3WUZA

Crystal structure of the ig v-set domain of human paired immunoglobulin-like type 2 receptor alpha
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
MLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for simultaneous recognition of an O-glycan and its attached peptide of mucin family by immune receptor PILR alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Paired immunoglobulin-like type 2 receptor alpha
total genus 29
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuzA00
2V7HA 3ILQC 3DYOA 5D2LE 3WN5C 5DJXA 1HZHL 2X4RA 4MMXC 2EDNA 4Z78B 2WP3T 2AV1B 3O3EA 4RMSA 2OXGA 4TQEH 4P4KC 4L1HA 1RFDH 5CILH 4UIMB 1U3HD 3CFCH 2ZP0T 4XTRC 4TPRL 5FYLE 1CIDA 4UT6L 4Y1AD 5F7LB 3NIDE 2ITCB 3WSQL 5BVJB 1XZ0A 2AJSL 4CN4A 4O2EB 3OKKA 5DRXB 3PV7A 2CXKA 4OQTA 5A2FA 3BIKA 1ZHLA 5D1QD 3T4AA 3RVVD 3SKNA 2FL5B 5CILL 5HJ3B 4P2OC 3GEWB 2VLRB 1A6VL 4N0FA 3MCKB 4NQCD 1ZAGA 1J0IA 2YKLH 2CDFA 4WGVB 1KN4H 3SQOH 5C0BB 4HUUA 4NJ9H 1D5MB 4JN1L 2KH2B 2Y5TB 3F12A 1J88A 1KB5A 2BCKA 4PBWD 5GZNC 1AGCB 4XNZB 3S97C 3GJFH 4LSDA 5HHNA 4Y4FB 3V52L 4YXLL 3KPNA 2BRRL 3T2OA 3MGOB 2UVEA 4YK4C 4M6OH 4WTXA 5T5FH 2YRPA 1KJ2H 1NCNA 2CKBH 3TH3T 4X7TB 1C08B 4RSVA 1RIHH 3S37H 4WW2B 4ZDHA 2B5IB 5ELIA 5MEOB 3VD5A 1VGKA 5ACZA 4I0PD 5E99L 3QCTL 1UZ8A 4ZMAT 2NXYC 2FEEL 4KWUA 5IJKC 3WXWH 3P9WB 3VGHA 3PGDA 3BVNA 4FQ2L 3KXFB 2CH8A 1DCLA 3ARGA 3ZKXB 1E6JH 3CGTA 4QRRD 3L7EB 5EBWA 1IE5A 3TPUA 3WDJA 3FB7B 2WUCL 3LRSB 3CDCA 1C08A 3MNZB 4X7SL 5EOTB 3CUPB 1F90H 5T1MB 3TT3H 3SE8H 2P48B 5DHVH 2DLGA 2DQJH 2R9HD 4L8BA 2R56H 2BSSB 4FFWD 4AENB 2VH5L 3OXSA 4KPHL 4PJIB 2AEQL 4E9LA 1BVKB 1AO7A 5A16B 3U7YL 1V7ML 5DURB 1GZQB 4FMKA 4MA3A 2XTJE 2VDRL 3DRQA 4OZIE 2Y5TA 3F12B 4GG6E 1KTDB 5LBSH 1AGCA 3G6AA 3FN0L 1WEJL 3EGSB 3HFML 1X3DA 3INUH 1WT5C 1FO0B 3O41A 4KQ3H 4XXCC 5DHXB 3U4BH 4ESKA 1ROWA 1G9MH 3O2DA 3H9SE 2ZJSH 4DUWA 4A6YH 5HJ3A 2HFFA 1F8TH 3GRWL 4FTVB 4WI9A 4O02H 3LQZB 4PS4H 4P49A 1V3KA 3FRPA 4RA3A 3QQ3A 3B5GA 1KCUL 3T0AA 4X9BA 3CDYA 3REVA 1MFDH 2ITCA 2EECA 3I2CL 4W4OA 4MAYD 4OCWH 2DWDB 3KLHC 1TQCB 4G8GB 3CH1A 4IEFB 3HE6C 4YHLL 1FFPA 3IDJB 2VKXA 4UIMA 4P23A 2ADGB 1HXMB 4H20L 5CAYB 3SKUD 1IGFL 1N6QH 4S0SD 4PUBL 2KPNA 2D7TH 5D2NE 3WFZA 3ARWA 3MLXH 5K9KB 4FMFA 5JHDA 3OL2A 4OBSA 3HNVH 4N8PA 3FTGA 2PTUA 1OHQA 4NZUH 3CC5B 4U1SA 2X7LA 5JIHA 1ITCA 4GS7C 5C7XH 5K59F 3L1OH 4OCWL 4TUOA 1UM4L 2EZ0D 2R1WB 2VSDA 5IEHB 5FDWB 3BQUB 4PRPE 1QFUL 3BEVA 3HUJA 4X6BB 5DQJA 2EKSB 3NAAL 3MJ7B 5CUSH 4JM4L 4R4FH 3LKSB 3O6LH 5B4MC 4NZUL 3K4DA 5GHWH 2BERA 3UYOD 4MSWA 3VFVB 4R2GC 5TJWK 3ULUC 5FA4B 4BUGA 1A7RH 5DYOB 5E1AB 3DX9A 3H42H 3SDCA 4PJXB 2F74A 4G7YL 5H94A 4L8SB 3GSNA 5GRYA 1U8NA 5ABDE 2H41A 5D7SH 1M05B 1I3RB 2ID5A 1T0NA 2NY4C 4LDEB 5FHBH 1R5VA 3H0TB 2YXFA 2GTWA 3RIFK 4Y2DB 4E5XB 2X09A 3S34H 5IMKB 4MDIA 4RGOH 3VXPA 4CMHC 3OKOA 25C8L 3H9YA 4PBXA 3MLVL 3ULUD 5DD5H 2NY1B 1FNSH 1KELH 3HZYB 3HG1D 1HNFA 1N5AA 2GJ6D 2UZYB 1AD9A 3E0GA 2FX7L 4RIRB 1RZKL 2YXMA 5F21B 2H9GB 1GC1H 5D2LB 3GM8A 1ZA3B 1BQLL 1P7KA 1ZGLP 5EO0A 1T0MB 1K3IA 1PX4A 3MZTA 4HQQL 3QUMB 1J0HA 5CZKA 4H5SB 2VDPL 3WIHA 1KELL 2B5IC 2JB6A 3S4SG 4BK5A 3MX0A 3FOMB 1EPFA 4ODWA 3LMJH 3PV6A 4JPKH 2RFXA 5IQ7L 4KMQA 1UJTA 4BSJA 4NM8L 4J8RB 3MRIB 4R96B 3CFJB 1FL5A 4AH2A 3FQUB 4XNZC 4LCIH 3RUGF 2IF7A 1Z9MA 1CCZA 1TZIA 3MRLA 1A9BB 1IAIL 3MV8A 4G9FA 4NJAH 4OZHB 4QHMB 2VDNH 3WUZA 4QYOA 5GSVA 3M1BB 1X9QA 1EEZA 3EYFA 5KSVA 3HMWH 3HZMA 2Z0BA 1RULH 2YD6A 2FO4B 4YIQB 4HD9A 3C6LC 2OQJA 1VCAA 1UCBH 5F7EL 5GS1B 5IMOB 3LH2H 3I02B 5EC2A 5ALBH 3QDJE 1I7UB 5INCB 3VRLE 4L5FH 5C0DA 4FXGA 4ZUUB 2H2SD 4X0KA 4P3DA 5H35A 3WSQH 4Q2ZA 3QIBB 1BM3H 1N5YL 1S7QB 1QEWB 5EZLB 1INDH 1CLOL 2YC1A 1FPTH 2V5MA 2OS7A 1JJUA 4JRXA 3M8OH 4OCRH 3GRWA 4ELKB 1R3IH 2FJHB 3VXUE 1SEQH 2FEDD 1WCBB 3TNMA 3BIAX 4GOSA 4KMLB 4F8TA 4QF1A 5C08A 1PLGH 3NCJH 1CZ8L 3MV8E 1WZMA 1BM3L 1JGDA 5KANI 1NDGB 5HI4D 2HRPH 2XWTB 4KI5C 1R5IA 1QSEE 3CFBB 1HQ4B 3MMEA 3KPRA 1MCJA 4N8VA 4YK4B 2CGRL 4Z7VE 5I17B 1II4E 4HDIB 1MOEA 2YS4A 4WHYG 3RA7L 1PQZB 1ZV5A 3MRIA 5FGRA 5GSRB 1JTTA 5HHOD 1EJOL 4DKFH 4MXVE 3BGFC 3C5ZC 1OLZA 2YPLA 2QQNH 3QDGE 2X4QB 1CK0H 3PWPB 4LMQI 4DN4L 3OPZH 4OZ4A 5I1CL 5SWSD 1PSKL 5GZOD 4WDIA 4HLJA 3UPAA 1VADA 5ESAA 3RA7H 4WFGE 3VXSB 1HDMA 1YEKH 3HC4L 3OWEA 4DKFL 4WWKB 3NIFE 1EH9A 2OI9C 4RA0C 3EYUL 1FE8H 4MA7L 1OAYL 1HIML 2DKUA 3N1PC 4E41A 4XC1L 1WWWX 4YBQC 1C16B 1QFPA 1PYWA 1RMFL 2E27L 2YUWA 4P59L 4MHHI 4ONHA 4DUXA 4KDWA 3WJLA 1D3CA 4JM2B 2MPAH 4XRCA 3PWUB 5DC0A 1CQYA 5D6CB 3H7BB 3Q6GH 2B4CL 1NC4B 5JW5B 1DDHB 4NO0A 4XBPA 4RFOH 1URLA 5H94B 2CDEA 1KJ2B 4TOYH 4YJZL 3BH8A 5EU6E 2KKQA 3QXUA 5BXFA 1KJ2L 4DVRL 3Q5TA 3JV4B 1OSPL 2ZSWA 1Z2KA 2NY0C 3FN0H 4WI5A 1KLUA 4P2RB 5GGVY 1WZLA 1TPXB 4F7CA 2XA8H 2BZDA 4LLUB 3CLFL 1QLFB 1U8HB 4NQDE 3GIZL 2B7DT 2R2BB 3QUYA 4DVRH 2MCG1 5D2LA 2F54A 3AFLA 4GW1A 3PG2A 4Y1AA 1AD9B 2BY0A 4HKBA 2HRLA 4U1SB 4D0BA 3D25A 4P4KD 3TC9A 4HWUA 4WEBL 1ITBB 2CO7B 1QR1A 3CLFH 5DJCA 4Y88A 5KOMC 4K3EH 3GMMB 4HZLA 3FT4B 2AEPL 4ZNCD 5I1HH 3WS3A 1T3FA 4TSBH 1LVEA 1I1AC 2BJML 5JQ6H 3BE1L 1LNUB 3MLRL 1AKJD 3RUGE 1U8IB 1JPFA 3T0EA 4OGYH 3FO0L 3I6GB 5T3ZD 3MV9E 3NA4A 2PTVA 2GFBA 4LCWB 2GJZA 4CU6A 4GKZA 1F5WA 1XGTB 1JUFB 2GSGA 4IJ3B 5DMJB 3AROA 1FAKT 4PJFE 1S8DA 5HDLA 1L6XA 4XCNA 3X11A 2ZPKH 5JXAH 5CBAB 1U8QA 3VD9A 4YHZH 2NYYC 5J13B 3STLA 2N56A 5D6CA 2V17L 1IKFL 3WIIH 4Y5XC 5DUBA 5IMMA 5JLZA 1FH5L 1OB1A 2P4AB 4FTVE 2YMXH 4EDXA 5BS0B 4LAQL 1YA5A 5I1KL 3SE9L 2HJFA 5TF0A 2NY5H 3U79A 2EYRB 4MDJB 1MUJA 2HP4A 1YMHB 1A3LL 3FOLA 5EO9A 5SWSA 1RJCA 4RGNB 1CDBA 5C9KA 5ESAB 3WXVL 3ULVC 1UH3A 1AHWB 5J6GB 1RZ7H 3FB6B 3DHJA 4X99A 1I85A 1ZS8B 3MNWB 4PJIE 1G7LA 2EEBA 4HQQH 1KEMH 1NCTA 1VFAA 3BPCA 4AIOA 5DVKA 3SKJH 1CGSH 2Y6SC 5D96C 1LEKA 1M71B 4WI7A 3TO4A 2L0DA 4J3OC 5EA0H 3U46A 1J8HB 4APQB 3L5XH 3O4OB 5DTFA 4FFYH 2QHRH 5JO5A 1YEEL 3TF7C 4Z7QF 3NZHH 3NIGE 1HQ4A 4X9HA 4AEHL 3UTZB 2I27N 4XPHH 2I26N 3SGKA 4U1KA 4Z7NF 4Q9CA 4ZS6C 4F7TB 4NC1C 4PJIA 5B21A 3A6OA 5TDOA 5C0AA 3SKJL 4TUJA 5CIPH 1A9EA 1PKOA 3MFGB 3MODH 4MA8L 5D1QA 5JA8B 3KLDA 4X8XA 3EYQD 1KUMA 4M7ZB 5IW1A 2HWZL 5I71B 1RZKC 1ZTXL 2XY2A 1FL6B 1LO2H 3QXDB 5CZXC 3FT2A 1JHTA 5IBUG 5DD0H 5JOFA 3CZFA 1RULL 3ZE0E 4KK8C 1HYSC 1IKNA 4JFED 2CUMA 4XVTH 5H35B 4S1SL 3QG6B 1UCBL 1KIUA 2YUZA 5F7EH 4XNQA 1NCWL 2WBJB 4YAQB 5LGKA 5C0DB 1SYSB 5FA3B 4G6FB 1RUKL 5K9QI 3OKKB 1A2YB 5DRXA 1P4IL 4RRPG 1QO3A 4PJEF 3VD4A 3MOBH 2UWEA 2YD9A 3RQ3A 4JQXA 2OQJB 3BSZL 2PXYB 2MNUA 4G80B 3LSOA 4HF5L 1I8MA 1LK2B 1MAJA 1JZ4A 1TJIH 4LSPL 3VWKB 4LOUD 2BX5A 5E08H 4YDJB 2Y6SD 5DVNA 4CJ1A 2DQDH 5D1XD 3B5HA 1NMAL 2OR7A 4Y4FA 4OGXL 4GUPA 1OTSC 3L5WA 3PUCA 3OF6D 1KEGL 1N0LA 3QP3A 2CRIA 4QRRE 3SBWA 5TDPB 4JCLA 1QFOA 1MJ8L 1RK0A 2H26A 5DMKB 1E4WL 4NC2B 4FXLA 2FLBT 4P23C 4KHTH 3WNKA 5ISZE 1E4JA 3ULVL 4NQEA 3FRUA 4XNMA 4HEME 3HS0B 3QH3A 4OLUH 5IOPA 4MXQC 4WY7L 5BJTB 5ANMB 1ZHLB 3A6CL 1HK6A 2HVKB 2CO6B 5M95B 3T0BA 4MAUL 5E9DE 1Y6NR 3QUKA 2AERT 4K94H 4E41D 4TSCH 5E5RB 4FABH 3U0PA 1DN0A 1ZVYA 1WZKA 2XPGA 4PGZA 4NPYA 5J0BA 3U1SL 5F1NA 2H2PD 3G5VB 5D7KE 5FOJA 3KPQB 2OJEB 3VDAA 5FXCH 4H0GA 1NCAL 1Y18A 4MAYB 3ES6B 3SDCD 3WL9A 3IKCB 3LQAH 3RUGA 3NFPA 1JP5A 5SWQA 4J3VA 5I2IA 1G0XA 1TFHA 2WIMA 4LLWA 4LHUG 4PJ7E 4I18C 4WNQB 4P5MB 3TN0B 3QUKB 3GSRA 1NC2A 4NBZB 3IVKA 3PABA 2MJWA 3KPSD 1EZVX 5HDQL 1I1YA 4NQED 2K7QA 4ZTPH 4JKKA 4HH9B 3RWFB 2H2SC 1H5BB 1IEBA 5ILTL 4W4NA 3MO1B 1WBZB 1BWMA 4Z7OE 3SGEI 1F90L 1A8JH 2CIIB 2AXJA 4XX1G 4UQ2B 1OT2A 4PJ5E 2VH5H 2BC4B 4DUVA 3MRQB 3IDIA 3GSUA 1TXKA 5F97E 2N1KA 5GRUH 1P6AB 1KIRB 4XP6H 5TGBB 2F5AH 4CVZB 5T1LD 3QEUB 3U7YH 2J5LB 4YHIB 3T09A 4F33B 5E4EC 1QLEH 1XGYH 3GM0A 1TQBB 5FB8B 2BVOA 5C0AD 5AG9A 2PR4H 1QYGL 5IVXF 2EDKA 2FX9L 4X4MA 4UTAL 2R39A 2UY7A 1RZGA 4UQ3A 5KVMC 1LK2A 4M93B 1VACB 4QHKJ 5LJYH 1MLCB 3IJHA 1RI8A 1NGQH 2HVKA 2JB5L 3RWJA 1E0OB 4JREB 3MRPA 3RBSA 3VXUA 1UKQA 4FQIL 5E9DB 2DLHA 5C6TH 2IAMA 3CDFA 4DKEH 2GCYA 1MIEL 8FABA 1BHGA 2F53E 4ZSOE 2CLRB 5DHYB 3IFPA 1YEGL 1A4JB 2VN4A 3MLWL 3TBYB 3F7YA 3L3JA 4Z7VB 3RWEA 3QAZB 3C6LA 4WJ5B 4MCYA 4EVNA 3D39B 5HYEA 3ZO0A 4LARH 1HXYB 5C8JB 4MD0A 4FFVC 3WD5H 3LN5B 2C9AA 3IETB 4R4BA 3QXAB 3A6BL 1G7QA 4QXGH 3W2DL 3NA9H 5J6HB 5IQ9B 3P11L 5IVZB 2YBRB 2CLZB 3VXMB 1IL1B 3GHEH 2EDLA 3IXTA 4CVWA 4NO5B 4HBCL 4KQ4L 2BVQB 1Y0LB 3F7QA 4KDVA 4NM4H 2Q7YB 3DGGA 5K9QG 1OP3K 1I4FA 1M71A 4IDJH 2VISA 3EZJB 5K9JH 4A6YA 4IRZL 4K3EL 4YAQA 3BT2H 3MRKB 1SJVA 2Z92A 3SE3C 3U4EB 1CGVA 1RZFL 3R06B 3QFJB 3NTCL 4OLVH 4ZFOB 4P3CL 4OZIB 3RIAF 3FB6A 3VWJA 2MOVA 3V5HB 1DQDL 1FFOA 1EEYB 3FQTB 4JN2A 1JGEB 1E4KA 5FHBL 5K9JL 1U92A 5LQBH 2V7NA 3DMMA 3VWKC 3BKML 3C6LD 5F9WC 1CGWA 3QIUD 4NQUA 1FVCB 2MCPH 1KNOA 3SCMC 2EH7L 4ZPTA 1Z6JT 1K8DB 3Q3GB 4HKZB 1RZIA 1XGPA 4OLVL 4DEPB 3IXAB 3QNZA 4U7SA 5BS0A 2VZVA 3VW3H 3BD3A 4OTXL 2R2EB 1SHMA 2WBKA 4U2ZA 3NZHL 2YEZA 1F58L 1Q1JL 3PIQA 3EJYC 1AXTL 3KXFE 3T77B 4FQJH 1CICC 4HUUB 1M7DA 2M26A 3SO3C 3B3IA 3FONB 3QEHA 4JANA 3IETA 2CXGA 3ARBC 3LN5A 2UWEF 1G7LB 3MNWA 2YA2A 5EZIH 2FATH 4O5LH 3T8XA 3ZDXE 4F7MB 4KJYA 4AM0A 3FHAA 5GJSL 2NXZC 3LN4A 4JDZA 2PYEB 5I15L 5D5MB 5H2BB 4L8CA 1X5FA 3DVIA 4P2QB 1EK3A 3RWEB 1IJ9A 2D31A 5IHLB 1VENA 1P4LA 1U3HA 1DR9A 2YZ1A 2LV4A 3GK8L 4AL8H 1S7RB 2AJUH 1XR8B 2VDKH 1QBLL 1BREA 3BKCH 4NJAL 1MWAH 2OJZL 2IAMB 3ZSSA 4UT7H 12E8H 3T0XA 3RY4A 4OB5L 5EU6D 2PNDA 3KAAA 5L2KD 5KJRL 5LWYL 4HIIB 7FABH 3D25B 1I1FA 1VACA 1EVUA 3TYGL 5C0BE 3MV7E 5CP3H 4PR5B 3ARFB 1EAPA 5GS0H 1MI5B 1MVUA 5FUOH 4PY7B 3RKPA 1EERB 3BI9X 1FP5A 1CXEA 1AXSB 3RTQB 1S8DB 3NFNB 1FFNA 2DKSA 3GB7B 3AU1A 5J9PA 2BC4A 4N0YL 5GIRB 4LCWA 4NN5B 3I6GA 4RNRA 1F4YH 2CIIA 4G3YL 1ADQL 2QQLL 1INQB 3MA9H 5FCSH 1LNUA 3O8XA 2JKXA 4M3KB 2IGFL 3C8KA 4ZO9A 4G42B 3EOAB 4KKBC 4QHNB 4OZFB 1FN4A 4UZGA 3DI2B 4M6OL 5I19L 1MI5A 3DSNA 5CEYB 3V6OE 4LLYA 3E6FB 1I8KB 1JPTL 1OWWA 4W6WB 2W9LA 4JM2A 1LP9E 3O6FC 1DBAL 3NCFB 1CR9H 4GW5B 3DX8B 3JV0A 3KXFD 2KUTA 5KS9A 1CYGA 1MFDL 3BDBA 2WW8A 3MRRA 3VFWB 1DBJH 4GT7A 1BQHA 5D6DA 2E7CA 4LSPH 1SJEB 2J2ZA 1A3RH 4R8WH 4UV7L 1QZ1A 1IAKA 1S5HB 1UA6L 1P5UA 2DQHH 2VLKA 4QNPE 1JPSL 3HR5B 4DN4H 2Z35B 5JNYA 1K85A 3O4LA 2YKLL 4HWBA 3UJIL 1WJ3A 3C8KB 4Z95H 4JG0H 1T2XA 3ROOA 3QIWC 5JW3L 2Q1EA 5IW6A 1DZBA 1MFAL 1ERNA 3BH8B 3FQRA 3T0ED 4X6EB 2VABB 4QOKB 2BY2A 4LLAA 2VDOL 2GTZA 3ARPA 1DQQA 3V52H 2OBGA 5IVXE 2NW3B 5C0CB 2AEQH 2HLFC 2P7TA 3VFRB 4U6YB 3CLEH 1XF3A 4OGAC 1GSMA 4Y5VB 1QSFE 2HT3D 1JZ8A 3IAPA 5IB3A 1U41A 3PXHA 3CVHA 4P23D 4GKOA 3GGWB 5E2VL 1H3TA 4FFWC 2XWTA 5F1OB 1OW0C 2Z91B 5IROA 4K9EL 2BNRB 3H42L 5GS2H 1RZJC 4OLYH 4S2SB 2NZIA 1CFSA 5DD6B 2GW5A 1GGYA 3B5TA 3V4UH 1JGEA 1NCUA 1RUAH 4HV8B 3ECBA 4LOUC 4POZC 3K80A 1EFQA 3VXSE 4JJ5B 3EOTL 4D8PB 3DXAB 2PXYA 5IEKA 4LP4A 5E5UB 4KJWC 4I0PC 1YDPA 4R3SB 4PJ7F 2V9TA 2X89A 3GIZH 5B8CB 1IGFH 1UZ6E 1N6QL 1HHGB 2P47B 5GGVL 5A2JH 1NFKA 1A2YA 1Z3GH 5INCA 4NRXA 5IFHL 1M7XA 4PLJC 3T0VA 5AG8A 2P45B 4J1UA 4PJ8C 1QFWM 1ORQB 2CIKA 1ETZB 2R69H 4PGDB 3KYOA 2AW2A 1CXIA 3I50H 1MCHA 3MBXL 3D69A 2ICWA 4KY1H 4MXVF 1FNFA 3DV4B 3KDMB 5D72L 4ZS7L 3ECBB 4MCZB 2JIXB 3G6JE 2F9BT 4R4BB 3HFMH 3QUMH 5I9QB 3O6KL 5C0AE 1CD9B 4G8FB 1IAOA 4C4KO 2GJ6E 5KBNC 1K6QH 2XFXB 3HG1E 1QHOA 1XGRB 4YUEH 3FO0H 4U1KB 3TWCL 4QKXB 3UTZA 4X6DB 2D0FA 3V6ZA 3ESUF 4JVWA 3H9SD 4G7YH 4NM4L 3U83A 4XPFH 3MJ9A 1J5OH 1FFOB 3KWWA 1JN6A 4HIXH 4JM2D 3MRPB 3UC0L 4YHZL 3ULVD 1HSBB 1YECL 5DJ0A 2HVJB 4PJ5B 1I8IB 1CF8H 3MLSH 4UOJA 5ALBL 3D0VA 2BSRB 4X80H 4P3CH 1DLFL 3D39D 2F5BH 3OKEB 1JVKA 4YPGB 2JK5B 5BMFL 1CE6B 3KPSE 3RGVC 4JG1L 5DJAA 3AY4A 1HHJB 1YEJL 3VXMA 4P46B 2ICWI 3QZWA 32C2A 2VLKB 5CSGA 1S5HA 1LWRA 5F7FA 4M7JL 1X5JA 4X6CF 1TNNA 3DOSA 5D1XC 2BFVL 1ZHBA 3RVXC 5HSFA 3QXAA 3ZE0F 1FNEB 5CD3B 3WFEL 1KPVA 1PKQB 3HAEH 2DB8A 1QSZA 2NW2B 4BZYA 1HWGB 1A3QA 1E4XH 3T0DA 3H9HA 1CZ8H 3ZDZF 4LPWA 4MCYB 3KPPB 3VRIB 1DUZA 1BVLB 4PJBA 4PJEE 1CN4A 3OKYA 4LFHD 4HS3A 3VH8A 2EIEA 3Q5OA 3HB3D 4HHAA 2CGRH 1T0MA 4HUXA 2FATL 3QCVL 2GCYB 1CBVL 3VU2A 4RBPH 1CGYA 1GOFA 1NUDA 2ZG3A 4ZPVB 1FYTB 4OLEA 1A6UH 5FYKU 5FAAA 2GJZB 1HHHB 3CVHH 5D93B 5HDBF 3MV11 2R1WA 2VDQL 5DC4B 3WHXB 4JO1L 3GK8H 4XCEB 4JFXB 2EDRA 3IKKA 2AJUL 2VDKL 2PO6D 3HPJB 3TH2T 5I1LA 4TUKL 1IFHH 2ICEA 5IJVA 4B53A 4X5WB 5B3NA 12E8L 2FZ3A 3WFBL 4MJIB 5EOCL 4MJ5A 3MV9A 1IGCL 1M4KA 5C0IB 1OM3L 5HD8D 1XMWA 4DTGL 3N1GC 3UPRA 3DX9B 2DWDA 4QGYA 4QEGA 5FA4A 4FQ1L 2AQ1A 4XXDB 4GMTL 5EZOL 1FYTA 3QQ3B 2F54B 4DN3L 1CFTB 3TO4D 3I9GL 1LO3L 5FYKE 3WFBH 3BGMB 4KJPD 1ZT1A 3VG0H 1NUNB 5GGRY 5IUSA 4WENB 3X13B 1XCTA 5HHVH 2CK0H 4HPYH 2W92A 4FQ1H 5FDWA 1FZMB 1RUMH 1NC2B 4M6AA 5DO2C 3S5LA 5KVDH 4JFPA 1NDMB 1WISA 2QLVB 4PRPB 3UTPE 5CJOH 3I9GH 3FTGB 4X9IA 4WO4A 1YYLL 2BXYA 3F58H 1KJ2A 4OGXH 3RNKB 1BVKA 5JW4N 5BV7L 4ODUA 4AL8L 1M7DB 2QQNL 1S9WA 4Z7UA 2F8VA 4M02A 5L9DH 4HS8H 2G2RA 3RVUC 4OB5H 2RIKA 1DL7H 4L4VE 5D7LD 2UWEB 3IU3B 3JWOH 5I71C 4YPGA 4KRPD 4ZSOA 3HC4H 5JOPE 3REWA 2DMCA 3S3JA 3V95A 1FBIH 3BQUC 4NRZA 4XMKH 2NCMA 3LV3B 3O45A 1I8IA 4KTEL 1IARB 4PG9B 3RIAK 4TPRH 1RHHA 4IRJC 4HS8L 2DQFA 1G7MB 1OAYH 2QKIA 5BZWB 1M1SA 3GJFB 1AFVH 3EZ8A 5E94B 3TGXA 4L9LC 3LIZL 4NFDA 1EEYA 3O4OC 1FZJA 1GIGH 2E9IA 3BW9A 4KJPC 4PRAB 1S78C 4DWHA 1X4XA 5GJTH 5DMGD 2Q3ZA 1UXSB 3MR9A 1OY3B 1TQCC 1J1PH 1IQDB 2B4CH 3I6KB 3KPMA 5H37H 5JOPD 2YRLA 3C09C 2EH8H 3QDHA 4GKSA 4HPOL 1UVQA 5KSBF 3DV6A 4K3DL 4OLXL 3QFJE 5IHUH 3VWKA 3BX7C 5CIPB 5SWZE 4K9EH 4LFHG 1S7SB 4XZUA 3SCMA 4OGZA 3RPKA 1G7QB 2Z8RA 1RPQA 2ARJA 3V7MA 1RVFH 2JJTA 5E2WH 1FH5H 5FGBA 4R8WL 2VLRA 4GRMB 3V4UL 4GRWE 1Q9KA 1P1ZB 1GHFL 5F1IA 3BO8A 4KHXH 3D1MC 4I8DA 2NTSP 1KXQE 4UT9H 2FB4H 4MX7A 1EFXD 2DICA 4JRYD 4CN1A 4WFFE 1HOCA 3VCLA 4NDMA 1XF4A 1F2QA 4LLMA 4YHMH 1JYVA 1W0VB 5JORB 8FABB 2AEPH 1MCOH 1RZ7L 3K74B 1JIBA 3RGHA 4M4PA 1NGPL 4HAFA 1ZWIB 1MREL 4KHXL 5JPNA 3VXRA 4EN3C 2VZUA 5DJXB 2O5ZL 3CFIC 3GFUA 2EXWC 1M6OA 3L3DA 2V7HB 3HZMB 3STLB 1BZQK 1I7RA 3GKWL 4JM2F 1CGXA 5LCVH 1G84A 2GY5A 5DJ2B 4JQVA 5E1HB 1I1AB 5D2LF 3MCKA 1F97A 3F7RA 4YHKL 3WE6A 3L95B 1EV2E 1RUPH 1KIRA 1DBKH 4ETYA 5MEQA 2WMPA 3GMNB 4Y19D 2YPVL 2HN7B 5FYJL 4CW1B 1JWSB 3WNLA 3U9UA 4QOKA 4HIJB 1FIEA 1Q9WA 1FNAA 3HZKB 3VFUA 1CQKA 1L4IA 4MA8H 1X5XA 5IW6B 3M17A 1RIVH 5GZOC 3B2VH 1OF2B 4U0RC 4NQDB 3MRNB 3SO5A 5IVOA 4K3JL 4ZD3L 4ISVA 2ZUVA 4HH9A 4NSKB 5I1KH 5E24E 3R4DA 2R4SL 1A5FL 3D85B 3STZB 2FCBA 3EDEA 4K8RL 4LCUA 2P8MA 1KG0B 3CFDA 2Y9RT 2JJWA 5ITFB 2ZCKL 2PYFB 5KS9B 4H1LH 1CS6A 1KLFA 3UTPD 2HAZA 3BT2L 4Q0XH 3OF6A 1FLRH 3BIBX 1A0QL 5CBEB 2Y4SA 3O6KH 4PTTA 5ICYA 5KSAC 4ZOAA 1DSFL 2A73A 1IZKA 1WWAX 4YFDB 4XCNB 1FG9C 2C3GA 5ENWA 3IGAA 1K5NA 2VLJE 3CZJA 2J8UA 5I16B 3STBA 2V17H 5LQBL 5KAQF 1E4XL 1G7HB 4PJXA 4PBVC 1NCDH 4LQ1A 2GITB 4N0CC 2R2CA 3PL6B 1DDHA 1I3UA 5DI8B 1AJ7L 5FIEA 4WWKC 4TVPL 2H45A 5IOPB 1NQBA 4LKCA 3TA3C 2C5DC 4KI5F 4UOW0 1T3FB 1BPVA 2BRRH 5DFVC 1MJUH 4Q6IC 4KUZH 3PQYD 1KIPB 4JFEA 4NQCB 5DD0L 3RWCB 1NGYA 1RJYB 2FSEB 4L3ED 1FGNH 4PJCA 5IEHA 1J8KA 4RMUA 5MERA 2Y06H 2Q8BL 4EXPX 1VFUA 2APVA 1NJ9A 1YYMH 1RJZB 4X5XA 5IBUB 2CKBA 3MREA 5HDOA 5IG7A 2GK0B 1QBMH 3MV8D 1MCSA 2BSTA 3DURA 1AO7D 4KUZL 1NBVL 5B22A 4DAGL 3B9DA 3PF2A 4WDIB 4LAJH 4XPTH 4LRIA 2P49B 1AGDB 4LSUH 4MX7B 5FUCC 4R0LC 3WLBA 3K7UA 2A6IA 4QRTA 4EUPH 1FFRA 3MYJB 1MH5B 3ALWA 2YPLB 1NEZB 4PJCE 4ZAKC 5DLMH 4HK0A 3TIEA 3VFOB 4JDZB 5D1QC 1V3JA 1I1RA 3GI9L 2DQDL 1YUHA 5I8KH 2OL3L 4ZFFB 5CGYC 4UT7L 3MRJB 3UZVB 1LO3H 2AAVA 4FTVA 1ACZA 4NUGH 4NYLB 3SBWC 3V7AG 3UTTB 2A1WH 3RZCA 3SDXB 1CBVH 3EYVA 4XAKE 4XRCB 3SE4C 1V7MH 3BPNB 4YDLB 1FL6A 1WCBA 3TNMB 1I8LC 1MRFH 3KJ6L 3QULA 1UXWA 1IGMH 4G5ZL 4LPCA 3MRMA 4OZFG 5FV2A 1G9ML 3MRFA 2FJGB 2ESVA 3SDCC 3IJYA 1UXSA 3MR9B 3OX8B 4PREB 1ONQB 4JDTH 4XCCH 4P3DB 1ADQH 1T89A 4IMKC 4ZUUA 3F7PC 3P77A 4BSVB 4WU5A 2XICA 4GAYB 2BVTA 3GIVA 4HX1A 1U8LB 1IGML 1J86A 3N1QC 5HGAB 5FYJE 5AYUL 3K46A 1NANI 5JUEL 1BIIA 4PUBH 1K9TA 1KJMB 3VXRE 3JV6B 1I4FB 3LD8C 4N0UE 4ALAL 4RBPK 1IC5H 1KCKA 2HJKA 3O2DL 2OTUB 2CK0L 4HPYL 4MZ3A 1CDHA 3M1BA 4M5YH 1GIGL 2I07B 3DIFB 4GQ9H 3CFBA 3PWVB 1UCTA 4KHTL 4K94C 4PFEA 5DZOA 4QXTA 4S1QL 4DZ8A 3K4ZA 5J12B 1AP2A 4BK4A 4PD4K 5IP4A 2AV7B 1IC7L 3GSQB 2DD8H 1D6EA 3O2DH 4QRSB 4NRYA 5GGQL 1S9VB 1TQBC 4MD4B 1G6RA 2A74A 3SKMA 4OV5B 2VWEE 4D9RD 1AGFB 3NA9L 5GGSA 5IV2A 1Q0XL 1TVBB 1YN7A 3LKOB 4KROB 2E6QA 2J5LC 3DHMA 4EI6A 3MYJA 4MD5A 4R7DA 4MJ4A 1QOKA 1U8QB 3LQAC 3KG5A 4Y2DC 1BF8A 3X11B 3QUMA 1KCLA 5ICZB 5D7SL 1A1OA 1QQDB 2B0SH 2XI9A 3FO9B 1TETL 2X4UB 3RNQA 2PR4L 1SMOA 4NQSA 2FX9H 4TULH 1AIFA 3QEQA 5B39A 3ARDC 4O2EA 5HXMA 3SDDA 4HGKC 2XTJC 4XVUD 1S3KL 5J8OA 1YMMA 1C12B 1T7YA 2DF3A 5CP3A 3R8BB 2JLLA 3WMSA 3ET9F 3W9DA 4WHTA 2X42A 1L7IH 1QTYT 4XTRD 2VLJB 3CSGA 2R9HC 3ZL4L 1G9MC 1QR1B 3V7AE 2DYPA 3L5IA 1C1EL 1OAZL 4EN3A 4LQFL 1YJDC 1NL0H 1TCRB 2J6EL 4Q6YA 4GW1B 1KIQB 3UO1H 2E8ZA 4J3TA 3E8UH 1DANT 4D0DB 5KS9E 4PRHE 3SDAC 3ZKMD 2BVYA 5F96H 1GGUA 1KFAL 4X6BA 1C1EH 5FO9A 3MBXH 2B2XH 2PO6B 4G8GD 4FA8A 3P9LB 1JMXA 5DFWH 4LGRB 5C09A 1OPGH 3D18B 4DGYH 2Z8WC 4PB9H 2EIZB 2D0HA 2XN9A 1EEQA 1R3KA 3ZHLA 3GI8L 3B6SB 1A21A 2XOTA 4WW1A 5T3XH 1HXMA 4LCUB 2YPLD 4P23B 3P9MB 4DZ8B 1T7WA 1C7SA 5SV3A 2B2XL 3H7BA 4XC3L 32C2B 5IMKA 3NTCH 1HHJA 3VWJC 4PYGA 4GG6B 1A47A 5DA0B 4WHCA 3MRNA 4GBXD 4HGWB 4MVBD 5JMOC 5FKAB 3JV6A 4WEBH 5FHAL 3IF1A 3SEPA 4MZ2A 4ZO6A 2G75B 3UC0H 4XVJL 2NNAA 1NUGA 2DDQL 2EH7H 2ENSA 4BKLB 2OX5A 4RZCB 4U0QB 4ERSL 3IS1X 2KDGA 4Z8FH 1Z0MA 2VO5A 5KSAA 1IVLA 1JN6B 3F5WB 3LS5H 3UXFA 3PDOB 3OKLA 1HHKB 4ZXBD 2EKSA 4H0IA 1CGUA 1GRWA 1T03L 5HDBE 4KQ4H 1GZPA 4P57A 2A6DB 1F11A 2ZG1A 1X5HA 4K8RC 4K7FB 5T5NG 2QQLH 3EDDA 4NN6B 4QRSA 5L2KE 3QZWG 3DRTB 2ARJQ 2P5EB 4GBXB 4PLOB 1T0PB 1ADQA 5EFIB 1QACA 3HKFA 4GXVL 4O2FA 3MRDB 4Y0GA 2D0GA 2IADB 4ODXA 3VXNB 4G8GA 1BOGA 2KQNA 3TT1L 5ID1A 4M6NH 2XNAA 4JFOA 4EXKA 3RWGA 2R1YB 1H0DB 5EUKB 4ZOCA 1CIUA 2OMBA 3D3VD 2BNRD 3TPKA 3VFOA 1B4JH 4G8IA 1FC2D 1AKJB 3EKCA 3DETD 4K71B 2P8PB 1UA6H 1BOGB 2MQ0A 2VAJA 3QDME 3DXAA 5D96B 3DSFH 5DZLA 4D8PA 3GHBL 5IB4A 4I2XB 3O41B 3EUUA 4K7PX 4OCNC 3G6AB 4OLZH 4O2FB 4FRWA 4YX2L 5JQHC 5EIIA 3GI9H 4NHCH 1UB5B 3ZSTA 4N0UB 4GKSB 4FOMA 1RK1A 1WTLA 2OSLB 1A6VH 5BVPL 5TDOB 1AH1A 4RGNC 3L5XL 4JFQB 2BP3A 4MB5A 3T1FB 2HT2D 2VERN 2D4DA 1XF2A 1T04B 3OKLB 3K1KC 3N9GH 4OUOA 1V5JA 4I77L 3HUJE 1YPZF 3RL2B 4AIZB 4ONGH 4P2RD 5KG9B 3ARUA 1XIWB 1JGVL 3BP6B 1HEZA 1JI2A 5F89B 3BPOC 5HGBA 2ED7A 2ADFL 1X5ZA 3WN5B 5DQ9A 3UROR 1QPXA 2APXA 3N06B 3KLAB 35C8L 2J8UB 2CKNA 5D1ZA 1NGZA 3ZDYE 4HGWA 4DZBA 2PN5A 1NEZA 5A2IH 4P2CG 5MEPB 3HR5A 6CGTA 2HT3C 3IDYC 4NT6B 5E99H 2HLFD 4ZNEE 3VRJA 4MDJA 1P4IH 3GRWH 5D8JL 5F6IC 4RFEB 1FRGL 4FQLH 5C71A 2HA1A 4OI9A 3PP3K 5GGVH 1F3JA 3DURB 3FFDA 1LO5B 4P3WA 4ODSL 5JQ6L 4X5XB 1OB1B 3O2WL 5AD0A 2PYFA 1TJIL 2G5BB 3S5LB 4RMQA 1MY5A 4PJCB 4YBQD 3HE7D 1NGYB 2WV3A 5D7JC 3CH8A 1D5ZA 3KS0H 2BVEA 2A6KA 4FXKA 3EOAA 4QHNA 2CDFB 1I9RH 4JKLA 2DLTA 1OF2A 3ARSA 1R3JA 3TZVD 1IEHA 2HLAB 4HXAL 3G5YB 1UM4H 5T1KA 4L3AA 4XXDA 5EBLB 3BD4A 3MLYL 4NO2A 1CR9L 3PL6A 4ORZC 2ZCLL 4GKNA 4WFFD 3BAEH 3EDFA 5FGCB 4NNXB 4W81A 1JHLL 4OLUL 3MPCA 1I9RL 2MHAB 4HFWA 3FZUD 1KLGB 1AXSA 5AYUH 1WT5A 1EFXB 4BELD 4DOHB 3BRGC 2UVFA 5EBMA 1A6WL 4M1DH 4HZLB 1TZHA 4OFYA 1YNLH 1C12A 4HK3N 2Q20A 4POUB 4PLJD 4JG0L 3SGJA 1G1YA 1YEHH 1RSFA 2IQ9H 5E00B 4G6JH 4Y5YA 1YEFL 3NPZB 4TNWF 4IBLT 1F4WL 1WQVT 4KJQC 2VMFA 1YNLL 3RKDC 1P4LB 1U3HB 4NZDA 3VXTA 4M8QB 3QEGH 4L29B 1AQKL 1CFBA 4WFEE 3FB5A 4LQFH 4HUKB 4ISVB 4Z7UE 4N8CH 2VLKE 2RHEA 4Y4KB 1ZLWH 3W39B 4LPUA 4HUNB 4FQQA 1NUFA 3NZ8A 3KLHD 5I73B 3C5SA 1OAUH 2CDEB 4UDUA 4HIJA 3VFTA 3PIQB 4CUCA 4U05A 4N8CL 3MROA 3LMJL 4JKWA 4JPKL 5GRXG 4N8VG 2X1QA 4PB9L 4OGAD 2HWZH 1KGCD 2Q8AL 3TBSB 1ES0B 2ZNWA 2DMBA 5E8NB 1N0XL 1C16A 5EZJA 4C57C 1EXUB 2A6JB 4JFDE 5T3XL 3NABL 1Z5LA 5E8PA 5MEND 4LSVL 1CLYL 1JNLH 4EUPG 1T7ZA 4HBQA 2C7UB 1HN1A 1AR1C 4N1CA 4JAMB 1HH6B 5GGUB 3MNZA 4OCSH 1MFNA 4GAYA 4P2YA 3FQWB 3P77B 4HWNA 4BSVA 3AY4C 1Q72H 4G6ML 1NMCB 1CICB 5L88L 4M1CC 1DLHB 3GMLA 4UU9A 4ONFH 3TH4T 3CNKA 3LV3A 3O45B 4PG9A 4Z7WE 5FEBA 3C5ZA 1JGUH 1EBAA 3BJLA 1XR9B 4H88H 4NKOA 2FGZA 1BFSA 4BH7B 4QRUA 2L4OA 3QIBC 4DN3H 2NY4D 1JNHB 5CJ5A 1MWAB 1A14L 1VGKB 4EOWL 2GUOA 3RL2A 3LS5L 4Y4HD 2X70A 5I0DA 4C58B 4JFOB 3ZTNL 5ID1B 3DWTA 3MSPA 4JFFD 4LCCC 4M5ZL 5IVZA 1JV5A 3CDGB 3ROLB 3HE7B 2P5EE 4XNXL 4NUJA 1J5OL 2VZSA 1T1WB 3DJ9A 3MGOA 4NYLA 4Q97A 3HI1A 3AREC 3ULVH 3TN0D 3LN9A 4OM0L 4Y8AA 1UVQB 4LASL 2ESVE 5C0GA 4KKNA 3OMZA 5IHZB 4JFPB 5KVFL 5EN2B 4H1LA 3X3FL 1X6NA 2VR5A 1HI6B 5IEKB 4HG4K 1K2DB 5BQ7B 1TVHA 1A4JA 2J12B 5C0BA 2P8PA 4PJCF 4IRZH 4N5ED 3VGFA 3WDHA 1XH3A 4EEEA 3VXOA 2AJVH 3U0TA 4RGOL 5DSCB 4X7CC 2UYLA 1I7UA 4DGVL 1G7MA 5T3ZE 1FNSL 1FBIL 1QSFB 2BFVH 5IESH 3KYNA 3GO1L 4FQXB 4JO4H 1MEXL 5AZEH 4U1JA 2BNRA 3WIHH 4J3WA 4JFYB 1OAKH 2Q8BH 1YPZA 4PRDA 5BW7A 1Q8MA 3X3GH 2FHCA 1RUQH 3MRBA 1YYML 5HHMD 2IPTH 3G9VA 5F6HJ 3QB7C 1F6LL 5FUZH 2PW2A 3CPLB 4BZ2H 4B41A 4XVSH 5ESVA 3HR6A 1AGEB 2AXFA 2AV1A 3M8OL 2RB8A 1X7QB 3WIHL 3RDTA 1DFBL 3DBXA 2P8LB 3CSYB 3L3GA 5HHVL 4X6CB 3FQRB 1WFTA 1RV6X 2AI0H 1YNKH 3ARED 3N9GL 4WO4C 5I8KL 3WO3B 5EO1A 1A7NH 2NX5E 1G9NC 1MLBB 3RWFA 2B1HH 4JFFA 4ZUWA 3TBVB 1DQJB 1OOAA 5I1EH 4LCYA 3B43A 1EX0A 1W0WA 1X5AA 2XXMB 1U8KB 5GRUL 3NACL 3VI4E 3UBXB 3FB8B 3GSRB 3QO1B 1AY1L 3LEXB 1SJEA 1I7ZB 3HMWL 3GSXB 1UEYA 5EOCH 3T3PF 4JKMA 4I3RH 4MB4A 3RGVB 2X4OB 3LDBB 1QLEL 2W91A 1G7IA 1KJVA 3EOBB 4M7LH 5KVEL 4DCQA 1KXTB 2I9LB 3HNTL 3IKCA 1VSCA 1L0QA 4XB7A 4XMPH 1NGQL 3TLRA 1P5VA 2H3NB 3D85A 3HRZA 4L5FL 5B4MD 2VLJA 1JRHH 3L3IB 5C6TL 1U93A 4I3RL 1W8OA 2DIJA 2NLJA 1FORL 5JIIA 4BZ1H 1FG2B 4V2BA 4NQDA 5IVNA 5I1DA 4WHTB 4RGMC 2QSCL 4NNYB 4OKVA 3ZKNC 1T20A 4N9GB 3QWRD 2F54E 5GS0L 2EKJA 4CGTA 3S9DB 4F7PA 3QO1A 4QTIH 1BAFL 3DO3A 4JFHE 5IBTL 1F4HA 2CLVA 4I18B 3VFSA 1RZ8B 3QI9A 1U36A 4JFZH 3B9KB 1RJLA 1P7HL 2X4PA 2ZUYA 4X8JA 3NCJL 1QP1A 3IB4A 2IBZY 2XRAL 4LF3A 4LNRB 5DJ2A 1B90A 3C8DA 5DMKA 3T2NH 2E8YA 3NGBC 1IQWH 3V6OA 2ARWA 1UWGL 1DL7L 4OIAA 1DUZB 2X9YA 5DJ8A 1JTPA 3AREA 1J7VR 1FVEB 4FFVD 1I9IL 4TUOB 5IIEB 1KYOK 2D2OA 1GC1C 4XMKL 1TZGL 3F6LA 3TO4C 1JGLH 1P4BL 2Q76B 3RI5F 3E2HB 1FSKC 1OQOA 3K4AA 4JGMA 3VJ6B 4E0RA 5FYKL 3OPZL 3MRGA 4LGPB 2EYTA 2BMKA 3CFEA 1H8NA 5HD8C 4P4RA 5TDNA 1JL8A 3F6IA 3T2QA 1A1MB 3MJ9H 1U8MA 2W65A 2DTMH 4XWOD 3F62A 2FECL 3ULVF 3U2SB 4LIQH 1P53A 1FLRL 2HFFB 3VFMA 3QXVA 1OAXH 3SJVE 3OAZH 2YD2A 5HI5C 5E8EA 1UB6B 5EC1B 3BZ4B 3OZ9H 4RISH 3WUWB 5KZCB 5I18H 1EHNA 1NFDE 2YPKB 3TYFA 4Q9RH 1BJ1H 4PB0L 1XEDA 2V5YA 2X4TA 4DGIH 4M4RA 3S7GA 2UZIL 3GSOA 3QNZB 5T1KD 3SY0A 1RVFL 2R29L 1X5LA 5FYJH 1TENA 1N4XL 5JPMA 4R0LB 1JV5B 2ZPKL 4UAOC 3AAZA 4JY5L 2XZAH 1G7JA 1RIVL 3WFHB 1BD2B 4R6UA 4UV4H 1IKFH 2UUDK 5DMYA 1TTGA 4LBEB 4ZFOA 3E3QE 1ZE3C 1G6VK 2RQ8A 4UINL 3UTTA 4U1HA 5BZDA 1FNLA 3QBTB 3VXME 1RU9L 1LDPL 2YMXL 2B1AL 2GT9B 2VABA 2Z92B 3K8MA 3LKPB 2DAVA 1N26A 1RD6A 4UNUA 4IRSB 5F70A 3TZVC 5LXGL 4ZOEA 2FJFA 1TJHH 3IU3A 3QDMB 4KKLD 3G6JB 3EO1A 5FF6B 2PF6A 4ONFL 3TIDA 1YMHA 4UNTA 4Z7UB 1S7XB 3WFHA 1J1OH 3S4SA 3BE1H 4WRLA 2OK0L 2E6JA 2K3TA 4ZOBA 1EXUA 3JTSA 4A2LA 2F53B 1R3HB 5MENA 2LVEA 2WBJD 4WUUB 3D39A 5DC9B 5ETUA 1I3GH 1MJ7L 5EIVA 2Z91A 3MLTA 4WI2A 3O6ML 5T33L 4Z0XA 3IAQA 2X4NB 2W60B 1XCQB 2LU4A 1FC1A 1F6AB 2AJXL 2I60L 2HKHL 1CL7L 5MP6H 5EU3A 4WI6A 4DOHE 3Q5YA 1EZVY 4O2CA 4FQHA 2MKLC 2D7OA 5DI8A 1OW0A 5ESQA 3RVVC 4IOIA 3TNNB 3X3FH 4JHAH 3WV0A 2XQBH 2IALB 4X6EA 3GNMH 1MLCA 3QISA 1LO2L 4ZO7A 4M8QA 4ODTL 5J9PB 4JDTL 3S36L 3BDXA 5C0IA 4MJ5B 4P4RB 4R4ND 5TDNB 1CL7H 3G5ZB 5MP6L 3CCHA 4YXLH 1YECH 1IKNC 2NLJB 4WY7H 4Y5YB 3MRHA 3L3IA 5I1LB 4M1GL 1A3RL 1MAKA 1CE1L 4OCLC 1JPGA 2ATKA 4NBYB 4PP2A 2XKUA 1E6OL 2RAMA 5C0CE 4JO2H 3D3VB 2VXQL 4O51A 1DVFC 4KZDL 3ZTNH 3TT1H 2H8PA 3L7FB 3DYPA 2VSCA 4PJ8A 3TZVB 4ZYKB 3LAFA 4C83B 4TNWK 4ZPVA 1HH9B 1AGBA 3WCYA 3QUYB 4MS8D 3GSXA 3NCMA 1KYOJ 3T0EE 4LKXA 4FQ2H 2DQCH 3ARZA 4LNRA 1INEH 2LAAA 2R1XA 3DSFL 2A1WL 2VXVL 1MJUL 1HSAB 3O11B 5EBLA 1XF5B 3BKYL 2I25N 3TN0A 5A1AA 2PYEA 5EO1B 3V4PL 4CDHA 3LN4B 2VXUL 3HMXA 1KEGH 3GBML 1Y6KR 1JYWA 1VDGA 1DVFD 1KJ3L 1Z9SA 3FCTB 4N0RA 1ZGLA 5F6HI 4JGJA 2DQCL 1ZHBB 3PWLA 5DWUH 4AK1A 2P8LA 3CSYA 4G5ZH 5C3TA 3PE9A 2Z31D 3V79C 1T1ZA 3PQYE 4PY8I 4OLYL 3PWUA 3DYMA 5E2UH 4PP1D 1IGTA 3ZE2E 4XCCL 2VXUH 4EI5C 3U6RB 5ANME 3HRZB 3MJ8B 1CE6A 2WQRA 2XPGB 1LO5A 1T1XB 3ELAT 1DE4A 4P5TB 2XKSA 4G6AD 1K8DA 4RFEA 1WIOA 2DI7A 1PVHA 4XP6L 3STZA 2OL3H 1KTLA 3FT3A 1QFWL 4OIBA 4C4KT 1L7IL 5E8OA 2ZOLA 4RAVA 3O8XC 1HDMB 2VLJD 4BZ1L 3D85D 4TVPD 3TBVA 3VCLB 4JPIA 5DJYA 3O2VH 1IGJA 3M17B 4HJGB 1RK0B 2H26B 3UJJH 4KZEL 4Q7DA 1YNKL 3DUSA 1F3DJ 4JM2C 4S1QH 5TE6L 1FRGH 2FDBP 4PRPD 3TT3L 4PGEB 2DI8A 4DKEL 4JY6A 3L3OB 4Y19B 5GGQH 4ZUSB 3NACH 4MCZA 3O2VL 5F9OH 2JJVA 3DV4A 4XAWH 1S7SA 1VFMA 1Q0XH 1IM9B 2H1PH 4XNUH 1HCVA 1R5IB 4K3GA 3T1FA 5INDA 4Z18A 1AO7E 1CDUA 4PGDA 4R26H 2PYED 3T65B 4EZMA 1BFOB 2MWCA 5D5ME 2G60L 1I85C 1HCFX 1S7WA 1P4BH 1ODAA 4NNPL 2XN9D 4I48B 1K8IB 4O02L 4WFHD 4X83A 5JORA 5FM5M 4U1NA 1IQDA 3I6KA 3MC0A 3P11H 5AAWA 2XWBB 5IB1B 3C2SA 3IFLL 4Q2ZB 15C8L 3QO0A 4CMMA 1BBDH 4POZD 2VIRB 4J2XA 4TTDC 5E5MA 4DJMA 5E9DA 3CX5K 2XTJD 1MFCL 1REIA 4MNGE 2V5RA 3MLVH 4OUUB 4NIKB 5T3XE 1RZJH 2QR0A 5E03A 3PP3H 1LO0H 2X4SA 2G5RA 4NQEE 2FX7H 1WAAE 1A4KA 3GJEB 2BNQD 3ROLA 2FLRT 3BH9A 1XFPA 4ZTPL 2KZ1B 1LO4L 5E70A 5GGTA 4CNIA 3D87B 4U6YA 1EO8H 1FQ9C 3IDIB 1IT9H 4PGBA 4JY6B 1LO0L 5EH1A 4WV1B 2EDHA 2PW1B 1JE6A 3QEQD 3C6SB 3QYCA 4Z0BH 5DD1H 4M8VA 5D7KD 2AGJH 4BFGA 3FOMA 3QFDA 3C6LB 2VTFA 2ZOKA 4J4PC 4S0TD 2VZTA 1FJ1A 3WIFB 2UV3A 3QQ9D 2BVPB 4PJDA 5E2WL 2EDYA 1RHHB 1EAJA 4E41E 3MCLL 3SQBA 4MQXD 5ADOH 3IDMB 1FSKB 4MB3A 4UBDC 4Y2OA 2VLMD 4L3CA 1KTLB 3FT3B 3W0WE 1KPRB 3PWNA 1HH9A 4EDXB 2VLLA 2R2HA 5AEAA 5MHSD 4L8DA 3TZVA 3MJ8A 2Y07L 3NFPB 3QHFL 4LEXL 3ZTJG 4U6HA 2H8PB 5I18L 2SEBB 1QR4A 2Q6WB 2XY1A 1OM3H 3OGCA 1T5WB 2DJSA 2QSTA 3ZT6A 1MY7A 1CDIA 1RZKH 2GY7B 1R24A 3GHBH 4JZNB 4C55A 1RZGB 4MXWL 1VA9A 4OD2B 3UO1L 5J4MA 1UEMA 3BFOA 4MJIA 1RQ5A 4XB8A 4PJ9C 3DMMC 1NMBH 3ZKND 2FBOJ 5KZCD 4YR6B 3KPLB 3FO1A 5C0JB 5IM7A 1VEPA 3U48A 2O5ZH 3BP7A 3EDKA 4NQCE 3LB6C 4JB9L 2XQYK 5C09B 4LMQE 1FYTE 4IOIB 4LSTL 1OTTC 1F58H 3M45A 4DVBA 5J89A 4RGMB 5ID0B 4PV8A 1T80A 2DQEL 4G8EB 1JFQL 5I1IL 1KCRH 5TH2A 5D70L 5ERWB 4NQTA 4YQXL 4C83A 2E7MA 1MHPL 4HS3B 4P9MH 2V9QA 5CKAA 2ICWJ 2WK2A 4FHBD 1I1YB 3S96A 5LXGH 3QQNA 3PABB 2O93L 1MRCH 1F4YL 3DROA 1PKQE 2QSVA 2QADC 4P2RE 3PWJA 4WCYH 5I6XC 3ORJA 3QI9C 4O51B 1KTKE 5GRVK 3ZMRA 4L8SC 5JHDB 4WO4D 5C92A 4HS6B 3OAUH 3GSNH 3DXAD 1J0YA 1MQKH 4KKAD 5EBMB 4Z8FL 1D7FA 3MNVA 1S7RA 2M1KA 4W6YB 1NMCC 1WZ1L 1YMMB 3LEVL 3KPSB 2VUYA 2PTTA 5I1CH 4MQXC 4KZDH 5FYKD 5DJAB 2CSPA 3BKMH 1FCCA 2E9WA 2SEBA 2NY6D 5ESQB 2FJFB 1BBJA 7FABL 1CXFA 1QO3B 3RJQB 3FO9A 2ZUUA 1FLTX 4DGVH 3TNNA 3E6HB 3ARBD 3OJDA 1BQUA 1FYTD 3NGBB 3NCYP 4UV7H 1XCQA 3CFCL 2DQIL 1CXHA 3VH8B 1FE8L 5EU3B 3G04B 3EGSA 4CU8A 1NCBL 3MRCB 1T83C 4PJFA 2ORBL 1JPST 4GRWF 2AJSH 1U3JA 4WUUA 1J1XH 2DBJA 2UZXB 5FOBB 3GSQA 2J8UE 4M6NL 4TUJB 1QPPA 4TTGA 2AJ3B 1SQ2N 3VG9B 1XGQB 3HRPA 2HYMA 1DFBH 4PGBB 2VQ1B 4RDQG 1DBML 5CD5D 4I1NB 4Y4HA 5L8LB 5I73C 1UT9A 1KNOB 2YSSB 3SQOL 3BEWB 5D7LE 1WV7T 3HC0B 1UB5A 3RVWD 1AHWC 5KTEL 3QI9D 4GAJL 1R0AL 3HA0A 4NT6A 1E6OH 4YE4H 1FL3B 3TPUB 4U3XA 3LZFL 2IAND 3RPIA 4HC1H 1ZOXA 1T2QH 1IGIL 1QFHA 1QSEB 3QFJA 4ZUVB 4ETQA 4HC1A 1YEKL 1PFCA 4P5TC 3SDXE 1UFUA 1AQDB 1AY1H 1QVOB 4PJHA 4EBQH 4O4YH 4DAGH 3LKPA 4U49A 2P5WA 5A43C 5EPMB 1UGNA 5M7QA 1OTTD 4HMDA 4PJHE 2BVQA 1QFWI 3TYGH 4HAGA 2JJSA 3T4YB 1IGIH 2GSIB 1RMFH 1HINH 2XWJB 3HLAB 2IADA 1HILB 2DWEB 3GBMH 3MRDA 5J13C 2NY3B 2VL5A 5FGSA 2BNQB 1A64A 4PJGA 3OR7A 1KULA 1D5XB 3EO9L 3QIUA 5JR1H 1UXWB 2W59A 3BQUD 5JLZB 3G08A 3VI3E 1TNMA 4HWZB 2LU3A 1RUPL 5ACMA 4KV5E 2JIXA 2FWOA 4YPJA 4CRPA 5EU7C 3G9AB 3WEXA 4U6XB 2BCKB 3ULVE 2VXSL 4GLRH 2O61A 3ARXA 5HYSB 3CVHB 3IFPB 3BP5A 4HKXB 5IB3B 1DQTA 1GAFH 2XZCH 5E2TL 1N0XH 4QHKI 2XRAH 1HE7A 4QOKE 4HH8A 5FM5O 5JXAL 4U2YA 5D7JB 4FQLL 5L2KB 1A1MA 1CXLA 2CLVB 2NXZD 1DVFB 2VUOA 1VKXA 1VFAB 1EHXA 4F37K 1JNLL 1GGTA 1AC0A 1XZ0B 3WLBB 1VEMA 1GGIL 3IF1B 2FX8L 5F7KC 1AE6H 5DHVB 4HLZH 4IHOA 4RX4A 1Q9LB 1QRNB 2CMRH 1QG3A 1NBZB 3X12A 5AYQA 5IG7B 5F6IB 1J8HE 4R90L 2QSQA 2NY5L 1BJ8A 4OFYD 5TGBA 2H3NA 4PRHA 1CF8L 3OKNB 3ZT7A 1A0QH 2K1MA 4WW1B 4EN3D 4YWGL 1NGXB 1LEIA 1A14H 3A67H 2ADIA 3WFDH 1GZPB 1OP9A 4B7IA 2W0FB 2ZCLH 3PV6B 2VE6B 1UENA 4LIQL 3EYQC 4D9LL 2WLZA 3GMPB 3VWKD 3SPVB 5J1SC 4PV8B 1XF3B 2PO6A 3QXWA 2P7TB 4FZEL 4RGNE 3PDOA 3QUML 2ATPA 3NCYS 1IC7H 3F5WA 5CEYA 5C0NC 2C4XA 2MQCA 3OXRA 3L3HA 1MSPA 2IANE 2YD3A 5EIQA 5C9JB 5IGXL 5IKCA 3DX7A 3NCCB 2MMXA 4M1DL 3A67L 1HYSD 2AQ2A 5HTSA 4OKVB 5EOCJ 5I1DB 2LTQB 3DVGA 3BP4B 1K5NB 1GL4B 5J7CC 4YFLI 5TQ2L 3MA7B 4FZEH 5T1LA 3DBXB 3L3HB 3OXRB 5IKCB 5FKAA 3AU1B 4AYFA 3AS3A 5IGXH 3X14B 4ODVL 4HIXL 5CJQL 3QIBD 5DRNA 3N1MC 4JZNA 3S98A 3CU7A 2VE6A 4JQVC 3MZGB 4DKDC 4IOFD 5ACLA 1UJ3B 5CZVL 1S7TB 5J56B 4KRLB 5GZND 1G7IB 3QEGL 1AQKH 3MA7A 2FECI 4MQ7B 4F9LC 2KQMA 1Q0YL 1UKTA 2P8MB 5E1AA 3UBXA 4D0BB 3MLUH 5FCUH 1OQXA 3RVXD 1JPGB 1OTUC 3KHOA 1P7QD 1IFHL 1NBZA 4F8QA 4LSQL 4APQD 4AQ1B 2IWGA 4XP9H 5KW9H 4NKQB 2XKNB 4LVHC 4LVOB 3D2UD 1SVCP 1NFIB 1OD9A 5DQJB 1BFTA 4PRNB 2J6EH 4P2RA 43CAA 5DD1L 5LAXB 4KK5D 3KHQA 4FQHB 4K23L 4NN6C 4QHUA 5BXFB 4M03A 3RU8H 1KCRL 4BUHA 6FABH 2DYPB 5D6DC 3BH9B 4N8VB 2I5YH 3R0MA 2NY5C 3BDYH 4U1IA 4YFEA 2A38A 3VXSD 1N59B 2DL2A 5I30H 2QR0B 2VAAA 3TCLA 4G80A 4L4TE 4FQXA 4HUMB 4X4YB 2X70B 4YBLB 3VGGA 1R3HA 3DNKA 5AAMA 3DVFA 1JGUL 4I3SL 3FAWA 5L2KA 1N7MH 2HJLA 1EO5A 2EDBA 4WU7A 3S4SB 2M2DA 4F15B 2VL5B 1Q94A 4MAUH 4TVSa 3QO0B 1XIWC 5EUOB 3MOBL 4G6AC 4WWKA 3RZCD 1OGAA 4BH8B 3T3MF 1Z9LA 2LQRA 3QXDA 2IH3A 3H6JA 4JRYA 4MD5B 5IHZA 2JJTC 5FGBC 2P5WB 4L3EA 4EI5D 4BZ2L 1N7ML 1U91A 5A16A 1UADC 4DW2L 2GT9A 5IBLC 4KJQD 1UWXK 1Z5LB 3G08B 2Z31C 3I85A 4F9PA 3B9VA 1BD2E 4LASH 1ZA6A 1E27A 1HYRC 5KSVB 4HT1H 2ICCA 1WITA 3VD3A 4PJGB 4ZUTA 2YEZB 4LLDA 4OT1L 3TBSA 3W0WD 2RGSA 4WHDA 1T03H 4U6TA 1VEOA 3WDIA 3T2NL 1E4WH 2PO6C 2QL1A 4LRIC 3JWDH 3RHWF 1UM6L 4WCYL 1ACYH 1KC5H 4QRUB 2HJKB 4Y5XA 2AJVL 5J6HA 3BPCB 4G43B 1V7NL 3VFTB 1SEQL 1MWAA 4J8RA 3BGFB 3C5ZB 4Z7WA 5SX5K 3PGDB 4TQEL 2NPLX 2OZ4H 1AQDA 5JTWA 3GBLA 1NFDB 3IS0X 4JO4L 1AHWA 4JN2B 4IS6B 3TJHD 3FQTA 4GRLA 1RIUH 3P0GB 3VXMD 4HJJH 5BV7B 4PJGF 4CJ0A 2ZWLT 3UX9B 1MCDA 1A1NB 2A6IB 2JJUA 2Z93A 4MMZC 4QRTB 5F8RC 1S3KH 3RZCC 2KL6A 4G9DA 4CMHB 4NBXB 4WHYH 4R97C 4HXBL 4KJWD 3RAJL 4G6KH 3RDTC 1KN2H 1HKFA 2NY4B 5C0FA 4GBXC 4MVBC 4PRIB 3REWB 1MCLA 1NLDL 2ERJC 3QJFA 3BPOB 2AJ3A 4RMVA 5T3XD 5IMOA 1HHIB 4GMTH 5EZOH 1NBQA 3VGEA 3LIZH 4NKDA 4YIQA 3IDNB 1ES0A 4IDLA 2DM2A 5FECA 4OJFH 3RWDA 2C3VA 1U6AL 3ARVA 5FB8A 4V1DA 3RZWA 2AJYH 3GSVB 1NL0L 3H9SA 4LGSB 4U7MA 4YDIH 3Q0HA 3ARRA 3IDGB 1G0YR 1MCQA 1SJXA 4WO4B 2BK8A 5GS3A 5DD3H 1BWWA 1QD0A 2JCCF 2JTDA 2A2QT 1KFAH 2C3HA 2VN7A 4GKNB 3T4AB 1VPOL 5T5FL 1IQWL 3NZ8B 4P59H 5KTEH 1B6UA 4GMSH 1RAMA 3S37L 1Q9OA 3GJFK 2O26U 4J12A 3U30C 5HYSG 1R3JB 5E4IA 4LKXB 1MFEH 5TH2B 1ZSDA 5DJDA 3AM8C 5I8OL 5ENWB 5HYIA 1ZT7B 4G8EA 3O0RH 3HAEA 1KPUA 3WS3B 2A73B 4TOYL 4KVNH 2NTFB 5DJCB 4HWEL 35C8H 2LAGB 2WBWB 5HY9B 4U1MB 5I8CA 4QOKD 4R26L 1ZA3A 2G5BA 1WAAF 5C08D 4UT9L 1ZHNA 3FO1B 5C0JA 2WUCH 5AZ2H 4ORGA 1N5AB 2YUVA 3VGBA 2HTKD 4XVUC 4Q6IA 2F15A 2R4SH 3EO9H 4ZFZA 1CFVH 1B0RA 4LLUA 4L4VA 1JNJA 4JZJC 2VDML 3WHXA 1F2XK 1ZSDB 1LMKA 5DJDB 2D3VA 2E7LA 3OGCB 3DO7B 2ED8A 3QWOB 5ID0A 1BBDL 3JVGA 4Q9RL 1ZEAH 4DZBB 4LP5A 2ZCKH 1DQDH 2Q3AA 3G5YA 3K81A 4XWOC 4L8SA 2F74B 5CINH 1XAUA 3SDCB 4NKIH 3L3KB 1ZLWK 4YEFA 2NX5B 4Y16D 2XZCL 1S9KC 1VB9A 5MEQB 1DSFH 5CWSA 3A6BH 4QXGL 1BMGA 5DJ6B 9CGTA 1I1AA 3EDJA 3FRUB 4XNMB 3VE0B 4QRRB 4LHJB 1D6VL 3MGAA 4UV4L 2J1KA 3O9WA 2A9MH 1D5IH 1KPVB 1PKQA 2VLRD 5JHLH 1HHIA 2F8XC 4OQ1A 5CD3A 1FNEA 2WBJC 1T7VA 1AE6L 2DLIA 1YEIL 3L3GB 3T3ME 4PJ5D 4AENA 1NGXA 1LEIB 5AUMB 1KPRA 3TIDB 3HG1B 3LKNB 3CC5A 4R90H 5EORL 3WNOA 4NQXA 1GHFH 3MUGB 3PHOB 3LY6A 1CGTA 1M7IA 3MV7B 5GJSH 2WWKO 5F1NB 4K8RH 4YDJA 5DUML 4L4TA 5D1ZB 3VGAB 1FNGB 1HOCB 5CJBA 1YPZB 1KB9K 4PRDB 3VMPA 2HFEA 2X4SB 3CH1B 3JBG7 4KFZC 4QWWD 5L8KB 2X4QA 4ZXBC 1U0QA 4OD3H 5DHVA 2Y36H 3QPXH 5F89A 3KYNB 5HHXH 2OK0H 1E28B 2OTWB 3RVTC 5SX5H 1MWAL 1T5XB 1F4WH 3G5XB 1NGPH 3D0LB 1O7VA 4FG6D 2ZUXA 5F7WC 4BFIA 1PQZA 5CLWA 3OJ2C 4XP9L 3VXOB 4XNQB 5D7JA 2XNAB 3GMNA 1R3LA 3OKMB 1SY6L 1P69B 4QGTA 3BZEA 4ZQKB 4YBHA 3HE6B 3AAZB 5LCVL 3AGVA 1ZLSH 2BOBA 3AVEA 2DS4A 4Z77B 1JZ3A 3BKYH 3VFPA 4OIIH 4XGZA 4MA1B 3S6CA 5HHME 2EEDA 3TA3B 1RY7B 4E42A 4UINH 2A83B 4H1LG 5BRZA 4LCWD 4OUUA 2FWOB 2NMSA 3P4NB 3QQ4B 1T1WA 4GAGH 2WINB 2X1PA 4Y89A 4NUJB 4AJ0A 2BSSA 1MHHA 4PLNC 5B3JE 2QHRL 1UH4A 2IG2L 4C56A 4LLMB 1R3LB 3OKMA 2P5WE 4NDMB 2X1OA 5DTFB 1OGAB 1F45A 1MRFL 3QIUC 4ZQKA 1A5FH 5B39G 3BZEB 3GJFA 4NRXB 3BKJL 4P4KB 4M00A 1NGWB 3OJMB 5CD5C 1ZHKB 4M1GH 3LPGA 4I48A 2IH1A 3GMQA 4BKLA 4X9FA 3CVIL 2EDEA 5HVWA 2AK1L 4YHYC 1DBAH 1UZ8B 4Y4KD 2IG2H 5DJYB 4GRLD 5CP7A 4OV6F 5J6GA 4HKJB 2DJUA 5K9OB 1I3GL 3BYYA 1MCNA 2LVCA 2HFEB 2VITA 4OQTL 4XPGH 2G2RB 5E8OB 4L4TB 5EBGA 4JFDB 5FUOL 4KROC 1JMZA 2C7UA 3LKQB 4JFFE 2XYCA 4Z78A 2N4IA 3L3OA 3LEVH 3S36X 2VZ1A 3LKNA 2Y1VA 4NUGL 1S5IH 3V4PH 1EHLL 5E8NA 1DQLH 1NANH 4FNLL 1KXVC 2XQBL 4WEMB 5DUBB 43CAB 3HE6A 4G3YH 1CICD 3ZKSD 3EAKA 4KTYA 1W72B 2IBGA 5F8QC 5DWUL 4RAUA 3SHSA 1I8LA 3KJ6H 3OKDB 3U7AA 2YHGA 4XNYH 5FO7A 4EI5A 3D0LA 4X5LA 2B20A 4GG8A 4KTDL 3RWIB 4PJAE 4Y4FC 3WBDA 2VXQH 2NR6C 4Y4KA 1S7UA 4GRLC 4WWKD 1T22A 2OM5A 4ZSOB 1UH2A 2O5XH 1DBBL 3T0WA 5BO1H 4OSUL 5B38G 4ZFZB 3OKOB 3QWOA 1MUJB 2NZ9C 5HGHA 1IM9D 2Q7NA 1FIGH 3MUGA 4Q6IB 4NQXB 1NBVH 2IQ9L 4G6JL 2NY0B 2CKBL 3BRDA 4I4WB 1RUAL 2I9LA 4JZOB 2ZUWA 1I3RA 3N85H 2E9JA 4HJ0D 3W9DB 3PWLB 3EYOB 4HC1L 4PJBE 1O7SA 4JRWA 1W72H 3TFKC 3X3GL 5BS0D 3SJVD 2O5XL 3MJ6A 2X4RB 4GSDL 3U1SH 4X6DF 1IM3B 4UTBH 3ARGD 5FUZL 3PWJB 5BOPA 1KJ3H 4Y1AB 1KSRA 2RR3A 2WLYA 1MLBA 2W9DL 5FGCE 3U9PH 3G5ZA 2W07A 1OAUL 1MI5D 1AR1D 3CLEL 4RFNB 1QBAA 2OZ4L 1BZ9B 3RY6C 4RRPA 1VPOH 4AEFA 4K3HA 3UZEA 4RNRB 2PKDA 5D9SB 5C0ND 5EU6B 4DVBB 3OSKA 4R9HA 5D7JD 1FVDB 2DI9A 3OJVC 1DUYB 5JR1L 2W9DH 5ESVB 4OBRA 2IPKB 3PP4H 2AXGA 5I1EL 1D5BA 2EICA 1AP2B 2YZ8A 4V1DB 4KGLA 2AVGA 1NC4A 5F7NC 5C07A 5JW5A 5DT1H 3IDGA 1C5BH 1QRND 5LBSL 1BZ7A 1OPGL 1ZHNB 3S35X 1BJMA 3DECA 2X89D 4ONHB 1GAFL 3OAZK 3EOTH 1CU4L 4NKDB 2EXYD 2ZJSL 3H8NA 1IEAB 5DK2A 4AG4H 4XI5D 1K4CA 4NQSB 1UM5L 5F7DB 4L8DB 1JRHL 2A9NL 2VDLH 2VLLB 4NC1E 1FV1A 1QLFA 5GGRB 5IFHH 1GXEA 3S35L 4I9WD 3HMXH 2XT1B 3EO1B 3G6JA 4H1LB 2E7LC 5FYJU 4HGMA 1VADB 2ZSWB 1UWEL 1A1NA 2A74B 3KPRE 3SCMD 4YHYB 2FHBA 5IT2L 3KLAA 4U6XA 3VFNA 1TVBA 1YN7B 3HPLA 1B4RA 4OKDA 4XMLL 2AV7A 3MLXL 2YOCA 2DM3A 3BZFA 1NAMH 4QXTB 3QIUB 3WUWG 5EOQL 3UAJD 5ISZB 3HC3L 2C1OA 5EB9A 5I0ZA 5TPWH 5T1MA 1N8ZA 1S7VB 5EOTA 1D6VH 3TWCH 4AMKH 2F58H 1JNHA 4ODHH 2M8XA 2VQUA 3T4YA 2WANA 4R0LA 1JGDB 2DQGH 2DM7A 5L0QC 4O00A 1QKZL 3EBAA 4JY4B 1EEUA 1KB5L 5JDJA 1NBYB 3OBAA 4ZTOL 4QXWA 2GJ6B 4XCFL 5JA9A 1KCSH 3QPQD 4D3CL 3BGAA 3ZE1F 2YC1B 4PG2A 3JSSA 3LRHA 2OLDA 4JRYB 3WUWA 2XZZA 3RX8A 4EJ1C 4MXWH 4IDJL 4MGXA 3SE4A 2YD4A 2FJGA 5HHXL 4WU7B 2MKWA 3QIWA 5BRZE 1GYAA 1IEAA 3FKUS 1G9NH 4WWID 1R5WB 4RQQA 3SY0B 2NY2B 3RX7A 2D03L 3KPRB 3VI4F 3MROB 3O4LD 1PG7L 5DF0A 3VD7A 2VR4A 4C56E 1DTUA 1ZLSL 5FCUL 3KYKL 2F19L 4JFEB 5I76B 3DXAE 1WBYB 1G0DA 4OZHE 3WIIL 1EGJL 1A7OL 2YK1H 3LRGA 2OP4H 2VDPH 5A2KH 1YEIH 5I1GL 3BZFB 3HHRB 4ENEC 4YGAB 3WO4B 2CIKB 1LE9A 4LNVA 2XIDA 5EORH 3MRJA 2IMMA 5CSZB 4CDGC 2MQ3A 3KYKH 3QHZL 2BNRE 5F9JB 4JRXD 2XV6B 3PHSA 2C3WA 3U82B 1HHKA 5K93A 1F42A 5CSBA 4FXGB 5KVEH 5EUOA 3LZFH 4JO1H 4X8JB 4K55A 3GZKA 4DQOH 4JDVA 5EUOE 3QWQB 2D7NA 3MYZA 2NY6C 1MQ8A 1IM3A 4TSAL 5MERB 4KGJA 1OTSD 5IIEA 3VXUD 4HWBH 2QSCH 1RJYA 1CD0A 1EFXA 2FSEA 3AM8A 3LH2L 4NQCA 4OF5A 4JE4B 1J1OL 2BOCA 4XP1H 5F3HA 2MHAA 4HFWB 1RHFA 1VGEL 4W6XB 2OR9H 5T1DH 3U4AA 5D8JH 4MDIB 3VXPB 4Y2DA 1WFNA 3P40A 4QRQA 4LKCB 1JZ5A 3F65A 4PJAA 1LK3H 5DRNB 5MHSE 5DURD 3HCVA 3VG0L 1U8JB 4PJXE 2E6PA 5EU6A 1MPAL 1U8NB 4HFUL 3P30L 5IB5B 4O9HH 5D9SA 1UWXH 3RWIA 5ITBL 5CEZL 4PRID 5B3JF 3LEXA 4GLRI 1UWGH 3CAFA 1MF2L 1JWSA 1R3IL 1TJGL 2I60H 1LP9B 3QXTA 2FYYB 1DBMH 3F58L 3HCVB 1BFVL 1DQJA 4JZJA 3DX7B 3ZHKA 1UKSA 1KGCE 5ALCH 3RTQA 1NAKL 3K2UH 3UMTA 3L5JA 3CVIH 3QDGD 5FYKH 3C9NA 3RUGB 3ARFA 4K8RD 1U58A 3EYOA 1TJGH 3JWOL 5D93C 4JPVH 3BAEL 4ZYKA 4PJ8B 3RGVA 4J6RL 3RIFF 4JFDA 4JPWL 3IDMA 1VERA 1CTOA 4HIHB 1H3XA 1T0NB 2VLKD 4LLYB 1CK0L 1M05A 4MJ6B 5TFSL 3W0WB 3ZYOA 3P4LA 4G8GE 1HWHB 4PG2C 1LEGA 1FN4B 4HJJL 3H3PH 4OLZL 1PZ5B 1QRNA 4ODSH 3MQIA 4NJ9L 1MI5E 4QXUL 2DMKA 2BNUB 1AIFB 1J1XL 2X4UA 3RNQB 1OP5H 1NH6A 5DS8B 3HZKA 3VFUB 3EJJX 4QHLA 3RDTB 5TFSH 3V9FA 4R97B 1YC8A 5DGRA 5GGSY 1A7BA 4XC1H 4XH2A 1WGOA 3DX6B 3NFNA 4OD1H 1OL0A 3C2AH 3P0YL 2W0FA 3BP5B 4HKXA 1U6AH 2V6HA 4KRPC 4K94L 2XZAL 1WBYA 1ZMYA 3DLQR 3K2MC 5J11C 5IHUL 4PJHF 3LHPL 1EAPB 4DK3A 5IMLB 1T2QL 1X5KA 3DRQB 1WIUA 4MD4A 3PP4L 4NO3B 1JGVH 2R23A 2PYEE 5DD3L 3VA6A 5E6IB 5EIIB 3ILQD 3GDBA 4N90E 3OR7B 5E5MB 1QNZL 3CDGA 3IDJA 3WKNA 3RTQD 2DN7A 3OHXA 5IFJB 5IB4B 1D5XA 5E2VH 1LQSR 3QIWB 4YHNB 1XR8A 3ZHDA 2V7NB 3DMMB 3H7LA 3CUPA 4X4ZA 1W72L 3FFCD 3LQAL 2OTUA 5LKNA 3HLAA 4UIKL 4L4JA 4CKVX 2PXYD 2IQAA 5EU7E 1T5XA 2FEDC 4X7FC 1FGVL 3NABH 1ZHKA 5CJ8A 5HDQH 2AK4D 4D9RE 1A6ZB 3NN8A 1N2RA 1IBGL 1J0JA 3U9PL 5J1TC 3GMLB 4A6YB 1LHZA 3B3IB 3FONA 3QEHB 4JANB 4H8WH 5I9QC 1ND0B 3EHBC 1KTDA 1X44A 1SM3H 3NVQA 5DA4A 5AZ2L 3X17A 5INDB 1H3VA 3SDYH 4JAMA 4NO5A 2VXSH 1IL1A 5HHPA 3JWOC 1AO7B 4TSBL 4K7PH 2GUOB 4XHJD 3MRFB 1SBSL 5BRZB 3MRMB 3BEWA 3DTXA 2Y7QB 2LTQC 1CI5A 1YEDA 1MIMH 3GSWB 4NQVA 1ZXQA 2V2TB 5IR1A 3O9WB 1I9JL 4ZPTB 1FZJB 3DUSB 5B8CC 3LRSA 3N50A 4ZS7H 3AB0C 2GSIA 4ODBD 4JPIB 5KSAB 1JHLH 5FYJD 3F7YB 4Z7VA 2R0KH 1NSNH 4FFZH 2G60H 3B9EA 3B2UC 3I75B 3MRCA 3RTQC 3P0VH 2NNAB 2QTEA 3BUTA 3RL1B 3TJEH 3QUZC 4ZO8A 5BZWA 3C5SB 1E28A 2OTWA 5EWIH 3WKMH 1YUHB 1YQVL 5KSBB 5FK9B 5E8PB 1A22B 3J7HA 4GJTB 5KVFH 1RURL 3P3YA 1VHPA 3IDUA 2CDGA 3IJHB 5JMRA 1U8MB 5BV7C 3KJ4B 5C07D 5HGDB 3MV9B 2BY3A 4LCWE 4X7TA 3MNVB 3VWJD 3KPSA 5GGTL 4P5KB 3MGTB 1T1ZB 5C07B 4Y4HB 1T2JA 1HNGA 2UY6A 4Z7QE 2AABH 3ESVF 3O3AB 3Q6FB 2AK4E 3MBEA 4EOWH 5HY9A 2FH8A 4QRRA 4FQQB 3K8LA 3VE0A 1C5DB 1FVEA 4HT1L 5CEZE 4MWFA 1NAMA 5ERWA 4HBCH 3S5LG 1IT9L 1KLGA 3RU8L 6FABL 2NYYD 1DQML 1ACYL 1KC5L 1MHCA 4V1DD 5DR5L 3VGDA 4RWHA 4WTZG 3CX2A 3QCUL 1BLNB 4ZTOH 1LE5A 4PJDE 5T3ZL 3E6HA 1NCCL 2FEEI 2X5PA 5I1AA 1CFTA 4JR9H 5GRWA 5D1XA 1T21B 3T0EB 1P84J 4I18A 4NZJA 3TFKD 2MSPA 2PTTB 4I0PB 2VQTA 5CEXB 4N1HB 1RIUL 3Q6FA 4MS8C 1L7TH 1F02I 1P7QA 1S9YB 3O6FB 3RHWK 4NFBA 1Y18B 2EE6A 5C2BH 5DJZA 4OD2A 1I1AD 4JZOA 4B0MM 3O3EB 2EDFA 1U8OB 1FDLL 2OJEA 4LEXH 4U33A 1GVIA 5E8DH 2WWMD 1Q72L 4G6MH 5L88H 2D03H 2DL9A 1XT5A 3PJSA 4Y4FD 3QRFM 5DK0A 1QQDA 4PRIA 4H88L 4OF7A 5DLML 3D0VB 1PD6A 4LVNB 3UJJL 1Q1JH 1KJVB 4XMPL 4HHAB 4R4NC 3HI6H 3ARGC 5IW3A 4PJ5A 4TNVK 3OG6B 1S9XB 1FDLH 2BVPA 4PJDB 3AMLA 3PGFL 1MAMH 1NKRA 4Y1AE 2FGWL 1NEUA 4Y2DD 2N7AA 1OLLA 4YC2B 1OAQH 1PAMA 1IAIH 3H9HB 4IOSD 4ZAKD 4O9HL 3VH8G 1W72A 1BVLA 2OCFD 4PJBB 3GMRB 5KS9F 4XNXH 3MBEB 2VKWA 3C09B 4JFEE 1PEZA 4YXKH 1XGRA 3JUYA 4S1DC 3VG9C 2EXYC 2XFXA 2HN7A 4CW1A 3DVNB 1A7NL 1YEDB 2V2TA 1XIWA 5F3BB 3DTXB 1J11A 3IRZA 2IAMC 1MHPH 4AIZA 1EHLH 5L6YH 4L9DA 5DFVD 3B8SA 1JNNL 3CMOL 4CNIB 3V0WL 3PHQB 3EJZC 1YNTB 2GK2A 4IRJB 3KYOB 4HKJA 4GG6F 4PRHD 1N5YH 15C8H 5D7IA 4XBGB 1OARH 4S1DD 1ZWIA 2APTA 4F9PC 5JPNB 5D2NB 2NXZB 3OQ3B 1U91B 3QUXC 3P4MB 3NN8B 1QSVA 1NLDH 4RX4D 1JK8A 3WHE1 3GIVB 1HEZB 1MCWM 2IH1B 3GMQB 1WSST 1OAKL 1FJ1B 3WIFA 1UG9A 2DQUL 3QG6A 2EIBA 3QFDB 4ALAH 4I2XA 1ONQA 4PREA 4YO0A 1CD1A 4HMEA 3PWPA 3P30H 5BO1L 4ELMA 2OMNA 3UTSB 5GRVL 4M61B 2AJYL 4K2UL 1TVHB 5IB1A 3MOAH 1IAOB 4G8FA 5GSRA 4MNGA 5IBTH 3SJVA 5EG6C 2F8OA 1F6FB 4G43A 1B6DA 2ARJB 2OSLA 3GUTA 5SWZB 1AFVL 4MNHB 3SCMB 4OD1L 3K2UL 2X4TB 3QHTC 2IBBA 1IM9A 1T66C 3VFPB 4APQA 4D9QD 1LD9A 5CJXC 1N2RB 4ZFFA 2UZIH 3UYRL 5F96L 1HHGA 3VMNA 1AKJA 4KXZH 1N64H 1KN2L 1DQQB 1H3PL 1DANU 4JPWH 2EDQA 3KPMB 5LAXA 3BN3B 3OGOE 5F7MC 4GAJH 3SJVB 4MNGB 4JY5H 1DEEB 3WJLC 1O5DT 1UACH 4PRAA 1A7PH 2EYSA 3UJIH 2P44B 3QUXD 3VRLF 4Z95L 2EYTB 1IGJB 4HJGA 4KK6D 4PJ9B 1H3GA 3HE6D 2Y5EA 5SWSB 4I0CC 3MV9D 4EBQL 3TBTA 5JZ7C 3QFJD 5GGUA 4QLRA 5IW1B 4CVXA 2F54D 2VDMH 1PG7X 1UYWH 2R23B 2FO4A 1WIPA 4K7FA 1A7PL 5D2NA 3ZL4H 1QLRA 1KN4L 1CT8A 1F11B 1F4XL 3GGWA 4HCRL 1TJHL 3G6JF 4L1DA 5FHAH 4F7TA 5L7XL 2WIIB 2X10A 5J57B 1SY6H 4F58H 2HMIC 5DK3A 1FZOA 5IK3B 4EKXA 4MNQA 2W38A 1GPOL 2NW3A 1J8HA 1SBSH 1T83A 5T1LB 1K4DA 2Y72A 2X40A 1QRKA 2W0KA 1YEGH 3VFGH 3B9KA 1JFQH 4HUVB 2D4FA 4RZCA 4LPYA 1INQA 2NX5A 4N5EC 3I6LD 2WZPD 3ROOB 4UDUB 1YPZE 5DDHB 2FBJH 5IHBA 5E6IC 3GKWH 4AEIH 3EYSL 1G7PB 1NC2D 4OZGE 3HZVA 4DGYL 5EU4B 4LL9A 5C9JA 4OFDA 4NZTL 1A6AB 4UIKH 1H3WM 5CKGA 3W39A 2FO1A 3UTOA