1NGYB

Chimeric mature fab 7g12-apo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
b'QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mature Metal Chelatase Catalytic Antibody, Light chain
publication title Structural evidence for substrate strain in antibody catalysis
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 41
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2002-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngyB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngyB02
4K3DH 4U1JB 4YC2B 3RWFB 2OM5A 1YYLH 5DEFA 3EOBB 4EOWH 1N4XH 3DMMD 2C9AA 3PV7A 1TTFA 4PGBB 2AS5M 5J13C 4EQ2A 1FO0A 3S34H 3TCXA 4H26B 1NAMB 5F7LB 5JORA 2L7UA 5F89A 1OARH 3SGEI 3G6JF 1RUQH 4NP4L 1EVTC 3ZYOA 5F7UA 3EYVA 4PTTB 4TRPH 3G5YB 3L6FB 3FRPG 2VZUA 5CLTA 4MJ5A 5C08B 1BZQK 5TGBB 2GT9B 3MV9B 2VN4A 3CLFH 3KG5A 4KI5F 4PRIB 1X7QB 5D70L 5DFVC 5L8KB 4HIIB 3FB7B 3K2UL 2XQBH 3OJDA 2ICWB 3HC3H 5D5ME 4U49A 4RWYL 1K6QH 3D3VD 2JB5L 2ZUXA 1NGYB 1F90H 1I9RL 3GNMH 1YEKL 1HI6A 4JDVA 2DQJL 4M1CD 3B2UD 4FXKB 3ZKQD 4L4TE 1MFEH 4PG9A 2LU3A 2NY1B 2ZUSA 3D2UA 5DD3H 4Z7OE 1EO8L 5CD5D 3U1SH 1HK6A 4HGKC 3QRGH 4TNWF 1CXHA 1KBGH 2AERT 3F6LA 5I1CL 3QPXH 5DMKB 2E7BA 2JLLA 5B8CC 3A6CH 2GAZA 2EDEA 4HULB 5D72H 1A5FH 1OLZA 3MJ9L 4MA3A 1W72B 5CBEB 1DLHA 2NY2D 1NGQL 1I9JH 1BBJA 1H0DB 4HIHB 5D1XC 2ENYA 1J0ZA 5IWLA 1KFAH 4RMWA 5D2LB 3ARGA 4JZJA 3KPNB 3ROLB 2VDML 3P0VH 5I9QC 3G5ZA 3HI1A 4OLYL 4OF0A 3AM8C 3L5WB 4KJYA 1JNJA 5ESQA 5SV4A 3HCVA 1VDGA 3IAGC 1WFNA 4TULL 4OIIH 3JV0A 5F9WC 3CPLA 5D7IF 2FH8A 3HKFA 1WZ1L 4IMKC 4JO3L 1ADQL 4RMSA 1HH6B 5DF0A 2VITB 1HWGB 1CD1A 4XVTL 4MJIA 4AEIH 1U3HC 2G9HB 4XMKH 4JANB 4JQXC 3RHWK 4HAFA 3TBVB 1YYML 4K94C 4HWZA 1N7ML 2IANE 3TN0A 3S98A 1QKZL 5K59E 5ABDE 1BAFL 4HXBH 3S6CA 1QFPA 5HI3C 1A3RL 1VFAB 2APWA 4WU7B 4HZLB 2AABH 3SE4C 4Z78B 4R4FL 4A6YL 4KJWC 3RWEB 1A6PA 5BOPA 1UM6L 3TBWB 4AEHH 4YDKL 4BZYA 2ADGB 4LPVA 4JRYE 4QOKE 3RIFF 4R96A 4N1CA 4G8GB 3U7WL 1H3XA 2WIIA 1GL4B 4KKLD 1R3HA 2IQAB 3TZVB 2DD8H 4YFDB 4GG6E 5L7XH 1AFVH 3Q6FA 1L7TH 1IGFL 4QWWC 1BFSA 3LN4A 1OSPH 1HE7A 3CCHB 2CKNA 5BW7A 3DURA 5JOPE 2NX5A 2YMXH 4PJBA 3HB3C 4CU8A 3AAZB 2AEPH 5C09A 4OZHE 4WO4B 3RWDB 1GGBH 3LZFL 4R90L 2XQBL 2YXFA 3QIWD 4S1RL 5H35B 1KEML 3MLXH 4U33A 3IYLW 1OAKL 4M1DH 4QHLA 1FGVH 1CE1L 4JVPA 3MGTA 3MLTA 2P5EB 4L1HA 4P57A 5DHVA 2OYPA 1HN1A 2WV3A 4OBRA 3MR9A 4LOUC 5BZWB 4APQA 3QUYD 3EJZD 4EZMA 4NO5B 3PL6C 4WHCA 3IDIB 3QG6B 3SDXE 4BSVA 1B0RA 2A9MH 3QUXB 3QRGL 5SWZD 4CDHA 5E00A 5F7DA 4E5XB 4DN3H 4NJ9H 4M93C 1MRFL 5HHPA 4OCRH 4WI6A 3QH3B 5A3IC 4L4VB 1DBBL 1S3KH 4YO0B 1A5FL 1RULH 2YS4A 3NFNA 4FNLL 4G9FB 1O5DT 4LQFL 5D1ZC 1NLDH 2VXSL 1OOAA 3VXRB 2WUCH 4U1SB 1YY9C 2DQGL 2N7BA 1BM3L 1NFIB 2RGSA 2ZUUA 5I17B 1MCRA 4PRBB 4CW1A 4B5EA 4ZYKB 3EYQD 4P9HH 2GITA 1MCHA 4J3SA 4LSSH 2GKIA 4YLQT 2M1KA 1J8KA 5K33A 2A1WH 3BZDA 1I8LA 2C5DC 4JFEB 3DYOA 3PWPE 4LLQA 3LB6D 1CFNB 3LEYH 3OL2A 1WBZA 3RNKA 4YNYB 3INUH 2J8OA 1W2KT 5SWQA 2XKUA 4LP4A 1JTPA 2Q86A 4YXKH 4QHUB 2WK2A 1P7QA 3HG1A 4H88H 3BGFC 3HAEG 5E4EB 2XN9D 3VG0L 4PUBL 4ZMAT 2GQHA 4FTVB 3PQYD 5ANMA 1RJLB 2V2WB 2A6KA 2G5RA 4QRRA 1NMCC 3EDEA 1KF9B 4WUUD 1ETZB 2AJYL 1ZLSL 3IU3B 4XC1L 3VRJB 2EH7L 4KTYA 3C2AL 1NEZG 5E9DA 4FXLA 1CVSC 1J05B 4WDIA 3HZVB 2EDNA 2F53A 4AEHL 4Z7NF 3U48A 2XWTB 2YUVA 5JPNB 4KTEH 4TUOB 4DN4H 3PABB 1CYGA 2X42A 1OAXH 1QACA 5KSBF 3EJYC 3GMMA 1C16B 5DD6B 3IJHB 5LGJB 1WIOA 3PE9A 2GJJA 3QUZC 1S7TB 2H9GA 3ARRA 4K3EH 4R9HA 3RWHB 4PLNC 5MP6H 4X7FC 4TSAH 5IESL 1QFWH 4HUKB 3DGGA 2OR8A 1RZ7L 1GGBL 1WT5A 3B9KA 3DVIA 1J86A 1DUZA 2ESVB 2HFEB 2WINA 3C60A 3GJFH 2VLRE 1OTTC 4NDMB 1EGJA 1DUYA 2VXUH 4PJHB 4OM1L 2JIXA 4OZFA 3RZCB 1ERNA 2Q87A 4ETYA 5HYQB 1ZOXA 3JWDC 1X6NA 5FV1L 3PDOB 1HHJA 3MUY1 5FM8A 4LSDA 1OGAD 4X4YB 3IFNL 5E8PB 3MOBL 1CE6A 4S11A 2R0KH 1NLDL 1T7WA 2WUCL 1Q1JH 1ZLUK 1KB5H 3FTGB 1DCLA 3DBXA 1JMZA 1FFPA 1WCQA 3W9EA 4E42B 2EIEA 3RPIB 1ZHKB 1EEZB 1QFWM 5C0BE 2GJ6B 4K7FB 4CN1A 1P4IL 1VGEH 2B5IB 3CFKA 4OD2A 4KZEL 4ODUB 1PY9A 1R3IH 2IFFH 5D8JL 3S96B 4L8SC 5JLZB 4LCUA 5JNYB 1JPFB 3RVXD 3VFPA 1FLRH 3ZZ1A 5LXGH 1EEUA 4NKIH 1BGXH 3OKLB 3RNQB 3TBYA 1U8IB 3JV6B 2V7HA 2YEZA 3GSRA 2PXYA 1I7ZB 1A6ZA 5F97E 2PYFA 4FA8A 3BUYA 1LO5B 4UV4H 3Q48A 4ZOCA 5CIPH 3C5ZD 3MODL 2ZG2A 3QQ9C 2OQJB 3RX8A 4M02A 4X6CF 2FWOB 4PRPA 4WFHD 1IBGH 4DEPC 1FNLA 1CL7I 2KZ1B 5IG7A 2VQTA 5C2UB 5AYUH 2C3HA 4ORGA 3GO1L 3CSYB 1UM5L 5H37G 3UPAA 2FR4A 4MDIA 5E5UB 5EOQH 5FHAL 3C6LB 3Q5YA 5DLML 3DV4A 3MOAH 4JB9L 3D0VB 4JY6B 2AQ3A 2X4RB 4K3EL 4JKLA 3ULSA 4FFYL 4M1GH 3KYNB 2J4WH 4HPOL 3PHOA 1S7VB 4XXDA 2FLRT 4UOJA 5ELIA 3S4SA 1ED3B 1TVHA 3O2DH 3DX6B 1T04A 5T3XH 5GZOC 3N1MC 4LDLB 5F1SA 2PR4H 4I2XE 1WZMA 4PJXB 5EUOF 3N85H 4Y19E 4HSQA 3QDJD 2R8SH 2EEBA 3V52H 5CP3H 2CUMA 4Q6IC 5GS1A 1D9KA 1M71A 1D7FA 1MQKH 4I3RH 1QEWA 5I8EA 1T03L 5FYKD 3I75B 4WW1A 1LMKA 1QYGH 5FFLA 2IAMD 2OL3B 2VSDA 1UXWB 4GW1A 3VXUB 3HE7B 4URTB 5DWUL 1KJ2L 4I77L 4Q58C 3P4MA 4P9HC 4RDQG 4HMEA 3S3PA 1FVEA 2OSLA 1NAKH 5BV7B 4KUCF 5EORH 3OKDA 4NQEE 3PWLA 4IRSB 4NWTL 1BBDH 5FUZH 3DGCR 3CVHB 4ZSOE 3QFJE 4XPFL 5IVXE 1NGWA 1SHMA 4NM4H 1CFSB 1JIBA 2FGWL 5CJOH 5GSRA 3ABZA 5FGRA 2O5YL 5T3ZL 4X9GA 3QQ3A 1MVUA 2G2RA 2MTPA 3VD9A 3EHBC 1BGXL 3VRIA 3ET9F 4CNIA 2Q76B 2APTA 1EV2E 3HI5H 4X6CA 2NY0D 4QGYA 1DFBL 4I5BA 4L5FL 2O93L 3V9FA 5IMLA 3IDJA 5I1EH 3LQAL 2ARJB 1V5JA 4I18A 5IROA 4J1UB 3EOTH 2H26B 2VQ1A 3ZDXE 4ZUTB 4U6YB 3D18A 1HIMH 3T08A 2FO4A 3GRWL 4F57H 2QSCL 1OM3L 5E1HB 5IFJA 4XX1G 5HPMA 3LEXB 4MX7A 4PD4K 5C0RL 2BNUB 1F4WH 4MJ6B 1SY6H 5C3LD 2PTTA 5CILL 3H9HB 4QT5B 5KW9H 3AB0B 2HT2D 4MNHA 5AYUL 2DDQL 4WW2B 2ED8A 4S1DC 1XF4B 3OKKA 2C4XA 1WZLA 4S1SH 4YGVB 4XNQB 5HHXL 3DHJA 3KYOB 4QCIA 3M17A 4TUJB 1AXTH 2VLJD 5EUOA 3AREC 3MOAL 3WHXA 4KUZL 3BPOB 4EN3A 4M1GL 4LRIC 4OF6A 4WFGE 3VGAB 3TESA 4N5EC 1QSFA 5SWSD 2DS4A 4LKXA 3IDXL 4D0DA 2QHRH 3MJ8A 4JY5L 2PR4L 4MQTB 4M6MH 4LNRB 5C0JA 2FBJL 1HHKB 5DVNA 2NY6C 4ESKA 3DVGB 1LO4L 2A2QT 2ZP0T 3VFNB 3U9PH 1DLFL 3MUGB 3PDDA 1QYGL 3JSSA 4GQ9L 3WE6A 1PFCA 4N0YL 4GRWF 1Q38A 5FHBH 4NUJB 1RK0B 1BQUA 4PJ7E 1OAQH 2WNGA 3DX7B 5DGQA 2AEQL 2APVA 1X5YA 3NBNA 1H15A 1QLEL 2H2SD 5IQ7L 3ARBC 2XG5A 3RZWA 2QKIA 4FG6C 5CBAA 3K1KC 1UYWL 5CEZL 2Z31D 1AP2B 4I0PD 5C6PB 4PB9L 4YE4H 2UZIH 4YXLH 1RUKH 4HKJB 1X5KA 3LKNA 2AJ3B 2Z35B 4JPWL 3STZA 1CDIA 5KOVC 5JW5A 1HKFA 1HSBB 3VFTB 1OTUC 3TO4D 5CJOL 3WFCH 3I50H 5I30L 4G8EB 4CVZA 4PGJA 1I3VA 4IRJB 2B1HL 2V5TA 5GGVH 1YECH 3I6KA 3G5XA 3RKDC 3MA9H 4NBXB 3HI5L 1LD9B 3QIUB 4LSQH 1I1FA 1TQCB 3BAEH 2Y7QB 1JWUA 2FDBP 4JM2B 1EEYA 3I3DA 2M2DA 4P2RD 4J4PD 4KDTA 4XVUC 3WNKA 4CUCA 4GKOA 1ZS8B 4V1DB 1CXEA 1FC1A 2OXHA 1MNUH 5HDBE 4G6AD 3ARDC 3QULB 1D5BB 3A6BH 4L4TD 4PR5B 4XP1L 2AK4E 3T0BA 4G8IA 3O6FA 5C07A 5DEFB 3O3DB 5F9DC 1G9MH 4Y4FD 5TQ2L 1SY6L 3RDTA 4FQHA 1KCRH 2IQ9H 3OAUH 3ZE0F 1FO0B 2HN7B 4XCFL 5DC9B 1H8NA 4PGDA 5JORB 2OMBA 1DQDH 5F89B 5TFSL 4EI6A 1K8DA 3BT2H 1UZ8A 4M7KL 5CSGA 1CF8L 4S1SL 2E6QA 4MJ5B 4TTDC 1NCNA 3Q5TA 5E0QA 3MLUH 3RAJL 3WKNA 1GGTA 3RHWF 1FC2D 4GSDL 4XI5D 3OJDB 3PGDA 1GC1L 4M4RA 2V5RA 1HH9A 2BERA 3NPSC 4XNYH 2VJXA 5KSUB 3QDAA 4MHHG 4YDLC 4S1QL 4OAWA 3ULVF 4OKDA 5CD3A 4PJFF 4LHUA 5IR1A 4O5LL 1HI6B 1MVFA 4JDVB 3TJHD 2W0KA 3W0WB 3U0WL 3RL1A 1LEGA 1VFBA 3L1OH 4PG9B 3D2UB 4NJAH 4N0UE 1DBAL 4OCSL 1I7RA 3MV11 2XPGA 4R8WH 1WGOA 3QBTB 3ARFC 4OF7A 1OCWL 2UY7A 4UV7L 1WEJH 1AI1L 3TIDA 3GJEA 5E6IA 2Z8SA 2GAZB 1KIRA 1FN4A 1NBQA 2IAND 4MA3B 4HXAH 4YDJB 4NZTL 1DLHB 1ULVA 4XAKE 1AO7E 4QRPE 5FHBL 2WZPD 3KYMA 4B7IA 4WNQA 1BBJB 4PJ8B 4GW4B 5ENWA 3ARGB 2VLME 2XICA 5HYEA 4NC0B 2D7PA 3WS3A 3G5ZB 3HI1B 1LWRA 1VKXA 5MI0B 2W65A 2VB5A 3IXAB 4QOKD 4X5LA 1U8MA 4KJYB 4MD4A 4RZCA 5ESQB 5I8KL 1G7HA 1EA9C 1VFMA 4OFYA 1EFXD 4M7LT 3BDYH 3KLHD 2BVQA 3SDCC 3CPLB 1A7PH 5M95B 1B2WH 3ARSA 1TCRA 3CSPA 2H1PL 3O4LA 5GGVL 1YECL 1IC5H 1CD1B 2C1OA 3BIBX 1EJOL 1JZ6A 4LSQL 5FK9B 1AGBA 3BAEL 3RI5K 4JAMB 4P99A 5B22A 4X9BA 4PS4L 4TPRL 3VFRA 5IBTH 3B2VL 1RZJL 3DXAA 1ZT1A 4HWZB 3RA7H 3TN0B 1S7RB 1WFOA 4ZOEA 1NGXA 3FOMA 2MMXA 4HBCH 2MJWA 3BKJL 1KCKA 5MEPA 1NGPH 1HOCB 1DVFD 4UIKH 5CJ8A 1MQ8A 4P2QA 2B4CH 5AZ2H 3QWQB 2IH3A 4UINL 3E2HB 3I6LE 3DARA 3VXPB 3DMMC 2VLKA 4R96B 1WSST 4OFIA 2WIIB 2R4RH 3BPNB 2C4FU 3WIHH 1R3HB 1YJDH 5B4MD 2R69H 5J3HD 3VFOA 3Q6FB 1PLGH 1M7DA 4J3XA 1XGRA 3FQUB 4PJFA 3LN4B 2EDLA 5KSAD 4DGVL 3CVIH 5IM7B 1QBBA 2X7LA 3X14A 2JTDA 2NX5B 4PJBB 1HZHL 3THML 2VXVL 3TV3L 2DYPB 4ZO9A 2Y36L 5C09B 4FRWA 5HGHA 4MCZA 4MAYC 1C1EL 2I5YH 2V6HA 4IMLA 1OP3H 3RWJB 2XTJB 1AIFA 1G7MA 3EYUL 4QHLB 1MAJA 3PWPD 4P57B 1DN2A 3MGTB 3MLTB 1CL7L 5L0QC 1NAML 4LSRH 1UH4A 3BKYL 2R4SL 4APQB 4M7LH 4JKWA 2MWCA 4M1CC 4NJAL 5AG9A 3B2UC 2GW5A 3RY6A 4BSVB 1B0RB 2D31A 3ZO0A 4GXUM 5E00B 4GMTH 5F7DB 1AGDA 5MHSE 1N5YL 5CD5C 5ID0A 2RBLA 4MXQD 1CZ8H 1SYVA 1X4XA 1AC6A 3NFNB 3DSFL 4ZO6A 5F7MC 2IMNA 5BCAA 2NY2C 3KS0J 4NO3B 1QR4A 4ZFGL 4CW1B 2Q1EA 3K3QA 1RURL 2DF3A 2OZ4A 2GITB 4FXGA 5E24E 3GMQA 2EZ0D 1RUPH 4QHKJ 1KELH 1T2XA 4XVJH 1NC2D 4B50A 1B4JH 3RY5A 3BDYL 4LLQB 4P5TD 4JFFE 3C09B 5LBSL 4PJDF 1WBZB 3RNKB 3VDBA 5DEZA 1MF2H 5DTFA 2EH8H 3CDCA 5SWQB 2Q86B 1NBZA 3HUJE 2HFGL 1P7QB 3BI9X 5E8OA 2W92A 3HG1B 3SE8H 3WO4B 1LO3H 5CZKA 5IBTL 4LCIH 3HMXL 5F9JB 4ZPTB 4Y5XA 2VLRD 5HHNB 4WV1C 2R1WA 5ANMB 2A6KB 1G9MC 2IPUG 4WHDA 4QRRB 4HBCL 4OZIF 2DIAA 4NO0D 3FFDA 3BE1L 3U6RB 3CU7A 4PLOB 1EXUA 5E9DB 2FECL 5LQBL 2IBZX 4WDIB 4V2CB 3ULUC 2F53B 2PYEB 4LIQH 2EXWD 4RISL 3R4DA 4TSBH 3IJYA 4U3CA 1U3YA 1EHNA 5EZIH 2R56L 5KAQF 3GMMB 3OJMB 3WXWH 3T65A 4BQBA 1PLGL 3F65A 4G8FA 5CJ5A 4KKLC 3UTTB 2YPKA 3H7BA 3MO1A 2J12B 1MHEA 2WM0A 3DI2B 4RFNB 5IBUG 2H9GB 3CVIL 4D2NA 5C6WH 5B3JF 2VH5L 3VH8G 4NZUH 3WSQH 3DGGB 1F45A 4JREC 2BVOA 5C0BD 3B9KB 2DN7A 3RWCA 4L29A 3SE9L 2WINB 5C0GA 3TJEL 4YHLH 2W9LA 3MBEA 5KVFL 3QIWC 1DUYB 5K9KA 2L7JA 3DROA 2DBLL 4P23A 4QXTA 3F7YA 1FIEA 1J8HE 5D2NC 1A6WH 4NZRL 4OZFB 1LP9A 3FN9A 3H9SE 3TIEA 4F33A 4KTDH 3SKMB 3UTSA 2CDEA 1DQJB 4CJ0A 3HI6L 1YZZA 3QUYC 4LLMA 3EJZC 2IADA 4YPGB 3CXDH 1VADA 3KHQA 2WQ8A 4M8VA 1G9NC 3HAEH 4YWGL 1HHJB 5T1KD 5E8DH 3CU1A 5L2KE 5E2WH 4NRYB 4MWFA 3QO0A 3T2NH 4HCRL 1CE6B 1JPTH 3IDMA 5I74B 5F6HJ 1REIA 1P7HL 4YX2H 5FYKH 5GJSH 3RUGE 2BVTA 3DBXB 4J6RL 4BKLB 1FFPB 1IM3A 4PY8I 5I2IA 5DD0L 5C9JA 1TVBA 4AM0B 1HILA 4X7CC 3V0AC 1C7TA 3CFKB 4JGMA 3EYQC 1YNKL 3PGFH 4NUGL 4UTBL 4XVJL 2FCBA 2AI0L 4IDJH 4LCUB 4ZDHA 2ZZUT 3VFPB 1X5GA 3ZE1E 4ODSH 2RIKA 4OLZH 1MIEL 2DLIA 2F8XC 2V7HB 2YEZB 3WKML 2V17H 3GSRB 3LB6C 2PXYB 1WJ3A 1CLCA 5DURB 3NGBC 4TYUA 2PYFB 4OGZA 1G84A 3O11B 2HRPL 4ALAH 1TTGA 2DMCA 2OI9C 1JUFA 2B39A 2WBJA 3VXUE 2B4CC 3MQIA 4BSWA 1QSEA 4Y19D 4S0TD 4D9LH 3OV6A 1OPGH 5CINH 3SBWA 3VXNA 4NN7B 1UJ3C 4UAOB 1EHAA 2NYYD 3UXFA 5C0CA 2BMKA 4DVBA 1YJDC 3AY4C 3TLRA 5IG7B 2HP4A 4XHQA 1BF8A 2R2EB 4E41D 4ELMB 4ORGB 4TSBL 4F7MA 3K81A 1NL0L 2VR4A 3AS3A 1TJHL 1LGVA 2FR4B 4MDIB 4XNUH 1G7PA 3N1GC 3GI8L 5ICYA 3DV4B 5L2JA 4NQED 4G6JH 4YUEL 4PJ9D 5IBLC 5FDYA 3EZ8A 3QFJD 3PHOB 4XXDB 4ODXB 4M9OA 5J56B 3S4SB 3REWA 4NHUB 1TVHB 2MQ3A 1J10A 1A9BA 3P30H 1T04B 4OD3L 3VMNA 4Y4HC 4QXGL 2WUBH 2Z8WC 4M5ZH 4UTAL 4OKVA 1AKJA 3ALXA 4AQOA 5IKCA 5KBNC 1F5WA 4MZ2A 1P6FA 4D94A 5GS1B 3F7PC 3X3FL 4KTDL 1IGIH 4MA7L 1PG7L 1D9KB 3AFLA 5I1KH 1HSAA 3AM8A 1N0XH 3KPQA 3MV8A 1T3FA 1QEWB 5I8EB 3KXFE 4JO4L 4LFHG 4Q9RL 1ZTXH 2PTVA 4JDTL 4PY7A 2NXZB 1JWSA 3PWNB 1YEEL 1CVRA 3L3IA 1XR9B 1UA6H 4YHZL 4GW1B 1MJJA 1QFUH 1MJUH 4JFDE 4UT7H 5IHUH 3SO3B 2ZUTA 3VWKD 1S8DA 2R0WH 3P4MB 4X4ME 4J3OC 1FVEB 2DQCL 1CFTB 3OKDB 2HKHL 4QHKI 2BOCA 2I9LA 3FQTA 3PWLB 4MHHI 3EO9H 1WBXA 5JPMA 3S35H 1NGWB 4AK1A 2W60A 2XT1B 4RWHA 1A6AB 3GHEL 2UVEA 3NACH 4OV5A 4R26L 5GGSB 4HFUL 2KH2B 1KCSH 4JFQA 5E99L 3U9UA 3QWRD 4ODHL 2QQNH 2AJUL 1MVUB 2G2RB 3SKJL 3X3GH 1XT5A 1KENH 4ODSL 4ZAKA 4F58H 4WY7L 1VFOA 2EEDA 3VRIB 2BSTA 4N8PA 3RVXC 2VLLA 4AMKH 4WFGD 1N6UA 4PP1D 3ZDZE 1WWCA 1FL5A 3HZKA 5HHQA 5IMLB 1J11A 3IDJB 4Y2DD 2JJSC 4ALAL 2VQ1B 2OP4H 3NIDF 3JVGC 3D18B 5HPOA 4LQ1A 3FO1A 1WK0A 2ZCLL 3AS0A 4OLEA 2FO4B 5IVOA 4NGHH 3G6DH 4DGYH 1YQ2A 3C5ZC 4NQVA 3S37L 4Q2ZA 5IFJB 1U8NA 5HPMB 1INEL 3MLSL 3OKMA 4W70A 3L3HA 2PTTB 1DZBA 2Z93B 4Y5YC 3AMLA 1FIGL 4XC3H 32C2A 5K93A 4PJCF 4MNHB 4PBXA 1ITCA 5IW6A 2OX5A 1XR8A 3TPUA 4YK4C 1RHHA 4ZFOL 5DK3A 3OKKB 4I48B 3SE3C 3SGDI 2F5BH 3O6LH 1S9YA 2ICWJ 4O9HH 4QCIB 3M17B 1H3WM 3WHXB 1YEDA 1WBYA 4UMGA 2ZKHH 1K8IA 4EN3B 5I76B 1NC4A 4XGZB 5FGCE 5ICXB 3UPCA 1QSFB 3TA3D 4FQXA 3UX9B 4GBXD 5DJ8B 3V4UH 5I1AA 4D0DB 1JCKA 1UJTA 3MJ8B 3GI9H 2WUBL 3QT2A 2NY1D 4KK6C 4RRPA 4ELKA 1MCNA 3KPLA 5IFAH 4HW6A 4M6NH 5C0JB 5MENE 4OLWL 4POYA 4LCCC 6FABL 1T1YA 4DZBA 1ADQA 4X9FA 2EDTA 1SBSL 4DW2L 4CMHB 4LPCA 4BELD 3SKNA 3WE6B 1ZLWH 3U36A 3CD4A 3GDBA 2P47B 1W0YT 1MCJA 4LGRB 3TVMC 1MJ7L 3T0EA 1FP5A 2AK4D 3WLBA 4CRPA 1AR2A 4ZTPH 2QKIB 5CBAB 1ZT4A 1CQKA 2ITCA 3EAKA 1EPFA 4J3WA 1N2RA 4MLIA 3LKNB 1XH3A 3FFCA 1MCSA 2AAVA 3STZB 1KC5H 1E6JL 3BMVA 3VXMB 4CVZB 1RIHL 2UWEA 3X3GL 2YPLA 5DJDA 5JXEA 4RGMC 4J12A 3G5XB 4F3FA 1SEBA 1CDYA 3BDBA 2BDNL 5I71C 1JWUB 1ZVSB 3BP4A 1EEYB 2NY0C 4KPHH 5FYJL 3ES6A 3F12A 5BV7L 1FQ9C 2IFGA 4K07A 1JRHI 4GH7B 3KJ6H 1JHLL 4BZ2H 1PD6A 3S5LA 1L9NA 2P45B 4G8IB 3O6FB 5C07B 2YD6A 5T5NF 3D85A 2OS7A 3MRPA 3RDTB 4FQHB 5EDXA 4MJ4A 3ZE2F 2ZUVA 4XP6H 5DS8A 3P0GB 4PGDB 4MMXC 1Y6KR 4Z0BL 5F9AC 1K8DB 2HT2C 4I0KA 1UZ8B 5JHDA 2HT4D 1AO7D 4QRPD 4XAKD 2R1YA 2VLMD 3MA7A 1AH1A 2DTMH 4UBDC 4LLWA 4MJIE 4U1NA 3RI5F 1FFRA 3ME0A 2V5MA 3CH8A 3MCLH 3FCTA 1F4XH 3UC0L 3V6OC 3PGDB 1BHGA 4ODTH 1U9KA 4M6OH 2A74A 1HH9B 2H41A 4P9MH 4HUXA 4KC3B 4NRZA 2AXJA 4Y8DC 5JW3H 3G6JE 4GRWB 4AG4H 4OM0H 3GI9L 1LEGB 1VFBB 1BVZA 4FQ2L 1S5HB 1FNSH 3DJ9A 4EIZC 3OG6B 4ZUWA 1RMFH 1RZGB 1M1SA 2XPGB 3G08A 3QUXD 4NQXA 3MGAA 2C7UA 4KI5E 3WFDL 1I1CA 5MEQA 2FEEL 3CFBA 2NW3A 3TIDB 3O3UN 3GJEB 5E6IB 2O5XL 1KIRB 1FN4B 3D69A 1J88A 1I1AD 1TJGL 3UP1A 3L95A 3FO0H 1ZGLM 5B38A 2ZJSL 4U4BA 4U7MA 3KYMB 2CJUL 4WNQB 2NY5L 4YBHA 5ENWB 4NZDA 3SO5A 1NUFA 1RSFA 2X9YA 4WU5A 5EZOH 1GPOH 1ACYH 4JG1L 3MLYH 3MYJA 4HC1H 3WS3B 2CIIA 5C09E 4KY1L 5F8QC 3I6LD 4JJHA 5H2BA 1WTGT 4WHTA 4Q0XL 1QO3B 1VKXB 3VDCA 1BQHG 1Q0YH 2W65B 4YDVB 2AK1L 1U8MB 4MD4B 4RZCB 2GHWB 2Z31C 3ARYA 4I0PC 1HKLL 1G7HB 3MRLA 3AXLA 4H5SA 4C83A 2QQLH 5HYSG 3W2DL 4U6VH 2BVQB 2RCSL 2NTFB 1OP3K 2I25N 1CLYH 3OXRB 1TCRB 1NFDA 5BVJA 1D5ZA 3TO4C 3O4LB 2VE6A 2KPNA 4ZUSA 2C1OB 1V7NL 1QZ1A 2YD2A 4LCWA 3LKQA 5L88H 2DQTH 5INCA 1AGBB 4XPGH 3EFDH 3SDAD 3VFRB 2H2PD 3DXAB 1F02I 4KPHL 1ZT1B 3MGOA 3VXTA 2FX7H 4OUOA 4JE4B 1NGXB 4DFHA 5EZJA 2CIKB 5EBMB 1N3NA 1Y6MR 5D7IE 5MEPB 1OD7A 2ZG3A 4P2QB 2IPTH 4KI1A 1F6FB 1T7VA 1QG3A 5FO8A 3SQOH 1T7ZA 5MHSD 4G6ML 4Y4FC 2VLKB 5HYSB 2BNQA 4FABH 5F7YC 5TE6H 4HJ0D 3VFOB 4NQCE 3BHBA 5BJTA 5K9QG 5C7XH 5E03A 1XGRB 4PJFB 1FDLH 1ACZA 2YRLA 2X7LB 3X14B 2UUDH 3NFSH 1XCTA 2IMMA 4UILL 3HG1E 5HGHB 4MCZB 2Q3ZA 5BXFA 2R2CA 4IMLB 5HJ3A 1FGNL 1CXKA 1J1XH 4U1KA 5GGRA 5EU6A 1YEJL 1AIFB 1G7MB 4XI5C 5ESAA 5F9OH 3DVNB 4QRRE 4JN1H 4JFFD 5D96C 3RZCD 4OM0L 3RJQB 2YA2A 5JW4M 1K4CA 4B53A 3SGDH 3I9GH 1NSNH 2D31B 4P3DA 2BVEA 4NRXA 1IAKA 5JUEL 1AGDB 2Y25A 4H1LG 5ALCH 4M7ZB 2J6EH 3QJFA 4HX1A 3WUZA 1SYVB 5IP4A 2VR9A 4H0GA 3RGVD 4PJ5A 3D1MC 3IS1X 3DO7A 4U2YA 3BGAA 2F9BT 2A38A 5HYJE 5HYIA 1CD9B 1GPOL 4HQQL 2QADB 4YHIA 1JGUH 1BX2A 2UV3A 1TFHA 2NY3B 4WFFE 5AZEH 1IGML 4FXGB 3HE6A 3QEHA 5EULV 1KYOJ 1QBLL 5B39G 3CLEH 5HI5D 4HZAA 4PIRF 4GXVH 4KKBD 3SCMA 1VPOH 2CMRH 5D71L 3ORJA 5J1AA 2KQNA 1Q72H 5DTFB 1WVZA 3DWTA 3MROA 1UG9A 1JZ5A 2I9TA 1NBZB 2E9IA 5J4MA 1A7QL 5JXAH 1D5BA 2HG5A 3EFDL 1KIUA 4N9GA 1XGPA 5J12C 2VN7A 4Y5XB 2R1WB 3V95A 2FX7L 2BY1A 2E7MA 1J8HD 1X9QA 4EBQL 1DBMH 1T7YA 3H9SD 4Z95L 3LEVL 3FFDB 3BSZL 4FQIH 1LEKA 3OWEA 4EDWL 1NCAL 2WLYA 5JW4R 3QDMA 1BPVA 1KSRA 1DVFC 5EO9A 4HKBB 2ICES 5EBGA 5L2KD 1MFDH 3IJYB 3CZJA 2R0LH 3SDYL 3GM0A 4X8JA 1ZA3A 3JBG7 4YDIL 2BCKB 2DAVA 4G8FB 4U7SA 1P4BL 2YPKB 3H7BB 3MO1B 1MHEB 5J3HC 4P46D 4F7TA 2ZG1A 1KJ2A 2A73B 3B5TA 5AAWA 1S7WA 5KSAC 5DA0B 3QCUH 1EBAA 4PYGA 3MX0A 4EDXA 4WTZG 2BVOB 2VDLH 3WIIL 3ZKMD 5IFHL 2Q8BL 1UXSB 3IGAA 4L29B 1MCFA 1J1XL 4IOSD 2ZUQC 3M1BA 5C0GB 3KPRA 4Z7NE 4N1EA 3MBEB 4HK3J 4M7JL 5K9KB 2HJFB 3DROB 3T1WA 5KSBE 4QXTB 4L4JA 1ZA6A 4OIBA 4U1HB 4HMDA 1WICA 1Z9LA 2R1XA 1LP9B 5HY9B 1W0WA 3TIEB 4F33B 5F6IB 1SMOA 3QCTH 3UTSB 4PRPE 1OP9A 3QUMH 4PJAA 1JYVA 4OT1L 2CDEB 3O6MH 3FB5A 4PGCA 4OFVA 5KVDH 1ZHNA 4JFZL 2IADB 1CLZL 3RRQA 1P2CA 1VADB 3P0YH 5EPMA 4HAGA 1UCTA 3KDMA 1NCCH 4G9DA 4YHYB 4KQ3L 3VXUD 2FX8H 1IAII 2JCCF 4RAUA 4EI5B 1MRDH 3QO0B 3KLSA 2I60L 4Y5VC 2BFVL 2R9HD 4EUPG 5CIPA 5D93B 1YNTA 2DJSA 3OKNA 5DVMA 1D3CA 5HD8C 4R2GB 2MPAH 1WFUA 1F58H 3TM6A 5C9JB 2DLFH 5FEBA 4YIQA 4OGAD 5E2UL 1HILB 5TDOA 1DQLH 4PJEF 3WDJA 3BPLC 3ARDA 4NQDB 1U8KA 3WD5H 2EZ0C 15C8H 4ZDHB 4TVPE 1EHXA 3L5XL 3L9RA 4JM4L 1AGCA 2BY3A 3BYTA 3SPVA 5J13B 3KLDA 1IKNA 3AGVA 2CO7B 1EX0A 1GOGA 3UJTL 3VD3A 3FQRA 4FQJH 1JN6B 2Q8AL 1Q9WA 4K3JL 5GISH 1V3KA 5DHYA 1JUFB 5HHVL 2OJEA 1YN7A 1PQZA 3M8OH 1UACL 3KPOA 4EUPB 1EHLL 2WBJB 4JO2L 2W9EH 4Z7VF 1QSEB 3CSGA 3JWOL 1OD9A 4R0LA 3A67H 1CDBA 1CDUA 3ZT5A 3R8QA 5GS2D 1AQKH 3VXNB 2A6DA 4XPBH 3T2QA 2EIZA 5C0CB 1OTSD 3B4NA 4KMTL 2BMKB 2GK0A 3KXFD 2X10A 4FZ8L 1FV1A 5CP3A 5CKAA 2AGJH 1MFDL 2D7MA 1IAMA 2HJLA 1M6OA 2A83A 2HLAA 5KZCB 2EXWC 4QY8B 4JFDD 4LF3A 2X4OA 1NCWH 1G7PB 5E7BA 5EU4A 2XOTA 3MLRH 3RTQD 1JRHL 4X6CE 2GEEA 1DL7H 5L2JB 1KCUH 3ARFA 2AV1A 1A1NB 2R29H 4P4KA 4PGEA 3EDDA 4PJGF 1WCBA 3QNZA 1A7RL 3REWB 3C08L 4P2CG 1EMTL 1L0YA 1A9BB 5I8CA 3MRNA 1RZKL 5D1XB 4N9OB 4P2OA 4X4YA 2PO6C 5IKCB 1MELA 4LASL 4CAGA 2VQUA 3O4OC 3MRMA 1HSAB 3IRZA 3RVUC 3MV8B 1T3FB 3CXHK 5TE4L 4F15B 1CFBA 1ZLVK 1ORQA 1YEGH 4TOYH 4PY7B 5AD0A 1NCCL 5AWNH 3SDCA 3L3IB 4PJEA 1MJJB 2LE9A 1MRDL 4PRHA 1UQSA 3T4YA 1NMAH 5D6CA 5EIIA 4O00A 3QZWG 3PNWA 1MFBH 5EOCJ 5EUOE 1GCFA 5BO1H 1E4KC 2BOCB 4Z7WA 2I9LB 3FQTB 4JPKL 1W0VB 4ZXBD 1W72H 3OAYH 5FXCH 4PG2A 1WBXB 5IEKA 5JPMB 2Y06H 3WNPA 4RNRA 1HNGA 2W60B 1SY6A 1H3PL 1HHHA 4OV5B 4GS7C 4U31A 1NCDH 4JFQB 4IJ3B 3U9UB 4CMMA 4BFEA 4F9PC 3OPZH 4MNGE 4HG4J 4Z7VA 3LD8C 4NN5C 1RU9H 2YXMA 4N8CH 3DRQA 1X5IA 3BKML 2BSTB 4LVHC 2V7NA 2VLLB 4YJZL 2ZPKH 4NKOA 3OKOA 1FL5B 3HZKB 5HHQB 1CU4H 2JE8A 1MWAH 4P59L 4FQ1L 4PRDA 3WYRA 3FO1B 3SN6N 2ORBH 1YEIL 5IMOA 4NQVB 3W81A 1U8NB 4LAQH 5DZNA 2X09A 5MEND 1AQKL 1ZLWK 3L3HB 4XPBL 1URLA 2Z9TA 2WW8A 3VGBA 4QF1A 3G04A 1I7TA 3MACL 1Z9SA 32C2B 1SM3H 5DJXA 4Z7QF 1WIPA 2KQMA 2HWZL 2VKXA 1XR8B 3PWUA 4PJGA 5D7JC 5IW6B 4MNQA 5DFVD 3TPUB 3CH1A 3BPCA 5JMRA 1KJMA 1RHHB 1XGUA 1T66D 3WNMA 1C5BL 1S9YB 2C3VA 4J7RA 5TDNA 1CR9H 3I02A 1YEDB 1WBYB 3GBNL 4X7EC 4XBPA 4M93B 1K8IB 2R29L 1W8NA 2BOBA 1NC4B 3MUZ1 4QO1A 1MAMH 5T1LA 4FQXB 2P8LA 3TH4T 3W39A 3FO2A 4NFDA 1CS6A 5FM4A 1EUTA 5I1AB 1YY8A 3D87B 4ZO8A 1Z3GL 4LLDA 4QLRA 4WI5A 1BQLL 4U3HA 4ELKB 4OGXH 4IIQC 2DWEA 3KPLB 2MOVA 2FH6A 1JGDA 3BVNA 1T1YB 3OZ9H 3E8UH 5TF1L 2I07A 4JR9H 2F8OA 4PFEA 4A2LA 4DZBB 5ITBH 4E0RA 2DWDB 4W6XB 5EFIB 1YQVH 4O51B 1E0OB 4RA3A 5D7SL 5K9QI 1DEDA 1BIHA 1CXFA 1I3GH 3SKNB 5HHMB 5AWNL 5I66A 2G75A 3U36B 5FGSA 1P5UA 1AQDA 5E94A 2JJTA 2Y07H 3WLBB 1GYAA 1T0MA 3VWKC 5BO1L 1FAIH 5HDQH 1ZT4B 5CZVL 5C86A 2FB4H 1ORSA 1T1XA 2XY1A 2ITCB 1E4WH 2EYSB 4ZD3L 5FB8A 1TNNA 5DQDH 1NJ9A 1RIVH 2H45A 3BOVA 5D2LF 5ILTH 2VC2H 3FFCB 4YHKH 1OL0A 2D9QB 1U3HD 2GCYA 1QRNE 4GRWE 1FYTB 4GW5A 4I3SL 2UWEB 4JDZA 3W5MA 5EC1A 1EZVY 4XPHH 1MI5E 1RU9L 2YPLB 4RFOH 1JGVL 5DJDB 3VFGL 3RQ3A 1IAIH 4MJID 2KDGA 1C8PA 4F3FB 4F9LA 1SEBB 1TPXC 4HUMB 2F54B 1F3DJ 5JDJA 1MUJA 3BP4B 4PRAB 4HH9A 4LSVL 2EIBA 4N8VG 3ES6B 3F12B 3TN0D 5DD1L 4PBVC 1BD2E 4KJWD 1GOFA 1BZ7A 3V0WH 4Y2DC 2DQIL 4O4YH 3HN3A 5GGQL 3RWFA 4OUUA 5IJVA 3H6JA 4JRXE 4PGBA 1JI2A 3S5LB 4TTGA 2BVUA 2FD6L 1NAMA 1PKOA 4RMRA 4KI5D 3MRPB 1MLCA 1JTTA 3LMJH 4QWWD 1OW0C 4XHJC 4KGJA 4X5WA 3QIWA 3G5YA 4UT9L 4RAVA 1W8OA 4GMSH 5JHDB 3CMOL 2R1YB 4UUJB 2GT9A 1TJIH 5DT1L 1MRCH 4M62H 1LNUB 2C3XA 1CLOH 5D7LE 3O4LE 3MA7B 4HT1L 1T83C 3MLZL 4LLWB 1IAIM 5TJWK 4U1NB 5C09D 4LU5L 3GIZL 5ADOL 4ZNEA 2RQ8A 1CK0L 2MQ0A 3BESR 4LOUD 5SWZA 1YMHA 3DXAE 3ZE0E 3KPSB 3WBDA 4OJFL 3PL6D 4HUXB 4NRZB 2GJZA 3Q6GH 3TA3C 4Y1AD 2O5ZL 4QNPF 1T1ZA 4GBXC 5J6GA 2O61A 2HRLA 4APQD 5A3ID 4P2QE 2HVKA 1T89A 5GRUL 3G08B 2NY1C 5I8OL 1BFOA 2C7UB 3K74B 3WFEL 5MEQB 3FRPA 3CFBB 3GKWH 3UROR 4U0RB 5D1ZD 5ITBL 2NW3B 1KOAA 9CGTA 2VLKE 1YY9D 2Z92A 3MCG1 1AD0A 25C8H 3ALWA 1H0DA 5LKNA 1I3GL 5B38B 3ULVE 5D2LA 2W0FB 5C0FA 2XG4A 3KPNA 4PJFE 2E7LA 1U95B 4XPAL 1G6RL 4WU5B 2Z4QA 3D9AH 2QSVA 3MYJB 2CIIB 3NA4A 1FAIL 2B1AL 5H2BB 2BRQA 2CQVA 1UEMA 4WHTB 2FB4L 1E4WL 1SQ2N 1UWXH 2UUDK 1ZWIA 1RJZB 1AGFA 1RIVL 2XN9A 4GFTB 4NNYA 4N68A 1IL1B 5ILTL 1QHPA 3AXLB 3BD4A 3OQ3B 4H5SB 4C83B 1HH6A 4NQCD 3IFLH 3UO1H 2LVEA 4C4KO 1UJ3A 1NFDB 4PREA 4RFOL 4WUUA 4DEPB 1IAIL 3WIHA 5ADPH 4ZUSB 1R3LB 4XAWH 5GRWA 3I84A 3HG1D 4LCWB 3LKQB 4HMCA 5INCB 3ZTNL 1LK3H 3MGOB 3VXTB 4MB5A 4XWGH 2YPVH 4QRRD 5IQ9B 4H8WH 1L9MA 4NQUA 1QLRA 5I1JH 1IZKA 1N3NB 1Q9OA 4FQPA 1I9IH 2P7TA 3FOLA 2J1KA 2ADGA 2HYMA 3T04D 3IT8D 5FO8B 4KZDL 3RL2A 3LQZA 1C7SA 3B8SA 4X83A 3TZVA 4DOHE 5IVZA 12E8H 5CSZA 3QUZD 2BNQB 4WCYH 3QEGL 4L9LA 2BRRL 3O45A 3ILQD 4TSCL 5BJTB 1TJIL 3NA9L 3LIZL 1KB9J 4Q6IB 2JELL 2HT4C 4XP4H 1D6VH 1WWWX 5HYJD 3O3AA 4HCRA 4Z7UB 2DTSA 2BHZA 1U6AH 1XCTB 1Q0XH 5H35A 1VERA 4WFFD 1K4DA 2CKBL 1PG7X 3B9KD 5BXFB 5F93C 2ZCHL 5HJ3B 3C60D 5GGRB 3RVVD 5EU6B 3OTTA 4MXVF 1J1PH 5ESAB 4JQVC 4JG0L 1QR1A 1A4JA 2QHLA 1SYSA 4B0MM 1X5ZA 2JIXD 3QG6A 3ULUE 3ARUA 4K23H 1A0QL 2ERJB 2P8PA 1K4CB 4E5XA 4OB5L 1M05A 4NO2A 4P3DB 4DZ8A 3KAAA 2HTLC 4NRXB 1IAKB 4L4VA 4PJHF 3QUXC 2D0HA 1HCFX 1RZFH 3CGTA 3QJFB 4G9FA 4HX1B 3CX5J 2KZWA 4WEBH 3VXRA 4R4BA 1J5OL 3V7MA 5GIRA 1IILE 1DBKL 2YK1L 1I1AC 4MXWL 4PJ5B 1ZHBB 3DO7B 2NZ9D 3TGXA 4PRBA 1LEIA 4ZYKA 2D7TH 1D6EA 4K9EL 4MA1C 1L4IA 1U93A 2PNDA 2OL3H 4YHIB 4ZFZA 1BX2B 4OLVL 5HYFA 2JJSA 2VERN 3GSXB 1JNLH 3HE6B 5D2NE 2APBA 5CWSB 4XMPH 3QEHB 1J0YA 1UCBH 4MAUL 3VWJA 4WWKD 3U4EA 3GMOA 3P11H 4LDOB 4WFEE 5TE7L 2EO1A 2HAZA 2PCPA 1TITA 1X4ZA 5J1AB 2YUZA 3UO1L 1CGYA 3L3OA 3CVHH 4QHUA 1F2XK 4Y5YA 3MROB 3S37X 3UTSE 2VYRE 1J1OL 5F44A 2I9TB 2VXQL 4XBEL 4XAWL 3KPMA 1AJ7H 3C2SA 4LSUH 3IF1A 4FHBD 5K9JH 3MNZA 1XGPB 1H5BA 3VD4A 1BZ9A 5FYKU 3SDAC 3ZYJA 1Q94B 2H2PC 3JZ7A 5HVFB 3UYRH 3PP4H 5I6XB 2CRZA 5DMGD 2MKWA 4IS6A 3IFPA 4PJDE 3V4VL 4PRPD 1Z5LA 3HZVA 3VI3E 2IPUK 2XWTA 5CUSH 5F7EL 4TUOA 3QDMB 1MFAH 4HS8H 1BFTA 1MHCA 2PETA 4MD0B 3SQBA 4PV9A 5E2TL 2Z91A 4H1LH 5EBWB 1QD0A 4J8RA 1EFQA 2VDOL 2Z8VC 5GS2H 3ZL4H 4BUGA 5FYLE 4X8JB 3RWHA 1ZA3B 1MCPH 3HAEA 4GAJH 1FNEA 3UEZA 1II4E 4HJ0C 4LCCA 4DKEH 1XEDA 4OZIE 3QDJA 1D6VL 4X9HA 4W6YB 4F7TB 4Q9CA 1MREL 1G7IA 1UB5A 4R4ND 5CZXD 2HFEA 1Q0XL 1BEYH 4X6DF 4EDXB 1Y6NR 1K3IA 4NDMA 5E08H 2ICEA 4P3CL 4ONHA 1JV5A 4OCWL 4PJHA 5DQJB 2IAMA 5E2VH 1J1PL 5DUBA 3HMWL 4HWEH 1NEZA 3BWUC 4TVPD 1ZA6B 2VDRL 1PEWA 3GK8L 5SV3A 3SGJA 4L9DA 4XBGA 5EWIH 3RU8H 1N8ZA 2VR5A 3B6SA 1W0WB 2P5WE 4PJAB 3WJJC 3RZCC 1KJ3L 3FB5B 4PGCB 5B3JE 4G3YH 1XF5A 4F2MA 1TDQA 1P2CB 3FONA 1U8OA 4PJXF 2DQDH 3QXTA 5DJZB 2Y72A 3QIBA 4LNVA 5EPMB 1J0IA 5EU5A 4JQIH 3KDMB 3HC4H 2X1OA 3P2TA 3SY0A 3S35X 3G5VA 1RQ5A 3OB0H 2N7AA 5KS9F 3NIFF 3P4NA 4YHML 4KVCL 3HLAA 3RY4A 5CIPB 4KKAD 1R5WB 1YNTB 1UFUA 4M48L 3A6OA 3RPIA 3OKNB 2FX9H 4Y16D 3RGVC 2DQEH 2DQFA 3EGSA 5J6HA 5IOPA 3JV4A 4YIQB 4HHAB 5C92A 1JNLL 2ARWA 4XMPL 3LHPL 3ARDB 3GSNH 1U8KB 4ZTOH 1ZANH 2EE6A 4YFEA 1UM4L 3FT4B 3C5JA 3L9RB 5GJTH 3T0XA 1AGCB 4ZFOA 3SPVB 3SOBL 2APFA 4XNXL 4KWUA 5CMAA 3L7FA 4H8WC 2EC9U 1NMBL 5DHYB 3F58L 3KVQA 2OJEB 1YN7B 1PQZB 2IG2H 3MLWL 3KPOB 3RWIA 3MZGB 3TCLA 4DQOH 1LE5A 4GLRI 3UYRL 5IK3A 3AS1A 4KAQH 5F88A 3RVWC 3HNSL 1U8LA 4XH2B 3H2WA 2VLJA 5GGTH 2EIZB 4NT6B 2GK0B 2EYRB 5CHNA 3QUKA 4YDLB 1FV1B 3V8OA 4NNPH 4X6DA 3STLB 4LEOA 4X7TA 3LH2H 5GS0L 4K7PH 5SWSA 3C6LA 2HJLB 3O0RH 3OAYK 2A83B 2WP3T 2HLAB 1QOKA 1G7QB 4HIXL 4MLSA 3KYKH 4G43A 4LF3B 2X4OB 1NCBL 4DGIL 1IC7H 4H0IA 5CJXA 1WQVT 5EU4B 1I9EA 5T33H 3ZHLA 5DFTA 3ARFB 2AV1B 4WW2F 4P4KB 4PGEB 1AHWC 4PV8A 4KROB 1DANT 4HDIA 1JF6A 3HNVH 2YD3A 4FZEH 3QNZB 1CICD 3MFGB 2A77H 2JJUA 3NAAH 4PJXA 4JHBA 4OCYH 2NY6D 5I8CB 3MRNB 4ZNCD 1U3ZA 4P2OB 2HTKD 3MV7B 5KS9A 5KVMC 3CUPB 3HFMH 4NWUL 2A9NL 3WXVL 4OTXL 3BDXA 3MRMB 4KRNA 4UZGA 2E8YA 3K1DA 1I85C 3W82A 1N64L 1UXWA 4HK0B 1ORQB 1MCOH 4NOFA 3D39E 2DQDL 5K59F 2K7PA 3ARBD 5AD0B 3HC4L 5HVGB 3SDCB 2SEBB 5DFWH 4FG6D 4PJEB 4PRHB 3T4YB 1UQSB 5D6CB 5EIIB 3K8MA 3HE7C 3PNWB 4ONFH 4IRSA 5ITFA 4KHXL 1CDCA 2R9HC 5IB4A 4QHMA 3CC5A 4Z7WB 4O02H 3H9YA 1CGVA 4XP9H 4IM8A 2DQEL 3UJIH 5IEKB 2B7DT 2F19H 2CUHA 4IBLT 4PTUA 4RNRB 3TWCH 1RJYB 1HINL 1HHHB 4J4PA 4LLUA 4P2RA 3LPFA 5E8NA 4OGAC 3ZHDA 2FEDC 1YNLL 4CMMB 5JIPA 4ZTOL 1ZANL 2VL5A 1G7JA 3EYOA 2EDDA 4K8RD 1HCVA 3DRQB 5C2BH 1OWWA 4OBSA 5ISZB 4L4TA 3IB4A 1Q9LB 1NBVL 1BJ1J 5HI4D 2V7NB 1D5IL 2CXKA 1E28A 2ARJA 1DQMH 4NKOB 1GHFH 3OKOB 4Y4FA 4XB8A 1HDMA 1F8TL 1CIDA 1AC0A 4GOSA 5DRZA 1XGYH 3DRTB 2VZTA 1V05A 4PRDB 4GKZA 1KACB 3NH7L 4G7VL 5IMOB 3LRSB 3T0EE 3O2WL 4KAQL 3O6FD 2VDNH 3UCRA 3GB7A 1GAFH 3G04B 2YN5A 4WW2A 3DYPA 5GHWL 2OXGA 3VXOA 4ODVL 1XF4A 1OTSC 5DJAA 5DJXB 5FCUH 2HH0H 3PWUB 5L0QB 4JHWH 3LH2L 4YGVA 4XNQA 3CH1B 3BPCB 4NOBA 5T1DH 4YFLI 2EO9A 3NIDE 2EDFA 3TFKD 1MFNA 1MIMH 5DUML 5TQ0L 2C3VB 2P42B 1RJCA 5TDNB 1IC7L 3FKUS 2XA3A 1JPST 3ALPA 4XVSH 3I02B 3P77A 4XBPB 4JHAL 4DJMA 5IGXH 1XIWD 1DBJL 3PP3H 3BPOC 3QB7C 5EU7E 4FZEL 3W39B 3FO2B 5ALBH 1GIGH 4PJCE 5GRZA 2LAGB 3H9ZA 1JL8A 4LHUD 1YY8B 1QRND 3NVQA 1ND0B 4LLDB 4BA8A 3MC0A 4LNRA 2NY2B 5FOBA 2CK0L 2X1PA 1MI5D 1A6UH 1GGCL 2DWEB 1A64A 4L3EA 3BP5A 4M5YH 4J23A 4X7SL 3ZKXB 3BVNB 3MUGA 2D9CA 4UIMA 2I07B 5E7FA 4XCEA 5DA4A 5DHVH 4E0RB 4ORZC 4NUJA 4QOKA 1BD2D 1JPGA 2MNUA 3KPPA 4N0CD 5I66B 4OQTL 2G75B 3BP6A 4NPYB 4B41A 1AQDB 3TYGH 4GG6A 5E94B 4JRXD 2GFBB 3B43A 1MCLA 3LN9A 2YD1A 2J8UF 3LS5H 1FRGH 1ORSB 4OCXL 1T1XB 5KJRH 3F6IA 4OZHA 4O2EA 5FB8B 4X5XA 4AIOA 1NJ9B 5JOFA 3NZHL 3R1GL 5IUSA 1L7IH 4MA8H 5I1DB 4YZFF 5EC1B 3V7AG 5D7LD 4XMLL 1KEGL 3O4LD 1ZGLA 3P9WB 2Y7QA 4IRJC 1DVFA 3TEUA 3O3EA 1DQML 3S36H 4FFZH 1MUJB 3MXWL 3OF6D 4MS8C 1ZS8A 4CL7A 3DXAD 3DX9A 1JPSH 1UH3A 5C0AE 3QYCA 4JM2C 1A14L 4YBQD 3DLQR 1XGYL 4IRZH 1BZ7B 4K94L 1I8MA 4MQ7A 3PJSB 3IVKA 4OUUB 5IJVB 3O3DA 1FNAA 4P2QD 1CTOA 4P4RA 1F13A 2HN7A 1CN4A 3VFVA 1JFQL 1MLCB 2VTFA 3BKCH 3I3BA 2HMID 4GAGH 5GGRY 2VMFA 2VLKD 4ETQB 3VI4F 3EYFA 2FATH 5F7HA 2WIMA 1PSKL 4X5WB 3QIWB 5FCUL 2HH0L 2X4NA 1FE8L 4OSUH 2A6JA 1RIUH 3DUUA 4ONGL 4JHWL 4RAVB 1KN2H 2ZNWA 3DVFA 3ULVD 3C6SA 4DFIA 1WISA 4MAYD 3R06A 1YEFH 4RSVA 1F4YL 1UWXK 3E0GA 1MIML 4O58L 1KJVB 2AP2A 3O6KH 1DSFL 1V3LA 3PWVA 1T66C 3G6AA 3IJSA 4GLRH 5A2FA 2XRAL 3NIGF 5KSUA 1IKFH 5BRZD 2CDFA 4Q9BA 5I1GL 2OK0H 1T6VN 2FHBA 5SWZB 2Y5EA 1YMHB 7FABL 3ISWA 3ZE2E 1F97A 3W0WA 2GJZB 2YUXA 4PJBF 4H20H 4DAGL 4NCC2 3Q2CA 3V6BR 1T1ZB 5J6GB 2O61B 1LO2L 1YN6A 2AJVL 3LS4H 1OQOA 3FB8B 5KVGH 3IFOA 4M5YL 2HVKB 4J3TA 1CG9A 3U7AA 4PPTA 1BFOB 2J8UA 1DEEA 3QXVA 5C6TH 4EVNA 4RMUA 1EGJH 1QTYT 4YDJA 3QEQE 5KAQG 3JWDH 2Z92B 2E7HA 1AD0B 3I85A 2MCPH 4PJ8A 4GW4A 4MQXD 2X05A 5C0FB 1FPTH 1RUMH 3N9GH 3FQNB 4P5TA 1JHKH 43C9A 5IVNA 1M7IA 1P4LA 1G1YA 4HJJL 2XQYG 1IJ9A 2Z4QB 2IGFL 5IWLC 1A7OH 3IXAA 4JJ5A 4JZJC 3STBA 1PX4A 5FIEA 2NW2A 2CGRL 3WS6C 2OI9B 3C5SA 1KCVL 1ZWIB 4OV6F 3T0WA 2XN9B 1AGFB 4OZGB 4NNYB 2VLRA 1V7MH 4OF3A 35C8L 4M43H 2X6MA 5HSFA 1UJ3B 5KTEL 4LARH 4PREB 4XP5L 2DICA 5FK9A 4WUUB 5DJ0B 1YA5A 4JAMA 4NO0A 3FN3A 4OD1H 1JE6A 1UWEL 3WN5C 1WWAX 1E6OL 3S36L 1VB9A 1S7RA 2BXZA 1JPSL 3GBML 4IRZL 4K3DL 2BNRA 3TN0C 1HOCA 2R2HB 1QLRB 1YYLL 3H42H 3ULUD 1WWBX 4EOWL 1N4XL 1Q9OB 5TPWH 4JO1H 1JGEA 3REVA 3PIQA 2P7TB 4HUNB 2P8MA 5FF6A 3FOLB 3S34L 3VXPA 4F37K 3RL2B 4U0QB 3LQZB 5KVEH 1QP1A 4GAGL 1OARL 1OAYH 1RUQL 3RGHA 4KI5C 5IVZB 5C0BA 5CSZB 5BQ7A 4L9LB 4TRPL 3FQUA 3O45B 5IM7A 3BPNC 5C9KA 1AXSA 2IBGA 3CLFL 3DO3A 1YMME 4LGSB 4G6KH 2DYPA 2J6EA 1S5IH 4OGYH 1G0YR 1E4XH 3TYFA 3O3AB 3BP7A 3HC3L 3RWJA 5BW7C 1K4DB 2QSQA 1T6WA 5IVXF 1IKFL 1CDGA 1K6QL 1F90L 1SJEA 3GNML 1LE9A 5T1KA 3AVEA 4CDGC 2VIRA 3QQNA 4QYOA 2LAAA 4P23D 1MCCA 1MFEL 1QR1B 1OAZH 1A4JB 4GG8A 1SYSB 5DD3L 2H32H 1VSCA 1KG0B 1E4KA 3U1SL 3UTSD 1A3LH 4FQQA 2P8PB 1KBGL 3L5HA 3QPXL 1M05B 1U92A 4APQC 4Y88A 4NO2B 3QDME 4DZ8B 3A6CL 1LILA 4QXUH 4W4OA 5D72L 4K3GA 3ZDXF 1XMWA 4TVPH 1I9JL 3DNKA 3JTSA 4R4BB 1KFAL 4LSPH 3IDYB 5GIRB 1JBJA 4NO3A 1B6UA 1WUNT 2L4OA 1LEIB 2WBKA 3P0VL 1D6EB 1FORH 1U93B 3OGOE 1M7XA 4EIGB 3W5NA 4ZFZB 4NIKB 3VWJB 3KPRE 4OIIL 2IWGA 1G1CA 3U4EB 4OLXH 3GMOB 2B2XH 4KH2A 2VZVA 5FYLD 2PCPB 3U4AA 1I8LC 2AKRB 5E5MB 3L3OB 5TH2B 4AEIL 1NUNB 2YA0A 2X44D 4Y5YB 5DK2A 1PDKA 5T3ZE 4XMKL 1FNHA 2DLTA 3KPMB 1JNHA 1A21A 5F9JA 4POUB 3IF1B 4ZPTA 2ADFH 1XGQB 4KK9D 5HHNA 3DIFA 5D9SB 1P9MC 1UH2A 2X4SB 3MNZB 4RRPG 4YK4B 3BZ4A 4NN6B 1H5BB 4P0DA 1UVQA 2WBJD 4HXBL 1BZ9B 3WO4C 4E41A 2AABL 1SEQH 4BZ1H 4X8XA 3U6RA 2F5AH 4IS6B 4NHCH 1ODAA 3IFPB 2P5WD 1Z5LB 3OB0K 5DR5H 2PYEA 4WVRA 4XCNA 5HHOE 4PJ9A 4ZSOA 3QFJA 4LVOC 5JOEA 1I1RA 5IVXA 1MHCB 4PV9B 2D2OA 2DD8L 3QUMA 2Z91B 5L7XL 1AFVL 2AXFA 1L7TL 4J8RB 3B9VA 5KZCD 3UTTA 5IBLD 1OSPL 4IIQA 4YHOH 4TNVK 2HLFD 1NLBH 3HAEB 1Z0MA 2XZAH 3MFFA 1FNEB 1OSZA 2YMXL 4HGMA 2COQA 4LCCB 2AEPL 3ILQC 3QDJB 1RY7B 2F15A 5BS0E 4ELMF 1G7IB 1UB5B 5EIQA 3HRZA 4RFNC 3HR6A 5A43C 2BY2A 4Y4HD 3MLXL 2FJHA 2ZCKH 1LO0H 4M1DL 1K2DA 1T21A 1FGVL 2CD0A 3ARQA 3VE0A 1H3TA 2ICEB 4ONHB 4Q9QH 1JV5B 3B9KC 5JHLH 2IAMB 5DUBB 1ZV5A 1NEZB 3S3JA 3C60C 3RVVC 1AKJD 3SKMA 4AL8H 2D3VA 4D3CH 1DQJA 1I4FA 4XBGB 4RGNB 1FZJA 1N8ZB 3B6SB 4XZUB 1B0GA 3HA0A 2A9ML 3BD3A 3ILPA 1XF2A 4YPGA 4R97C 4DN3L 2K9UA 4NJ9L 3RIAK 4OCRL 3O3BA 5A2KH 1XF5B 1UKTA 4D0BA 4F2MB 2I24N 3FONB 1U8OB 4NRYA 1S3KL 2EYTA 5EU5B 3QIBB 1RULL 4LP5A 1UKSA 4TVPL 1V8HA 1BVLA 4WTXA 2CRIA 3SY0B 4LSTH 3OJ2C 5HDBF 3VH8A 3G5VB 1IEAA 1G7LA 3VW3H 3P4NB 3QWRA 1IT9H 4RGMB 5CCKH 4XXCA 4BKLA 3HLAB 4HGWA 2L0DA 3L3KA 2VXTH 5I74C 4AM0A 4P9HL 4LPTA 1FORL 2X89D 2NZ9C 4LSSL 2DQFB 2NTSP 1TLKA 3EGSB 3OB8A 5IOPB 5J6HB 2A1WL 2NNAA 3JV4B 5E6ZA 3FQXA 4I13B 4NQSA 4YHPA 5CEZE 1OGTA 3LEYL 4QRUA 2B2XL 1N5AA 3IS0X 4KRPD 2JCCE 1IE5A 3QG7H 3INUL 4ZAKD 2YKLH 3C5JB 4WWKC 1KLGA 4LEXH 3BQUD 1MHHA 4YXKL 1NBYA 4PB0H 4ZFOB 4TUKH 3O11A 1G0XA 4H88L 3I3EA 1OHQA 5CMAB 3L7FB 1KN4H 4Z8FH 2PXYC 1DQQA 3AROA 1VACA 1MJ8H 4K8RH 4NBYB 3LRGA 4JKPH 4PJEE 2AW2A 2X4PA 3RWIB 3SDDA 3TCLB 2EKJA 1LE5B 3DUSA 2NY7H 4PJ7A 5IK3B 3MLVH 4NHCL 5F88B 1RVFH 1TXKA 1U8LB 3WFBH 3ZYIA 2AVGA 2VLJB 5F71A 5DMGC 1BJ1H 1IFHH 1CDJA 3NTCH 1QLFA 5HVWA 2EE2A 2R2EA 3WV0A 4KTEL 1CD8A 4UAOC 5CHNB 3QUKB 4C56A 4DN4L 4ELMA 3D39D 1OAXL 2YD9A 3QDGE 2YD8A 3O2VH 4X6DB 3MCKB 3H3PH 4LEOB 4X7TB 3PG2A 4PD4J 5SWSB 1CT8A 2NMSA 4JPVH 4KXZI 1HHIA 4G43B 4Z7VE 4ZQKA 5T5FH 1NLBL 5MP6L 2XZAL 2R23A 2QL1A 2PTUA 4TSAL 1QFWL 2AJXH 4MB4A 4ODXA 1NC4D 2F74A 4PV8B 2H8PA 4PJIF 4JKKA 4HDIB 5GGVY 4FQXD 4NHUA 4KK6D 2ZCKL 1UT9A 4R4NC 5CZXC 5JW4N 3EUUA 1RHFA 3H3KA 2VXUL 3M07A 3VXSA 1P1ZA 3HR5A 2NXYD 4BUHA 5I15H 4U1MB 4JN2A 3LY6A 3WEXB 5KS9B 1G9EA 1YEHH 3P9MB 2AK4A 5C0IA 1OT1A 5GS1C 3TVMD 3PWNA 1D9KC 4I0PB 1XR9A 4BFIA 4GRWH 5F8RC 4PJGE 1T1WA 1LDPH 4MNQE 5IJKA 2R0KL 3BW9A 4LMQI 1INDH 2PKDA 2NXZC 4JPIB 3UJJH 3T0ED 1Q1JL 1CFTA 3CZFB 4OQ1A 2W59A 1CFQA 1KB5L 5CCKL 1T20A 4L1DA 5ITFB 2EKSB 3QAZC 4HLZG 5IB4B 4QHMB 3CC5B 4HWBH 4DTGH 3N0PB 4KKAC 1A6AA 5E8EA 1VGEL 5GGSA 4Y16C 1R3IL 2IFFL 5CLWA 4DK3A 4PTUB 3ETBF 4WI7A 5D5MB 4P2RB 4LLUB 5E8NB 1FLRL 4KQ4H 5LXGL 3PP3K 1PY4A 4NKIL 5LWYH 5AUMA 2VL5B 1G7JB 5LGHH 3EYOB 1VGKA 4L4TB 1NKOA 2MCG1 1U8JA 1NUDA 1E28B 1CBVH 1QBMH 4Y4FB 2W9DH 4UV4L 1HDMB 1S9XA 1IRAY 5K9OA 4F7EA 4TNWK 4C58B 4TQEH 3D48R 4ZS7H 3WL9B 3UTOA 5DRZB 1RFDH 4HUUB 4YAQB 4I1NB 4I18C 4GKZB 5IROC 3R8BB 3BZEA 1A9EB 1MCWM 3VD5A 4JZNB 4XB7A 1GGUA 2Z93A 3H8NA 5FDWA 4QRTB 1IBGL 3GB7B 1RVFL 4GAYB 3D85D 1XF1A 5LCVH 2NY4D 2E27H 5IB3A 1VEPA 4OFKA 3PXHA 4PJIA 3VXOB 5DJAB 4I48A 1DTUA 4UBDD 1MLBA 4OZ4A 3MMEA 5D96B 5EOQL 4OLUH 5JQ6H 5I76A 4XGZA 5ICXA 2J4WL 5EA0H 2AQ1A 3KR3H 1QUNA 4RA0C 3P77B 1UWGH 3RX7A 1G6RA 5DJ8A 3GGWA 3ULVH 3QRFM 3O2DL 4EN3C 2V5YA 1KTDA 5T3XL 4OI8A 4M6AA 1Y18A 3EIFA 4C54A 2IANB 4Z7QE 3N85L 3CSBA 1CICC 1T7XA 2R8SL 3V52L 5FOBB 2J88H 4YGAB 2GYSA 1MPAH 3DX8A 1CWVA 4L3EB 5F1KC 3BP5B 1PX3A 1MQKL 2ZNXA 3HUJF 4I3RL 2HTKC 3EO1A 3PHQB 4Z76A 3BEWB 3QO1A 3WUWG 4UIMB 4POZD 1CFVH 2CR6A 4XCEB 1C5DB 4JGUA 4AY0A 2DMKA 2Q20A 5C0AD 3AMKA 1JNNH 4QOKB 1JPGB 1N26A 5C08E 3KPPB 4LVEA 2BC4A 2JB6B 3RIFK 1AY1H 3UPRA 1A6VH 3MV9E 5F21B 3BP6B 4GG6B 4PRIE 1P7KA 3E6HA 1NAKL 5EORL 5I19H 1BBDL 5FUZL 5DUPH 4Y2OA 4HKZA 4O2CA 2ZOLA 2VAAB 5J12B 4NM4L 4OZHB 4WUKH 4O2EB 4X5XB 3SDAA 5JOFB 1U58A 3VDAA 4RMQA 3VXMA 4PP2B 4KQ4L 4QTIH 4RGOH 1BLNA 4QEGA 5ACZA 5EIVA 1XCQB 4LLVA 5HDOA 4GRLA 1ZGLB 4JFHE 4QRSA 1ZVSA 3WHE0 1GJIA 1HQRA 1R5IA 5FUOH 1DVFB 4K8RC 1LVEA 1VA9A 5I1EL 3O3EB 2AJSH 4K2UH 3SDXB 1KB9K 3EOTL 5HI4C 3DX9B 1HIML 2R0ZH 4F57L 2BY0A 2CKBA 2P24A 5J57B 1I8MB 4KDTC 4MQ7B 5D2LE 3IVKB 3MRBA 2VZSA 4HF5H 5DD5H 3GBLA 3ZYZA 1F4WL 5DGRA 1MCKA 3K8KA 3CDGB 3QI9D 4NKDA 4P4RB 3NCYS 5KSAB 3BXNA 5KW9L 3VFVB 3O6FC 2E27L 5I1HH 3QEQD 1FYHB 3EYFB 4DKFH 1P5VA 1TZHA 4AT6A 3ULUH 2X4NB 2A6JB 1EZVX 3DUUB 2DIBA 5DDHA 3C6SB 3B5HA 1AXTL 3PWPB 3R06B 5JQ6L 2B0SH 4JFFA 3FMGH 3FN0H 3OSKA 3WJJA 3BX7C 2EDRA 2V9QA 4YH6A 1O7VA 3TFKC 3PWVB 3KJ4C 3G6AB 3IJSB 5ICZA 3HUJA 1PBYA 2CDFB 2V2TB 1B6DA 4D9RE 4RIRA 4X80H 1XIWC 2QHRL 4J2XA 4Y5VB 1CGXA 1Y0LA 1IC1A 1S5HA 4MCYA 1FG2A 2DI9A 5BVPH 5L9DH 3E6FA 3NCMA 4M6ML 1I3RA 1RZGA 1YN6B 3RGVA 3PUCA 4F37F 3IFOB 4KXZH 1NDGA 4QTHA 4DVRH 3CFIC 1CG9B 3SGKC 3U9PL 1JYXA 1NANI 2J8UB 4EVNB 1DEEB 4G8GE 3PGCA 3OG4B 2WQRA 3OXSA 2OTUA 4KK5D 1G9NH 3O9WD 1OAQL 5E6IC 1NC2B 2CR3A 3V8CA 1L0QA 4QNPE 4P5TB 4MZ3A 3HRPA 43C9B 4YHNB 1M7IB 1P4LB 5I1IH 4N0CC 4M00A 1RK1B 1QO3A 4YE4L 1VESA 4JRYD 4YDVA 1CTNA 2UZIL 2W1NA 1RUKL 2D4FA 2JJWA 4YXLL 4JJ5B 4NM8H 2NW2B 3HE6D 4I0CC 2DLHA 1DDHA 3C5SB 5L6YH 2P5EE 3TO2A 4XTRD 4AIZA 2NTFA 3WFCL 3I50L 1IC4H 2N56A 1F3RB 3SCMD 2VLRB 3OXRA 1WAAF 3BN9D 4HUVA 4QTIL 5JOPD 2G5BA 4UB0H 3V5HA 4RGOL 1YMMD 1FFOA 3MA9L 1J8HA 1XAUA 2M8XA 4NO0B 1ZKAA 3FHQA 4L4VE 5DRWA 5FYLH 2NQCA 1EERB 2CIKA 1MNUL 4G9FE 4WI2A 5EBMA 5L2KA 3VXRE 4FQLH 3A6BL 1VENA 1IQWH 5GS3A 2BNRB 4YBQC 4X6FA 1G9ML 1QFHA 1JGEB 3REVB 1KCRL 2IQ9L 1AHWA 3PIQB 3MXVH 2P8MB 3OAUL 5FF6B 4P46A 3QDMD 5HYSA 3LDBC 5I1HL 4JFEE 3ZMRA 1DQDL 1HWHB 4FS0A 3QCVH 3U4BH 1UB6B 2FGZA 3BT2L 5C0BB 3T0AA 4DKFL 5BQ7B 4AIXA 2HMIC 3VGGA 3CFEA 3ULUL 1ZAGA 3FAXA 4N0RA 2XXMB 1AXSB 1H3UA 3MRKA 1WC7A 3MLUL 2B0SL 3SKUD 1FSKB 3ULVC 4ERSH 4W4NA 1I85A 3TYFB 1CGSH 3BP7B 2QTEA 4HUWA 5BZDA 4XNYL 4FTVE 2E6JA 5H94A 3DVNA 5ACMA 3MBXH 4GT7A 4NSKB 1SJEB 3KPRD 1LE9B 1B0WA 5T1KB 3OX8A 4AJ0A 2X9WA 2VIRB 4QYOB 5J11B 3L1OL 5IMMA 4ZODA 4GG8B 5B21A 1BIIA 5IIEA 3GHBH 4R8WL 4G5ZH 2WP3O 5T3ZD 4FQQB 3EYSH 3CK0H 1U92B 2K3TA 3J8F7 1OAUH 2VUOA 5IT2H 3F7RA 1WEJL 5BOZG 4G7YH 3RY6C 4GS7B 3L3JA 4HXAL 1LP9F 2VNCA 4U7KA 3K8LA 1G9NL 1S7UA 4JVUA 5HD8D 3UTQA 4LLYA 3LD8B 4NN5B 3JTSB 1F11A 4MXVE 1WAAA 1U91A 3VJ6A 4LCYA 4MQXC 3IXTB 3QA3A 1QNZH 2ESVE 1X5AA 5HHOD 1A7BA 2CLZA 2NY3C 4PJHE 1KLUA 1GGIH 1A7PL 1R3KB 1B2WL 3GJFK 2XKNA 4UB0L 1IC5L 4RGNE 3IAPA 4H1LA 4Y19B 1FVDA 3RIAF 5BS0D 5DK2B 1EK3A 1BFVH 3NCFB 3QXDB 4PBWD 1JNHB 1NGZB 4P5MA 3DIFB 3RA7L 5GS0C 1S7SA 2WWMC 4I4WA 3BZ4B 1UVQB 1KTLA 4XCCH 5TDPA 4NP4H 4E41B 5E56A 4Y4KD 4Y5XC 1IQWL 1NGPL 2EXYC 4JFDA 4UIKL 2B4CL 5AZ2L 4CADA 2X9XA 4HIJA 3FB6B 5E5RB 1L6ZA 3P9LA 5IB5B 5D70H 3RTQA 2GJ6E 4HKBA 2QLVB 4X0KA 3TH2T 3F5WA 3K2UH 2DI7A 4XCNB 4PJ9B 5FA3A 1A6TA 2R4RL 4ZSOB 3QFJB 5IVXB 3WIHL 1YJDL 43CAA 4RWYH 4KMQA 2R69L 3QUMB 3NZ8A 1SVZA 1U42A 4X98A 7CGTA 2AXFB 2JB5H 2BCKA 1I9RH 1YEKH 1F4AA 4IIQB 3ZKSD 2DQJH 2X2YA 4ZOBA 1OSZB 3MFFB 3SJVA 2A73A 5DJ6A 1U3JA 4U2ZA 1IM9A 1EO8H 1OQXA 3TNMA 2I5YL 4KROD 1CGSL 3HRZB 2IJ0C 1UXSA 5I1CH 2FJHB 2PO6D 4R6UA 1K2DB 1NPUA 1T21B 2CXGA 3VE0B 5LVEA 1U36A 2HJFA 5CEZD 5EBLA 1TETH 4LSRL 3MJ9H 4U1HA 4NFBA 4P2OD 5HY9A 3RVUD 1NGQH 2N1KA 2WANA 4M7LL 2VO5A 1IQDA 2E8ZA 3FT3A 1I4FB 1H8SA 3MUHL 1FZJB 4P23C 3VWKB 1B0GB 4MJ2A 3ILPB 3GSNA 1XF2B 2EEAA 3EYSL 4GMTL 1J87A 2VDMH 2LTQB 1FZMA 3V6FA 3IKCB 3O3BB 4OLYH 2ENSA 5J7CC 4C4KT 4D0BB 4ZXBA 1EEQA 1CZ8L 1EH9A 4EI5A 2EYTB 5EZLA 2BK8A 3NCBB 1RZ8B 5GQBA 5IBUB 1BVLB 2EDHA 3VH8B 3X17A 5IHZA 1IEAB 5JDSA 4TULH 1BMGA 3UTZA 4YHYC 1G7LB 4WTZA 5GRYA 1WZ1H 4JO3H 4P3WA 4HGWB 2FHCA 4PLKC 2WLZA 3L3KB 4XVTH 1IARB 5D93C 3U30B 2LU7A 1RUPL 4AQ1B 1IGTA 4ODWB 2NNAB 4S0SD 3QDGD 4NQDA 1KELL 4LVNC 3FQXB 1YYMH 5IMKB 1B4JL 4NQSB 5GGTA 1S9WA 4YHPB 1N7MH 4PJXE 5DQ9A 1NANH 1OGTB 1QKZH 4QRUB 2AEIT 1BAFH 3VCLA 5CKGA 1N5AB 1V3MA 1MF2L 1XZ0A 2XZCH 2EH8L 1A3RH 3QISA 1RZIA 2GY5A 4AZ8A 1KLGB 5KS9E 5DYOA 4M9PA 1MHHB 3NIFE 5I1LA 1NBYB 4R4FH 3V4PH 4A6YH 1FNFA 1JN6A 5MENA 1BFVL 3SE8L 1MEXH 1NUGA 2EC9T 2XWBA 4OIAA 4WI4A 5C0EA 1LO3L 3MRQB 4LCIL 3N1PC 1UM6H 4YDKH 4EUPA 1KIQA 4BJLA 1DQQB 5KANG 1VACB 3QXWA 3U7WH 5F1NB 1PG7W 3FJTA 4KK9C 4EXPX 4XCCL 2X4PB 1GRWA 3SDDB 5FYJE 1IGFH 3DUSB 2WBJC 2J3SA 4PJ7B 2V5SA 5D7JD 3U46A 2E6PA 3TF7C 2JKXA 3TBTA 4WJ5A 4Z9KB 1QLFB 4LIQL 3SBWC 2QEJA 1E4JA 3F8UB 5IB2B 3LZFH 4R90H 4C56B 2DJUA 4GRMA 4S1RH 3V5KB 1KEMH 2DIJA 4IDLA 5EZIL 4QY8A 3TA3B 4MNQD 1OAKH 4P2RE 4WTWA 3WXWL 4CBPA 4GBXB 1CT8B 2NLJA 3EZJB 1CE1H 1HHIB 3ARVA 4XNZC 3O8XD 4ZQKB 2WMPA 1FFNB 2R23B 1A1NA 1X4YA 5B8CA 1S7XA 4HEPG 4NZUL 3WSQL 4OQTA 2HLFC 1DANU 1XFPA 3FHAA 2F74B 2H8PB 2DM7A 5T1LD 5DEGA 4YHLL 4WWID 1MRFH 5IV2A 1M4KA 5D1XA 1R24A 1DBBH 1KXQE 3NABH 1TETL 3JUZA 1WTLA 4K71C 5GRVK 3VXSB 4FNLH 1A6WL 1P1ZB 3HR5B 5FECA 4LQFH 4JN2B 2VXSH 2DQGH 1A02N 2AK4B 4OCMC 1ZK9A 1BM3H 3WS6A 5C0IB 3CXDL 1OB1A 1F00I 4OI9A 4NZJA 5E8DL 3DUHA 4D9QE 3GIVA 4BFIB 5E2WL 5I0DA 4IMKA 1HYRC 1T1WB 1QSZA 2XZQH 5GGUA 4F15C 3T2NL 1JPTL 1OWRM 3BW9B 5JQHC 3GFUA 2P48B 5DVLA 4YX2L 1U3HA 5FYKL 1MWAB 1CFQB 5GJSL 1T20B 2XFXB 4NBZB 4JQXA 1W0VA 3QNYA 4TN9A 1FZKA 3WN5A 4AENA 1H8OA 4GKSA 1LQSR 2XACC 2Q6WA 5E8EB 1LK2A 3PGFL 4XX1E 1QQDA 3VG0H 3S36X 4PUBH 4IDJL 5FAAA 3SE4A 5KN5A 4HWUA 4YQXH 4CVUA 4OLZL 2XZCL 3L3GA 5AUMB 3G6JA 2V17L 5T1MA 4IJ3C 1VGKB 4L3EE 2AJYH 1ZLSH 4KRPC 4XC1H 2EH7H 1U8JB 3V4PL 4N0UB 3C2AH 4ZAKC 5D1QD 4HK3N 5I73C 1MEXL 3BQUC 3U0PA 3QZWA 1S9XB 2UWEF 4RQQA 4X9IA 4F7EB 5JZ7C 5FKPB 3E1F1 5K9OB 5L8JB 1F6AA 5JTWA 4D9LL 3BZEB 1OPGL 5CINL 1AO7B 4QRPB 4OF8A 5FDWB 4XHJD 5A1AA 2EDKA 2EIDA 3WNOA 5CEXB 2X1QA 5IESH 5SX5H 5IB3B 3UTPE 1RZ7H 1SJHA 4W6WB 4PJIB 2D7QA 2X70A 1MLBB 4XNUL 5C08D 3LRHA 2K7QA 4OZ4B 3MMEB 3PL6A 3C8DA 3MV9D 5C1MB 4PRID 4Y1AA 4OM1H 4G6JL 2WAHA 5CEYB 2X5PA 2YN3A 4RAHA 2M26A 4LHQB 2KUTA 1T5XA 2ID5A 4HLZH 1KIPA 4G6FB 1G6RB 3V0VA 3GGWB 4V1DE 3WNNA 3MRCB 2Y6SD 5D1ZA 5F7FA 3P30L 1KTDB 3GMLA 1Y18B 4FQXC 4M5ZL 3IFNH 3NABL 1I1AB 3MOBH 1U8QA 3W9DA 3JV5A 3BRFA 2QQKH 1IGIL 4MA1B 5DC0A 3DX8B 4JFHD 5I1KL 5F96H 3UBXG 1N0XL 5D7IA 2NXYC 4WGVB 5HGAB 4Z76B 2DWDA 3BJLA 3EO1B 3T2OA 4KKCD 3QO1B 5EFIA 3T3PF 4O51A 1ZTXL 2GUOA 1A22B 5F6HI 1BJMA 3T0DA 4FMKA 1UA6L 1JZ7A 1P4IH 3MNVA 3TT1H 4KZEH 1QFUL 1MJUL 2XZQL 4UT7L 5D8JH 5IHUL 1C12A 3UPRB 2BC4B 2R0WL 5EC2A 3VG9C 1P7KB 4NQCA 1GZPA 1CDHA 3E6HB 4JEGB 4PLJD 2EDBA 1VEMA 1A1OA 3EO9L 3T0EC 3U83A 2EYSA 4HKZB 3S35L 1P9MA 4Y7MA 4O2CB 1DE4A 3LKSA 2ZOLB 4GUPA 3NACL 3EOAA 5DI8A 4FFVC 3SDAB 1KCSL 1U58B 3MODH 3DYMA 1FYTA 2QQNL 3W0WE 2AXGA 1WZKA 1KENL 4F58L 4YQXL 3UBXB 1BLNB 3L3DB 5ACZB 1TZIA 1H9VA 4LLVB 4GRLB 4ZUVA 2ILLA 4AMKL 4QRSB 2F54A 3KLAA 4PRAA 1HQRB 1R5IB 1AR1D 3K80A 2J8UE 4ZPVA 5JXEC 2ADJA 4D9RD 2OP4L 2H3NA 1NFDF 3GO1H 4NGHL 3QUZA 3G6DL 2CKBB 2P24B 1UM5H 5EU7C 4DGYL 3MRBB 3FAWA 1K9TA 5FHAH 4JCMA 1ROWA 5DLMH 4YZFE 4NKDB 4JB9H 5E6YA 4XC3L 3BXNB 2VAJA 5HYJA 4FFYH 4G8GD 4BH7A 1GOHA 3QHFH 4HKXA 4HPOH 2ZOKA 3T0VA 3KWWB 3TZVD 1U2HA 1X5XA 2EDQA 4IHOA 4L3CA 5C71A 3NCYP 2NY4C 4UUJA 1TZHB 4AT6B 1LNUA 2F5BL 3O6LL 5DDHB 4O9HL 4NKMA 4JZOA 4JFFB 4N8VA 4WO4D 5CSBA 3F7QA 5ETUB 2ZKHL 3SGEH 1U2CA 5ICZB 3HUJB 3GMRA 3KPSA 4YFLF 1T03H 2P5ED 1S78D 2VRAA 3V4UL 5I0ZA 4RIRB 4L8CA 3VI4E 3MRJA 1Y0LB 5IFAL 4Z7UF 2GSGB 4MCYB 2BNRE 5DWUH 1FG2B 1KJ2H 2HTLD 4I77H 2BZDA 3E6FB 4M6NL 2PF6A 1I3RB 3RGVB 2QQKL 1IGYB 5D6DC 5F96L 5DO2C 3MRIB 1NDGB 4QTHB 4NWTH 1HHGA 4L8SA 3PGCB 4L4VD 5E1AA 2DL9A 1MH5B 4XPFH 3K46A 3NIGE 3OXSB 4KMLB 2OTUB 4G9FD 2W0FA 4POZC 1H3GA 4U0RC 3E3QE 3TT1L 1U95A 2FGWH 3VXRD 3MJ7A 4P2YA 4AEEA 3ELAT 4WWKA 3BO8A 2O5YH 5T3ZH 3RX5A 2NX5E 4PJBE 5J89A 4ZTPL 1QRKA 4XWOD 4YBLC 3QR2A 1DFBH 3G9AB 4CU7A 2XTJE 3LV3A 4CJ1A 1RJZA 4JFED 4L5FH 2ZSVB 2MHAA 1IL1A 1FZOA 3LQAH 1DDHB 3VA6A 1KC5L 3IU4H 3TO2B 3VWJD 2XQYK 1TQBB 4AIZB 4FFWD 4FOMA 3ESUF 2XA8H 3U79A 5JIIA 4HUVB 3GRWH 3QXUA 3KS0H 2QSCH 1OM3H 2G5BB 1O0VA 3WLWD 5KSBA 3V5HB 1FFOB 1R3LA 4Y0GA 1J8HB 5C0RH 3RFZC 4BFGA 1X5LA 4RX4A 3OKEA 3H0TA 3H9SB 3QHTC 3U7YH 1ITBB 2HJKA 5CILH 3MRHA 4FTVD 4JFXA 5DRWB 5EN2B 3JTTA 5IQ9A 5FUCC 1O7SA 2DDQH 5DJ2A 3VXQA 1BWWA 3KJ6L