1NGYB

Chimeric mature fab 7g12-apo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Mature Metal Chelatase Catalytic Antibody, Light chain
publication title Structural evidence for substrate strain in antibody catalysis
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 41
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2002-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngyB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngyB02
4WNQA 2D0HA 3VFRA 2NY4C 2AJYL 4G3YL 1HH6B 3QEGH 3MLSL 3DX6B 3VH8A 3BFOA 3IFPA 2BX5A 3DX9B 4JREC 3BKJL 3IETA 4J1UB 1WBXA 1SY6L 4GQPH 4NO3A 4PGCB 3D2UD 3UYRH 4DUXA 5JPNB 3GIZH 4QOKB 4HBCL 3TBYA 5KSAA 1ND0A 4RMUA 3NOIA 3BKMH 4Y19A 3SY0A 3KHQA 5D1ZA 3ZYJA 2P5WA 3LKOA 4WUUB 3W9DA 4QRPA 3HPLA 5F44A 3TJHC 1S9KC 4KK9C 3TYGL 4NKOB 3BEVA 4OLUL 1QO3B 3ISWA 4I4WB 5C0IA 4U1SA 5EZOL 5IEHB 1DANT 4P2OB 2HTLD 4OD2B 2OI9C 2KL6A 2YD1A 2D3VA 5IMLA 4MD0B 3BN3B 4X6FA 5I76B 3QCTL 3IJHA 2XY1A 2CJUL 4YDIH 4R2GD 3CC5A 2WUBL 4NUJB 1E4JA 5F1SA 1MCIA 3HNSH 2Q8AL 3CLFH 1GYAA 4OGXL 2V7NB 4KMTH 3F62A 3PIQA 1A4JB 4Q9BA 1KGCD 4PGJA 4X6BB 2A73A 1N8ZB 5I30L 3QUYD 5D1XC 1S5IH 1VACA 3UJTL 3QXAA 3STLB 3SCMD 2Z31B 1YPZF 1KIPA 3QP3A 1BZ7A 2YC1A 5CCKH 1HCFX 3D0LB 1I7RA 4OKVA 1DSFL 1UKTA 4LGPB 1AI1H 1J5OH 5E2UH 1J0HA 1B0RB 3GSNL 1QQDA 5IROA 4GXVL 4YX2L 3OXRB 1XF2A 3VXMB 2A77H 3HNTH 1I9RH 1OT1A 4U6YB 3LMJH 4UT7L 2BZDA 2CLVB 3BAEH 3JXAA 3MR9A 3PABB 4LFHG 4FXKB 3P0YH 4OF8A 5IR1A 1CLZH 4PLJC 1A14H 1UZ8A 2WAHA 4P5TA 3TPKA 4E5XB 1M7DB 4JFQA 1WC7B 4PP1D 2Q7YA 3TNNA 4XRCA 1KOAA 4W68A 1R3JB 1XCQA 4E41B 4F15B 1EXUA 3X3GL 3WDIA 5IJVB 5EU7C 4U6VH 4LSTL 1KELH 4U1KA 5EO9B 5IVXE 3BE1L 4APQD 3MXWL 2ORBL 5DD5H 5I1GH 1HQRA 4JDZB 4Y4FC 3QAZC 2HKFL 3T0EA 3MRPA 2DQCL 3E1F1 3T3PE 3VJ6B 2DMCA 5HVHB 3RUGE 3NPSB 3ZHDA 4CVUA 4K94L 5L0QC 1LD9A 3BGFB 4NHUA 4JPVH 2JLLA 2J8UF 1P6AB 3KJ4B 5C09A 2R4SH 4JRXB 1NL0L 5D93B 5C0BA 5B8CC 1UM6H 3SDCC 3RU8L 3BRDA 4A6YH 3O4LB 4OGYH 3Q5TA 4WGWB 2B5IC 3PG2A 3MJ8B 3ARED 1LP9A 3CFBA 1NGPH 1GIGH 2UZYB 4U0RC 5FYJE 4K55A 1S9XB 1DQLH 5GGRB 1F4XL 4YHIB 2R1XA 4WVRA 1I1AA 2BRRL 1DBAL 3NTCL 3GJFB 3RX5A 2HLAB 4I77H 4JRYA 2XZAH 5BS0B 2OL3L 5LGHH 2SEBA 3BW9B 3JZ7A 4I0KA 1RJLB 2DTMH 3GSWB 4PJ5B 2AEQH 3RVWD 2HTKC 1EX0A 1MCFA 3O81A 4HCRA 4X9FA 4PJFE 1KPRB 4X9HA 3NCJL 1K4CB 1WF5A 5FHBL 1OB1A 4W81A 5DJCB 3DVGA 3Q0HA 1UADC 2R2BB 3HC4H 5KSBE 3G04A 1YMHB 4NZTH 1CGTA 3NFNB 4NO2A 1G9MH 4XPAH 1T6VN 3ZE1F 1BZ9A 3ZDZE 2XTJD 3SJVD 5I1DB 5IG7A 5F9OL 4PGZA 4WHYH 4YZFF 1AFVH 3K4AA 2ZNXA 2X4RB 4GKZB 4QRRA 2O61B 1AR2A 1YEHH 1OAYH 4XCCL 3VFMB 1YEEL 2AV1B 4M6ML 3N06B 4L3ED 1KCRL 4XVUD 5DYOA 2DLTA 2YUXA 4RAUA 3AS1A 3QZWA 4M7LL 2JF1A 4PJ7A 4L8CB 3V2AR 2MJWA 4M1GH 1LVEA 2NXYC 4MWFA 4XPGL 4CL7A 5FUCC 1YN6B 4M48L 4P46B 4IIQB 5F7UA 4G42B 4CN6A 4IRSA 2GSIB 4QNPF 5DJ0B 3OAUL 2AXGB 5HHOD 1AHWC 1RUQH 3RA7H 3MGTA 3QQ4B 5ALCH 5I8CB 4J7RA 1JZ3A 5K9KB 5D7IB 4X4MA 3ZHLA 3D18B 3O6KH 3CFCH 3MV7D 5MEPA 3GB7B 3DTXB 5F7EL 1JPTL 3ES6A 3SO3B 1GGCH 3BJ91 3NCMA 2BSSB 5DD1H 3IDJB 1I8IB 3NGBC 4F7MA 1ZKAA 4HUWB 1CK0H 3CDGB 4HIIB 4BKLB 3QG6B 3RDTB 5L2KD 2HJFB 2PR4H 4RMRA 2ITCA 4F2MB 5BW7C 4LPXA 3I84A 1JN6A 4QHUB 4QXUL 1JPFA 2GK0B 3O3AB 2AJ3B 3MJ9A 3HE7C 4JPIA 1ORSB 1DQQB 3DROB 4NJAH 1DQTA 5DHVA 1BX2B 2AERT 2C1OB 4LHUB 4LSRH 2VQ1B 1YQVL 3AB0C 2BVOA 2WQRA 3IXTA 1P9MA 3PWVA 3HC3H 1INEH 5CBAA 3P0VL 2IALA 2ESVA 1HZHL 2XN9B 4EI5B 4LIQL 1QFWI 3ALPA 1B88A 5HHVL 3WJJA 1KGCE 4ZFOB 3TT1H 4HLZG 5DRNB 1CXKA 1IC7L 2G60H 5ABDE 1EFXA 1MQKL 5E1AB 4ZPTB 1ZAGA 5IJKC 4XMKL 3RWCA 3HE6A 4ZUUA 4MNGA 5C9KA 4PLKC 2IMMA 3ME0A 3P9MB 3MCG1 4YDKL 5J89A 1DBJH 1KIUA 4Z7VE 1JNJA 3G5ZA 3IKKA 1R3LA 2A83B 3GHEH 1YEIH 4JY4B 4LLUA 1R3KB 3VXSA 5E6IA 4OD1H 3GHBL 1TVHA 4I3SL 3IJYB 5GSVB 3QEUA 3MXVH 5DWUH 4KH2A 1FNSH 2D9QB 2F5AL 2O5YL 3O2DA 1N59B 2VDQL 3INUL 4Z76A 2XQYG 3WLBB 4M4PA 4YK4C 4B50A 1V7MH 4U2ZA 3STZA 5D1XB 4V1DB 2PXYA 1SQ2N 1N64L 4HKJA 2ED8A 2PTTB 2GHWB 4JVWA 1EIBA 1YDPB 3FO2A 1DLHB 2CUIA 3FN0H 4Y16C 1UACL 3OKLB 4PJBF 2VDML 2N56A 4KQ3L 4MJ5A 5IVZB 1RUMH 1YUHB 1U8HB 2YD5A 4FN0A 3VE0A 1CF8H 1TENA 3O41B 5JNYA 1ZWIB 1U92B 3T65B 2J6EL 3BIAX 2G2RB 2Q3AA 43CAA 4XNYL 2H32B 2R1YA 5BZWA 5I1EH 2DQUH 2I24N 2QKIA 4JJHA 3EZ8A 3SDCA 4JPKH 3NN8A 4GW5A 4AMKH 4X6DA 2DQJH 4LFHD 4MNQD 1RUPH 3S36X 2FD6H 4RMQA 1OVZA 1KBGH 4HCRH 4NC1E 4BM7A 5TF1L 3ECBB 3VI4E 2VR4A 1BVKB 5KN5B 2YD6A 2IPKB 1CGVA 3O2WL 4R4ND 4KZEH 1MRCL 4J3WA 1ZXQA 4X6CE 3AAZA 4Y4FB 3P4OB 4I5BB 3U46B 3QAZB 4RBPK 4CVXB 5CGMA 1EJ6A 1BLNA 5IB1B 4OV6F 4QCIA 5L0QB 3RWJB 1CR9L 2IQAB 4JM2F 1JF1B 1U8KB 4WUUD 5B8CB 3WHXB 4D0BA 1C08B 2PW2A 3QDME 4AH2A 4LQFH 4ELKA 4MQXC 3CDYA 5LCVH 4NN5C 5E2WH 2B5IB 2JJUA 3SDXF 4P2OD 1VFBA 3MNZB 2XTJE 3VXNA 3WFBH 3SJVE 3IDGB 4U0RB 3G5VB 1JMZA 4F9PC 3C87A 4HZAA 5ECJE 5SX5H 1FFRA 2PW1A 2X9WA 2F53A 3T4AA 1CFVL 1OGAB 4AEFA 2AVGA 4LAQL 4JG0H 4K3DL 2UWEE 4L3EE 2HFGH 1HINL 4FG6C 4RISL 3GSXA 1FZMB 3TNMA 3HI5L 4HHAA 4HG4K 2EDTA 1QACA 3ET9F 1QLRB 1A1NB 1PKQB 4HJGA 4GLRI 5IVXA 4PY7A 5A40E 5LBSL 3WS6A 5KS9F 3VXPB 2CLRA 2Z31D 2HKHL 3BKCL 5TQ2H 4JO4H 1U8JB 4PIRF 5DVOA 1ZANL 1KB5L 3EYFA 4MA7L 1NFDE 4FQCL 1GAFL 3U36A 4S1QH 3T0XA 4KTYA 3QXWA 3I02B 4PJEB 3ZZ1A 4K23H 1R3IL 3QJHB 1NSNH 4FXGB 4JQVC 4ZUVB 5HHOE 4TPRH 3BN9C 5F88A 3ULVF 3VXMD 3RWGB 1I75A 4P2CG 2HRPL 1IT9H 1AHWA 3G5XA 1VFAB 2Y9RT 2NY0D 3SE9H 3T0BA 1RIUH 5LGJB 2YR3A 3MC0A 3MV7E 5EZIH 3MJ9H 3RWHA 3H42L 1LO0L 1YPZB 1J1PH 1XFPA 3MYJA 5C0FA 3PWJB 5DHVH 3OG6B 3E3QE 2NXYB 2XWJA 4E41D 3BYYA 4YFDB 1MFEH 5L2KE 3D69A 5DQJA 3TZVA 2X2YA 4LDLB 1TVDA 3NCYS 1NJ9A 5BW7A 2FO4B 2FEEL 1H3PH 4OIAA 3SGKC 4LHJB 1A7OH 5D9SA 4Z7NE 3GNML 2ADIA 5E2TH 4LSSL 1W0WA 3D87B 1AGFA 3QI9C 1QR1A 1VPOL 3O6LL 2EDJA 5T3ZD 4HGWB 3BP6A 3IYLW 4JZOA 2FSEA 1JK8B 4N0RA 4AM0A 4EI6B 5EOTA 1DLFL 4QHNA 1F58H 4HPYH 1BWMA 3BH9B 4QF1B 3REWA 3ZDXE 3NGBB 3H0TB 1INDH 3O9WD 2A9NH 2YSSA 2DWEB 5F8RC 3VXRB 5CP7A 1X5AA 3F7YA 1OSPH 1L4IA 2DAVA 1YA5A 4U4BA 4WFED 2GQHA 2I07B 3MLZL 2Z93A 3TH4T 3OKOB 4XP9L 3KHOA 2DQFB 1MCLA 5GRJH 3O2DH 1I9IH 1KIQB 3CPLB 3HE7B 3M17A 2QTEA 4JM2C 2J8UB 1YJDC 1CXLA 5JR1L 2R0LL 5D6DA 1RULL 2BMKB 4PJ5D 3FRUA 2ZJSL 3WLWD 3ESUF 4Q2ZB 1D5XB 2YRZA 1ZS8B 4MAUH 3B9KC 1S7SA 1PG7H 3UPRB 2CKBB 1RZIB 4U3CA 1IARB 2EDLA 1KXTB 8FABB 5C0RL 4ZO8A 3ZE2F 3U48A 3O3EA 1KN2H 2OYPA 2X7LB 5CD5D 1XGQA 5CD3B 4GXUN 2Y1VA 5E6YA 5ICXB 2X4SB 5ID0A 3L3DB 2RHEA 1NAKL 1J87A 4HXBL 1QUNA 3D2UA 4MS8D 4RDQF 1JPGB 4OJFL 2AJSH 5CJ8A 1A3LH 1T1XB 1U8LB 4CVZB 4DVRL 1AGBA 3O11A 5DSCA 3QFDB 4RNRB 2AV7A 4GSDL 4ZSOB 4PJAF 4AEHL 1J05A 4Y16A 3ZT6A 3SE8L 5DZOA 4D3CH 5JW5A 2V2WA 4MJ2A 1PY4A 3LAFA 1K6QH 5H2BB 5GRWA 3S6CA 4ZNEA 4PBVC 3TPUB 3DX8A 1EHLL 3LKRA 2P8PB 3KYAA 5BXFA 5H35B 4KZDH 5T1MA 3SOBL 1QSEB 3QH3A 3K46A 4HUNB 1I1FA 4OCNC 5D8JH 4MA1B 2E7BA 4MNQE 3ULVC 4S0TD 1U42A 3JTSA 1G1CA 4WW2B 5ITBL 4PRIB 4QXGL 3CJJA 4PR5A 5I73C 4NQXB 4CDGC 5ANMB 5ISZA 4Z7WE 2Z92B 4WHTA 2A1WH 3N50A 1GJIA 2OK0H 4IDJH 1A6VL 3LN4B 4GMTL 2EDBA 3QUYA 4AEIH 3RBSA 3HUJF 1S8DA 4G8GB 4JZJB 4OLVL 2DIBA 3SCMA 1EBAA 5I1LB 1NDGA 1ORQA 3MCKB 3DRQB 3S37H 4QLRA 4WUUE 3T2PA 4Z7VA 5I9QB 2BVPA 1XGTB 1H0DA 1IKFH 5DQDL 1TQBC 3DMMC 4J3XA 3WFHA 3I9GH 1Z0MA 5IT2L 1FYTB 2VXVH 1GHFL 4I9WD 4QT5B 4OT1L 2OSLA 4L1HA 2B1HH 4H1LA 4RQQB 1OAZH 2FR4B 1DJSA 1FL6A 2GJ6B 1QOKA 1KLGA 3B2VL 2P7TB 4JM4L 1UXSB 4LP4A 4F9PA 3Q6FA 3QSKB 4JJ5A 3LEXA 2KUTA 1HHJA 1D6EA 3GMNB 1U0QA 3DUSA 1CGWA 2VSCA 3MLYL 4R90L 1PZUB 2R0ZH 4EI5D 4HPOH 1ACYL 1N5YL 3EIFA 3L3HA 1QPXA 4XAKD 3IFNH 3QQ3A 2QSTA 1S9VA 3NZHH 4EDXB 4APQA 4A2MA 5DS8B 1JJUA 3FJTA 1SJEB 3DI3B 3ARGD 4U2YA 1MHPL 2BHYA 4NN5B 4RZCA 5DQ9B 2R56H 2D03H 3QUZD 5FYJH 4TSCL 4HK0B 4U1JB 1Q94B 3T8XA 3KXFA 3O2VL 1DE4B 4V2BA 4BH8A 3N85L 5DRWA 3EO0A 3VXME 4K9EC 1TDQA 5MERA 2V2XA 5JLZA 3V0VB 2HN7A 4FQ1L 5FCUH 2ARJA 3RBGA 5IQ7H 3KS0H 4ZDHB 2Y07L 5HDBE 4DUVA 2DB8A 3RTQC 5CINL 4PJCF 5HI4D 3OGOE 4LVEA 1BFOB 5GGVY 1WBZA 1KYOK 4WUKL 2WANA 4E41E 1EEUA 3MNVA 4NQCA 3AU1A 4OF7A 4PJBA 4UT9H 3BZEA 1RAMA 4ZODA 4GG8A 4X83A 4KKBD 3GDBA 2R0KL 2A6JB 3SPVB 3EJYC 1I3GL 4WENB 3OG4B 5GS1A 2E5EA 1WISA 5FA3B 5TE4H 1YC7A 2ZCHH 4Z5RB 1B4JH 1J0JA 4ISVB 5DFVD 2YEZA 4PRDA 5T3ZE 3OSKA 2Q20A 3NCFB 2RGSA 3ZKMC 3QG7H 4KK5C 4LKXB 3FO0L 3NABL 4BZYA 2CUHA 5DMIL 3P3YA 1WFOA 5AYUH 2ZUSA 1P1ZB 1XT5A 4ALAH 5DEGA 4KVNL 4OFPA 4OM0L 1KCVL 4XBEH 2UWEA 3WSQH 4L3EA 5JW4M 1EAPB 1PDKA 1ZLVH 1S5HA 3IFLH 4HKXB 2OJZH 1UCBL 5FOJA 4PRHA 1RIHH 1DBMH 4KRPB 1AY1L 1U58A 6FABH 1CN4A 1L0QA 5J6HA 3WXVH 5BS0E 1KF9B 4M61A 5F9JA 1EGJA 4JY6A 3FT3B 1IM9B 3T3MF 2P46B 4PJ5E 1TVBB 1MWAL 3QI9B 3CVHL 1XZ0A 1N7ML 4OLZH 1VEPA 1U8PB 3B9AA 4EBQH 3VD3A 3MACL 1C16A 5I0DA 3SDXA 5F93C 1V3MA 2C7UB 3EJJX 5I16A 1Z3GH 4IS6A 3MLPA 5HHOA 2CXKA 5TFSH 1A7NH 4B5EA 1WWBX 4XAWL 5I71C 2MKWA 2VDLH 4M6OL 4U1NB 4O00A 3T4YB 4QRTA 5I1HL 4D9RD 4YXKL 1KJ2A 3C6LC 3MV7A 4QHMA 5CEYB 1OM3H 1MCHA 4FFWC 2NTFA 5B22A 5C6PB 1LO5B 1W72B 1R5VA 4LEOA 1IC5L 5D5ME 1NBYB 5LGKA 4JM2B 5TDPB 1VKXA 1A9BB 3C5ZC 5EOCJ 1FL5B 4M6AA 4JFOB 4PJDB 4ODUB 5L2KA 4FXLA 5HY9B 1S7WB 4LLYB 4OCXL 4GMSL 3P4MA 2BNQB 4OB5H 1F4AA 1W0VA 3A67H 3KPTA 4LSPH 2LE9A 4WDIA 4HD9A 5F1IB 2LVCA 3VWJC 1CDGA 1GGTA 5CJQL 1NCBL 3LQAC 1FG9C 1O7SA 1FNEB 2C3VB 1J88A 2HP4A 1XF1A 2PCPB 4ODHH 4ZFGH 2JK5A 1Q9WA 1QA9A 1NC2B 2JIXB 3VCLA 4AENB 3MODH 3VFPB 4NFDA 5DMJB 5AZ2H 1NLDH 4QRQA 1KJMB 3CX5K 1U8IA 5D7IE 5KTEL 1ZA6A 1X5GA 2Z4QB 1OAKH 1HE7A 4X98A 2EXWC 2RFXB 4I18C 2EECA 2JJWA 3S88H 4ZO9A 4LPUA 3GMQA 4H1LH 2R39A 1QBMH 3K3QA 2K1MA 5TDOA 1NBVH 1SJVA 3ZKNC 2B20A 4O5LH 2YOCA 1BOGA 1CT8A 1KTDA 5EH1A 3LQZA 4NCC2 3I6GB 1T2XA 3T1FA 3RKDD 4L29B 4L8SB 4JANA 4PREA 1MAML 1T3FB 2E6PA 5BMFH 3QJFB 4I9WE 5IOPB 5HHPB 4FNLH 3QDAA 1FGNH 1YEJL 3JWDL 5EOQL 3SKJL 4KRNA 1IZKA 1MPAH 4NUGL 5LAXA 5I73B 4WTZA 3BWAA 3CSPA 1EAJA 3L5WA 3ABZA 4LLWA 4RGND 1BAFL 1LNUB 4YQXL 3U0WL 2H2PD 2MSPA 3C5SA 5E56A 1CD0A 4QRUA 3HLAA 2G75B 1NC4A 5JORA 2XQBL 5EOCH 1C5DB 4UZGA 4TSBL 1LE5B 1CU4H 4ZTPH 4XAKE 4WWKD 5EUKA 4JEGB 1UWGL 4RFEA 1TQBB 3BDYH 4ETQB 3RWEA 2EXYD 4G8EA 4U1GC 2QQLL 1PZ5A 2UVFA 4CNIA 1P7HL 5E8OA 1FGVL 2X05A 1X4ZA 1J7VR 3NACL 1U9KA 5E6ZA 1F00I 1DQJB 5D2LE 1OLLA 3N0PB 1F4HA 2K7QA 4NRZB 4NQVA 5AYQA 2C5DC 3K8MA 4MNQA 2APXA 3OR7B 3PGFL 4JFYA 4XP1H 4JKPL 3VD9A 3IF1A 5IHBA 2GJZA 2IPTH 4OTXL 3U2SA 1QFOA 2ZG2A 4NQUA 2YZ8A 4KGJA 1OF2A 3VFGL 5DFTA 3TH3T 1I9JL 4BQCA 1ZHLA 2E9JA 5HYSG 3IVKB 4P9MH 1HH6A 4IOIA 1HXMB 3LEVL 3U0PA 1CL7L 2XFXB 1G7LA 4HBQA 3S36L 1RJCA 4PLKD 8CGTA 4FQQA 5DEFB 3TBWA 1KTLB 2XKSA 4DCQB 2IH3B 3EKCA 3VFTA 2VDRH 4TRPH 4HGMA 1VB9A 5MEND 1SMAA 3EW3B 4E0RB 4FABL 4XP5H 2Y4SA 5JIPA 1VEOA 3VXQB 1JNNH 3MLWL 4PRNA 3ALXA 4NKOA 4XC3L 2FHBA 5IEHA 5F71A 4GW1A 1QSED 1DUZB 2H1PL 1K4DA 3HMWH 4OLYL 1UQSB 4GAGL 1SJHA 4MD0A 1T7YA 3RTQB 1EGJH 3FONA 4DGYL 5I8OH 1XF4B 5FYLD 3RWDB 5DXWA 4LKCA 3VI3E 1HCVA 4D8PB 3GSOA 1NFIA 1CFTA 1QNZL 1IAKB 4ODXA 4PJAB 5HPMA 1G7QA 2J88L 1MQ8A 1F97A 2VE6B 4H20L 4JLRA 1JVKA 1MJJB 4I3RL 3HUJA 2NY5L 3VWKD 3LV3B 2B0SL 1EO5A 3JV4B 5C0JB 3R06A 3MNWB 2YRPA 5L2JA 3PGDA 5JIIA 1PD6A 3UO1L 4G8GD 1T66D 2Z31A 4UB0H 5F3BA 1IAII 5T1LB 2OTPA 2HH0L 2YPLB 1KJ2H 2ZUWA 5J9PA 1DUYA 3NA4A 1YY9C 2DLHA 1U8OB 3L5XL 3PWLB 1A22B 1CDHA 1UKSA 4UIMA 5EO0B 1HEZB 1KPVB 4UAOC 2JB6A 5BV7C 1FYTD 1G7IA 5HYFA 4DTGL 1JHTA 4HAFA 5DD0H 3HZKB 4NKIL 1NMAH 5MHSD 2CLVA 3CXHK 2GJ6D 3ARPA 2VAAB 3MRHB 1S7TB 4CRPA 2IGFH 5EC1B 4D9RE 1LEGB 5FV2A 2GTZB 5DVLA 3DO7A 2ZOKB 1VGEL 5GS0L 3BPNB 3WNPA 1KJ3H 2VDNH 1YNLL 1FSKC 1TQCC 2BP3A 4GS7B 1U41A 1L9MA 3EOAA 3KLAA 4HIHB 4JQIL 4DW2L 4YHKL 4OZGF 5C0DA 7FABL 4OD3H 1X5IA 5F3HA 5DD6A 4EIZC 1IVLA 5IBLC 2AKRA 1HWHB 1LMKA 5EPMA 3I2CL 1PKQE 4Y89A 2VR9A 4JDZA 5IMKA 1D5MA 4ZO7A 5IF0B 3FB7B 5I1AB 2PO6D 2N7AA 3O3BA 5I71B 1XGRB 2DQDH 3OWEA 3VWJA 4LU5L 2VL5B 4PJEE 3RY6C 1YNTB 1GZQA 3C6LB 3I75B 1SYVA 1RJYA 4YR6B 4DZ8B 1CVSC 1D6VH 3MJ6A 1INQB 4OQTA 2AGJL 4X9BA 5KVGL 3QUXD 3K8KA 1T6WA 3QFJD 3OPZH 4P59L 2ILLA 1LO3L 3O9WA 1H15B 1BFVL 3I6KB 3DV4B 3C5ZB 3RQ3A 3X12A 5EC2A 4ZFZB 1JRHI 5FGBA 3ILQD 3U9UA 4TTDD 1FG2A 3AVEA 1E4XI 1ZT4A 5KJRL 4YFLI 1PSKH 3K0WA 4DKDC 5KVEH 1TZIA 1FO0L 4D9QD 2XZCH 3P0GB 1JWUA 3SBWC 4HW6A 3PXHA 3IFOB 4RGOH 1K4CA 4HXAL 5DK0B 3JWOL 1E28B 5HDQL 4KV5E 2DYPB 3RWIB 5FYKU 5L8LB 3N1PC 4U1LB 3MOAL 4UV4H 3ZT5A 4HQQL 1E27A 2YRLA 3HFML 4N0UA 4UDTB 3LQMA 3SDDD 4RGNE 1BQLH 2NYYC 1L7IL 3D48R 2BNRB 4I18B 2P44B 4MVBC 1V8HA 1ZOXA 2GFBA 3QHFH 3L7EA 1WZKA 4Z8FH 2EIDA 3IDXH 3VRJA 3VFMA 1MHEA 2ZUQC 3MLXL 5D5MA 2AW2A 3MRFA 1N6QL 4NDMA 4XNQA 4LEXH 3GO1L 3CDFA 4WFFD 2RB8A 1QZ1A 2B39A 4JQXA 1RUKH 3WNLA 4KRPD 3LS4H 2CGRH 3ZKSD 1G9NL 2FBJH 4TUOB 3AUVA 2KH2B 2Z8RA 5EBWA 1JI1A 3PQYA 4NKMA 1SY6A 1A6PA 1T1ZA 3CAFA 4NNPL 4NSKA 3ZYOA 4NQDB 4KXZH 1YN6A 3GGWB 3MUGA 4OM1L 2VNCA 3CVIH 4S10A 1PQZA 2Z8SA 1P69B 4G5ZH 5DJ0A 1NMBL 3CZFB 4MNHB 3SE4C 5FM4A 3DGGB 4LCCC 1MI5B 4N68A 1V7NL 1WZ1H 4OFYA 2AQ1A 5GGSB 3LRSA 3GB7A 2F8XC 2HLFC 4KHTL 4OLWH 4U1GB 4RRPA 5ICYA 4JN2A 1RURH 2WBJC 4JFPA 4DN4H 1QFUL 3ULSA 1LO4L 4ZSOE 1AC0A 2Y7QB 5MENE 2MMXA 4PRBA 1GOFA 2CRIA 3V5DA 4QHUA 2VDOH 1DN0A 2BNQD 1MCSA 2DIAA 3BO8B 3RX7A 1X4XA 1QSEE 3Q6GH 5C0EB 5ACZA 5K9OA 3DRTA 2BSED 3MRNB 1ZHBB 2ITDB 4G80B 4F58H 4RWYH 3UTQB 2VQ1A 1HNGA 1BQHB 2FECI 3CFIC 1C1EL 3VFUB 4YGAB 3PDOB 2DM2A 5FYLE 3X13A 5JW4Q 3P0YL 2DQTL 4GLRH 3KWWB 3PJSB 1NC2D 4YHML 2JIXD 1BJMA 3NBNA 3GSNA 2AJUH 1T5XB 3QIUD 4GW4B 5ANME 1BIIB 2F54B 1SVZA 3A6OA 4XZUB 1S7RA 2LAGB 2BOBB 3OJDB 4MDJA 1P4IL 1F90L 4Q74A 3X3FH 2IBZY 2YMXL 3LKQB 1DEEA 3WIIH 5I17B 4FFZH 5E1AA 3VDCA 1YY8A 2MPAL 4G8GE 2HT4C 2ZSVA 3ARGA 1KELL 4XMLH 1IAOA 3QRGL 3EO1B 5FIEA 3QUZA 3M8OL 1H3GA 1UM4L 2V7HB 4QRSB 4GRLD 1TIUA 2DS4A 3NVQA 1AGCB 5D2LA 4EEEA 1FYTE 2VQTA 4XCYA 2EDRA 3JWNC 3DECA 1OP5H 1T2JA 3V6OE 4X7EC 2EDQA 5FM5M 1IEBA 5MHSE 4R7NB 4AQOA 2GJ6E 4LLVB 2A6IB 1IGFH 2EKSB 4NZRH 25C8L 3ZYIA 4YDLC 1WIPA 3V4PH 3SKNA 5C6WH 5J3HD 2VLRB 2ZNWA 1EERB 3BVNA 3HAEB 4OZIE 1UJ3B 2IFFL 2P49B 4Z7OE 4XX1G 1QLFA 1DLHA 1KJVB 3W39B 1JWSB 3H9HA 2LU7A 3ARFC 1FNHA 4OQTH 4UAOB 4Z7QF 2UZXB 5BV7B 1XF3A 1U8HA 4M93C 5TQ0L 4ZXBC 1IQDA 1YMMB 2DRUA 5D6CB 5HBBA 4TUJB 3CX2A 1U92A 2G2RA 4QHKJ 3QEHA 2HVKA 3LB6C 4KJYB 1H5BC 2EZ0D 4CU8A 4MA8L 1JNLL 5HJ3B 2BOCB 4BQ8A 4X7TB 3D25A 5I1IH 2ADGA 3HI6H 1VADB 1FSKB 2CIIB 4KMLB 3X11B 3QFJE 4LRNH 1BQHG 1M6OA 3MO1B 5I8EA 1EEYB 4MJ6B 4OGAD 1YEHL 4UIKH 5IK3A 3SKOA 3M1BB 4RFOH 4L3CB 2YD9A 4XNXL 3FO9A 1KV3A 1CICD 2Y6SD 5FECA 2DI9A 5KVMC 2D7PA 2ARJQ 2V5SA 4D9QE 3AS0A 4K3JH 1NGWA 1R24B 1R5WB 3S98A 2XKNA 2WSKA 5MI0B 2OL3B 2QADD 1SEBB 3WKNA 4M1GL 4ELMF 2DD8H 5F9AC 3FOMA 1F11B 2CK2A 1KCKA 1EEQA 3LIZL 1CFBA 4LCIL 1UB6A 4PJIB 2C1PB 2EH8H 4JFXA 3AS2A 4NQEB 1CDUA 3D85D 5E08L 3MLSH 3D9AH 4KJPD 3WFZA 3X14B 4UUJA 3BKJH 1MCOL 4Y2DB 4GAJL 1SY6H 4R0LC 3KLHD 3CFCL 4HBCH 3QDJA 4GJTB 2WP3T 2CDFA 3OJ2C 4KUCF 1UJTA 1EUUA 3O8XB 4WFFE 3NFPA 2X6MA 3HZVA 4O58L 3H9SD 2AK4B 3SGEH 2ICWB 1CK0L 4F9LC 1IL1A 3TYGH 4OLUH 4M5YL 1RVFL 5EZOH 1NCUA 3BD3A 3IDNB 5T1LD 2IJ0C 2YPLD 1VA9A 3RPKA 4M3JA 5JQHC 4NZUL 5IP4A 3KYMA 5BQ7B 2CDGB 3QCTH 4NJAL 4WJ5B 2CJUH 2ZOLB 3BGAA 2CDEA 2WUBH 4ENEC 5FF6A 3MRKA 3MYZA 3IU4L 3MLUL 4F3FB 3MQIA 2Q8AH 4LCCA 4OGXH 5DHYA 2X42A 3C09B 5HVWA 1KFAL 3HI1B 4OZHE 4G6FD 2VLKB 3P77A 3V6ZB 4KWUA 4RIRA 3VMOA 5I30H 4IRJC 5E95B 1S7XB 4WU7A 3UJTH 3IB4A 2Z8VC 1JTTA 4NKQB 5EB9A 2FJGB 4OUOA 2JCCB 3H9YA 2C3HA 3GJFK 1N0LA 3FFCB 4Z9KB 1WAAF 4HIJB 5L8KB 3AY4A 5CEXA 4EDWL 1IGML 1DSFH 4PJDE 3C8KB 3GSNH 3NCBB 4HUMB 5GISH 4R96B 4GXVH 4YX2H 1MFBL 4BFBD 2BNQE 4GRWF 4UT7H 3FQTA 5HXMA 4JO2L 2VITB 3EYSL 3F6IA 3IDMB 3G6JF 1LO2L 4JVPA 5FGCB 3JBG7 4HGWA 2XNAA 4O4YL 4KK8D 3FOLA 3CFEA 2CH8A 4NPYA 1SBBA 2PYFA 4MQTB 2WBJB 2OX5A 2HJLB 2BCKA 3VXUD 2YXMA 2DWEA 3AXLB 5HHMB 3X3GH 1ES0A 2X70B 5F7NC 5BZDA 4LSTH 3T77B 1RK1B 4WWKA 3BE1H 3MXWH 2ORBH 5E8NA 4Y4KB 1MIML 5F1KC 2HKFH 1QHOA 2GSGB 1SJXA 2DQCH 4AT6A 5I0ZA 1HH9A 3MRDB 5DHXB 4P5KB 4K94H 2I5YL 2VH5L 1CF8L 2IQ9L 1IGTB 1NL0H 2WIIB 1G9EA 4UNTA 3V5HA 1CFQB 1ZS8A 1FLTX 4YFEA 5F7KC 4EVNB 1U8QB 4OCWL 2HYMA 5ESQB 1U93A 5IB2B 5BJTB 1F42A 1FFOA 5HDOA 4JCMA 4XCNB 4XMPL 3S34L 1JPST 1FV1A 3L6FB 1A9EB 3TV3L 4M3KB 2XQYK 5IM7A 2X7LA 1KBGL 1PFCA 1CZ8L 1F4XH 3MJ7A 2BNRD 1DBAH 3C60C 3NTCH 5SX4H 5IW6A 2XWBB 3EYOB 2DLGA 4JKLA 2EDKA 1B0GA 3BQUC 3DURA 4ZQKB 2XKUA 5HYQA 2V5MA 1BWWA 1JPGA 3PNWB 1NAML 1U36A 2VZ1A 2X89D 3FCTA 1AP2A 4G43B 1HILA 2QSCH 4RNRA 4XH2A 4ZSOA 1C8PA 1C7TA 1A6WL 5F6HJ 3NCJH 5MENA 5F7DB 5FHBH 3RL2B 5GRXG 3FT2A 3TC9A 3DGCR 3PHOB 4GBXD 5H2BA 5KVDL 3REVB 2X09A 3DVFA 4ZUTB 4L8DB 3MRLB 4WTXA 2IBGA 5DUBA 3PWNA 5F9OH 1NGXA 3LKNA 3QXVA 4JO3L 1MY5A 3KPQA 2G5RA 2NY3B 4G7YL 1CVRA 2V2TA 4WI2A 3O3DB 4XCCH 3VD4A 1YEEH 3EYQC 4M6MH 5EWIL 1RJZB 4L4VB 4TQEL 4OCRL 5ERWB 4EN3C 1MI5D 1WVZA 1T0MA 1IGIL 4S2SB 3HCVA 1KCRH 2VJXA 2CXGA 3VWKA 2HFGL 3ARFB 5CKAA 4M7LH 1T7XA 1HKFA 1Q9LA 3L9RB 3MV01 4M93B 3SKMA 4ZXBB 4G8GA 1P6FA 2FJHB 4XPGH 1UKQA 4DK6A 4PRAB 5DK2A 2VXSL 1UA6L 5FO9A 4M48H 3BD5A 1ITCA 1H5BB 2WINA 4FQHB 4YHYB 5LWYL 3N1QC 4NN6C 5DF0A 1CXEA 3OKKB 4AIXA 4J8RA 4XPHL 3OAUH 2DMKA 4Y5XB 4UINL 1CTNA 1TJHL 4XPBL 3TJEL 4KDTC 3BZ4B 4NT6B 3D6GA 3ARXA 3TO2A 1FVCA 1JFQL 3QHZL 5F7EH 4R0LA 4BH7A 1JPTH 3RPIA 2EYSA 2XT1B 5FOBA 3MJ9L 4HJJL 5EZJB 1KSRA 4OZIA 5EIQA 1JMXA 5IVOA 2F54D 4PLNC 3FQRA 3V7AG 5C0CB 4P23C 1MJ7L 4X0KB 4NCC1 3CFKB 3U9PL 3H9SE 2ICES 5ITFB 5D2NB 3WBDA 1V05A 4QXUH 3KYOA 2CRZA 3FZUC 3E8UL 5KSUA 4ZUSA 5GS0D 3C8DA 2X44D 2YPLE 1Q1JH 3MRMB 5HHNB 2PO6A 4FZEL 4F7CA 5HGBA 2AEPL 4HK0A 1UVQB 4I2XB 1YQVH 4WW1A 2FEDC 1KB5B 3N1MC 5DLML 2OTUB 4K2UL 4OZ4A 3KPMA 3P0VH 1PEZA 1HZHH 1TITA 3B5GA 1I7ZB 3WHE1 4GH7B 1D5ZA 4NFBA 3GSRA 3QUXA 4LIQH 3QFJA 4CN1A 3JTTA 1RI8A 2FYYB 4YC2C 5HHVH 4ZAKB 4W6YB 1WICA 1GCFA 1T1WB 1G7PB 1IC7H 4K7PX 4PB9L 1MQKH 4XMKH 1NDMA 4HS3A 1P4BL 2E9WA 4Q97A 3U7AA 1ZVYA 4LRIC 1BFOA 3BDXA 4YDKH 3F7QA 5EULV 3ROLA 4HKBB 4LVOC 4HZLA 4NM4L 4WCYL 2XOTA 1A1MA 5L88L 32C2B 2R23A 3GHBH 4I3SH 1GZPB 4UOW0 2X41A 1YMMD 5F9DC 4XXCC 2MTPA 2F5AH 2O5YH 4ISVA 3AGVA 4P4KC 5DJ8B 4PJ9D 3SDDA 2VDQH 4YDVB 2BXYA 3INUH 1JL8A 1QP1A 2H8PB 4IRJB 1LEKB 5TPWL 2X4UA 1LILA 4MLSA 1MHCB 4XNZC 1MH5B 5EFIB 4NQSA 4AG4L 1J1XL 3VXUE 2V5YA 1T22A 1HHKB 3OKNA 4HX1B 1JGEB 2BSTA 2XI9A 3D3VA 1UACH 3FFDA 1Y6NR 2VDMH 4KQ3H 4XXDB 5ETUB 3DV6A 2FL5B 5FO7B 3WV0A 4K71C 2EDDA 4O51A 5IEKB 4Y5YC 4FTVB 4D3CL 5J12C 2W65B 5HGDA 1X5KA 2QHLA 3IGAB 4FQXC 4XNYH 2H26B 1FHGA 2X5PA 3L3OB 2R9HC 1U3YA 1QHPA 1JGLL 2A9ML 1U8MA 5DJZA 4NRYA 5DJXA 1UENA 3SHSA 3IAQA 1K85A 2BY1A 3IKCB 4K7FB 5TF1H 3UYOD 2MQCA 5IMOA 2H2SD 3PWPA 5JHDD 3O2WH 3OKEB 3ZLQC 4HK3N 2BNRE 1MRCH 5EU3B 3NIGF 4MJID 4OZHA 4P57B 4U6TA 3L3GB 3KPNA 3FT4A 3LEYL 4Y2DD 3OXSB 5INDB 1WCQA 2B2XL 3VFWB 3C08L 3HTLX 4IDJL 5J57B 1A4KB 3ILPB 1W72A 1U6AL 1NBYA 4RCAA 1CR9H 2ICWI 4ELMB 3Q3GA 5E4EB 5ENWB 3O8XD 4FFVD 5B3JE 1FL5A 1U91B 4JFOA 1E4KA 1DDHA 2C3XA 5HY9A 1S7WA 2IANB 2N7BA 5GJTL 4WI6A 4YH6A 2FO1A 2W9DL 1JF6A 4UU9B 2VXVL 1LDSA 4MDIB 5IW1A 1M71B 5DTFB 3MFFA 1IGJB 2C3VA 3OKYA 4NKDB 3BQUB 4LVNC 2R1WA 3KPLA 2JIXA 5HYSA 1CFVH 1WBYA 4LAQH 4R7DA 4X5LA 3QIUA 4K3DH 4RMTA 1FZKB 2DICA 3KPOB 1ZLUK 3TIDA 5E94B 1MI5E 1HINH 3JWDC 5SV3A 4IOFC 4RISH 4EN3A 1ZSDB 3HI5H 4Z7UB 5EBMB 4QTHB 4F7EB 4MX7A 5BRZB 5CSZB 4GFTB 2VLKD 3FL7A 3O45A 1J12A 1G7HB 4XX1E 2XY2A 3OTTA 4HIEB 5LBSH 4ONHA 1T21A 3DVIA 2HKHH 3BKCH 4W4OC 2M26A 1ZANH 5F6HI 4FQCH 5FM5O 1GAFH 3FFCD 4YAQB 2OMNA 3CCHB 4PTTB 5FK9A 2AXFB 3I6GA 4GRLA 1P7KB 3RL1B 2DBJA 3K2UL 2VERN 4MMXC 4NP4H 4NYLB 4LLDA 2HRPH 3G6JA 4NNYA 1KEML 3WUZA 2ZG3A 4U1IB 1RFDL 2R0WL 1RSFA 5LXGL 3I85A 1JTOA 4HGKC 1HWGB 2D31B 3H42H 3UJJL 3V4VL 4KI1A 1LO0H 1M05B 3RWFA 3GIVA 1LQSR 1JNHA 1P5VA 2X40A 1OWRM 2F54E 2D7NA 5C08B 5D1QB 3QIWC 1F4YL 3MMEB 4PY8J 5SWZB 4YHNB 2YK1L 4KK6D 4QXTA 3ZKQD 2VUYA 4X5XB 1R0AL 4JY5L 5KANG 4K8RD 4Y4KD 4PS4L 4ETQA 3Q48A 4NBZB 2FLRT 2GCYA 3GNMH 4XBGB 3O6FC 5ILTL 4LSSH 2WWMC 4PJXB 1A2YA 2F8VA 2PYED 1ZLVK 2B1AL 5EU5B 5B21A 1VPOH 1C5CL 3O6LH 3ARWA 4C58B 4NRZA 4XHJD 1WWAX 4G8FA 1DLFH 3FTGA 2GI7A 3BIKA 1T0NA 3HR5A 4IHOA 4OAWB 1S78C 1VSCA 1KTKE 2W60A 1FORL 1TNNA 1OPGL 3RVTC 4P23B 4LDEB 2XTLA 3ZDYF 3DPBA 3OQ3B 3DIFA 1JF5A 4J4PD 3MLZH 2R29L 5AG9A 4OGZA 4XP9H 4H0GA 3ZTJG 4KQ4L 2LV4A 1CICA 3NZ8A 1G7JA 1KG0B 4XWOD 1RIHL 3V6FB 1XCTA 5JR1H 2R0LH 1RULH 3QUML 1AXSB 1KTLA 1Q0YL 4DCQA 2IH3A 2ZJSH 5EU6B 1HYSD 4JFFD 4BZ2L 1H8OA 4KROC 3MLRL 5KVFH 4QKXB 1MELA 4LSUL 4GKSA 5HI5D 3WN5A 5J4MA 1YMME 4NN7C 4FP8L 2VZUA 1HHHB 4NO0B 1L6XA 3S4SB 2E7HA 5C0RH 3FRPA 4AIZB 5FO8A 4PJ8D 5SWSD 1MCDA 1OTTC 1T04B 1MFCL 2C4FT 3G5YB 1GGIL 1DUZA 3D85A 4HKZA 1K5NB 4N8VB 1QRNA 2JTDA 4OCYH 3LRHA 1MWAA 3CVHA 1A7NL 2NY3D 1NAKH 4JO1L 4HXBH 3RWDA 5IBUB 4DZBB 3EYVB 4OJFH 4C54A 1D9KD 3ARVA 3FQNA 4DVRH 4L4VD 3TLRA 1SYSA 4GSDH 1AC6A 2HVJB 3N9GL 2VE6A 2QJDA 5IHZA 2BXZA 3SE8H 3H9SA 3VGHA 4RA3A 4R97B 3MNWA 5E8EA 5C0AD 3KVQA 1DP0A 1EHLH 2YKLL 2PF6A 4CMHC 1HXYA 1CLCA 3TBTA 3SOBH 5T1LA 5C6TL 1F3JB 2YPLA 1Z9SA 4FQXA 3QDHA 3CFDB 4P4KB 3TCLB 4UDUB 1MCRA 2BNUB 3LKPB 3QXDB 1AQKL 1CD1B 4XGZB 1MVUA 2YUZA 3G6AB 4O2CA 1MREL 1ODAA 4B0MM 5JO5B 2DI8A 1G6RB 1KPVA 1W72H 3UTZA 3RY4A 3VRIA 4MD4A 5ITBH 1Z5LA 4QXGH 4PJIE 1F13A 1E6OL 3BGMA 5J8OA 2D7TL 2VZTA 4ZYKB 4KJWC 3G9VA 4L9LC 4P2RB 5D7JD 3FO1B 5JHDE 3H3PL 1QSFD 4HMCA 5HD8C 3MODL 1A3QA 2NY1C 4MJIE 2BFVL 2FDBP 2FJFA 4GMTH 1MHHB 2X4QA 4H26A 3DUUB 4PJGF 2W9LA 2DLIA 2JJTC 2ADJB 5KZCB 1OAKL 5ICZB 3S35X 2NNAA 2VKXA 3IJSB 2Y72A 3QUKB 1R3HB 4Y5YB 5J12B 4X8JB 4NRXA 4OF0A 1QBML 4K3HA 5L6YL 4PGBA 1N3NB 4PJHE 2QQNL 1P2CB 5DJDB 5DQDH 5IT2H 1GHFH 4XNUH 1MLBB 4OT1H 1RZJL 1G7MA 5IF0A 3FB7A 5IHUL 4IMLA 5B4MD 3WD5L 4JM4H 4GXUM 1MPAL 1NANI 5JQ6L 1NLBL 3S4SG 1QYGL 4MHHG 1ZGLB 1WFNA 5I2IB 3MLYH 1T4KB 3U6RA 2DF3A 1AD0A 4N8VG 1NBZA 1ACYH 3SGJA 3VXUA 1N5YH 3NPZB 4ZAKD 1II4E 2VLKE 5IBUG 4BFIA 1JWMA 5C2BL 1I3UA 1M4KA 1TZGL 3L95B 2GW5A 2YPKB 5CHNA 2JCCE 3TVMC 2EEDA 3FFCE 3BDYL 1UM5L 4TSCH 1FFQA 1HSBB 2FIKB 1WIUA 5E00B 3IXAB 1PX4A 5JDSA 2L0DA 3TBSA 3WKMH 1BD2B 1RUAL 3O2VH 4D2NA 3QIBB 5GZNC 2EC9T 3N85H 3B8YA 5DK0A 5I1CH 4G6ML 4YHPA 4PGDB 4JHBA 4ZPVB 2UZIL 4KY1L 4LCYA 4U1LA 1G9NC 5JMOC 4FQ1H 3GSQB 4LLQA 4CN4A 5MEQA 2EH7L 4KJQD 4MJ4A 3EGSB 2Y07H 4W70A 5D7KD 4WHCA 5CINH 2BNRA 4J12A 5CJOL 4W6XB 3SGDH 2APFA 4WUKH 2Q6WB 4GAYA 2Y5EA 1U95A 2Q76B 1J0YA 3QIWA 1MFDL 1J8KA 2UYLA 4HS6A 5JIHA 3RVUD 1FP5A 4HWEL 5DMKB 4FRWA 5JHLL 2AXJA 1N5AB 5DGRA 1ZLSL 2R0KH 1FVEB 1I4FB 4GBXA 1TTGA 5FYJU 4JRWA 4ONFL 2PYEE 5J1TC 2D7OA 1MUJA 5DUPL 3MRCB 2HG5B 5K9JL 4GRMB 3FO0H 3NABH 1UB5A 5JXEC 3V52L 1FDLL 2IH1B 5AWNL 4LDOB 2WNGA 5I15L 3KPPB 4LCWB 2OM5A 3DVNA 4MD5A 4OQ1A 5J7CC 4I0PB 3HB3D 5I8OL 4KVNH 4OM0H 1KCVH 2Z91A 5FHAL 3DXAA 1UCBH 3BEWA 5KANI 1ONQB 1NMCC 3S96B 3V7AE 7CGTA 1AY1H 1UZ6F 5GXBB 5E5MB 1QLEL 3PP3H 4PY8I 1DVFB 3O6FB 4WO4C 4U6XA 5DDHB 3DOSA 2BVQA 3GSUB 1MWAH 5EA0L 3CVHH 1FFNB 3PHQA 4JFFE 4UB0L 3BXNB 3GJEB 2X4OA 1FPTL 3MACH 4KI5F 5DMGD 5ID1A 3EOBB 3VXOB 2RR3A 1T89A 5IB5B 3HZMB 5CAYB 3TT3L 2IAND 4P3DA 2EYTB 1WCBA 5FB8B 2E27L 5SWSE 1ZGLM 1FN4B 5E03A 4XAWH 5EUOB 1E0OB 3WYRA 2VIRA 4S1DC 4M6OH 1I1RA 3PE9A 5I1HH 4OFKA 5HI3D 3MV9D 4L1DA 4YDJA 1WTLA 2HT3D 2APTA 3KWWA 1I7UA 3W82A 5E24E 4L4VE 1IC5H 5GGSY 4JB9H 5AUMB 1WWCA 2R2HB 4YGVA 4F8TA 1CFSA 1K8IB 2VDNL 1AO7B 4DGIL 1AIFA 3BJLA 5BRZD 3RGVC 2R2EA 4KROB 3H3BC 5CILL 5C0AE 3I3BA 4OCXH 3KJ6L 1H3UA 3GEWB 2YD7A 2IADA 3HNVL 5T1KB 2V7HA 3E6FB 2NXZC 3ARBB 5GRVK 3U0TB 3VFVA 1ADQL 4HJ0C 5CJQH 1NCBH 3MRJB 3MREB 4Y4HC 5C70A 1IM3A 3B4NA 1QFWL 2X1QA 5GGTL 4EOWH 3TCXA 2GITA 1ITBB 1ZT7B 2FH8A 2DL9A 2Q86A 4X99B 3E0GA 1QSFE 1D6VL 2EKSA 4M1CD 3I6LE 4L5FL 3SEPA 2PETA 2EDOA 3U1SL 3HG1D 3K4ZA 2WLYA 3AS3A 2LFGA 2XXCB 1WT5C 1G9MC 3KLDA 2ENSA 5GZOD 5C08D 1RHHA 3IAPA 5D1QD 4J3SA 4WV1C 1MF2L 5D2NE 1N0XL 4LNRB 3QA3A 1NH6A 5KVEL 2NW3A 4UV7L 3LSOB 4K7PL 5I1JL 2X4TA 5EOQH 3JWDH 2IPUG 3SKJH 1JZ2A 1IGYA 3TGXA 4RGOL 1DANU 4NUGH 1KPUA 3EYUL 5FGRA 4FZ8L 3SDAB 2RIKA 4YEFA 1QVOA 2NY2C 4PJ9A 2F8OA 3KPRD 5HGGS 1FO0A 3ZSTA 4UV4L 1BAFH 3TN0D 4YQXH 3U0WH 5JTWA 3VFNB 2WM0A 4JDVB 3GSVB 1LP9F 5HTSA 1VFOA 4X5WA 5CWSB 2XQBH 4TSBH 1M7IB 2X4PA 2X4NB 1U8NB 3QULA 5GRUL 2NY6D 5GJSL 4GUPA 3K1DA 2LU4A 4DOHE 3HMXA 3M1BA 2CUMA 1T83A 3RVVC 4P3WA 1UWGH 3VG9C 4J3TA 5D1ZC 3LDBC 1Q0XL 2NX5B 3H6JA 3OX8A 4LGSB 2EDWA 1S3KL 4U6HB 1DEDA 1FGVH 2K3TA 3MFGB 4LASL 4KI5C 1A6TB 1R5WA 4IOSD 3NACH 2FBJL 3BZFA 5EU6D 3G08B 4MQSB 5DRZA 5IESL 2OR7A 4P2QB 3DETD 3PGFH 5J1AA 4JKPH 1EJOH 1DQML 5B38A 3BT2L 1LEIA 5A16B 4NO0D 4OTXH 1QKZL 3BRFA 4PGEA 1BVLB 1I9JH 5D7KE 5JHDA 3QPQC 4S0SD 3HZYB 3OZ9L 3PWUA 4MJIA 3LEVH 3DX7B 3RKPA 4XNMA 1TJIL 1CL7H 3QPXL 1YEFL 3TVMB 5EG6C 5AD0A 1U3ZA 4JHWL 2D4DA 3MA9L 3KPSD 4LARL 5KG9B 1JZ5A 4OLWL 3R1GL 1RURL 4PJHA 4M7ZB 3P2TA 2UUDH 4O2FA 3ARDB 3MLWH 4XC3H 4FTVE 4Y88A 5EBLA 1QRKA 3MRQA 1QEWB 5E9DB 4XVTL 5IROC 3U7WL 5GHWL 1X7QB 3UPAA 1QPPA 2LU3A 3FB6B 4WU5B 2XV6B 3UC0H 4GG6E 1XIWB 2VDOL 2ZUUA 4GAGH 4UBDD 1X5LA 5ESVB 2BSRA 1OTUD 2H6PB 3BP5B 4J3OC 5IBTH 2VN4A 4DGYH 2GYSA 2ZOLA 4KDWA 3HC0B 2YBRB 3VFOB 3T1WA 2HA1A 4P5TC 4N0CC 2IAMA 4MQ7B 3IRPX 5C7XL 4Q58C 4D0CA 4I3RH 5INCA 1HI6B 5CMAA 5FDWB 4KDVA 1ZT1B 2NY5H 2VLKA 4O2EB 2B0SH 4NCDA 2A38A 1OP5K 5IB4B 3UO1H 2Z35B 4G6AD 2DBLL 5BOZG 2FJGA 3L7FA 4NHCL 1MCJA 4HUUB 2JCCA 2P1YA 2HH0H 3PP4L 5E8PB 3UEZA 5DJAA 3T0EC 3RZWA 2MNUA 3L5XH 2YZ1A 4G9DB 4ODTL 2XZQL 2IANE 3QCUL 5MEOB 4NKIH 3W9EA 1S9WB 4OUUB 1ZEAH 2OXHA 4PJGB 3MV9E 1QBAA 1NMCB 1VGEH 3GFUA 5GS0H 3QDGB 1YNLH 1WEJL 2A74A 1HHGB 3BI9X 4JQIH 4WO4B 4YHKH 4DW2H 7FABH 1NEUA 4RGMC 5C86A 3ULUL 2DWDA 4Z7UE 5KW9L 5BRZE 3BX7C 3SQOL 3RGVA 3I2CH 5GGQH 5I66A 5T3ZL 3T77A 4EUPA 1QD0A 1WQVT 3OB8A 1FZOA 3NIDE 3D39B 1OAXL 2KZWA 1KT2B 4DVBB 5D72L 1A6AA 3BHBA 4OQTL 4OZFA 4P5KA 2J4WL 2PYEA 2AI0L 1OGTA 4KKCC 4XTRC 4HULB 3UTTB 4LU5H 2CR3A 4JPWL 1JGUL 3QIBD 3RNQA 4PRPB 1N2RB 3ALWA 2Z0BA 2W0PA 5ESAA 3OAYK 3WIFA 2AGJH 5KVGH 1DBBL 4P59H 3L6FA 1H3XA 1LO3H 2OR9L 4UQ2B 3PV6B 1BFVH 1CDCA 3MBED 2I9TB 1T20B 4A6YB 3H7BA 4RAVB 1MLCB 1J1OH 3HG1E 4J4PA 3KNBB 3WL9B 3RZCC 3D0VB 3NCEB 5IV2A 2NCMA 1KC5L 4ODWB 3OKMB 5KJRH 5HYJD 2EE9A 4WI3A 5C08E 1FO0H 5DD3H 5C07A 3GRWL 4WV1A 1FVDA 1BPVA 2BHUA 4JFFA 4KVCL 5I74C 1CFNB 4HXAH 3CH1B 3JWOH 3JV0A 4H5SB 4Y4HB 1Q9KB 5HDQH 3QWOB 2H3NB 4G9FB 5EZLA 1D7FA 1FFPB 3VXTB 4PJXE 2GUOA 3MOAH 1Q9OB 4Y1AB 5T3XD 4HQQH 4PJ8A 4IRSC 3HFMH 3EFFB 5SWSA 5H37H 1EZVY 3KPRE 1WV7T 1PX3A 5DI8A 1L7IH 2VLJB 3C9NA 4PTUA 3J8F7 2EH8L 1XH3A 1C12B 1ZHKB 1B4RA 4L4TB 1UXWB 4LSQL 3HS0B 4JG1L 3OF6D 3D9AL 4LCWD 1D9KA 2P24A 4I0PD 3MLXH 5D7LA 5CZXD 3GZKA 1N6QH 1BECA 1EVTC 4N0FA 2VWEE 3BPCB 3DUHA 4NIKB 3RAJL 4F7TA 4FS0A 3GO1H 3KAAA 2BVYA 2P5EB 4MA3B 3EOTH 4LOUD 4EQ3A 1TZHB 1G9NH 1OTSC 5C0AA 1KCSL 1ZLWH 1ERNA 3QO1B 2KBGA 3L9RA 4HUVB 2AXHA 1DVFD 5DJYB 1BGXL 5EU6E 4NNPH 5FA4A 3OHXA 4CU7A 4E42A 4OM1H 4WNQB 4CBPA 1NMBH 3QB7C 4D9LL 4Y5XA 1P9MC 3B6SA 1I7TA 3VH8B 4UTBL 3IFPB 3SDYL 1FNFA 1B90A 1JZ7A 5D7JA 3IETB 4POZD 1WBXB 4NO3B 1QSFA 1RZKL 2VC2L 1ZTXL 3TBYB 5KSAB 1V7NH 1ND0B 3WNMA 3SY0B 1MJUH 1KIRA 1I8LC 3LDBB 1BQUA 3WJJC 4KHTH 2P5WB 3W9DB 4QRPB 3HPLB 1QFUH 2HJKA 3KPSE 5EZJA 1LO4H 3HE6C 5A1AA 1AO7D 3FB8A 2QR0A 3BEVB 5IVXF 5TE6H 2NLJB 5C0IB 4U1SB 4X7FC 1SHMA 5D2NA 1AKJD 4MAYD 3JUZA 3MROA 5IMLB 3T3PF 3AMLA 3RUGF 4X6FB 3VFSA 1KNOA 3IJHB 5E6IC 3S35L 5GISL 3CC5B 4OFVA 4X4XA 3ARBD 4P5MA 2VZSA 1C1EH 4ZFOL 4ZS6C 3C6SA 3BKYH 2VQUA 3W2DL 2DQTH 3EJZD 4YHMH 3PIQB 3G6DL 2ED9A 3MRBA 4QYOB 4DGVH 5C1MB 2RCSL 2A73B 5AAWA 2HMID 2PXYC 5K59E 1VACB 3QXAB 4L3AA 1P4IH 1F90H 1K8DA 1IFHL 3PGCA 1BZ7B 2YMXH 5GPRA 1K2DA 2YC1B 3WO3B 2AEIT 2MPAH 4EIGB 4OKVB 1I7RB 2AABL 3QRGH 4WHYG 1HQ4A 3M8OH 1UM4H 1QQDB 4M1DH 4KKAC 1BBDL 3TA3D 4PJFF 2ATKA 1XF2B 3DO3A 4OLXL 3LPFA 1FAIL 3NIFE 1ZHNA 3B9EA 3MR9B 5KSBF 4HH9A 4P5TB 5CJXA 5HGHA 4WI7A 3SDAD 4JFQB 3ZDZF 3CU1A 4N5EC 4EUPH 25C8H 3TNNB 4GQ9L 4QHLA 4XRCB 4LQ1A 4HEME 1XCQB 2AEWA 3VH8G 1OP3K 3SO5A 1V5JA 4OZFH 2IG2L 1EXUB 2E7MA 2OQJA 5EFIA 3S3JA 4EJ1C 1HN1A 4Q6IA 2IFFH 1FNGB 1HQRB 2OR8A 3H3KA 1RZ8A 4HX1A 3MRPB 2N4IA 2FX7L 1LD9B 1PG7W 2FCBA 3W0WA 2QSCL 3GMLA 5TQ0H 3F65A 4XPFL 1I85A 1L0XA 2QV2A 2VISB 3O3UN 3QDMD 1TNMA 1FC1A 3EHBC 3ARYA 2E6QA 1NAMA 1GRWA 1OD9A 4X7SH 5IMMB 4GG6A 3MRGA 4MA8H 1JNLH 1LE9A 3CFBB 4P2QD 4TSAL 3VD7A 4XP4L 4OBSA 1M7XA 1MOEA 3PV7A 4LL9A 3V4UL 2R1XB 1I1AB 1U3HC 3L5HA 3TO4D 4JRYB 5HDLA 3U4EA 3NH7L 3K81A 2SEBB 4XNXH 4P57A 3RZCA 2VO5A 3FB5A 1AR1D 4HMDA 1ETZA 3RJQB 5HYJE 3MLVL 3UAJD 3MV8B 3ILPA 1OB1B 4DK3A 5JPMB 5IVNA 1FE8L 3DVGB 1NUDA 3DJ9A 5FAAA 5GIRA 2AS5M 3WS6C 3G04B 1T5WA 3V0WL 5ENWA 3BUTA 1BVZA 4Q9RL 5JOFA 4NO2B 3F8UB 4X4YA 3G9AB 1BZ9B 5IG7B 3ARDD 3LIZH 2DL2A 4LCIH 4Z95L 5T3XE 1YEDA 3LN9A 1OHQA 4QRRB 1XIWD 2DJSA 4G6JL 5E08H 2P45B 5A3ID 3DI2B 3MV9A 5IIEB 1MCOH 1MRFL 1UG9A 4GAJH 5IKCA 4JFDD 4KKLC 4LCWE 2ATPA 5DYOB 4Z77A 1BM3L 4RAUB 1OARL 2J5LC 5H94A 3QZWB 4S1RL 5CKGA 4PJ7B 4O9HL 1HKLL 1ZSDA 5BRZA 1B2WL 4O58H 4QO1A 5F7FA 4G7VL 5JUEL 4MWFB 1EMTL 3FKUS 4CKVX 1CI5A 1FZJA 3BH8A 2G9HA 4P3CH 4M5YH 3TZVC 1RVFH 2NZ9C 4Z7VF 2KQNA 4IRSB 1F2XK 3RNKA 3GBNH 4EKXA 4YAQA 4NZUH 4PG9A 3ROOA 1H3TA 3WNKA 1FRGH 4J6RL 1Q1JL 4RBPH 2CMRL 3MGTB 3WHE0 2NY4B 2C3GA 3QCVL 3B83A 3IU4H 3MLUH 4X6EB 1JGDA 1Y0LA 4C57C 3QO0B 3IU3A 5EUOE 5MEPB 2HT2C 4JREB 4OF3A 1KFAH 1NGZA 3ES6B 3HA0A 1YEKL 4FFYL 4F7MB 4P4RA 1F3RB 1I8LA 2F15A 3DBXA 3HG1A 4I3GA 3T0AA 3QDGD 3V8CA 2A0LC 1NEZA 3KYNA 3PL6D 2ZWLT 4MCYA 1EO7A 2ITCB 4NWTL 2EYRA 5C08A 1AO7E 1JN6B 1JPFB 3MMEA 4EDWH 1IGMH 2Q8BL 5JZ7D 5D6DC 5SV4A 2OI9B 5DHVB 1P7QA 1A7QL 1MFBH 3D39D 4KAQL 2BVOB 2E9BA 3IXTB 3PWVB 1X5FA 4JO2H 3EYSH 5EU5A 5CBAB 4F57H 1LO2H 2IALB 5TGBA 2ESVB 1WZLA 2GTWA 3KPRA 3RVXC 2CO6B 4O4YH 3TN0A 1FL3A 3N1GC 4PLOB 4B53A 2B8OT 1EFXB 3VI4F 3RWCB 3HE6B 2CD0A 4ZUUB 3OAZH 4MNGB 4ORGA 2HAZA 3V5KA 4OFIA 4X6CF 1MIMH 3OGCA 4K3EL 3G5ZB 4GKNB 4UT6L 3GMPB 3UBXA 5ADPH 3QZWG 1CD9B 1R3LB 4LLUB 2CKBL 1NGQL 1REIA 3VXSB 2I5YH 2VH5H 3EAKA 3TIEA 15C8L 3P9LB 3MGAA 1TVHB 4ZUWB 2IQ9H 4YBQD 4A2LA 1KLUB 5F96H 3UDWC 3OL2A 3QEUB 1RIVL 2HTLC 3FAXA 3CMOL 4G9FD 4OCWH 3GBLA 5CGYD 4Z76B 1T7ZA 4XMPH 3S34H 3STZB 4R2GC 3TV3H 4LHUG 4HDIA 3CMGA 1T04A 3WJLA 2ZCKL 1CZ8H 4XCEA 2VLJD 4HKJB 1PYWB 4BSWA 4POYA 1SM3H 4L4TD 2DI7A 3FO2B 1KCLA 4S1SL 2UWEF 1NAMH 2R4RL 3QUYC 4MJ5B 1A02N 3KPSA 3QQ9D 3VE0B 4LSVL 3SCMC 5IB3A 2HVJA 4QOKD 1A6WH 2BC4A 3L3JA 5JNYB 5DZLA 2MQ0A 3LH2L 43CAB 4N1CA 5BZWB 2R1YB 5IFJA 1HDMA 2QKIB 5FYLL 1QBLL 4LBEA 5KVDH 4YWGL 1NFDF 1OLZA 3SDCB 1P4LB 3ARQA 3NN8B 4GW5B 4X6DB 1F3JA 1RU9L 2GAZA 4TOYL 2BNUA 1YYML 4JO3H 5C9JA 4XGZA 3JSSA 4P2QE 4G7YH 3TWCL 2R8SL 1ACZA 5ACMA 4LPVA 2C26A 5EWIH 1U3HA 4HUKB 2P8MA 4TQEH 4OCRH 4WI8A 4PP1C 4TVPL 1EEZA 1IGIH 1TTUA 4CADA 5T5NF 5KSAD 5GGUA 1EUTA 1BLNB 1HHIA 1IAIL 1TPXC 1YEGL 4R6UA 3L3IB 2ADJA 3GM8A 4QRPD 1T03L 3SKUD 2EEBA 4D0BB 4APQC 2PW2B 2CR6A 1OW0A 1H8NA 3OKDA 3R4DA 2VXSH 3V9FA 4QY8A 1GGBL 1OT2A 1UA6H 3S8WA 4I0CC 4JDTL 2PTVA 4JN1L 5LWYH 3VMNA 1VFBB 3RUGA 5SWQA 3VXNB 5DFWH 5EU4B 4Z7NF 3GUTA 3IDYC 1GSMA 4XPHH 1MLBA 4Y5VA 5TH2A 3BYTA 2BVUA 4UINH 2AK1H 3QNZA 5DR5H 5AZEL 1TJHH 3MLTA 2MWCA 4XPBH 3TJEH 1DTUA 2PW1B 2F53B 3T4AB 4NP4L 2LTQC 2DQGL 4QWWD 2FB4L 3AREC 1JFQH 2JB5L 4NC1C 3QHZH 4JFDE 4KUZL 1S7QA 5LQBL 3GSXB 3RHWF 3TNMB 2MHAA 4HHAB 2OTWA 1FNLA 4MB3A 3ZDXF 4HJJH 4HJGB 3GI8L 5IVXB 4RFNC 5C0GA 3DSNA 1MJ7H 3ZE0E 1AXTL 4YE4L 2CIKA 4OCSL 4YNYA 2CLRB 3U9PH 5IFHL 1NCCL 4LPTA 3EYFB 1G0XA 3U36B 3RVWC 3BPLC 5H8DA 3E8UH 4PJFA 3W11D 3IS0X 1MJ8L 4FZEH 2AEPH 5D7SL 3RI5F 1HSBA 1KXVC 5DVNA 5GS1C 3EOYG 3QQNA 4M5ZL 4ODSL 5F88B 5KSBA 4PV8A 5IFAL 3ULUD 3IXAA 5DLMH 1AHWB 3G5XB 4K2UH 3QIBA 2XTJC 1NCNA 4HWZB 4JRXD 1P53A 5F89A 3RWHB 5I75C 3O4LD 2YD4A 2P8LB 1YYLL 3GSQA 1MAKA 1JRHL 3MYJB 5C0FB 3MBEA 4PB9H 4DQOL 1GL4B 3I50L 1E4XL 2XWJB 5I1KL 3KLSA 3QDGE 1P4BH 1J8HB 3WE6A 1ED3A 4OI7A 3HHRB 3D69B 4XVUC 5DQJB 3TZVB 2Q6WA 1NJ9B 5HHXH 5HYJA 4EXKA 3EBAA 5L8JB 4YPGA 5C0ND 4NM4H 4WCYH 5D9SB 5BS0D 2ADIB 4UOJA 1W0WB 5L88H 5DMKA 1AGFB 3FHQA 2MCPL 1QR1B 4LPWA 3D39E 4PV9A 1IQWL 3AB0B 4JZOB 2FSEB 4G8IA 5KVFL 4AM0B 5EOTB 1O0VA 4QHNB 2VABA 2HG5A 3QUMA 1A0QL 3REWB 3ZMRA 1MIEL 5TPWH 2YSSB 1I3RA 5CP7B 3F7YB 2O5ZL 4OCYL 4AG4H 2YWYA 3GI9L 3OF6A 1J1XH 4Z7WF 2Z93B 1I1AD 2A6KA 2XA8L 1MCPL 2I9LB 2D0GA 4YO0A 4HIXH 3E3QC 4HFWB 4LCUA 3FRUB 1DVFA 1UWXH 1AQDA 3MV8D 1S7SB 2M8XA 2DTSA 1FFNA 5F6IC 3UDWA 1JGLH 3QWRD 2A9MH 5D70L 4G9FE 2DQEL 2Y5TA 3O3EB 1XGQB 3DLQR 3GMRA 2EYTA 4P46D 3UX9B 1GPOL 4YK4B 5ID0B 1W72L 2ID5A 1J18A 1FN4A 5DO2D 5IWLA 1YJDL 3CUPA 2VLJE 3D2UB 4KTEL 5DJ6A 1ZA3A 5J6GA 3LEYH 1AGBB 3MZGB 3C5JA 3O11B 4L4TE 5DSCB 2B2XH 1OAUH 1J05B 3C08H 4Y16B 1HNFA 1U6AH 5JW5B 2V2WB 3KS0J 5ELIA 3ZTNL 4N9GB 4YXLL 3V7MA 1K8IA 4QOKE 4F37K 2K9UA 1VGKA 3DX8B 4TN9A 3LKRB 3JUYA 4XI5D 3GMOA 4AZ8A 5BXFB 4LLMA 5T1MB 1AKJA 3F7VA 3QH3B 4MAYA 1OL0A 1I1FB 4HLJA 2C9AA 2F74A 5GJTH 4N90E 5D96C 3RDTD 4OCLC 2W9DH 3ARSA 4XNUL 3JTSB 3E6FA 3ARBA 4JFEB 3BESR 3MREA 5ISZB 2VLLA 1IC4H 2JJSA 4LHUD 3KDMA 4TNVF 4WHTB 2NY4D 5TDNA 2X1XR 4HK3J 1HOCB 4F8QA 3QUYB 4NJ9L 3JVGA 5HDBF 1A5FL 3VG0L 3WFDL 3SCMB 4HV8B 2XN9D 1NDGB 5IGXL 1ORQB 3KG5A 4Z7VB 3ULVL 2DMBA 4XVJL 4QRPE 2BVPB 3V95A 1H0DB 3U83A 3TJHD 4GKOA 3TFKC 4HUXA 4KK9D 3TA3A 2OSLB 4H1LB 5GSRA 4LNRA 3P30L 3C2SA 1FL6B 2D4FA 3K2UH 4MSWA 5F9WC 2V5RA 3MCLL 3WKML 3LPGA 3Q6FB 1X5HA 3OR6A 1OY3B 1KEMH 3VGBA 5BCAA 5I1CL 4JJ5B 3SDAA 2XG4A 3LEXB 1HHJB 4F33A 1RFDH 1D6EB 2R0WH 3DUSB 5LXGH 2ESVD 3MRRA 3UZVB 2FRGP 2RBLA 3UJJH 1JUFA 3V4VH 3AREA 1D5BA 2CLZA 2X1OA 1TPXB 3VFNA 3L3HB 4R4NC 2FGWL 3QQ3B 1S9VB 5GRVL 4APQB 2YUWA 5D1XD 1C5BL 4V1DD 4B7IA 1F4YH 4X6CA 2YK1H 1U8NA 4EXPX 5DRXA 4ZFFA 4Z78A 3B3IA 4JY5H 4RZCB 1R0AH 1NFKA 1HSAA 4PS4H 3D1MC 3T8XB 3KXFB 2DJ4A 5ILTH 1YN7A 4BH8B 2B1AH 1C5CH 3QDMA 4J3VA 3EO0B 3ULUE 5MERB 2V2XB 4P2OC 2HN7B 1O7VA 2ARJB 4JRXE 3SJVA 1X44A 2VSDA 5HGAA 1WLHA 4PLJD 3O4LE 3WCYA 1T1YB 1FORH 1OPGH 3TO4A 1Q72L 1AGDA 1BVLA 5CBEA 1WBZB 2P47B 4YUEL 2R29H 3MNVB 1Y6KR 4NQCB 3NMEA 1QBBA 3AU1B 3LKSA 5DVKA 4KQ4H 4PJBB 4LPCA 5D5MF 1H9VA 3BUYA 3BZEB 3IT8D 3MGOA 4GG8B 5JXAH 4K9EL 1X4YA 3QUMH 3S97C 4XBPA 1Q0YH 2JJVA 4Y4FD 3FQUA 4NO5A 4R4BA 1X6LA 5GS1B 2JE8A 2Z31C 4BZ2H 1FJ1A 3MV11 3W5NA 3I3EA 3MLRH 2R2CA 2YEZB 4LSUH 1NFDA 4PRDB 3WDHA 4ZNCD 5CJ5A 4JHZA 4FP8H 2E3VA 4K07A 4HS8L 2VTFA 4OIBA 4OCMC 3SDCD 3FQXA 4H1LG 2ZSWA 1MFCH 1GGIH 5DT1L 4XT1C 4UQ3A 5DEGB 4JO1H 2UWEB 1LWRA 2NY0C 4L3EB 1CE6A 5CEZL 4JFDA 5C71A 3QNXA 4PRHB 3U4AA 5D7IF 2DN7A 2APBA 4JAMA 1U58B 1JYNA 2XACC 3N9GH 4M61B 1OGAD 1TCRA 4JY6B 4JB9L 4NGHL 2DDQL 4F15C 1UYWL 2HTKD 3KYKH 1XZ0B 5CSBA 3MV8E 2YKLH 2Z35A 3B9KB 1C16B 5C6TH 3MA7A 4AJ0A 2OJEB 3SDXB 5I16B 2GT9A 1AQKH 1FCCA 2EC8A 1MREH 1ZK9A 3A0OA 1R5IA 3MUZ1 2ZPKL 4G9DA 2IBBA 1LK3L 3L3KA 4CW1A 2E7LC 3RIFF 5D93C 1E6OH 1XR9A 4QRTB 2D7TH 1KJ2B 1Y18A 5DC9B 3S5LA 2FNBA 4QHMB 1Y6MR 1PBYA 1S9WA 3FQWA 3H3PH 2FBOJ 4FQJL 4EOWL 2BFVH 1R5VB 4LEOB 1RZ7L 2W07A 5EN2A 4ACPA 1VCAA 1ADQA 3O9WC 4C56B 1VKXB 4X8XA 1VERA 5FKPA 1IRAY 1JYWA 3PL6A 1JHKL 5KS9B 5L2KB 5FGBC 4Q0XL 4PJ7E 2LQRA 5GGTA 5L6YH 5M95B 3CXDH 3P4MB 1CQKA 2QQNH 1W0VB 3VD5A 2NXYD 4WDIB 3UTPE 4YBHA 4OFDA 1RZJH 1U2CA 2GY7B 2FZ3A 4DVBA 2YS4A 2QLVB 5IHUH 3VRLE 3OJVC 1Q9WB 3WD5H 5D2LF 1X9QA 1XR8A 1BOYA 3VCLB 4ORZC 5LVEA 2W38A 5FFLA 5JQ6H 4M9OA 1NLBH 3P73A 4QRQB 5E70A 3VGEA 1IGCL 2Y06H 1U8IB 1N6UA 1QYGH 3QNYA 3LS5L 5CD5C 4U1HA 4X98B 5ADOL 1CDJA 1V3KA 3GMQB 2VXTL 3V79C 1KENL 3PV6A 1AXIB 5TDOB 2XN9E 1G1YA 3B5HA 4MS8C 4NOFA 1S7VA 3IDIB 1MLCA 4C4KO 1TZGH 5C2BH 1BOGB 1KTDB 3VXRD 3LQZB 3T1FB 1J8HD 1X5ZA 3F5WA 4JANB 1NKRA 4M43L 4PREB 4JQXC 1XGPB 3WEXA 3VGGA 3DMMB 1UM5H 2BVTA 3EDFA 1QSZA 5CIPA 2VZ3A 3HE7D 1RUAH 5LAXB 3T0DA 5F1OB 1CXIA 3OB0K 2IPUK 3BWAB 4G6MH 4H5SA 2H41A 3F12A 3L5WB 9CGTA 4LPYA 2R15A 2UZIH 4LLWB 4KY1H 2V9QA 3STBA 2G5BB 2FWOA 2EH7H 4YXHL 3QRFM 1EJOL 3C5SB 4QRUB 2ESVE 4OI8A 1DFBL 1NC4B 1SEQL 3B9VA 4ODVL 5JORB 3MRIB 5CJOH 1JPSL 5I19L 4Z7WA 3VDBA 1ZHKA 3VI3F 2V17L 3TF7C 3HS0A 1KN4L 5EUKB 1F2QA 3DX6A 4V1DE 4KKNA 4RFEB 5JMRA 3DX9A 1MFDH 3RWEB 4G6KL 4G8EB 4J1UA 4PGCA 1IE5A 5JPNA 4QOKA 3SO3C 2MQ3A 1PZ5B 4CNIB 4HWEH 5JHLH 2B4CL 1ZLSH 3GK8L 1RZKC 2EDEA 5DUML 4UMGA 4WEBL 4WUUA 1WFTA 4ONFH 4NQVB 4XWGL 4NFCA 4MNQB 1KULA 4JFYB 3IF1B 5DUPH 5K9JH 1CD8A 1QO3A 4I4WA 1IAMA 4P2OA 3CFJB 4IRZL 3U2SB 1D5IL 4OD2A 3PHSA 1IMHC 3V52H 1CG9B 3UC0L 1FDLH 5AWNH 1ZHLB 5I15H 4IOIB 3EUUA 5I76A 5IBTL 2AJVL 3BWUC 4AY0A 3U0PB 5FHAH 1UEMA 4PRID 4NUJA 1G7LB 3VMPA 4CDHA 1JIBA 4FQQB 4EI5C 3TBWB 4OSUL 1E6JL 2V7NA 2WK2A 5EU7E 3VFTB 1QLEH 2HWZL 1A4JA 2F9BT 4Y16D 3K80A 4X6BA 1N8ZA 1N6VA 5EA0H 3STLA 3ARGC 4MXVE 4PRNB 1FPTH 1NCAL 2NLJA 4FMFA 3QUZC 4TVPD 4OIIL 4GW1B 4PD4J 3TT3H 3D0LA 1K4DB 5I8KL 1SJHB 2NW2B 1BBJB 2E27H 3B2UC 4X6DE 1B0RA 3FONB 4WTZG 4PJEF 4LKCB 3OXRA 3VXMA 4JFED 1QFWM 3GSOB 1NFIB 1CFTB 4U6YA 4NQTA 4ODXB 5HPMB 2ZKHL 4CAGA 1G7QB 2BRQA 5ISZD 3PABA 4FXKA 5KOMC 4N5UA 1ZEAL 4JLRB 5GRZA 4K94C 3HUJB 1X5YA 4QYOA 4E5XA 1M7DA 3R06B 5HI4C 1WC7A 3O0RL 3PGDB 5L2JB 4DGIH 1OGAE 5GQBA 5F3BB 4YIQB 1R3JA 4E41A 5CILH 1BMGA 1KLFA 5J9PB 5BO1L 5IJVA 1DUYB 5GGQL 3KJ6H 5EO9A 5CJBA 4UIMB 2BY0A 2JB6B 4KKBC 3HNVH 4MQXD 1G7IB 4N8CL 4ZG1A 1ADQH 1JHTB 3VJ6A 5IW3A 4KV5F 4NOBA 5DFVC 4ZTOL 2X9XA 1QFWH 2NY0B 1RHFA 2E7LA 4JRXA 3BSZL 5GGTH 1PAMA 2W0LA 2J1KA 3O4LA 3DO7B 2F53E 1WITA 5MP6L 3EOAB 3KLAB 4L5FH 2D7QA 5C0DB 2YWZA 3U1SH 5F3HB 1HYRC 3MJ8A 3UJIL 2VOTA 5KOVC 4FG6D 4RDQG 5DD6B 2AJZB 4YHZH 2OXGA 4QGYA 1Z6JT 1S9XA 2AKRB 1IKNA 5BV7L 5EPMB 5GGRA 1T2QH 1GVIA 2V6HA 1J1OL 4YHIA 1YPZE 1XGUB 3GJFA 5FV1L 2HLAA 5T33L 1FNGA 4UTAL 5IMKB 35C8L 1D5MB 1MF2H 5BS0A 1N0XH 2W91A 3BW9A 4RMVA 4JZNB 2Q7NA 5DD3L 4UV7H 2XPGB 1RJLA 4K7PH 3GSWA 4PJ5A 5I1JH 3O3BB 5FUCE 3VWJB 1KPRA 3KXFD 1MEXL 3EYUH 4FZ8H 1GZQB 5DJCA 2QQQA 1FLRL 2VISA 3SE3C 1SYVB 1RJYB 2R2BA 5DZNA 3BN9D 1YMHA 4HC1A 3NFNA 5IMMA 3GRWA 3HMXL 1ZLWK 3O9WB 1ZVHA 4PJCB 5I1DA 1VDGA 5CIPH 3X12B 4R8WL 5EC2B 2X4RA 3U9UB 4GKZA 5GRUH 1IEAB 5GJSH 2O61A 1FG2B 2WWKO 1ZT4B 1MRDL 2AV1A 1CLYL 1TZIB 3VXRE 4NQCD 2VB5A 1J8HE 4N8PA 1Q0XH 1JWUB 3EOTL 1S3KH 3MV8A 1JHLH 3C2AL 4LASH 5JPMA 2VMFA 4F80A 4L8CA 3LY6A 1FBIL 3GBML 2J8UE 1FH5L 3RX8A 1IM9D 4JR9L 1WWWX 3QWRA 5E5UB 5IESH 2FX8L 3QI9D 1E27B 4N0UB 4PG2A 1DQMH 3BT2H 4P46A 4IIQA 1QKZH 3UYPA 2DLEA 2XA3A 4G42A 2J8OA 1X5JA 2GFBB 2GSIA 3CDCA 3L7EB 3MBXL 1Q38A 2OZ4A 2AXGA 3VRJB 3OZ9H 1MHEB 1QFHA 1CDYA 5JDJA 5D5MB 3MRFB 4WW2F 3QQ4A 5I8CA 4NDMB 5IIEA 5K9KA 5HPOA 1TJIH 3QPXH 4XNQB 5D7IA 1YEFH 3D18A 5K93A 2UV3A 1MJUL 4PRHD 4JHWH 3MA9H 4ESKA 4LARH 4XVSL 1GOHA 3DTXA 3R1GH 4R4FL 2BSSA 5EBWB 4ERSL 3PQYB 2APVA 4JM2D 3IDJA 1I8IA 4WY7L 4NKMB 1T1ZB 3L1OL 3AY4C 4HUWA 3CDGA 1J11A 3O4OC 4HIIA 4NSKB 3RKDC 4BKLA 5TE6L 2KQMA 3QG6A 3RDTA 3MUGB 2HJFA 3B9KD 4M9PA 4XVTH 3U7WH 4F2MA 5GHWH 1PQZB 5M7QA 1TXKA 2GK0A 3ZE1E 3O3AA 2AJ3A 1GC1L 1ORSA 1DQQA 3DROA 2L7UA 1Z9MA 5GS3A 4YZFE 1BX2A 2C1OA 4LHUA 1B9ZA 4X6EA 4RGNC 3QO0A 3BKYL 2H2PC 3LRSB 3BP4B 1DL7L 4PRIE 5C7XH 4TNWF 4DGVL 1P5UA 5ICYB 4JN2B 2XN9A 4JFPB 4LGRB 3ULSB 4EI5A 1N4XL 3EO9H 4C56D 4OZIF 2VXUH 4ZFOA 5DRNA 2DBLH 4WWKC 4NHCH 1RZFL 4PRBB 4ZPTA 3PP4H 3V5DB 4Z7OF 2EXYC 4ZNEE 2VDPL 2QHRH 1VESA 4AIOA 1L7TL 2OP4H 3QBTB 1DN0B 4TVPE 4UILL 3P9MA 3DSFL 4M1DL 1EK3A 4ODTH 2XZQH 3QCUH 5ACZB 5K9OB 3DRTB 3DYOA 2A83A 4DWHA 4JY4A 4QNPE 1R3KA 1XMWA 1Z9LA 3ULVD 3X13B 4JVUA 4J2XA 4JFEE 3IJYA 5GSVA 3GSNB 4M7JL 2IEPA 1A64A 5ISZE 3CZJA 4U3XA 1S7RB 3S3SA 4D94A 2D7MA 3CK0L 4K8RL 4HH8A 5IUSA 1WEJH 4MDJB 1N59A 1DZBA 4L8BB 3WLBA 1IZJA 4NNXB 1DEEB 3ULUH 5A2IH 2X10A 5D1XA 4V1DA 5KW9H 1YY8B 3SQOH 2ZSVB 3ARGB 2EE2A 1NBQA 5T3ZH 1IAOB 5EBGA 3JV6B 3QUZB 2PTTA 3EDKA 4E9LA 3NFSL 4GKNA 3GMPA 1YDPA 3TBVB 1OAXH 1CIUA 5D72H 1F6AB 5D2LB 3OKLA 2J4WH 4HWUA 3DMMD 4XCYB 5IVZA 2AI0H 1YUHA 4BELD 3P9LA 4YFLF 4ZUWA 1LHZA 2M2DA 3O41A 1KLUA 4JPWH 1IEBB 4JGMA 1ZWIA 5EO1B 2FATL 1JGUH 1MSPA 3T65A 2Z9TA 3GJFH 2H32A 5K33A 4X7SL 4XPTL 5J06A 3SKNB 2F58L 4MA1C 1DBBH 1FIEA 4QGTA 5FCSH 3BVNB 2OR9H 1LDPL 1TQCB 4WW2C 1OCWL 3MOQA 1NC4D 1PYWA 5B3NA 3ECBA 1BVKA 5KN5A 5F7LB 1KC5H 2IPKA 1QLFB 3W81A 2MCG1 2CKNA 4RRPG 3H9HB 3VWKC 4HC1H 1EVUA 3LD8C 2IMNA 3GRWH 3U46A 1JP5A 1XF3B 3P4OA 4I5BA 4Y4FA 3TFKD 3IRZA 2W0FB 1T66C 2BY3A 1IQDB 4JZJC 3UTSB 4KVCH 4CVXA 1PEWA 5IB1A 3RWJA 2IQAA 3KXFE 3VGFA 1JF1A 1U8KA 3QEHB 5I9QC 2HVKB 2O26U 1DBKL 4HLZH 3WHXA 5B8CA 1C08A 2I60L 1P4LA 3SE3A 3TM6A 4FA8A 3D25B 2ADGB 3EFDL 3V6OC 5E7FA 4HFUL 1M6OB 3MNZA 3HPJB 2VRAA 3AFLA 3IS1X 5I8EB 3IDGA 4KXZI 4KTDH 4LSQH 3F58L 4JG1H 3SKOB 5IK3B 5FXCH 3G5VA 3RTQD 3FO9B 3RAJH 2E6JA 1CTOA 4OZHF 5FECB 1OGAA 3M45A 1HK6A 4NQCE 3CH8A 1NGWB 4PJBE 3HAEG 2XKNB 1FZMA 1KCSH 4ZOCA 2UY7A 3L3IA 1QLRA 2OZ4H 1A1NA 1PKQA 3RJDA 2Y36L 5CEZD 3FOMB 1BGXH 4Q9QH 3VXPA 4PJDF 3EJYD 4P3CL 1UB6B 1U8JA 3CSYB 2PO6C 3GBNL 4JFXB 4FQ2L 5EU4A 3ZKMD 1FRGL 4D9LH 4KK5D 3I02A 4PJEA 4GOSA 4UTBH 3SDYH 3QJHA 4UUJB 4FXGA 4ZUVA 4I13B