3B 3C6LD 1CTNA 1TTUA 3MFFB 3MNZB 3O6FC 4OCMC 1RHHB 1JV5B 2XTJB 1KG0B 4PP2A 3Q3GB 5FYKH 3UC0L 2Q87A 1M7DA 4KROC 2AJSL 1S7TA 5J89A 4WWKC 4AJ0A 3NAAL 3U0TA 2EECA 4QWWC 3QEQB 1AI1H 5J12B 4KPHL 5LGJA 1FZJA 3RZCA 1A7QL 4OD2B 1H3WM 3GIVB 2UZIH 1FVCB 3BI9X 5CIPA 3ROOB 4LHUB 5KZCD 3U4BH 2JJSA 5KSUB 5MEQA 4XP4H 2E8ZA 1X44A 1RZGA 2XTJE 1KTLB 4NQCD 1IGTA 4F2MA 3BSZH 4S2SA 5T1MA 1CF8L 5T3XL 4NKMB 1BWWA 4I2XB 5IVZB 2VXUH 5JIHA 3QDJD 5D7LD 4P23A 4J3OC 1LP9F 3KJ6H 5D2LF 4OGXL 3QEQE 1QEWA 3C60D 4JREB 3SHSA 3NCBB 4Z18A 1JPGB 1JZ2A 1ZGLM 3QBTB 2CKBA 3AREB 3PL6D 1A1NA 4XHJD 1ZT1A 1KN4L 3EUUA 5GHWH 5KBNC 5FF6B 3L1OL 3MRNA 5BO1L 3LB6D 5C07B 1VFOA 3MRIB 2F58L 2QADB 3IDXH 5D1QC 1P2CA 3BVNB 3BEWA 4NJAL 3UAJC 1M7XA 4I2XE 4RGOL 2EDJA 1A1OB 5F6HJ 3L7EA 3GMMA 4R7DB 4CVZA 3D3VD 4Y5XB 3CPLB 4G6FD 1CK0L 3IAQA 2C3VB 5IB1A 1HQ4A 1DJSA 3DVFA 1KULA 1N26A 5FO9A 1UH4A 2I27N 1RULL 3MUJA 1U8LA 3W2DL 3X11B 4PD4K 2HJFA 4D2NA 1FC2D 5C07E 4EI6A 4U1KB 2GT9A 1WFTA 2NTFB 5JW4Q 3MJ7A 1W8OA 1A6ZA 4GAYB 2ZOKA 3VW3H 3WFHA 4JQIH 3QEHA 2Q7YA 5E2WH 4TUKL 1FNGA 1PBYA 3N1QC 1JTTA 1G7QA 5BV7C 1S7WA 1U8OB 2VWEC 3QJFA 4KMTL 2N7BA 5FYKU 4EQ3A 3DMMD 1EEZA 3S5LG 4Y5YC 3WMSA 4KJQD 4G9FD 5IWLA 4XPBL 3GMLA 3VFOB 3A67L 5L8JB 4Y4HD 2VLRA 3UTSA 3DXAD 4GMTL 2ZCLL 1T3FA 1S7SA 3L9RB 1MCPL 4UV7H 5F96H 3TC9A 3N9GH 3AY4C 3QPXL 2AK1H 4WW2B 4U6HB 1OAXH 4Z0XA 1PSKL 1WCBB 1F6LL 2RB8A 2W65A 3CLEH 4XNUH 3GKWH 4M1GL 4ZAKC 5AYUH 1KPRA 4X8JA 3MRJB 3THML 1MHCA 3WSQL 5I8OH 4O2EB 4NO3B 4ETQB 4ORZC 4FQHA 3MZGB 4I0PC 2DLHA 1DE4B 3TBTA 1BGXH 1N2RB 3GM8A 1A21A 4MHHI 3BN9C 4NBYB 3R4DA 3O9WB 2Q6WA 1RURL 3OKNB 3S34H 2EICA 4FZ8H 4QXTB 4A6YL 2CK2A 3LRGA 1I1YB 5CCKL 4NHUB 3DX6B 2VAJA 1N64L 5AWNH 2C1PA 1WBYA 2GUOA 1JZ7A 2IG2H 4HMEA 4JFZH 5DJ2B 5SWZA 2FEEI 1F4WH 4JKLA 3QXUA 1IAOB 4JFEB 4V1DD 3RVWD 1DQQA 5LWYL 3TT3L 1LO3H 1WBZB 3MCG1 5GS1B 2Z31B 3NZHH 4Q6IC 3KYMB 3DETD 1FLRL 2F54D 2C3GA 5JHDB 1CLOH 3NN8A 3W5MA 2X4UA 3WXVH 4PJ7F 4CNIA 4FQXB 5D1ZC 5CHNA 1FO0H 1TJIH 1PYWB 4KUZL 4FS0A 1WT5A 2J4WH 2DQEH 4Y5VA 3M07A 3CX2A 3MLTB 5F9OL 4BJLA 2C26A 3CSGA 4QTIL 1T1WB 3L5WA 1ORQB 2JB5H 4KI5E 3HRPA 4YHMH 3CDGA 3KPNB 4KKAC 4M8VA 4G6KL 1IGFL 3C5ZD 1EV2E 4P4KB 4Y4KC 2KKQA 4NM8H 3FOLA 3HNSH 1KJ2L 1EIBA 1T6WA 2K3TA 2XOTA 4U1IA 5T1DH 3VFUB 3QI9B 3RWHB 4XMKH 1FG9C 5ITBH 5DJYB 4BQCA 4JGUA 3SCMC 4OV5B 2H1PL 2WUBL 1ZT7A 2HFFA 1D5MA 1N5AA 5CD3A 1CU4L 3BPOB 3QQ9C 1IC7L 2QSQA 5E7FA 2NR6D 5C0BE 5DTFA 4RDQF 4MD4B 3DBXB 1UZ8B 4PJ8C 4OI8A 3T0DA 2FWOB 4LCUA 4PGBA 1WFUA 5HGDA 2UZXB 1IBGH 3PWLA 4ODWA 4HPOH 1XGPA 1Z3GH 2H32A 3N1MC 3C2AL 4KJYA 3P9MA 3UCRA 3IDIA 1X4ZA 5FGSA 1GGYA 4LLMA 5F1OB 3PP3H 3WFBH 4PJ5B 3QRFM 4L3EA 3QXVA 5IF0A 1IKFL 5EUKB 4QO1A 4DTGL 4JKKA 3GSUA 4ZFZB 3OF6A 3P73A 4P3DA 3MLZL 1MLCB 4OZFB 2G9HA 1BWMA 2PO6D 4G5ZL 2IFFH 4XAKD 3JV4B 4X9HA 4ZTOH 4XRCB 2OXHA 1HH9B 1T5XB 3S9DB 4IHOA 1MSPA 5I76A 4PJ5E 5FO8A 4X6CA 5C0EB 3H0TB 4JFHE 1HK6A 4KJPC 1U3ZA 4ODXA 2DAVA 1INDH 2XQYG 5H37G 1SMOA 4CAGA 1BM3H 1NC2D 3GB7B 4LSSL 5DFTA 5DQJB 4LVNC 1MQKL 1D5ZA 1EGJL 4IOFD 2H2SC 1Q94A 1AIFA 1AGBB 1NEZA 1G6RH 2H3NB 2HH0L 4FQLL 1OP9A 4S11A 3IXTB 4X98B 3VE0B 4P48A 8FABA 5F8RC 3H8NA 2BRRH 3STLA 4XPAL 3MA7A 1M6OA 1U3YA 4UIKH 3ARGC 3OKOA 4X0KB 3QUXB 3W0WD 4D94A 2X7LB 1JGDB 2P8MA 1FL6A 1OHQA 3ARVA 5B8CB 3GO1L 1JPFB 3GJFH 2ID5A 3ARXA 3FQRA 4OZFG 3MTRA 1JBJA 3VXTB 2NXYB 1KB5H 1ZVSB 4JQXA 5SWSE 5K9QG 1U8NB 3P0VH 1IMHC 2ZSVA 5IMLB 3V95A 5IEKB 1DDHA 3ESUF 3QDMA 8CGTA 1U8JA 3BWUC 4WY7H 1U91B 3T0AA 1A8JH 3T1FB 3DO7B 3IDMB 1ACZA 4FQIL 2DQDH 4YFDB 5T1KD 1TVBB 5C0NC 3HE7B 5D1XB 5LBSL 1XGUA 1AD0A 3P4NA 4DUWA 1N4XH 2O5YL 5DDHA 3MV8D 1FFOB 1I1AC 2FZ3A 1IZKA 4OCXL 2YPVH 3SKMA 1MCCA 4G80A 1MPAH 5F7EH 2ATPA 1JZ8A 4ACPA 1MWAA 1AO7D 4ZS6C 1VFMA 4JO2H 4FMKA 4O4YH 1Q0YH 3BWAB 4GFTB 5DD6A 4QNPE 2WWKT 1OVZA 3X3FH 1K2DB 4TRPH 3BEVB 2CLRA 3C8KB 1QHPA 4V2CB 3VFWA 4NJ9H 3QUYC 1U2CA 2SEBB 4JPWH 5JUEL 3BZFB 3EDFA 1JPTL 4H26B 4XP5L 1VKXB 1MJUL 2YD4A 3MV9D 5ID0B 2NXZD 2WSKA 4KV5F 5L6YH 4QHMB 4KTYA 4N0RA 4G43A 4UOW0 3RL2A 4WWKA 4HFWB 2R8SH 4X99A 2C4FU 4BH7A 3W81A 4PRIE 3QUZA 1LDPH 1VADB 3IFNL 4JM2A 2RJMA 1H9VA 5IK3A 2VE6B 3EJZD 5EIQA 43CAA 1SYVB 1XIWA 4HXAH 2YRLA 1HCFX 5L2KE 2FL5A 5D9SA 1FFRA 3HLAA 4HCRA 3HC3L 2IAMC 2VXSL 4NOBA 5JDSB 1YNLL 5C0DB 4QRSA 3UJIL 4LLVB 1EAPA 4EBQL 1YY9D 2EO1A 5ABDE 1JYNA 3LPWA 1FE8L 1BFVH 1UM6H 1QBLL 4XXDA 1WLHA 4H1LH 3ZTNL 1OAZH 4CMMA 2ORBH 2P5WB 3DVGB 5ENWA 2IWGA 1KNOB 1UWGL 3VGGA 3KXFD 1NCWL 1KYOK 2FDBP 3AMKA 1QRNE 5EUOA 4F7MB 2G75B 4GRLC 4GG6B 5DRWA 2F53D 4HWZA 5DC0A 1G0XA 3KPTA 4CVXB 4HUNB 3VXMA 5ALCH 4LIQE 1DQJA 2LAGB 5GJTL 5E08L 1NFDB 5DT1H 4YQXL 4LSRH 5KVGH 3EO9L 5DFWH 2VDQH 5IVXB 3P11H 4ZUVB 3WIHA 4YPGB 1TQBC 3WNKA 5I19H 5I1GH 4EIZC 3D39B 2BNRB 3TN0B 4CRPA 3D0VA 4NWTH 3EYSL 3DRTB 4O02L 1KSRA 3ZE1F 2ZCHH 2GAZA 1JWMA 4J3SA 5JIKA 1ZA6B 1O7SA 4S10A 5EU7C 4L9DA 5I1DA 4M6AA 4HMCA 1C5DA 1CFQA 3QIWD 4OLZH 1I8KA 1OGAB 1NFDE 3EOAA 2B0SH 4P2CG 4F58H 3D25A 4H25B 4JKPL 3RDTB 5IVXE 4WGVB 3VXOB 5E8DL 4OD1L 5MHSE 2MQ0A 4ONGH 4XX1G 3F5WA 3O3EA 5JNYB 3D39E 3KYKH 2OJZL 2FHFA 1P4BL 2Q1EA 3TVMA 2AXFA 4AY0A 2AJZA 5BJTB 4X6CF 4XI5C 4NN7C 4XPGL 1I7ZA 2ADFH 4EDXA 3MUY1 4HWBL 5BVPL 4GAJH 1RMFL 3GMQB 4MJIA 5KW9H 1YN7B 5IMOB 3HUJA 4ZAKA 3JVGC 4P2RA 1OGAE 2VLMD 4Z7OE 3RVVD 3I6KB 1J0IA 2IF7A 1TENA 1A3LH 1U92B 1DUYB 4UDUB 4I0PA 1JF1B 4FG6D 5FECB 3DX8B 4LSQH 5EOQL 1IAIH 4XVJH 4YLQT 5J3HC 2CPCA 4ZOCA 4NHCL 5C8JB 4ZXBC 4OKDA 4B53A 2OTUA 1NFKA 4X9FA 3HI5H 3UP1A 1YY8A 2JK5B 3UTQA 2QBWA 2K7PA 1Y6NR 4QHKI 3GUTB 1GYAA 3MRKA 2OR9H 3GSXB 4PJFB 4H20H 3DRQB 2A9NH 1FG2B 2HT2D 2W0FA 4JKMA 4I0CC 5F70A 2A0LC 3VRLF 4UINH 4RWYL 3GJEB 4JZJB 1RZJL 3U48A 4BQ8A 4OKVB 5CBEA 5HHMD 4FP8L 5H2BA 4G42B 3MRPB 2VLKE 2VDNH 3FB7A 4TSCL 3B9KD 4YXHH 4Z7WA 3A6BH 3BH8A 3EYOB 4PRNB 5CLTA 2PYFA 1HEZB 3O8XC 4OT1H 3JBG7 4P23D 3FL7A 4U6TA 3MCLL 1NSNL 4YC2C 4PJFE 1E4KC 1RK1B 3PNWB 3TO4B 5MP6H 3BPLC 1P84K 2XWBA 1YMHA 4O9HH 1CFVL 1U6AH 2AEQH 2VZOA 1LO2L 5HVFB 5J11B 4HFUH 4YXKH 4LSDA 2BNUB 5FA3B 2V7NA 1SY6L 4X9GA 2IBGA 3T08A 2A77L 1QSEE 4LPUA 4Q74A 4Y4KA 5E5UB 3UPRA 3H3PL 5JQ6H 1B3JA 1WWAX 4I13B 4HLZG 4WTXA 4YX2H 4DN4H 5ACZB 2ED7A 5KTEH 3TESA 4I4WA 5HYEA 4NKDA 2LAAA 1A7OH 5FA4A 3BRGC 3L5IA 4M7LT 3WCYA 3ZYJA 5C08A 1U8MB 1S78C 1K4CB 3O45B 5JMOC 1OP5H 4NM4L 5HJ3B 2EYRA 3HR5B 3V0AC 4WUUA 1XGRB 1JNNH 2H9GA 4PJ8A 5BQ7A 2ERJB 3BP7A 5IW6A 2APXA 4CMHB 1B2WL 2HTLC 3PWUA 4XPTL 2CO7B 4XWOD 4R7NB 4W4OC 2GEEA 1AFVH 1ETZB 1RU9L 6FABH 2FR4A 1HYSC 1CQKA 2I07B 4JM2F 4MS8D 5K9OA 3M17B 1F3JA 2AAVA 3TBVA 1KB9J 1GPOL 1G7IA 3HN3A 1T5WB 3LKNB 3MLVH 4I3SH 1F2XK 4H0GA 3LN5B 1IEHA 5B21A 4L3AA 3ROLA 3EFDH 5E6IB 3U6RA 7CGTA 4FFYH 4L29B 1RIUH 3MRMA 3EJYC 1DBKL 1F6FB 1T22A 4JFYB 3UTSD 3HC0A 4UQ2B 1FDLH 1Q9LA 4N90E 3G9AB 1F4YL 5JA8B 3N1GC 3QPXH 1ZGLB 3PP3K 4DFIA 4FTVD 4D8PA 3WNMA 5CD5C 1FPTL 3B5HA 3VXSB 1NBVL 1R5WB 5DRXA 5KSAD 4OSUH 4XC1L 1IGCH 4FN0A 1BVLA 3FOMA 4QHKJ 5EUOF 5BW7C 1I8MA 4DGVL 4HK0A 1HHKB 3KYNA 4J4PA 2OQJB 1I85C 2A1WL 1F97A 5TFSL 5DI8B 3RGVA 1UJ3C 3QEUB 2EDWA 4DEPC 4K8RD 1FFNB 1OAUH 1TJGL 4ZUUB 2NY6D 1IQDA 3ZKNC 4BK4A 5EULV 2R29H 1Y6MR 2VKXA 3VMOA 4EUPA 1MCQA 1A14H 1MRDH 1XCQA 4X4MA 3VXSE 2R2EB 2YXFA 3VXRA 5KANG 3ARYA 1N6UA 1ZEAH 4Z8FL 4PTUA 2AEWA 2EDRA 4GAFB 5SWZD 1CVRA 3NZ8B 1EO5A 3O2WL 2X1WL 2QV2A 5IFAH 4Y2DC 4P2OB 4P5MA 1IT9H 1MIEH 4E41A 1SEBA 4LIQL 3GGWB 1RJZA 2IANA 2R4RH 3MCKB 4DFHA 3GBLA 4OUOA 3PHOA 1Q9WA 3KPSB 5DMYA 2IPKA 1LD9A 1A7RL 3SO3C 5FM5M 1X6LA 2K9UA 3KPQB 3GJFK 4YH6A 3VWJA 1JNHA 3MRDB 4JN2B 1D9KA 1BQHA 4HSQA 1HIML 2QQQA 4U1GC 5LQBH 1A4KA 5FKAA 3C6SB 1Z9MA 3ZLQC 2ZUWA 3SE9H 2ZPKL 3QG6A 1QPXA 2C1OA 4OIIL 2FATH 1OP3H 1A2YB 1F3RB 1KCVH 2OL3H 3MUGB 3HUJF 5GGVH 1J10A 1QBAA 1I3VA 3ZYIA 1UVQB 3U1SH 1J1XL 1I1AA 3BMWA 3OBAA 3QUMA 3MREB 1FIEA 4P2QD 2LE9A 2WUCH 1V05A 2AP2A 2I26N 5D71H 2APFA 5MEPA 1EO7A 4ZS7H 3TV3H 3GSOB 1NAMH 1N7ML 1BVKA 2DBLH 3FONB 4MXQC 3V6OE 1RJCA 1NGZB 4TNVK 1WC7A 1FVDA 1OOAA 3B43A 4JFDB 2BSTA 2XN9A 5DJXB 3MACH 3OKLB 3QUYA 4WI8A 4YHZH 2MHAB 4R3SA 3C87A 1S9YA 5I1LB 3EGSB 2R0KH 1JK8A 2ATKA 4X9IA 1BZ9B 5I30L 4LRNH 3REWB 1W2KT 4J3VA 3E6FB 5D6DA 3UPCA 1T1ZA 5IMMA 5FUCC 4KHTH 1TZHB 1C5CH 5I6XC 4XH2B 4XP1L 1S7VA 3GRWA 4Z7WF 4L3ED 3GSWB 5MEOA 4JFDE 5JIPA 3U7AA 5ESAB 2R1XA 1CLCA 1F4XL 2VR5A 5T3ZE 5IESL 3D85B 2ZJSL 1FGNH 5J06A 2IAMA 3OKKB 3OXSA 5FUZH 1DQTA 2FBJH 4M00A 3KJ4C 3T0EB 5ALBL 3SKOB 5JPNA 5F9DC 3MRRB 5GGQL 5JQHC 4OZGB 5B4MD 3AMLA 4CU7A 3C09C 2Y7QA 5KVDH 4NN5C 1BD2B 5C09A 4ONHA 2MKWA 4QRPB 3FT3A 3SJVE 3PWPE 3TPUA 4KTEH 1JFQH 4XC3L 5HVHB 2AJVL 1M71A 3ZT5A 1CG9B 1EGJH 2X10A 2QJDA 1ZSDA 2P5EB 4GRLA 4LEOB 2NY4D 3U83A 4B50A 2A74B 1N6QH 4R8WL 2B2XL 4I48B 1BZ7A 1IEBA 1PLGH 4PG9B 4HUVB 4XBGA 2CDFB 1TVDA 4XPAH 3GMRB 3PF2A 3RWDA 1BEYH 1IGIL 3RFZC 1FL5A 1SHMA 1BD2E 3WYRA 4HJJH 1N8ZB 4QRPE 4GW1A 1Q9KA 2EKSA 5GRVK 3KWWA 4U3XA 1FRGL 3VGBA 3JUYA 1PQZA 1JZ6A 5FHAL 1REIA 3H9SB 2P5EE 4XPHH 4C55A 1IGMH 1S7QA 3LS5H 2J5LB 2APBA 4PJEB 5E2VL 1LE5A 3PGFH 2GK2A 2BSRB 4DCQB 3DGGB 4JO3L 2HN7A 3CVHL 3MSPA 4R2GD 2W9EL 2HMIC 4MNGB 1ZVHA 3U82B 1CDGA 2CQVA 3QNZA 1IC4L 1A1MA 3QDMD 2ZUTA 4RFEA 5EU6B 4L4VE 3WN5B 4TUJB 3TFKD 1IQWL 4P57B 4Z7QF 3DUSB 4QHLB 1DQLL 1MJJB 1K8DB 5BZDA 5BZWB 2A6IA 1FORL 3OZ9L 4U1LA 2AXGA 2EYTA 4NUJB 4DKAA 3AAZA 3H9SE 5DJ8B 5HBBA 4GMSL 3HS0B 2OTWA 1R3HA 5FYLH 4BKLA 5J1AA 1K85A 2WIIB 1IARB 1T7ZA 3PABA 4MNGE 1I7TB 4R0LA 3T4AA 4XTRD 1NCCH 1CDHA 4TSAH 1KIPA 1KUMA 3HCVB 3JVGA 1MRFH 4Q0XH 4X6BB 5I66A 3CSYB 2OI9C 1CI5A 2X1QA 3G08B 5KG9B 4UUJB 4MZ2A 4OZHB 5C0GA 2ARJA 5JHLH 3GSNA 2XRAH 2GW5A 2G2RB 1ZA3B 4ZSOB 4LOUC 1U58B 3L3IB 2B4CL 4ZXBA 3KDMB 1A4JA 5HYJB 1MUJB 2FIKB 4KROD 3PIQA 4WWKD 3OJ2C 1FCCA 1KELL 1TETH 4M48H 4MDIA 5J13C 4P5KB 4QWWD 5HHXH 1W0VB 1HKLL 4Z77B 2OCFD 1T1XA 2YPLB 4M6NL 5TQ2H 1MY7A 1URLA 4JM2D 5SX5H 3MR9A 3P4MA 1YECH 3R1GL 4OZHE 2FX7H 5INCB 1XIWD 4PJ9B 2KPNA 4PRBB 2RQ8A 4MA8L 3TA3C 3D2UB 7FABL 2HRLA 3BGMB 2V2TB 2EDLA 3SGJC 4Z7VB 5HYJE 1V7MH 3V2AR 1YNLH 5A2JH 4GBXC 1AE6L 5TF1H 4GRMB 3C5SA 3O8XA 1QR4A 2WBKA 4MMZC 1KC5H 1E4KA 4CDHA 3K4DA 2YPLE 2QKIB 2GK0A 2NW3A 2HKFL 1HKFA 4QRQB 1HILB 4PJAB 3PWVB 3LEVH 1UWGH 5ADPL 4UIMA 2B1AL 1ADQH 3UTZA 4L8CB 4Z76B 3TBSA 2YA1A 5D1QD 1T2JA 4WDIA 2VAAA 3GMNA 2HLAA 3BXNB 4FQ1H 3GMPB 4X4XA 2KDGA 5AZEH 3UAJD 3L7FA 4PBXA 2YN5A 1T2QL 4GKZB 2J6EH 1G7PA 3BH9B 4QXGH 1QLFB 2DM7A 3ULSB 1EFQA 4PJAE 4N8VA 3G5ZB 2HVKB 3MODH 1L9MA 4OCWL 4IRZH 5DMIH 5DMKB 2DD8H 1ZE3C 1A64A 3LQZA 4JFPA 1A9BB 1IEAA 4AENB 1ZKAA 3MMEB 2ADGB 2HWZL 2CR6A 3NCYP 1OP5K 3JTTB 4W4OA 3IFOB 3TO2A 2QADC 5A3IC 4UOJA 2YMXH 1MNUH 4CADA 1UKQA 4AIZB 4X6FB 2DQCL 1MI5B 5F1NB 1TDQA 3QDGB 4HS8H 4ZD3H 3J7HA 3O4OB 4CN4A 5DURD 1R3JB 1K4DA 1YDPB 4JR9L 3NFPB 2F5BH 4NFBA 4XVTL 5DQDL 2BNQA 1JIBA 5CFHA 2P24B 1P4BH 3RAJL 4MD5B 1SYSA 5IFHH 1PZ5A 4PJHB 2NW2B 3K8MA 1R3KB 2EIBA 2J8OA 3O4LB 1E28A 2JCCA 3MGOA 2XNAA 3MGAA 3FN0L 5T33L 4ZAKD 3NA9L 4N0UE 4JZNB 4FABL 4P2RD 1KIQB 3S7GA 2VIRA 4U1NA 2FD6H 3IDJA 5CZVH 5C9JA 2YS4A 2I5YH 4M5YH 4ORGA 1I85A 4N0YL 4UTAL 4I0PD 2W9DL 5D7KE 1UJ3A 5H94B 1HN1A 5E6ZA 3BN9D 4MCZA 4PJHE 1LO0L 1PAMA 4NZUL 1MCJA 3F6IA 4X6DA 3SKNB 1GZQB 4UDTA 3UZVB 1XH3A 1U8HA 2CGRL 3HG1A 2Z92B 4OZFH 4PS4L 5E2TH 3NCCB 4LLQA 3K3QA 4WW2C 5IKCA 1CXIA 4OUUB 4CW1A 4UTBL 1UXSA 1JJUA 3KVQA 4OCYH 3SDAA 4RWYH 2PYED 4U1MB 1H15A 1MAML 2NZIA 3OX8A 4I18B 4WU5A 4Y2DA 4JG1H 2L7UA 5DA0B 3VFSB 2R23B 2A2QT 2Z8SA 1KB9K 5FXCH 4EVNA 4PJGA 2R9HD 4LHJB 3AROA 2BVPA 4JY5H 2DOCA 1ND0B 5L2JB 4K3EH 3FZUC 4R4FL 2PNDA 4OQTL 1G7HB 3IAPA 5DYOB 1AKJA 1A6AB 1N3NA 1I7UA 1IC1A 2V9QA 5D7JB 1S9VB 2Z91A 5HHNB 3HE6B 3HPLA 3DSFH 4Z78A 3T8XB 1F58H 2XFXA 1A6UH 1AXTL 2XKNB 3K8KA 4O5LL 4OTXL 1F8TL 4XCFH 5IIEA 2ICWI 5F88A 4KKAD 3I9GH 3VG0L 1A7BA 4KI5C 3H3PH 1JWSB 3HMXH 4Y4KD 1FGVL 3QCUL 4PR5A 1DSFH 4PB9H 2AJUL 5AZ2H 4XNXH 4PREA 3LN4A 1YMME 3BKMH 1OP3K 5C08D 4XNQA 3SCMD 3O0RL 4PGCA 5TQ0L 1I9RH 3MC0A 3ZDZE 4HJGB 2D31A 3QQ9D 1HINH 4M7ZB 2Q86B 4AEEA 3GMOB 5DFVD 1A9EB 5M94B 2ADJB 4PJ8D 5C0JB 3LY6A 5CGTA 4JAMA 5DK2B 2VR9A 1J8HB 2CLVB 3C5JA 2YZ8A 3QXTA 4XCEA 3VMPA 5LXGH 1QVOA 1YEKH 1LMKA 2HTKC 3SDYH 3QI9C 4JN1H 3HZKB 1A5FH 4M02A 3KPRB 5DF0A 3DUHA 5BMFH 3DJ9A 4O58H 3LRSA 3REVB 2WINA 3BPOC 5FKPA 3G6JA 4OF8A 5ANMA 4WU7B 1S9XB 2B1HL 4AEHH 3FO2A 4U1HA 5CGYC 3NCJL 5DQ9B 4PLJC 3G5XB 5GJSL 1MF2L 4JHAL 4G8GB 5IHBA 4MQXC 1RVFH 1J8HE 5DC9B 2R15A 1RZ8B 4Z7NF 4XNZB 2C4FT 3A6CL 5J8OA 5ILTL 2X4SA 1S8DB 4LMQE 4KAQL 3RZWA 2GITA 5ICZA 5MENE 1AQKH 4ZFFA 2WIMA 1DVFB 4J8RA 2ITDB 5HHPB 3KPRE 1CD1B 4KJPD 3CFBB 4PLOB 5HYQB 3ULUF 4GQ9L 3L5JA 3QG7H 2I60H 4Z7UA 3MXVL 3VXUB 1TJGH 4F37K 1INEL 4A6YA 4BSWB 1LEIA 2H2SD 5KVFH 1QFUH 4KY1H 3QUKB 1MIML 5I75B 1LO4L 1HWHB 3FO9A 4ODVH 4RSVA 5I8CA 1ITBB 3HFML 1W0YT 3VMNA 1MVFA 5K59E 4YDLB 3S88L 2EYSB 3IETB 3B5TA 4PBVC 1UWEL 3INUH 3VXUE 1OQOA 2YSSB 1X7QB 4R4NC 4HV8A 2ICWJ 3NH7H 5FK9A 4NQED 3SN6N 1A3RL 5IGXH 1PGRB 4WJ5A 3T4YA 5I1AB 4NPYB 2IH1A 1KIRB 2J7LA 3DVNB 3CMOL 4N1CA 1HIMH 5CP7B 3GBMH 3FKUS 1D6VH 2ZPKH 5KANI 3ZO0A 2X4TB 4JFFA 2VYRE 2JCCF 4OIIH 5C0ND 5ETUA 1I7RA 3O6LH 5BS0A 4DUXA 3L3HB 3MGTB 5D8JH 3MA9H 1ZLVH 3DX7B 4MA3B 5E8OA 2QQKH 4FA8A 1KJ2A 4C58B 1FNEA 3WHXA 1EVTC 1I1AD 4ELMB 2X4QB 1L6XA 1NMCC 4O2FA 4PV9B 4NZDA 4JFQA 1FNHA 5CEXB 4OLYH 3O41B 4MD0A 2NXYC 4MCYB 4OM0L 1QACA 4RMRA 1OSZA 4P46B 3MLUL 4X6DF 4ZS6D 1R0AL 3P77A 3IF1B 5INDA 2C4XA 4ZOAA 4P4RB 1JVKA 3DV6A 2DWEA 3RNQB 3HE7C 4G7YL 5D1XC 5D96B 3QUYD 4GKNB 2XZAL 3FQWB 4ELME 1Z9SA 2X05A 3HRZB 4QRUB 4LSUH 5F7DA 1NCDH 3FQTA 1MCHA 4PJGF 3WUWB 4P5TB 3NFSH 1FAIL 3BT2L 4UB0L 4X83A 4AM0A 1KGCD 2JB6A 4U6YB 4AEFA 4YDKH 3JXAA 3FN9A 1HQRB 4XPFL 4ODSL 5C0IA 1KACB 2AK4B 5TDNB 1JMXA 4GRWF 3W82A 2H8PA 3LIZL 3ULVH 3T3MF 5CILL 3HAEB 4MNQA 1J5OL 3SGJA 1B6UA 2KBGA 4LSTH 2IAMD 4GBXA 3EO0A 2X70B 1JV5A 5SX5K 3M45A 3OMZA 4ISVA 1QHOA 4WO4A 2EDQA 3ZSSA 1NL0H 4HC1L 4L1DA 4R90H 3CFCH 3DNKA 5JW5A 4LLWB 5J6GA 3FRPG 4XNYL 1AR2A 4GAGH 5C09D 3RNKB 3KR3H 5HHOB 3WO4B 1E4WL 1J0YA 4FNLL 4ODHL 4HBCL 1UH3A 2YUVA 4HF5L 5HYSB 3LKOA 2BVTA 3SGEH 1FL3A 1MFNA 4GRLD 4PRHD 3QXDB 1JTOA 3K4ZA 4HIEA 2Y36H 4N5EC 4ALAL 2APTA 2CUIA 5CEYB 1N0XH 4DAGL 1II4E 2MNUA 1TMCB 1UB5A 1WK0A 4I2XA 4NKMA 1IGIH 5E99L 5T5NG 4F9PC 1G7MA 1PEWA 4YHIA 3UPAA 1T04B 1DL7L 3TYGL 4DQOH 3HA0A 4N8PA 4K7FB 5GRXG 1JPGA 1HHIA 3S5LA 2JE8A 3N50A 3QQ4B 3I6GA 2KQNA 3P2TA 43C9A 1QBMH 2DMBA 5FUOH 2NCMA 1MVUB 2Y5EA 3DUUB 1HNFA 3OG4B 5IOPB 4XAWH 2JJTA 1AGFA 4UILL 1AQDB 1OAYH 1Z5LA 1DBBH 3CGTA 3LEXA 1NCAL 2BSSA 2PXYB 3G6JF 4XGZB 1TVHA 4MJ2A 5EZLB 4RNRB