3WUZA

Crystal structure of the ig v-set domain of human paired immunoglobulin-like type 2 receptor alpha
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
MLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired immunoglobulin-like type 2 receptor alpha
publication title Structural basis for simultaneous recognition of an O-glycan and its attached peptide of mucin family by immune receptor PILR alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 29
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuzA00
1QG3A 1JK8A 3KLHC 2IQ9H 1NGQH 5BS0E 2DLHA 2IBGA 1A1OB 1AQKH 3X11A 3SDCD 4ETQB 2WINB 3RNKB 2EYSB 4K3DH 5DMJB 5HGGS 1R3KA 2Y25A 5I1HH 1KEGL 3VFTA 5JXAH 3EJYD 3VFNA 5C3TA 3AS2A 5BJTA 4D9QD 4JFDA 2WBJA 2RQ8A 4GW4A 5BZWA 4H8WC 2PR4H 5D2NE 3T3PE 4MYWB 4XVJH 2YC1B 4IHOB 2JB6A 2B1AH 1J1PH 2F58H 1XF2A 4XCYB 2XV6B 1G7MB 2X7LB 1KCLA 4MJ6A 4KKBC 5K33A 2ORBL 3QDJE 3ARQA 2DJ4A 4IIQC 3LS5H 3ZE0F 1A7OH 2P7TA 3IJYB 4N1HB 3U9UA 4LCCB 5B3JE 2GAZA 5D6CA 1U3YA 2J8UB 3V52H 4LGPB 1RUML 5MI0B 5DD3L 3QJHA 2EO9A 4XVSL 1S7UB 4CN6A 3MRQA 5M94B 4DAGL 4AYFA 4R8WL 1Q94B 1CDUA 1WF5A 1P7KB 3G5YA 4RWYL 3QBTB 1F6FB 5HTSA 4HQQH 4J23A 3QRGH 5IROC 1YEFL 5AD0A 4WU7A 4EI5D 4NQCE 1ZEAH 1NCUA 2MCPH 1L9MA 5IHUH 3ZTNL 3DIFA 1QO3B 1SJVA 2P8PA 1YEGH 3VWJC 4EDWH 2JIXD 3MROB 3NCBB 1OW0A 1BBDL 5FDWA 3WFBH 5HYQB 4JQVA 2B5IB 3S88L 1OTTD 1RZKL 4QHUA 2ERJB 4TRPL 2YPLA 3O6ML 4OCWH 1DE4A 4YE4L 1HN1A 4PBWD 4ZS7L 3ZKMD 2VOTA 2AJXH 4QF1A 1PD6A 5I30L 4YFLI 3HI6H 2BNRD 1JE6A 2IAMB 4J3WA 1J05B 3K2UH 4YK4B 2K3TA 3PP4L 1NFDE 5HJ3A 1FNSL 2CJUH 3WIIH 3KPPA 4QY8B 4HKJA 1AGDB 1KNOA 5EH1A 4G7VH 4X4YB 2WIIA 1NANH 1T6VN 4GXUM 5JO5A 1RHHB 2NNAA 5DJYB 4LSRL 4NC1E 3NCMA 4QHLA 5LQBL 1G7JA 5CKAA 5IB1B 1BFTA 1RZJL 4LU5H 1MF2L 4WFEE 2EICA 1YYLL 3VJ6A 3RTQD 1NDMB 3PWPA 3WUWA 4ODTL 5INCB 4PV9B 5F7WC 1KPUB 1K8DA 4LAQH 3DMMC 4HDIA 3TYGH 1DQJA 3EZJB 4IBLT 1GZQB 2I9TA 4LVNB 4GS7C 2C3HA 4C56D 5CD3A 3NFNA 4P4KC 3RGVB 2OZ4L 3ESVF 4MA7H 3L3GB 2DBLH 5T1MA 2IH1A 3PDOB 2O61A 1I3GL 2GSIB 4JB9H 3G6JE 2WQ8A 4P2OA 4ODSL 1Z5LB 3VCLB 4DKFL 1FNHA 4TTDC 4WO4A 3EYQC 3EFFB 2A6KB 3J7HA 2EXYC 2R69L 3HAEH 3OKMA 4R0LC 2I5YL 4OI8A 1YNTB 2KZ1B 2OZ4A 4X6CA 2V2XA 2PXYA 4N8CL 2A6JA 1CQKA 1Z6JT 3HG1A 2X4NA 4XAKE 3CDFA 5EZOL 3STLA 3LQZB 1JFQL 2D7PA 2VH5L 3TC9A 4OV6F 1R5WB 1MCHA 3I6KB 2C7UB 3QQ9D 1AY1L 5HHOD 2R1XA 4QRRA 5BZDB 3ULVC 1MRFH 3STZA 3U46B 1J11A 4DVBA 4F9LC 3I6GA 4DK3A 1CE1H 1WIUA 3FQRA 3CVIH 2WBKA 1MLBB 3MUJA 5EC2B 1HHIA 5FYJU 3CVHB 1DQMH 4U6XA 2XPGA 43CAB 5EZIL 3BQUD 4F8QA 5DA0B 3P4NB 2GUOB 4NQVA 1E4JA 5MHSD 1F6AB 1R5VA 4X6EB 5T1LA 4H8WH 5TJWK 1W72B 4U3XA 1DLFH 3PUCA 5BW7C 2BOCB 5F9AC 1GGBL 4PBXA 4HZLA 3WXVL 3KYMA 1LO4H 4G80B 5IBLC 3VH8A 5FM4A 1X3DA 4N9OB 4NKOB 4G8GB 3V4VL 2XXMB 1JPTH 4YDVA 2CKBA 3CLEH 5C2BL 2P5EB 2R0LH 4G6JH 4FQLL 3SDAD 2ATKA 4Z95H 1W72L 1QVOA 4TSCL 4F8TA 5A3ID 1PKQA 3OF6A 4X6DA 1S7TA 5EO1A 4Y16A 2EKSA 2CLRB 5GRJH 3D39E 1J1OL 3FKUS 3LHPL 4OTXL 4UNVA 3B3IA 2FIKA 1WEJL 2B1HH 1VDGA 4TVPE 3SOBH 3GSOB 2D7QA 3VFMA 1IAKA 1KF9B 3RZCD 4HKZB 2VLKE 5CSZA 4MB5A 4N0UA 2AJVH 5I17B 1NL0H 5CS7A 5D2LE 4JZNB 1B0RA 4G8IA 1AO7D 3L7FB 5GSRA 3U7AA 1F3JA 2GK0B 3A6OA 1WBZB 1AIFB 1H8NA 4RGOL 3GMMA 4ODWA 1FJ1A 4M7ZC 1MH5B 5JOEA 3FFCA 4YR6B 1B88A 3IFLH 2W65A 5I1KL 3GMNA 3V5DA 1FSKC 2P42B 4PUBH 5EBLB 2AK4B 5DUBA 1MHEB 4OUOA 4GRMA 1IQWL 4CMHB 3WO4C 3QIWA 4G9FD 4E42A 3VRLF 4JO3H 4D9RE 3AREA 3VGFA 5ENWB 4HLZH 4Y0GA 5F9JB 5CGMA 1GAFH 3DJ9A 4Y2DB 3MOAH 4PRHD 3DRQA 4OI9A 3DO7B 4JR9L 4PJ7B 3JUYA 4X99A 4POZC 1F3DJ 4ELMB 1MY7A 5ALBH 4KTDL 2NTFA 4KUZH 4NOBA 4UT7L 1VEPA 1MIEL 1NEZA 3TP4A 4BUGA 3MBXH 2OMBA 4LSTH 3O41B 1XGUB 3CPLA 5AYUH 3TCLB 2FBJL 3BN9D 3NPZB 2DIAA 3DWTA 2FX7H 1MELA 3C87A 2F53E 1A1MB 1NAKL 1PZ5B 1QR1B 5HHNB 5ITBL 3QDJA 3S4SB 3LMJH 1FL5B 1BZQK 3D0VA 3ETBF 5K9QI 2I9LB 3T2OA 5CWSA 1NGPH 3GB7A 4NZTH 5LVEA 3WS3B 1JGLL 5F1KC 1S9YB 4QRSA 5DS8B 5F72S 4G3YL 5IB4B 5JHDB 4LPXA 5FB8B 2XZCL 3QPXL 5DD5H 2E9WA 3ET9F 4LGSB 1KC5L 1QSEE 3OGOE 1BBJA 2NR6C 2FCBA 1J86A 2HMID 5DC0A 3OKYA 1A6TB 1H3UA 2X1PA 4X7SL 4HWEL 1XGRB 4DK6A 4G8EA 1OAXL 2BC4B 4LSPL 4W4NA 2QHRH 5FO8A 3C5JB 3ULVH 4FQJL 3IS0X 5EZLB 1KFAH 4FXKB 3TPKA 2NY6B 1S5HA 3V0WH 3H9ZA 4KI1A 3PV6B 3OGCB 1TZHB 5EU5A 3HI1B 2Z31B 1R3HB 2P5WB 3NZ8A 3TVMA 3WDIA 5DJCB 3TJEH 5HD8C 1ZS8B 4I5BB 5I75C 5ILTL 5L2KD 3AFLA 3VGDA 1FO0B 1T3FA 2VXQL 5FOBA 5DI8A 1FFNA 3T0EB 4D0DA 1BF8A 4M5YL 1A8JH 1DQQB 1UCTA 5J56B 2GT9A 1CDGA 1BOGB 2VLJE 1T0MA 3C2SA 5C09D 1KTLA 3QDGB 1ZT7B 3VWKD 3FB5B 3KLAA 4FMKA 5E4EB 1OSPL 2V17H 3UDWC 2F5BH 1NSNL 2DLEA 4ISVB 3MRDB 4NFDA 4P4RA 1EEYA 2MHAA 4NKIH 2ZNXA 2W9LA 3ARZA 5JW5B 2OR7A 5I1AB 4OD1L 2ICWB 3L5XH 2NLJB 1URLA 4JE4B 4OCRH 5CBAA 5E7FA 2Z91B 1FV1B 5FGBA 1WWBX 3PHSA 2EXWC 4D0CA 1H5BA 3KLSA 4PJXB 4X9BA 3QULB 4MXQD 1G6RA 3O4LD 2XOTA 5I0DA 3VXTA 4KPHL 3K7UA 2JB5L 1Q8MA 1HZHL 4AT6A 1KTRL 1AGBB 3CVHH 2X1OA 4X8JA 2FIRT 1UVQA 3CK0L 4M6NH 1RIHH 3DPBA 1MCDA 4GRLA 5C0BA 3VXQA 4QXGL 5C8JA 3GGWA 3KPNB 1IC7H 1DL7L 2P48B 1SJXA 2R9HC 3QUML 3SGEI 3RIAF 4XAWH 2J1KA 4PJ9C 3HUJB 3SGKC 1EFXD 4XXDA 3BPLB 1CT8B 3BP6A 4Q6IA 3X12B 2OSLB 5CSGA 1FGNH 1C16A 1FAIH 5F7KC 4YX2H 3B9KC 3ARPA 4OLUH 4QYOA 3S36L 1OGTB 1O7SA 2UUDH 4ZFZB 1JHKH 2P8MA 3DSFH 4TUOB 5DJ8B 3QUMA 3CXDH 5EC1B 2PO6B 43C9A 3BFOA 1JF6A 4WUUD 3W9EA 1HQRA 3VD9A 4MNQE 3T04D 1E4KA 5CEXA 4ZXBD 2JTDA 1IL1B 4L8CB 2NPLX 4U6TA 1JI1A 4FQXC 3IDJB 4CMMA 2QSQA 2V9TA 2P4AB 3GSRB 4MQSB 5DK0B 1V3JA 3BDXA 2FYYB 3NCEB 5F1NB 3KPQB 4EI6A 3SDCB 1NPUA 4OD3L 1RZ8B 3HNTH 2VXUL 1S7RB 3FT3A 2EDJA 3H42L 2ZCLH 3LZFH 4J4PD 4XP5L 2R15A 1VB9A 5KG9A 1BQHA 1N2RA 1SBSH 2MQ3A 4FQHB 1YN6B 4MJIE 2XACC 4ALAL 2D03L 1GGUA 3R06B 3MRKA 3GIZH 4OQ1A 3ULUL 3OXSB 2YSSB 1P5UA 1AGEB 3SDXE 4XPAL 4XP9H 1BFVH 2YHGA 4S11A 5IB3B 5KSVA 5IBTH 4EUPA 5CJ8A 1QTYT 5K9QG 3MPCA 1BIIA 3UJJL 5DJ0A 4U1MA 1IGIL 5FA3A 5DRZA 4ZAKA 4UILH 3PDDA 4TPRL 2R56H 3BWAB 2HT4C 1IC1A 2BVOA 2KPNA 3D39A 1A9BB 3BZFA 3ALPA 3FQXA 5F88B 4O4YL 1V3LA 3QQNA 1UENA 5GHWH 3WFEL 4KZDH 2IPTH 1T0NB 2VLKA 1LO5B 3FQTA 3GRWL 3QIUB 5GIRA 4F2MB 1U95B 1KN2H 3ZL4H 1DCLA 5IHBA 1K85A 3IXAB 4EI5B 2WWKO 3X13A 1BD2E 2E5EA 5I73C 1U8IA 1JN6A 3MV01 4Z7UE 1ZHKB 3Q3GA 3L3IA 1N6UA 2JIXB 3EYSH 2P24A 5HPMA 4X7TA 5CJ5A 1UH4A 2IWGA 2Z93B 2ARJQ 1CU4L 1Q9OA 4DTGL 4K23H 2PYEA 4PRDB 1KELL 3FOLB 5GJSL 3KPRE 3RFZC 2DQGH 3U0PA 1RULH 4DGVH 2CLVB 3OKEB 5ICZA 3DXAE 1TTFA 2BNRB 4PJGE 2JKXA 4DW2L 1NCCL 5DHVH 2HT2D 3O3BB 2NY5C 2RFXA 3L5JA 5GGQL 2SEBB 2PTTB 3MMEA 3V6OA 1UZ6E 1YMHB 1NBYB 2VLME 4PJHB 1HIML 1IAIH 1MHCB 4WY7L 4XC3H 4YGVB 3OKNB 4O2EB 1UH2A 4A2LA 1MFBL 5DLMH 2AXGA 3UTPE 4DOHE 3UJIH 2FD6H 3RTQB 1R5IA 4K9EL 4U0QB 3OHXA 3FONA 4PJCE 3PWPD 4EI5C 3DUSB 4X4ME 4ZTPH 4WI4A 1KPRB 1YPZF 3BWUC 1EO8L 4UDTB 5C1MB 1Q1JH 3MV7E 3AXLA 1IKFL 4C56B 3NACH 3GMLB 4AEHL 1KCRL 3W5NA 1OTTC 4Y5XA 1FO0H 1HYSD 5IV2B 1ZLVH 4NNYA 3LKRA 3VFUB 1D6VL 4JAMB 2N56A 4HJ0D 3ZKMC 4BUHA 2ZSWB 1JHTB 4LCWD 3GMOA 2HKFH 4XGZA 1QSEA 4WO4D 4ZFGH 1SMAA 4YDLB 3PWJA 4P99A 4LARH 2R0ZL 2ZG3A 4EN3B 1LO2L 4A6YA 5HXMA 8FABB 5T3XL 2J6EA 4HPOL 5DDHA 4AG4L 2XY2A 2VDQL 2PXYD 2X4UA 5DRWB 5I1LA 2AKRB 2ATPA 1RJLA 2VAJA 2DKUA 2XA8H 3CFDA 3HG1D 4RGNE 5F1IB 2VLLA 1WLHA 3VXUE 5HHOB 4PD4K 1UWEL 4NCC1 3TO2B 1QFUL 3CH8A 3SBWA 4OD2B 5GS0C 4QRRD 4ZS6D 4R7DB 5J9PA 2EH8L 2X1QA 1A7QL 5J13C 5I8EA 3BQUB 4F37K 4HUWA 2QQKL 1IRAY 2OL3B 3O0RH 4JN2A 1G84A 1NFIB 3VGAC 1MCKA 3S37H 4X7FC 4UNUA 2DLFH 3DBXB 4ODUA 5T1LD 1IGMH 1GVIA 3MA9H 2F54A 1CZ8L 2FGWL 1M1SA 5MEOB 4H1LB 4Q9QH 1XH3A 4LOUD 4KKNA 1RZIA 1R3JA 1G7LB 1BQUA 3C2AL 4OUUA 4XPGH 4ZO8A 5CP7A 5SX5H 3U1SH 4WEUD 3ZE1E 3BRFA 4YDLC 5EWIH 3TBSA 3NAAH 2OLDA 1K8IB 3SDAB 3FAWA 5DURB 3BD3A 3HPLB 4LCIL 2VC2L 1OF2B 1OP5H 3PL6D 4JPVH 3MLTB 4FQIH 4QXTB 1Q9LA 1DQDL 3QQ9C 2HFTA 4QTIH 3D0LA 3OF6D 3VXSD 4UDUB 3A6BL 4HXBL 4Y16D 5D7IA 1P7QA 5BMFH 1QSFE 5FGSA 1IAOA 3MV9E 3Q5TA 4NQEB 5JW4M 3HMWL 3RZCB 3RWHB 1L6ZA 4NN6C 5E94A 4NYLA 5GGTL 3UO1L 5TF1L 1KEML 4OJFL 1IGFH 3TCXA 2LU4A 4EQ2A 4OZIF 2VDLL 4BH8B 3JTSA 3IJHB 2RJMA 3BQUC 1YZZA 3RWFA 1YMME 5CINL 4PG2C 3RP1A 2ADJB 2E27H 3FTGA 3RA7L 1A02N 4I9WD 1IGTA 1A1NA 1CE6B 5GGTA 3LKOB 3HZMA 4HGWB 3Q6GH 4L8SB 2NY5H 3FFCD 1ULVA 1TTUA 1JPGA 3N1QC 3PGDA 1IGJB 3FN3A 3IAQA 2Z4QB 3HI5H 1T1WA 1RZGA 4G9FB 4KK9C 3DVIA 2L7JA 3RX7A 4WJ5B 2DM4A 1J8HE 4MGXA 3PWNB 3QIWD 4HS6B 5D1QC 4N8VB 3MXWH 5FYKU 1T5WB 5I19L 1MCNA 3ARED 2UZIL 4PRHB 1S9XB 3RY6C 5BS0D 4NC2B 2K7PA 3QI9D 5A3IC 1MVFA 2AJ3A 4JFOA 1FH5L 2QL1A 3SQBA 1QHPA 2B7DT 2H3NB 4F9PC 1JNJA 5C0DA 4QRPB 1T89A 1WFNA 2IJ0C 2YD8A 4MJIA 1S9KC 4ESKA 1S5IL 3HE7C 1BVLB 3ROLB 3IGAA 3ZHKA 3HMXL 4MLSA 3SDXA 4MJ4A 4M9OA 2D9QB 3D25B 4TUJA 3MQIA 2EDKA 4OGXL 1A7NH 2X44D 1A2YA 3O6LH 1UJ3B 1UM6H 4JJ5A 4I48A 2KZWA 4XWGL 4JDVA 4MDIB 3W9DB 4ZFOL 4M7LL 1FNAA 3QDJD 4AY0A 1WFTA 2BFVL 1IGCH 3ZDXE 1BAFH 2DQTH 5F89B 5JNYA 4CN4A 2QJDA 4CVUA 1JYNA 4NT6B 4BQ9A 4DKAA 5D1XD 2Q3ZA 4E41A 4Z8FH 2JCCF 4NFCA 2GJ6E 3VD3A 1VKXA 2C4FT 3MUY1 2Q87A 1MI5A 1A64A 3BH9B 4ZFOA 4NDMB 4FNLL 5KANG 4NKQB 3WXWL 1V8HA 2X4QB 1AD9A 3OKDA 4M6MH 1BD2A 2D4DA 4TNVK 4NQCD 4Z7UA 3C8KA 2BMKB 3TWCH 1FRGL 5GS0H 1QEWA 1QFWM 4JREC 2FJGB 3UYOD 1QLEL 5D6DA 1U8NA 4P3CL 4U1IA 3D85A 4YFLF 2CIKB 4K8RD 1MAKA 3TVMD 2DF3A 1JRHL 1ORSB 5E24E 2BY2A 5L2KB 5HHME 1UT9A 3QNXB 3BN9C 4MJ5A 3EDEA 3QUKA 3ZT5A 1EIBA 3I6LE 4XX1E 1CLZH 4GXVH 1XR8A 2GIYA 5JOFA 3MRHB 5KVDH 4H0HB 2CXGA 4XNZB 3RL2B 1P1ZB 1ZTXH 5C09B 3VWKB 5L6YL 1U6AL 3O3DA 3QHZH 5AWNH 3U4EB 4U6YA 2Y6SC 4B7IA 1QD0A 1S7QA 3QR2A 1ORQA 3MOBH 1P6FA 3FO0L 1DLHA 1G7HB 4DN4H 2QADD 1ZSDA 1A6PA 1TJHH 1C08B 4WFED 3U2SA 2B39A 4XRCB 3T0AA 3GO1L 4GUPA 4LLQB 3KNBA 4MD4A 3QRFM 3FCTA 4PP2A 2LQRA 4GSDH 4LLMB 4FTVE 4X4MA 4LEXH 3QHFH 2DKSA 3EIFA 2HRPL 4JFQB 1CDHA 3DI2B 4HBCL 3MV7A 3O4LB 1T1ZB 3QUZA 5INDB 3JV4A 3O2DL 2GTZB 4XCNA 1KCSL 4PJIF 3S36X 1UYWH 4LLYB 3H3PL 5LGJB 4LF3B 2FO4B 1LO0H 2C9AA 4NKMA 5HHVL 1BX2A 5JPNB 1MNUL 1F11A 3EO9L 2VWEE 1UH3A 3INUL 4H5SA 3O2DA 5LWYL 5MERA 1I7ZB 4G5ZL 4GBXD 1ADQL 4BFIB 4NQUA 1EFXB 1B90A 4M43H 4H1LH 4TSBH 5IR1A 5HVGB 4F15B 5FM5O 1ZLUH 5AZ2L 3FO9B 4KRNA 4NNPH 3QIBC 3ZMRA 5IMOA 4NRZA 5DJAA 4Y8DC 5TFSL 5ADOH 1LEIB 5I16A 1EBPA 5ANME 3WBDA 5EO0A 3VA2C 3V6ZA 1B9ZA 1DBJL 3QH3B 4XAKD 3JWDC 4OZHA 3VXUA 5KJRH 4YHPA 2Y72A 1A7PL 4KK8C 4ZXBB 3AMKA 1WUNT 4YWGL 5IW1B 2WBWB 2IFFH 1N5YL 4YZFF 4Z7WF 5EORH 5GGRY 4PJ5B 1F4WL 2ICWI 3MBED 1XZ0A 1XF1A 4IOFC 5EU6E 3U4BH 4LAJH 3TBYA 2YMXL 4MXQC 1J0JA 3BIBX 4Y19E 5C2UB 2ADFH 3D3VE 3MO1B 3KWWA 3TM6A 4UV7H 3O3AA 1T20B 4I8DA 1FVDA 4OZFA 2WUCL 4GG8A 1AD0A 1PYWA 1U58B 5FECA 2DLIA 1GZPB 3NIDF 1U8PB 5HGHA 3QB7C 4G43A 4L4VE 5B8CA 3S5LB 5F9DC 2H8PA 2HLAB 5GGVH 2PCPA 4G6MH 2BNQE 5I1JH 2R1YB 4ZPTA 1JTOA 2GCYA 1QLFA 2BSED 1HHJA 4ZAKD 4C58B 2A1WL 1W8OA 1A6AB 1TVBA 1V05A 2IH3A 5C0JA 2FX8L 3D39D 1RIUL 4Q74A 3MV9A 4TVPD 5GGSY 1N6QH 3MLPA 2H1PL 1HK6A 4IM8A 4Y1AA 4PJDB 5C0RH 3SE3A 3GBML 4M8QB 1YMMA 1OAYL 4YHLH 2XWBA 5FDYA 4CVZA 3HLAB 5KVEH 5L2JB 5GSVB 1OPGH 1FFPA 4GMSH 3BGFB 5F9WB 5KAQF 3TZVA 4PJAB 3M8OH 4J7RA 1YUHA 3GKWL 4WEBH 5CCKH 5JIKA 3U30B 1DBBH 3QEUA 3GMRA 3QSKB 4Y4FA 2XTJE 1HH6B 3LRGA 1Z9SA 2EDTA 4LRIA 3ARGD 2WBJC 1OARH 3MV11 4DGYH 3IKKA 1MY5A 1YNKL 2OR9L 3DUHA 1FDLL 2MNUA 4JRXA 5C0IB 3U83A 3GBNL 3S4SG 2P46B 2HG5A 2P8LB 2GSGA 4D9RD 4E5XA 1LMKA 3MXVL 5JQ6H 1N8ZB 4U1NA 3OR7A 5E6IA 3MCKA 4KHTH 3VFRB 5M95B 1ZA3A 4DN3L 3ROOA 4HC1H 4XBPB 1ZLVK 3TFKD 3OX8B 4KKLD 4HWZA 1BP3B 2ID5A 2OM5A 3P4OA 1W0VB 4ONFL 4U7KA 4JKLA 3QEGH 5JA9A 1FVEA 3QEQE 2WAHA 4QCIA 4JDTL 5E8OA 1PAMA 1TFHA 4GAJL 4LMQI 4NGHL 3VXRB 3P9LA 1SJHA 3V2AR 2XYCA 4Z7VB 5K93A 2XKUA 3U82B 3AMLA 1MEXH 3EYUL 4JZOA 3BO8B 3ZDYE 4BQ6A 3DX8B 4GLRH 3CZFA 2F53D 1NBQA 5ECJE 4ELKA 1OW0C 3NH7L 3U30C 4HJJH 5EBGA 4JQVC 1RK0B 1FZOB 1JNLH 4RZCB 5TQ0L 2APFA 15C8L 3V7AG 5B4MD 4EVNB 2NY0B 5SX4I 1AFVH 4PGDB 25C8H 1HI6A 1MJ8L 2IH1B 4LCWB 1DDHB 4ZNEE 2GEEA 4RBPK 4NO0D 4UIKH 3RIFK 2HT2C 2W91A 3BUYA 4PJFB 4PTUA 2LAAA 5DZOA 5C9KA 1UM5H 3QA3A 1FGVL 5GZOD 5IFHL 4DKEH 1QSED 3JWDH 4G8FB 4HEME 4RFEB 2V2WA 1KXTB 5IFJA 1EXUB 1G9NL 3O8XD 1UQSA 1S7WA 4G42B 4N90E 1I3RA 2WP3T 4PR5A 4Z0BH 4LKCB 4FZ8L 5DK2B 3NIGE 1D9KD 4OFKA 2DD8L 4DGIH 5TE4H 4CADB 3MRGA 1AP2B 1T2XA 5J7CC 2F8XC 5TDNB 1N4XH 1VADA 1KT2B 1TVHB 1WVZA 4O58H 2W9EH 5JW3L 2I60L 1U41A 3LEYL 4K7FA 5FGCE 5JIHA 1A7RL 3T8XA 1YDPB 1BJ1J 4MCZB 4XVUD 5IOPA 1K4CA 1MRDH 4NRYA 4YUEL 3HPJB 5F6IC 4D0BA 1JPSL 4ORZC 5J6GA 4JANA 1B0GB 1MWAL 2ARWA 4C4KT 3MRFB 3BZEA 2DICA 5KVFL 5CMAA 5EO9B 5DTFA 5ICYB 1P4LB 2WSKA 3IDXL 4X6FA 5F96H 2J88L 4HX1B 2YPKA 3K46A 1CLYL 4ZUUB 5T1LB 1OP5K 4LFHD 4RAVB 1HYSC 1P6AB 2VLJD 3UPRB 4MA8H 1C5DB 5I1CH 1PEWA 4OFYA 4IEFB 4CN1A 2EECA 3K8KA 4P46A 2WWKT 2NTSP 4KVNL 3IYLW 1CFTA 4UQ2B 1ND0A 2NXZC 3RWDA 3UC0H 4DZ8A 2XICA 3QNYB 5FUZH 4ZYKB 4WO4C 1FCCA 1TNMA 3CDGA 4KQ4L 4GKNB 4WDIB 1J5OH 4NJAH 2HYMA 2EDWA 3HRZB 3BEWB 4UOW1 4F7PB 1F90H 4XP6H 2X10A 3NZHH 4FTVA 3WD5H 5DJZA 2EIEA 3MRNA 5I1IL 2X4OA 2MCG1 4HJGB 2PXYC 1WCQA 4PB0L 3H0TB 3PL6B 4EUPG 5EOCH 3VG0L 2Y9RT 2QQNL 2JJUA 1UFUA 12E8H 4K3EH 3VXSB 4RQQB 1MJ7H 1TZIB 1DVFA 4GW5B 1B2WH 2BJML 5DEFA 1L4IA 4X4XB 4DQOH 3KXFA 2BVQB 5CBEA 4LSUL 4MD0B 4ZS6C 3H9SE 4MXWH 1X7QA 4WHCA 3GJFB 3OR6A 2YBRA 3LKNA 1DEDA 3BP7A 4WWID 2J5LC 3IFNL 3TIEA 1C7TA 4AEEA 1YEJL 1I8IB 4LLWB 4WW2B 5HI5C 4KI5E 1S3KH 2Z92B 2V7HB 2VRAA 1OB1A 2YUWA 1N5AA 2HVJA 2GTWA 1INDL 1KPVA 2AEPL 1TPXC 4HMEA 5DT1H 1HDMB 1I4FA 4MNQD 4E0RA 1KIQA 3FO2B 2WZPD 1EUUA 3IDNB 4MQXD 1MAMH 1FYTE 3MGTA 3NCCB 4XI5D 5EU6A 1I9JL 5EUOE 3QFJE 3IDMA 2OQJA 2ZOKA 3MLRL 4CU7A 2APWA 5BS0B 1OWWA 3QI9B 1BQLL 2CIIB 3Q6FA 2Q76A 1TJIH 2ORBH 4B5EA 4Y19A 2JE8A 1J8KA 1HINH 4Z5RA 3D3VA 1AHWB 5JXEA 1ZVHA 2ICCA 3O11B 3SE4A 3MLUH 3QXDB 5IVZA 2KBGA 1P53A 4Y16C 2XRAH 3O6FA 4WHYG 1VFBA 1RUMH 3ZKNC 1MQKL 3FT4B 3ULSA 3EO1B 3Q5YA 4XVSH 3O4OB 2Y5EA 4K71B 4U1JB 2IBZY 4MJID 5E8PB 4RNRB 4F58L 3T3MF 4AM0B 1J12A 7CGTA 3NFPA 2HFEA 5D2NB 5FGRA 4R8WH 4L4VA 1AGFB 4QT5A 4HS8L 4HWBL 3HC3H 3RDTD 1IAMA 1ETZB 1WBYB 1VACB 2CQVA 3CFCL 4O2FA 1NGZA 1CGXA 4X9HA 3I2CL 3KGRA 5JPMB 2BNQA 3Q2CA 1I8KB 5A16A 4HKXA 1NCDL 2V7NB 3QO1B 5FF6A 2W60B 2FSEB 5D1XB 4HWBA 1FIGH 3DI3B 1K2DB 1RZKH 4PTTB 5EU4B 3G5XA 1H3PL 4ZS7H 3EGSB 1ED3A 3GSQB 3QIWC 2WWMD 1F02I 3C9NA 5IF0A 1BBJB 4FABL 1ZT4B 3AREC 2JK5B 3LV3B 4X83A 1FNSH 2X89A 3BH8B 4NQCB 3QI9C 4MD5A 1MCLA 3RZWA 2AJZB 4NQTA 1BD2D 1PQZA 4AENA 1M05A 3BIAX 5HPOA 2YUXA 4CVXA 3SQOL 1VFAA 4KC3B 4OGYH 1TETL 3GIVA 1S9VB 4WV1A 1QRKA 4LSRH 1FG2A 2DTML 3D85D 3O4OC 3KPRD 4NJ9L 1UZ8A 3BRGC 1CFQA 5I76A 3TNMB 3DXAD 4GG6E 1T1XB 4KWUA 2H32A 1XF4B 1NFDB 3QAZB 1HHHB 5EU7E 1JZ2A 2ED8A 2B2XH 2J8UF 1IZKA 5DSCB 3MNZB 1GHFH 3MACL 2XWTB 4XMPL 4MVBD 3ZYJA 1L0YA 2Y5TB 5KS9E 2VLMD 2D0HA 3C6SB 3LS4L 5IW6A 1AJ7L 2OZ4H 4JG0L 2WV3A 3QEQA 1RJYA 2UYLB 2OJZL 1MCIA 3LH2L 3VA6A 1UM4L 3UTPD 5I9QB 5H2BA 1EEYB 4M02A 1TZGH 1JRHI 2WNGA 5F3BB 5ALCL 3H8NA 2Z9TA 1ZLUK 3VMOA 4NKDA 4POYA 4LLUB 4ZNCD 4OKVB 5SWSE 5E08H 2EC8A 1FCGA 3P9MB 3BGMA 2A6IA 5C6TH 1JPFA 3MV7D 3QFDB 1ZLWH 4M61A 5C0CD 3QUZD 1GJIA 3WHE0 2BNUB 1XFPA 3RL1B 4K8RC 3N9GH 5FYJL 4L4JA 4X8JB 5BVPL 4U05A 3TVMC 5FCUH 1DANT 4ZNEA 3G6JB 3EHBC 1AY1H 2XG5A 4LSVL 5C8JB 4WU5A 5J8OA 1KJMA 3HE6D 1FBIH 3OZ9L 4GBXB 5E2TL 5KOVC 2EDEA 4LBEB 4JY4B 5HI3C 5I1DA 3QAZC 3U7YL 4MA3B 1ZVSA 1HILA 4QHMA 1DUZA 4JFEE 1PBYA 1T2QH 5I18L 3WNNA 5EZIH 2R8SH 4ODXB 4KZEH 1Y0LB 3MR9A 1LHZA 4KXZH 1HKLL 5C0GA 2ADGB 3L1OH 4JQIL 5EN2A 1NDGA 4JVWA 4YHOL 3FB7B 3MUGA 1MCPL 1NBZA 1OAQL 3BISA 4RGND 2CKBH 2QADC 1A4JA 1GGBH 3W9EB 3ULVE 1RHFA 3M17B 1I9RL 5D5MB 3UZVB 2F8OA 3VI4E 1KUMA 1GPOL 2J4WH 3MBEB 1MHHB 1YEDA 4NUJB 5JQHC 3QJFB 2IQAA 3T65B 4GMTL 5DVOA 3UPCA 5D1ZA 2R2HB 1ES0B 4TSCH 4XPFH 4L4TE 2YD2A 1I9IH 3HS0A 4H20L 1U3HA 4GQ9H 4UAOC 5C0EA 1N2RB 3LHPH 4OTXH 3SN6N 2C3WA 1EH9A 3U36B 1WEJH 1CG9A 5T1KB 3BKYH 4I4WB 3MRKB 3DTXB 5EOQL 2D0GA 4U1KA 5BVJA 1ZE3C 4Q6IC 5F7EL 3FB8A 1JNHB 4NPYA 5ESVA 2FBOJ 1FL6A 3MRRA 4F7CA 3FT2A 4RGOH 3MUZ1 3HZVB 3RPIA 3KHQA 1DSFL 5EU3B 2HJFA 3HNSL 1RSFA 1XIWB 5BO1L 1IKNA 1BM3L 1RURH 2YKLH 3GFUA 3VD5A 1EHLL 1J1XL 4GKSA 4S1QL 3V6BR 1QBLL 3W11D 1E4KC 1PJ9A 1QSFD 1X5YA 3H9SA 3MV9D 2XQBL 4N8VG 4MWFA 4NCDA 4R90L 1I1AD 3IETA 8CGTA 1RUAH 1MFEH 1E6OL 2EYTB 4WCYH 2PN5A 5D2LB 1RQ5A 1EJOL 1U8IB 1YMMD 3DO3A 5H37G 3O3EB 4NHUB 2VE6B 3TYFA 5HPMB 1EA9C 1J87A 2F19L 1Y18B 2F9BT 4KHXL 4UQ3B 4KTDH 4AEIL 3LSOB 5DYOB 3ARGB 5GRVL 4G7YL 5TGBA 5I0ZA 1UJTA 4UT7H 4Y4HA 2J2ZA 3ARXA 2BSSA 5L7XL 1HSBA 1T7ZA 1FYTA 5IQ9B 3HNVL 3ARDA 3QFJA 3TPUB 1J8HD 1XF3B 3L95B 5IMLA 3NABL 3F7YB 4PRIE 3GSUB 4ZUSA 1QKZL 1OTSD 3C6LA 4OCMC 3V5HA 1PY4A 4UTAL 4ZAKC 3ULUC 2ZJSH 3FHAA 4TULL 5IT2H 5DA4A 1RUQH 4I1NB 1ZLSL 5EA0H 4R2GB 1LDPH 5H94B 3DROA 2CR6A 5ITFA 1FNGB 4G3YH 1LD9A 3MRBB 1MHPL 2WLZA 2XZCH 4G9DB 2H26A 1BFOA 2FWOA 1CFNA 1HCFX 5E8DH 2VUOA 3FZUD 3UTZB 5JW4R 4J1UA 4K8RH 3MJ7A 4PRPE 4N0CC 4RMTA 3QEHA 5FHBH 2F53B 4WNQA 5IG7B 4XHJC 3AAZB 4X7SH 4K3GA 4HWEH 3PHQB 5KSAD 3NCJL 5EPMA 3AXLB 3LN5B 1LK2A 1WZ1H 3DX7B 4FQJH 4P2QA 4UTBH 4WHTA 4QNPE 4TSAL 5CEYA 1JGDB 4Q2ZA 1AXTH 3KYOB 3ARGC 4NNYB 3DX6B 4FP8L 4NO0B 5DD1L 5BXFB 2EYRA 3SKOA 5HY9A 3MRIA 5ERWB 2GJ6D 1IBGL 5IB2A 4NQSB 5E5MA 4XGZB 4NQDA 5IM7A 1D5IL 2M1KA 4PJ7F 3TT3L 3S96A 4L29B 3O8XB 3GMQB 3R0NA 5HSFA 4ELMF 3WNLA 1K3IA 2VZTA 3T4AB 1BVKA 3QQ4A 1D9KB 1JV5B 1G9ML 3MNVA 2OK0L 3EZ8A 1RJZB 1C12B 3FRUB 4KK5C 1QFWH 4F7TB 2V9QA 1OSPH 3IU4L 2QR0A 3FB6A 3BW9A 4YPJA 1NLBL 4BKLA 3MZTA 1BEYL 1G6RH 5C71A 1HQ4A 3F5WB 1JNNH 5I6XB 1SEQL 4U1SA 3VRJB 1M7DA 4OB5L 5HHMD 5HYJE 5IKCA 4YXLH 6CGTA 1EHXA 4J3SA 1XGPA 4KJQD 4V1DE 5IGXH 3IU3B 4W6YB 1PGRB 2VLJB 2HJKA 1ZA6B 4K9EC 3JV6A 3SO3C 5FO7B 4XNXL 5E9DE 4Y5XC 3VMNA 4JKWA 3MREA 4HBQA 5GGRA 3FQWB 1YEHL 2HH0L 1EPFA 4X5WA 2DQJL 1XH3B 2DTSA 5TH2A 2X4PB 2VXTH 4QXGH 4M48L 4LSSL 2BXYA 5GZOC 2WM0A 5CP7B 5MEQA 4X5XB 3O8XC 3QUMH 4X5LA 1Q72L 3IRPX 3MLYL 1JYXA 4FTVD 3G08A 2G9HA 4UOJA 6FABL 1SY6A 4QHNA 5FUCE 4KV5F 3S36H 5ISZE 4NRXA 3PWUA 3X3GH 1U8QA 4NZUL 3D0LB 3N1GC 3MRLB 5J0BA 1LE5B 3LEVH 1OL0A 2E8ZA 3SBWC 5JW4Q 4XVUC 2X70A 4NYLB 3WL9A 2YA0A 2A0LC 2CDGA 4QWWC 3JTSB 2Y36L 1QNZL 3KG5A 4JFEA 3DSNA 1A0QH 5CJXA 4KRPD 3S97C 4ERSL 3V0VA 2D2OA 1KB5L 3O9WA 1A4KB 3F7RA 3TIDA 4DEPB 1F4XL 5K9OB 1A1NB 1KCVL 4QRUB 4G6AD 1RFDH 1CDIA 4EUPH 4XP5H 3V5KB 1XCQB 3P0YL 3S5LG 4AMKL 5DMIH 4MNQB 1KLUA 2ZNWA 2AABH 2IBBA 2D03H 1QLRB 3BZDA 4P5MB 1KB5A 3SE8H 3K4DA 3ULUH 2GHWB 2CDEB 2ARJA 3LDBB 2GJZB 4GAYB 4J12A 4XPAH 1O5DT 1CF8L 1D5XA 4ZDHA 5ID0B 4HCRL 5EU6D 5DGRA 1T66C 3PG2A 2APBA 4TVPH 1OCWH 3C5ZA 2DQFB 1R3IL 4JFFE 3UJJH 1MFDL 1TLKA 3HC0B 5CEZL 2DLGA 5CP3A 5DO2C 4Y19D 2IGFL 3D3VD 3FRPA 1MVUB 1NGXB 4OCXL 4TPRH 1U8LA 5JORB 1OSZB 4ZTOL 3O6FD 1UWGL 3MV8E 5E2VL 2I07B 3HUJF 5TDPA 5BV7B 2X4TA 2NW2B 2DQHH 4RISL 3IGAB 2YRPA 1B6DA 1KN4L 3MSPA 3RDTB 3SDXB 1U8OB 4PGCA 2ADIA 1NC4B 3UTTB 4L9LB 3LIZL 2VDNL 1A2YB 4RX4D 2BNQD 3EFDH 1VGKB 3V6FB 4LLAA 4M62H 5JHLH 4XNQA 3DVGA 2W0FA 4L9DA 3KPOA 1KCKA 3ES6B 5DXWA 5F1SA 3UTQA 3PHOA 3TNNB 5D93C 1KELH 3QUYD 5GJSH 2LFGA 9CGTA 4ZG1A 3DV6B 4LHUA 4HG4K 3DUUB 1ZVYA 1R0AL 4LSDA 1VPOL 1OHQA 5EBMA 3SKJL 2BVPB 2NY7L 1NMCC 5EBWB 1BD2B 5C07A 2X89D 4MCYA 3UYPA 4WI2A 3G04B 5HGAB 1J9CT 3V4PH 4LNRB 4CKVX 5I66A 3QO0A 1A3RH 3R4DA 5BQ7B 1YEKL 1T89C 3RGHA 4EBQH 1T0PB 3AS1A 5CJOL 1LO3H 1MFBH 3D85B 3X14B 4BZ1L 4FHBD 2V5RA 3GHBH 4I0PB 2XTJD 3KPRB 2JELL 4P59H 1JGUH 1M6OA 3L5HA 4NO2A 4K9EH 3RDTC 2CH8A 1I1YA 3DXAB 4PJGB 3QUKB 3MLZL 4XNUL 2XWJA 1V7MH 2IPUK 4PRIA 2B4CL 4HIIA 1ZLWK 4RAHA 3CZJA 2BCKA 2IPKA 5HDBF 3REVB 4NO3B 1OD7A 5EFIA 1DUYB 4OAWB 1OQOA 4AEHH 2VXSL 3P0VH 3PQYE 1KCRH 4JM4L 4MDJB 5E1AA 2CDFA 1CR9H 2BSRB 5B39B 5J6HA 2DWDB 1IT9L 1T7VA 4Y4KA 1D3CA 3NPSB 4A6YH 4DOHB 3QEQD 2J6EH 2EH7H 5BRZA 5ELIA 2DKMA 4JRYE 5T3ZL 2WWMC 3BAEH 1WZLA 2D9CA 2QEJA 4PJCB 3MRMB 4ORGA 3KNBB 3FCTB 2CUIA 2VR4A 3GZKA 3CAFA 3NA4A 1OOAA 1I8LA 5C0CB 4PLJD 4ZODA 5T3XH 4I2XE 4HPOH 5D6DC 5EIVA 3FMGL 3VFWB 1ZV5A 4NM4L 1T21A 4IDJH 3JV0A 5A40E 1UWEH 5F3HA 2CGRH 1I1FA 3HE6B 4KTEH 4P2RE 1MUJB 3L3KB 4YDKH 1X5AA 3CSGA 4YJZL 3TN0A 2UV3A 3WHXA 2EH8H 4PJHF 3QDAA 1BZ9A 1E4WL 5T5NG 4P5TD 1KCUL 3HZYB 2DYPD 4ZQKA 2N7AA 4MVBC 2H2PC 3QISA 5TDOB 2YD5A 4N90D 2FJHB 5DJAB 3CFBA 4KUCD 4CJ0A 4JFYA 2UWEE 4LGRB 1C5BL 3UTSE 4RGNB 5FO9B 4V2BA 1KJ2A 3TO4D 4Z7NF 4OLWL 4CNIA 1G1CA 3NPSC 3EDKA 1YPZA 1EVTC 2D4FA 3TBVA 4YLQT 4S2SB 3C2AH 1WIPA 1JBJA 1Q0YH 4N68A 3H3KA 4PBVC 4P5KA 3TBYB 1R24A 1WFUA 3CSYA 2PKDA 1HEZA 5KZCD 2N4IA 3QUZC 3UBXA 3F58L 4JVPA 3P11L 2VC2H 1NLDL 3WE6B 2EDXA 5E9DA 4YXHL 1U3HD 5AZEL 4MAYA 2PYFB 2W1NA 3KYKL 1KLFA 4HXBH 3DRTA 2E3VA 3H7BA 3MLSL 1PYWB 3SPVB 3HE6C 4HPYL 2ZKHL 4YHZH 3BEVA 3E6HA 3TA3A 5GGTH 1KBGL 4OJFH 5CIPB 2RCSL 4MNHB 5D7LA 4XVTH 3MNWB 4IRZH 3U9PH 3Q5OA 2DWEB 1U92A 1D6EB 4TTGA 4K2UH 3RA7H 5C9JA 3UJTL 5IVNA 3R1GL 3OKKB 1A9EA 4RGNC 3PNWA 5DWUL 2GYSA 5ISZA 1M7IA 4Q6YA 4AL8H 5HVHC 5FYKL 2IH3B 2GFBA 1QSFB 2VSDA 5DC4B 2H9GB 3MV9B 3ZE2F 3S6CA 5EOCJ 1I1AB 4HUXB 4S1RH 1MPAH 1ZHLA 1W8NA 4UT9H 2X2YA 4ONGL 4XP1L 1T22A 2IANE 3T08A 4J3TA 2Y4SA 4UU9B 3L5WB 1R6VA 4EDXA 4I3RL 2XWBB 5I19H 4CVZB 1BZ7B 2UZIH 3CC5B 1SYVB 5C08E 2VISB 1UWXK 2NW3A 4MS8D 1PSKL 5E03A 5CZVH 2FDBP 1I7UA 2B8OT 2D3VA 3TJHD 2JF1A 4KI5D 4OCSL 3S34L 3KAAA 1Q9WA 4XPHL 3WLBA 1LEKB 1H0DB 5HHQB 3CDCA 4PY8J 3GM0A 5L8JB 3B43A 4Y4HD 1FZMB 5IJKA 1J8HB 1FYTD 1DJSA 1C1EL 2PW2B 2VLRE 1YECL 3QFJD 2Q20A 1HHKA 3OR7B 3D69B 3VE0A 1NAMA 1A6VH 4B53A 1INQA 4PRNA 5SWQB 3C6LD 1AI1H 4UMGA 2ICEB 3UTOA 4OLZL 4O51B 2OBGA 4M7LH 5D71L 5I74B 3V8CA 1LE9B 4LPTA 4F3FB 5DJXB 2VQ1A 4JHWL 3RX8A 3P4OB 2AJYH 5CSBA 3BSZL 1YNLH 1E0OB 4PG9A 4MJ2A 3L3DA 1K5NA 3S3PA 4QOKB 3GK8H 3SE3C 4MQTB 4U33A 1DN0B 4KKBD 4JFHE 2D7MA 2E9JA 5KSAB 1T1YA 5IVXE 4U2YA 2NY1D 1NCBH 3TZVC 1FP5A 4M6OL 1TCMA 1I7TA 3QCUH 2AQ3A 5JIPA 1Z9LA 4HS3A 1JGEA 1CK0H 4NN5C 4M1GH 4Y4FC 1KACB 3WNKA 1SHMA 2VDML 3A0OA 4LRIC 1F8TL 4IRSA 5CGTA 2GJ6B 2C1PA 2L7UA 3SKMA 3JXAA 5CZKA 1JJUA 1CBVH 1LNUA 3VFVA 1E28A 3FOMA 3F12B 4Z76B 1YN7B 1RK1B 1LGVA 3VFPA 3T77B 1OTSC 2XNAA 3PIQB 3RNQA 2V2WB 4Q9RH 2APVA 2BZDA 4J2XA 1MRCL 4HUUB 3QXAA 1YEEL 4PJ8A 4POUB 3RWEA 5KVMC 4ZPVB 3FO1B 4M7KH 5F7DB 2OTUA 1SVCP 1CIDA 4BSWA 4PRBB 1VADB 4L3EA 5KN5A 2CXKA 2A6DB 5DD6A 2HTKC 3F62A 4WENB 1NMAL 3FZUC 4HK3J 1LP9B 1IEAA 4KROD 3DETD 5HHMB 3C60A 4D94A 4OLYL 4DCQB 4QRTA 3AU1A 3DURA 5C0AE 2E9BA 4NRYB 1LK3L 1U36A 3CNKA 3MRPB 4FG6C 3BZEB 5FUOH 1IFHL 2JCCA 3KDMB 4OZGB 3E8UL 3O2DH 1E4XI 3PQYA 2ESVE 3OAYH 4HG4J 4JO1H 2NX5E 4ZUTA 3QWRD 2V6HA 3LQMA 5GJTL 4S10A 1SQ2N 1GOFA 5JOPE 3INUH 5L88H 4JY6A 4PJEE 3GSVB 4Y5VA 1NCWL 3CDYA 5LWYH 5AUMB 1QBML 3EOTH 1NFKA 3BPNB 3WFCL 4RIRA 5IWLA 4KJYA 3MRCA 3F7VB 3GSNL 4P49A 2X4OB 3MFFB 3OWEA 4U31A 5AZ2H 5SWSD 5IUSA 4I2XA 4LKXA 4P4KD 2ZOLA 1YQVL 4OZ4B 3SCMD 4JKPH 5GS1B 1YC7A 4MXVF 5IEHA 1A7PH 1EGJL 2CK0L 4NNXA 3GSNA 1CDCA 4YWGH 4P2RA 3A67H 4TTDD 4FS0A 3EYQD 4C83B 5MENA 4ZFFB 2Y06H 4CDHA 3HCVA 3AS0A 3LKNB 4OZFH 2QHLA 3E0GA 4APQD 4KRPB 4MX7A 2YMXH 4JFED 3CSBA 5JDSA 5LBSL 1CICA 3MGOB 4RGMB 3MLXH 5F71A 2CMRH 3H9HA 4OLXL 3SGDI 1QQDA 5D7JA 4PREA 1P4BH 2XT1B 5ANMB 4KH2A 4HKBA 3ESUF 3UTSA 4O9HL 2ZCKL 1DQLH 4P46C 2AJSH 4QGTA 3ULVD 3WFHB 2Q86A 2QTEA 3WIFB 1I4FB 2G60L 1AC0A 1JCKA 3ARYA 1C5CL 4YFDB 3ZLQC 1H3WM 4PJIA 3BPNC 5EU6B 5C92A 1FIEA 1YJDL 2OQJB 5E2WL 3W5MA 1FZKA 1Q9KB 1X44A 3GSWB 4M4PA 4OM1H 1UEMA 3VXPB 4Y19B 2RHEA 4KFZC 1XGYL 5KSBE 3ARSA 4L4TD 5J1AB 3WFZA 4X4ZA 2FX8H 1HXYA 2CLZA 4RFOL 4WUKL 2VWEC 4F7EA 5IBLD 1SJEA 4Y8AA 5A2LH 1BPVA 3GI8L 1QP1A 2ICES 2YRZA 3CD4A 1RUKL 4DUWA 4ODHL 1XGTA 5C0ND 1FNEB 4L5FL 2GQHA 4HIHB 3ARFB 3BP4A 2DN7A 3GMPA 5HHXH 5ESAA 5B38B 3TH3T 1H3TA 3KJ6H 4Z7WA 4IS6B 2RAMA 1QOKA 3SDDA 1OAUL 1YEIL 3SDYL 3BVNA 4JRWA 5ICXB 3QUYB 4YAQB 1NBVH 1IGYB 4FZEL 1P9MC 3CLFH 4JHZA 4D9LH 2VJXA 3C5SA 5DFTA 4B50A 4R96B 4ZSOB 3ZKSD 1YNKH 4YNYA 3VXOB 4QGYA 2C3XA 4XCCH 4FOMA 1A3LH 1FVCA 1MFAH 3QDMB 3DGGA 2LAGB 5GGUB 1KTDB 5IF0B 2IANA 1EUTA 4LPVA 1NH6A 4NSKA 3KPTA 4NOFA 1A6ZA 3MXVH 5I8OL 1NGYB 3WS6A 2VDKH 5C08A 1P5VA 5E2JA 4QKXB 2XZQL 4N0YH 5JXEC 1BMGA 4HXAL 3O6FC 4JFDE 4LASH 5HGBA 3IF1B 2Q6WB 2XTJB 3SJVE 4ONFH 1CYGA 1RY7B 4FFYH 4XT1C 4NUGH 3D18A 4TNWK 3Q0HA 3BDYL 4OF8A 1II4E 1FFOA 1AC6A 2LV4A 5IIEB 4BA8A 5TF0A 4CVWA 3NFSL 4ZD3H 1ZWIA 2MJWA 3QZWG 4JGUA 4PRID 1L7IH 1KIRB 2A77L 1I85A 1JF1A 3TT1H 2DMKA 1UACH 5CHNB 4D8PA 1JWMB 3NH7H 3B9DA 4JM2A 3CU1A 4PYGA 4WFGE 5E99L 4R3SA 4PJDF 4M1CD 1MJ8H 5K9KA 4NZRH 1OD9A 1WC7A 4Y4KD 3T0BA 5T33L 3GHEH 3ZYIA 4PGEB 3LN9A 4OSUL 1CTNA 3NIFE 1JWSB 3PGCA 4PJAF 4LCYB 4NM8L 3I9GL 1FGVH 5E2UH 5AG8A 5F7HA 5IFHH 1N3NB 1Z3GH 2Q8AL 1IQDB 4PRPD 4XBEL 5T5FL 2YEZB 2YN3A 4LQFH 3VW3H 4NO5B 3RU8H 4NQXB 1MREL 1IEBA 1U8JA 1HHGB 2KUTA 4PRAA 5LCVH 4CW1A 1UXWA 1AQKL 1AGCA 2YPLE 3GI9L 1U8MA 2FL5A 2JJWA 4WV1C 5H35B 1NUGA 4JPIB 5I1HL 5JXAL 4OF7A 1GL4B 3DVNA 4YPGB 4LEOA 5JW3H 5H8DA 1F4YH 1V7NL 3E2HB 4MSWA 4AJ0A 1TJGL 2NR6D 4ZO9A 2DIJA 4LFHG 4JKKA 3LKPB 4P5TB 2PR4L 2DYPB 4XVJL 3ZHLA 1JZ7A 4LCUB 4YUEH 1J1PL 2F58L 2O5YL 4Q7DA 4JVUA 3JUZA 5KVFH 1WCBA 3RY5A 3IDXH 3K0WA 1JMXA 4NP4L 1CLYH 2F74B 3L3HB 5JLZB 4L8DB 5DHYA 3TO4B 4X98B 3LS5L 4HEPG 2AV1B 4Z7VF 2C3VA 2HJLA 1A7OL 5KSUA 5I8KH 4JO2L 4KVNH 1XMWA 2O5ZH 1ZT1A 2YR3A 4Z7OF 2X4SA 5C0AA 1ITCA 4HT1H 5HYJD 5IESL 5KZCB 4HQQL 3QRGL 3LEXB 4WI9A 5DRNA 4HK0A 1VENA 5IVOA 1D5MA 3PABA 1CGWA 5I1IH 4V1DD 4GRWE 2BOBA 2MCPL 2W9DH 4PB0H 3HB3C 4I18A 4YDIH 2Z35A 2ESVA 2QQNH 3VGBA 1YEGL 4EDWL 4PJFF 2V2TA 5E9DD 1Y6KR 2NX5A 3O2VL 3PJSB 3WFBL 5FKAA 4MAYD 2BJMH 1VGEH 4PGBA 1X5LA 2VKXA 2R23A 3HR5A 2MKWA 4UV4L 3OV6A 2E7LA 5ID1A 5SWZD 4LVHB 2YXFA 4OCWL 4X6CE 2AJXL 3IRZA 4P5TC 5EUKB 3T0XA 3HI6L 1NGWA 5ACZB 3FB8B 4J6RL 5D9SA 2CJUL 5C0FA 4L8BB 2R39A 2GY5A 4S0TD 1J88A 3ZSSA 3QUXA 2YOCA 2P47B 5ISZD 1HNGA 1S9WB 4Z0XA 2AEPH 4BQBA 2EIZA 2AJUH 3QQ3A 4YQXL 5J11B 4GW1A 5DJ2B 3G6AB 2FJFB 4PJ9D 3S9DB 2PUQT 2FEDC 4AIZB 4DZBA 2D31B 4HIJA 4PV8A 1J0IA 5D1ZC 2XY1A 2AW2A 1U91A 5CJQH 3TYGL 5I2IA 4H26A 3K8LA 3HAEB 4MMZC 3Q48A 4MNGA 1U3HC 1OY3B 4YO0B 1VEMA 3G5ZA 1CD1A 5DMKB 3E6FA 1U2HA 3KPLB 2HFFB 4HFWB 3P77B 4YXKH 4MA7L 1O7VA 1BIHA 1V3KA 2VZ1A 4LVHC 4Y4HB 2LTQB 4NBZB 4JB9L 1G0YR 2VL5B 4BH7B 4HWBH 3CFEB 5EUOB 2EE2A 4OQTL 5FAAA 4JFXB 2AAVA 4LNVA 4X6DE 2X4RA 4OCLC 3OPZH 4JFFD 3DV4A 2EC9U 4QO1A 4RAUB 5KSBA 5KTEH 1GRWA 3IDYC 1OGAA 4H25B 2F5AH 3BPOB 3TGXA 2C4XA 3D9AH 4OQTA 3MV8D 5J11C 1SEBB 4LLVB 5TQ2H 1QZ1A 3T1FB 4K94C 4X9GA 3QG6B 3I02A 4HUVA 4J1UB 4WW2F 5DEGA 1KJVA 4G6FD 4FABH 4IOIA 4MZ3A 4IIQB 4N0FB 4WNQB 3CVIL 3LN4B 3FN0L 3IJSA 1L0XA 2C1OA 4G8GE 5EPMB 1PG7H 3PGFH 3TJHC 4KI5C 2BRQA 2HT4D 3SQOH 1MCOH 3QG7L 4NZDA 4Q2ZB 1HWHB 2H32H 2R1WB 3MYJB 1TETH 4H8WL 2A9NH 1M71B 4FQQB 2P44B 1DLFL 5DQJA 5FK9A 4RA0C 4Y4HC 1ZHNB 4GXUN 4PLKD 3U0WH 3R8BB 4Z78B 1PX4A 1HOCB 4NJ9H 3GUTB 1EEZB 1X5KA 2OJEA 3IDUA 3WJJA 1LO4L 1NC2A 3AUVA 3VWJB 3C6LC 3VU2A 5B39G 1JPTL 4JZJA 3MACH 1G7QB 5GRUH 4XMPH 2WUBL 3OAYK 2R0LL 3X3FH 3WNMA 4G6JL 1I8MA 3L3OA 1WBXB 4Z95L 4UB0H 1KULA 2XN9A 3T3PF 3LS4H 3SJVA 3BPOC 3REWA 1KLGB 5FEBA 1FN4B 1WT5A 5GRJL 4KROB 4M93C 5HYSB 2B1HL 2AK4E 4X6BB 4PY7A 3SOBL 4JCLA 1M7DB 3L3JA 4UNTA 4GG6B 3CCHB 3IXTA 1IVLA 3V95A 5B3JF 1KIPA 1S8DA 2NY1C 4JCMA 5DUMH 3W0WA 4ACPA 2AJVL 2YPVH 3OJDB 4QTHB 5C86A 4B7LA 4JGMA 4B0MM 2ZG1A 2YZ8A 5KS9B 5GZNC 3T2QA 1A1OA 1KJ3H 1U8KB 4ETQA 2WINA 1UEYA 3PQYD 3MREB 4PJ7E 3RNKA 3UBXG 5GGRB 2EYSA 2NY3C 3IFLL 3OBAA 2NY4C 4PUBL 2ZPKH 3DMMB 3MA7B 3VD7A 1WTGT 4JRYD 3OZ9H 4R4ND 1TQCC 3L9RB 5DVMA 5AYQA 2V5TA 5LGHH 3QXVA 2YC1A 4IHOA 2DL2A 2YD6A 4JO3L 4XCYA 4GS7B 3KYNB 5SWSB 1G7MA 2FEEL 3VFOB 2X7LA 4P4KB 1GAFL 3SCMB 4QHNB 3I3DA 1XCTB 4JQIH 3EJJX 4YHOH 3T09A 1OAQH 3OKLB 3IJYA 5ALBL 4LCCA 1NFDF 4FFVC 4KUZL 2J8UA 3BXNA 3VFSB 4KROC 3DETC 1I9RH 1EX0A 3AB0C 1RIVL 4P2RD 4R0LB 2X70B 1S7UA 1O0VA 3OSKA 3IAPA 4GKZB 1JZ4A 5EU7C 3G5VB 4APQB 3MBXL 1Q94A 5TE7L 3QWOB 1P7KA 4LSTL 5AYUL 2FX7L 5T1DH 4HIEB 5FYLL 5A2IH 5D70H 3AROA 1CICD 2HWZH 1QO3A 5D7JD 3Q1SL 1YY9C 2FECL 5GGSB 3UTSD 1ROWA 1WV7T 3MROA 1E6JL 1NGPL 5HYQA 5GS0D 1UKSA 1AXSB 2P5WE 3AY4A 1CVRA 5HGDB 2ARJB 5DD5L 4YFEA 1ZANL 1D5XB 1FHGA 3MFGB 1CWVA 3V7AE 3I75B 4EIGB 3CUPB 2IAMA 1J05A 1ZMYA 3OKOB 2X41A 2BY3A 3T0EE 2R2BB 3SCMC 3G6JF 4K94H 4L4TB 4QY8A 1AGDA 2DQUL 4FRWA 4R4BB 2QHRL 1DSFH 4X4YA 2E6QA 1EDQA 3HNSH 5C0BE 3QDGE 1MLCB 35C8H 3HA0A 4MA1C 4WRLA 1IM9B 1RHHA 3GBLA 32C2B 3S8WA 3PDGA 2CSPA 5IB1A 3TJEL 4P9HC 1RU9H 1FG9C 1WAAE 4YDJA 4IRJD 4APQC 1NDMA 3MJ8B 1E6OH 3BZ4A 4PV9A 5CJXC 1CFSB 1KPUA 1GOHA 3O9WC 1W0WA 4Z77B 4LPUA 3BYTA 4PJXE 5D5MF 3UP1A 3ZDZF 1MCCA 5FKPB 2GW5A 3KS0H 1GZQA 4XCEB 3SDDD 3WEXB 1TCRB 2XFXB 3RGVA 2V17L 3S7GA 3L3GA 2WQRA 3PDOA 2F5BL 1ONQB 4KKAD 2GSIA 2BHYA 2HTLC 4NKIL 1HYRC 1Z5LA 3VCLA 4MMXC 2IAND 3EFFA 2V5MA 3NABH 3C5ZC 2A6KA 2DMCA 4MCYB 4OCRL 4M7ZB 1YNTA 2FHCA 5C08D 1FSKB 3B8SA 1ZLSH 1DBAL 5DQ9B 4M1DH 5DJDB 3LQZA 3RAJH 3CVHL 4TVSa 3WO4B 3HN3A 4KK9D 2MWCA 1R5WA 2R29L 3I6KA 2C7UA 4M6NL 1RIHL 3C8HA 4J8RB 4RRPG 4JDZB 5D1QD 5BZDA 3OAZH 4DVRH 5C0NC 3U46A 3B2VL 2FR4B 4KVCL 3EOBB 3BP5B 3ULUE 2VLRD 1MLBA 5EC2A 3CVHA 3NCJH 4QRQB 4ZUWB 3VI3E 2A9MH 4FQ1H 5L9DH 3SY0B 5FOJA 1GGIH 3QCTH 2W38A 4LQ1A 43CAA 1EMTH 2HKHH 1FGNL 1FAIL 4YX2L 2GUOA 5F70A 4TSAH 4RMVA 1F6AA 4X6EA 4OLUL 4P2CG 2DQEH 4JM2D 3HE7D 4Y4KB 1W72A 3K1DA 1GC1L 1JHKL 1WGOA 2BOCA 3CXDL 5D2LF 4CGTA 1IILE 3KPSB 1QA9B 1IBGH 1H15B 2DQDH 4YHKH 3VRIB 3RHWK 4YHNB 2NY2C 3O45A 1I1CA 2QSCH 1D5IH 1MCWW 4PRPB 5IEKB 3TT3H 4G80A 4JLRB 3GKZA 2BK8A 1I7RB 5MP6H 4I13B 4JFHD 4ONHB 1EAPB 4NHCH 4NKOA 4G8GA 3TV3H 5F7YC 1G9MH 2PYEE 1CD0A 1LILA 5JMRA 3ILPB 2ZCLL 3IU4H 3LZFL 2AV7B 2CLRA 1SBSL 4M4RA 5HDQH 1SYSB 5HYEA 1SEQH 3GSOA 4OB5H 2WK2A 3V6OE 3IKCB 4HKZA 4XP9L 1BFVL 3K3QA 5GISH 5I17A 4XPTH 5IBTL 2WIMA 2YK1L 4XC1H 1IC4L 3OJVC 3UYRL 4JZNA 3BHBB 1P2CB 3L7FA 2GK0A 2GY7B 4S1SH 3L5IA 1AIFA 4CBPA 4ODVH 4RDQF 4TQEH 4M1CC 2QV2A 4Y4KC 1HKFA 2R56L 1MH5A 2MFNA 1YEHH 5I75B 4YR6A 5CILH 5GRYA 2DQJH 1SY6H 1RUPL 4LSSH 5EBLA 4EZMA 2AK4A 3ILQD 5E1HB 1MHEA 1U3JA 5HYJB 4DWHA 1T7WA 4WGVB 3I84A 4KZDL 3RVXC 2G5BB 5C0AD 2DI8A 1KN2L 4V1DB 3ZL4L 4MAUH 1AE6H 1I8LC 5DHVB 5ENWA 5F9JA 6FABH 4F33B 5CUSL 4LDEB 2Y6SD 4P9HH 2OP4L 1WICA 3F65A 5E9DB 4Y2DA 1NUNB 3DO7A 2ESVD 4PJ7A 4M7JH 1QRND 3ZTJG 5ESQB 5KW9L 2NX5D 3QYCA 5SWZB 4K23L 1PVHA 5E00B 2VIRB 5JOPD 2A83B 1RULL 3HTLX 4DGVL 5E6YA 2K7QA 2Q7YB 1ZGLB 3O41A 1XGUA 4TNWF 3TCLA 2W0LA 4YHMH 2Y36H 1LEGB 3CFKB 4XZUB 4DFIA 1JZ3A 1U92B 1KB5H 2AK1L 1A1MA 1PZ5A 1QR1A 4WW1B 3BKCL 5HHNA 1KCVH 3S4SA 5I71C 1AQDB 5ACLA 1FL5A 4HGMA 1IAIL 4I0KA 2I9LA 2XKNB 5T3XE 1WIOA 3FQUB 5DLML 3WS3A 5CP3H 3EYVB 1A6UH 1S9YA 4BSVB 3BN3B 4PJBE 4PJ9B 3UJIL 1FL3B 5DS8A 5IB4A 5JHDA 5FB8A 1RMFL 1CF8H 1HCVA 3B9KB 2A73B 3O81A 3QIBD 3TH4T 3ALXA 5E8NB 3PXJA 2F54E 3BJLA 1A6TA 1MFDH 1XGRA 2IGFH 2BC4A 3C5JA 3ZO0A 3B5GA 4MAYC 4OCXH 2J3SA 4P3DB 4KK8D 4ZTOH 4FXKA 1NANI 1FFRA 1FO0L 1UWGH 1MFCH 3PV6A 3OGCA 1TZHA 1CGVA 4FQXB 3HI1A 3TBWB 2Z31A 1R3HA 2P5WA 2EEAA 3WJLA 5DJCA 1GH7A 4IOFD 3MRJB 1GGCH 3S35L 1ZS8A 4I5BA 4IMLB 2NZIA 1QBBA 5B38G 2HKFL 4FXGB 1PLGL 4M7LT 2BDNH 4ZFGL 2DJUA 4P57B 4Z6AT 1FO0A 1X5ZA 4JFFB 3GJEB 3T0EA 4LARL 2R4SH 3VXMB 5FUCC 1DQQA 3CH1B 1OLZA 5D7IE 3IFOB 1JWUB 2VQ1B 4IJ3C 1BOGA 1J0YA 3OB8A 4HK3N 2ZZUT 5EULV 3QDGA 2ZSVB 3FB5A 3MV8B 5D72H 2H6PB 1H3GA 3LQAC 1K4DB 3D1MC 1AKJD 3KHOA 3NCFB 4U6VH 3SE9H 1T83A 4LLDB 5AAWA 4CL7A 2BRRH 4KJPC 4ISVA 3MRDA 3P4MB 1WAAA 4G6FB 5JW5A 3WYRA 3FQNB 5I1AA 3SKJH 5KAQG 2ICWA 2NLJA 2J7LA 3QCVH 4KQ3H 1NQBA 4EOWH 2Z91A 1FV1A 2VERN 4J3VA 4PJXA 3O0RL 1X5XA 3QULA 4YIQB 3RRQA 4JY5H 2ENYA 1OTUC 2DLFL 1J0HA 3MA9L 4BZ1H 4HUKB 2C1PB 1AGBA 4UBDC 4NWUL 1T2JA 4U7SA 3KJ4C 5IJKC 4NQEE 5I73B 3KPNA 4XPGL 3RVTC 3U1SL 3RVUD 5F97E 3HUJA 3EYOA 4JFZH 3BJ91 3X12A 5HHPB 2OSLA 2WP3O 5IMMB 3M1BB 4F7MB 2VXSH 5JMOC 4JM4H 3IDIB 2XQYK 2OTUB 4WTXA 3SDXF 1IC5H 4JFDD 1OGTA 4JPVL 2WBJD 4FQIL 4P2YA 3SJVD 4LDLB 1UA6H 4ZFZA 1WJ3A 5EC1A 4TUOA 5DJ8A 2AI0H 5CGYD 2PO6A 3VXNB 1MCJA 5BMFL 3HC4H 1XGQB 1GIGL 5T3ZH 5D7SH 5EOTB 3DECA 4OIIH 4O5LH 1J10A 1CGTA 2EO1A 5ETUB 4QRTB 4CU6A 4L8CA 3IDJA 2YD1A 1KGCD 1IGFL 5DK0A 3GSRA 3V4UH 4YEFA 3GSXB 1NCAH 4C4KO 4R9HA 5F1NA 3KPQA 3QP3A 3BKJL 2E27L 3SDCA 4E41E 4OV5B 1RZ8A 1UKQA 4LSQL 2ENSA 1S7RA 1MI5E 3ZYOA 4NM4H 4IRSC 4WFGD 4PLKC 2NY5L 4QRPE 2AXFB 1N6VA 4Z18A 2JJSA 4JRYB 4FQHA 1YN6A 4Z7UF 3R06A 1KJ2H 3K4ZA 3OXSA 2YSSA 5HI4D 2IADB 2E7HA 1AGEA 4I3SL 1KCUH 4KGLA 4LHJB 5IB3A 3MXWL 4FA8A 3GRWA 1CXLA 4BK5A 2HVKB 1N59B 4P9ML 2H2SD 4PJGF 2YPLD 2XKSA 3BI9X 5HDOA 1V3MA 3BWAA 4NNXB 5IHZB 1A9BA 1HWGB 5F88A 4P2RB 4UUJB 3C60C 1UZ6F 4XNYH 2ITCB 3PWLB 1T0NA 1LO5A 3QIUA 4F2MA 1U95A 1BWMA 1E27B 1CL7H 1QYGH 3IXAA 3NGBC 4EI5A 4JG1H 1DR9A 1A7NL 1WITA 2ITDB 2WANA 3O6LL 3F58H 4R4FL 4ZO6A 2R4RH 1UM6L 3ECBB 4PREB 2FEEI 4AH2B 5F44A 1ZHKA 2UWEB 2JIXA 3FFDB 3W39B 4PJCF 2DQTL 2Z93A 1UB6B 3BPCB 5K59F 4Z8FL 3FOLA 4R4NC 4Y5VC 4N1EA 5J13B 3VGEA 5I1EH 3KR3L 2CLVA 1BJMA 3OKEA 2BNRA 5IWLC 3VGAB 5L0QC 5JW4N 3LQAH 4L3CB 3O3BA 5TE6H 2IAMD 3GM8A 4M6ML 3RKDC 2FB4H 5B21A 2VZ3A 2SEBA 1OP9A 5DWUH 3TWCL 1YMHA 1NBYA 3N1FC 4PJHA 1MHCA 4P2OD 2FECI 1GGTA 1P4IL 2FATL 1NUDA 4YGVA 2NXZD 4O2EA 3P4LA 2F15A 4F7EB 3U6RB 4IRJB 2OS7A 3RTQA 1CXHA 1OAKL 3HAEG 1JHLL 3U0TB 1MQ8A 3BIKB 1U42A 1MJJB 4I3RH 3DUSA 4N0RA 1CICC 1RVFH 2VAAB 5D7JC 1CLZL 5DD0H 4OZHE 1HXMB 4UDTA 3BRDA 5KVDL 2YD9A 4RSVA 1ZTXL 3OXRB 1KG0B 5MEPB 4C56A 3K81A 3GMLA 5AWNL 4EXPX 2YRLA 2ZUQB 4NN6B 1NAMH 5IV2A 3MOBL 3VFUA 3MODH 4JAMA 3LKQB 2AERT 2IFGA 4PJBA 4DN4L 3HZKB 4BK4A 2ZSWA 1JHTA 4DUVA 3RY4A 3RWCB 1C1EH 3IDGB 5IBUB 2BY1A 4XH2B 4GSDL 4LEXL 5HI5D 1G7PB 4EN3A 5IFAH 4UIMB 5D71H 1QHOA 2EDRA 8FABA 3RWJB 2VXVH 5I8CB 3ZE1F 3GDBA 4O02H 5DRWA 5F1IA 1UYWL 4HF5H 4MQ7B 1EZVX 2EDBA 4EJ1C 4XNMB 2EKJA 5HHOA 1LO0L 1T4KB 2OL3L 4IRJC 5D1QB 5BCAA 5LAXA 1UXSB 3TO2A 1OAZH 3UX9B 3RWGB 4OD2A 1LWRA 1FLTX 4LRNH 4HUNB 4R7DA 1A14H 4Q97A 3T2NL 2VLRB 4PJ5E 4K3JH 3IFPB 1LVEA 4KJWD 2OL3A 3SDDC 3ZKND 3NBNA 4L1DA 1F3RB 1INEL 4JM2B 3HE7B 3DBXA 1EK3A 4U0RC 4C59B 3IVKB 3L6FB 5E4IA 2ZUQC 2OI9C 4KKAC 5KJRL 4G6KL 2EIBA 4M00A 4Y1AE 4BQCA 5MEOA 4H1LA 3L7EA 1AO7B 1JUFB 3PE9A 1S7SB 2R0KL 2X40A 2IFFL 5E5RB 4XPBH 3ARBA 1G7LA 2PW1B 4WI3A 5EORL 1QFPA 5IVXB 3JTTB 4JO4H 4JQXA 1YEEH 4LIQL 1K8IA 3THML 3SDAA 3HPLA 3RUGB 1OF2A 4LVOC 2FL5B 5HYSG 4HFUH 1N0XH 3X17A 4U6HB 3MLTA 4QXTA 4UV7L 4JRXE 3O3UN 2XG4A 3DVNB 2VDRH 4UDUA 4LEOB 4KY1H 1NMAH 3D48R 1JPST 3K80A 2DBJA 4NQEA 4OLYH 3PWVB 3RZCA 3RWHA 1BJ8A 4R7NB 1MJUH 1LK3H 4HLZG 4JREB 5C3LD 1FLRH 4BH8A 1IFHH 3IJHA 1I85C 5KVGH 2FZ3B 2NYYC 4MLIA 5GGVL 4G6ML 5I1JL 2VABB 2W92A 2ADJA 5E8EB 4JM2C 4N5UA 3MUHL 2HP4A 2Y7QB 4EKXA 1FFQA 3LKOA 4HGWA 4L8SA 2OXGA 4FFZL 5IJVB 1UB5A 2OTPA 1Q38A 3T0WA 1IGJA 2AK4D 2Z4QA 1N6QL 1DFBH 2X4SB 5EIIB 3VFGH 4NZJA 1PEZA 3WFCH 4HK0B 4WJ5A 3HFMH 5C0RL 3GSNH 3HMXA 3PWNA 4O2CB 4WTWA 1G7IB 1MCFA 4N8VA 1U93B 3CU7A 1F45A 1T5WA 3B8YA 5KVEL 3MJGX 1OPGL 4PRHA 1S9XA 4GMSL 1YQVH 2BSTB 3V0AC 2V2TB 1QRNB 4YBLC 4Y2DD 5CCKL 5DRXB 1DBBL 3WN5B 4QRPA 3HHRB 5DJ6B 5JZ7D 5B3NA 5JUEL 2VITB 2DM7A 4AQOA 4PJEB 3UROR 1OARL 2A74B 5D8JH 1BVLA 2NZ9C 3VXRE 3ROLA 2C5DC 2W59A 3QNZB 4XMKH 3EO0B 3O6KH 5E6ZA 5LBSH 2DDQH 4K07A 3OAUH 5IB5B 5JQ6L 4OLXH 1UJ3A 4KHTL 4MDIA 3W9DA 1LP9F 4KAQL 3DX9B 2KL6A 4HH9B 3B83A 1IM3B 3EHBD 5GQBA 2ZCHH 4NT6A 3QEGL 3ILQC 3RWIB 2G60H 5IQ7L 2F8VA 5HI3D 2YN5A 3WKNA 4OZGF 2L0DA 2AEQH 1CXFA 1ZXQA 4MB3A 1KSRA 3BH9A 3S35X 2DI9A 4NDMA 4YHIB 1U8HB 3RHWF 2XZAL 3QIBB 1LQSR 5E2WH 2VZUA 2X4QA 4BYHA 2HN7B 2VZOA 3B6SB 3V9FA 4D2NA 5I2IB 4FQ2L 4I18C 1T03H 1YYMH 3EOAB 3RPKA 2BMKA 1NCNA 2FX9H 3KPMB 2JJVA 1BOYA 4HJJL 1XF5B 3WN5C 3C09C 1IAII 1JNLL 4NN7C 4BZ2H 4WUKH 2E7LC 2CIKA 1H9VA 2Z31D 1X9QA 3GI8H 5TPWH 4UIKL 1ORSA 1QR4A 2AS5M 5I15H 4FQPA 3QNXA 7FABH 1FE8H 1R3LB 4ZUVB 2IMNA 1UM5L 4ODHH 2UUDK 4DKEL 3JWDL 3P30H 1ODAA 1CS6A 3T0ED 1ZHBB 3MRHA 5KSBB 3QUXC 3KXFE 2YUZA 3RL2A 1P1ZA 5C09A 3VWKA 2DB8A 1YEIH 4DGIL 3SDYH 4Z7QE 5TE4L 3AGVA 4GRLD 5C0BD 1AKJB 1FQ9C 2G2RB 5FA4B 3U4EA 3QDGD 3ZKQD 4X0KB 1N4XL 2X42A 1G7HA 2E9IA 2W9EL 1FORH 3LVEA 4U1HB 5J06A 5EZJB 5HVWA 1C08A 5E95B 3WLWD 2QKIB 4PLNC 5LJYH 4XRCA 1X5JA 1F4AA 1B4RA 1CQYA 4LLQA 3MOQA 1IEHA 1MRDL 2APTA 1UCBL 2R2EB 4LLMA 1TTGA 1QACA 2R0WH 4JFQA 4WUUB 1ADQA 2XZQH 3O4LA 4JFPB 1D5ZB 2FH8A 5F96L 1T1ZA 2HFGL 5INDA 4HGKC 4HXAH 3LRSB 3PF2A 3EYFB 2GTZA 1A5FL 2G75B 3IB4A 2O5XH 4LLYA 2VDPL 3T4YB 5I1CL 5LGJA 1JK8B 4LF3A 4J3UA 3BDYH 5JPNA 3KS0J 3UC0L 5FUZL 3X11B 1I7ZA 1J5OL 4BFIA 4NJAL 1EFXA 1F90L 3NZHL 3WD5L 1R3KB 3PP3H 3VFTB 3VFNB 1WISA 4WIQA 3FO9A 1D7FA 5BJTB 1BF2A 4JFDB 2WBJB 5EOCL 2DM3A 2VR9A 1LEIA 2UVEA 4GW4B 12E8L 2CRYA 1NUFA 5BZWB 1L7TH 3QH3A 1MJ7L 3BKML 2JB6B 5F7UA 1M4KA 1B2WL 1XF2B 4DQOL 1FPTL 4ZXBA 5IW1A 4MJ6B 4QXUH 4PD4J 3I9GH 4JN1H 4PJ5A 1KIPB 1RZFL 1S8DB 4R97B 4XBEH 2P7TB 3U9UB 3ULUD 2GAZB 5D6CB 3GNMH 1RZ7H 1MREH 1KYOK 3QJHB 2C4FU 3CMOL 3GI9H 3MO1A 3MRQB 3LCYA 4J4PA 4UT6L 1S3KL 4BZYA 3G6DH 3G5YB 1T20A 2X05A 1BREA 2VLKD 1V7NH 5AD0B 4WU7B 1U58A 5DT1L 3MLVL 4KMTH 1TJGH 1GZPA 4N0CD 3PV7A 1U8PA 5GS2D 3DIFB 3RVUC 3WJJC 2UY7A 1MAML 2P8PB 4ENEC 4XHJD 3S5LA 4CJ1A 5JR1H 2O5YH 1XR9A 5FDWB 5HBBA 4D3CH 3WSQH 4JZJC 4NC0B 5FFLA 4XP4H 3I85A 2HLAA 1GGYA 4NP4H 4QHUB 2R1YA 1TJIL 2YPLB 1HINL 2PYED 1DE4B 3MLUL 4QF1B 2XRAL 1WT5C 5CGYC 3FL7A 1A6AA 2AGJL 3BXNB 3ZE0E 4JO2H 3T0DA 2E7MA 5HJ3B 4I77H 5FV1L 3KPPB 5C6PB 3A6CH 4HKJB 1CXEA 5JIIA 1KNOB 4BM7A 1ZGLP 4R97C 1SM3H 2WIIB 3HC3L 5IESH 1CGSL 1H3XA 4PJDA 2EDQA 3O2WH 5JO5B 3QIUD 4C57C 2NNAB 4M8QA 4QHLB 5L2JA 3HLAA 5GSVA 1G7JB 4KK5D 5SV3A 1JGVL 3P2TA 4HSQA 4PJAA 3D87B 3VJ6B 3O2VH 2VN7A 1FIGL 3PWPB 3WUWB 3ZDYF 4UV4H 1HH6A 1K8DB 2EDDA 4HIXH 1X4XA 4UINH 5DMYA 5F6IB 4HDIB 5HI4C 2APXA 1DQJB 4RMSA 4ONOA 2I9TB 4V2CB 5C0IA 4KMQA 1NMBH 3LPGA 4JPWL 3QPQD 2P8LA 4FQCH 4N5EC 4J6RH 3OQ3B 4GRWB 5CD3B 3NFNB 4TUKH 1N8ZA 5CZXC 3U7WH 2H2SC 5T1MB 2LVCA 3VFRA 2O61B 5C6WH 4P2OB 4XWOC 1EHAA 2NXZB 4OGYL 4XBPA 4Y88A 3OX8A 4LCCC 4WO4B 5MI0C 4GAGH 1W0VA 4YQXH 5LXGL 3OKMB 2HAZA 2VDOL 1F13A 5FYJE 4X6CB 1RZKC 4KUCF 3VXRA 3NIGF 4YDJB 2V2XB 2B0SH 2CK2A 5FXCH 2PXYB 3BZ4B 4X7CC 4Z7VA 2A6JB 3ARTA 3ZKXB 1H3VA 1AXIB 3HG1B 1N64L 3NTCH 5DF0A 2X4NB 1W0WB 2B2XL 3STLB 3BO8A 1P7HL 3DX8A 1VERA 1GHFL 3UXFA 1ZOXA 2R1XB 5SX5K 4QRRB 3JSSA 3STZB 1KENH 3ISWA 1RK0A 3SGEH 3WFDL 4DVBB 1FZOA 2B5IC 3I6GB 4RZCA 5T3XD 1N7MH 2ERJC 3FQRB 4EVNA 4PGDA 2A0LD 1HHIB 3AY4C 4LCWA 1DDHA 4QWWD 4U6XB 2XPGB 4PP1D 1RZJC 2J5LB 3CJJA 1TZGL 4NQVB 1VHPA 4PJFA 1R5VB 4OQTH 2IAMC 4XMLH 4YK4C 4G8FA 4RFEA 1EXUA 2EZ0C 5E08L 2F54D 4G42A 5I1GH 4EN3D 4HZLB 5A2FA 4KK6C 4U1LA 5C6TL 4LKCA 1TPXB 1X5HA 4P2OC 1MWAA 4NWTH 5DK2A 3KYMB 3ME0A 4CADA 3N9GL 1AP2A 1DN2A 3VH8B 5TDNA 5FCUL 1KT2A 1TVHA 2Y07H 2QBWA 4UZGA 2IALA 4YDVB 2CKBB 1UGNA 5D5ME 3ZDZE 1RV6X 1FBIL 1T66D 3MCLH 1YDPA 2ATKB 1HNFA 4MCZA 1QVOB 1M7XA 3ZKXC 1T7YA 1ACYH 2DQCL 4CUCA 1PKQB 2CD0A 2DQIL 1EAJA 3FN0H 5DO2D 4X6DB 3HPJA 1S7TB 5EO1B 4Y16B 2EKSB 1T2QL 1B0GA 3MRFA 2R8SL 4KZEL 5EO9A 3B3IB 2FIKB 5ICYA 1P4LA 3QG7H 4HX1A 1P7QD 4ZUUA 4LVNC 4RAVA 3L1OL 5F21B 3VFMB 3UPRA 1IAKB 3AM8A 3RGVC 1C5DA 2CKBL 5CSZB 3TESA 4N0UB 5A1AA 3O45B 1PY9A 4UQ2A 1B0RB 5L8KB 4G8IB 4WI8A 5GSRB 1REIA 1F3JB 2J4WL 3QNYA 4KI5F 4ZYKA 3ARBD 3GMMB 4GKNA 4WDIA 3RVVD 4ODWB 1FJ1B 3HRZA 3BEWA 3J8F7 4F7PA 3FFCB 2W65B 4W4OA 1KEGH 3GMNB 2D0FA 3LRHA 3V5DB 2WUBH 4HJGA 3DARA 3DOSA 4WFFE 5DURD 2M26A 4XPFL 5DUBB 3H0TA 3PL6A 1I9IL 2Q3AA 4GRMB 5EUOF 4GQ9L 3VXSA 4RQQA 1TZIA 3QIWB 4E42B 4PIRF 4GW5A 3QT2A 2ZP0T 5F93C 4X4XA 3V7MA 3QDHA 1JVKA 2BVQA 3AREB 3BKYL 4MD0A 3WNOA 1OVZA 4NQED 3DRQB 4CRPA 3GJFA 4X99B 2VL4A 4KJWC 2NTFB 5FCSH 5DD3H 2RBLA 2W0PA 3OJ2C 1NEZB 1I8IA 4LLWA 4WW2A 4DAGH 2Z92A 2V7HA 4OF0A 4RWYH 3CPLB 4GQPH 1RURL 2YKLL 4K3HA 5KOMC 1YEFH 2GI7A 1HDMA 4KRLB 1CDJA 4N8PA 3FO2A 3ZTNH 3QDJB 1MOEA 3IDNA 1RUAL 1MFEL 3D0VB 4P2QE 1I3UA 1OM3L 2EIDA 4F37F 1GC1C 4WCYL 5CWSB 1BBDH 5L8LB 3GB7B 3VRLE 5BS0A 4ZOBA 3QI9A 3S88H 2CIIA 2DMBA 4QRSB 4TRPH 1QBAA 3O6MH 4E41D 1AHWA 4YE4H 3O11A 4KMLB 3QXDA 1MI5D 2J8HA 4OFDA 5I30H 4NQDE 3IT8D 4QRPD 3LD8B 3FT4A 3EO1A 1RIVH 3PP4H 5J89A 4U1JA 5E8PA 4RNRA 4AM0A 5D2NA 4G8EB 5TE7H 5FO8B 1AGFA 1DEEA 1T80A 1ETZA 1WBYA 1VACA 2P45B 1S5HB 4FN0A 3EOYG 3TBTA 5EU5B 5FYLH 5JPMA 3CXHK 5LQBH 4OGAD 3NZ8B 3TVMB 3Q1SH 1I8KA 1RZJH 2ZJSL 1MF2H 2V7NA 3QO1A 5IT2L 1YYLH 1RUQL 1HSAA 4GG6F 5EA0L 2W60A 1E6JH 1WWWX 2FSEA 5D1XA 4GRWH 3E3QC 1LDPL 4ODTH 1K2DA 1T3FB 4PTTA 5FOBB 5DI8B 1FFNB 4R26L 4D0DB 3RJQB 5EU4A 2GT9B 5KS9F 1KYOJ 3EGSA 4CMHC 1ZANH 5E8DL 3GSQA 1ZKAA 2H2PD 4K8RL 1T0MB 1KTLB 4RMRA 1ZT4A 2JK5A 3KLAB 3LV3A 5FHBL 5AAMA 3BH8A 4NQCA 3K74B 2AJZA 2QADB 4Y2DC 2DQUH 5FHAL 1JYWA 1I3GH 1WZ1L 4P4RB 4UTBL 2MHAB 4ODSH 1BJ1H 2C26A 5JZ7C 1AXTL 1AR1C 4DKFH 1S9VA 3LD8C 4M03A 4LHQB 2D7TL 2VMFA 2R69H 2EDNA 5CBAB 2I5YH 3QHTC 4LPYA 4QXWA 4D0CB 1H5BB 2CRIA 1G6RB 3TNMA 4N8CH 3BX7C 3VXTB 1T1XA 1XF4A 1NFDA 1HHHA 4AT6B 5EZOH 2YD7A 1JFQH