2P7TB

Crystal structure of kcsa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB-A
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB01
1QRNB 3V9FA 1ZKAA 1RZGB 2EYTB 4GUPB 3QZWA 1UCTA 3MV8D 3RUGF 1LEGA 2OL3B 5F9OL 3NGBB 4RBPH 1FFPB 1TQCB 4CW1B 5TDOA 4XVJH 1ZWIB 1TZHA 1YEFL 1F4XH 1QRND 4M5ZL 5EIIB 5A3IC 1TENA 3FRPA 3T2QA 4NKDB 5FKAA 4P5TB 5I6XB 1CGUA 4OM1L 4NQVB 4U6TA 4EUPG 1E6JH 2DOCA 2J8UF 4E42A 1UQSA 3BO8B 4JFDD 2P5ED 2FX8H 2YZ8A 2F9BT 4OCWH 2VZ3A 3LQAC 4P5TD 4YHIA 3RUGA 2DYPD 3BWUC 3PHQA 3DSNA 1BJ1H 3MA9L 2EE6A 1YNLL 2CK0L 4QRPA 1S7QB 3KS0J 4WFGE 1YQVH 1IE5A 2IFFH 2AK4D 5D2NA 2J4WH 6CGTA 4JGMA 3L5XL 4UUJA 2J8UA 2AABH 4PJFF 1G7IB 5HY9B 2L4OA 1IBGH 1VADB 5D72H 2QSTA 1JHKL 3QXAB 4OIAA 1FCCA 3PDDA 5DT1L 3CJJA 3WHXB 3ZTJG 1E28A 5GS1B 1MUJB 5J11B 2P7TB 4JO2H 4YFLF 2HJLB 1OP3H 1LQSR 4XP9L 1YEGL 3H9HB 4D0DA 1S8DB 1NSNL 3PDOA 4B5EA 2IGFL 4H0HB 4OM0L 4GT7A 4LCUB 2Q86B 5I17A 5MEQA 4X4XA 2IQAB 4QXGH 5KW9L 4PJFA 5E5MB 5JW5A 3QEQB 1KTLA 1DE4B 3QRFM 2LFGA 2DWDB 3RPIB 4ODSL 4Z0BH 3QO0A 3KPSA 5M94B 2WW8A 5FM5M 2BVQB 1JYVA 5JIIA 3QEQD 3VRJA 1ORSA 3S35L 1MHCB 3UTSE 4ZOAA 1EFQA 2HG5B 5D2LA 1KPUA 3E6HB 5F7DB 1UKQA 1F6LL 3DRQA 2PCPA 1TQCC 4PRIB 4UINH 5T1KA 3UPRA 2MCPL 5SX4I 1MEXH 2BSRA 1CVSC 4Z7VE 1A1OB 5C70A 5CLWA 5F7KC 1CD1B 4P5TC 1KB5H 2OTUB 1TETL 1MJ8H 3CSGA 1CFQA 3D25B 4DVBB 4BZ1L 1U8KB 1HKFA 1IC5H 4CMHB 5EOQL 1U2HA 1UB6A 4J8RB 3UTOA 1XGTB 1KUMA 4LPYA 4D9QD 1TPXC 1A6ZB 1YYMH 4Z7WF 4Q74A 1Q9KB 1HEZB 1CGTA 3LKPA 3GMPA 1T5WB 1DL7H 3CVIL 2V5RA 3IRPX 2KDGA 2NNAB 1A5FH 2VE6A 4QRTB 3W0WD 4HKZA 4O2FA 3RWCA 4XXCC 3ULUL 1JZ2A 3Q0HA 3QUMA 3CSYB 3LEXB 3VFTB 4A6YB 1A2YB 4JZOB 1N8ZA 3FCTA 1NAMH 5ANMB 3RWEA 1OSZB 1AFVH 1VDGA 4XPGL 2J88H 1IKFL 2FEEL 1CFTB 2WUCL 3EO1B 3KPRA 3SGDI 2R4SL 2Z9TA 1BFOA 4Y4KB 1JPSH 4LSTL 3KYNB 3MV9E 2QADB 3O11A 3NZHH 3RTQD 2O93L 4ALAH 4F37K 4JO1L 4PJDE 1T03L 4CVXB 1UZ8B 4Y4KD 2Q76B 3T4AA 4QXTA 2QADD 3MV7E 4UOJA 4WFFD 4GQ9H 1T66D 3BP7A 1BAFH 5CILH 4FZEL 3V6FB 2EIBA 1IKNA 2E27L 3HE6A 5IB1A 5IB2B 4KTEL 2NY4D 2K7PA 3WLWD 4Q9CA 4IMKA 5BZDA 4YHKL 1L4IA 3BMVA 3KDMA 43C9B 2OX5A 4U2ZA 3C5ZB 5HHOE 5TPWL 4GRWF 4PG9B 1I7TA 4XC1H 4L29B 4PYGA 1MFDL 1TVHA 4WDIB 2JJWA 3F58H 3HE7B 3R1GL 3Q5OA 3S36L 3QUKA 3WO3B 3X13B 4DFHA 1J11A 3QHTC 2YPLA 3RWGB 3NACL 3VWKB 3MRMB 1PAMA 3EOBA 4LEXL 1S7TA 3C5ZD 5ICYA 3AAZA 4RAUA 5HGGS 1D9KA 4RMWA 5I1JL 5I8OL 2CKNA 3TT1L 2CKBA 1VFMA 4KKLD 5BS0D 3K2MC 4CMHC 4X6EA 4YBHA 3VWKD 4WTZG 1PFCA 1BREA 4WV1C 3VGBA 4MXWH 4GKZB 1MFAL 1NCAL 1TCMA 1UG9A 3NZ8B 1F4YH 1AXSA 1DBJL 4YZFE 2VAAA 4G43A 3RVXD 4KDTC 2GT9B 3BOVA 1K3IA 1MCPH 3MV01 4K8RL 1J12A 1FC2D 4JANA 4F2MB 3WUWB 3EZ8A 3P0YL 5FKPA 1JGEA 5B8CC 5D8JH 1YZZA 3FOLB 3IDMB 5C86A 2R8SL 1Q9LB 1Q9WA 4HIIB 3BGMA 4FQQA 1CGYA 3T0WA 2JCCA 4X4ZA 2VXVL 4Y8AA 2VKWA 2BNQB 2P49B 3VA6A 4PRDA 4Y4KC 4ZXBB 4JFQB 1AKJD 3JWOC 3JWDC 2QADC 5AYUH 4PJBA 1WBXA 1UWEL 1T66C 2XZCL 2ERJB 4PLOB 1KIUA 3MRBB 3QDJE 1WFUA 4GXUN 3HPJB 3RY4A 4X7DC 4ZXBD 3QJFB 3WLWC 1ZS8A 4ETYA 5IR1B 4OZIB 2FSEB 3FT3B 1KB9J 15C8H 1ZT1A 3VI4E 1R24B 4O51A 1QBMH 4F7PA 1OHQA 1OM3H 1OLZA 3UDWC 1FDLL 5DLMH 3PWNA 1A7RH 1JGLL 4WW1A 5CEZL 2GW5A 5E8NB 5BMFL 3C5ZC 4JQXC 3VFUA 5IIEB 2XXMB 3EGSB 5IT2H 1N0XL 3QIUA 4YHNB 4KKLC 1IILE 2ZUVA 2O5XH 3VWKC 3IJSB 3ZL4H 4XCYA 4YDVB 4YXHL 2X4NB 4NZUH 2ENSA 4LIQE 5C9KA 1JUFB 4NJAH 2DTMH 4JPIB 4GS7B 1BWMA 5E2VL 1RFDL 1PVHA 4LSQH 5ENWA 4NO2B 1T5XA 3RVXC 5DRZA 4JR9H 4RGNB 4H5SB 1JPFB 2BVPB 2QQKH 1AGEB 3KPPA 1BFTA 1VFAB 3IDNA 1EXUA 4G8GB 4PRHD 1U93B 3TJEL 2HVJB 2FDBP 4KRLB 3ILPA 4P48A 1I1YA 4LLVA 3V7AG 4QNPE 2N4IA 1MAML 3MRIB 3KHQA 4BSWA 2LAAA 5HVHB 4GG6B 4JFXA 3F6IA 4G6FD 4KROB 1AGFA 3VDAA 1KLUB 1HILB 5IMMB 1CQYA 1YMHB 3K1KC 5C09A 1AXTH 3W11D 4ZS6D 2JB5L 4RISL 2YXFA 4ZXBC 4XTRD 1ZHNA 1L9NA 2EYSA 3MLSH 2F74A 3QNXB 4KROD 1JTPA 2PN5A 3GSXA 5IF0A 3KYKL 1B9ZA 1OWRM 2DS4A 2BJML 5D7IE 4Y4HD 3GGWA 1OGAB 4K7PY 2BFVL 4W6YB 3P4OA 5FGBC 1OF2B 3LKRA 1CIUA 1A9BA 1MAJA 1QR1A 1UM5L 2FIRT 3BWAA 5DVKA 2WUBL 2EC9U 3MXWH 3TBWA 4LRIC 2VLME 5J57B 2QQLH 3IS0X 2ZNXA 3UO1H 4FNLL 3O2DH 4NQXA 3LH2L 2GSGB 3FRUA 1NFIA 3P4MB 2CD0A 4P5KB 4FZ8H 1K6QL 4GRMA 2VDRL 2WK2A 3D1MC 3OR6A 2FWOA 4U1HB 5C3TA 2D4FA 3HTLX 3DECA 5I9QB 5GGQL 1DFBL 1KCVL 3V52L 5F3BB 1QRNE 3DETD 1MCJA 5BV7H 3NCFB 3O3BA 4XPAL 4GS7C 3WFCL 4M1GL 3VXPB 4GMTL 1B2WL 2ORBH 3DBXB 1A6UH 3UBXG 1WUNT 4AMKH 1P84J 3CLEH 5D5MF 1QNZL 5JOEA 3FAWA 1CT8A 3VGFA 3HNTL 2NX5A 1SMAA 3P9WB 1I7ZB 1KCLA 4ODUA 2XN9B 5FOJA 4JN1H 1LWRA 1S7SA 2XKSA 3VMPA 3KNBB 4ZS6C 4EOWL 4CADA 3GSVA 3N85L 2EYRA 4XTRC 4HAFA 4TULH 1MCWM 5DJ2B 1AQDA 4YO0B 5CEXB 4KROC 1EMTH 2NQCA 1RU9H 1XGPB 1XGUA 4LLMB 3MOAL 5DMIL 4U33A 5LBSL 3IU3A 2A2QT 4Y4HC 1S7XB 4P57A 4KQ4H 4TVPD 4GW1B 3KPMA 5DQ9A 1RURL 1KCSL 1M6OA 3ZLQC 4UB0L 32C2B 3I2CL 5DUML 4EZMA 2C4FT 3S96B 2EDBA 1YDPA 3U30B 4XAWH 5I1CH 3V4VL 4IRZL 3MRRA 1KB5A 4F7CB 3MLYL 4ODHL 2EDLA 1L0YA 5F71A 3M8OH 3ECBB 3V8CA 2OM5A 1N3NB 3FQRA 1T89A 1JWUA 3DXAD 2GK0A 5L2KA 3W2DL 5DEGB 4CJ1A 1IGML 3QEQE 3DETC 3L3KA 4M4PA 4OLYL 4XGZB 2Z35B 4NZTL 4HSQA 4CMMA 1KV3A 3L1OL 5IFAL 1JYWA 2HJKA 3QXVA 5LGKA 2HFGH 4JHWH 1Z0MA 2R1WA 1KN4H 2A6IA 1P4BL 4NQDB 4I0PB 4R3SB 4XVUD 4YBQD 5KSAA 4PRIE 1WZLA 4ZDHA 3NCEB 2AVGA 2CR3A 3IDIB 4RX4A 4DUVA 4FQ1H 2EDNA 1IGFL 3PABB 4D9QE 2C7UA 3MNZB 4G80B 4NQDD 3OR7B 1FZKA 2C3WA 3T8XB 5J56B 5DMGD 1UA6H 4LCCA 5I18H 5D1QB 2Z8WC 4NJ9H 4DZ8A 1RHHB 1ZOXA 5KSBF 5SV4A 4RDQF 3TBYB 5LWYH 2ESVD 2Z91B 5GSVA 3WMSA 1T7WA 3W9EB 5IM7A 3IVKA 4PV9B 5D1QD 5FECB 4TSAL 4G8FB 4OD3H 1RUML 1PLGL 5DD5H 5FO7A 3N1MC 3VJ6B 5F9JB 4GJTB 4TPRH 4U3XA 4X7SH 1WFNA 5ANME 3RP1A 5E2WH 2KZ1B 4XMPH 4ZS7L 2VRAA 5CSZA 1QR4A 3ZDYE 4M1DL 1ZLVH 4F9PC 5KSBA 1SJEA 4OLXH 1KEGL 4OGYL 3EUUA 5T1DL 4UILL 1BGXH 2XV6B 4MJ4A 4PG2C 4LQFL 4I3RH 4JLRA 3WLBB 4N0UB 4ZOCA 1GAFH 4QHKJ 3CK0L 1ZLSL 4NYLB 4QHNA 4OZGF 3T1FB 2R39A 4P2RB 1I8LA 3SOBL 2YD9A 1EHLL 5FHAL 4ZUVA 5B3JE 2VISA 4HCRA 1CXHA 4G8IB 1NMBH 3WNKA 4X80H 4XVUC 5CBAB 4YBQC 2QBWA 1HINH 3QDMD 4M93B 1DEEB 3PP3K 3UTSA 5JDSA 1SVZA 3PWLA 3VH8A 3QG7H 5IB5A 4OZGA 2FRGP 4YUEL 1UZ6F 3UTZB 2XG5A 3RIAF 4Y1AB 1GPOL 5IB4B 5DMGC 4Z7VA 2WBWB 3TGXA 2BHYA 1WITA 5GGTA 4KMLB 4LGPB 1UB5B 1N7ML 4HZLB 3ARFA 3OG6B 3KLHD 1RMFL 3OKDB 3TCLB 4Y5VA 2ZG2A 3O81A 2D4DA 5D1QC 1UWGL 3MJGX 4Q2ZA 3VE0B 3GUTB 2QKIB 3BP4B 5E99L 4KRPB 1MRDL 4WGVB 1T1YB 3SDAD 2PO6D 3PGCA 4ZTPL 5JHLH 5KG9B 2MFNA 4MQTB 1KIRB 1UKTA 5LGJB 4HWEL 3CDGA 4N0CC 3D87B 2D9CA 3BRGC 1TZIB 3CX2A 1GZPB 4WUUA 2UZXB 1A7OL 1HNFA 1DQJB 1PG7W 3MCKA 2NY7L 5E5RB 3GSNA 4OV5B 1HWHB 4XP4H 2C4XA 1TVBB 4HZAA 5GS2H 5JO5A 3MRGB 3SDDD 1QSEA 2QHRH 2BNQE 3EO0A 2FGWH 2A6JA 5ESQB 5D93C 3EFFB 4AEHL 3WEXA 1CFSB 2FL5A 3QH3A 3GBLA 4YIQA 4Q0XH 2VLRD 1EK3A 4TUJB 1DLFH 2IAMD 2YKLL 7CGTA 5FOBB 3R0MA 4NQEB 4GRLA 4OZIE 1CYGA 1S7UB 1W72A 3MV7A 1LO2H 2CLRB 4HPYL 5AZEL 5I73B 4JG1L 4ORZC 3I6GA 5I19H 1ITBB 1HHKB 5D1XA 3MJ9A 3MBEA 2YN5A 4UNUA 3X3GL 4ZG1A 4TYUA 3KXFD 1U8MA 1NGYB 2VWEE 5HHOA 4M93C 3QZWG 1UCBH 4QHMA 1XGYH 3QRGL 1RIHL 3P0VL 4L3EB 4CVWA 5IVXB 5CBEB 4JFHE 3KLHC 1FYHB 2ARJA 3GKWH 4NKQB 1YNTA 3DHJA 4MZ2A 4QTHB 3DTXB 2ENYA 4X99B 2EDOA 4JZJC 1TNNA 3BKYH 2GTWA 3LPFA 3PWVA 1GOGA 4Y2DD 5B38B 4FQ2H 2WP3O 4WI4A 3SDAC 2LVEA 2H41A 1T20A 1QSVA 2NY1D 2P8LA 4D0CA 2IG2H 4RGNE 5IHUL 3QPQD 4JFPA 4ZQKA 5MI0B 4X5WB 5HJ3A 5AUMB 5GGRY 1AJ7L 1AY1L 4PTTB 3U9PH 1KJ2A 4G8GE 2J3SA 5F6HJ 4KRPC 5KVEL 4EI5B 1SJXA 3LQZB 3PJSA 1TVDA 2EH8L 1X5AA 1E4JA 1R3JA 3VFOB 3ALPA 4W81A 4OSUL 2Y9RT 3O2DA 3RAJH 1KPVA 3LS5L 4MSWA 3SDDC 5C8JA 4IRJB 4DKAA 3I9GH 1PSKH 4HKBA 3NTCL 4LSPL 4GG6E 1B4JL 4M8QA 2VDMH 3MRQA 1G9ML 1YECH 2ZZUT 1L9MA 4LL9A 4S1DD 3DMMD 1RJZA 5D1ZA 4AENA 4BUGA 2AJSL 3RDTB 3Q5YA 4IRJD 4K3JL 2XWBB 5KSVA 2YD8A 3VD7A 1IM9A 1KJVA 2D03H 5TFSH 3D2UD 2O61A 1LVEA 4TSBH 2DLGA 3TO2B 1A3LL 4LARL 5FGCB 3UTPD 5FUZH 3QDJA 2PUQT 4RMSA 2P42B 1OGAE 1EEQA 3ARWA 4N5UA 1FNAA 4EDWH 5IBTL 3ARZA 1ED3B 2HRPH 5I73C 1P4LB 2VDNH 4LLWA 5H37G 5GISL 1B0WA 2NY5H 5CD5D 3FJTA 4D94A 5CKGA 1UT9A 4DZBA 4K3HA 3CC5A 3I6LD 1X5IA 4U7MA 2WIMA 1FZMA 3EDDA 3GJFK 5D71L 1C16B 3MLVL 2BVOB 1Y18B 1GZQA 4GKSB 4JKPH 1SY6L 5TF0A 4EBQH 3EOAB 3ZDXE 1JNJA 4LF3A 1HXMB 3BPCB 4UAOB 2BNRB 3LMJL 4AEIH 4HUWB 2V7NB 2ATKA 3BRDA 2KQMA 4H0IA 5I8KH 1YY8A 4OI8A 5AD0A 4FP8L 4BFEA 4YR6A 4K94H 2AS5M 1AGDB 2GEEA 3VXTA 5H2BB 3VFGL 4KDWA 1ES0B 1LNUB 5I75C 4X98B 5FGSA 4PFEA 1EIBA 1DVFB 5F6HI 4HPOH 5T3ZE 1JRHL 4K23L 3TO4A 5FGRA 1MVFA 1TZGL 2QJDA 2EZ0D 1X5ZA 4LSUL 1G6RA 3GIZL 3GK8H 4MJ2A 4Q58C 4YGAB 1CE1L 3K4AA 4S1DC 2XN9E 1HOCA 3DMMC 5IVZB 1DVFD 1PG7X 4ONFH 5DFVD 4IRJC 4NQSA 1GJIA 4KMTH 1VA9A 5L2JA 3ULUE 5TGBA 4UTAL 4Q6IC 2VDKH 5KVFH 5GZND 5EO0A 1HSAA 4QRSB 4WWKA 2FHCA 5FM5O 3SE3A 1IAOA 3GRWH 3ZKND 3OKOA 3L95A 4XNXL 5SX5H 1I1FB 4IMLA 3BXNB 5DYOB 3BGFB 2NXZB 2A73A 5F9OH 4WHCA 4U4BA 1FE8L 5D7IA 3RWHA 5FA4A 4LK4A 5IJKC 4XCFH 3FB6A 1R5VA 5CD5C 1XR9A 2BDNL 2AJUL 2CR6A 3VXUD 3IXTB 4HUMB 2NXZD 4OM1H 1OP5K 5DI8B 4R90L 5B21A 4G9DB 5HD8D 2I07B 5E2UH 5IG7B 3MJ6A 1TLKA 3HZVB 1C12A 5J13B 2HWZH 4OJFH 1JP5A 1OGTA 1P9MA 4GBXA 2OLDA 3CX5J 5TE4H 3X12A 1HH9A 3TM6A 4OZHF 3L3HB 3MA9H 4LU5H 3VI3F 1OAUH 1MH5A 4ZAKA 1YNLH 2VXQL 1I1AD 4BFIB 2C3VA 1IQDA 2HP4A 3IDXL 4UAOC 2VITB 3HZKA 4HBQA 5HVFB 3HHRB 3L5XH 4GUPA 4NQDE 3JV5A 4ZUUB 1JHKH 3CPLA 4RRPA 1FFPA 4IRSB 3ARDB 4CW1A 1O5DT 2EZ0C 4OZHA 1ZWIA 4MAYA 5EIIA 1IGTA 3QA3A 5FO8A 1IEAB 4UV4H 1DVFC 1YEGH 4NKDA 1NSNH 4J4PA 3ARDD 4NQVA 1R3IL 3NCJL 3VG9C 2ESVE 2F54B 5FUCC 5DQJB 4GXVL 3BO8A 1WV7T 4GKNB 1WZKA 4U05A 5KW9H 3ZKNC 4CBPA 5I1GL 3L5HA 4LPCA 3GNML 5EFIB 4CJ0A 2EEDA 5C3LD 4M9OA 1CR9L 4Z7QF 5CHNA 5TF1H 4L4TD 3K2UL 4XXCA 1CBVL 1S7QA 3B9KB 4ODWB 1OQOA 2Q6WB 1G7LA 5J1AB 2GAZB 3TT3L 3C8KB 3QQ9D 1BQHG 1NEZB 4YDIL 1Z9LA 2NXZC 5JOFB 4XPBH 5FEBA 5BJTB 2MCPH 1G7IA 4QTIH 3V5HB 2V17L 3B9KD 3G5VB 1VADA 5HD8C 3C87A 1AE6H 4XB8A 3QB7C 1QLFB 3WHXA 5GS1A 1TETH 1MUJA 3HAEH 2P7TA 4BZ1H 3EDFA 5EOQH 1XMWA 4LCIL 3H9HA 3VRIB 4H26B 3NH7H 4IS6B 2EDXA 4N0UE 3PV6B 1I1AC 3VG0L 2O5ZH 4TNVK 5J13C 4LCUA 2D31B 5JXAL 4FQXB 2Q86A 4P2RE 5J3HD 4P0DA 5J4MA 2XXCB 5E5MA 1DE4A 1F3RB 1KPRB 3RPIA 4P4RB 1MWAA 2GITA 1A6TB 4TTGA 3ARVA 2BVQA 1X7QA 2FZ3A 3BPNC 4F7EB 2PYEB 1TFHA 4KXZH 2HG5A 3KPOA 4U49A 5JQHC 1FNGB 1I75A 1IKFH 1T0PB 5E0QA 5CIPH 4PRIA 3ARDC 2R4SH 3ZKSD 4KK8D 3HA0A 1ZVYA 4MMXC 3MLTB 1JF1B 4Y1AE 1AHWB 1A1OA 1K85A 4Q97A 4R8WL 4JO1H 5DK0B 3IAPA 3D25A 4DVBA 1U8KA 2DQHL 3GIVB 3V0WL 1BMGA 1XGTA 3WIFB 5CAYB 4XNYL 4HGKC 3F7YB 3F7RA 1A6ZA 3Q48A 1Q9KA 2BVUA 1DP0A 4FZEH 4OLZL 2E27H 1T5WA 3QQ9C 1BVKB 4PJXF 4ENED 1V3LA 4G42B 2NNAA 2P5WD 1RUKL 4EN3B 4PRBA 4YHKH 1DLHA 2V9TA 3B9KC 3KYMB 3NAAL 5EUOB 3CSYA 5FYLD 5T1LB 3LEXA 3VFTA 1MFDH 4U1KB 4MNGB 4R2GD 4A6YA 4MGXA 4N0FB 1EV2E 1A2YA 1OP9A 4JZOA 4QO1A 3MRDA 5HHPB 1OSZA 1WBYB 4LEXH 5DURB 1T6VN 3N9GH 2DI7A 1CFTA 3T3PE 2WIIB 1B90A 5T1LD 3WFHA 5I8OH 1Z0NA 4DN4L 3KYNA 5J3HC 1DSFL 4W6WB 5F93C 4R0LA 4EQ2A 1BJMA 4EUPB 3L6FB 1MFAH 1QKZL 5CP7B 2VABB 2VZOA 4JY6B 4CVXA 1G1CA 2YOCA 2Q76A 1F11A 1I9JL 3IFOB 3BUTA 3H0TB 4NQEE 4R26L 3TF7C 3ARTA 3T0VA 3BH8B 1FORL 3V6FA 4JHAL 4F15B 3HS0A 5IB2A 3ABZA 3AREA 4KK8C 1YMMB 43C9A 1QFHA 4PJIF 12E8H 2XI9A 4P5MB 4PG9A 2W60A 2VXVH 3TYFB 2ZOKB 1MJUH 4URTB 3X11B 4N1EA 1I8KB 4L3EE 1CLZH 3HE7A 5IVXE 2G9HB 3RWGA 3KPNB 4LNRB 1KXQE 2WLYA 3FKUS 3DVGB 5ERWA 3EDKA 4X8JA 4M6AA 2E6PA 2XZCH 2R1XB 4LPTA 3RVTD 1CVRA 1A7QH 1X5FA 2KZWA 4ENEC 4ZPTA 5FV1L 1IQWL 4PJIA 4FFYL 3AM8A 4GKZA 4F7TA 5LXGL 4L8CB 3PL6D 2IEPA 1FDLH 1NBVL 1VFUA 4R2GC 2GT9A 4DWHA 3MOQA 4LAQH 4JDTL 1EAPA 1N59B 3B6SB 5BMFH 2GK2A 3LKSB 4F2MA 2OSLB 3WUWA 1G6VK 2EDJA 4K7PL 3IDMA 2WINA 1N0XH 3NCMA 1CD9B 4ZFZB 1EFXB 2FATH 2H3NA 4UI2A 4R4BB 25C8H 1G7QB 4Z76A 5LCVH 2BNQA 2P8PA 4YXHH 2AXHA 2GY5A 4LGSB 2GUOB 5E8OB 5FM8A 1LEIB 4Y88A 5F1KC 4XCEB 4Y5XB 2NTFB 1BPVA 4CL7A 1ADQL 3AY4C 5FO9B 5FGCE 4PJ7B 2VYRE 2UWEF 3MRBA 3HPJA 3TA3B 3VGEA 4NRYA 4D9LL 3QJFA 5IR1A 1EZVX 4OZIA 3GDBA 2FSEA 3I6LE 2V2TB 4LP5A 3RZCB 5HDBF 3QIWA 4DKEH 4MD4A 3Q6FB 5F7WC 3D85B 4LRIA 3TA3D 4CN6A 1GOFA 1MAMH 4PGBB 2ZCHL 3WN5B 2V2XB 2FCBA 4KJYA 5E8NA 3HMWH 2NPLX 3EYFB 3MRNB 2H26A 2RBLA 3QFJB 2EE3A 3EGSA 3C6SB 3LKNB 2ZSWA 4HK0B 5T33L 4R96B 3RVTC 4FQHB 4RISH 3O41B 4P46B 4XXDA 1C7SA 3IJSA 2BNRE 1LDPH 3QXDB 4XX1G 3SGEH 3KYKH 4OCLC 4PY7B 1JUFA 2BJMH 3PL6C 4JPIA 3UPCA 2XY1A 2VSCA 2PKDA 4MXVE 4P46D 4NO2A 4H5SA 1OTTD 4UMGA 2HJFA 1JPFA 4XBPA 3NOIA 1UM5H 1FYTB 4G8GA 5IW6B 4P9HH 1SHMA 2HVJA 4MB3A 3S35X 4OFYD 4NNPL 1OSPL 3UROR 1YPZF 9CGTA 3BMWA 1L0QA 1NKRA 4B41A 5FUCE 1C1EL 4JFEA 3MRIA 5FYKL 1K6QH 3PXHA 5HHMD 3MUGB 1M1SA 1HWGB 1QBAA 5GGUB 4GG6A 4WTXA 3CVHL 4FQCL 1HILA 1AQKH 5IMMA 1YMHA 3EYSH 1PEZA 1KCVH 3LEYL 5JORB 4TSCL 5EPMB 5CJXA 3WFCH 4XZUA 3WIHA 4GMTH 1B2WH 3NVQA 3B4NA 2VXTL 1IEHA 4HS8H 2Z4QB 4ZUSB 3NFPA 1OGAA 1YEJL 5A16A 3TA3C 2D7OA 2X42A 1WC7A 2EKSB 2E7LC 1ZV5A 2Y36L 1QNZH 2YA1A 1CD8A 1OF2A 1XF1A 1JPST 3HNTH 1Z9OA 3SE4A 4MNHB 3GBNH 2ZNWA 4FABH 2IMNA 3C09B 1FL3B 2FR4B 4DK3A 3WN5C 4EOWH 1JGVH 2NY3D 3B3IB 4KZEL 4M3JA 4PJ5A 1GGYA 2GSGA 1S9XB 3DYOA 3P4MA 3MODH 4P5KA 3MSPA 3TBVB 3VH8G 3MOAH 5DMIH 3G6DH 4KH2A 2OXGA 5GRXG 3H42H 1NJ9B 1X5XA 4P46C 2W1NA 1JV5B 4XWOC 4U1GC 1OTTC 4R97B 1RURH 1KXVC 4PGCB 4UB0H 3DI2B 3I2CH 4OGAD 4OD1L 4F80A 1JHTA 2DJSA 3VXPA 1F4WH 2BSTB 3V4VH 4IRZH 4NP4L 5JHDB 1G7PB 4ODHH 4OCXL 5D7LD 5FYJE 1P2CB 2CDEA 1MCEA 4ACPA 1I85C 5EU6D 5IBUG 1XR8A 5L0QC 2VZVA 2XNAB 1HHIB 3T2NL 5KN5B 4NSKA 3IAGC 1I7ZA 5JHDD 3AS2A 2AAVA 4M7KL 2E8ZA 2F54E 2FD6L 2XN9A 3S36X 5C0BD 5HDQL 1MCQA 3KNBA 1ZLUK 1BX2B 4G6ML 2PYFB 5FAAA 4V1DD 5DJ2A 1CD0A 5CEXA 3AB0B 5JNYA 3GJEB 1D5ZB 2WQRA 4TRPH 3K74B 4LLMA 1RZIB 3L1OH 5IFAH 3VFRB 4N8VB 1S7XA 3RWJA 5FK9B 3VFVB 4GW1A 1T1ZA 5J6HA 3SQOL 4ONGL 4QY8A 3IGAB 3BZFB 1XIWD 1U8PB 4RAHA 1ZA6B 4OQTH 1WT5A 1QLRB 4LSSL 3MGOA 1Q72L 3TH2T 3I50L 3RU8L 3VXQA 4IIQB 4F7CA 2NY3C 5KOMC 3QUZD 2D0HA 5IHZB 1QBLL 1YJDC 1SYSB 3FB7B 4GW5B 3NIDE 5DZNA 2Q7NA 1QOKA 3BKCH 1MCWW 1N3NA 4O2CB 5ESVA 3WXWL 3GMOA 1A1NB 1ETZA 1FPTL 5DEGA 3IFPA 3TN0D 1NMCB 1B0GB 3EJJX 1X4YA 4N8CH 3UJJL 1U8IB 4H20L 2UZYB 4XGZA 4OGAC 1CGWA 1AI1L 4NC1E 2CJUL 1RUMH 3ZE1F 1HIML 5I1KH 2OP4L 5L8LB 2OR8A 3LS4H 4I18B 2PYEE 3NPSB 3I02A 4M6MH 3TVMB 1F58H 1JWSB 4I0PA 4R3SA 3RWFB 3CDYA 4DEPC 2X40A 4XP6L 4P2OB 3IDIA 1KEGH 3AMLA 5T1DH 4OT1L 1NGQH 1FIEA 2HMID 3MNZA 2X1PA 2DQGL 2VQUA 3OR7A 4Z95L 3M45A 4KKCD 4MD5A 1ZLSH 1N4XL 1PKQA 1L7TH 4LVEA 5CZVH 2XWJA 1RHHA 4HGWA 4Q9BA 4P59H 3SDYH 4N5ED 3TBYA 3AB0C 4Z5RB 3O6FA 2LV4A 3W9EA 1X5LA 1FBIL 1XIWC 1OW0C 4OBSA 3VA2C 4EXKA 5FECA 5A2FA 5EUOE 4RFOL 3PWPB 4QRUB 1FFOB 5F9JA 4JFFB 3VJ6A 4MNGE 3QUZC 2H6PB 3BP5A 1A4KA 2W65B 3GJFH 4HWZB 3UBXB 1TIUA 5C0DB 1ZAGA 4AK1A 4RWYH 3U7AA 1CFNA 1N7MH 1VFBB 3A6CL 3TN0C 3REWB 1EGJL 4LHUD 1RMFH 3B43A 3WLBA 4WFHD 2E9IA 1G7HB 5C2BL 2F53D 1UWGH 4M7ZC 4KTYA 1LO5A 2Z92B 4P2RA 1K4CB 3V6ZB 2X4QA 3QWQB 1XGRB 5HYJB 1NMCC 3KGRA 1XF4A 4IDLA 5DHVB 2D0GA 4K3EL 1KULA 5DA0B 4J1UA 5A40E 5F7HA 4PJAB 4PRNA 4X4ME 1A7OH 1UACL 1T0MB 4YDKL 3BHBB 3IDJB 4BZ2L 1YMME 4O00A 3JV4A 2AXJA 1DEEA 4I18C 4H8WL 3NPSC 5EOCJ 3H9ZA 2B1AL 4OLEA 5JW3H 2VZ1A 3V4PL 4KKCC 3C5SA 4MA7H 1KB9K 3OAUL 3UTZA 4AEHH 2Z31A 2VR4A 4Y1AA 5HI3D 4ZFOB 5IB4A 1IAIL 2J12B 4BA8A 3FQTA 2EH7H 3DV4A 4S0SD 1IC7L 3OGCB 3UZEA 1UB5A 5DRNB 4HZLA 4MXQD 4N5EC 4OZFH 3TCLA 1J1PL 3DHMA 3PGDB 1UM6L 3LQAH 2CGRH 3QCTL 3GBML 4JG1H 4YE4H 2M2DA 5DEFB 2QKIA 2AEPL 4LDOB 1BM3H 4LLYB 3MLXL 1G9EA 5KG9A 1MRFL 1KIRA 5LGJA 4P2CG 5JW4N 4GW4A 4MA8H 3SCMB 3IDUA 4G6KL 3P73B 2I9LB 3CVHB 1RZFL 4LDEB 1TZIA 3REVB 1GZPA 1PEWA 5IQ9B 2CIKA 3W9DA 3G6JF 3QRGH 3P0VH 1WZ1L 4LQ1A 4OV5A 4P2QA 4XPFL 5BZWB 1MHEB 4E41B 3C6LA 1MCHA 1TVBA 3SDCB 2IBZY 3MFGB 4P23B 5I2IB 5ESQA 3O45B 2V9RA 1TNMA 4PGZA 3STZB 2YUVA 1CFSA 4Z7UF 5GRVL 3FQXA 5IHUH 4PJ7E 3BYTA 1JHLL 2AJYL 1RI8A 4LVOB 1AY1H 3G6JA 4NQEA 1P69B 4X6FA 4FQIL 2CLRA 4X6DB 1QEWB 4K3GA 1FN4B 4OSUH 3RGVB 3LS5H 5A1AA 1NGYA 1PZ5B 3FONB 1B4JH 5HI3C 2ZUQB 2FB4L 3MMEB 2OL3H 4DTGH 3QFJE 3RGVD 1EEZA 1IEBB 4L3EA 5IVXA 5MEOB 3LN4A 5CBEA 2AJSH 4MXQC 2BY2A 1RUQH 1NBZA 2OZ4H 4QTHA 5HXMA 3O9WA 4JAMB 4QRQB 3D5OF 4DCQB 2IWGA 1A3LH 4HIHB 3BKML 2DIAA 4R7NB 1CG9B 5B38A 3K81A 4NGHL 4YFLI 1KTKE 2EDEA 3QUYB 5IBTH 2HTLD 4U7SA 5AUMA 1PY4A 4O5LL 1RK0A 1FYTE 5GISH 2DI9A 4TOYL 4EI5A 3WXVH 1O7VA 3ZE0F 2VDPL 1NC4B 4D3CH 2C3GA 1MCOL 1YEDB 2ADGB 2KL6A 3P30L 4HJ0C 3SBWA 4OIBA 5DC0A 4NBZB 5D71H 1BLNA 3DSFL 1R3KB 4F3FA 1MREL 2HT3D 1NC4D 4QYOA 4JRWA 4BK4A 2VNCA 4GFTB 4N9GB 1BOGB 1P84K 4UTBL 2X70B 4DGVL 3BSZL 3RDTA 4P23C 4LOUD 3O2VL 2XWBA 4YFDB 3JTTB 3EJZC 5E94B 1F90H 1R6VA 3LKQB 3WO4B 1P7QB 1U8JB 1RZJL 4L9LA 3LD8B 4KK9D 5ID1B 1GGBL 4NUJB 4HXBL 3ZE2E 3MJ8A 3LHPL 1JRHH 5F7EL 2NY0B 1P4LA 4U6VH 5EORL 1TZGH 4KJPD 4OBRA 4NNXA 4OKDA 4G9FD 3WSQL 3RGVC 1X9QA 3IKCB 1QHOA 4KKAD 3VGHA 1WIPA 2LAGB 4EI6B 1OT2A 1NCCL 1MHHB 7FABL 4ZUTB 2LE9A 1K9TA 4UTAH 1ZXQA 1C16A 1BFVH 2ARJQ 3QI9B 4XB7A 5KJRH 1QFWI 5GHWL 2BVOA 3GMNA 5A2LH 1E4WL 3P11L 1HXMA 1S5HB 3F8UB 3BPCA 3BZDA 4MMZC 5DDHB 2BNRA 2ZCKL 3WS3B 2ICEA 4HHAA 4HUWA 2HTLC 3QI9D 1ZT4B 2CMRL 1YEIH 1FE8H 4JDVB 3UTQB 2DWEB 5AYQA 2BDNH 1AGDA 3QUYC 5H2BA 5JHDE 4S2SB 1LNUA 5HGHB 3BDYL 4HD9A 2ED8A 4R90H 3RPKA 3E8UH 5E1AB 2FJGB 1INQB 2VDLL 3GSRB 2X6MA 3DLQR 5D6CA 2HT3C 3Q2CA 4JQIL 4N9OB 2ZJSH 2G75B 4L8SC 2JLLA 1E4KC 2YD2A 3QZWB 5ISZA 5F1NB 1BBDH 3FO1B 5BQ7B 4FXKA 5HI5D 3OKEB 4YWGL 5TDOB 2IQ9H 4JJ5B 4QRSA 5D7JB 2FX7H 3CSBA 5GRVK 4G6AD 3JWOH 2R0LL 4KK9C 3JWDH 3BZ4A 1CGXA 3OJDB 5F72S 3WO4C 3NABL 4KJPC 4E42B 1UQSB 1AP2B 1NUGA 4QF1B 3LD8C 5DTFA 1YC7A 4ZFFB 1QZ1A 1FO0L 4KKAC 1AC6A 3IXTA 5EBWB 2NY0C 5FYLL 4DAGL 5I71B 5DI8A 1R3IH 3NCJH 1WGOA 4ZSOB 1HQRB 4G9DA 4GXVH 2I07A 4WHDA 5IG7A 1MCKA 3BN9D 1X5KA 5I1GH 3V7AE 5L8KB 4R6UA 2Q3AA 2EXYD 3L3HA 1HSBA 2J8UB 4UUJB 4QRPD 3QI9C 1CR9H 4DKFH 1A7NH 3K2UH 4BFIA 2J2ZA 3FZUD 3CXDL 5EU4A 4XVJL 1E28B 5GGRB 1F4XL 2VITA 3BPLB 5IFHL 1UWXH 3OMZA 4ISVA 3K0WA 1S9YB 2B39A 3PDOB 2V17H 4U6XB 5FUOH 4F9LA 3U46B 4IRSA 1E6JL 1LO0H 5FYJU 5I17B 3H9SA 4X4XB 1NCWL 4PJFB 4OCWL 4K2UL 5JW5B 3U4EA 1HNGA 1WLHA 1WCQA 1KTLB 1ONQA 1IEAA 4TUKH 4LCIH 1C5BH 3ZDZF 5GS0D 2YRLA 1NAKL 5HI5C 5JXAH 2F54A 2IFFL 1ORSB 3SE8H 4U1MB 2ZOLB 1KPUB 3OKMA 3KR3H 2HLFD 1NFKA 3KPSD 1UEMA 5FHBL 5T1KB 2V5TA 4FFVD 3NCBB 3CFCL 5JPNA 2BSRB 5D72L 4ODWA 4MX7B 4K71C 2GAZA 2BY3A 3C8KA 4O2EA 4UIKH 1CFQB 1NEZA 3PWPE 5T1KD 2QSCH 3NCCB 1MQKH 5JOFA 4JFFE 1G7JB 2OXHA 2CRZA 3FQUB 1PX3A 3V5HA 1ERNA 5T3XE 3G5VA 2X10A 4WFHE 1K4DB 4XHJD 3BN9C 4NN6B 4APQA 3SKJH 2GHWB 1KFAL 4R8WH 4YDLB 4QXGL 3V6BR 5CJOL 4ZNEE 2OI9B 2EXYC 2VE6B 4HKZB 4AY0A 2AQ3A 3VRIA 1NPUA 4H26A 4CVZA 1FFQA 4PJGF 3QUMB 3FZUC 4FQXA 1HDMB 5HYJE 5SWQB 1KPRA 4Z7WB 3BIBX 4P4RA 4W6XB 3KPRB 3NAAH 4PJAE 1HQ4B 5DS8A 1CI5A 3BPLC 2OQJB 2E6QA 1JTOA 1LMKA 2PYEA 3RKPA 2NYYD 1J9CT 1FNGA 3KPRD 1WWBX 4PJGA 5GS0C 1IC5L 2BSED 1A64A 3LKOB 4HV8B 5SX4H 3MACH 1JF1A 3MLTA 1AHWA 3KJ6L 3V8OA 1FC1A 3HE6B 1DL7L 2HLFC 3S4SG 5GGSA 2A6KB 1C5CH 3KHOA 4RFNC 2VZUA 3ELAT 4FFVC 3GIVA 2FHBA 1I9JH 3FB8B 3KDMB 3WIFA 1YEHH 3HKFA 2Y72A 1FSKC 4HFUH 3F7YA 3MGTA 4R26H 5JW4M 2IPUK 3HE6D 1I7TB 1FORH 1TVHB 5GIRB 4JHAH 1BVKA 4Z78B 4LSRH 3NBNA 3IDYB 4EN3A 2J88L 5ICYB 3AAZB 3KS0H 4RAUB 4YHZL 3KYMA 5DRWB 3U36B 2M1KA 1I7UB 4XHJC 1JPSL 1NC2B 1DDHB 4Y4FB 3NIFF 1KOAA 4U1KA 4X6EB 2YPLD 2Y06L 4ALAL 2JKXA 4E41E 4GRWB 5HHPA 1QFOA 1D9KD 1T1XA 4W4NA 3WBDA 3D69B 3SGDH 1AXSB 4NN6C 4HWNA 4YPGB 1HHGA 2VAAB 4TNVF 1ZVSB 2OI9C 3P77A 1BAFL 5MP6L 1U91A 3SJVB 5AG9A 5I76B 4FFYH 4EUPA 3L6FA 2Q20A 5CP7A 2AEQL 5FKPB 1T1WA 1JGEB 4ONOA 3AC0A 1IT9L 4NPYB 2Y07H 4RBPK 1EUUA 3H0TA 3IFOA 3PV7A 3EOYG 3RIFF 2XZAL 3BGMB 5C0AA 1X4XA 3BH8A 2FJFB 5IKCA 2NYYC 4JDTH 4LNVA 3F58L 1GC1C 2VO5A 3UXFA 5IGXH 1F97A 3PQYA 4K7PH 1YMMA 4ELMF 1ZVHA 2GJJA 1KN2H 1SY6A 2DLTA 3HR5B 1WBXB 4NWTH 4KI5F 1BQHB 1X6NA 5I1EL 2NR6D 1YEKH 3TYFA 2ZOKA 1ZLUH 2NZIA 3X11A 3QHZL 3HAEG 5K93A 1MFNA 3MREB 3KPNA 4LNRA 2N1KA 4MXWL 4QHUB 2R2EA 1FVCA 1F4YL 3HE6C 1IKNC 4F7PB 3MBXH 2R1XA 1ZGLM 1WAAE 3I6KB 4JREB 1M05B 4XMKL 2EDKA 2VMFA 4NBYB 4WI2A 4LPUA 3BW9A 3DV6A 1N6QH 4TVPH 2H1PH 4XPTH 5D8JL 1NH6A 1WCBB 4L8CA 3QIUB 4W70A 2LVCA 3QSKB 3IDYC 1K8IA 2ZCHH 5K9OB 2X4OB 3RL1A 3B6SA 3ULVD 1IGYA 1A8JH 1D9KC 3EYOB 3LKSA 2XYCA 1SEQL 5I74C 3QIUD 1JI2A 4Y4FC 4GMSH 1ZEAL 3J8F7 5AYUL 3DVFA 4ZFZA 1EFXA 2I9TA 1FNFA 1D5MA 1LE9B 4R4BA 2HAZA 3IDNB 5LVEA 1Q1JL 4UQ3B 1WFOA 3S3SA 3I3BA 2HFEB 3OXRB 3MRKB 1KXTB 2GUOA 5E8OA 2XY2A 1XGQB 3UJIL 4Y5XA 1IAMA 2MMXA 5L7XL 5FO9A 2DQEH 5C08A 4G9FE 2DM7A 1CTOA 4BSWB 2E7LA 1RD6A 2APBA 3MQIA 1X3DA 4X9GA 2V2TA 4HIXL 1AGFB 2I27N 3RZCA 4NNPH 1OSPH 1E6OL 2PW2B 3Q6FA 2NR6C 3D85A 1ZHBB 3I85A 4S1SH 4PGBA 4XNMA 2O5XL 5CSBA 5J12B 2V2XA 1T04B 1ZE3C 3ZL4L 4K3DH 5IF0B 3RTQA 3MRNA 4LKXB 2WMPA 2XWTA 4NZUL 5C09D 4FQCH 4NJAL 3QFJA 3U6RB 3C6SA 4HK0A 2R2BB 4YHML 1H3GA 1MOEA 3L7FB 2GJ6B 1CLCA 4JR9L 4XCCH 1JMXA 3LKRB 3O41A 2QQKL 1NEUA 1QR1B 1UKSA 4HF5H 4WHYH 4YNYA 3GSQB 1CU4L 1FRGL 4JFOA 4PY7A 2XT1B 4YC2C 3NIGE 1IFHH 2JELL 2Y36H 4PBXA 4NQXB 3WYRA 3OAYH 2NXYD 2JK5A 2YBRA 3MYZA 1KT2B 1RZ7L 1D6EB 3C5JA 1FYTA 3OR6B 5IW6A 3JVGA 5F8RC 2E9WA 3QIUC 3BDXA 1DUYB 1I8MB 4NO0B 3LB6D 4ETQB 4AH2A 4KZEH 2JE8A 3RVVD 4B7LA 5DXWA 3MUGA 2C1PB 2RAMA 5TH2B 3H2WA 1DN2A 5GGUA 3Q1SH 3B2UD 4K9EC 5IEHB 1W0WB 2GCYB 5JUEL 2XTJB 1FP5A 3L5IA 5BW7A 1NFDF 3UEZA 2NW2B 2R23B 4HG4J 5EPMA 4OD1H 2NX5B 1ACYL 1JBJA 4OFIA 3OB0H 1RK1A 2Z4QA 3MXWL 4ODUB 3HI5L 4OCXH 2COQA 3HNSL 1C08A 5E6IB 3GSVB 3UO1L 4CADB 1WWCA 3T2NH 2NX5D 3G08B 4XPHH 4NUGH 3WKNA 1RY7B 1WTLA 3MX0A 2Z8SA 4M7KH 2FD6H 5D5MB 2DKSA 4P3CL 2FR4A 5HDQH 1IC4L 4O02H 5D6DA 5J12C 3B3IA 2GQHA 1S9XA 3RKDD 2J8UE 5K33A 1ACZA 2DL2A 4L4VA 1FLRH 2ORBL 1YDPB 3HRPA 2J5LB 4F33B 1KB5B 1NJ9A 4X6CF 1JV5A 4N0YH 5CGMA 3SQOH 4ONGH 2NXYC 3MA7A 2P8MB 3CLEL 4PGCA 4FFZL 5I30H 4UOW0 4D2NA 1J86A 4YQXH 3UYRH 3RX7A 4LSSH 2BSTA 1NL0H 5L2KB 3LB6C 1S9WB 3RU8H 1G7PA 4DJMA 4TUOA 4PJFE 1P7KA 4JM4H 1P2CA 5GJSL 3RVVC 3RBSA 4I3GA 1T2QL 4OKVB 1W8OA 2J7LA 1HHIA 4KDVA 4TULL 1K5NB 3I84A 3FN9A 3B2UC 3V79C 5KN5A 1EMTL 4MQ7B 5L2KD 4PJCF 3QDGA 4KK6D 4BH7B 5DJCA 1NAMB 4KQ4L 4QT5A 1JPGB 5I0ZA 1BX2A 3HMXH 3UJJH 1ZMYA 3MZTA 5AZ2L 1TCRA 1AI1H 5KSAB 1WJ3A 4KVCH 3GJEA 1D5ZA 1RZIA 2OP4H 3VFRA 1H3VA 4N8VA 4XAWL 1NGPH 1JGUH 5FK9A 5FA3A 5KSAD 5E4IA 2ZUWA 3M8OL 4RX4D 3BZFA 4NN5B 4XP6H 4YJZL 4A2MA 1ZA6A 2QR0B 1BF8A 5E6IC 4UQ2A 2MCG1 4J3UA 2DQGH 4MNQB 2BMKB 4IIQA 4Z95H 2ZWLT 1TQBC 1XH3B 2VZSA 4JE4B 5GSVB 1QSZA 3RKDC 5IM7B 4JO4H 1SYSA 3FB7A 1JPTH 3AUVA 5C0GA 4IBLT 4KJQD 1A1NA 4M6OL 5FO7B 2E8YA 5EZJB 4J2XA 4JHWL 1B0GA 1ZSDB 4R9HA 4YAQB 4WFGD 4Z7WE 3D48R 2XKUA 3KPRE 5KSBB 1SJEB 4FQ1L 2G5BA 3ARXA 3JBG7 4RFOH 1IGJB 2ZP0T 5D7SH 4NZDA 3WHE1 4LCWB 1JI1A 4PJHF 3TVMA 2AV7B 1T89C 4RAVB 1OD9A 4PPTA 3TBSB 1QPPA 4P2OA 1ZGLB 1UA6L 3G6AB 5M95B 4KK6C 3UTTB 3MPCA 3A6CH 3MLZL 1IM3A 4ZUVB 1EGJH 1TJGH 2VISB 3D39A 5LWYL 5C2BH 1DQQB 2IMMA 4HAGA 2C4FU 4K3EH 5DD5L 4JPWH 35C8H 4YHOL 5IB5B 4OZGB 4Z5RA 5KSAC 1IGIH 1HXYB 2X7LB 4LVNB 3RX5A 1J1OH 4XMPL 2OR7A 4WIQA 4BZ2H 3UTSD 5L6YH 1OCWL 4OLXL 4WHTB 2I25N 3PWPA 4QRUA 3V4PH 1FFOA 4JFFA 4KMQA 2H6PA 2W65A 4HWZA 5IWLA 2F8XC 3OAUH 4LCCC 4GRWE 1GAFL 2APFA 3UBXA 4DVRL 1INDL 4B50A 4OGZA 1ADQA 5C0DA 4KJQC 3HUJF 5IBUB 1IC7H 3ARFD 4Y2OA 4K55A 1VFBA 4ZNEA 3R0NA 3REWA 2Y1VA 2F5BH 3CDGB 4ZNCD 1J1PH 3SJVE 1UM6H 2AI0H 1G7HA 3QCTH 3QNZA 4WUUB 4X80L 2Z93B 1LHZA 2Z92A 4KY1H 2AEPH 5F6IB 2W0LA 3L3DA 3V6ZA 2AV1B 1XGRA 5HYJA 1JN6A 3MRCB 1CL7L 4FXLA 4OLVL 4M00A 5IVOA 1QSEB 5GXBB 1RZFH 3HUJA 3WCYA 2OTPA 5FXCH 4KGLA 1T0MA 3IDJA 3AGVA 1WZ1H 4CKVX 3H3KA 3IXAA 4XPFH 5DEZA 4H88L 2XPGB 1QVOA 1QSED 1FJ1B 1S9KC 2EKJA 4I5BA 4J7RA 3BVNA 3C2AL 1I8LC 4KVNH 2FBJH 3ARBB 3U2SA 2W0KA 3QAZC 5D1XB 4DN3L 3MBEB 3OGCA 5DRNA 5JHLL 1JHLH 2AJYH 5AEAA 4GRLD 4LPVA 1I3GH 1N0LA 3MV7D 1KELL 3PGDA 5I15H 5B3NA 4XNUH 4FQIH 3PHOA 2R0KH 5D1XD 3MBED 2D7TH 5E03A 1RSFA 5DEFA 5FYKU 2VLKB 2R9HC 3GSUA 5TQ2H 4PUBL 2ICWI 4XP4L 1RULL 3SCMA 5HHOD 1EO5A 1KG0B 3P73A 2I9LA 3CVHA 2GTWB 2IPTL 3PWVB 2QHRL 2FGWL 2FB4H 5IQ9A 3ARFC 3B8SA 4ZO8A 4HMCA 2DKUA 4Q0XL 4X6DF 4Y5VC 4YGVA 3ZTNL 4D0CB 4WFEE 1MHEA 5BZWA 4E41A 4M7LH 4G7VH 2VSDA 5K9JH 1DLFL 4CN1A 2E6JA 3SDCA 4P23A 3BKMH 1QLEH 3KPLB 4QRRB 3PJSB 5LJYH 3STZA 4ERSL 3N0PB 3PGFH 1A6AB 3BEVB 4HUUB 3WE6B 1KPVB 5JXEA 5C8JB 3HC0A 5E95B 1E27B 4TOYH 1UCBL 3BP6B 1QEWA 3MRQB 2IC2A 4P3DB 3OHXB 4X6DA 1XGYL 2AQ2A 2FH8A 5J89A 4U1NB 2V5YA 1U92A 3P30H 3LEVH 5BV7B 3U4BL 4FFWD 5AAWA 1CIDA 1KJVB 3TNMB 1PZ5A 3BKYL 4HWBH 3FONA 1MREH 5ESAB 3DVNB 3SO5A 5D1ZD 4UTBH 1IEBA 1AD0A 1M4KA 1IM9D 2GJ6E 2IG2L 4GRLC 5EBMA 1SMOA 3SEPA 4ORGA 4JAMA 3ARBC 4QRQA 3DX9B 4LLWB 1J0JA 4JFYA 3I3DA 5D1XC 3MBEC 3U9PL 3WFBH 1UXWB 4HIHA 4R7NA 3QDJD 1OY3B 1WAAA 3ZSTA 2WBJB 2DIJA 4X5XB 2JTDA 3QUYA 1FZMB 1GGBH 4LLDB 3OKYA 4HXBH 3LHPH 1KJMA 4YLQT 3MTRA 4H25A 3CAFA 1EJOL 2C3HA 3I9GL 3U0TA 2E7CA 2NY6D 4LF3B 3RY6A 1M71B 3HNVH 1NEZG 4XNQA 1R3KA 4AT6A 5AD0B 5GHWH 5TFSL 4TSBL 1MHPH 3SGJA 1CXKA 3VMNA 2DRUA 2P48B 2XTJE 4N9GA 1RJCA 5FUZL 4UV7H 1S9VA 1OTUD 2DL9A 2PW1B 1YEEL 3GHBL 3MGAA 3KVQA 4D9RD 3QUXB 3QO1B 1JNLH 3UYPA 4EDWL 1WBZA 5HSFA 2HRPL 3JTTA 2NX5E 5E24E 5E94A 4ZODA 5HYSA 1G6RB 1CCZA 3OF6A 1P7QA 1U8JA 1VGEL 4OF3A 2D2OA 2NY5L 4HDIB 4O4YH 4X7EC 4WI5A 3FO2B 3BDYH 4JRYB 1J0YA 1JGDB 1I4FB 1T22B 4JJHA 3WDJA 4FFWC 2L7UA 5DJYB 3TO4D 1VEOA 5TGBB 5DJDB 1UM4H 2ITDA 1HSAB 4WWKB 4NCC2 4MHHG 4JKPL 3OKOB 5D1ZC 5D5ME 5BOZG 2Y5TB 3PXJA 3IKCA 2UY6A 4EI6A 4IMLB 1MHHA 5KVDH 5MEPB 5JDJA 2A73B 4XAKE 1II4E 2X89A 4WWKD 4U3HA 1WISA 4Z7OF 4YWGH 1U41A 1F45A 2KKQA 1P5UA 4LMQE 5I8KL 3RWHB 5FA4B 1D5XA 1R5VB 3DROA 2R0LH 4OF8A 2ZSVA 1AR2A 3MCG1 3NABH 1XT5A 2YMXH 4OLUL 4HPOL 2H8PA 3UTQA 2FH6A 2BNUB 2R29L 4KZDL 1C12B 4NFCA 1HCVA 2RFXB 1OGTB 2NY6C 3AS3A 5L2KE 1FO0H 3TNNA 3ZHKA 5A43C 1P1ZB 3ZKQD 4S2SA 3IU4H 3CU7A 3IJHB 5HGHA 5FYLH 4DAGH 4ONFL 2M8XA 4PJ8A 4ZAKB 2VLMD 1JYXA 3UMTA 5E1AA 1INQA 1IQDB 5ADOL 5KVFL 4MDIA 3GSRA 4GBXD 5F3HA 5EN2B 3HZKB 3GRWL 2G75A 1EHAA 1D5BB 1OTUC 3OX8A 1BWWA 4ZAKD 1JNNH 2DMKA 5F1NA 1GGCL 2ATPA 3FO1A 3VFNB 5BQ7A 3G9VA 3CPLB 4UIMB 1OAQH 3CXDH 3OKEA 5F96L 4F57L 3MNVB 4JJ5A 4OZHB 5D7JA 1V7NH 4MAYB 4YHYC 1QFWL 4XCFL 1IGTB 5IFHH 3SKNB 3QA3B 2ICWB 5FO8B 4WVRA 3A6BH 3JSSA 2X4RB 4XX1E 3TO4C 3OJDA 1A6VH 2AW2A 1AP2A 3MXVL 5E2UL 4QF1A 1NCWH 1I8IA 2CK2A 4K2UH 1EGJA 1RJYB 4ZFFA 2HWZL 4OJFL 5TE4L 1OPGL 4MNQE 1XEDA 3ROOB 4J4PD 5EBWA 1J8HB 3F12A 4LU5L 4WWKC 1NAKH 5CHNB 1OAUL 4WO4B 4YHPA 4ZSOA 3SE3C 1HQRA 1QFUL 3GHEH 3VFMA 2ED9A 4DUXA 1G7LB 5I8EB 3WJLA 4KAQH 5H94B 3P2TA 5FHBH 2DICA 1RAMA 1MY5A 2P24B 4DOHB 3IFLL 4UT7L 5JW4R 1NLDL 3CFCH 2P47B 3BAEL 1X5HA 1NCBL 1KTRL 3T65B 2UVFA 3V4UH 5KSBE 3ZTJH 4YXLL 5GGRA 2VDOH 4UV4L 4LCWE 4R4FL 5F1IB 1S9YA 3ALXA 1FAIL 4MS8D 1I9RL 4U6XA 3LPWA 1AH1A 5EU7E 3U46A 1P9MC 4GBXC 1KFAH 3EOTH 1TMCB 5DA4A 3UTTE 2CO6B 5CJOH 1J8KA 2PTUA 2XICA 1MELA 5SWZB 5MENB 4ZAKC 3B83A 1MWAB 4RCAA 2GITB 2XIDA 1UVQB 3RI5F 4U0QB 2B0SL 3T09A 5J9PB 2AJVH 5CP3A 3LIZL 5C71A 5TF1L 1X7QB 1KC5L 5HDOA 5KS9F 2FZ3B 3KPOB 4U1MA 2ZOLA 4LKCA 5DUBA 1A7PL 3NGBC 4WI9A 3LVEA 4OZGE 4XPBL 1DBKL 4QTIL 1DUZB 1N2RA 2LU4A 3A6OA 4MAYC 4Y16B 5DVLA 5C6PB 1AE6L 3QWRA 5I6XC 4MX7A 1WEJL 3CZFB 3N1GC 2XG4A 4J4PC 4PRID 2EE2A 3OAZH 1G7JA 5KS9A 3HN3A 4BKLB 3FQUA 3NH7L 1SYVB 2O5ZL 1K4DA 3KAAA 4MCZA 3KJ6H 4MWFA 3ULVL 1T2JA 4JRXB 3QIBB 1UZ6E 4PRBB 4MA3A 1DLHB 1RIUL 1U42A 4EEEA 5I66A 1BHGA 3BIKB 4KPHL 4WUUE 2NW3A 3N06B 4Z6AT 4M9PA 1HDMA 1XF2B 2OMBA 2YN3A 5SWQA 1A14H 2I26N 2ID5A 3MRDB 2WWKO 4Z7WA 4MS8C 3SKMA 4M02A 1QSEE 4YHZH 1T7ZA 3WFHB 1HQ4A 1QFPA 4PJXB 5EZLB 5GS1C 2FO4B 2J6EA 5J11C 2OQJA 3CCHA 4C59B 2Y06H 4R0LB 3SE9L 4NQTA 4X9HA 4NM8L 3UX9B 1ITCA 1HHHB 1ODAA 4N90E 1F11B 3LKOA 3WNNA 4HV8A 1RZKL 4LDLB 3T4YA 3ISWA 5MP6H 4AM0B 3HS0B 5SX5K 2A6KA 2AEQH 2I5YL 3AREB 1NCNA 1IT9H 1OAYH 2W59A 3BKJL 3FB8A 4PRAB 4U1LB 2XZAH 1BVLA 2R4RL 4FS0A 5L9DL 1TTFA 2W60B 1I3RB 1J0KA 3HG1A 5GIRA 2VLKE 4Z78A 1J0HA 3ARED 3H7LA 5E2TH 4JO3L 2I60L 4Y16C 3K8MA 4HEME 1A6WH 5ERWB 4OD2B 3N9GL 5DRWA 3U36A 4PJEF 4X8JB 1BQUA 5I1EH 1I7UA 5KSUB 1MF2L 4HKJB 3UYOD 4XRCA 1NC2A 1DDHA 4Y4FA 3HE7D 1SBSL 3QHZH 3ET9F 4ZPTB 5ABDE 3J7HA 1JK8B 4PJIB 3QG6B 1I9IL 2VLJB 4F7TB 3DURB 4IOFD 1KGCE 3D69A 2DMBA 4YPGA 3EIFA 4QRRE 3T04D 1YJDH 4XT1C 3MNWA 1M7IB 4LLQB 1N5AB 3W39B 3MFFB 3O0RL 1Q94A 1ZVSA 2DBLH 4X7CC 4XMKH 4HT1L 1EAPB 3SJVA 5HGDB 5I76A 4J3SA 5IESL 4BM7A 1A02N 4NPYA 2CPCA 2WINB 4MLIA 3IYLW 3K46A 5EH1A 2DJUA 12E8L 4KU1A 2H3NB 3S7GA 1F4AA 4YPJA 2FJFA 1MJUL 4Z76B 1CLZL 1RZ8B 2EO1A 2P8PB 3UC0H 4W4OA 4CAGA 1SEQH 4G3YL 1P6AB 5F89A 1BQLL 1ZEAH 2AEIT 4EJ1C 4JKLA 5ACZA 3HR5A 1BQHA 2J8OA 4FTVB 4R0LC 3OKKB 3QEHB 1AGCB 2BNQD 4LFHD 3GMRA 1A7QL 1Q1JH 4NRYB 2GJZB 3CZJA 3MREA 3S37L 4QHUA 3UJIH 5L7XH 3QIWB 4MD4B 5E00A 1NLBH 3I6KA 3JXAA 3P9MA 1G0XA 3AREC 4POZD 1M05A 4XP1L 4LAQL 4KJYB 2H45A 4HBCH 4HIXH 2H26B 3QIWD 1E6OH 1WCBA 2UWEB 2ZSWB 3TPUB 3L3GA 4BSVB 3HE7C 3BJ91 1YN6B 2FATL 4PP1D 2XACC 4XXDB 4N8VG 5K9OA 2X4OA 25C8L 1K2DB 5LCVL 5CMAB 3VXRB 3EYOA 4IOFC 1CLOH 3MO1B 1Q8MA 1IZKA 4HJGA 4D9RE 4XVTL 4JFHD 4YHMH 8FABB 1FL5B 2HJFB 3AM8C 4XBPB 3B9VA 1LE9A 5HYEA 3MJ7B 4UQ3A 2HFEA 3OXRA 3MRKA 2WP3T 3TPKA 3VXOB 3ZMRA 1CU4H 1FRGH 3K3QA 4RQQA 3U0WH 1XGQA 4JFZH 4OUUB 1NQBA 3S4SB 1UFUA 5GSRB 4RGND 5DD3H 1FIGH 2Q87A 3TJHC 4DKEL 2JELH 4U6HB 3ARGA 4JFEB 4JPKL 4R4ND 4G8GD 4U1IB 5BVJA 5HYIA 4F8TA 1RZ7H 4JRYE 1GYAA 4HKXB 4PV8B 3HMWL 4LP4A 2PW2A 4XC3H 2GYSA 4JFED 1ZHBA 5ID0B 2FIKB 3S8WA 1LDPL 1T04A 4XZUB 1YPZB 4LKXA 1RUAH 2NY2B 5JUEH 2ERJC 1VHPA 3ARYA 1PYWB 3U6RA 4HK3N 3NFPB 4H1LH 1MIEL 2R2BA 5A16B 1WC7B 1Z5LB 3L7FA 3KJ4B 2GJ6A 2WZPD 5C2UB 4POZC 1XAUA 3KLDA 1ACYH 2NY2D 3HCVA 4HH8A 3GSQA 3QIWC 4P9HL 2QTEA 5FDWA 2EICA 1OGAD 1P53A 3HI5H 3T3MF 5IROA 2E3VA 3HNSH 4X4YB 2VWEC 4PP1C 4WI8A 2A9NH 4PJ5B 5MERA 1HHJB 3VD9A 3O3UN 1KT2A 1D6EA 1LK3L 3DO7A 1DUYA 4P3CH 1I8MA 3MLUL 1FFNB 1IC4H 4NO0A 1AQKL 4XP5L 1R5WA 3EYSL 4ETQA 4PJ5D 4Q6YA 3HI6L 5DHYA 2C1PA 4JN2B 5TH2A 4NO3A 1JHTB 5IEHA 1W0WA 2GCYA 2HYMA 4P9ML 3V0AC 1U95B 4HS8L 4JDZA 4RGNC 4OZHE 4C54A 3HAEB 1U36A 1SJHA 1T3FA 3VI3E 2HFFB 2CDEB 1XR8B 4R4NC 2NW2A 2R23A 1PDKA 4FFZH 1QQDB 1EA9C 2W9EL 4HCRL 2YD3A 4YXKL 1H3XA 4NSKB 3GBNL 4FABL 5F70A 3QCUH 2DQIH 3T1WA 3UP1A 5GJSH 1INEL 2DB8A 5E6IA 1JGVL 1T2QH 5T3ZD 5HVHC 4MJ5B 4X6BA 5DHVH 2X09A 1J8HE 3G08A 5JNYB 3MODL 1LP9F 4OFKA 3L3OA 2XN9D 3ZO0A 2MHAB 5SWSB 2F5AL 3G6DL 5D5MA 1KF9B 4BQ8A 3H42L 3RWJB 1IMHC 3ULUD 1T1ZB 5J6HB 5CJXC 5GGTL 4QY8B 1NANI 4HLZH 5AZ2H 5CIPB 1ZHLB 4DOHE 1J05B 2NY2C 4I1NB 3HB3D 4OV6F 2PXYA 1F4WL 3KJ4C 3MGOB 1I7RB 2B5IB 5GJTH 3VXQB 4F33A 8CGTA 4HH9B 3BI9X 3SE4C 4MJ6A 2P8MA 4Z7QE 4PGJA 3NMEA 5EB9A 4BFGA 3QQNA 5ESVB 4AYFA 4D0BA 3GMOB 1T7VA 1ETZB 2V9QA 1B6UA 1XZ0A 1S9WA 3IFPB 2IANB 3DX7B 3C60A 5C07B 3GSNL 3VU2A 5SWZE 4OKVA 5MENE 5F1OB 2DLFH 1K5NA 2JB6B 5I9QC 4HIJB 4MQ7A 4M6OH 4TRPL 2NCMA 3O6MH 4PB0H 5HHVL 4BH7A 1NAMA 3I02B 4HC1H 1JPGA 1AD9B 4B53A 2D9QB 5D70H 1Q38A 1DQDL 1NBYA 2YS4A 4FQJH 4WHYG 1NMAH 4OQTL 5IMOB 5EULV 5J6GB 4QHLB 5DSCA 4I0PD 4OCSH 3BQUA 2VR5A 3P4LA 4MD5B 1PKQB 1BD2A 3HI1B 3WIIH 3BKCL 2QR0A 2FECL 3MLZH 2XWJB 1P6FA 4HGWB 3TLRA 3GI8L 3BRFA 4MNQA 3ULUC 2BMKA 4HX1B 1CDIA 2F19H 1XH3A 3O6FB 4JRXE 4N8CL 1VEMA 5HGBB 3HB3C 1M7XA 1KLGA 4K8RD 5I1KL 4M5YL 3RHWK 4UDUB 3O6FD 4YHOH 3LS4L 3OXSB 4WI7A 5TDNB 5EZJA 4E9LA 1VKXB 3BP5B 1ZSDA 4M6ML 4LPWA 1A4KB 1F58L 4X0KB 4N0CD 4YAQA 4PIRF 4EDXB 1WT5C 1OCWH 3U30C 2B5IC 4J3XA 4PJXE 4NQCB 5CUSH 1CFNB 1IGJA 1NGQL 3PWJB 3EFDH 4LCWA 3GSOB 5DFTA 4JPVH 4PTUB 3ZZ1A 4DVRH 1INDH 2AV7A 4RAVA 3DI3B 1LO5B 3F6LA 3MUHL 43CAA 3TBSA 1H5BA 2X4QB 1ZGLA 1L7TL 5EC2B 3G6AA 1FVDB 3UTTA 3VFSB 5CZVL 1XF4B 2VDQL 5E5UB 4P59L 1JL8A 4J1UB 4U3CA 3SDYL 3BEWB 1DQQA 4PRNB 4P2RD 3CFKA 4KRMB 5C0CB 5DK2B 2H32H 4N1HB 3WL9B 3JV4B 4LBEA 3P0GB 5F88B 1CL7H 5CEZD 4OAWA 2A83A 4I0PC 4OLVH 3LDBB 4OFVA 4NIKB 2UV3A 3C5SB 4NM4L 4OCYH 1HXYA 2X7LA 3ZKXB 2Z31B 3U1SH 4MD0B 3FQTB 3DV4B 2DD8H 4H88H 4QXWA 4RWYL 4WHTA 5HYSG 1IL1B 2R2CA 2BC4B 1FZJB 3C2AH 4Y1AD 4PJIE 4S11A 1AC0A 3GMMB 2VLJE 4BQCA 5T5FL 3MYJB 1LD9A 4DN3H 3M1BB 4K8RC 3O6FC 3VRLF 4GW4B 1KELH 1WIUA 4I8DA 1W0VA 4NNYB 4JGUA 3V0VB 2Z93A 2CIKB 4KRPD 3W9DB 1MFCL 4LIQL 1E4XL 2AV1A 3GMLA 1TJIH 4P2QB 3MRCA 1BBJA 4PUBH 1N64L 3C6LB 1RULH 4C56A 5JW3L 1DBBL 2IPTH 4MA7L 3MRPB 3C9NA 4GXUM 1GH7A 1RQ5A 3C6LD 3ZTNH 2EH7L 3FQXB 2ED7A 2XPGA 4FTVE 3T2OA 1FJ1A 1QSFB 3G6JB 3LQAL 2CGRL 4X6FB 3ARBA 5ICZB 4YE4L 4ERSH 3QFDB 4ODVH 1BM3L 1IZJA 5I1HL 1IARB 1URLA 4Y0GA 4NQED 4MA8L 3O4OB 4RMVA 5EO1B 1FNEB 1R3HA 4Z7UB 5DQDL 5IMLB 1T0NB 2ZUUA 4Q7DA 2UWEE 2ADFL 2VLKA 1EEZB 3LDBC 3FMGH 2A6DB 3PUCA 3LN4B 1B0RB 3U4BH 1NDMB 1NBZB 3ZKXC 2Z31C 5DGRA 3O9WB 4MA1B 1KG0A 2AXGB 4LVHB 5HDBE 3VXRE 1VESA 3WFDL 5I1IH 4MAUL 5C0FB 1VENA 4L3ED 4BJLA 3BISA 3EHBD 3D18A 5E8DL 4NRXB 5DD0L 2JJTC 1UEYA 3O9WD 3UPAA 1YNKH 4ODXB 3HFMH 3V6OC 2EDFA 2OJZH 1BIHA 4OCRL 1RK0B 3CH1B 1A0QL 4XBEH 3BGAA 3KPLA 1CLYL 4QRRA 1GVIA 3MRJA 4G8EA 1D5IL 3MCLH 1DANU 1A6AA 1T4KB 4PD4K 5J7CC 3BEVA 4HUUA 3WE6A 5CGYD 4ELKB 2HT2C 3QDHA 4JFEE 1BLNB 1AO7B 2YRPA 1F2QA 1TTGA 1E27A 1EJOH 3CXHJ 4EI5D 3VXMA 3LN9A 4F3FB 4X9IA 4QYOB 3BP6A 4P3DA 3OHXA 2OL3L 3NFSL 3C6LC 4LLUB 4DTGL 4LRNL 4WEMB 4U1NA 2EDTA 2C9AA 2YRZA 4HG4K 5IFJA 3W81A 1RUQL 2HN7A 3FT2A 2OZ4L 4QOKB 5BRZA 3TNMA 1YPZE 2R0WH 5DMKA 5ESAA 3DVNA 4IOSD 5EOCH 5GS0H 1SVCP 1JF5A 1EERB 4L9LB 2MTPA 3RDTD 1YEEH 3GHBH 4X8XA 4KUCD 3SPVB 2FYYA 4ZFGL 4F7MA 5F1SA 5IEKA 3MJ8B 1HZHH 3WHE0 3X17A 1J18A 3DX9A 5IMKB 5E9DA 4NNXB 4MHHI 1UXWA 5J8OA 3D3VA 1VGEH 3WXVL 2WBJA 3ROLB 1UJ3A 4PLKC 4X5XA 3SDXF 4D3CL 4L8BB 2ADJB 4LLDA 4PJ5E 4QXUH 5DWUL 3FTGB 3THML 3GMNB 3EHBC 3OV6A 1AR1D 3O9WC 4MA1C 1OWWA 2ICEB 4HHAB 1G0DA 4KKBD 4OTXL 1M71A 2BY1A 4IHOA 3ARQA 1T80A 1J5OH 1F90L 3BE1L 2BNRD 5MI0C 1G9NC 3D6GA 2VAJA 2PW1A 5IW1B 5CGYC 4JY5H 3QUXA 3QO1A 2RQ8A 3L5WB 3FT4B 4OLUH 4EI5C 1MAKA 4NHCL 4U6VL 2R29H 5D6CB 4KZDH 2BRRL 4NKIL 2IBZX 3SBWC 4HDIA 2CO7B 3FO2A 4ODTL 4U0RB 3QJHB 2ZPKL 4JRYA 5ISZB 5ECJE 1JGDA 1I4FA 1T22A 4I9WE 4IJ3B 4FXKB 5DJYA 3O3AB 5ADOH 3CH8A 5DJDA 4AL8H 1KCKA 1BFVL 1GC1H 2AJ3B 5KJRL 2CQVA 3H6JA 5ETUB 5SWSE 3RDTC 5T5NF 5ISZD 2Y5TA 1G0YR 5I1LA 3BZ4B 4MJIB 2NZ9D 1GGCH 3OKLA 1MI5B 2LTQB 2VUYA 5MEPA 4NBXB 1XF5B 4EQ3A 4F57H 5F96H 1YEIL 1F3DH 5GZOD 4L9LC 1QFWH 2DQFB 3RY5A 3GI9H 5DTFB 3T0EB 1EJ6A 4P4KB 1SM3L 3VXSA 5E2JA 5LGHH 3F65A 3D0VB 2CDGB 2CLZA 4UT6H 4PLJD 3E8UL 3QWOB 5KZCB 3MXVH 4E0RA 2BNUA 1XFPA 3IFNH 2RFXA 4XMLH 3K1DA 1QYGH 4GSDH 2ZJSL 1OPGH 1MCFA 1AR1C 1P1ZA 2ZG1A 2IANE 3IRZA 1HSBB 1VB9A 2R0ZL 3IJHA 4KKBC 5C07E 3BUYB 5IHLB 4A6YL 1BBDL 5IV2A 4BK5A 1CGSH 1QFUH 5EU4B 4NHUA 4JZNB 2IQ9L 1OVZA 2FX7L 5EN2A 1RJLB 1U8OB 4ISVB 2FO1A 3JWOL 1D5BA 2CKBH 3JWDL 4L3CA 3IFLH 4UT7H 3GJFB 1NLDH 3BAEH 2W38A 2EDRA 2EO9A 5EC1B 1NCBH 3VFNA 1A3RL 1JRHI 4UIMA 1HK6A 1CDHA 1KCUL 3MNVA 3H9SB 5ICXB 4YXLH 3U4EB 3VWJA 3SKNA 1ONQB 2ICWA 1R3LA 4R4FH 5EU3B 1LO3L 2X4RA 1FAIH 1I9RH 4IRSD 3NN8B 3ZE1E 3FO9A 3H9SD 1PKQE 1MNUH 2MPAH 1LK2B 5FYJD 4PGDA 3AU1A 2FX9L 2E9JA 4M7LT 1RJYA 3OKMB 3TZVA 5EUKA 2ADIB 3DOSA 4IJ3C 1FVEB 1IAKA 4J6RH 3ROOA 3FN3A 2NZ9C 5C7XH 1J8HA 2B0SH 3TIDA 5JPNB 2F54D 3LIZH 4WO4A 4DKFL 5FV2A 2H32A 1N6UA 1A7NL 3MLWL 1KC5H 5JQ6L 4I3SH 5GZOC 1L7IH 4JCLA 5C6WH 4HS3B 4JY4B 1QUNA 5I8EA 4O2EB 5H94A 2LTQC 2HKHH 3BGFC 5DRXB 5LG1A 1A7PH 4I2XB 2XA8L 2P24A 3G5YB 1DBKH 5B22A 2V5MA 4PLJC 3QBTB 1A7BA 5FUOL 1TJHH 1XCQB 4U2YA 1DQLL 4PJ9B 3HLAB 1CDUA 4HS6B 5C0RL 1LO0L 5EDXA 3T65A 5ALBH 4APQB 4DK6A 5IVNA 3K8LA 1WEJH 1NDGA 2JIXB 2ZUSA 4NQCE 1WICA 4NO5A 4GG8B 4TUKL 1EO8L 5F1IA 2VN4A 4CVZB 1C5BL 3KPQA 4KFZC 1MPAH 4TN9A 4APQD 2WV3A 1SEBB 3ULVH 1KSRA 3SE8L 4POYA 3KR3L 5SWZA 5MENA 1F3JB 3FHQA 5CEZE 1RIUH 1UYWH 1Z9SA 4YFEA 5DD1H 1UVQA 3RIFK 5DVMA 5J9PA 4KPHH 4FQXD 5DS8B 4S1RL 5JZ7D 2H9GB 3S5LA 3N50A 2IPUG 3WNOA 4K9EH 2YD1A 1U2CA 5CEYA 3DGGB 4UIKL 4F9LC 4KK5D 2QSCL 4PJGB 1MQKL 3AMKA 3O4LB 4IRSC 3ZYOA 4Y16A 1DUZA 4KV5F 1ZT7A 2PYED 4OB5H 3DX6B 1ZHKB 3SKJL 3CZFA 5GGSB 3SE9H 3HZMB 5K9KB 2AK1H 4NM8H 4TTDD 3MUJA 5EBLB 4BKLA 4NKMB 1RZKH 3MGTB 1SYVA 2HLAA 3V6OE 1HH6A 2P44B 3MV8B 4IDJL 1Q0XH 4Q9QL 1JWMB 3WFZA 4JRXA 3QIBA 2I5YH 5MHSD 1DJSA 3BKJH 3SKOB 1S78D 5DR5H 3BIKA 2CLVB 2R4RH 5L9DH 4XBGB 4Z0XA 3TBTB 4AQOA 3ARSA 3OSKA 1HYRC 2EDQA 4JFDB 4JO3H 4P2QE 5GS3A 3ORJA 2P5EB 4EN3D 2I60H 1XF2A 4I77H 2X4TB 1J1XL 2ZKHL 4FQLL 4PJ9C 4BFBD 1T1XB 2DYPB 3ARRA 1F42A 2QQNL 3BD3A 4APQC 1HHGB 1MF2H 4PJXA 5EZLA 3ZT7A 4C57C 2FO4A 3MACL 4NOBA 5AWNL 4ZPVB 3P77B 1TPXB 1SBSH 1U91B 5DURD 3SY0A 2AK4B 1I9IH 1C5CL 3B9DA 1QSFE 1T1WB 3GB7B 1HHHA 3G6JE 4FQXC 4L5FH 4NZRL 5JZ7C 1YEHL 5ITBL 4HFUL 5C0AB 2LU7A 3O0RH 4OLWL 5IKCB 4AM0A 4HT1H 4IEFB 4Z7NF 4NC1C 4KK5C 3WFEL 4LSRL 2YSSA 1H15A 4UU9B 5IESH 3PQYB 5J1SC 3TWCL 3CFEB 2YR3A 5HDLA 3MLPA 3ME0A 5C0AD 1WVZA 4PRAA 4U1LA 4Z7UE 4F8QA 3S88H 1BZQK 3WIHL 1I3RA 5EU5B 2X5PA 2Q1EA 2CIIB 4HLJA 4M43L 5GRUH 3PQYD 3O8XA 4TTDC 4ZMAT 1YMMD 4G3YH 1EUTA 5D2LF 1BQLH 4OD2A 1AHWC 1DBAH 2R2EB 1FVCB 3JZ7A 4PY8J 4XCNA 4PBWD 5KSUA 4HKJA 2EE9A 3T77A 1S7VB 1JZ5A 5DK3A 5HPOA 4ELMB 1XF3B 2DDQH 1JK8A 5DJ0B 3S37H 3QG6A 1YY9D 2YZ1A 3BW9B 3DV6B 2VLJA 4ZD3H 3DURA 1S78C 5KVGL 2Y07L 4NFBA 1ORQA 4D8PA 1M7IA 4LLQA 1N5AA 4NC0B 3W39A 3MFFA 1K8IB 3O6KH 1UWXK 4XP1H 4EN3C 4KI5D 5HGDA 3RL1B 5E8PB 3QHFL 3ZYZA 1IGYB 4ZO9A 1G9MC 5IGXL 4O58L 1AO7E 4QWWD 1KN2L 4NWTL 5E08H 2APWA 2AEWA 4L1DA 2I9TB 2P45B 1CTNA 1KTDA 1YEKL 3S34H 1D5MB 3CGTA 1SBBA 3QPXH 4J3WA 1ULVA 4WI3A 4YHLL 4HUVA 1RZ8A 5CKAA 1ROWA 3I75B 4XVTH 4OUOA 4QOKE 3ZE0E 1EFXD 3W0WB 5T3ZL 4WV1B 2W91A 5ACLA 3MBXL 4CNIB 4FTVA 3OKKA 3QEHA 5C08B 1AGCA 3STBA 2HFTA 1I1RA 2GJZA 2W9LA 1OB1B 2IJ0C 2P43B 2A74B 1N6QL 4TVPL 2H1PL 4XPTL 1J7VR 3ES6B 1NBQA 5C08D 1L6XA 5B8CB 4F15C 1U58A 4GQPH 3QQ3B 4PBVC 3L3IB 4JPKH 4XNMB 4Z77A 4HUKB 4HJJH 1YN7B 3RTQB 3RZCD 1KNOA 2XWTB 2UWEA 3TPUA 4GMSL 4PP2B 3D85D 3GRWA 2CSPA 1RIVL 5DMYA 4BSVA 1G7MB 4ONHA 1YN6A 3DPBA 5DGQA 2CUMA 4JVWA 1K2DA 1D6VL 1YY9C 5CMAA 4PY8I 4YNYB 3VXRA 3QFJD 3MO1A 4JFOB 2V7HB 3EW3B 1MCRA 2NY4B 5IOPB 1MIEH 2BY0A 8FABA 5IK3A 4CDGC 1PQZA 4JB9L 3WV0A 1FL5A 4XWOD 1RUPL 3GO1L 4KI5C 2DQEL 2EC8A 2JK5B 4WNQB 2YBRB 4MCYB 2R15A 3MJ7A 3C5JB 1MCBA 3VXOA 3CMOH 4QWWC 4Y5YA 2XZZA 2IF7A 3W5MA 4OUUA 3FB5B 1DBMH 1ZK9A 3S4SA 5GSRA 2WQ8A 5GPRA 4AH2B 4GAJL 1TDQA 4JM2F 4U6HA 1FYTD 4G7YH 4S1SL 4U1IA 4LCYA 5ISZE 5BS0B 4HKXA 1LK3H 4PV8A 1V3JA 4K3DL 2C26A 3UBXI 2EDYA 4L4JA 4L3AA 4L9DA 3MLUH 4XP5H 1CFBA 4DW2L 4H0GA 4RDQG 3HI6H 3HC3H 2ZUYA 4XCCL 1VEPA 2EDWA 3KLAB 4MJIE 5ID0A 2FIKA 4Y5XC 1MI5E 5DC4B 1T7YA 1YPZA 4HF5L 2JCCF 4P9MH 3VCLB 4JM2A 1RK1B 1PYWA 1IFHL 1OAXH 1HKLL 3T0EE 3SQBA 1C08B 1Z5LA 3L9RB 4PJBF 2W9EH 4HCRH 2YK1H 4YXKH 3RZCC 5L88L 1NFDB 4RWHA 4M61A 1H8NA 4TVSa 1AKJB 2IALB 1EVTC 1INEH 3MRLB 4X4YA 5BXFA 3D0LB 2DBJA 3RTQC 1HHJA 5IHBA 3F7VB 3VFWA 1B88A 1EO7A 2C5DC 3Q1SL 4L4VB 1MJ7L 2F5AH 5EO9A 3BH9B 1FFNA 5B39B 1A21A 5IP4A 2GTZB 4L8DA 4KWUA 5GGTH 3ULVF 3MA7B 4JVUA 2ZCLH 1OARL 4NKOB 5JA8B 3DUHA 4L4VD 2NY4C 4JN2A 3Q3GB 1U95A 3WJJA 3H9SE 3HAEA 4TUOB 1P7KB 5TDPA 2HFFA 2QSQA 1T21B 3T0XA 3JVGC 2JJSA 4RMRA 1U8LA 1QQDA 3RBGA 1GL4B 4XPHL 2R2HB 4NUGL 5DUPH 3WNLA 4X6CB 3JTSA 3QDGB 3FL7A 3BJLA 1LE5A 5DJCB 1FNSL 3CSPA 5HHXL 1MLBA 4QT5B 4O02L 3R8BB 1WFTA 3GSNH 3TFKD 4MJ5A 1TCRB 1QACA 3LPGA 3QDGD 5BW7C 1EEYB 3T08A 2MHAA 5HHVH 1FLRL 4PRHB 5SWSA 2X9XA 2PF6A 2QEJA 3MV11 4OCMC 3ZDZE 5CJ5A 4N0YL 3WS6A 5FA3B 3MRFB 4PJCB 5CIPA 4I2XE 1DQDH 2OR9L 1ZHLA 4RMTA 5EZIH 1J05A 5I30L 5C9JB 4KKNA 2KBGA 2CRMA 3AROA 5FF6B 4KHXH 3QISA 4NFDA 3UYRL 4YQXL 1W72H 1NL0L 4UQ2B 1I7RA 1TXKA 4G6FB 3MJ9H 4HH9A 4C4KO 1FNLA 1U6AH 2BXZA 4JM4L 3QQ4B 3C09C 5C0GB 2YHGA 4JVPA 2DLHA 5D6DC 5CCKH 3MUY1 3GI8H 4BELD 1X5YA 2IANA 3DX7A 2A1WH 5C07A 2XA3A 4Y4HB 4U1JA 3WUZA 3HMXL 1Y6NR 4UNVA 3PHSA 2ZUXA 5L6YL 2JB6A 1GHFH 5I8CB 4KVCL 4MDJB 4HIJA 2GFBB 3VGDA 2G5BB 3E0GA 4M5YH 3K7UA 1T2XA 2DQUH 2Y6SD 3RJQB 3X14B 4R97C 5AG8A 3DRTB 4RZCB 1NGPL 3GKZA 4H1LG 3LCYA 1JGUL 3S37X 1J0ZA 1AD9A 1F6AB 4J12A 4DGIH 5CFHA 4PJGE 1KEML 4WU7B 1JMZA 3O4LE 1Z6JT 5F8QC 3H8NA 4X9FA 1KJ2H 5DZLA 5IMOA 1IM3B 1KCRH 5GRZA 3D39B 5J6GA 1Z3GL 4QHLA 3TVMD 2W9DH 3TFKC 4PS4H 4C83B 4P2OD 4NT6B 4JO4L 1JPTL 2XRAH 3HI1A 3NA9H 5MHSE 4PJHB 3D39D 1FHGA 1H0DA 3FQNA 3P9LB 5EOTB 3MV8E 2VDQH 4NDMB 3G5XA 1Z9MA 2XTLA 1I1CA 4HX1A 1PW3A 1R0AH 2BERA 4WEUD 5HGBA 1FV1B 4LHUG 4S10A 5ELIA 5DO2D 5D7SL 5C0IB 4UDUA 2E5EA 3OXSA 1VKXA 5TDNA 1N5YH 5CGTA 3OAYK 4NM4H 4JFDE 4X0KA 2P5EE 4RSVA 5K59F 4EDXA 3RA7L 4XH2B 2VLLB 4UBDD 4Y19A 1G9NL 4WW2F 3PWPD 4IIQC