2P7TB

Crystal structure of kcsa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB-A
publication title Crystal Structure of KcsA mutant
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p7tB01
1ZVHA 4JGUA 3O8XD 4PRBB 3SE3C 5IB4A 5J12C 1N0XL 4L5FH 1DE4A 1DDHA 1R3KB 1ZA6A 1VFOA 4M43L 3D18B 4JFDD 1LE9B 1CICC 1RIUH 2JJVA 5FAAA 2WP3T 4OGAD 3GSWB 1KCUL 2PXYD 2H41A 4NKMB 5BXFB 4K8RH 3GB7A 3H7BB 2NY5L 1D9KD 5ICXA 2X89D 4ZAKB 3MUGB 4G5ZH 3W2DL 4CVZB 3ES6A 4QNPE 1KYOJ 4YFLI 4UB0L 2GSGA 1BLNA 1PY9A 4PJ7F 5C70A 4YHKH 3THMH 4X8JA 1BGXL 1HQ4A 2GITA 1KEML 5FUCC 2IG2L 5DRXB 3VCLB 3J8F7 2UUDK 4HFUH 1IAII 3MLVH 1RK1B 5LGHH 3BE1L 2X9WA 3OAYK 1EO8H 5FKPB 4JN2B 4G6AD 3HTLX 4NP4H 3RNKA 1UM5L 2ADFL 4F3FB 3DROB 2B7DT 4PYHA 3TNNB 3EIFA 3SDCD 1BJ1J 3RX8A 4L3EE 4PLJD 1YEDB 2NY7L 4KTEL 4PJ5E 1U3YA 4RAUA 5FECA 3RY6A 5J6GA 1J5OH 4K8RD 4IIQA 4P99A 2VAAA 3LKQB 5IJKA 3I6KB 2CDEA 2BC4A 4OF3A 3P4MB 4HPYL 1AGCA 1OW0C 3TGXA 3S35L 2ZUSA 3OGCA 3WSQH 5IB4B 4MAYB 1CL7I 2NXZB 1BJMA 1ZA6B 1YY9C 1S5HA 3EHBC 1BOYA 1XH3A 2VABB 2VDLH 3RWDB 3S97C 4G42B 2N1KA 4O51B 3UPAA 2VJXA 2CIKA 3KJ6H 2BNQE 3IFOA 1E4XH 4TVPE 2AV1A 2FH8A 2A6IA 2W9LA 2LAAA 2O93L 4LLYA 1UA6L 5DLML 5LAXA 3G6DL 4KWUA 3QJHB 1F11B 2ZNXA 5JW4R 3IDUA 1RV6X 4S0SD 3EDKA 3SBWA 1AFVH 1DQML 4UILL 1X5AA 4Z7WA 1L0YA 4ZS6C 5F6HJ 4JZNB 3PWPD 4XNQA 1Z0NA 2Y6SD 4P9MH 2FRGP 1ZVYA 3BAEL 3DX9A 2E8YA 4CJ0A 1HIMH 2EKSA 2H9GA 1R3IL 3RZWA 3C8KB 3KJ4C 4NGHH 3IFPA 1MNUH 3TA3D 1NUDA 3BEWB 5AEAA 4QHKJ 3WHE1 4YXKH 2BSTB 3O3DB 2IWGA 2J4WL 4X80L 2EO1A 3FO2B 5BZDA 4Q6YA 4JPKL 2X9YA 5DJDA 4IIQB 2VAAB 3MV01 2EDQA 1ORQA 3JV6A 1NGYA 2W9DL 4CW1B 3OB8A 4K2UL 4BFEA 1NFDA 5DQDL 3WXWH 1HI6A 4RFEA 1XF3B 5I8EB 1PY4A 2FHBA 3JZ7A 5H35A 1E4KA 4YHYC 5IVZB 1CFNB 4ZS7L 1ES0B 5EU3B 5EUKA 4PRPA 1HH6A 3MJ9H 5GGUA 1ZKAA 3IDYB 3BKJL 3O2DH 3TWCH 1S7VA 3B9VA 5GJSH 5CP7A 4M8QA 1QUNA 5CEZE 4EUPG 3FOLA 4LLYB 3U46B 1KPUA 1N2RB 2VLRA 3VFTA 4R0LB 5T1KA 2ENYA 5LAXB 5DJAB 5DC9B 4X4YB 1F4XH 3ZT6A 1CD9B 2EXWD 5JHDE 4OFVA 4ZSOE 1I8IB 2DBLL 5CKAA 3EOYG 3P9LA 4XI5C 4X6CF 3WE6A 3OJMB 1DEEA 2H3NA 1A4KB 4PB9L 5E2VH 4JANA 1OQOA 1MREH 5E6IC 4UT6H 1C08A 2EKSB 5SV3A 1JPGA 3QO1A 4KJWC 4IOFC 1XF5A 3U2SA 3BN3B 5KSUA 5DA4A 4G9FD 4NT6A 4ELKB 3BPCB 3EDJA 2H2PD 4G8GB 4NKOA 1CZ8L 3WS6C 5MEND 4TOYL 5IK3A 1NBQA 4DW2L 5IVNA 5MI0B 4Y4KA 2XI9A 4MA1C 4YH6A 4J4PD 1ORQB 3FT2B 4LK4A 3S5LB 4M93C 3GJFK 1WFUA 2IGFH 3HRZA 4OLWL 3DV4A 1HI6B 2NZ9C 1UCTA 5GRYA 1ZEAH 4PJDF 4RCAA 3O6ML 1BECA 1HNGA 3UZEA 4KHTL 4NC1E 2X05A 3HZMA 1C5BL 1OM3L 1BF8A 2P5EA 5HI4C 3QG7H 4M8QB 2GTZA 3CVHB 2NY6B 2MJWA 2AAVA 1OSPL 3KPOA 5T33L 3FOLB 4P2OC 1P9MA 3DYMA 5D7SL 3TYGL 2XWBB 2B4CL 2YUVA 3B2UC 5GZNC 4QHLA 3AROA 2DDQH 3D6GA 1QRND 4N0RA 1PEWA 1QSFD 3EYQC 5KS9A 3CX5K 3GMMB 3MREB 4K8RL 5L88L 3MJ6A 2EZ0D 4XWGL 2FZ3A 4JPIA 3CK0L 2JB5L 4BUHA 4G5ZL 3GI8H 1JPGB 3QO1B 3Q48A 3QXUA 1GAFL 1U8JA 3BI9X 4G8FA 4A2LA 1SQ2N 3U2SB 1FC1A 2D4DA 2R2BA 3QO0B 3HR5B 2E9IA 1K8IA 2A6KB 3SDDD 5JXED 4HPOH 1FORH 4K7PX 4NKOB 3EJZD 1OGAE 4XBGB 1QLRB 3A67H 4HFUL 4JFHD 3TJEL 1MWAL 4M6ML 1K6QL 4TULH 2V2TA 5AWNH 2X1XR 3HRZB 1KG0A 4I2XA 4PJGA 1BP3B 3DV4B 3FT3A 1S7TB 2OL3H 3M1BA 4ODTH 5DQ9B 2AGJH 2X4PB 2HJLA 1MRCH 2WZPD 4XP6H 4MB5A 1NLDL 2X6MA 4X7TB 4K3JL 3IVKB 3HZMB 2XN9E 4HKZB 4PJHF 4WU5A 1KF9B 1JGUH 1YEHH 4LVNC 1KB9J 2X1PA 3SBWC 1MCSA 4KAQH 3VWKD 4PJFB 4ZXBA 3GJEB 4GSDL 5EC2A 1MF2H 3UTTD 3OKKA 4KUZH 3QAZC 5E8OA 4Z9KB 5ADOH 1EJ6A 4EQ2A 5BOPA 1NSNL 3SGJA 4PLNC 1M7IA 4PUBL 1UCBH 4S2SA 5KS9B 3WFZA 1IARB 3BH8A 4YBLC 1G9NC 6CGTA 2JE8A 1F13A 4A6YL 3O6FB 3TM6A 4JPIB 1KXVC 3KGRA 5BMFH 2Q3ZA 4PV8B 1A6TA 3MPCA 4BSWB 4Y5VA 4PY8I 3NFPA 3FB7B 3C60C 2IMMA 4X6EA 3T8XA 4M6OL 2Y06H 3ULUH 3MBED 4HK3J 2D7TH 1E4KC 4LFHD 1G0YR 1HIML 2UY6A 5EZOH 3WN5A 1IAOB 1NGXA 4WCYH 1KG0B 3ARQA 3FT3B 1FYTE 3HZVB 3T04D 4PP1C 3HUJA 1I7ZA 1T0NB 1T3FA 2E9WA 4HWUA 3V2AR 4OIIH 1P5UA 5C0CA 2X1QA 3OR7B 1JPST 1CCZA 3I50H 2WANA 5CLTA 4IOIA 4WU5B 1H3TA 1UM4H 3JV5A 4Y4FA 3ZL4H 4YJZL 3QIWA 4TN9A 3SOBH 3QUMA 3VU2A 1HOCA 5HHXL 2PO6D 4ZXBB 4LCWD 4XWOC 4IHOA 3T2OA 5EC2B 4H88L 1WJ3A 2UWEA 2UVFA 3V8OA 2G60L 4X6FB 4PP2B 1NBVH 1NC4D 1M7IB 5FDYA 4KK9D 3ULUD 3ZYZA 1NEUA 3O2DL 3BH8B 5D1QD 1UWGL 3T0AA 3SHSA 4DVRH 4R8WH 4HG4J 1GCFA 4J3VA 4EDXB 2Y23A 3PWNB 3VG0L 3OXRA 4LNRB 4XMPL 5B8CC 4ELMF 2HJFB 1IGCH 2VIRB 3OXSA 3DXAE 3QXTA 3QYCA 5I8KH 4Y5VB 4PG2A 5ISZD 1KC5L 2V5YA 1DBJH 1PAMA 5C0NC 3QQNA 5DUML 9CGTA 4XCFL 2FHFA 4XP1H 3FQTA 4L3CA 1F3RB 1FFNA 1TZHA 3K8KA 3RWEA 1JWSB 3IDXL 2XTJB 4EBQL 4KI5E 1JWUB 1NGXB 2FNBA 3C6LC 1OAYH 3M17A 2JKXA 2MQ3A 4X7DC 2UZYB 2Q76A 5IJVA 4FTVE 3IXTA 1NGZA 1MJ8L 1TZIA 3DBXA 3OZ9L 3HUJB 5FYKU 3QT2A 3MLXH 3D5OF 4D0BB 1FFQA 3EOBB 5C0CB 4U1KA 1QBLL 3BPOB 5I1KL 4XCYB 1BPVA 4IOIB 4LGRB 5GQBA 3UYRH 2NY2C 4X9GA 3ZKXB 1DVFC 2J8UB 5HGHB 5HYEA 2IGFL 4HK0B 1KCKA 3OB0H 4IHOB 2SEBA 1GIGH 3TIEA 3U0TA 4IMLA 4W68A 4OFKA 2BNRE 5HHME 3BRFA 3U4BL 3BKCH 4Z0BL 2FLBT 3H3PH 5FO7A 1HN1A 1UXSA 1NAMA 1L0XA 3QG7L 1CDBA 1XEDA 5IHLB 4WWKD 3REWB 3ZTJG 2J3SA 1KSRA 3OXRB 3AS2A 1I3VA 4UNUA 1YEKH 1EZVX 3MV7E 4LAQH 2GIYA 1VA9A 3U4EA 1WK0A 2WQRA 1YMME 5HI5D 3D85D 3SEPA 2DDQL 5ACZA 3MGAA 2E7LC 4KTYA 4Y16B 2F8VA 4EUPA 3SQOH 2X4QA 2NY3D 3MRIA 1KIRB 3RWEB 2NR6C 4OFPA 4P4RB 2ADIA 7CGTA 4YHIA 1BQHB 5CFHA 3JWDL 4NN7B 1UKQA 1NGZB 1TZIB 1W72H 3BVNA 5F44A 4LSSL 5F9OH 2NY1B 4HPOL 2VL5A 5F1IA 3CLFH 3MRDB 1S9YA 5CBEB 1EBAA 3VJ6A 4HGKC 2EDHA 3FFDB 1SJEB 3MSPA 3GMRB 3GSRA 1QO3B 5T3ZE 5AWNL 4L3EA 4K3EH 3ZMRA 2ESVE 3RUGB 1NANI 2OL3L 4GOSA 2SEBB 3TIEB 4PJ5A 3PWUB 2AGJL 2UYLA 3O0RH 4J1UA 1YNLL 4XP6L 2YKLH 3TBVA 3QR2A 4N5UA 2HH0H 1NJ9B 3RGHA 1MVUA 4L4JA 1YEHL 1Q9WA 4V2CB 4WGWB 1XGTB 3EZJB 4PGEB 2PW2B 1ZA3B 4XRCA 3V8CA 5D1ZD 3HRPA 4JFDE 1MF2L 4Y5YB 4AMKH 2B5IB 5D1XD 3QPQD 2BNQA 4RNRB 5AUMB 1U3HB 5ADOL 5BW7A 4K94C 2H2SC 1FFPA 3WN5C 2MCG1 5ACZB 1U8HA 1X5HA 3F7VB 3QDGE 4JKPH 1TIUA 1LEGA 3DVFA 3C6SB 3RU8H 1K5NA 3S36X 2WUBL 1CFSA 3NN8B 2PYEB 5BMFL 2F58L 5F71A 3U6RA 4MCZA 3DARA 1IGFL 3DURB 3WFEL 3AREC 1QBAA 4Y4FC 3BVNB 1F97A 1I9JH 1UWXH 3QIWC 5E2TH 1MEXH 1TNMA 4I18C 4P23D 4U1IA 2NW2A 4AL8H 3ULUL 2PTUA 3O4LD 5EZJA 3RDTA 3GSRB 2E27H 1E0OB 4MAUL 1VSCA 3PP3H 2IMNA 2GK2A 2C1OA 3HPLB 1FGVH 1WWBX 2DL9A 4PJ5B 2UYLB 3U9PH 4RWHA 2FJFB 1ACYH 2LV4A 5D7IE 4OIIL 1JE6A 1FCCA 5ENWA 1R5IA 2AK1L 1VEPA 2X9XA 3O4OB 1UM4L 4R4BA 1N5YH 4I3RH 1Q9WB 4ZQKA 1UZ6E 2DLFH 1RZKH 4KTDH 3LMJH 1XGQA 4HLJA 3U0WL 4XRCB 3TBYB 3U30B 3KYOB 4NCC1 4NN5C 4MDJA 2C26A 5DD1H 3KPRD 2FX8H 1FFPB 5D2NC 1A8JH 3X3FH 3WKNA 4RGNC 3C2SA 3DVGA 2FWOA 1IGYA 1LEGB 1JL8A 1RIVL 4M9OA 4OBSA 5JZ7D 2UZIH 2YSSB 3PWVB 3EOAA 3HN3A 4UZGA 5JHDA 3BGAA 4HZAA 3U6RB 2AEPH 4MCZB 4LNVA 4IDJL 1ZLWH 3B8YA 4F7EA 1RVFH 3S34H 2ZCKH 5D7JB 5F9JB 1FZKA 1RZ7H 3PWPE 5I8KL 1MHPL 3TNMA 3GBLA 1X5LA 1WIOA 3BDYH 1DBJL 1JPSH 1YC7A 2IALB 2HLAB 2JTDA 2OJZL 1S78C 4YK4C 1FZJB 1HH9A 3QHTC 1QKZH 1U8PA 2R56L 1IVLA 4N5EC 1SJXA 3HHRB 4BZ2H 1OAYL 4HS3A 3UJTH 3FN9A 5ETUA 1KGCE 1R3HA 4JQVC 1I8MB 4WI7A 5L2KD 1GGBH 5K9QG 4ZYKB 3VMPA 4G43B 3MLXL 4A2MA 5HHOD 1H8OA 2VLMD 1P69B 3EO1A 2XYCA 3D39E 5DZOA 1U6AH 3EFDH 3HZYA 4JM2C 5DYOB 1LD9A 4PJ8A 5EWIH 4KKLD 4UOW0 3UYRL 1S9WA 5E7FA 1TZGL 3AMLA 3KYNA 4ZQKB 1WCBA 1ZLVH 4N0UE 4OZIE 2P8PB 2DTMH 4FFWC 1TETL 1QBML 3KNBA 3OWEA 2DKSA 5EBWB 2IH1A 1KEGH 2Y36H 4AIXA 4U1HA 5HGBA 4U1LA 1ZHKA 5F3HB 4I9WD 4Z7WF 2RR3A 4WO4A 1OTTD 4GUPB 3NCMA 1XAUA 2ENSA 5C3LD 2FWOB 2WWMC 5CSBA 1PLGL 4LPWA 1INQA 2ARJB 3EGSB 3VXSD 4AQ1B 3UTSD 2X5PA 4WHDA 3FMGH 4WHYH 3DHJA 5GGSY 2PTTB 4IRJA 4ZSOB 1FPTL 1OAKL 2J8HA 3QG6A 4F7EB 2OR7A 5EU6B 3QWQB 2BVTA 5F7YC 1T7VA 1FZKB 1BIIB 1BFSA 5D6CA 4NQVB 5J7CC 4KY1H 5C08D 5BVJB 3O9WA 2X4UB 1NANH 4KQ4L 3SQOL 3W81A 3FT4A 1NFDF 1U8PB 1C7TA 3AS1A 3SPVB 1WWWX 4KV5E 1JGLH 1W72L 1OGAA 4MJID 3CLFL 2WLYA 4LHUD 2N4IA 4ZPTA 4JREC 1GOHA 1Q1JH 5KW9H 3EO1B 2AS5M 4HWBL 1DBKH 5BJTB 3L3KA 4PJ8B 2CKBL 5ESVA 3NIGF 2CQVA 5JNYA 1FBIL 5BW7C 3KYNB 1VGEH 1WCBB 3GBMH 5BV7B 3HC0B 5KVGH 2LVCA 4U31A 1A6ZB 2WQ8A 3QEQE 3LHPH 3QIBD 3VXOA 2XN9A 2IH1B 3O0RL 2HT2D 5FHAH 4U1HB 5HGBB 3A6BH 3IJHA 2YKLL 3TBTB 5E8DH 2Z31A 4U7KA 1FNLA 2NY0C 2HH0L 4I3SH 5DMKB 1TVHB 2APTA 2V2XA 4UINL 4HGWA 2DBJA 4ODVL 5CP3H 3GKZA 5KG9A 3OJVC 4KQ3L 1OAZH 3NABH 4POZC 5DTFA 5DVOA 3FOMB 4X8XA 3KHOA 2DRUA 4YFDB 3RDTC 1KNOA 5HJ3A 1UC6A 3SDAA 2YD1A 4M7LT 1FFOA 5T1LB 5IFHL 4HXBL 1VKXA 3O9WB 5TE6H 5IESH 1TFHA 3RU8L 1OD9A 5J1TC 1A4JA 5FGCE 5J13B 5EB9A 1WWCA 4BQBA 1EEZA 5SWZD 3NFNA 5DRZA 1D5MA 3MNWB 5E2TL 1OGAB 5EBGA 4I0PC 4QHUB 4U6VH 1WTLA 5T1MB 1KCSH 3HC4L 3ZE0E 2HVKA 5C71A 1T7ZA 5H8DA 3FQRA 4X7EC 2AXFB 2B39A 3RPKA 3PQYD 3LQZB 1FYTA 3IF1A 1V7NH 2E27L 5CZXC 3U7AA 5HYJB 4C4KT 3P4NB 4KXZH 4M1DH 1A3QA 2V7NA 2O5ZL 4NM8H 3VXOB 3VMNA 2Y4SA 2XN9B 4PJAE 3L5JA 4KI1A 4RX4A 3U9PL 4MD5B 1J1OH 1ACYL 2D4FA 1YECH 3R0NA 5EO9A 4WEBH 3ZKNC 1DBBH 1NGQH 4P46D 4LSRL 5KS9F 3MJ8B 3O2VL 5JDSB 2WBJD 2QQNH 1F4AA 1ZT4B 1N5YL 4L9LA 2VRAA 4CL7A 4O58H 3ARUA 1T80A 4R2GD 4NQSA 3NH7H 3EOTH 2BOBA 5KG9B 3TEUA 5TPWL 3ULVD 3L3IB 5GGSA 5DTFB 4LLUA 5GPRA 5DD1L 1CICB 5JOPD 3X13A 3HS0B 1VKXB 4JO1H 1SY6H 3AAZA 4GBXA 3OQ3B 3X17A 4U1NA 5ITFB 1EHAA 1IQDB 1A4JB 2DQHH 3ZDZE 1U93A 1P7QA 4PJGF 4I5BB 3FN0L 5IEKA 1PGRB 3NFNB 2AEPL 5HDLA 2DM4A 1RVFL 3S34L 3CVIL 2ZCKL 3T0EA 1DLHA 1RZ7L 4GT7A 3BIKB 4NBXB 4LOUD 4RMTA 5DURD 1RSFA 3BDYL 3SE4C 1UEMA 4D94A 2HMIC 4Q6IA 1UADC 2X41A 1O7SA 1CT8B 4GAJH 4QYOB 5DI8A 3CFJA 4N68A 4NFCA 5JPMA 2L7UA 4ONOA 4FTVA 3VFVA 3DV6A 4WO4C 4AG4L 4HBCH 3ALXA 1MIMH 1OLLA 4NYLA 3C08H 3UJTL 1S7UA 1NLBL 2P7TA 4FXGA 4XC1L 1QFHA 1J0YA 5EU7E 2R4RL 4ZPVB 3EBAA 4Y19D 1JTTA 3VRIA 3NCYS 2R8SH 4MHHI 1U6AL 1ADQL 1RAMA 2GYSA 3WXVL 3MV9D 5I6XC 1PKOA 3JWOC 1B0WA 5JLZA 3QI9C 1Q72H 2BNRA 3H42H 1F6FB 2L7JA 2ERJC 4ZUTB 2W38A 1KEGL 2Y36L 4OLEA 4U0QB 4HEME 4PJBB 4PRHD 2GK0B 1EEQA 3X13B 1WZ1H 3F7YB 5BRZA 4WNQA 2YRLA 3D48R 4HUUA 2JJTC 1I1FB 5FK9A 3BEVA 4XP9L 4U1NB 3SDYH 4CMHB 3MV7A 2ZCLL 5IMKB 5JQ6H 4P5KB 3GJFB 3FMGL 3DXAB 1BD2B 2YD9A 2XWJA 5EORH 4ALAH 5BVPH 5TDOA 3HUJF 4U3HA 3JTSA 4P59H 3BH9B 3V52L 4KY1L 1OSZB 3MCKA 4LEXL 4Q6IB 5ID0B 4OZGE 5I1IL 2F54B 3T3ME 5HVFB 1U36A 5JPMB 5IKCA 2YD6A 2J8UF 2X44D 4XP4H 3DGGB 1U42A 1YUHB 4NJ9H 3I9GH 5I0ZA 4GKNB 3IFNL 2HKHH 4YDKH 3ZE2E 5IGXH 2Z91B 4FQCL 1JGLL 4I13B 2P7TB 3MA7A 4FXGB 3MJ7B 3DMMD 3JBG7 3DSNA 4H8WH 3I75B 1Q1JL 3CAFA 5KW9L 4P2RE 3CSYB 3ZZ1A 1MELA 1DBKL 1KBGL 2ESVA 3HNVL 1PJ9A 4PBVC 4Y1AA 2X7LB 3SDAC 1IGIH 3OMZA 1GC1C 2FBOJ 1VGEL 1B0GB 4YEEA 1WBYA 3V5DB 4HEPG 1AXIB 4PJEE 3LHPL 4XBPA 4WIQA 2ZSVA 4YGVA 3TZVA 4OB5L 3UTPE 4K3DH 4F33A 4JDVA 2JELL 5FHAL 4YHYB 3O8XA 1R6VA 4JVWA 4LASL 3PL6D 5E8DL 5DD5L 2P5WB 4M9PA 5DF0A 4GS7C 4I3SL 4JFDA 1KN4H 3L3DB 4TUJA 1OARH 1YMMB 1M05B 2PXYA 3QDGA 2V17L 4KGJA 4OD2B 15C8H 1OAZL 4JY5H 2J7LA 1Y0LB 4KKCC 5TDOB 1D9KA 3DI3B 2X89A 2C7UA 3WHE0 4UTAH 3PXJA 2DQTL 4N9GA 5D7LE 3IAGC 4LFHG 1O5DT 2NY5C 3GSNA 2Z0BA 3RVXC 7FABL 4CRPA 5IKCB 5CGMA 5E6IB 1D7FA 3WUWB 2HTKC 4E0RB 4X6DB 2OYPA 1DN0A 3RUGF 4XVUC 1NPUA 3MA7B 1SHMA 1EHLH 3ULVL 4L9LC 5DVNA 5J6HA 4QF1A 1KCSL 5GISH 2W60A 4G3YH 3W0WD 2FYYA 1RZJL 3P30H 5JIKA 4W6XB 1LGVA 3SDCA 3OSKA 4LDLB 4JZJA 4M93B 1ND0A 2BX5A 4PJ9C 4MVBD 1J86A 5D7IA 3HG1D 5DVLA 4G6MH 3FAWA 4LPUA 4XBPB 1XIWC 1UH2A 2ZSVB 4NM8L 3KS0H 2OS7A 5HXMA 4WW2A 3F5WA 5JW4M 3CFCH 3TZVB 4R4NC 1B4JL 2NX5E 3LV3B 4S1SL 4F33B 5FYKH 5E94A 1OAUH 3BUYA 1MLCB 4M7LH 5C0JA 2XPGB 3QUZA 4M48H 1WVZA 1CXFA 3MLPA 5C09B 1KN2H 2NTFA 3MV8B 4S1QL 1T66D 4P4KD 3BN9C 3T0EC 3G5ZB 4LP4A 3F6LA 4P3CH 1D6VL 4GXUM 4LGPB 5I1GL 4QTIH 4I4WB 3AGVA 2VDPH 3JUYA 2GI7A 3QDGB 5DHYA 3FZUC 5TFSH 1U58A 4B7IA 4BQ9A 1ZS8B 3NACH 4LQFH 3RVWD 1I1AD 1KCVH 2C7UB 4WHCA 1N3NA 3MRFB 3ARPA 5DFTA 1T83A 1B2WH 4X0KA 1TLKA 1CDCA 1UJ3C 4BKLB 1K4DB 1RD6A 4OLVH 2BVPA 2OMBA 3MRJA 3PWPA 2D2OA 2UZXB 3QIUC 4E41E 4NSKB 2NY4D 4NHCH 5FYKD 3F58L 5IM7A 5E4EC 3I6GA 3HI5L 4HUWB 5J6HB 3VD7A 5SX4H 5JW4Q 1J1XH 3AU1A 1GGIL 4OD3L 4MD4A 2CLZA 3EYUH 4OCRH 3BT2L 5SV4A 3WD5L 2IBZY 3OKEB 1F3JA 2BOCA 4GG6B 2O61A 1QR1A 2YUXA 5EFIB 4JZJB 5C9JA 3K46A 4QRPB 5DK3A 1MIML 5IB1B 1E6JH 2YMXH 1TITA 3D39A 2FEDD 2HP4A 5EU4A 4WW2B 1G7QA 2G5BA 3F5WB 4P2QD 4Z76A 3WIHL 4NFDA 5E94B 3QDHA 5C0JB 2R8SL 4OZIA 3QRGH 4OCWH 4Z77B 2RFXB 3QNYA 2NTFB 5LKNA 3ROLA 4LVNB 5DD6A 1BZQK 1TJGH 4O5LH 1MAKA 4OKDA 3H42L 1E6OH 3MRLB 4OSUH 3BQUD 3AB0C 5ESQB 3KPRE 2ZUXA 4HIXL 5E00A 1P7KB 5LXGL 4OZFA 4JFQA 3WL9A 3CPLA 4FQLL 5EH1A 4WFFE 2EYRB 2NLJA 2Y7QA 2OJEA 4CN4A 3QUXC 4JFZH 4X0KB 4YBLB 3ALWA 3CSGA 5C86A 4Z6AT 3OBAA 1A22B 3O2WL 5B4MC 4K7FA 4NPYA 1KJMB 3OL2A 1KPVA 4X5XB 3V4VH 5EORL 3RTQD 3KLSA 4GAYB 5BVPL 2W0FA 4GXVH 4YXHH 5FCSH 5IM7B 4L1DA 4P59L 1NMAH 3IJYA 4OZ4A 4CADA 3C60B 3IDJA 1T1ZB 5FO8A 2CLZB 2O5XL 3VRJA 3V0AC 1CI5A 2R2EA 5F8QC 2BOCB 4XP4L 4OLUH 3MJ9A 5HBBA 3O2DA 4GG8A 3RJQB 1U41A 4MD0A 2EE2A 2HKHL 4M7JH 1C5CL 3QDJE 3D39B 3OX8A 5EU4B 5AYUH 2VLME 2G5BB 1FFRA 3VI4E 4L8CA 4OGAC 4DFIA 3I6LE 3CUPA 2Y1VA 3IDIA 2FBJH 4UIMA 4OI9A 4TNWK 2PXYC 3DTXA 1S9XA 1A14H 1LEIA 4N0UB 3MNVA 3TCLB 4OKVA 3FFCD 4RDQF 1UQSB 3QEQA 3QNYB 1G7HA 1T89A 1QSZA 5DD6B 1IM9B 1IGIL 1A3RH 4J12A 5I17A 2EIZA 5EIVA 5IB3A 2YHGA 3MRNA 4L8SA 4K3DL 2VLKB 4MNGE 4OZFB 2NZIA 4LL9A 1MI5D 5F7WC 5CJXC 5FF6A 3ZE1E 4IS6B 3W9DA 3VXSE 1XMWA 1I9IH 4LMQE 1P2CA 1KN4L 3B5TA 4BFIB 4Z7NE 4X9IA 1QSFA 4K7FB 1MFEH 4NPYB 5ICZA 2B4CC 4G6AC 3MLWH 1V5JA 5I8CA 3QEHA 1XZ0A 4QGYA 4QY8A 3UPCA 4PLJC 1H3PH 1ZE3C 4MNQD 5D71H 2XXMB 4OZ4B 2J88H 4NO5B 5HHPA 4K8RC 3T0WA 5DEFB 4F7MB 5EDXA 3IDJB 5JXEA 3DUSB 4HKBA 5FO8B 4PD4K 1VEOA 4BELD 2R2EB 1LP9A 2GJ6D 5KSAD 3ZHKA 4NDMB 1U91B 3C6LB 5EOQH 4IRZH 3OKLA 25C8H 2VZUA 4PTUA 1EHLL 2VLLA 1JHLL 5HI3D 2EDJA 5GISL 3I84A 1DANT 2I60L 2VZ1A 2XQYG 4NQCE 3GM8A 4OZHE 4UIMB 1DQDH 4HMDA 5A3ID 1S9XB 3GNMH 1MAMH 4LSUH 3P30L 3MNZB 3MNVB 1NQBA 4R7NA 4BSVA 4OKVB 2VN4A 1AHWC 2OSLA 4P5TD 2NY2B 1WISA 3MTRA 1A1OA 4UNTA 4K07A 1PZ5A 4EN3C 4H26A 5I17B 1ORSB 4G6ML 2VDKL 4R6UA 2H8PA 3BO8A 1KLUA 4U0RB 2BVEA 4G8IA 4KRLB 4O02L 1NBYA 4FFVD 5FYKL 3VWKA 2IAMD 1HSAB 4JEGB 4QRQA 2PUQT 2R0ZH 4QXGH 2Y6SC 3W9DB 4Y2DD 2W1NA 2P8MA 3DPBA 3EYOA 4NNYA 1IKNC 4G8EA 5GZOD 2D7OA 4UDUB 1J7VR 2MTPA 5GGVL 4UDTA 1JGEB 4Q9QH 4C56B 4YHLH 4DGVH 3WNNA 4HQQH 3TA3C 5C0GA 4RMUA 2ILLA 5I8CB 3FO0L 3EO9L 3NACL 4LQFL 1KCVL 3RVTD 8FABA 3CDYA 4LHQB 2OL3A 3PV7A 4XNUH 5FGCB 2GT9B 1U8MA 3PG2A 2ED8A 2EDFA 5J56B 5JOEA 1QLFA 1G7LA 1IRAY 3IETA 5F6IC 4F57H 5SWZE 4OLVL 2YUWA 4GRLC 3MBEA 5T5NF 1DBAL 1UYWL 4U6TA 2PF6A 3OJDA 4NHCL 1QFUL 3RPIA 4PTUB 5F3BA 2JB6B 4PGCB 2B20A 3NZHH 4I77H 4N0CD 1ZT7B 3QWRD 4XXCC 3FTGB 1QOKA 4ODHH 3IU3A 1JF1A 2UV3A 3GSXB 4JRWA 4OCRL 4R7NB 2OSLB 3E0GA 2WM0A 1W0VA 2PCPB 4PJAB 3T2NH 3TV3H 2BSED 4GMSL 4H26B 1E6JL 2NXYD 2YMXL 1DQQB 1SYVA 1F6AB 1AJ7L 3BGMB 1KLUB 5I71C 3D2UD 2EXWC 3RL1B 4LCUA 5TQ0H 1AC0A 3GM0A 2CRMA 3TFKD 4G6FB 1KJ3H 5GGQL 2ZUTA 5L0QB 1TJGL 1I8KB 3IU4H 3RA7H 1NC4A 4XZUA 4PPTA 3HNTH 4OSUL 3T1WA 5D1QA 2QADD 4YNYB 5C0GB 3LRSA 2OXHA 3QUYC 2APVA 4N1HB 1MCOH 3WJJA 3MRPA 4LLQA 1OL0A 5LWYH 4XPBL 4J4PC 35C8L 3MCLH 1RHHA 3V6OE 2XWTA 3LB6D 2DF3A 1BM3H 5IV2A 3P4OB 1SEQH 1AR2A 4WFGE 3V4VL 4DN4L 1SEBA 5E6ZA 1T89C 1Q9OB 3AREB 1H0DB 3FHAA 4OZGA 2HJKB 2ADGA 5F3BB 1NMAL 1OP3K 5BQ7A 4JCLA 2EC9U 2GSIA 3BGFB 2FJGA 1BJ8A 3DVNA 3S35X 3P77A 3AS3A 4UV7H 3QDME 3MRRB 5B21A 4WHYG 4ZAKD 3SCMA 3ARFB 1JUFA 1F5WA 4YLQT 2F53B 4S1DD 1N0LA 5CD5D 4M7JL 1DUZA 1B0RB 4P2RA 2NW3A 1SYVB 5BZWB 2QEJA 3OG6B 4FNLH 4G9DB 4YR6B 1I3UA 3A0OA 3QWOA 4HV8B 1A14L 1GGCL 2CIIB 3DVIA 4HKXB 5F8RC 1FL5A 4PJEA 2EZ0C 5EG6C 4XPTH 1Q0XL 1HYSD 3H3KA 2ITCA 1EJOL 3K1KC 1A3RL 4PV9B 3VXMB 5J4MA 4Y88A 4PRHE 3SDDC 4FQXC 4JG0H 1FNSH 5CWSA 3I02B 3EJZC 5H2BA 5EULV 5D2NB 4UU9A 4LLQB 4XNYH 3RWJA 4MXVE 4KI5F 3NAAH 1I9IL 4WTWA 4D9LH 5M95B 3D85A 5C0RH 5IBLD 1R5VA 4MAYD 2I5YH 2H1PH 2NXZD 5IV2B 5I2IB 5LQBH 5D7LA 1OT1A 1SEBB 1EBPA 1CTNA 5ERWA 3ARGA 3F7QA 5D71L 5IW3A 2GSIB 2D7MA 4UIKH 3P77B 5C2UB 5I73C 4NUJA 4C4KO 1Z6JT 5JPNB 3STBA 3SCMB 1KXQE 3HB3D 5GS1A 5HGDA 3JWDC 5EOQL 1P1ZA 5CSZB 25C8L 4P2RB 4K9EH 4OM0L 1ZOXA 4XX1E 1U95B 3VGBA 2E7MA 4CAGA 1U2HA 4Y4HB 1DQDL 4JM2B 1MAML 4XHJC 2FR4A 3P9MA 1T04B 3B9KA 1FL5B 1BOGB 1FNHA 1X5IA 5IHZA 1IKFH 2ITCB 1LO3L 2NX5A 2QQKH 4KZEH 3NCYP 1MJ7H 1R3LA 3CSBA 4H20H 3WYRA 4K23H 2YUZA 2P46B 1YJDH 4LLVA 5HVHC 1NCCH 2WWKT 1AXSA 4GLRI 5FXCH 3CD4A 2V9RA 2BHYA 5H2BB 2WLZA 4KDTA 2OCFD 1W72A 1I1RA 5D4QA 5JW5B 5D1XA 4ERSH 3ZDYE 5E9DE 3IKCA 2BSSA 4H25A 2QSTA 4YHLL 4HQQL 3U4AA 3GSVA 4I48B 3ARYA 5D7LB 3FHQA 4ZUUA 1YEIH 2XXCB 1NMCC 4YDLC 3MRHB 4R4FL 3QJFA 4YUEL 4M1CD 2EH8H 1KIPA 3G04B 2HFEA 1INEL 5T3XL 1VADB 5CZKA 4F9LC 1J05A 2PO6C 2VZ3A 4RFNB 3VXQA 4AEIH 2AW2A 1FO0B 1WEJH 2YXFA 3FRUB 5HGDB 5GS1B 3QXAA 3LN4B 2EECA 3F12B 1P1ZB 3O3UN 3O4LA 5DR5H 2P8LA 4BUGA 2AKRB 4KK9C 3ULUC 2EIEA 3NZHL 2VXTH 4JREB 5ADPH 3X14A 1KCRL 1I7UB 5E24E 2LAGB 2WIIA 4EOWH 3B9KB 1D5BA 5JDJA 1V3KA 3CVHH 3GKWH 1N8ZA 1MQKL 3TV3L 2NX5B 4KUCF 2ZG1A 2W91A 1BQUA 4NRZB 3U7YH 1SM3L 3TO2B 3VXUB 2OP4H 4YHOH 4LLVB 1NL0H 3V0VB 1JN6A 2YPVH 5MP6H 2VUOA 2VLJB 4YAQA 3GSUB 1XR9B 5LBSH 2NY0B 1KJ3L 3KPRA 5GGTH 3WHXA 4OLYH 4AT6A 4IOSD 2BSSB 5IIEA 2C1PA 4P3WA 2BFVL 3NCJL 4ZUUB 2YC1A 5JA9A 4OF0A 4PRPD 2C3VA 1JVKA 2ZUVA 4MX7A 1FG2A 3MCLL 1KIPB 2GFBA 2NY6D 4GG6F 2K1MA 1OTUD 4ZUSA 1GSMA 3BX7C 1EGJL 1VFAA 4E41B 5EUOE 1QR4A 1DFBL 2OLDA 4LPXA 3WJLA 1J05B 3PNWA 1G6RL 2JK5B 4QXTA 5D7IF 1SEQL 3QXAB 4FZEH 3FN3A 4WW2F 4OQTH 1X9QA 2NNAB 2P8LB 4XX1G 4I0PB 4LSQL 1H5BB 2E3VA 5FDWA 1C12B 1UZ6F 2JLLA 4P57A 3CMGA 4HC1L 3MOBH 4P9HL 3IAQA 5IB2A 3UPRB 2WIIB 2FL5B 3QDJA 3C8HA 4WFED 4WWKC 2IC2A 1WCQA 1N8ZB 2XNAA 2OK0H 1UACH 2HWZH 4HWZA 1N6QH 3ARZA 2EEBA 1FRGH 3RKDD 4PJCE 1WZKA 3MV11 1KELH 1JN6B 1R3JA 1R0AL 3RVVD 3FONB 3S36L 4MLSA 1OGTA 2YS4A 5AAMA 2G9HA 2XG5A 1T1WA 2NY3C 3BZ4B 1XR8A 3CC5A 2I26N 4R90L 3GSOB 4JO4H 1KTLB 2PR4L 4R9HA 1HHIA 2Z92B 4CGTA 1FP5A 1HHJB 5INDA 4DVBA 4Y89A 2IBBA 3VXSA 3QNXB 4PR5A 4LRIA 3KLAB 4ZFOA 5DJ0B 2P5ED 2OZ4H 3T2QA 4Q2ZB 3RGVC 4FFYH 4JQIL 4D9LL 1AQKH 3CU7A 3E6HA 3WO4B 4J6RL 3CXDL 4XNZB 3WFHB 4JKLA 4FG6D 4PRNA 4QXUL 3PNWB 1JZ2A 3L9RA 1TPXC 5GRUL 1A6AA 3T65B 3WS3A 1EA9C 2AJZB 1G0DA 3QEUB 3LIZL 4N1CA 4OZIF 4P0DA 2AJYL 3SJVE 5IB2B 3O6FD 3ISWA 3UTZB 3QDJB 4XTRC 3BP7A 1BZ9A 3NIFF 1MUJA 5D1ZC 3SGDH 2X2YA 3WCYA 4Z78A 1H3XA 4NQCA 4HWZB 5GSVA 5D1XC 2J12B 2W65A 4Y5XA 3QPQC 1A9BA 4HX1B 5IR1A 1TCMA 3FFCE 1GZQA 3QIBA 2XT1B 3O6KH 4HS8H 2G9HB 4CNIA 1T1WB 2VZTA 4DUVA 5A16A 4PD4J 1IKFL 1CF8L 4UAOB 2QQKL 4KZEL 4LF3A 1AGDA 5CKGA 1T2QH 4YX2L 4MNGB 2ERJB 3KHQA 4K23L 3MGTA 1HHIB 3SY0A 3E8UH 5FCUH 1II4E 1VGKA 2X70A 1NEZB 1IJ9A 3WFDH 3C2AH 3PGFH 4P23C 4PR5B 4R97C 3RY4A 4ZFOB 2ICES 3G6AB 2EC9T 1BZ7B 4HBQA 4PGDA 3TVMC 4MWFA 5I75C 1R5WA 4BQCA 4ERSL 4F8QA 4TSBH 1ZSDA 3SGEI 3A6CH 3LN9A 4RFOH 4LVOC 1LO4L 1FYHB 2BY2A 4KV5F 4ZXBD 2Q8AH 1HQRA 3KPLB 3QEGL 2GEEA 3HI1B 3Q3GB 5D5ME 4DKEH 3NVQA 1ZT1B 4NJAL 1B4RA 3IJSB 3PIQB 1TVDA 4MNQE 3WS3B 1I3GL 5M7QA 4OCLC 4X5WA 3LSOA 5SWZA 1ZANL 1EMTL 3UBXG 5ABDE 4OV5B 5FO9A 3Q6FA 4NZTH 5B39A 4KHXH 4IRSB 3BP7B 4HS6A 1BZ9B 1MUJB 2V2WA 1HXMA 3EJYC 3L7EB 4Z78B 4OZHB 3VA2C 4NQCB 5GSVB 3L7FB 2W65B 2XZQL 2IBZX 2DIAA 5IW1A 1J0ZA 1A9BB 1WFNA 3H8NA 5CP3A 1C16A 1UZ8A 4L1HA 4R7DA 1AD9B 5ADPL 2J6EH 4UQ3B 4X99A 3O45A 3RAJH 5FA3A 3OKOA 2CLVB 1FLRL 5JZ7C 4CNIB 3ZYJA 3CVHL 4KKAD 2XTJD 3MA9L 3GUTA 3L5IA 5A16B 4P46A 2DQJH 1A02N 1AGDB 1JZ8A 2WBJA 3MGTB 1Q94B 2OP4L 4ISVB 5DWUH 1NL0L 1AI1H 5J89A 1OB1A 2X70B 5C0CD 3WJLC 5I74B 1E28B 1Q0YH 5E2WL 4XPFL 1LQSR 2YN3A 4PGDB 3KPNB 5LBSL 3EAKA 4MWFB 3G08B 4JKMA 1RUPH 5GGTL 4G6KH 2E8ZA 4OLYL 5KVMC 2CMRH 4D9RD 4JRYE 1UB5A 3BP4A 2CPCA 2LABA 4YFLF 2MKLC 2VZVA 4H1LH 1XF2B 3BKYH 4DZBB 1HXYB 4JFFE 1G7PA 2YN5A 1CR9H 3V6OA 3AXLB 3LSOB 2CK2A 5C0IA 4NRXA 4YPGA 4KKLC 1GJIA 3DRTB 3WV0A 1CE1L 3OAZH 5DVKA 1AO7B 4RGMC 5B39B 3MRMA 2CK0L 4PJAF 2ZUUA 1WZLA 3DYOA 3QHZL 4HS6B 2V2WB 3CMOH 1HXMB 1RUKL 1IL1A 5FA4A 4FZEL 3L3JB 2FB4H 4DN3L 1N6VA 1QLEH 3VXPA 3RIAF 3S7GA 3QDMA 2O5YL 5I1HL 4Y16D 1OTTC 2DWEA 3EYFB 3QFJE 4YQXH 4R7DB 5HHQA 2IEPA 4X99B 4S0TD 4Y0GA 1K85A 2DMCA 4UT7L 2PKDA 1V7ML 2ZWLT 1SBSL 5C0BE 4LRIC 2OK0L 1SY6A 4PJ9B 3QCUH 5IMLB 2NY1D 5F1NB 4LSVL 1E27B 4RMSA 1YNTB 1G9EA 2F15A 1BHGA 4NZUL 3ZDZF 1HNFA 1V3MA 5E2UL 1I9RL 3AM8A 5JW3H 1XCTA 4PRHA 1F90H 3B83A 4KK6D 1Q9KB 2C4FT 3D9AH 5EPMB 1NUGA 1QFWH 4JO4L 5EN2A 3VFGL 1UB5B 1X4YA 3DRQA 3S4SG 2A83A 1YA5A 3MBXL 4MQSB 3G5YA 1HILA 3KS0J 1CGWA 2OZ4L 2YBRA 1J9CT 2AEQL 2PYFA 3DX8B 4YPGB 4FFYL 3FL7A 1HDMA 4NFBA 2XRAH 2OX5A 2BDNH 4LP5A 3VXNA 3R06B 5KSVA 4OD1L 2CLRB 4XCEB 3WLBA 4KROB 1RULL 1IBGH 3ZTNH 3QIUB 1U3HD 2HT2C 1T20B 1FZMB 3D1MC 2O26U 4V1DE 1QEWB 2K9UA 3QDMB 1EPFA 3LRGA 4PB0H 1MRDH 2VH5L 3B9AA 5HHQB 4GH7B 5DUBA 4JQXA 1G7MB 2HKFL 3WDIA 5HDBE 5IQ9B 2A73B 3WUZA 2QHRH 4HF5H 4F15C 2P4AB 1ZVSB 3LKSA 5L9DL 5IVXB 4TVPH 4IBLT 4ZOCA 4KRNA 6FABH 2DMKA 1AGFA 3O6KL 3OPZH 2ZUQB 1YEFH 4OFDA 4MA8H 4HJGB 1ZLUK 2IPUK 4JKWA 1RQ5A 4YC2B 2HFFB 1T2QL 4JDZA 5EN2B 1DL7H 3D69A 3HI6H 3MRQA 4PJ5D 3E8UL 5FGSA 3AB0B 5ALBH 3K4AA 4GQ9L 4XPHH 4ONHA 3SO3C 3WFDL 3C2AL 3PGFL 3T3MF 5F9DC 2IH3B 5E9DA 1NGPL 1HCVA 2YBRB 3S88H 2R9HC 2PYFB 2DLTA 2XY2A 3ZE2F 4U1GB 3IDMA 3MLZL 2Q8AL 3VXNB 2DJUA 3MUHL 2JJUA 4KVNH 3WLBB 4X7SL 5EOTA 4DKEL 1ZHNA 3QQ9D 1NAKH 3KR3L 4MZ2A 5TGBA 2BNQD 5IBTL 3BDBA 4XP5L 2X4TB 2DTSA 4Z8FL 4TVPD 1BVLA 3MZTA 3UEZA 1HSBA 5DD0L 4M7ZC 3QH3A 5B3JE 4GRMB 4YXLH 3VG9B 3G6JE 2QSCL 4N0FB 3WLWD 4KHXL 1C5DB 1GHFH 4D3CL 1IILE 3QULB 3O11A 4R2GC 1CBVH 1LDPL 3E6FA 3ULVC 5D7JD 3AY4C 2BSRA 5I30L 1ED3A 4RRPG 2DLGA 2YPKA 3O6LH 3V6ZA 4ODXB 4RWYH 1RZJC 2VC2L 3MACH 1DLFL 1G7JB 1NDGB 3U82B 1T1YB 1H3WM 2IFFH 5J11C 4UQ2A 1LK3H 2DQJL 1UGNA 4WUKH 2BY0A 3MRQB 5DWUL 4BK4A 4ONHB 5B3NA 5D8JH 1Q0YL 3KDMB 1KUMA 4LPCA 4XMKL 4NHUA 5EO0A 3BPLB 1JNHB 4RISH 5KSBB 1TJIH 3DGCR 2VDQL 4GKOA 2ICWI 5IHBA 4G6KL 1H8NA 4DUWA 4M5ZL 5ACLA 5L6YH 2CMRL 4M6AA 1P4BL 4QLRA 5HHNA 2F5BH 1ZHNB 4HT1L 3C9NB 4M62H 1T03H 1XGRB 3N1MC 1RUAH 3FQNB 1CR9L 1IQWL 4HFWB 3RY5A 1HSBB 2G5RA 3MFFA 5EUOA 3QH3B 3NPSC 3JTTA 2R23A 5KN5A 4BM7A 5HY9A 4RBPK 5BV7H 5IG7A 1VHPA 4C58B 2ZOKB 5KBNC 5EU6D 2FB4L 3E6FB 5MEPA 2R29H 3UBXA 4XPAH 2IQAB 3W11D 1T5XB 3V6ZB 2FEEL 1PSKH 1QSEE 4JO2H 2JCCE 2ZZUT 1NAML 3KPQB 4GAGL 2UUDH 1W2KT 2WMPA 4UQ2B 4PJCA 5DMIH 3OAYH 4YHZH 4EN3B 2DKUA 4G8GE 3GMLA 1QPPA 2DQIH 4MQXD 3B2VH 2NTSP 2ZUYA 1EERB 5I15H 4PJ8D 3BQUA 1Z9MA 4NHUB 5EO0B 3I3BA 5JW3L 1X5KA 2DM7A 3VGFA 4KPHH 4MCYB 3HPJA 2ORBH 5F88B 4WI6A 2YD2A 4EDWL 4KRPC 1DSFH 3DMMC 4Z7UE 3H9HB 4M4PA 3KPPA 1UH3A 5IB5A 4NBYB 3ARWA 3IAPA 2A6JA 2VDRL 3KVQA 3MFFB 4LSPH 1N6UA 5HSFA 2BDNL 4A6YB 2R23B 3UC0L 3H9SB 3MLSL 1OTSD 5KN5B 5F6IB 4X4ME 4NC0B 1D5IL 2M2DA 2X4OB 3LQAH 1IT9L 4GRLB 3VWJC 1CDUA 3FQXB 4XC3H 3QP3A 4ZODA 5T1LD 3S37H 3D0LA 3SJVA 3DHMA 3PL6C 3O9WD 2VISA 4JFOA 4MDIA 1IEHA 4U7SA 5FOBB 4WFEE 1YYML 3RX5A 1BMGA 1F8TL 3SO5A 5D9SA 4UT9H 3UO1L 3GK8H 4HH9A 2ATPB 5C6TH 4HF5L 3NBNA 5DFVC 3OKDA 3FFCA 1OGAD 3GMLB 4JHAH 2A1WH 5I71B 1BREA 2FHCA 5BS0E 5L2JA 5C0EA 4TVPL 2QR0B 5D7KD 6FABL 1T7WA 2B2XH 5K9KA 3OPZL 2MCPH 5JIHA 4EI5C 1N4XL 5HYJD 4BZ1H 1MFBH 1MI5A 5HVGB 5GRWA 3UDWA 2R0WL 5ITBL 5E08H 2XN9D 2DQEH 4X4ZA 3VFSA 1BBDL 4HXAL 2GJZA 5IF0B 4XPHL 3KPPB 3QUYB 5JO5A 1EVTC 5CJOL 1S7SA 2WIMA 2X1OA 3OAUH 4TRPH 4KVCL 3S88L 3BMVA 3TBSA 4PJFE 5TF1L 4KJPD 4U1JA 3EO0B 5D5MA 5E8PA 3S4SA 2D31B 4JY6A 4JPWL 4MNQA 4MVBC 4YZFF 1QA9A 3SKJH 1QVOA 3VI4F 1OQXA 4UOW1 3P9WB 3OAZK 4X83A 1BVKA 3KWWA 3BHBB 3ILPB 1CICD 1S7XA 4PRAA 1DQJB 5ELIA 5EZIH 3SJVB 5KSAA 3KYKL 1RURH 4S1RH 5IUSA 1GXEA 4JFOB 4MDIB 4QHMA 4BFBD 5IHUH 1XGYH 4R3SA 3VFOA 4YXLL 4N90E 1T66C 3L1OH 1OF2B 1U8NA 4O2EA 4OCSH 1RMFH 1AQDA 4P4KC 4DKDC 3I3EA 5AG8A 1X3DA 1GRWA 2HYMA 1M6OA 3TBWA 4ZTOL 1NUFA 4ZUWB 5HYQB 2XQBH 4IJ3B 4WU7A 5HYSB 5KANI 4P5TA 3ZE1F 4DZ8B 3RVWC 1I1AC 4OGXH 3O6LL 3PV6A 5L2JB 1A1NA 3VA6A 3HZKA 4RWYL 3S5LG 2F74B 4O00A 5CEZL 4Z7NF 3V7AE 3MACL 3QISA 3SE9H 3NIDE 1FYTD 4GW4A 5DK2A 3DO3A 3ZKMC 2IAMA 3KYMA 2YEZB 3GJFH 3HE6C 4WUKL 3F7PC 4MB3A 1A6UH 2DIBA 1OD7A 3N1GC 4GMTL 2NY4C 1NMBL 3BZDA 3IS1X 3NTCL 1MCJA 3VFSB 4FQXB 4N8CH 4Q9CA 5F70A 3WKMH 2AJSH 5IBUB 1FDLH 5D8JL 1GL4B 4WV1B 4QRTB 2V7HA 4JRYA 2DI9A 3JVGC 1CIUA 3F6IA 1RJLA 4YHML 2FGWH 5D5MB 5DZNA 4JFFA 3R1GH 2MSPA 2QQLH 4PRIB 4XGZB 1QA9B 4GJTB 1QVOB 1K2DA 3X12A 5KVFH 3K2UH 4OZHF 4AIZB 5K9JH 1YY9D 1J88A 4QXWA 1T21A 3KWWB 3DUUA 2KKQA 4PRAB 4FZ8H 1WBXA 1MH5B 1HCFX 4LKCB 2FCBA 3EUUA 3GHBH 1IEAA 3LN5B 3HMXH 4QHMB 3VFOB 5I76B 1U8NB 3WNPA 5D96C 5CIPH 5BV7L 3DXAD 1BD2D 2W9EL 1JRHI 1M6OB 3QWRA 4F7TB 3U83A 4J3UA 2V5SA 4UI2A 4M02A 5DJ2A 3AMKA 4NZRL 5D70H 3STLB 4LCCC 5I1AB 2R29L 1VEMA 2AJUH 4YHNA 2OTUA 3PV6B 3I2CH 12E8H 2AK4E 3TPUA 5DMJB 3MRCB 4KC3B 1A7PH 4KI5D 5C0BA 1T22A 2F54D 4JO2L 2XTJE 5E1HB 1YDPB 2OTWB 3D2UA 3N1PC 2VQ1A 3PE9A 4C55A 4RRPA 3TH2T 4PGBA 5SWSE 4I1NB 3RTQC 5GSRB 1HWGB 1IEBA 2H32B 2DQIL 3WNLA 4F37K 4WW1B 3ZHDA 3VFWA 4MJ5A 1ONQB 4OT1H 5JHLH 2J8UE 3LDBC 5E03A 2V7HB 5CJQH 1L9MA 4KPHL 1RJLB 5HGAA 1V8HA 1SMAA 4J7RA 4NBZB 2ORBL 2FO4A 4PLKD 1KULA 1U8KB 2P24A 3X12B 4G7YH 2CRIA 3PP4L 1AKJB 1DSFL 4N8VA 4PRBA 2WUCH 3A6OA 4U6XB 4ODUB 1FGNH 4D0DB 1NMCB 2P5WD 1R3KA 1RZ8B 2ITDA 3D18A 4RMWA 1DBML 3MYJB 1LE9A 3ROOA 5F93C 3BISA 1YMMD 3GSWA 4DJMA 4V1DA 3JSSA 3LQAL 4NKMA 5BXFA 4X9BA 1NH6A 1ZTXH 3PGDB 1AXTH 5DDHB 3H7BA 4QO1A 5DJ2B 5F9WB 3QFJB 4JN1H 5E5MB 4ZAKA 3MUGA 5BO1L 4HULB 4F2MB 3VXRE 4RA0C 2OTUB 4XI5D 1C7SA 1JPTL 5C0BB 4HUNB 1F45A 5A2JH 5E6ID 5TQ2H 2VQ1B 5I1JH 3VCLA 3U9UB 5C6TL 4FFZH 1RK1A 1TCRA 1TQBB 2A1WL 2Q6WB 5FKPA 5JUEH 1IC5H 5T3ZD 1A9EA 3QFDA 3DROA 4JM4H 4MJ5B 3TNNA 1HHHB 2B2XL 3D0VA 4AEFA 2EO9A 5JIIA 4LIQE 4MQTB 4UTBH 3O41A 2Y72A 2DJ4A 3WMSA 4R26H 4BZ1L 3ABZA 1A3LH 1CQYA 3HC3L 2MPAL 5CGTA 2NZ9D 1A7OH 3LKQA 4XNXH 3I6KA 1J0HA 5E08L 3TZVD 4U2ZA 3RNQB 1DP0A 4N8VB 5HI3C 4MAYA 2X4NB 3OAUL 3FB5B 5ESAB 5F6HI 3ZYOA 4ZFZA 5C09D 5HI4D 3L5XH 3MV8D 1CD0A 2ITDB 2VABA 3RWDA 2DD8L 4P5TC 4G42A 3PJSA 1WBZA 5F1OB 3ROOB 4LU5L 4O51A 1UKTA 4KUCD 4V1DB 4EIZC 3QDGD 2H45A 4DQOH 4CMMA 5E99H 1TXKA 3EFFA 1KB5H 2OI9B 4FFVC 2BZDA 4QHKI 3G6JA 1RURL 4S1RL 1JNLL 3QJHA 1F11A 5DRNA 2VE6B 3LCYA 4Y2DC 2PYEE 3RZCA 4QHNB 2CXGA 4OCSL 1RMFL 5GZOC 4DAGH 1CE6B 3W5NA 4JZNA 3EKCA 5F7FA 3KXFB 3RWHA 4WY7L 5B38G 3BPNC 3DIFA 5I8OL 1P84J 1P4IL 3VGAB 5KAQG 3S96A 1TCRB 1B9ZA 1C1EH 4MXVF 4RGOL 3HLAB 4OGXL 3RVTC 4MMZC 1PD6A 3C8KA 2FD6L 1A9EB 3QFDB 3ILQD 3BEWA 3B43A 1IAKB 3D0VB 3MLRL 4DTGH 1G9NH 2G2RB 2BSTA 4NQDE 2R39A 1WGOA 2NY3B 3O3DA 2XFXB 2RHEA 3O41B 4QRPD 3FO2A 3CH8A 3EDFA 3O3BB 4AENB 1J18A 3ARDC 1A6UL 1FNGB 4XCCH 4CW1A 5FYJH 5FUZL 2VAJA 4N8CL 5TE4L 2XZAH 5GGRB 2AJSL 4M7KH 1AP2B 1XF3A 5I8EA 3QUZD 3S3PA 1FAIH 5EU5B 5DHVB 4N0CC 1JRHH 2DOCA 4Z18A 1SMOA 3IKKA 3BUTA 1EFXB 4ZFZB 5IVZA 1CFNA 5E1AB 3TC9A 3RGVB 1ULVA 3U7WL 3REVB 4CKVX 2HRLA 2FGWL 1ES0A 1WBZB 3PJSB 5EU3A 5GJTH 3BFOA 4YE4L 43C9B 2QQLL 4CMMB 3K2UL 5K9JL 4D8PA 4TUOB 3EFFB 1CD1B 1FH5H 4N0YL 3C09C 4LBEB 4FZ8L 3U46A 1N2RA 4DEPC 3G6JB 1AGBB 4R0LA 1CK0H 4AEHL 5DJAA 4X4YA 2Z8WC 4ZFGH 1FNFA 1HKFA 5DRNB 1K8DB 2EH7H 3TFKC 4NM4H 2GTWB 4HJ0D 4W81A 3RZCB 1BQHG 3V0WL 1I8IA 5MHSE 1HWHB 4H1LG 4HIEB 3RWHB 2MOVA 1A4KA 2QADC 1Q8MA 3DIFB 3VGEA 3OKMB 5HYIA 3T08A 3CLEH 1QSEA 3S96B 2JCCA 1OP5H 4OZFH 3ZDYF 1RJYB 3C60D 3I2CL 4NQUA 2WAHA 3MLTA 1A7PL 2VDMH 4ELKA 2CKBB 5CILH 3TT3H 2DQDH 3BPCA 4L8BB 5KSBF 1KGCD 1DCLA 2D7NA 1L7IH 4G8GA 4ETQB 2FH6A 3LB6C 3BP6B 1PDKA 2QTEA 4MA3B 4QRRE 1FL3B 2MHAA 5C07E 1PVHA 4ZTPH 5ANMB 2DQCL 2GQHA 2AEIT 3D39D 1CXHA 3FT2A 3S5LA 2CRZA 1MCIA 3E3QE 5INCB 1RZFH 1J12A 3S9DB 3WIIH 4OT1L 1LO2H 3TVMB 5K9OB 1JNNH 3P11H 1IM9D 2J5LB 4KGLA 3RWFB 4Z7UA 5F21B 5DUPH 4S1DC 5CD5C 3CFKB 3MZGB 2C3WA 4LARH 2VLKD 4D8PB 5FM8A 1MFAH 3CVHA 4NCC2 1UEYA 2R2HB 1S8DB 2WUCL 5MEQB 1JI1A 3IGAB 4MXQD 1T1XB 2XWBA 1L6ZA 3KPSB 5T3ZL 1IFHL 3FKUS 3L3GB 3B4NA 4X4MA 1LO0H 1T7XA 2FX9H 4D9QE 1HYSC 1M4KA 4F80A 2WK2A 2Q8BH 2QBWA 3T0BA 5EU6E 3FQWB 3GMMA 3MREA 4P48A 4TNVK 2ADJB 1AXTL 1BF2A 4YWGH 5GGTA 3VE0B 1QSEB 5JTWA 1CGSL 1I7RA 2JCCB 2XZCL 3LS5L 4HZLB 4LKXB 4ZUVA 3V4UH 1ROWA 1WZMA 3V95A 2FEEI 3RVUD 4P9HC 3MLTB 3QO0A 3HR5A 2A6KA 5DS8B 2HN7B 2EYSB 4OIBA 4L29B 2DQGH 4PYGA 3T1FB 1YN7B 4MAYC 5I1JL 3C6LD 2MHAB 4XBGA 1QLRA 5A2FA 5BS0A 5C8JB 4M1GH 1IAMA 3WDHA 1MCEA 2PW1B 3NZ8A 3RQ3A 2JIXA 1LILA 3MLYL 1S7TA 1PW3A 5DQ9A 2X4PA 2YOCA 2BXYA 1ODAA 1RFDH 5EUOF 5E5UB 3QEQD 4OQTA 4U6YB 1LVEA 2NY2D 3N1FC 1XF4B 3GSNL 4X7TA 3IVKA 1S7WB 4R26L 3CZFB 1A3LL 2DAVA 2D03H 4Z7UB 4HKZA 1A7OL 3V6FA 4XNXL 4HDIA 4MJ6B 4JB9H 1QHPA 5I1LA 1WF5A 4PJFA 4WENB 5L2KB 3S6CA 4L5FL 2R0KH 3GJEA 4GFTB 3UP1A 1JZ3A 1IAIH 4YHPB 5EBMA 1RIUL 1AGEB 4K71B 5FYLH 5AZEH 4C56D 4RGMB 4PJCF 1ITBB 4W6YB 4PJIB 4DQOL 5E99L 4DCQB 4NKDB 5E8EA 3O6FA 3MJGX 3ARSA 3VW3H 1H3VA 1I7RB 4ZUVB 5IMOB 2ZG2A 3RY6C 4KKNA 4IIQC 4PV8A 1A6VH 1OP9A 3OF6D 5IJKC 2E7CA 4YHKL 3THML 4BSWA 3BKMH 3FB7A 1XCQB 1F58H 3QA3A 5I9QB 2PTVA 4ODBD 2OZ4A 4JRXE 4QOKE 1CL7H 4F7CA 5BS0B 2ZUWA 3MLVL 2HFGH 5LGHL 4LLAA 1I3RB 4L4VE 2VERN 1C1EL 1EO8L 1IAOA 5D7KE 3NZ8B 1YQVH 2XA8H 4K94H 2LU3A 3IDYC 2JIXB 4NP4L 1LO5A 3HZVA 3VD4A 5DC4B 1T0NA 4FXKB 4DTGL 5IEHB 5HYJE 1A5FH 5FYLD 5EBLB 3OR7A 4LQ1A 2WINB 1J5OL 4OQ1A 1M7DA 3F62A 5TF0A 3V6FB 4HUVA 1RZIB 4HDIB 3O3AB 4MNHB 2XZAL 4M7KL 5I1LB 3QHFH 4MJIB 4RDQG 1GOGA 3WSQL 4BK5A 4LHUB 2VMFA 2BRRH 4R96B 2APXA 1N59B 4AM0B 4G6FD 3BZFB 5J57B 5EBMB 2VDLL 3C5ZB 4X6FA 2PN5A 4PP2A 2E7BA 2I07A 5D72H 5F1SA 4JY4B 2VYRE 2YA0A 1J0JA 3WEXA 3KJ6L 1MFCH 3EYVB 2ZP0T 4WGVB 3OJ2C 1PX4A 1E4XL 5E8EB 1FH5L 1VESA 4EDXA 3PWNA 4FQ1H 3CFIC 3TN0B 2Z35A 2EDNA 4LNRA 4XCNB 1QFPA 5MI0C 4BSJA 1AE6H 1CGVA 4L4TB 2HJFA 3V4PH 2VIRA 3DX6B 4Q0XH 1AFVL 2VXVH 3INUH 3QA3B 3QQ3A 3QXDA 4K3HA 4P9ML 5A40E 2AK4A 4F7CB 3ARED 4F15B 3CLEL 1JWSA 2A9NH 5FUCE 1JWUA 1CLYH 3BZEB 3RBGA 4NGHL 5FHBH 4ONGH 1XFPA 1MNUL 1LO5B 5HYFA 3TT3L 1EO7A 3X11B 4NUGH 5SWSA 5B38A 2NY6C 4YXKL 4D0BA 1OTUC 3RWCB 3ARFD 5D5MF 4Q9RH 3EOBA 3ZSTA 4C83B 2F53D 4XCYA 4OLZH 4ZTPL 4Z5RA 3RRQA 5AAWA 1M7DB 5FM5M 1SBBA 2EXYD 4HUVB 1W0YT 4JGMA 2CH8A 2J8UA 5HGHA 3WXWL 4HK0A 4J2XA 3SO3B 3LKPB 2MMXA 1GPOH 1LO2L 3QRFM 1DN2A 1JNNL 1EEYB 3P11L 5ACMA 1UVQA 3IFLH 3Q6GH 3ARTA 3BWUC 4DUXA 4PJXE 1Z3GH 2I07B 3FAXA 2VXQH 3K2MC 1X4XA 2J6EA 3MJ9L 3WDJA 1IMHC 3TWCL 4YPJA 3WEXB 3PHQB 4PJBE 5GJSL 1IZJA 4P5MB 5EC1B 4X9HA 3MOAH 3MRGB 3REWA 3K81A 4FMFA 1N5AA 3RVVC 4X4XB 2Z35B 1Z2KA 2IFGA 1VCAA 4Y4KC 1LO0L 1F4XL 4KMLB 5DO2C 2AXHA 3VXTA 3GHEH 3SKNB 3OKNB 5F1KC 1BD2E 1EDQA 4RAHA 1YPZB 4Y16A 2Q8BL 3VXRA 2NMSA 2V5MA 5F7MC 3QQ3B 3QXDB 1A7RH 4YBQC 2AK4B 5E2VL 1KIRA 2X4SB 4YWGL 1MREL 4UT6L 4DKFH 2P47B 4C54A 4P4RA 3V4UL 3LD8B 2XY1A 1NCBH 1BQHA 2F54E 3CGTA 1TDQA 1DUYB 1BQLH 1JMXA 5DQJB 3CFBA 4H1LA 1NCAH 5JXAH 5SWSB 2C3HA 1WSST 3MRDA 5B38B 3H9ZA 1KTDA 3SCMD 5T5NG 1KIQB 5CBEA 4FG6C 1P9MC 3FFDA 1SJEA 5E2JA 4Z5RB 3CNKA 1D5ZA 4P2RD 3GMRA 5F7DB 1QO3A 3JWNC 4OGYH 3HMWH 3UJIH 4Y4HD 3RUGA 5I16B 5DJCB 1MHEA 4LCIH 3PWUA 3C5SB 5DK0B 1ZEAL 3S8WA 2IBGA 2XTLA 1QFWM 4N8PA 3LEXA 3N50A 4NQTA 2H6PB 1B88A 1UVQB 4RA3A 1FZOB 3UTPD 2D03L 3GIVA 3ALPA 1NJ9A 2XKSA 1FO0H 4YDVB 4AEEA 2N7BA 5I1EH 1DQTA 1XGTA 4PGEA 2PW2A 1ZA3A 2P5WE 1FCGA 1N5AB 2B1AH 1F00I 1ITCA 4OFYD 4Y5YA 3W9EB 2WWMD 4RNRA 5AUMA 1U3HA 1IAIL 3LRHA 3TH3T 3VXTB 1NFIB 3CH1A 3F7VA 5E95B 2IPTH 4JFEE 5AZEL 1WIPA 1OWWA 3VXRB 1G1YA 1JWMB 3C6SA 5D7LD 5IFJB 4PJ7B 1Y18B 3VW3L 3ARGD 3NN8A 2PYEA 3Q0HA 3GI8L 3MLUH 1MJUH 3DURA 4LLMB 1OP5K 3CFBB 4H1LB 4OCYH 1FORL 4KMTH 1ERNA 4X6DE 2KQMA 3BKML 2EDXA 4ZXBC 1KTDB 2D0HA 2Z8VC 3A67L 1D5ZB 4JAMA 2ZCHH 1NCNA 1MCDA 3VFMA 3D87B 4TULL 3SGJC 3N0PB 4BFGA 4NQDA 1CLOH 3HPLA 2BVOB 5GRXG 1KFAH 1MHEB 4ODTL 5F7EH 4UNVA 3B9KD 1MRCL 2FJFA 3LEXB 4JHWH 2VNCA 2NX5D 3DLQR 1HEZB 4J3XA 3GIVB 4LDEB 4ODSH 3WFBH 4KZDH 1JGUL 3VXUD 1AD0B 5DHXB 4KRPB 2VDOH 4CVUA 4Y5VC 3DMMB 1N64H 4KAQL 5C09E 4ZDHB 3MV8E 2VLJD 1MJJB 5HDBF 4OAWA 5HVWA 1S7QB 2BRRL 3TBYA 2NY0D 3KYOA 4KUZL 2AERT 4ZO8A 3TP4A 3V7MA 5H37H 4M8VA 1A0QH 5FUOH 3CH1B 4K7PY 1BFOB 5D72L 1ZMYA 1UCBL 3ARBB 3ZHLA 3EDDA 1MFCL 2RCSH 1G0XA 1NCTA 3VWJB 4K55A 5TE7H 2YSSA 3PWVA 2IANB 1PBYA 5F96H 3BPOC 3SKOA 5HDQH 3PL6B 1AE6L 2Z93B 3WNKA 5D7JA 5F9JA 2Q86B 1JHTB 4E41D 3LAFA 2RGSA 4FMKA 2IALA 5EOCH 2HLAA 5HD8D 2HG5A 2Y06L 3BYTA 2AJXH 1E4WH 4BH8A 1FZJA 2D7TL 4JAMB 4NO3B 2A9NL 4OV6F 4I0PD 2FIKA 3VFMB 5EZOL 4WCYL 2DLHA 1CLYL 4XVSH 4NQDB 2D7QA 4QRRA 3F7RA 4GG6E 5F7KC 5C07A 1FN4B 1I8MA 4QRPE 4ZYKA 4G43A 3TYFB 4WUUE 4Q9RL 4EI5B 5DJ8B 3I50L 5DYOA 4OLZL 4LLWB 3HE7B 1F6LL 4O2CA 2ICEB 2VXSH 4HMEA 3MGOA 4WI9A 5GRJH 3ZL4L 4APQA 5B3JF 5E70A 3SOBL 1ZWIB 4PG2C 1N26A 2P8PA 2QSVA 4JDTH 3G6JF 1SJHA 1V3LA 1GPOL 3SKMB 1KXTB 5EBWA 4OAWB 4YO0A 2RJMA 3QCVH 1ETZB 1FL6B 4TTDD 5F3HA 1NBVL 1Z3GL 4GUPA 4NN7C 1J8HB 3HG1B 4WFFD 1HKLH 2NY1C 4R8WL 4DVRL 2ARJA 3EGSA 3AVEA 5MEOB 5JOFA 1HYRC 3EYSH 2HVJB 3SKOB 4Z0XB 2PTTA 4ZSOA 4NQEB 4XNMB 1B6UA 1S9VB 5EU6A 1IGCL 3WUWG 4LLDB 4KK6C 2ARJQ 1BIIA 4Z95H 4NQVA 5BVJA 4ZD3H 5FYJE 2X4UA 2HG5B 4XP1L 4KJQD 4BH8B 2IADB 1U8IB 4O9HH 3GMNA 5LCVH 1B6DA 5IOPA 2FIKB 4EI6B 4HD9A 1NCBL 2DYPB 3SPVA 3GMQB 1KJ2H 2YRPA 1BQLL 4QRRB 2HMID 3K0WA 5C07B 3QZWB 1UT9A 1VERA 1NCAL 3QDJD 4LVHC 3GRWH 2BJMH 3QNZA 3B6SA 3JV0A 5BJTA 3H0TB 5IROA 3I6LD 3P0VH 43CAB 3HE6B 1MPAH 4O2CB 3QCTH 3MGOB 1U3HC 2LU7A 2EDTA 3IDNB 3SDXE 3STZB 4APQB 1T5WB 2NY4B 4OGYL 3BSZH 3HC0A 3MFGB 3LKNA 2OR9H 1A6ZA 3ELAT 3GSQB 1GIGL 1SJHB 2WP3O 3WNOA 1OVZA 1F4HA 2LTQB 3NIFE 4YO0B 3TBTA 3BKCL 4QCIB 3GMOB 3H3PL 1OOAA 2VLKE 1FO0L 3ULSA 5DMKA 1TVHA 5I1EL 1PQZA 1FVDB 1XT5A 4MS8D 3PHOB 3T77A 2JCCF 1A2YB 5EZLA 2R1XB 5JOFB 3PUCA 1BFTA 5C0AB 4Y8DC 1YEKL 3DWTA 2A6DB 4G6JH 1QTYT 3QPXH 3FOMA 1IC4H 4LAQL 1WC7B 4D0CA 4ENED 5I1CH 3UJJH 2BNUB 1FQ9C 5T1LA 3MCG1 3U36B 1GC1H 5A1AA 1MCFA 3TO4B 3GMNB 5IOPB 5IW6B 4CBPA 3O4OC 4FQQB 3MNWA 4JRXA 4QOKA 3RX7A 5F9OL 5C0DB 1CS6A 4QHUA 5T1MA 4IRSD 3UMTA 1N0XH 4Z7UF 3QNZB 1XF1A 3WNMA 4FP8H 3B6SB 3CX5J 3VD5A 4HGMA 2W59A 3N1QC 4NQCD 2AXFA 1A1MA 3HAEB 2ZCHL 3QQ9C 4M43H 1K3IA 2V6HA 3LQZA 1F3DJ 4X7CC 1OHQA 1MFDH 5HYJA 3N9GH 3P4NA 3LKNB 4K3EL 4YDJB 4BQ6A 1EHXA 1KCUH 1CLOL 4PJHB 5CD3A 1KFAL 3BYYA 1EZVY 1F2XK 2LQRA 3PDGA 2DI8A 4MD5A 1G1CA 3WLWC 2Q7YB 2M26A 4P3DB 4I3GA 3MJ8A 4ODSL 4PJIF 5JDSA 3WFBL 3ULSB 3G9VA 1ZT4A 3EJJX 1JK8B 5D7JC 1PQZB 1QG3A 4WI2A 3BD3A 3Q2CA 2J8OA 3T77B 3SE3A 5J3HC 1BGXH 3V6BR 5EZLB 4JG1H 2DI7A 4E42A 2EEDA 1KB9K 4WI5A 1U92B 3L3IA 4AMKL 2BRQA 3L3HB 4C56E 2W92A 4D0CB 3BE1H 1CICA 3MR9B 3HS0A 5AZ2H 1VFBB 2EDYA 4JKPL 4KK8D 5FB8B 1UM5H 5ITFA 1FHGA 3LQMA 1O0VA 2CGRH 4NN6C 1IQDA 5TE7L 3RL2B 1WT5A 5F96L 2NY7H 4I5BA 4KTEH 1L0QA 5HDQL 2CR3A 3UYOD 4CDGC 5DEGB 4JRXB 4QOKB 1I9JL 4HPYH 1P4LA 1MEXL 4IMKA 3BIKA 5D93C 1WQVT 2Z8RA 1ZHBB 3G5XB 4L4VB 2K7QA 3PABB 4H5SA 4AL8L 1CT8A 3LZFH 4QYOA 4XVUD 2A38A 1A1MB 4PJFF 5GS2H 3U0PA 3UZQA 1FGVL 5CD3B 5FYLE 2D7PA 1G9MH 5TH2A 4ZPVA 1EUUA 4OCNC 4NRYB 2I9LA 2X42A 4PJ9D 1YEJH 3BD5A 3BWAA 1I4FB 1EXUB 5DLMH 4MB4A 4NO2B 4OZFG 1LEKB 4TSCH 1CIDA 4I3RL 4WFHD 4R4ND 2DLFL 1RZKL 1OW0A 1B3JA 4KTDL 4UILH 3LMJL 3AS0A 4JDTL 2WV3A 4ZOBA 3CFEB 1PYWA 2APWA 4ZUTA 5J12B 3NCBB 4HMCA 1LNUB 1JGDA 4E42B 4KKBD 3QCVL 4PJBA 4XPGH 2FX8L 2GK0A 4JHBA 3F7YA 3X3FL 1I1FA 3FZUD 1E4XI 1EH9A 2ZG3A 2Z8SA 5IMKA 4MQXC 4RIRB 2UZIL 2AI0H 4P5KA 5H94B 3GJFA 3NIDF 5GS2D 3DXAA 1BD2A 1FV1B 3RWGB 4PJ8C 4JPKH 3BIBX 4YFEA 2W9DH 4WFGD 1P4LB 3BH9A 5BV7C 3FB6A 4XMLH 5EIIB 1OSZA 4KROD 1JPSL 3BW9A 4NC1C 2IF7A 3PGCB 4H5SB 2I25N 1Q9LB 5ID0A 3QIUD 2F54A 5TDNB 1SYSA 3LOWA 4O9HL 5LCVL 2Z9TA 1QKZL 3DGGA 1X5FA 1YUHA 4HIJB 4ZS7H 3QDMD 4MSWB 4GKNA 4BZ2L 3ZT7A 3BKJH 3U0PB 4ZFOL 2UWEE 2Z91A 3MJ7A 3P2TA 2X4RB 1GGBL 5TH2B 2F53E 3I75A 4JLRB 1OTSC 2EKJA 2CKNA 3CSYA 2I9LB 3EFDL 3BWAB 3H3BC 3P0VL 4IRJC 3HMXA 5EWIL 1RU9H 3ARDB 3QCTL 5KVEH 2X7LA 1LMKA 1A47A 5CIPA 1B0GA 2OR9L 2DBLH 3MO1B 2DTML 3O9WC 3V5DA 4CVWA 1PYWB 4KH2A 1JGDB 4PJXB 4EQ3A 3ME0A 4PB9H 3VXME 2E6QA 1D5XB 1MSPA 2ICWB 1DANU 5JIPA 2P5WA 1O7VA 4LSDA 4QRSA 1EAPA 3HCVB 3L3DA 5D2NE 4BYHA 3WIFB 1CZ8H 3K8MA 4RGNE 4AZ8A 4Y2OA 4TOYH 2IPKA 1YMMA 1M05A 3PXHA 3X3GH 3D3VE 5DVMA 1CD8A 4DW2H 4OD2A 3LEYH 4NKIH 2CRYA 3QPXL 1NC2A 1IC4L 2EDOA 1Y0LA 1G84A 3W39A 5I1CL 3AC0A 5GRZA 4WTXA 3LQAC 4OLWH 3FB6B 5KAQF 1BEYH 3BW9B 3R0MA 1JFQH 3PWJB 3O6MH 1AIFB 1SYSB 2GY7B 4PY7B 5E6IA 4FOMA 4KHTH 4U1SB 3WUWA 1A6PA 1C5BH 4E0RA 4X6DA 4EVNB 2Z31C 3MOQA 4WI3A 4F7PB 3O3EA 3KJ4B 4TYUA 4KJPC 5E7BA 2YR3A 1JNJA 5LVEA 3WS6A 3GGWB 5KZCB 1MHHB 1OSPH 5T33H 1PKQE 5D7SH 4FP8L 3TYGH 2B4CH 1M7XA 4Z7VB 1CU4H 1MFDL 4ESKA 1YY8A 3GBML 3N9GL 5CIPB 3VH8B 5KVGL 2A77H 4GRWE 2CDGB 5L88H 5KOMC 3LV3A 4XWGH 3A6BL 1MLCA 3CK0H 2JB5H 2XPGA 1I1YA 1WT5C 4ZNCD 1GGYA 2XKNB 4K3GA 1GAFH 4BH7A 3N06B 5C09A 4QRSB 2X1WL 3MV8A 1YQ2A 1Z9OA 1TVBB 1WIUA 1EAPB 4IMKC 3HA0A 3DO7B 3G5ZA 4XB7A 1BWMA 4KK5D 4I4WA 2IPKB 3BJ91 3FCTA 5E9DD 4FN0A 2AABH 4P2OA 4JG1L 4JFEB 3NABL 1NC2B 1ZS8A 3TJEH 1MWAH 4M6MH 3W39B 1K6QH 3LEVH 1DEDA 3MRFA 5AZ2L 3TJHD 4TVSa 1G6RB 5TE6L 1BX2A 4TPRH 5IESL 2CGRL 3LS4H 1K9TA 4BKLA 1X5JA 1K4DA 1NLDH 4JJ5B 1CFQB 2K3TA 4K3JH 3ETBF 2GKIA 4XBEH 3JV4B 3O3EB 4NSKA 1OP3H 1PG7H 3SKUD 1YEGH 4HUWA 4U6VL 4N9OB 2XA3A 1DE4B 1UG9A 3LZFL 1DDHB 1QYGH 4GSDH 3OKEA 4MA1B 4GG6A 4YBHA 1V7NL 5EFIA 1NSNH 2ZPKH 2IQ9H 4QRPA 1YY8B 4PUBH 2AJ3A 5IB1A 4WUUA 4M1DL 4GBXC 1MY5A 1KB5A 4CMHC 1G9ML 3GB7B 1J1OL 4A6YH 4KU1A 5ICXB 1YECL 4WEBL 1DBBL 1NGQL 1I1YB 3VXUE 1YEJL 4EN3D 3ES6B 4BH7B 4Z77A 4HWEH 2RFXA 4TSCL 2GSGB 2QQNL 1BLNB 4QKXB 1IGJA 2VLJE 4O58L 3MRLA 1UH4A 4X8JB 1HQ4B 2GITB 1LDSA 3FCTB 3NH7L 4M6OH 4KI5C 4P2OB 4Q6IC 5ESQA 3EOTL 1RUMH 1P7KA 4WI4A 3KAAA 4RSVA 4XPGL 2EYRA 4JO1L 3FQUA 1SY6L 3RNKB 1BX2B 5CZVH 3DYPA 1KJMA 3IYLW 1EO5A 2AI0L 2DQHL 1X6LA 3P4LA 3MXWH 4M03A 3MRBA 4X5XA 4RAUB 5FECB 5J6GB 4GAYA 2CDEB 2BC4B 3H9SD 1AGCB 1RHFA 2F5AH 3C60A 4XMLL 5HHXH 4PLKC 3OGCB 1OAQH 4YDIH 4GRLD 2YPLE 4WJ5A 1T1ZA 4GAJL 4H88H 1S5HB 2G60H 1XH3B 5CGYC 4HBCL 3WFCH 2WSKA 4MZ3A 2AJ3B 4WUUB 3C08L 2CIKB 1UWGH 4OUUA 3IFOB 1KB5B 4FQHA 2AV1B 2A6IB 3SDXA 1L7TH 3VG0H 4N0UA 5C2BH 4XMPH 4U3CA 3TCLA 3UCRA 1A7QH 1UQSA 1RU9L 5KVEL 3TH4T 1IM9A 1IGJB 1Q72L 3MROA 4WVRA 1KC5H 4Z7WB 5DUMH 1MCLA 4F37F 4XCFH 4XNQB 2VLKA 4YIQA 1H15A 4NCDA 3QAZB 3DX9B 3IDXH 1V05A 4EBQH 4LEOA 2H9GB 1T2XA 1U3ZA 1WZ1L 4IS6A 2Q1EA 4U05A 2YRZA 3FQUB 3IFPB 1MJ8H 3OZ9H 4BFIA 1CFBA 3SDYL 3QUYD 2KBGA 5JQ6L 4WTZG 1J8KA 3X3GL 1KTRL 1QBLH 5BZDB 5I1KH 2OQJA 3OHXA 3MRBB 3LEYL 4NKIL 5B8CA 3AFLA 5DJDB 4ALAL 3JV6B 1NGYB 1NFDB 1BAFH 4QWWD 4NO5A 4F7MA 5DEFA 4RFEB 4OI8A 1BEYL 1JFQL 4WJ5B 3DUSA 5GIRA 3TZVC 5H35B 3VI3F 4CU8A 3O8XC 5FOJA 3U4BH 3SJVD 4NJ9L 4Z0BH 3I9GL 2LVEA 5EUKB 3T0XA 2PNDA 1U91A 3C6LA 1HH6B 4NDMA 4PRPB 5GGUB 4YDKL 5IGXL 5C6WH 1S7VB 4OUUB 4YZFE 5CP7B 4FQHB 4H8WL 3SDXB 3K8LA 1KPUB 2VLRB 3VFTB 1UJTA 3MNZA 1BWWA 4JFXA 5T1KB 4WRLA 1L9NA 4Q7DA 1D9KC 1BVZA 1CU4L 1DVFA 2COQA 3MROB 5DSCA 1ORSA 2A77L 5C7XH 3P9LB 3WE6B 1QP1A 1OT2A 1DEEB 2H3NB 4JFPA 4QT5A 4EZMA 4YIQB 2B1HH 4JANB 1H15B 4B0MM 1HSAA 1C08B 4LEOB 1XF5B 1P7HL 5KSUB 4JR9H 3JWDH 4NT6B 4FQXD 4LSSH 4UDUA 2E7HA 2A74A 5LG1A 5CEXA 3ZDXE 1JGEA 1OARL 4C56A 1IAIM 1U9KA 3GMPA 4OBRA 2VITA 5IK3B 2AABL 3ILQC 2OQJB 3OHXB 15C8L 5B8CB 4JY5L 3E1F1 4Y4KB 3SDCC 5D6DA 5AG9A 4JZJC 3LEVL 4UTAL 1JTPA 3DX7A 2E7LA 4PRID 2GT9A 5A2KH 2Q7NA 3I3DA 4TPRL 2LFGA 3OF6A 4WW2C 5GIRB 3LS4L 1YNLH 2H32H 4QTHA 4UOJA 3QUZC 4WI8A 5H37G 4XBEL 3ESUF 3V79C 2P5EB 4FQIH 1PG7L 1YEGL 2JB6A 3Q5TA 2GTZB 4PGCA 1JYXA 1MQ8A 1KACB 1ZT7A 3FTGA 3KPOB 4G3YL 1QYGL 1CQKA 3GSXA 4JFXB 4QHLB 1CLZH 2PCPA 2ZPKL 4PJAA 2IQ9L 5C1MB 1DVFB 1YEEH 5DSCB 1T83C 1AR1D 1DQQA 5CJ5A 1F6AA 3BGMA 4XHJD 3BD4A 1QPXA 3CFCL 4HJ0C 3B8SA 3L6FA 4JFPB 4QT5B 2WUBH 3RL1A 2FZ3B 1OAUL 4M7LL 3N85H 4M48L 3IRPX 4DK3A 2F58H 3NA9H 2FSEA 4G8FB 1U8JB 1IGFH 4HWEL 1KN2L 3WFEH 3S37X 2R2BB 1JIBA 1K8IB 4J3TA 1I8KA 2A74B 5CEXB 4P3CL 4QTIL 3GMPB 4OFIA 2VDPL 2VITB 1VB9A 4HJJH 5DEZA 4YNYA 5TFSL 1JBJA 1RUML 4JRYD 1DR9A 2QV2A 2CUIA 4MAUH 2V2TB 4JFFD 1DTUA 3DX7B 4I2XB 4NC2B 1B2WL 4PJGB 5IWLA 3M1BB 1AKJD 4J3OC 4AY0A 5CZVL 2HJLB 1LHZA 4QTHB 3IRZA 3P4OA 1BQSA 3MXWL 2AK1H 2Q3AA 5DD3H 1AO7E 1Q9OA 3AREA 1NCDH 1H0DA 5CJBA 1OAXH 2HJKA 4M5YH 3JXAA 2F5AL 4I18A 3U0WH 1J1XL 1OAQL 4HKJA 2DQFA 1I9EA 4YDIL 2EE3A 3QFJD 4M3KB 5C3TA 3EYUL 3MRRA 2MKWA 3OKKB 4Z7OF 5I19H 5E8OB 3ARFA 1V3JA 4MXQC 2F53A 3WFCL 4S2SB 4ETYA 4MMXC 5C0BD 1B0RA 3CSPA 5BZWA 4AK1A 1RIVH 1JI2A 3L6FB 4G9DA 4YR6A 3PDOA 3MQIA 1L7TL 4HV8A 4TSAH 2LU4A 2CIIA 2GJJA 1NEZG 4HKXA 2FSEB 2ZKHH 3QRGL 4OCWL 4WFHE 5C2BL 1A7QL 4IDJH 2Q87A 1KTKE 1A6TB 1MCKA 1ZK9A 2VB5A 1Z9SA 4O5LL 5KOVC 1MHPH 4PV9A 1D6EA 1E6OL 3NFPB 3VXMA