1NGYB

Chimeric mature fab 7g12-apo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mature Metal Chelatase Catalytic Antibody, Light chain
publication title Structural evidence for substrate strain in antibody catalysis
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 41
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2002-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngyB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngyB02
1YNTA 3JWNC 3U4AA 4TVSa 1KOAA 1MNUH 5KSBF 3I6GA 1I8LC 4I18A 3CFBB 3V5KA 3NCCB 1KEMH 1QFWH 3IDUA 1WK0A 3BKMH 4WHDA 1JRHH 4OZGB 3QO0A 3KYNA 4HV8A 3SN6N 2OL3H 1A7NL 2YD6A 2FJFB 5E0QA 4QRSA 4RSVA 4YC2C 4XP9H 3IJSB 4LDLB 2EDEA 3TA3B 3QRGH 3IDYC 1CD1A 2FEDD 3O9WB 4KUZH 3PWUB 4WEMB 1BLNA 5GS1C 1ORQA 1WCBA 3VDBA 1I85A 2P49B 3BP5B 3HPJA 4NC2B 3NZHL 5F6HI 1N6VA 4XCFH 5EBMA 2P42B 4OLUH 4IOFD 5L6YL 2DAVA 4P2OB 3GBML 4MJID 5T3XH 1CI5A 4PUBH 2GITA 3P30L 2BOBB 1G9NL 1KYOJ 1DQML 5KTEH 4R3SB 1OAUL 1Y18A 1I3GL 1YMMD 1YNKH 1TVBB 2X1PA 1ITCA 3VMOA 5BV7C 3EHBD 1U3HC 3SKNB 4K8RC 4DUXA 2Q6WA 2APWA 4PRBB 1HH9B 3H9SA 4MCYA 3H7LA 5HHVH 5EOCL 2YPVL 3TO2B 4CDGC 1FAIH 1ORSB 1WZ1H 3MRIB 4PJ8A 2P43B 4P3DA 1NGWA 2YSSB 4KTYA 2AJVL 4YFLI 4GG6A 2DIAA 1GYAA 4HH8A 4F7EB 3HC4L 5JZ7C 4M7LT 3GMOB 1OT1A 3B9KA 3L3DB 1W0VB 3G6JA 2XI9A 3CFCH 5IWLA 4WW1A 1XF1A 3QHZL 3D2UB 2XXCB 1PJ9A 1A3RL 3AS1A 4YGVB 5EPMA 3MJ7B 4LF3B 3P40A 1T1XB 1HHGB 2IH3A 1FNAA 2GIYA 1LO3H 1TENA 1KXVC 4PGCB 3PWLA 4AEIL 3ZTJG 1ES0A 2OJZL 5GSRA 1DR9A 3EUUA 2V5RA 5D7LB 2JCCE 4QWWD 5FHBL 2P5EE 5K9OA 3KPMB 3QDMA 1A4JA 3MREB 2EKSA 4LBEA 4NRYB 2LV4A 3TT1L 3KVQA 1KLUA 2Z9TA 1YEGL 1F4YH 3UTPE 2JELL 3WKNA 2CDFA 3WDJA 3A6BL 3BISA 3ARTA 3IDJA 1SEBA 1GHFL 4NN6B 5EIIA 5FXCH 2HVKB 3RKDD 3OB0K 3SE4A 5ICXB 2MHAB 2EDRA 3KPPB 1D5BA 3RWHB 2W59A 1D9KA 2NQCA 5IB3B 1AXSB 5C9JA 3BGMA 3FOMB 1Q72L 5DUBB 3MRMA 3G04A 3SJVE 4QRTB 3DMMA 1F3JA 4ZUVB 2UV3A 3Q6GL 4FP8H 1MAMH 2J6EA 4XNXH 5E5MB 3SOBL 5ESAB 3ME0A 3O3AA 4MA8H 3OF6D 2KBGA 4NWTH 3T4YA 4GKZB 5HI5C 3N1FC 1KFAL 1S9XB 4CMHC 1FL3B 4UUJA 2FZ3A 3NBNA 3MROA 3EZJB 2HT3D 1INEL 2Y25A 1KCRL 4TNVF 5E9DB 1WSST 3U9UA 4NNPH 3E8UH 5CMAA 4OFVA 1CDBA 3WJLA 5AYUH 5HVHB 2YEZA 2YMXH 1XFPA 3I02A 2FIRT 1XZ0A 4YO0A 3L95B 3HZYB 4G5ZL 4GBXA 2BRQA 1T89C 1JMZA 1OAXL 5ERWA 2AS5M 2VE6B 1UYWL 1T7YA 1ADQL 5EFIB 3VWKB 3VXUD 3W0WB 5HGBA 1Q9KB 2B1HL 5KSBA 4H1LA 5J1TC 3OQ3B 1RZ7L 3T1FB 3E6HA 3OAYK 2IANE 3N85H 4UNTA 4WWKC 4KI5F 3K80A 1NMCC 5EZOL 2NY1D 4HIXH 4MA1C 4GFTB 4QLRA 4XCYA 5GRVK 4RISH 3A0OA 4YHOL 4LRIA 2Z92B 5DTFA 1QFUL 3Q3GB 5C0RH 2GAZB 1R24A 3RZCB 3ARYA 1UXWB 4LEOA 4P4KD 3LKSB 4TSCL 5I6XC 4LRNL 5IROC 4ZOAA 1YNLL 4O02H 4Z78B 4HKBA 1MHPL 1RQ5A 2VLRD 4M93C 1HIML 4O9HH 2DLHA 4M1DL 4QRPA 1I1YA 2VDLL 1JYVA 4M7LL 2EECA 2D7MA 5C07A 4MMXC 2XWJA 4NO0D 3O45B 3U4BH 1FZMB 1OQOA 3V7MA 4XMLH 4OJFL 5KVEH 2WLYA 1MI5B 2OSLA 5DWUL 3ARDC 4ZFOA 3S4SA 5BRZE 3P9LB 4JDZB 4X5XA 3U0WL 2KZ1B 3CFBA 3EOAA 3FMGL 5SV4A 2AEQL 3UYRL 1NUGA 5DJZB 1BQHA 3MV7D 3V8CA 2YD8A 4YDVB 5F3HA 2UY7A 3VGDA 2WMPA 5E00B 4UB0H 2CK2A 4MCZA 4DWHA 1BECA 2FJFA 4PTTA 1UB5B 4QOKA 4ODSH 2XIDA 1AD9B 3VFSB 2FLBT 1CDCA 1OAKH 1NC2A 2D0GA 4Y2DA 1FZJA 1IGYA 4PJEE 4PJIE 3C8DA 3O9WA 3X13B 4IJ3B 4L29A 2WK2A 3BT2H 3UO1H 1Q9LB 3IFLH 1IGCH 1J1XH 4G9FE 3KPNA 2MSPA 3RWEA 4MXQC 3PXHA 4NO2B 2NW2B 1KULA 4HKZB 3UC0H 3QPXL 1UM6H 2Z8RA 3P9MB 1NAMB 1KEGH 4JFFB 3V0VA 4E41A 1SBSL 4HG4K 2BNRD 1WVZA 2L4OA 4Y16D 2YN3A 4Z7UE 3D87B 4FFVC 1Y0LA 1MQKH 5DJYB 2PW1B 3MRIA 5DA0B 1BOGA 1P1ZA 4XWGL 3RWDB 1T2JA 2YSSA 3SDCC 5JIKA 1JE6A 4HMEA 4MMZC 5F9AC 4AMKH 4FQHA 3C6LB 5D7JC 5IFHL 1EH9A 3TN0C 25C8L 3L3DA 1ONQA 4F37K 1XMWA 3GMLB 4YH6A 4IRJC 1NCDH 4YAQB 1JL8A 1NGZA 3RWGB 3U7YH 2ICWJ 3DX6B 3LQAC 4J7RA 4YHPA 4TPRL 5AZ2L 1L0QA 3QNZB 5DURD 3MJ7A 2FO1A 3KPTA 2WBJB 2J7LA 2Y6SC 1HHGA 5CJQH 1TCMA 4MAUL 4QRRE 1A2YA 2ITDB 3FN0L 3T0DA 4NQEE 3AMLA 5GGRA 2ICCA 4OD2B 2Y36L 3RJDA 2R4RL 3UTSA 1PDKA 5I19L 4OIAA 3OTTA 3IFOA 4NDMA 5FYJH 3REWA 3B2VH 5DK3A 1K5NA 3BOVA 4PJCE 5HI3C 4H5SB 4NC1E 1QYGL 3GRWH 2D9QB 4JM2D 1I1AB 5JOPE 4G6JL 3FCTB 5C0CD 3MFFA 3GHBL 3BGFB 5C09B 2QADD 5FEBA 1CXIA 4K3GA 4P23B 5DQ9B 3P4MA 1FG2A 3LKOA 2E5EA 3K46A 3OXSB 1DBJH 4KTEH 3VFNA 3HFMH 5I1HH 5L9DL 4NPYA 2MPAL 4Y5YC 5CCKH 2HLAB 3CVHH 4NGHL 1C12B 2M2DA 1AXSA 5DUML 4P9HL 4QRTA 1P4BL 5A2IH 2C3GA 3NPSC 5D1QA 1H3WM 3UTTA 1CQKA 5E5MA 4EIZC 2R0ZL 4M6OH 1RUQH 3FQNB 2R23A 5ETUA 5IFAH 4FG6D 3LEXA 3KPSB 3O6FA 4ONFH 3VMPA 4BSWB 1FPTL 4P4RA 2GT9A 2FB4L 4FQJL 4P3WA 3V4UH 3LKNB 3MRHB 1A64A 3NPZB 5SV3A 3QZWA 2GUOB 2X44D 1OP9A 2GJZB 4G8GB 1ACZA 1K4DA 2NR6C 3ZKND 2DS4A 5HGHA 3S34L 4FQLH 4Y19B 3C9NA 4NC1C 1Q1JL 4JFQA 1H3VA 4U1KB 5E2UL 3ES6B 3LMJH 1WEJH 3BPNC 5IESH 3FO0H 1OD7A 4JHAH 4WUUB 1ZS8B 2AK4B 4Z7WE 3DUHA 3IU4L 4XT1C 1T1YB 4P5TD 3QUMH 5EC2B 4IRZL 3HZYA 3B4NA 4JHWL 4MNGB 5H35A 3IVKB 3EGSB 5E2WH 1KJMB 5GRZA 4ISVA 5ITBH 4YHKH 3GMNB 1GGCL 2NTFB 2YPKB 2VE6A 4C55A 2C1OB 4K3JH 3EFFB 3ARUA 5EFIA 4KMQA 3VWKA 4PRPD 1LEGA 2M8XA 5DUPH 4HF5H 1CU4L 1RZJC 3T1FA 4JPKL 1KXQE 2VDML 3ESVF 4LSQH 2Z93B 1D5XA 3MSPA 1IT9H 2YK1L 2FLRT 2YRLA 5LAXB 1BAFL 5EA0L 2DQEL 2FJGB 1NJ9B 2GHWB 1F13A 1FE8H 2CRZA 2H1PH 4DKFL 1RSFA 1K6QL 1R3JA 1CF8L 2UUDK 4U1LB 1NQBA 5IBTH 3GMMB 4ALAL 5D5ME 5HD8C 4N0FA 3LKSA 2DYPD 2EDWA 1MFCH 1BD2D 3I9GL 4Z5RB 4ONHA 3I75B 4EUPA 5D70H 5F7NC 5IQ7H 1DL7L 4W4NA 3KPRE 1ZK9A 1T7WA 2OR9L 2WQ8A 3O45A 1NFKA 1QRNE 4YX2L 2FX8L 3MBED 3ZYJA 1MI5A 3VGEA 1IKNC 3R1GL 3VH8G 2G75A 4Y4HB 4RFEA 1TZGH 4JDZA 1JFQL 4WV1A 3AAZA 4RAUA 4X6FA 5HYSA 1F90H 5FKAA 1QKZH 2J12B 1ZEAH 5L2KB 4I13B 5IVXF 1FG9C 2VQUA 3GJFA 3L5IA 2Y23A 4YDVA 3OZ9L 5HHMB 2VJXA 3T1WA 5CKAA 5F71A 1MEXL 1UZ6F 3QUXB 5JW4Q 3KPOA 3BQUC 2CKNA 3VXRD 5ID0A 3PGCB 1KB5A 3QIUB 3VFSA 4NYLB 1U8LB 4KHXH 1G7HB 4HJ0D 1YY9D 5F7MC 4UQ2B 4GW5A 3BDYL 1T0NB 3LKRA 2CIKA 1HEZA 1I8IB 3CSBA 3QYCA 2J3SA 2BY0A 1YYLH 4BZ2H 3GSWB 3FFCA 3MV01 1Z3GL 3RPKA 4AM0B 3S36L 5KVFL 1CDIA 5DRWB 4TQEH 5I71C 5IB4B 4HKZA 1QVOB 2VYRE 2J5LB 3V8OA 3RA7H 4GG8A 4PG9A 3QULA 2XYCA 2RGSA 4NUGH 1MIMH 5JW4M 5HYQA 1JWMA 3GM8A 4NO5A 1NC4D 4JFFA 4HEPG 5IMKB 1ZE3C 2ESVB 4J4PC 4JY4A 4OGXL 3GBLA 5GZOD 3Q2CA 2NY4B 2PW1A 3MR9B 4GQ9H 4P2YA 3GI9H 1RUAH 1MPAH 5EORH 1FVDB 4PYGA 5J6HA 2Y5TB 3MV8A 2MQ0A 3O3EB 3C6LA 1EMTL 1T1ZA 5DD6A 1NEZB 2DDQH 1BQLH 3C2AH 3CX5J 4XCCL 1DQDL 3FT3B 2FBOJ 1YPZB 1R5IB 3GMLA 4YAQA 2VDNL 5DLMH 1QNZL 4KROC 3QNZA 1OSZB 3GMQA 5GSVB 1S78C 5D7KD 5I9QC 1NFDB 2DQIL 4PRDB 1KG0B 1J88A 1JHKL 4YDIH 2HRPL 4OD2A 4G43A 4N5EC 1QTYT 3UZQA 3VWJA 4N0UB 1J10A 3X3FH 3S8WA 1KBGL 4K23L 5DO2C 4ZTPL 2VDRH 4PJDB 5JTWA 1MHHB 3FCTA 3GO1L 3DUSB 3F12B 1QBBA 2AQ3A 1E4XI 5CJOL 4AG4H 1T66D 2F58L 3EYSH 2HN7A 4Q0XL 4K71B 4N1EA 1YN6B 4GG6E 5EU4A 5MENA 3BKYH 5I8KL 1RAMA 1MHCA 2HLAA 3G6JE 1FFNA 3WN5B 3QEHA 1J86A 1JGLH 1B6DA 2NTSP 1NFDF 2D4DA 3OGCA 4QHKI 4CNIA 1DN0B 3HMXA 4JLRA 5JDJA 1RUPH 5FHAH 4FXGB 2NXYB 1WC7B 3FQNA 4QRQB 2EE2A 1WWBX 3D3VE 3HS0A 1TQBB 3M17A 1Q0XL 5JHLH 3SDAA 5FYKU 2ITCA 4Z7VB 1IQDB 3RWCB 4K94C 4YQXH 1UWEH 3WNNA 4Z95H 2A6KB 3HI5L 2ZUXA 4FABL 4TTGA 4PJDF 2EDNA 2DQJH 4QY8B 1BQUA 4L5FL 1HN1A 1QO3B 3SE8H 1V7NH 2FX9H 4X7SL 5C1MB 2B5IB 4PJFB 3QDME 5F1OB 4U1KA 1TPXB 4PV9A 3QI9B 2Q76B 3QFDA 1AQKL 3W11C 5EBGA 2MKWA 1T1YA 3WIHL 3C60C 3PWVA 1MCNA 3RDTB 2R1YA 2XTLA 2HRLA 3EGSA 2N1KA 3OG6B 3QUZB 2B39A 2VABB 1X9QA 1CICB 5E6IA 1E27B 3LH2L 2C1OA 3EFFA 1VFBB 3RTQB 4PGJA 4OGYH 3RHWF 4UQ3A 5IVXA 5IWLC 3MA9L 3DX9B 2C5DC 4PS4H 2GJJA 1KJ2A 3BIKB 5LAXA 5J12B 2JIXD 1NJ9A 4BH8A 1C7TA 1X7QB 1P84K 3K7UA 3T2PA 2DL9A 3DBXB 4I77H 1U8JA 4LPWA 4JKKA 1IGTB 1HYRC 1V05A 4QF1A 2NY6D 5KSAA 1NLBL 1WBZA 2AXGB 3CCHA 3DTXA 4G8FB 4KJYB 5EZJA 4Z5RA 4X7DC 3NIFF 3I75A 4L9DA 1XH3A 3PWNA 4GKSA 1U8QA 5EU6B 1DVFD 5JO5A 3TV3L 1HSAA 1ED3A 1N59B 4Y0GA 3O6MH 3LQAH 1EHAA 3DVNB 3TPKA 3S9DB 1TITA 3QQ3A 2G60L 2ZCLH 3U79A 4ELME 2PETA 4EDXB 2VUOA 4W4OA 1FSKB 1CFTA 3D85B 4R4ND 2L0DA 4ZO8A 3SE4C 3CFEA 1QBAA 4L3CB 5D2NC 1D9KC 2FDBP 4XVTL 5KSBE 2CR6A 2X4NA 3VCLB 1DEEB 1PAMA 3NZ8A 3GIVA 3KJ4C 3KS0H 2C3WA 2PO6D 3HR5A 3V5DB 4NYLA 4B50A 3L9RA 5JR1L 1RU9H 2D7TL 4FFYH 4UQ2A 3PF2A 3HC0B 2R2EA 5I17B 4RGOH 2J8OA 3DI2B 2A6DB 3NIDF 1PYWB 1WTLA 2VIRB 2DD8H 1BVKB 1KENL 2WNGA 3KYMB 2FIKA 2A9MH 4P46B 4D0CB 1I9RL 4PV8B 4P2RB 1A6AB 1OGAB 5DRWA 1JVKA 4QRPE 5LQBL 1ZHKA 1UWGH 5C2BL 1NSNH 1SEQL 3LV3B 5C07E 5JNYB 1J87A 4WJ5B 5JXED 1U36A 2O61A 5DT1L 1HHIA 2HJKA 1INQA 3TVMD 3WJLC 1GZPB 3IAGC 4Y4FC 5HJ3B 3BSZL 3V6BR 2ESVA 5SWZA 2ZOKA 4ZS6C 2DQCH 1W2KT 4GBXC 3GSNH 3MR9A 4ZAKA 5E8PB 3B2UD 2MNUA 4G6ML 3G6DH 2VXTH 1U8NB 2R2HB 4ONOA 1FDLL 3O3EA 3LEVL 4X7FC 5FGCB 1MFNA 2P8LA 3GSUA 4QOKE 1OW0A 4LHUD 4WU7A 4KRPB 2DLIA 3VXTA 3RGVB 4LRIC 4HEME 4LVOC 1UQSB 1FV1A 2ERJC 1EAPB 3LVEA 5GSVA 3QG6B 4HUWA 4PGEA 5FFLA 2PYED 1KG0A 3E6FB 3OB0H 4G9DB 1QRKA 4DKEL 1XR9B 4D94A 2IFFL 2AVGA 2AJYH 3TCLB 4MSWB 1FBIL 2DM4A 4XPGL 2XTJD 5I1LB 3RI5K 4FRWA 15C8H 4C54A 3MPCA 3FB5B 1RVFL 4RGMB 1WFTA 3EYVA 1EX0A 4BQ9A 4RCAA 2O5YH 2WIMA 3RWIB 3SKUD 4PJDA 3ZHKA 4E41E 1G7LA 1MHHA 2QR0B 4Z0BH 1L6XA 2IC2A 2H2PC 1RHHB 1RJYA 2BSRA 5IK3A 2SEBA 3CNKA 5L7XL 3V79C 2Y06L 4LNRA 4IMLB 4ZSOB 1BFVL 4HDIB 1IEHA 2FR4B 3N1MC 3RU8H 4N9OB 1YN6A 2LABA 43CAB 2HKHL 2NY2C 4AT6B 1IKFH 1HE7A 1KPRB 5LGHL 4R8WH 3CXHJ 1HOCA 1NBYA 3BAEL 3VRIA 4M7JH 5A2KH 2RCSH 3C8KB 3JWOL 3QNXB 1L0YA 1AGCA 1XGPB 5AAWA 5BW7C 4R90H 3RX5A 1OVZA 5DEGA 2CKBL 5JW5B 3O9WC 1ZLUH 1WC7A 3IJYA 4RIRB 1GZQB 3CX2A 1R5WB 4HIIB 4WU5B 4DK3A 2VWEE 1D6VH 3T2QA 2WUBH 4XNYH 3MGAA 4P2OC 1TMCB 3PP4L 4MHHG 4NQDB 2VKXA 1MWAL 3PQYA 2A6KA 3UTSE 2DKUA 4XP4L 4H25B 4YWGH 3QEQB 3OR6A 4PB0L 1U3HD 5TE7L 3X3GL 2W9LA 4D0BB 4K8RD 1N8ZA 1QO3A 2YC1A 5C0AE 3SKJL 4BM7A 2BMKA 4G6KL 4GMSH 3GGWA 3QJHA 2GJ6E 2DJSA 3V9FA 4DQOH 1ND0B 5IFJA 1VFAB 1U8PA 3JV0A 2VDOL 5JZ7D 1RIHL 1I75A 1DUZB 4NQSB 1MCSA 3WNKA 1JF1A 1CICA 4PJ5B 1S7TB 4K7FB 3ZDXE 7CGTA 4KHTH 4HK0B 4E5XA 1VFBA 1DFBH 1MRFL 1KV3A 3RIAF 3SKOA 3C6SB 3Q48A 5J9PA 4DGIH 3EZ8A 1T21B 4KVCL 1UZ8A 3RNKB 1T3FA 3UTTE 2N4IA 3VXMA 1C1EH 4HPYH 1IZKA 3NFPB 5EC1A 1JPGB 4XWOC 2R1WA 4KI5E 4R7DB 3DBXA 1OAQL 1T7VA 3L3HB 1IGTA 2DI9A 4Q9RL 4JR9H 1BM3H 3T0AA 4X6EA 1TVHB 4XNUH 4KJYA 2J8UB 1SYSB 5GXBB 5CLWA 4NNYB 4RNRA 5E8NA 4HS6B 5I1IL 3IDNB 1RZIB 4LLVA 4OCXH 4QYOA 5HHPB 3BZEA 2A77H 1N59A 3WUWA 4A2MA 5GGUA 3JSSA 1F4WH 3D39B 4AEFA 3DVNA 4Y4KA 4EDXA 2R69L 1RIUH 2Z4QB 1OSPH 1AGEA 4NN6C 4TSBH 2XNAB 4LGSB 3NA4A 4AIXA 3D85A 3U6RB 3DHMA 3CZJA 4GXUN 4Z0XA 1L7IL 2ZUTA 4HMCA 3QFJD 1EO8L 3PXJA 4C56B 4M1CC 3B3IB 5HI5D 2OBGA 4P99A 3RL2B 5T1MB 1BZ7B 2W60A 2N56A 5DHVA 3RBGA 3HC0A 3BE1L 5I17A 4GAYB 4WGVB 1I9IL 4HJJL 5I8OL 1PYWA 4IHOA 1BVKA 1J7VR 1E4WL 4XPTL 4Q6IB 4P46A 4D0CA 1EJOH 4Q97A 5H2BB 3ARBB 4M43H 1AI1H 5TE4H 1NDGA 5C71A 2EDHA 3O2WL 5DJ0B 4LCCA 4FNLL 1MJ7L 3LV3A 1T4KB 5C6TL 4HC1A 4EI6A 4KKLC 4XAKD 3T2OA 4YZFF 1BIHA 2XN9D 5HVHC 1YMHB 4CN4A 5HJ3A 3CFDA 3FTGB 4IS6A 4HUVA 3O2VL 4URTB 4OKDA 1OF2B 1PSKH 2FCBA 4DZBA 4O4YH 4JO3L 3VW3L 2OI9B 3ZT5A 3CFJB 1SJHA 1OAYH 4WWKD 1U8NA 4PJXF 3V0WL 1SBBA 4L4TB 3VWKC 1P2CA 1JNNH 4Q74A 5HHXL 2C4XA 2DBLH 2ZCKL 4KMTH 1GPOL 4ZPVB 5KN5B 2GTWA 4DGVL 2XKNA 5CSBA 2W1NA 3NCBB 2DLEA 3RUGB 3OKYA 4PGDA 3RGVA 1X5HA 5C08D 1QBML 3RZCC 5I2IA 2AJSL 3JWDC 4LMQE 3T0XA 2Q7YA 5D4QA 3BKJL 4G9DA 2YPLB 3FFCE 4FN0A 3O4LE 3P77B 2B4CL 1SY6A 2DQDL 2WSKA 1AKJD 3MYJB 2N7AA 1VFMA 1FNSH 1HXYA 3MGTA 2ZUVA 3REVB 2VITB 3PGDB 1AE6L 1G7MB 3SE9L 1BPVA 3ARDD 5F89B 3CU7A 1T0PB 4YBQC 2V6HA 3NACL 4X9GA 3DVGA 1EAJA 3KYKL 1IGFH 2X1XR 1RZKH 3DIFB 4ZODA 2BDNH 4JQIH 2QR0A 4U6TA 2R56L 4X6BB 1HHHB 1ZHLB 1ZTXL 2Z31B 4U1NB 5E70A 3RJQB 2W0LA 5TF1H 4ZSOA 2UYLB 3VXQB 4HDIA 1K4CB 2AJXL 2F74B 4ZUUA 4NKMB 1IAMA 3QIBB 3MV8E 4MJIA 3RUGF 2BC4A 4X9BA 5B22A 3DNKA 1XGQB 3QDJB 3QIWB 3QNXA 2YUVA 5GS3A 1Q0YH 4KVNL 4XZUA 2EIZB 3PABA 4QXGL 4U6YA 1LO0H 4HGWA 2R8SL 4IJ3C 3UJTL 1NCNA 4MD5B 4RIRA 4G6FB 5FB8B 5MEQA 2H26B 1MNUL 1FL6A 1QFWL 2NY5C 4B5EA 1NBZB 1EHNA 2ZSVB 3SCMB 1JRHL 3R0NA 4H25A 1A4KB 3QEQA 5GHWH 5BRZD 4P2QE 4ZOEA 1YQVL 1CLOH 5TDPB 5FOJA 1IEBA 2DQUH 4FQQB 5EU5A 3N1GC 4FFVD 3UTZA 2J6EH 2GSIB 3QRGL 4O2FA 3U0TB 3SDCD 2F19H 6FABH 3H3BC 5DD3H 5ELIA 5D7JD 1I9EA 4OI9A 2BHYA 1YEEH 3QWQB 1DUZA 4MA7H 4XCFL 3WS6A 3TN0D 1GGYA 1AGDA 3PJSB 4HLZG 5MENE 1AD0A 2E3VA 3TIEB 3T0BA 5T3XL 3H7BA 3C6LC 5FF6B 1YEIH 2W9EH 4IRJD 5DF0A 3RVUC 5DJ6B 3G08A 5FAAA 5KTEL 4F57H 5TDOB 1S7QA 1XGYH 1YNKL 4Z7QF 4D9RD 1T21A 2Y6SD 3X14A 3RNKA 2B8OT 1HINH 1NEZG 2AXHA 2X7LB 4G9FD 4MB4A 1QACA 4HCRH 4RGNE 3A67H 2HFTA 5HHVL 1U95B 1FAIL 3T0WA 4UIMB 1WZ1L 3AU1B 5GGTA 2ILLA 5HI3D 1SYSA 4XBPA 4AIZA 3S6CA 1S7WB 4NNYA 4GLRI 4AQOA 3BUYA 4H1LH 1I7TB 3PE9A 4YHNA 3H6JA 1RZIA 1PKQA 2BOCB 3V7AG 5HHPA 2MJWA 3BZDA 3K81A 1C16B 3CFCL 4PRIE 4U1MB 4OIIH 1R3LB 3WCYA 1A47A 5F9JB 3BGFC 1FNEA 1EEQA 5I16B 1H3GA 3D39A 1ZSDA 5I0ZA 1P6FA 2CLZB 3QAZC 2EDQA 2Z4QA 1LO3L 2AJZA 5JIHA 3ABZA 4M1GH 4J3UA 2JJVA 2YUZA 1MCEA 2DICA 1UVQB 2LVEA 2VR4A 5F21B 5TQ2H 1FFOB 1LDPH 1IE5A 1MCBA 3DX8A 3I50H 2X4PA 5IVXE 4FTVB 2F54D 3HN3A 4PJXA 1GIGL 1UZ6E 3IXTA 3QXVA 5T1MA 2J88H 1BZ7A 4RGNC 2LU3A 1IAOB 3U48A 3VFOB 4GAYA 1ODAA 2A6IB 1Q9WB 2D31B 3G5XA 3SDAC 1IGIL 1VEMA 2NR6D 1TJGH 1JNLH 3OKDB 5E2JA 1G6RA 4ZNCD 1UXSA 5GGVH 4G7VL 1A6WH 2ADIB 3VXUA 2YBRB 1GCFA 4NOBA 1G7IB 5SWQA 4UDUB 5C0BB 1EGJA 5CEZD 1VFUA 1KGCE 1YMHA 2PTTA 4DZ8A 4FP8L 1MAML 4XNXL 5FUOH 2X4SB 4F33B 1Z9MA 1BJMA 3CSPA 4PBXA 1PVHA 1JGDB 1JGVH 3CFJA 5C0GA 5EIVA 4YHYB 2VLRA 1IAIM 3F6LA 5DD0H 4EI5B 4M02A 3ZL4H 1A7QL 3FONB 1ZANH 4WFHD 4KZEH 3THMH 4UNUA 2RR3A 2HH0H 4TULH 4ZYKB 1IM9D 5JPNA 1J05B 1F42A 4NO0A 3RUGA 2AKRB 5JHDB 5HD8D 4JRXB 3BH8B 4S1SL 3STLB 2O26U 5AYUL 1PEWA 4NKDB 5ANMA 1FFRA 2YMXL 2P8MA 1BF2A 2QHRH 3I85A 4GUPA 5E8DH 4F8QA 1JPST 2CJUH 2BY1A 2W38A 3SO3B 2YPLA 3UTOA 4S0TD 3P77A 4TSAL 5I1EH 2Q3AA 5F70A 3MYJA 1FZKA 2CLRA 3C87A 3OV6A 2WZPD 2ADFH 4Q9QH 1G7MA 1MFEH 3MXVH 4HD9A 3ILPA 2YRZA 4JFXA 2RJMA 2WBWB 2W0FB 3N85L 2OYPA 1ZWIB 3ARFB 3CK0H 3Q6FB 5T1KB 4J1UA 3PGFH 4EDWL 1N5YH 4Y2OA 4HIXL 1P9MC 2C1PA 2GI7A 4Y4HC 5CWSB 1VADB 4RISL 5EO9B 1H3PH 5SWZE 1A7OH 1OWWA 3MRFB 1ZVSB 4JKMA 4LCWB 3GZKA 4I0PB 4JFEA 4W4OC 2UYLA 3BQUD 2F74A 5C0DA 3F7YA 4O02L 3ESUF 3QIBA 1YEDA 4JVUA 5ADPH 3WYRA 4O9HL 1FVEA 1JNJA 3QUXC 4X4ZA 5I74C 4DFHA 4LKCA 5DHXB 3MLZH 3QDJA 2DBJA 1MF2L 2BJMH 4KQ3H 3GDBA 3FQWB 5CSZA 1XCQB 4K9EC 4XMLL 5E7BA 5F1IA 5EH1A 3R8BB 5KVEL 1T03H 5IJKC 4O58H 3MMEB 2BNRA 4MD5A 5FB8A 1G0XA 2ZOLB 1DDHB 3CVIH 4ZFFA 5A2FA 3TZVB 4X4XA 3G5VA 2F5BH 4UT6H 5D72L 1NBZA 3V7AE 1S5HB 5L2JB 1ZHNA 1LDSA 1CL7H 3GSQB 1MH5B 2EIEA 3DYPA 4GS7B 4JHZA 4OFYD 3HKFA 4BKLA 3BP7A 4PG2A 4J4PD 4ODSL 2DQTH 2UWEF 2IQAB 4QRUB 3VGHA 4FQQA 3TESA 3BPLC 4PJDE 3S36X 1OAKL 5A2JH 3U0TA 5DC4B 3HZMB 2LAGB 2NYYC 5T33H 1ETZB 2NY4C 2YR3A 2VISA 1T5WB 2QQQA 2VQ1B 3BT2L 4NUJB 4OB5H 3E3QC 4ZAKC 3UO1L 1LEIA 3IFLL 1MIEH 1GAFH 1J1XL 1A7NH 4KDTC 2V2XB 4NCC2 4OT1L 3PJSA 5C70A 3F62A 3TIEA 1VHPA 3OR7A 2ZG2A 3UC0L 4RAVB 1OW0C 4KROD 3IFPB 1HWHB 4L4VD 1UCTA 1ZA3A 1S78D 1KEGL 3O2DA 4AYFA 3WO3B 3B5GA 4GRMB 3RIFK 4GSDH 2CLVB 3PIQA 5HVWA 4KTDH 3TYFB 1HYSC 4N5ED 1X6LA 1F11A 1VPOH 1UT9A 2PXYB 3AU1A 5E94B 3PQYE 1I3GH 5B21A 4AMKL 5DO2D 3R4DA 4F80A 1QPXA 2HFEA 4U1MA 3VDCA 1R3LA 3U7YL 5F9JA 3NIFE 3LRSB 3WHXA 5I16A 3WE6A 2GK0A 3KPQA 5C0EB 3MV9E 3HC4H 2CLZA 1KJVA 2FYYB 4KXZH 3HZKB 4HUXA 3ARQA 3B6SA 2CRIA 3U0PB 4MLSA 5F9WB 1D5MA 1UVQA 2EC9U 4EUPH 5LJYH 1MFAH 1IAIH 3HE7B 4HPOH 3TJEH 5FYJL 2FECI 3B2VL 2A83B 5GS0C 1A3RH 4FTVA 3GRWL 3JTSA 4YBLB 5J7CC 1KCVL 1XGUB 2Q8AH 3VXME 3HAEB 3IKKA 3WXWH 4U7KA 3HG1B 1JWSA 2NXYC 1FYTB 3BPCB 1IAOA 2BSED 3VFOA 4KKCC 1TQBC 2A6IA 3RVWC 3R8QA 4P5TA 3S37L 4RMUA 1GL4B 1QR1B 3OKDA 3T0EA 4C57C 1DBJL 5J4MA 1M6OA 1GH7A 2DWDA 4U2YA 3CDFA 5FHBH 2NNAB 5I1HL 3HFML 1EA9C 3NAAH 1BVZA 1VKXA 4MD0B 5CCKL 1G6VK 3TT1H 3NIDE 3CVHL 4H20H 1YEGH 2B5IC 1RZGB 3H9SD 1KIQA 3W11D 4XX1E 1UH3A 1JNHA 4ODXA 4W6WB 3C60D 4BJLA 1HDMB 1AHWB 1WIUA 1GGIL 1R5VA 2Q86A 4ZFGH 4M6OL 4OUUB 4F33A 5IFAL 2L7JA 12E8H 4OCSL 4Z6AT 4ONFL 3QCTL 1J8KA 4DCQB 3V4UL 3QUZC 3RX7A 1VACA 1CICC 1JGDA 3C5JA 1VESA 2DYPA 3OKKA 3G5YB 3LN4B 5ALCL 5T5FH 5FO9B 1BD2A 5HI4C 4XI5C 3RTQC 4EI5A 1INDH 5FM8A 4LLDB 3DRQA 1CDJA 5FCSH 3AROA 2DTSA 1S7UB 3DVIA 4NC0B 3L3OB 1V3MA 3L3JA 3NN8B 3LMJL 3VFPB 1M1SA 3STLA 3FO0L 2BVEA 4NKDA 4PRAB 4EQ2A 3QUML 1CFVL 3GK8L 4W81A 2ICWI 3VE0A 3QDMD 4LSTH 2YD9A 3EFDL 3IGAB 3QNYB 3SDDB 3TBVB 3BKCH 1YEJL 5FOBB 5DUPL 4HF5L 4KH2A 2NMSA 4OQ1A 5KSUA 2L7UA 3GSVA 4WTZA 1N5AB 3VD9A 3QISA 4G5ZH 3NCJH 5HHQA 1WFOA 3VXPA 1OAXH 2OTUA 1FE8L 1C5BL 2H1PL 2OTWA 4W6XB 3MRQB 5MEPB 4E0RB 2C3HA 4WI3A 1UYWH 5AYQA 1ZVSA 2UWEA 3D5OF 4LCWA 1D9KD 1MFDH 4Z7OE 5IBTL 1PQZB 1FSKC 2B1HH 2O5ZH 1CFQB 2BY3A 4Q2ZA 1RZ7H 2GSGA 3DV4B 1MFCL 5F93C 4XBEL 3DECA 3VI4F 5T3ZE 3GNML 5IHUL 2VLLB 1JZ7A 1EJ6A 4WEBH 5IQ7L 1IZJA 3P4OA 5IV2A 1QFUH 4JFOA 4JCLA 1F00I 5J6GA 1X5ZA 2AXFB 3BEVB 4TSCH 3MRKA 3O11A 3ZDYE 2X10A 1NC4A 5KSVA 1PY9A 1TZGL 1L0XA 2X4QB 4KGLA 5DRXA 4C58B 3QUKB 1GGBH 4RBPK 2MQ3A 2Z8WC 4M7LH 2V2WA 2ED7A 4P46C 1G9MC 2X4TB 2FJHA 3EDKA 4NRZA 4JZOA 1UB6B 5L2JA 5DHYA 3GFUA 4Y4FD 3V6FB 5BZDA 3HNVH 3MNVB 4ZS6D 4Z77B 3U0WH 4HJGA 4GBXD 1CIDA 3BD4A 3HMXH 3L3IA 4WI2A 3WS3B 3ZE2F 4HKXB 3BN9C 4MGXA 1FYHB 1UKTA 2AEQH 4IRSB 3EDJA 1CDYA 1HCVA 1O7VA 5D2LB 1U3YA 1A1MA 1ZT7A 5FKPA 4BZ2L 3MOBH 5IEKA 4F3FA 2VB5A 1FZOA 4OCRL 3QCVH 4MJIE 3AMKA 2EE9A 3F65A 4TQEL 2NX5B 4JQVC 3PHQB 3PWPB 4P5MB 4NQCD 2APVA 3ULVC 4OLWH 2YD4A 4I0KA 3MLVH 3CZFA 4NIKB 3IFPA 1YMME 4NUGL 1GC1C 1MIML 2DLGA 4HBCL 3RGVC 4Z18A 1FLRH 1CVSC 1JK8B 5SX4I 5IHZB 1NFIB 4NZRL 4QRPD 3VG0L 1DQQA 4U1JA 3MJ9A 4GQ9L 3CU1A 4N1HB 1RUAL 3BESR 1MPAL 5EORL 5E94A 1PLGH 3CSGA 1A9BB 4N9GB 2BVUA 2EICA 1XAUA 4RGMC 1YZZA 1BQLL 3C2AL 2FWOA 2H2PD 1P4LB 2HJFB 4OAWB 2X4RB 2IH1B 4QHMB 1KJ2H 3MRBB 1I1FB 2W65A 4MQ7A 5DLML 3ROOA 2GYSA 5K9KB 2NY2D 4YR6A 3QXTA 2FYYA 1G7PA 4HIJB 4NO3B 5IFHH 3BZ4B 4KY1H 3MLRH 4QOKD 3U0PA 4KWUA 5EN2B 5I1AA 3GEWB 2HLFD 3TA3D 3VRLF 3HE7A 1X5LA 3O9WD 4OGAC 4TPRH 1ZLWK 5AZ2H 1UM4H 1CE6B 1MELA 1ERNA 5I75B 5F3BB 3X3FL 2GTZA 4IOIA 4R6UA 5CBAB 3EBAA 3HAEA 2C26A 4P2OD 3FN0H 3BPCA 3Q5OA 3J7HA 3BEWA 4JKPL 4AG4L 2R4RH 3EYSL 3U36A 4OZHB 2YKLH 2NXZB 4HZAA 1J1OL 3BHBB 5K93A 2GFBB 3ZMRA 4L8CA 3BKYL 3ROLA 2AI0H 4MD0A 1XIWB 4X8JA 3G9AB 4OZFB 4LLUB 1YJDC 1PKQE 3AY4C 3GHBH 4OCWH 1PZ5B 1JGLL 3I6LD 5GZND 1VEOA 4ODUA 4PB9H 5K33A 3MCKB 4X6DB 5FHAL 3D39E 1R3KB 2D0HA 4JY6B 1DQJB 2R2BB 1LO5B 3WS6C 1TTGA 4LSVL 4NGHH 5JHLL 5T1DH 1CDUA 2E9IA 4OFPA 5JLZA 3FFDA 4YQXL 3G5YA 1UWEL 1T2XA 4Z95L 5FO9A 3RY6A 4WI5A 5B8CA 3D2UD 2DF3A 2DQJL 2VZTA 1UC6A 2BCKB 3Q1SL 2WP3O 2FECL 2R0ZH 2FX9L 5KW9L 1ITBB 4XWOD 4PJXE 5IB1B 3L3OA 4OZHF 4X98B 5C0FB 1X3DA 3F7QA 3NN8A 5FV1L 4DFIA 2FB4H 1T22A 5F7DA 2BNUA 4JN2A 4PRAA 4EVNA 1I8MB 3UBXB 5D7LD 3MLXH 3IAPA 3WNOA 2VUYA 2EEBA 5AD0B 3STZB 3S34H 4Y5XA 2V9RA 4NHUB 2JJTC 5E99H 1A5FL 5KS9B 1RPQA 3VXUE 3T77B 5DSCB 4CU8A 1TZIA 4OGYL 4MLIA 4H88H 1C08B 1N5AA 4PJAB 3GHEH 5KVDH 4IRZH 4YBHA 4JHWH 1KIPA 3EJJX 4D3CH 7FABH 4J8RA 4U6HB 4ZS7H 4ZUTA 3HMWL 2JKXA 4OF6A 4OTXH 4X9IA 4YJZL 4FZEH 2ADGA 1U2HA 4JRYA 4MJ5A 4AIOA 2YD2A 4OKVA 5EO0A 2XICA 3NFNA 5C0JA 1KELH 4BQ8A 4JPKH 3U82B 2C7UA 2HKFH 2VLRE 1AJ7L 1FFQA 2YK1H 4S11A 3UTTD 5EA0H 5DJAB 3FRUA 2QSVA 3F7PC 1CF8H 1NCWH 5DJDB 3TVMA 5FYKD 5ANME 3LQAL 2A0LC 2ARWA 1T83A 4JDVB 3I9GH 2X4QA 5E9DD 5CINL 1P6AB 2YPLE 5T1LB 4Q6IC 3AM8C 3IDIB 2X4TA 3ARBC 1YC7A 4KKLD 3VXSA 3BH9B 1BJ1H 3OMZA 1HXMB 1ZLVK 2R4SH 3V6FA 4JAMB 2WWKT 2FEEL 2COQA 3K4DA 3HUJB 3MJ6A 5GS0H 1JFQH 3OHXA 4LLMA 5INCA 1KLFA 5BS0B 4G8EB 1FN4B 1RU9L 2LTQB 4FFYL 3WS3A 1YYMH 4HKJA 1DBKL 1KF9B 1F5WA 4I3RH 2ZUQB 3VWKD 3QQ9C 4JFEE 2WIIB 3O41B 5KG9B 3KR3H 2OI9C 1TJIH 2A9ML 1CBVH 3X11B 1R3HB 1MUJA 2BXZA 4HUUB 1L4IA 4XRCB 4P5MA 5FCUL 5FK9B 4FZ8H 1VSCA 1NSNL 1CG9A 3BDYH 5ID1A 4E42A 3RZCD 2IPUG 4XBGA 2R2CA 4HUKB 4BFEA 3VGGA 3P9WB 4QEGA 4XMPH 1NMBH 4CVWA 4YXLL 4BSVB 4Z9KB 1BEYL 5IHZA 1RUKH 2BNRE 5FDYA 4Z7QE 1WUNT 4FQ1H 4OZIE 2XOTA 3GSNL 1U8IA 1AQDA 2MOVA 3DRTA 4MVBC 1M7DB 2Q87A 2XY1A 2ATKA 2XQYG 4YBQD 2VXTL 1A1NB 5C0IA 3UYOD 3LRGA 4JFDA 3EJZC 1MI5D 4OCMC 2BVPA 5BMFL 2HJFA 4OAWA 1XCTA 1I3UA 2IH1A 3K8LA 3D25B 3WNLA 5GS1A 5HHOB 3OAUH 5DYOB 1HSBB 3OKMB 3TPUA 4WTZG 2UZIH 2QTEA 4PJ7E 1BGXL 3P2TA 2Z31C 4F15B 5HHNB 3H9ZA 5CEZL 3NCMA 1OY3B 3RWFB 3QIBC 3U7WH 4XVUC 5JQ6H 1UENA 2CIIA 2V5YA 1T80A 3SGDH 4C4KT 5LGKA 4PY8I 4XB8A 3IU3B 2D0FA 2AJYL 2BZDA 2VDNH 3LQZB 3EYQC 15C8L 1QNZH 3QIWC 4APQB 1E4KA 1HCFX 3QXAB 1CE6A 3VXOB 3MNWA 1C5DA 5EU3B 3KDMB 3LS5H 4R7NB 1C5CH 1YN7B 2DQIH 2O5YL 4P5KA 4X99B 3MX0A 5C0CE 3C5SA 2HRPH 1HZHH 1P84J 5ILTL 5ICZA 1BX2B 1CXEA 3FB6A 4OZHA 2Z35A 5GRYA 5JA8B 3RU8L 4MAYB 3SCMC 1Q94B 1T7ZA 4NM4H 3TH4T 2DKSA 1IKFL 4JFFD 1KBGH 1XIWA 4D8PB 4ZTPH 1S7XA 4PG2C 4LLUA 5DMKB 1J0IA 4M7JL 2RCSL 2Z0BA 3PDOA 1DUYB 3UPRA 4XNZC 4OLYH 2BSSB 1PZ5A 4R90L 4GRWH 2XT1B 3SPVB 3MCKA 1RFDH 5LVEA 1FORL 1EXUB 2MTPA 2ICWB 5DHVH 2FL5A 3H2WA 1I9JH 4JY6A 4EBQH 1MSPA 3C6LD 5I8KH 3RVUD 4RZCB 1D6VL 1N0LA 2WUBL 4XNYL 2HFFB 3NH7H 2YXFA 1G9MH 3R06A 4NM8H 2BHUA 3HLAB 3JV6A 4MB3A 2V7NB 2XA3A 1IC4H 1S7SB 2O5XH 3VGAB 3QDGB 4YWGL 3VFUB 4LGRB 1MWAB 3CDCA 2IALB 4HC1H 4RMRA 3QHFL 2WBJD 1H8NA 1G9NC 5A3IC 4V2BA 2VC2H 1IGJA 4GMSL 3CH1A 3OBAA 4FQXA 1IFHH 2D9CA 2DQGH 4DQOL 5EOCJ 3ULUF 1FFPB 4IOSD 3QEGH 2PYFA 4EJ1C 3HI5H 3RPIA 4FXKA 4EN3B 5CIPH 4YHZH 1MJJB 5FDWB 3T0EE 4YDLB 3O0RL 4X7SH 3STZA 4O51A 1FNLA 1HQ4A 1F4XL 2VAAB 3R0MA 4NHUA 1I1AD 5DI8B 5LG1A 1QSFB 4KHTL 5D6DC 5T3ZH 1DFBL 2VQTA 3T77A 2WBKA 1AQKH 3MCLL 5ISZA 4QHUB 3QFJA 1C08A 4DGIL 3ZKSD 4P23D 3WIHH 4YNYB 4ODBD 2R1XB 5GS2H 1C1EL 5CP3A 4HPYL 3MQIA 5HGAB 1S9YB 2VSCA 1T2QL 3MV7B 5DJ2A 5BCAA 4ETQA 1JIBA 3L5WA 2V2TB 1TZHB 1JF5A 1F6LL 4JR9L 3C8HA 2H3NB 4P9MH 1EHXA 1DN2A 1MREH 4XNUL 1BD2E 3JTTB 3LKPA 3LKQB 4HH9A 1A6UL 3MYZA 5DJAA 1BWWA 1DJSA 2EDDA 3IJHA 1SYVB 3SE3A 2X1QA 1HILB 4QTHB 1HQRB 3OKLB 3SDAD 4P0DA 4ZQKA 2V17H 1X4XA 3CFIC 4M5ZL 4XC1H 3WL9B 3HAEG 4G8GD 5TF0A 1RK1B 4OQTL 1RIUL 3CXHK 1OSPL 4F7CB 5IB5A 4TSBL 5T1LA 3T0EC 3HB3C 3BDXA 4Y19D 5EOTA 4HWBA 4PGBA 3V4PL 5IHBA 3V95A 2AK4D 2YA0A 6CGTA 3CXDH 1B0GB 1PD6A 1F6FB 5MEOA 3VXRE 2G60H 4XGZA 1NDMB 4OCYH 1QLRA 3HCVA 4G8EA 2JJSA 4GW1B 35C8H 3P11L 5IROA 5CFHA 1FP5A 2XA8H 5IMMB 2QKIB 2R15A 2UWEE 4LCWE 2WIIA 3O41A 2FSEB 3WFHB 5E1HB 1TIUA 1EJOL 4D9LL 4Z7NF 4M43L 1AI1L 5TE4L 4EI5C 1OP3K 1AKJA 3MUGB 2D7TH 4MB5A 1FO0A 3DROB 2HVJB 3GB7B 4H8WC 2KPNA 1OD9A 4L8SB 3S97C 3H0TB 1JYNA 4ZO7A 4R4BB 4YPJA 4PJBB 5SX5K 4BSVA 4UT9H 2AQ2A 3EO1A 3FO1B 3SY0B 5GRWA 3SO3C 4O4YL 2IAMB 1SEQH 3PP3H 4C59B 2ZCHH 5DT1H 1MVUB 4JM2B 3AC0A 3HZVA 4Z8FL 5CJ8A 1KGCD 4Y4HD 2DBLL 2EXYC 5E56A 3BSZH 4QHLB 1JI1A 4WI9A 3ARFC 2QADB 4OF3A 5HYJA 5L2KD 1M05A 5DYOA 5FA3B 1SJEA 1CGYA 5IT2H 4HT1H 3QUXD 5HHNA 5GGTH 2I5YH 3IETA 1PEZA 4GAGL 4X7TB 4Q9CA 3OWEA 2VKWA 3WMSA 1FNSL 5ITFB 5CJBA 4PJBF 1V7MH 1CD8A 3WIFA 3EDFA 4APQA 3QXAA 4P2CG 5IW1B 4KRNA 5EU3A 2OXGA 5FUZL 2VLME 1YN7A 1IGFL 1RZKL 4X99A 2BDNL 4JQIL 4DKEH 1WBXB 5ENWA 3C08H 1BX2A 1MLCB 1JPFB 3P4NA 3SDCA 3VFMA 2ICEA 5IR1A 2D7QA 3MBXH 4MJ2A 5TF1L 5D7JA 1E28A 3KXFB 4XMKH 1H0DB 2RIKA 1RVFH 4HX1B 1Q94A 4RWYH 4WTXA 4LLYA 2ICES 1B88A 4Q58C 5INDB 4L8DB 4GS7C 4AENB 2VOTA 4IRJA 3QHTC 2ESVD 5SWZD 1LP9F 2IEPA 3MLTA 1JV5A 2DI8A 2BSSA 2NYYD 2AABH 2UY6A 2VXUH 2NY4D 5L7XH 4ZAKD 1LO0L 1PX4A 2X4OB 1ZGLB 2ICWA 2G5BB 4LPYA 3CIQA 1CXKA 5LGHH 3UXFA 4PRPB 3BAEH 1JJUA 2VL5A 2R0WL 1WCQA 2PCPA 4JB9H 4I9WD 4OIBA 2ZKHH 4GRLA 2V7NA 1S7SA 4PJHF 4R2GB 2CKBH 3B5HA 4J6RH 4HIHB 4I4WA 1DSFH 2EDLA 1CLOL 2XWTA 2H9GA 2OL3B 1O7SA 2CRMA 2E7MA 3RL1B 1HH6B 2J6EL 4X6CB 2AJ3B 4BUGA 1TETH 2VLKB 5KOMC 4TN9A 4XXCA 5IIEB 1A6VL 5DD3L 2PXYC 4Y5YA 3X3GH 1YEEL 1G0DA 4MA7L 4EN3A 3DI3B 3E0GA 3TBYB 3HPLB 4G6KH 5DK0A 2BFVL 3NIGF 1YEIL 3U7AA 5L0QB 1BIIA 4WFGE 5AZEL 2I9LB 4QHUA 3GMPA 3I3BA 1WZLA 1XGYL 1IJ9A 1E4XH 3NVQA 5TGBB 2VDOH 3IS1X 5SWSB 5L8KB 3U46A 1HINL 4DVBA 4JPIB 2DJUA 4JJHA 4JFZH 1S9YA 1NBVH 4HCRL 3OL2A 4CW1B 2DI7A 3O8XB 4OM1L 1NGPH 3MJ8B 4MQXC 3JZ7A 1QA9A 1MCRA 4PLOB 2IQ9L 3BX7C 5FA4A 3DPBA 5HDBF 5F9WC 2ZSWB 1OLLA 1I4FB 3HE7C 4LSDA 1KLGB 2XPGA 4X6CF 2NXYD 5MHSD 3DWTA 1A0QH 3W9EB 1Z0NA 3JV4A 4YBLC 3EYUH 4KKCD 4PRHB 3RVWD 4JFPA 1OAQH 4G80B 4OIIL 4QTHA 3OKLA 3VI4E 2CDEA 4Q9RH 4K3HA 5IJVB 1IEAA 3IDGA 4MHHI 3PQYD 1NCUA 2DIJA 1BF8A 5CZKA 1N6QH 5DGQA 5FECB 3BRDA 1CN4A 4M1GL 2RFXB 1GJIA 2BRRH 1TCRB 1FGVH 4LPVA 1CR9H 3UJIH 3ECBA 4Z76B 1B2WL 4JFYB 3I50L 3T04D 1A21A 2N7BA 3DARA 3S37X 3OJVC 5CD3B 4M5YL 1HI6A 1FJ1A 3W39A 1ULVA 1NDMA 1IM9A 2R69H 1AHWC 4OZFG 4I2XB 1XGRB 3WEXA 2KL6A 3QUZD 4GW1A 4P9HC 4ZFOL 1A6PA 1CICD 1MCLA 2J88L 3PL6B 4O2EA 3L7EB 5C8JA 5ADOH 1IBGH 1VCAA 2EE3A 5HI4D 4XI5D 3RTQD 4JRYE 1A3LH 1UJ3A 1TJGL 3WFHA 3ZE2E 1EO8H 4OCNC 2QLVB 1D5IH 3TM6A 4P57A 5GGVL 4JJ5B 4CADB 1A6WL 5L88H 3CLFH 3TIDA 4PRNB 2WP3T 4NQUA 5DK2B 1IKNA 2H2SC 3T8XB 4L8SA 4J3WA 3BZFB 3H0TA 4X0KB 1XF5B 1A1OB 4NRXA 5I8OH 1LD9B 1X4ZA 1J0YA 2IPKA 4PJBA 4LCIH 5FUOL 4LPTA 2E7LA 3T0VA 5ICYB 3ULSB 1P69B 1KCLA 4XNQB 5EU6D 1J5OL 3VXSE 3F7VB 4HIEB 4OLVH 4FQPA 3UBXG 4O00A 1WF5A 3T65B 1MVUA 3SDDC 5DD0L 2IPTH 2PTUA 3ZL4L 2GCYB 3LPGA 1SVCP 2FGWH 2UZXB 4KZEL 5IMOA 5DS8A 3THML 5IMLB 2HH0L 4TULL 3WJJA 3GUTA 3KYOA 2CDGB 1OTTC 1EVUA 3D85D 5FA3A 1RIVL 1NGYA 5F6IB 2A74B 1LP9A 4MA3B 5I66A 1RJZA 5E8DL 2CJUL 5IOPB 4CJ0A 3TO4B 2PYEE 4FQ2H 3TEUA 2AEPH 1N64H 1UJTA 5I1EL 4DGVH 1UFUA 5JOFB 4Y5VB 3G5ZA 3QQ4A 4X7TA 3FB7A 1KTRL 4LSRH 2G2RB 5J89A 1KB9K 4DGYH 2ADFL 4Q9QL 1BJ1J 3B5TA 2XTJE 1JTOA 1MFEL 4OFYA 3MXVL 4DVRH 5IW1A 3IXAB 1MLBA 3CK0L 2AJSH 4J4PA 5I1GH 2QQNH 3PGFL 1PG7H 1NCAH 3BKJH 3GSXB 3VRLE 4PJHA 4P46D 4WHTA 1H3PL 4LPCA 4P2RD 1OGAD 2B4CH 1A7OL 3TH2T 1MLCA 4R96B 1S7RA 3ARWA 4WFEE 4OI8A 1AE6H 1ZT1A 1L9MA 3DSFL 5HYEA 4JFDE 4K7PH 3KYKH 4PJGF 3PHOA 3TBSB 3VXNB 3BN9D 3MLZL 2C3VA 1KXTB 2BJML 1OGTA 4KQ3L 2A1WL 3ARVA 4HFWA 1UEYA 1A22B 4G3YH 4L4VA 3KPLA 2ZUYA 4O58L 1AFVH 1RULL 2AJXH 4IRSC 1F4HA 5H94B 2G5BA 9CGTA 4X9HA 3IS0X 3DHJA 2NY0B 3AXLA 4WY7H 4BSJA 3CVIL 3ULVD 1YDPB 4UT6L 1OCWL 3KLAA 4HQQH 4KRPD 1ZHBA 2IG2H 3ZT7A 4KVNH 3RGVD 3N1QC 4I3SL 1BVLB 2JIXB 3OXRB 4QXGH 3FOLB 2XTJC 5ESQB 3VGFA 3VMNA 4ZOCA 4Y1AA 3UJTH 1M7IB 1UA6H 2DQTL 3DGGA 5J1SC 2OL3A 2H6PB 3LN5B 2D4FA 4PR5B 2NLJB 3ARRA 1HH6A 3M1BA 3HI1A 1IL1A 5KZCB 4X6CA 1WTGT 2ZZUT 2VLKA 3ZKQD 5E1AA 2HG5A 5IIEA 5T33L 4OZHE 4OB5L 2ARJB 3RNQB 1MIEL 1GAFL 3HRPA 1DVFB 1YQVH 3HPLA 5IQ9A 4LNVA 1MQ8A 3V2AR 5B38B 1NCCH 2XQBL 2P5WB 1QHOA 1GRWA 4K2UH 5IP4A 5LXGL 3CDYA 4NFBA 2CO6B 4DOHB 1G84A 4X5LA 5SWSA 2CPCA 3T4AB 1AGBB 1JWUB 1NLDL 4HS3A 3O81A 4GSDL 4HUMB 4BFGA 1U8OA 1S8DA 5EUOF 4MZ2A 4KTDL 3MJ8A 2IADB 1MOEA 5E8EB 3GSOB 1EO7A 1VPOL 4OGAD 3FT4A 2ARJQ 4UI2A 1ZLVH 3MRJA 2ZSWA 1GXEA 3FO9B 5T5NG 3O3BB 1KLGA 1E4KC 3B9DA 2V9TA 3MZTA 5I75C 1YEFH 2FHBA 1FHGA 4OZGF 4HWEL 3BVNB 3IB4A 4G80A 3C60A 1KTLB 3B43A 4V1DB 2YS4A 1QSEB 4NQDD 5DJ8A 5EO1A 3CUPA 2VZ3A 1CYGA 1TDQA 4LLWA 5M95B 2NXZC 3QEQD 3VU2A 2OQJB 1WAAF 2RFXA 4PBWD 2Q7NA 4B0MM 4LSUH 3ZHDA 2VNCA 3X12B 1XIWC 3UZEA 4ORGB 1MFAL 4ZUSB 1IAIL 4HPOL 5ISZE 3TJEL 4BH7B 1A7RL 3QFJE 3LSOB 3D0LB 1J0ZA 4NNXB 4HFUH 1CFNA 2Q8AL 4I2XA 3WXWL 3K74B 3OKOB 3AGVA 4UZGA 1GGTA 4PJ5D 3UDWA 4TOYL 3LS4L 1AIFB 5FGBC 2BVQA 4K3EH 1H5BB 2FRGP 3VH8A 3ZKXB 3LCYA 5JORB 3S96B 5JQHC 1S7VA 2LFGA 3NAAL 4JJ5A 3OB8A 1GIGH 4GW4A 4LSPH 4MNQB 1H8OA 4NN5B 3MJGX 2X70B 1XGTB 4H20L 1U0QA 5DVNA 1MCWW 4JG0L 1KN4L 3BD5A 1KB5L 1AO7B 1YUHB 4FQXC 4XAKE 5DEFB 3T8XA 4DN3H 3BZFA 3CVHB 3H9HB 3O3DA 4UU9B 1IGIH 2XN9E 3HRZA 1MCJA 3QO1B 1JUFB 3MRCB 4ZFGL 4F7MB 1QEWB 4G7VH 5DRZB 12E8L 2VMFA 5D2NA 3C5ZB 3ULSA 4XHQA 4XNQA 1RV6X 1C7SA 3OJDB 2NY5L 2P46B 3EOBB 4HIEA 1MCHA 3T65A 5T5FL 3D0VA 1RJLA 1INDL 2W0PA 2GCYA 3D39D 3W5MA 3DO3A 3RP1A 4NSKB 1J8HA 2BVYA 1X5IA 3BJ91 5C3LD 4I5BB 4PJGA 5DJXB 5C08E 2A74A 3K4ZA 4XH2A 1VENA 4YC2B 1U8MB 2X2YA 3EIFA 4F7TA 3ZZ1A 5EZLA 3I2CL 3L3KA 4WDIB 3MJ9H 5IOPA 4TUKH 3VD3A 4MX7A 1A7QH 1I8KB 3BO8B 3T08A 1U58B 4C56D 4PFEA 1DE4B 2VLJB 3QUMB 4LSTL 5HDQL 4WNQB 4I48B 3BKCL 4S1SH 2A0LD 1P7KA 4Y4FA 2FH6A 4M9PA 3SE3C 1HHKB 3IXAA 2VZSA 4AH2A 1ZLUK 3KNBB 4XNMA 3NCJL 4NT6B 5IM7A 4OF0A 5I1CL 3ARBD 4TSAH 5IW6B 5D93B 2H8PB 5FYLD 1S9WB 4NQXA 2ZJSH 2NW3B 4FFWC 4L1DA 1MFDL 3VFTB 2O5ZL 3QUYB 4R97B 4CUCA 4AEEA 4C83B 5DJCB 1PZUB 2WUCH 3U2SA 4EDWH 2BSTB 1Z5LA 4NQCA 5EWIH 4WEBL 2XG4A 2R29H 5F8RC 3SKMB 3NABH 1WJ3A 3HE6B 3QQ9D 3MRPA 5HYJE 5C2UB 2JJSC 4KKNA 2LTQC 1FNFA 3IDMB 5GGVY 2X1OA 1M71B 4PLNC 4L4TD 2ZUQC 5CBEB 4OV5B 4OZ4A 1GGBL 3RVTC 1KIRA 1YY8A 2EYTA 1MF2H 1A9EB 5EUOA 2KDGA 5B4MC 3FOLA 5F1SA 4PD4J 2HT4C 4WHYG 5BJTB 1NH6A 1UH4A 3HNVL 4PJ9B 3EOTH 1FL5B 2YPLD 3HMXL 4PR5A 4MVBD 3BPOB 1Q9OB 4ZXBB 4LAQL 5D72H 3T09A 1MCKA 3DO7B 1BFTA 4OZGA 3EJZD 2ARJA 3QXDB 3MOBL 4X5WB 3QCVL 2ZNXA 3IJSA 5B38A 5BW7A 2C3XA 1NPUA 4OLWL 1WAAA 3MLVL 3TA3A 3BJLA 1OP5H 2H45A 3FQTB 3PWUA 2VDKL 4D9RE 2Z31D 4JFED 3BP5A 1FLRL 4LQFL 3OPZH 3QIBD 4OT1H 1Z6JT 4XVUD 4QHNB 4G8IB 4P2OA 4UOW1 3G6AB 2JB6B 4TVPD 3UPCA 4F15C 2IADA 2BOBA 3HA0A 5DDHB 5E8EA 3GSOA 3QDJD 3EYQD 3QIWD 4U1GB 4R3SA 4M7KL 3DURB 1PLGL 1TVBA 4WW2B 1A6TB 3O3BA 4JGMA 4APQC 4MXWH 3SKNA 3GJEB 4PRBA 1HH9A 4JPVH 4G6FD 1KPUB 5I1JL 1KT2B 1KJ2L 3TO2A 1KTLA 4V2CB 1WQVT 1ORSA 5GGRY 1QSEA 1N4XH 4DTGH 2JCCB 1RJCA 3QJFB 3SCMD 2P5EB 5DQDL 2DN7A 5KAQG 4UTBH 4YIQB 4F7EA 2A9NH 3GMOA 4KPHL 2ZNWA 3ULUC 1OP3H 1DANT 1W0VA 3MLRL 4KY1L 4EXPX 1UACH 4TNWF 3F6IA 2LAAA 4I0CC 5JPMB 3FRPA 3D2UA 4ZUSA 1Q8MA 5I8CB 4K07A 4BH7A 4LEXH 2V7HB 1I7UB 4IBLT 3LSOA 3D0LA 1UM4L 4NNXA 4YGVA 4LF3A 1T04B 1T1XA 5SX5H 2F54E 4ZTOH 2VL4A 3JWOC 2R0LL 2XZAH 1JPSH 2OJEB 4XB7A 4PGCA 4WW2F 4WWKB 1KTKE 3SJVB 5IUSA 2FHCA 1M4KA 2YKLL 5D7LA 5HXMA 3D69B 2E6PA 1H5BA 1U93B 5A3ID 4GRLC 5I73B 5JORA 3KPMA 2W92A 3MREA 3LEYH 4NRYA 3VGAC 1KCVH 2AI0L 3D18B 2R9HC 8CGTA 2EH8H 1S9VB 4OCWL 3TBWB 4Z7NE 5DEFA 3S37H 1BHGA 4PB9L 1HHJB 5CEZE 3MRCA 4XXCC 2HVKA 2K3TA 5ICXA 5IEHB 2A38A 2MHAA 3KPPA 3C5ZA 4EN3C 2Q3ZA 4GLRH 3RWHA 1JTTA 4YDLC 3U9PH 5T1DL 5IB3A 4ZO6A 3FOMA 5DUBA 2VTFA 2OZ4A 2VDQL 1KPVB 3EO0B 4U0RC 3VI3F 2H32H 4ZUVA 3U30B 4WO4B 2FGZA 1GGIH 4WFHE 5ESAA 4QHKJ 4RFOH 1X5GA 4GKZA 4OCSH 1I7RB 1S9XA 3QCTH 3WNPA 1FL3A 2DRUA 4RMSA 2JK5B 3A6OA 5F1NB 2IANB 3AREB 1KN2H 5ALCH 4U33A 1A14H 1T20B 4GXVH 3S35H 4HZLB 2ADJB 3MLXL 5E9DA 5CP7B 4FTVD 1Q38A 3BP6B 3GSRB 5GRJH 1DE4A 4CRPA 5E99L 1LNUB 1XF2B 3WFZA 3K4AA 4BZ1H 4MZ3A 4H88L 5HGGS 1CGWA 1AY1H 1FNGB 1CFVH 3GHEL 3FQUB 5KVDL 3GK8H 3BW9B 3L95A 1DP0A 3T0ED 4D3CL 5CLTA 7FABL 1CZ8L 2Y7QB 3HB3D 3BIBX 4ZS7L 5IW6A 4OTXL 3EFDH 3DXAB 4KUCD 1B4JH 2BXYA 4FZEL 3W0WA 1OAZH 2P4AB 5CUSH 4ENEC 5HGDB 3VFTA 1Q9KA 3QUYA 5J3HC 1YEJH 1NBQA 5BRZB 3LQMA 1XF3B 3V6ZB 1KELL 2K7PA 2HKFL 3MA7B 4HWUA 4TYUA 5C0BD 3Q5YA 1JP5A 4M48L 1EZVX 3W9DB 5BV7H 4UMGA 1C5BH 5CZXC 2Z92A 4K8RH 3CSYB 3Q3GA 1NCWL 3HE6A 2GAZA 5JDSB 3S5LB 1PFCA 3RZCA 1UXWA 5A1AA 4CAGA 1LP9E 5JA9A 1JGEB 4Z78A 1LEKB 5E2VL 4EI5D 2DTML 2I25N 4J3XA 3LZFH 3V5HB 4XBEH 5IHUH 3BMWA 3GNMH 1UJ3C 5IVNA 4PJEB 4PJIB 2NY3B 3L5XL 4R4FH 3N9GH 5GRXG 1A9EA 1FZMA 2VAJA 2Q8BH 5JHDD 4G9FB 1JMXA 3MLYH 3RBSA 5TH2B 3WLWC 2R4SL 4HS8H 4GAFB 3P9LA 5GS0L 4JE4B 4L8SC 4N90D 4PJ9A 3P0GB 4X4YB 1W0YT 4PJHE 5I1KH 3WDHA 2FNBA 3RWJB 1Q9OA 1YYML 1NMAL 2E7LC 3OKEB 3DO7A 5DJZA 5H37H 5CD5C 4I3RL 3O4OB 1T6WA 2IAMC 3PNWB 5E00A 4PBVC 3KR3L 5CJXC 1NAKH 4N1CA 1TJIL 1ZV5A 2EXYD 3TJHC 1CBVL 3ARFD 1UB5A 5T1KD 3FQRB 4ZG1A 4Z7UB 2OXHA 5BZWB 4CMMB 1AD9A 2CO7B 4Y88A 4FZ8L 4M3KB 1AC6A 1KCKA 1UM5H 3WJJC 3J8F7 3X13A 4LCWD 4QXTB 4L4VE 1Q9LA 4XMPL 1NMBL 4QHNA 4YHIB 1OHQA 2GQHA 4ZD3L 4KK8C 4OCRH 1RUKL 4NO2A 4FQ1L 1OB1B 1RI8A 3NPSB 2NW2A 4CN1A 2QQKH 3DURA 3LIZH 4WW2A 3P9MA 1YA5A 4HBCH 4HAFA 1EFXB 1NAMA 4QRRB 3GSNB 1K2DB 4KDVA 3MXWH 4NQEB 2APXA 4Y1AE 5HDBE 2XACC 3I3DA 1W72H 4K55A 4NZRH 2H41A 3VG0H 4OFKA 2W91A 3OAUL 4KK9C 5DJYA 5I1DB 3RWDA 2Q1EA 4ETYA 4OV6F 2UZIL 4XP5H 4YIQA 3CMGA 4KKAC 4UDTB 1NCTA 3U7WL 5JQ6L 3ILQC 4JO1H 1W0WB 4UILH 3RWGA 5JPMA 2BNQB 1P7HL 3DX6A 5I8CA 3MV11 2WBJA 3LS5L 5FYJU 3EO9H 1C5CL 2ITDA 1JZ8A 1HZHL 1E6JH 1R3IH 4NWUH 1N3NB 3SJVA 1SJXA 1UG9A 3QH3B 4UIKH 5K9QG 3IRZA 1Y6KR 1JCKA 3A6CH 4GMTL 3CFKB 4HWBH 3AFLA 4NM4L 5E6YA 4H5SA 2VLMD 3TC9A 1I1AA 4R2GC 2IF7A 5E4IA 5K59F 1FC2D 1K8DB 4D0DB 1EBPA 3FL7A 1S9VA 3H9SE 4CVZB 4DEPB 5C09A 4PP2B 4OLYL 1FVCB 3TBWA 4JKPH 2NY7H 3FO2B 4P49A 4P23A 2PXYD 1J1OH 1HHJA 5DQ9A 3MUY1 1RFDL 1AXTH 2VO5A 3IAQA 2NCMA 2Z91B 3OXSA 4KJPC 3ZTNH 1YPZF 1I9JL 4EBQL 5IEHA 1CS6A 1Z2KA 3DETC 4IMKC 3QR2A 1C12A 4W68A 4Z7WB 3NH7L 1G9ML 5L0QC 4NM8L 2J8HA 4DAGH 1IC4L 4AL8L 5KOVC 2O5XL 1FO0H 1F02I 2JB5H 4WO4A 1MJUL 1ZLSH 2P8PB 5CAYB 4HC1L 2AV1B 1RK0B 1K3IA 5B38G 2VC2L 4EXKA 4TUJB 4BQCA 3KPSA 4QXUH 4MQXD 1IFHL 1F6AB 4BSWA 2DQGL 4LSVH 2JK5A 2IANA 3AB0B 3AREA 3LKNA 3MRHA 3O8XC 3QEGL 1J9CT 2HJLB 1BOYA 2EYRB 1T20A 2GUOA 3HE7D 1BZQK 4U6VH 2GJZA 4G8GA 3Q1SH 4YHZL 3GSRA 4Y19A 5KW9H 4ZNEA 4LP4A 5D5MB 3ES6A 1LNUA 1WBYB 5T3ZL 1XF2A 4U3HA 5FUCC 1FYTD 2OP4H 4H26B 4WUUA 1ZS8A 2AK4A 4R0LB 4TNVK 5IKCB 3MLWH 2W9DH 1GC1L 5I71B 2VN4A 5GGQL 5EC2A 5GPRA 3BW9A 4Z7WF 4HXBH 4MNGA 4KRMB 3KPRB 3IVKA 2Y7QA 1KJMA 4MNHB 3O6LL 1EEYB 1CL7I 3GMNA 1QRNB 1T6VN 2NTFA 2YPKA 1CGXA 3DXAA 5D2NE 4WFGD 1A5FH 4EEEA 1NKRA 3OJ2C 1H15B 5F9OH 3L6FB 4P9ML 5GIRB 5ACZB 1SY6L 5AWNL 1MREL 2Z93A 2WV3A 1NL0L 3RY4A 2FJGA 2E9WA 4Z7VF 2ZG3A 1VGEL 1J8HE 2LU7A 3HMWH 5J1AB 3MRGB 1CGSH 1NUNB 1X5XA 5IB2B 2B7DT 4U1LA 3FRPG 4LLQB 4PY7B 4IDJH 4PJGE 3GMMA 2V17L 4Y8AA 3MCG1 3PL6C 3UDWC 4PJFF 2QQLH 4MXVF 2GKIA 1AJ7H 4XC1L 1LEKA 5AUMB 3CPLB 3V5HA 4U05A 1RY7B 5TDNB 4ZUWB 1GSMA 4KROB 1JPTH 2F53B 2H2SD 5J06A 2DM3A 2ZPKH 5TH2A 1KC5L 1P9MA 4Y4HA 2CXKA 3CXDL 4YE4H 2LVCA 3EDEA 3E2HB 3EYFB 3TH3T 4OCYL 5CINH 3H8NA 3SGEI 2F8XC 5L2KA 35C8L 1LO4L 4CKVX 4JREB 2XA8L 1CTNA 3SDDD 3U83A 1YNTB 3QUXA 4S1DC 2D03H 3LAFA 1TJHL 3PGCA 3I6GB 4I18B 2WQRA 3V5KB 5BZWA 3QIUA 4MDJB 3V0AC 4NQCE 1U8LA 1OTTD 1G7HA 4BFIB 3VG9C 4NBYB 5IJKA 3B83A 1T0NA 1DBKH 3JUZA 3KYNB 4HV8B 4KXZI 5TFSL 3BRFA 4HK3J 1I8IA 3IDXH 4JRYD 3GKWL 5F6IC 3GSWA 1YECL 4YHIA 1X44A 4UT9L 4AM0A 2ZUWA 3TO4C 1UWXH 3S7GA 2CGRH 3K2UL 5IB4A 3WKML 5FCUH 1CD1B 1QVOA 4DW2L 1ORQB 1WCBB 5ESVB 5I76B 2ZCHL 3WUZA 3HC3H 5F1KC 4XPAH 1GOHA 5EUOE 4QRRA 3FJTA 2CD0A 4M62L 4YXLH 5IMKA 2GITB 1BEYH 4DUVA 4PTUB 3ET9F 4RA0C 1V3JA 5DC0A 5FIEA 1Y18B 1RZ8B 3VXSD 5EUKB 4KDTA 1FVDA 5IT2L 4NZUL 4OZGE 2Y5TA 4UOJA 3GJFK 4HT1L 1OL0A 4WFFD 4LSSH 2Q6WB 2E27H 2I60L 1L9NA 1NEZA 2J2ZA 5GGTL 2I5YL 4MCYB 4OCLC 5GISL 5ECJE 1T0MB 5BMFH 3FT3A 4F37F 4L8BB 32C2B 1YPZA 1R5IA 1KIUA 4LL9A 4PJ8B 4UV7L 2BNQA 4P3DB 1NGWB 3VFGH 1BP3B 1WAAE 1V7ML 4GG6B 4O5LH 4IRSD 3MLSL 1BGXH 1OSZA 4WVRA 3B9KB 3SGKC 1NFDA 3G6JB 4PRDA 5CEZH 2J4WL 2MCPH 3LPFA 2MCG1 4WW1B 1N3NA 2NY0C 3C08L 5AG8A 2NX5D 3QH3A 3PWPD 5C0NC 3UP1A 3MBXL 5EPMB 1IILE 4N0UA 4XMKL 1RZJH 3D3VB 4RWYL 2IMMA 3VDAA 3NA9L 1QR4A 5CGTA 1JZ5A 3BUTA 1ES0B 5GSRB 5KANI 3ELAT 5SX4H 4CN6A 1MY5A 3DUSA 3F12A 4PP2A 5ILTH 2AABL 3FO2A 4WFED 2VXUL 2OM5A 3I6LE 3WSQH 2P7TB 1QSEE 3ULVF 4UV4L 5K9OB 4LBEB 1A4JB 2EKSB 5D1XB 1SM3H 4JFDD 4NZTL 2QV2A 4U2ZA 3D1MC 2EDOA 2CDFB 1DQTA 3WN5A 4Z7WA 1G6RL 4JB9L 3ZYIA 1PBYA 2ZKHL 1BFOB 3IDJB 1SEBB 4UTAH 2HLFC 1DN0A 5EIIB 5FO8B 3TA3C 4Y89A 4J6RL 1FORH 1DSFL 4FXGA 4QRQA 1D5BB 2XXMB 5DEZA 5J0BA 4TUJA 5C9JB 3MRMB 3G04B 4Z7VA 1IQDA 3DMMB 3RWCA 1TETL 2R0KH 2EYRA 2Y72A 3C2SA 2XKSA 5D7LE 2ZUUA 3OG4B 4QY8A 3T4YB 3GI8H 3QHFH 2LE9A 4PJFA 1R0AH 3E1F1 4UUJB 3PV6B 3MROB 1WBYA 2YD3A 3QI9A 2HYMA 2Q76A 4N8CH 1IQWH 1E4XL 3U9UB 1UEMA 2NXZD 3RDTA 5GZNC 5J57B 1N26A 1TQCB 2DMCA 4YXHH 3RVVC 2OX5A 3O0RH 4JFZL 4N8PA 1NBVL 1EEYA 3QUZA 2VABA 1F4XH 1XIWD 1E27A 5F7HA 1NGPL 4D9QE 3RTQA 1H15A 2YEZB 3MCLH 3I02B 5ACZA 4ELMB 1XZ0B 4YO0B 4GBXB 3DX9A 3BIKA 4U31A 1E0OB 2GY7B 5ERWB 3BMVA 5BXFB 1LMKA 1A0QL 2NZ9C 3W5NA 1T2QH 2X5PA 3CDGB 1X7QA 2EH7H 3EOYG 5HGBB 3EYUL 5KSBB 2FO4B 4H1LB 4MS8C 4P59L 5M94B 3E6HB 1OTUC 5FYKE 1EUTA 3ZYZA 2EKJA 1U42A 1MAKA 3EW3B 2AXGA 4G8FA 5AUMA 2AERT 4M4PA 1LK2B 5E9DE 2PR4H 4AK1A 5TDNA 1N6QL 1XEDA 1A6UH 1H5BC 2BERA 2F53A 5EU6A 1R24B 2BRRL 1FGVL 1CR9L 3UJIL 5E7FA 4FQXD 4LEOB 4N0CC 4NN5C 1TXKA 3O6KH 3SBWC 2VXQH 4H0GA 4HKBB 4LCYB 4RRPA 1FC1A 4M5ZH 4WI8A 1I1YB 2UVFA 4OQTH 4BUHA 5C07B 1F58H 1U6AL 2YA1A 4KRLB 4ELMF 5ADOL 3V4PH 3STBA 1LK3H 1IBGL 4L3CA 2P24B 3C5ZC 3IKCB 3W0WE 3H3PH 2VH5H 2OSLB 4J12A 4ZFOB 3S4SB 1A3LL 5HDLA 5ISZD 3I84A 1FH5L 3TNNB 3VCLA 1DEEA 4A6YH 4X5XB 4JO2L 1O0VA 1D5IL 1IC7H 4KMLB 5L88L 1D5ZB 3FN9A 3CLFL 4MDJA 5BO1L 3V5DA 3EOAB 1CD0A 3LN9A 4BFIA 1BQHB 5F3HB 4RFNB 2J8UF 3P11H 2NY2B 1LWRA 4MCZB 4YXKH 2A6DA 2M26A 2VIRA 4PTTB 4QOKB 1HWGB 3KYMA 1P53A 2B1AH 4LCIL 1Z9LA 4D9LH 4PV8A 4TUOB 2ED8A 1NC2B 4P2RA 1A6AA 1OGAA 1FZJB 4Y2DB 1IGYB 3BYTA 3CLEH 2XZCL 5F8QC 3FKUS 5JNYA 5ESVA 4L29B 4OLVL 1KUMA 4WJ5A 5I76A 1S3KH 5CILH 1CE1L 2IPTL 1MRCL 3KPNB 1MI5E 3RWEB 2CRYA 1GZPA 1MCDA 2FGWL 4PTUA 2R39A 1QFPA 3SO5A 2HFGH 4FFWD 3O2DL 4JVPA 5T1LD 3VD5A 3RX8A 5E8PA 1B3JA 1RZ8A 4S1QH 5EUKA 5D93C 5D9SB 4OF7A 4K94H 4GXUM 2F8VA 2R2HA 1MCQA 3V0VB 4E41B 1FGNH 3QUYC 4Z8FH 4JQVA 4N0YH 1DZBA 4FQ2L 4R97C 2AEPL 5J11B 1N64L 3AS2A 1T0MA 4L8BA 32C2A 5BS0D 1WIPA 1Y0LB 3D6GA 1BOGB 1P1ZB 4LSRL 4DGYL 4OLZL 5GJTL 1QSVA 1UQSA 3HE6C 3MZGB 4DVRL 4FQHB 1EAPA 2IMNA 5I1GL 2QQNL 3QG6A 3ZDZF 4X7CC 1PG7L 1NCAL 3RVTD 1ONQB 3E6FA 1QD0A 5E2TL 1XR9A 3S5LG 1NGZB 4GAGH 4EKXA 3TCLA 3ARGB 3WDIA 4MSWA 4YHPB 5B4MD 3VD4A 5I1LA 2HT4D 3TCXA 3FB5A 1UADC 3D3VA 4ZPTB 3ZSSA 2ZUSA 5FUZH 4K7PL 2CMRH 4M00A 2FD6L 1A2YB 4JFFE 3RWIA 4YHLH 5GGRB 1RZFH 4FMKA 4OGZA 3TF7C 4PJ9C 4CVUA 3UTSB 2HT2C 3N06B 1RHHA 3QSKB 3IFOB 3QQNA 4NDMB 3REWB 2P7TA 4G3YL 1K5NB 3BPOC 4IMLA 5F44A 4ZXBC 5C0AB 1AFVL 2FR4A 2CSPA 2OMNA 5D1XA 43CAA 4X80H 2GJ6B 4AT6A 1DQLH 5EU7E 1KPRA 4WY7L 3MFFB 4M6AA 1AR2A 3C8KA 5JOEA 4HQQL 2IG2L 1ZVHA 1XGPA 5HHOD 1LGVA 1BFOA 5HYJD 3P4MB 1ZKAA 4OD1H 4KI1A 1FG2B 3LKOB 4EOWL 1OTSC 4W70A 5FO8A 2BK8A 5JW5A 3VFNB 4L3EB 4NPYB 4YPGB 1UA6L 1S5IH 3DJ9A 3VI3E 1GZQA 4HIIA 1R5WA 4WU5A 2R0WH 4NQDA 3MLPA 5D1QB 1EEZB 3H3KA 4LDOB 5A40E 3UTTB 1B90A 4R9HA 2QBWA 4U1GC 4APQD 4D0BA 1F3RB 2R23B 5ETUB 4WW2C 5FGSA 3LEXB 3O6FB 3AY4A 2EXWD 4PPTA 3PV6A 2B2XH 4P4RB 2GT9B 5DZNA 1B0RB 1NCCL 1QQDB 1ND0A 4K2UL 4S0SD 5C09E 3QZWB 5DVLA 1VFAA 4JGUA 4H8WL 3SQOL 1KTDB 1A6VH 1K4DB 3RKPA 5DFVC 5HGHB 4MAYD 4QTIH 3ULUD 2Z8SA 5BVJB 3C9NB 4JFQB 4NQSA 5C9KA 2BFVH 4PJ5A 5EU7C 1S7TA 2CUMA 4K7FA 5TQ0L 3UJJL 2CXGA 4HK0A 4ELKB 5AZEH 4HCRA 3C6SA 3ZDXF 4GKNB 4ELMA 3TYGL 3NMEA 5H35B 3S98A 4ISVB 3QP3A 5BXFA 3NFPA 1QZ1A 3CDGA 1JPGA 1YEFL 2WBJC 3DX7B 3KPSE 4R7DA 1LEGB 2FO4A 4JZJB 4OM1H 3RHWK 2DIBA 4RDQG 3L3HA 2IQ9H 4N5UA 1CXHA 1D5XB 1TVHA 3MODL 4GRLD 2EC8A 2J8UA 4NQTA 4JDTH 3QDGD 1LK2A 4G8GE 2JJTA 1QLEL 4LKXB 4HS6A 2R9HD 1R3JB 3IDNA 1N2RB 5I73C 4LSUL 4Y19E 4ZNEE 1I1AC 4N0FB 1VGKB 1KB9J 3KLSA 2EIDA 3CAFA 3MOAH 4RA3A 4WUUE 2AK4E 4LCYA 3CJJA 4LAJH 1L6ZA 3OAZH 4ONHB 4QGTA 4HFUL 4P23C 2DLFL 3WIIH 4EUPB 3RVXC 4EN3D 2PTVA 3N0PB 4MNGE 3N1PC 1BZ9B 2XNAA 3W81A 3L7FB 2BVTA 5FM5O 3U6RA 1D7FA 4CDHA 5JUEH 1QSFD 3DXAE 2P24A 3IKCA 2CK0L 1B2WH 2G75B 4RFEB 3TNNA 4WV1B 4K3EL 4C56A 4M5YH 3AAZB 5E6ZA 4RAUB 3BGAA 4X6FB 5GRUH 5HYSB 4U6XB 5FKAB 3B3IA 1D5ZA 4CU6A 4LSPL 3U30C 4WO4C 3GJFB 3RL2A 1IM3B 4OFIA 3RRQA 3AUVA 4DN3L 4NBXB 3KPOB 1CXFA 3SGDI 3AREC 5ID0B 1VDGA 2EYSB 5DD5L 1KB5B 4Q6IA 2C4FU 3AM8A 3ARBA 3JVGC 4TUOA 4TTDC 5H2BA 1OPGL 3QWOB 4GW5B 4Y7MA 5DJ0A 3LKRB 2CIKB 1HEZB 1T4KA 4MD4B 5HTSA 1G1CA 3DGCR 4AEHH 1H3XA 3FFCB 3O4LB 4HUNB 2I9TB 5TJWK 3FTGA 1OF2A 3ZE0F 2CR3A 4ENED 2VXVH 4GG8B 4PG9B 5L2KE 3QULB 5J3HD 3DV6B 1J5OH 5HYQB 5D9SA 1JWMB 4NO5B 2DLTA 4QNPF 5BVPH 5HHME 4L4TA 5I30H 3EKCA 3MJ9L 2OLDA 4TUKL 4ZPVA 3B9AA 5KN5A 5CZXD 4JY4B 1MCOL 5DMIH 1W8OA 2CUIA 1RIVH 5J6HB 3MV8B 5A16B 1AP2B 2DMKA 1XT5A 5CGYC 1T1ZB 5DD6B 4KUCF 1UKQA 4FXLA 5HBBA 2MWCA 3D48R 2BX5A 3P4LA 4P3CH 2ZJSL 3ARGA 1X5YA 3REVA 2VITA 2NY3C 3PGDA 4OM0H 3WLWD 3RI5F 3BD3A 5F89A 4ZPTA 3GMQB 2P47B 2WUCL 5I18H 5CSGA 1FCCA 3KS0J 4WI6A 3DIFA 5EWIL 2ESVE 1WWWX 2R29L 3NABL 5CD5D 4G43B 4X6BA 1HHHA 1ZHLA 3WO4B 3W2DH 2IAMD 3VWJB 2Z31A 4U1NA 5K59E 2RAMA 4P2QB 3E3QE 4S1RH 4RRPG 5C0AA 3VXQA 4ODTH 1K4CA 4NKMA 2VN7A 4XVJH 3TJHD 3UBXI 3O4OC 4HWNA 1NCBH 2GJ6A 3DSFH 4KQ4L 4Y8DC 1EBAA 4YHMH 4PP1C 1XGQA 3QIWA 4XTRC 4I9WE 1YPZE 1TTFA 3QIUC 3QAZB 2HN7B 2A1WH 2BNQE 2EIZA 3S3JA 1YEKL 5EU4B 1IMHC 5MENB 1RULH 4M6MH 4L3EA 4KK8D 4XVSH 4YPGA 1MHCB 4NCC1 2DQHH 3QT2A 3EOTL 1NFDE 1FFNB 2H26A 4ZDHB 2YHGA 2RHEA 3QEHB 1OCWH 4XPBH 4I1NB 3OGCB 4R26L 2ZSVA 2X9YA 3SCMA 4CNIB 1EEZA 3CMOH 4JLRB 4MDIB 4I3SH 1IC5H 1K9TA 1A4KA 2J5LC 2GW5A 4N0UE 4RGNB 4U7MA 3HS0B 4M8QB 5TDPA 3M17B 2OZ4H 3LD8B 1B0RA 3SDAB 2ITCB 2OR8A 1QQDA 4KK9D 8FABB 4POUB 2GSIA 1N7MH 1KJ3H 2X89A 1HKLH 4JKLA 1KTDA 1ZXQA 1MY7A 4KKAD 3KXFD 3OPZL 5FYKH 5BVJA 3ILQD 4PRIB 5BQ7B 4PV9B 2P1YA 5FF6A