1GJIA

Crystal structure of c-rel bound to dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
275
structure length
275
Chain Sequence
PYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKIRTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFILCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIVFRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords IL-2 CD28RE DNA
publication title X-ray crystal structure of proto-oncogene product c-Rel bound to the CD28 response element of IL-2.
pubmed doi rcsb
source organism Gallus gallus
total genus 49
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gjiA02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1gjiA01
4P5KB 3VXNA 1L0YA 4MGXA 3RBSA 2VXQL 1AD0A 4JO1L 1AI1H 3CFBA 3I84A 4EUPA 1VFAB 4LSPH 1ONQB 4J3UA 4MMZC 3WJJC 4EQ2A 4ERSL 5HGAB 3H8NA 4F8TA 5K93A 5K9QG 1MIEL 1XR9B 1M7DA 4D94A 4LCYB 2EEAA 1HINL 4JANA 5KS9A 4ZUSB 4LLVB 3LN4B 5A16B 5FB8B 4P99A 1KCUL 5KSBF 1YNLH 3S4SG 2X9WA 2XTJE 3MCKB 5DK2A 1TFHA 3QWQB 4FXGA 5IMMB 3QRGL 1QR1B 1H0DB 1NCWL 2IBBA 4ZQKB 2D7OA 4POZD 2B5IB 5I71B 3IKCA 4X9GA 1NGPL 4RAVA 1BFVL 1U92B 5I75C 1Q1JH 2GJ6D 2DI9A 5AD0A 5JZ7C 3FO9A 1YMMA 3TBYB 3BGMB 2J12B 3PGDB 3BRGC 3V4UH 2XN9A 4F3FB 1YPZA 3BXNA 4IRSC 3X11B 3X3FL 3VFOA 4ODWA 4BH8B 4LHUD 1UA6L 3MBED 4OZ4B 4N0UA 4YFLI 1JFQH 2A6KB 1FGNH 1OLZA 4GJTB 1EBAA 2D2OA 5ANMA 3FL7A 2MJWA 3S5LG 5KSAA 5D2LE 2HJLB 3QEUA 5IF0B 1CDUA 4PTUB 2Q20A 2GSIB 2VAAA 3DTXA 5CEZD 3BIKA 4YWGH 1EGJL 3RWDB 2JF1A 1X3DA 3CC5B 1CK0L 4MCZB 5GZND 2NQCA 5C07E 3WFEL 4UILH 4PRNB 3RVWC 4U1JB 1RUML 4JO4L 1I3VA 5ILTL 2EYTA 3B43A 1CLYH 1AQDB 2J8OA 2JJWA 2IANE 3O6FD 5T3ZL 3MV7D 3AMKA 2YEZB 4XBEH 3AB0C 5E4IA 3DX8B 4JG1H 1L7TH 3C2AH 1FNSH 2R0ZL 4DJMA 2A6DB 4JHWL 3O45A 1I1AA 1F3RB 3SKNA 3HMXH 1R3LA 3VI4F 4PGEA 5DFTA 3ELAT 2NY6D 1MWAH 1RUKL 2HN7B 2YD2A 3AS2A 4U3XA 1MQKL 2EIZA 4LP4A 2NTFB 4AQ1B 1OP5H 3VD7A 2RR3A 3WSQH 3KYOA 2BNRE 3GHEL 3BHBB 2N56A 3W0WB 4OZGF 2H6PA 1R3JB 3IETA 5JW5B 1JPFA 3NVQA 1ZSDB 1XF4B 1FVDA 4MVBD 4QEGA 5LG1A 3HMWL 3QDHA 1FIEA 4Y1AB 1KTRL 3TYFB 4LEOB 3FT4B 3FRUB 1DTUA 4U1KB 5D2LF 1JZ4A 1UJTA 1N5YH 2VWEE 3RP1A 1C5BH 4OLWH 4QXGL 5JPNA 3BPOC 3RRQA 5DTFB 1AIFA 1TQCB 3TT1H 4DAGL 3OJMB 1IC5L 1GGBH 4MNQD 1HK6A 4XPHH 1BQLL 3OHXA 4ZOEA 5HHNA 5C0BB 1X4XA 5IR1A 5DDHB 2VLRB 4NN6C 1X5AA 2IAMC 1XT5A 4UUJB 4G8IB 4C54A 2VUYA 2P48B 1U95A 3QCTL 1F4WH 2PR4L 4Z7UE 1M6OA 3EAKA 5D7JC 4FQJH 4JKMA 3O4LE 5EC2A 4M62L 3QH3A 5FDWB 2EO9A 3S35L 3FB5A 4CGTA 2B8OT 5JHLL 3QDJB 1R24B 2J8UA 1JWUA 4HPOL 1BJ1H 2DL2A 4FN0A 2C4XA 1I7RA 2X4TA 4UDTA 4KMTH 4KK8D 4XPGL 5B38B 5D7IA 5IHLB 2B0SH 1LMKA 3KJ6H 4ZPTB 1S9YA 2VLJD 1BIIA 3QCVL 5GSVB 3GFUA 3H0TA 4JRWA 3G5YA 5DRZB 4L4VE 4XT1C 4EEEA 5E56A 2ICWA 3CFDA 2IQ9H 5K59E 4WFHE 1H3PL 3ARGB 4XNZC 4HS3A 3U0TA 1TZIB 2FEEI 3ARZA 4BFIB 2NX5E 1RJLA 5EO0A 3SPVA 1T80A 2EC8A 3W39A 3UAJD 1KJVA 4P9HL 4FZEH 1MCOH 4HQQH 1VPOH 3FO1B 5DLML 3FQUB 4OT1H 5D2NB 1HZHL 1PVHA 4PB0H 1RMFL 4PJBB 1CTOA 4Z7UF 1TJHH 2W07A 1N6QL 3RY6A 1NAKL 2ZUUA 1FG2A 4WU5A 3HPLB 5J1AA 1MFBH 2P42B 1CICA 3CSYB 4NQSB 3CLFL 5CSBA 2PO6D 4LCWE 3MV8E 4EUPG 1FZOB 2ED9A 5BRZE 5GJSH 2MQ3A 1G7HB 1QFWL 1I1YA 1PKQB 1QSVA 1KLUB 2HKFL 4PJEB 3R1GL 3BOVA 3I9GH 1A7OH 4OUOA 2YPVL 3H7BA 3ALXA 4MJ5A 2RCSH 3MFFB 2X4RA 3RTQB 5B39A 3ZYZA 5DD0H 5IVOA 2G75B 5I1CL 5IM7B 4KXZH 2X4UB 2AI0H 3T0EB 1IGML 1CL7H 4LVNB 3MRLB 4DK6A 2P5ED 2HT2D 5IV2A 3QXVA 4CN6A 5IB5A 4ZYKA 4MLIA 3HE6D 3TO2A 1DBJH 1BJ1J 3EO1B 3BEWB 1NGWB 1KT2B 4HCRL 3BZDA 2WBJC 3DVGB 3SEPA 3MV9E 4JGUA 2IANA 5IB4A 2PN5A 3BMVA 3V8OA 3KLAB 1KJ2L 4HKZB 3D0VB 5I1GH 3TH2T 2H9GB 1Q38A 4CW1A 1IJ9A 3T65A 2EDTA 1I9JH 5GGVL 5FF6B 4HKXA 3VRIA 3EW3B 1A6AA 2O5YH 2VDRL 3DIFA 3WHE0 5FA3B 1I8MA 3KPSE 2EH8H 2ESVD 4JZOB 1KB5L 1N0XH 4S1DC 1T1XB 3OR7A 4ISVB 4X0KB 3UYRL 5KBNC 1CBVL 4KTYA 2XQYG 3EYVB 1SEBB 3INUL 5H2BA 3IJHB 3WLWC 2BNRA 3FOMB 1HH6A 3IS0X 3V7MA 4P46B 1QPPA 3U46A 5IFHL 4GSDL 1U0QA 3ARFB 4R7NA 4JKPL 4Z95L 4V1DD 3ARXA 2E9JA 5J9PA 5DD3L 5BZDB 1CU4L 4L3CB 4LSQH 3B5TA 1NCBL 4MD5B 3UZVB 1QSEB 1RZ7L 1WWCA 4NQCE 2WMPA 5CEYB 3LZFH 5JNYB 3F7VA 4Q2ZA 5J11C 2NNAB 5DMIL 2VSCA 2IGFL 3MLWH 2WWKO 3EDKA 2HFFB 5JQ6H 5AAWA 2PYEB 2OS7A 3X14A 1HILB 2CPCA 4HMDA 2CRIA 4Z7UA 3RWCB 2B20A 1RZIB 3G5VB 1NCDL 3O4LA 3D69B 2WQRA 5J6HA 1UKQA 4J1UB 1I3RB 5DI8A 2WSKA 1OAKL 3WNLA 5BJTA 4ZTPH 4NDMB 4WO4B 1ZV5A 1T20B 4P5TC 2QADB 3QG7H 1H3TA 5DS8A 2DQIH 5E2TH 1MCJA 2L0DA 2GITA 1K8DB 3ARBA 3QIWA 4G7YH 2NXZB 4IBLT 1B0RA 2ITDA 1BEYL 5IESH 4N1CA 1X9QA 4HIHB 3VG0L 2FX8H 2FGWL 5C09B 5F8QC 3JXAA 1DUYB 3RKPA 4L4VA 3QXDA 2UZIH 4YHPA 2WBKA 1DBKH 3P0VL 1NUDA 3FHAA 5DJZA 2NY4C 2R9HC 3TO4B 5JOFB 2B39A 3MOAL 1YJDL 4ODHL 3SE4A 1WFOA 2KPNA 4HWBL 4N0YL 3RWEA 3X13A 1GGCL 1RZFL 3PHOA 4D0DB 2W9EH 1UZ6F 3OTTA 4R90H 4J3WA 5EZJA 1I1AD 4QTIH 1CDBA 4O2CA 3TZVB 3EZ8A 2R2EB 3BRDA 1R0AL 3MGOB 4JFDE 3HFMH 3K46A 2FX7H 2H32A 4F58H 4X7SL 2DQGL 4AENB 3HI6L 4M7LH 4ZG1A 3EO0B 1S3KL 4CVWA 3FONA 4Q58C 2L4OA 5EG6C 1J0YA 5GRXG 1BLNB 2XG5A 3C6SA 5DRXB 5FUZH 4NN7B 3OKNA 2E6PA 2MOVA 2PNDA 4KJWC 4LCWA 2YWYA 1M05B 5HJ3B 3RWIA 4LSUL 5BRZA 1INQB 1QBAA 1LP9E 2AXFA 5BCAA 4YJZL 3L7FB 1EJOH 5GRUH 4K71B 4BZ2L 4M48L 5IB1A 4X7FC 3B9KB 3WUWA 4XXDB 1F8TL 4HJGB 5CJQL 4CMHB 4QHLB 4TNVF 2AGJL 1UQSB 5H94B 5F7EH 4FFWC 4JZJA 2OX5A 1AP2A 1MLBB 3BIAX 1KEGL 4QRSB 4JFYA 1MCQA 4M02A 2EIEA 2NY0D 1DSFL 4WY7H 4MXWL 1FVCB 1NFIA 2GJZA 5C0AD 2VXQH 2ERJC 4WWID 3RA7L 3IXAA 1Q9LA 1A9EA 4R7DB 3ULVH 4DGIL 4OB5L 3CH1A 4KC3B 1PQZB 3BH8B 2UY6A 3DYMA 3MXWH 4KRPC 3ZYIA 1A47A 5FO8A 3PWPB 1JZ8A 1Q0YL 2X1PA 1VACB 4ZSOE 2DQDL 1D6VL 1WITA 3ZHDA 3Q6FA 2BSSB 1CFNA 1QR4A 2ZSVA 5E9DB 1HINH 3MRPA 5LBSH 3SE8H 5B39G 3O0RL 1HDMB 2LV4A 3LPWA 3RDTC 2OSLB 5DUML 2HJKB 1BHGA 3VXMD 1CXLA 3KPSA 1URLA 5MP6L 4FQQA 4W81A 3TNMA 1H8NA 2VISB 1LP9F 2OJZL 4XX1E 5AZ2L 1IGIL 2DQJL 4B50A 5IBLD 4U3CA 4OGYH 1KPVB 2Q7YA 1BFVH 4DOHB 1YMHB 1AO7E 4I8DA 1KB9J 1JNHA 3ZTJH 5D8JL 1C16A 1RZGB 3TESA 5A43C 1UWGH 5K9KB 1S7WB 3X3FH 4JVWA 4E42A 5L2JA 1QFUH 2V7HB 3GSUB 1T83A 4IRZH 1UA6H 2MKLC 3K3QA 4LAJH 3P4LA 2BMKB 4NOBA 4PJ7B 4RAUA 5ID1A 3MJ7B 3IYLW 3AFLA 3U7AA 1R5WA 2FBJL 4LEXL 4NHUB 4WFGE 4Y4FB 3RGHA 3VXRB 1YY9C 4K23H 2IEPA 4NQCA 4ZOBA 2XTJD 5DJ2A 3H2WA 4LLMB 4LRIC 4OQ1A 5I76B 4GG6E 5J57B 3MYZA 4JN2A 4M43L 1B0GA 4OD3H 4P59L 3Q48A 3QB7C 1EGJH 1CLOH 5T5FH 5D96B 1D5MA 1TDQA 5L0QC 3MPCA 1CICD 4LCIL 5D7SH 1NC2A 3RX5A 3LKNA 2CKBL 3WFEH 4MQSB 3NFNB 4MAYA 4JO4H 4RGOL 5J1SC 3U2SB 1L7IH 3EOTL 2X4NA 1JGUH 1OAXH 4XAKE 3ULVD 2K3TA 2CLVA 3SDAC 2E9BA 1DE4B 3U83A 4DVBB 2VE6B 2X5PA 4QOKB 5F9JA 5LCVL 4G5ZH 3SJVE 2X1QA 3V4PH 1U8HA 4PJCE 2KBGA 1T03L 1MAKA 1FIGL 1EEYA 2QL1A 2F58L 5CHNA 5C0EB 1ZVSA 1XGTB 2ATPB 3JTSB 2QSQA 3VA2C 4LRNH 3OZ9H 2F8OA 3KPPA 1FO0B 4YHMH 4P2CG 3PIQA 1RUPL 4JEGB 1AXIB 1B90A 4L8CA 1U8NB 2NXYC 1D9KA 3VFVA 5IK3B 1CI5A 5EORH 3SBWC 5C07D 3FZUC 4HIXH 4N8VB 4LF3B 4HKBA 3CDFA 4I0PC 2IAND 3STZA 5E8PA 3SGDI 5F7UA 4S1QH 3MODH 3BE1L 4PP1C 3D5OF 4G8EB 1CDGA 1QNZH 2XA3A 3EGSB 5A2KH 3RWHA 2BSTB 4X6FB 3SDCD 4QXGH 3F7YA 4I5BB 3I6KB 4DAGH 1DQMH 1KEML 1EZVX 1DLHB 1IC5H 4U49A 4JFDA 1ETZB 1KN4H 3W11D 2D7PA 3OSKA 2VR4A 1JK8A 5HGHB 1MHHB 1NGXA 1J8KA 2P44B 5E8EB 2Y5TA 5MI0C 1G7IA 4LVHB 1SYVB 3MACL 3WO4C 3HAEA 3RZCC 4QHMA 3QCTH 2VDML 1LP9A 2PR4H 1TZHA 1MJUL 4GKZA 4Z7VE 4X5WB 4QCIB 4YXKL 4M62H 5LQBH 4WWKA 2XWJB 1HHGB 1J1XH 3ULSA 1S7QA 4Q6IB 4XTRC 1DVFC 4MXQC 5DJ0B 3CCHB 3UTSB 3T77A 4BFEA 2C3WA 2BVEA 3P77A 1YECH 2E9WA 5FKPB 1YQ2A 4NYLA 3MCG1 1U3ZA 5C6TL 4IOFD 5CMAA 2ZNXA 3D2UA 1YYML 3CFEB 4XVTL 2FIRT 1PDKA 5FECB 4LARL 2R0WH 3NIFE 4FHBD 2XRAH 3QHZL 3PWJA 2RB8A 3FHQA 3BP7B 2Q7NA 3LOWA 3WEXA 3AREB 4U1HA 4OCWL 1FJ1A 4LLAA 3O4LD 4ZSOA 1H3PH 1IEAA 3VWKB 1LK2A 4NKOB 3WUWG 3ZKND 5GGRA 2GCYB 3MLXH 1S9VB 1MFDH 3TIEB 3QULB 1JYXA 4GUPA 5KSVB 2VR9A 4Y4HB 1HQ4A 3V52H 4LLUB 1QLFA 2VXTL 2EC9U 4LSRL 3RVTC 1QKZL 32C2A 4IIQB 3ARBD 4X8XA 5K9JH 1Y18A 3MLUL 5DMKB 4NC1E 2M1KA 4OZFB 4Z7VF 1ADQA 3FO2B 1JZ7A 1N6QH 1NAKH 1KACB 4KUZL 1TPXC 1UXWB 4ODBD 4F37K 3RUGE 3WKML 1AO7A 2J8HA 4TSCH 5KVDH 4L4VD 5SWQB 3DBXB 5M94B 3IVKA 4WFHD 2VDKH 1ZEAL 1PZ5B 2HKFH 2W59A 4NKDB 1CG9B 1YEGL 4JPVH 1OPGH 5E6ID 2YRLA 3W0WE 2NX5D 3U7WL 1KNOB 1ZHLB 1JPSH 5AYUH 2DICA 3WFZA 1HIMH 3NIFF 4Y1AE 1FNGB 5F6HI 1MF2H 1FFNA 4GG6A 7FABH 4M93C 1NBQA 2XG4A 5HHOB 3MJ9L 4FXLA 2Z31C 1UZ8B 2YRPA 5I1LB 3DVNA 4HMEA 1C12B 1KJMB 2FL5A 2BY1A 2YPKA 3BQUA 1LNUA 4K9EH 4HCRH 3MV8D 1OAQL 4UV4L 1TLKA 2EH7H 1CLZL 5C0BE 1X4ZA 3OX8A 4OIIL 4XPFL 2DQUL 3B83A 5MEQB 3P4OA 3AAZA 1FH5L 3BZ4B 4ZTOL 2IQAA 2FSEA 4J6RL 3IRZA 3PHQB 1JHTB 1K2DA 4U33A 3LSOA 5J89A 4YDVB 3BDBA 1SVCP 4NM4L 5GGVH 5JW4N 1T5XA 2DIAA 3FT2A 5DEGB 3O3UN 3SJVA 2GSGB 4XP6H 4PJCA 4AY0A 3RUGF 4L4TE 5DRNB 5C86A 3JV0A 1A6TA 3BSZH 1IM3B 3UYRH 1Q94B 1FFRA 1OTTC 1Q9KA 4MNHB 4YBQD 5C0CB 1CBVH 4UT9L 3PXJA 4Y5YC 5F97E 3INUH 2M2DA 3VW3L 5D70H 1M7XA 1VFUA 3WS3A 5KANG 4IM8A 2G5RA 2VLME 3CDYA 3Q2CA 5DMGD 3U36B 2VZVA 3MV9D 4JFHE 3RAJH 3AXLB 1JZ2A 4Z0XA 3UPRA 3MCLL 3QIWC 5F1SA 3AM8A 3EUUA 1IGYB 2YD7A 4P5KA 1L4IA 4Z95H 1TENA 1N6UA 4X7EC 5I74B 1VFAA 2HLFD 2CMRL 3GMLA 4L9LA 1CU4H 1OP9A 1NCBH 3QAZB 4YIQB 4WHTA 1RZ7H 4TUOB 1IAIL 5HGAA 5I19L 3QIUD 3V6OE 1XR9A 4PRIE 4LCYA 5TF1H 4ZUSA 4E41D 5LGKA 2P8LB 5A16A 5DMIH 5FB8A 3U1SH 1HOCB 4XNQB 1QRNB 4XMKL 5E99L 1O0VA 3GO1H 2QHLA 4N8CH 3MCKA 1NAMB 5AWNL 4YHIA 5IMMA 4TSAL 2I07B 1QR1A 2XZQH 4PJBE 2D7TH 4ZQKA 5E94A 4FFYH 4U05A 1HN1A 1U92A 5E4EB 1XGPB 3MX0A 3H9HA 3WDHA 1RJCA 2VXVL 3FN0L 4MZ3A 3S34L 5DHYB 3BGMA 3TBYA 3DRQA 4LVOC 1NANI 4F3FA 4RGNC 4NBXB 1NCTA 4KPHL 1CXHA 4BH8A 1U8IA 1D6EA 4MA7H 1P4IL 2A6KA 2FGWH 2VZ3A 4Z7WB 5K9OA 1WT5A 1NC2D 5J0BA 5BVJB 4JCLA 1VFBB 3K80A 4UBDC 3T0EE 3CPLB 2HJLA 5F9WB 5B3JE 3HAEG 2GSIA 3V7AE 4D9QD 2OI9C 3UTQB 3MOAH 3DV4A 4Y2DB 4ODHH 2KUTA 5HVWA 1MCIA 4R4NC 5E2VL 3VG9B 3RWDA 4C56B 4LLQA 4MQ7B 3BN9D 2BC4B 5BW7A 1RZFH 3LV3B 4I4WB 2D4FA 2B1HL 4PRNA 1BIHA 3HE7D 1AQDA 1P5VA 4TVPE 2AQ1A 4PJIB 5IVZB 1MHCB 3DX8A 4JFPA 4X7SH 2DQGH 5IMOB 5GZOC 2AS5M 4ZFOB 2A6DA 1Z9SA 1QG3A 5C6PB 1BBDH 2YD3A 4JKKA 1NH6A 1DJSA 2EZ0C 3RUGA 4PGBA 5FYJE 1G0XA 4JR9L 4G43B 4U1GC 4L1HA 4TRPH 3BAEL 4BJLA 5CUSL 2NTFA 1SEQL 4M48H 1JRHL 2X4QB 1F8TH 1IL1B 3W0WA 4LIQE 4TPRH 2FLRT 4OI8A 5JW5A 1XF4A 5DXWA 3S88H 2GQHA 5IEHB 1TVDA 4Y1AA 3TYFA 4KKBD 4LEOA 1YY8B 4U1KA 5B3JF 4MXWH 4P23B 4XX1G 1KCLA 3KHQA 3ARPA 3KYAA 3T2PA 3RA7H 1G7QB 2R4RL 1QSEE 2W0KA 3MC0A 5EU6B 4PLJD 4WI6A 5C0BA 1YDPA 1UKTA 3T0BA 1F45A 2V2XB 2QSCL 4M61B 2LU3A 5DDHA 2XQYK 4JM2C 3BMWA 1GIGL 1HWHB 4G8IA 4ZUUB 2J6EA 1CGSL 3O0RH 4XNMB 4GAGL 3OR6A 3NCJL 5MENE 2Y23A 4L4TA 5DEZA 2FWOB 5MP6H 3A0OA 5EFIB 3NIDE 5FDWA 5GS2D 3MUGA 2BHZA 2OJZH 3O2VL 4U0RC 2ATKB 5AZ2H 5C2BH 2WNGA 2UY7A 3V5DB 3ILQC 1H3UA 4HFUL 2VERN 4MQXD 4FFVC 2WP3T 4WNQB 1A1MA 2EO1A 3TFKD 1S7TB 3ZKQD 5B38A 2ZSWB 1FZMB 1KPUB 1MHPH 5I9QC 1F6AA 5DD5H 3EIFA 5C09E 4ZPTA 3JUYA 4JRXE 5INCA 5GSVA 1FL3B 3JTTB 3N50A 4U1LB 2XFXB 5DRZA 1D9KC 3KGRA 2Y6SC 1FL6B 3UJTL 4P2YA 1S5IL 5L6YH 1TZGH 4FQCL 4UOW1 5F96L 1T0MB 3GJFH 3ARGA 4JDVA 4LPCA 3U0WL 5CKGA 1U91B 2VXSL 4M43H 4PV9B 4W6YB 1TZIA 3V6OA 5JW3H 4BFIA 2I9LA 3GSRB 4KDWA 1U93A 1EA9C 1DQQB 3FQUA 1ITCA 4LFHD 3EOTH 1BM3L 4PJBA 4GG8A 4LVEA 3MNWA 3V6ZA 4O4YL 5D93B 5FCUH 3CSYA 3QUYA 4NQSA 3EFFB 4U0QB 1FZOA 4KKLC 1G7HA 2V7NB 3G6JF 4JB9L 4OM1H 1PKQA 1KLUA 5ADPH 1T03H 1FIGH 5D6CA 4NWTH 4ZXBA 5CBEA 4S1SL 4CU8A 3MFFA 2BNQD 1P84K 3RTQA 5ID0B 1UCBL 3GI8H 3BQUD 1P7KA 2G75A 3TVMA 1GJIA 3VH8A 1KXVC 4UV7H 1OGAE 2XPGB 3T0EA 4Z7NE 4D0BA 1QFHA 5D5ME 4PG9B 1P2CB 2E6QA 1F90L 2FHFA 1CFVL 4Y19E 3BE1H 3DMMC 3DXAB 5FAAA 2P8MB 3BEWA 3P11L 1KT2A 2IALB 2OK0L 2QEJA 3DVGA 4HUUA 1KEMH 3WFBL 1XF1A 1KB9K 3KLAA 4JFXB 3VXTA 3UPCA 1XIWB 3MO1B 3D0VA 3BO8B 1HYSD 2H9GA 5GGTA 3FQTA 3TCXA 4X99A 3OAYK 2D0FA 6FABL 3KPMB 3EYQD 4D8PA 2HA1A 3BI9X 4NQUA 5J12C 2UYLA 4OCSL 2VABA 5FA3A 4JZOA 5F9DC 4XB8A 1AY1L 1T1XA 4ISVA 1V05A 1A8JH 5FKAA 1SEBA 3MLRH 3IJHA 5CGYC 3FOMA 3GJEB 5B8CB 4P2QB 3V5HB 5DWUH 1JJUA 1GPOL 4K3JL 5FYLE 4P46A 4Y5XB 1ROWA 4GMTH 3HNSL 3HC4L 4HZAA 3B2VL 4QRTB 5FYKE 1JZ3A 2KKQA 5ACZB 3F6IA 1Q72L 2O5ZL 4WI7A 1V3LA 4Z7NF 5I1AB 1MRDL 3L3GB 4EJ1C 2NY3C 5D5MF 3F58H 1AJ7L 3GK8H 4LARH 3QWRA 1MFCH 2PXYB 2R29L 2Y9RT 4L3CA 3QHZH 3ARVA 1QSEA 5DT1L 5L8KB 4OCWH 3SCMB 2Q8BL 5CEYA 1TTUA 1TXKA 3GMRB 5JNYA 5IJKA 5E5MB 2YD1A 1X5HA 5CP7A 5J6GB 3ZHLA 1T5WA 5C0ND 3RVUC 4LSRH 1RZIA 3G5VA 4B53A 4CU7A 5MENA 4HDIB 5IKCB 2OMBA 3I50L 1I3RA 3NAAH 3RL1A 2FJHB 4JFZL 4M7LT 1ZLWH 3K1KC 1ZT7B 4NDMA 3QEQB 1DN0B 5GRVL 1T20A 3BYTA 1KIPB 3QZWB 1DEEA 1U58A 2D0GA 1K8DA 4HJJH 2K1MA 1KCRL 4JQVA 4PGZA 2EXYD 2DTML 1JP5A 4LLWB 1LO0L 4HIHA 1GZPB 1ZEAH 5C09A 1HKLH 4JRXA 4RWYL 3I6GB 1DUYA 2FJGB 4R0LB 2GY5A 4URTB 2ZG1A 1IAIM 3O6ML 3KWWB 3QT2A 2C4FU 4K94L 2ED7A 4GBXC 3TO4A 3DUSA 4QY8B 4AEFA 3BESR 1G6RB 2R0LL 3PJSB 3MJ9H 4D0DA 4L5FH 5HDQL 2GY7B 3L5XL 5DC4B 2BCKB 4OLEA 3D87B 3KR3L 4ZAKD 3MZGB 2IADB 3UTTB 4NC0B 2CSPA 2AV1B 3P4MB 5EOCH 5DJYB 1OAQH 4UV4H 4F7PB 2DJ4A 5HPMB 4M8QB 4HIEA 4OIIH 4YH6A 3WNNA 3SDXE 2HFEA 5B38G 4NT6B 4LBEA 3FKUS 5DRXA 4ZTOH 2JCCB 4OLXH 5F6IB 3REWB 5GGRY 3VD5A 3DRTB 4PLOB 1M05A 2DM4A 1T1YB 4NM4H 4HT1H 1INQA 3EKCA 4I77H 5DC9B 3L7FA 1CGWA 3SE9L 3TJHC 3WFCH 5JHDE 5GS0C 3FOLB 4XXDA 2F19L 4YDIL 2B5IC 3MJ6A 4QHLA 5I71C 1KULA 1UQSA 4ZFGH 3RNKB 2XZCH 4YFDB 3EOAB 5AUMB 3H9SB 1OGAA 1MNUH 3K0WA 4L8DA 4UT7H 4WUKL 4PRBB 5D5MA 1ZVYA 1WZ1L 3HUJE 3QIBB 4FP8L 4ODVH 5ALBL 4Y19A 1FVCA 1FAIL 4FQHB 1GAFL 1B4RA 4Q9BA 4L3EB 1G7MB 1AKJA 1WT5C 3R0MA 1X5LA 5GRVK 3HC3L 1PQZA 1F4YL 2UWEB 3RNQB 4TTGA 5F7LB 3UO1L 4L4TD 4HBQA 4EBQL 3TBWB 2JTDA 4WW2F 5F7DA 2BSSA 3TBVB 4PJGF 3UZQA 8FABB 2FD6L 1IT9H 3CXDL 1A7NL 3OPZH 4NO3A 4YC2B 3SDXF 4JDTL 1HDMA 3PWLA 3WV0A 3FFCE 2VLMD 4XMKH 5E99H 2P24B 5DJXB 3VH8G 4KZDH 1EZVY 2GJJA 2HJKA 4FABL 4JFHD 3CK0L 5CS7A 4ORGB 5AWNH 3AS3A 4HULB 3L3JA 2YD6A 3V7AG 2VISA 4KKNA 3QI9B 4NC1C 2NZ9D 2HFGL 3A67L 4PLKC 4N90D 3EJYD 1KPVA 4WDIA 1PYWB 4PTTB 5EDXA 1YMHA 5I8EB 3BDYL 5EOCJ 4M6ML 4GRWF 4PJ9B 3S34H 1RZGA 4XC3H 2CK0H 2KL6A 3NMEA 2WIMA 5SV3A 1ZWIB 1S7UB 4N0FB 3D3VB 2V7HA 1DL7H 2MCPL 4PRID 3BGAA 5ERWB 1KJ2B 3W9EA 1P4IH 3PP4H 3HUJF 4RIRB 3IJYA 4Y4FA 3CVIL 5CZVH 3V79C 2DD8L 2AKRB 4U7MA 2R9HD 4X6DE 2FECL 5CZKA 4LLMA 5GISL 1RJYB 2A74B 3BRFA 1MY7A 1CVRA 4NQDB 1ZA3A 5KN5B 5GS1A 4PUBH 2X10A 1TQCC 4J4PC 4X7TB 3U30B 2R0KL 1UGNA 3VFGL 1LE5B 4IMLA 2HH0L 4NHCL 4FQPA 5FO9A 4ZXBD 1EMTL 5CIPB 3L5JA 4GW1B 1JVKA 2BJML 3OL2A 1DE4A 4DVBA 3TVMD 2IG2L 3CFCL 4OFYD 1BVKB 3VGAC 1F02I 4JR9H 5EU7E 3DSFL 2HP4A 1JGLL 3VI3E 5L2KE 3BAEH 5T5NF 4KROD 3EJZD 1XGTA 2EDWA 3P30L 4FFWD 3JV4B 2NY7H 4WI4A 1QYGH 1D5BB 5EU4B 5IK3A 1N64L 4N8VA 4LF3A 4Y16B 1A22B 2JJSC 3B6SB 4TVPD 5KOMC 4H20L 1P7HL 3MBXL 3WHE1 3GBNL 1KCSL 4G8EA 4X6DF 1MRFH 3LS4L 5DJAB 3EGSA 5B3NA 2BSTA 4X6FA 4AH2B 1FG9C 2E27L 3I6KA 4IDLA 1G9NL 1YQVL 3FB7B 1DLHA 3L3OB 4QHKJ 5J06A 4FZ8L 4WW2A 5DF0A 5KW9L 3SDXA 3DX7A 2ADJA 3ARGC 3GSNB 3QUZB 1MHHA 5HGHA 2A6JB 2QSCH 4ALAL 2PUQT 5E8EA 3MRBB 1JWSB 2A77H 5BQ7B 2DYPA 1U2HA 1QRNE 4XHJC 3RDTD 3MA9L 1CGSH 2JLLA 3EYOB 4GAGH 4J8RB 4X5WA 3W5NA 4QCIA 3D0LB 1JBJA 2VUOA 2HTLD 1HCFX 5TE6L 3K2UL 1A14H 3VFTB 5JHDA 1UACH 2XWJA 5D2NC 1HHGA 4Q6IA 4O5LH 3VI3F 4XCNB 5I1HH 1X7QA 5DJ0A 2DKUA 3CCHA 1VERA 1RIUL 3HLAA 4C57C 4X9FA 5FKPA 5IUSA 3VGHA 5TDPA 4PD4K 3P73A 1A6VH 3LN5A 3HUJA 3CFEA 3TBSA 3KLHD 4QRRE 4FQLL 5KVFH 4TNVK 3O6KL 5FECA 5HHVL 4Z77B 3UC0L 4HUKB 3L5WB 3HRZB 4YXHL 3BP7A 3LKPA 4M9OA 5CJOL 5ESAB 1JPST 3AREA 1I4FB 1LD9B 4DN4H 3E6FB 3T0EC 2CRYA 5MEND 4MSWB 5F96H 15C8L 3SE3A 1YEFL 3RGVC 3VWKA 2VXSH 4NNXA 3WHXB 2AK1L 4RQQB 3QULA 1ADQL 2JIXB 2F53E 4QXTB 1W8OA 4FTVD 5F3BA 4Y4HA 3V6FB 1H3VA 3FFCA 3MRJB 4LLUA 5GRJL 4IHOB 4B41A 4NP4H 5JXEA 1CZ8L 4HUVB 3RWGB 4OZFA 4U2YA 3KDMA 3IFLL 3FO2A 1HSAA 3DVFA 4O4YH 3WIFB 1UXWA 2FHCA 3HZMA 5ECJE 2GHWB 3QUMB 1LO2H 1OM3H 3NFSL 5A3ID 4JB9H 3ZKXB 2P5WE 2D31B 1A3QA 4NKDA 2A9NL 1CG9A 2V9RA 3RKDD 4S1SH 2YSSA 4XI5C 1IKNA 3QEHA 1UCBH 4MLSA 2EC9T 4PB9L 3SO3B 4I0PD 3BN3B 4P46C 1ZLSL 4WHYG 1UYWL 4Z76B 4X6DA 4NQXA 4I2XE 1HKFA 4MA3B 1FNGA 1XCQA 1BFSA 4XGZB 4R4FL 2BDNH 2VDLL 3ARFC 1T2JA 4P2OC 5I1LA 4OZHF 4X83A 1D5XB 4YDJB 5GSRB 3TV3L 1RUAL 4OGZA 3ZE2E 3P11H 1II4E 2BVUA 3C8DA 4NKIL 2GT9A 4AYFA 5HHME 3QP3A 2GJ6B 4LPYA 5KVGL 4ZNCD 3NZ8A 3F7QA 3BZ4A 2HRPH 4NWUL 5E8DL 1JHTA 4TQEL 1ZGLM 2DTSA 3LPFA 4P0DA 1PLGH 4LHUB 3MBEB 3ILPA 4AL8H 5DEGA 4OCSH 1OGAD 2GSGA 5L2KA 2AQ3A 5HPOA 4HGWA 4YX2L 1IM3A 1Q94A 3UX9B 3T2NH 5C0CA 2W0FB 3TN0C 1DVFD 4MXQD 3OAUL 1V7ML 4WO4C 5F93C 1BZ9B 1XGRB 5CCKH 1A2YB 2ARJB 5JW4M 4LU5H 1AKJD 1GPOH 4HFWA 4M03A 1BJ8A 3HNSH 3FB8B 3HC4H 4XRCB 1P4LA 3I2CH 2CKBB 5EUKA 1IGYA 2NXZC 2H41A 2NW3B 1Q72H 3WCYA 2O5ZH 3E6HB 5C3LD 1FYHB 3MV7B 1NGYB 2AK4E 3V0VB 2Q76B 4PJAB 4FQXD 3DGGB 4ENEC 4Z0BH 4DKFH 1A5FL 1I7TB 4TUOA 3ZE2F 3TO4C 1B4JL 4G8GE 4HIIA 5I1DA 1EX0A 3U9PL 3S4SB 2NY6B 4G7VL 1E4XL 3ULUC 2VRAA 5DUPH 2CK2A 4IS6B 4NQVB 4DZBB 3L3HB 3HNTL 1HOCA 4XNQA 1ZT4A 1MCHA 1QRNA 3TZVC 4YNYB 2ZP0T 1NAMA 3KPNA 5FYKD 3HB3D 1AR1C 1Z3GH 4M1DL 1N4XH 3OGCB 5EPMA 3NIGF 3I3BA 1CD1A 1KCVL 1REIA 3G6AB 1XGPA 4P4RB 2NZIA 4MA1B 4NN7C 4U2ZA 2AABH 4KQ3L 3QJHA 1NDMB 4HUMB 1LHZA 5C70A 4KI5E 5IB3B 3IB4A 1KCRH 4U1IB 3GI9L 2DTMH 3B9KC 3U4BL 5BOZG 4W68A 3LDBB 4QRRA 4OZIE 4MNQB 1DFBH 1RIVL 3BKYL 4Z7WA 4LLDA 2BVQB 1X5ZA 5IVXE 2LAAA 5BVJA 1S5HB 5D1ZD 1VFBA 1QOKA 1H3WM 1A7QH 4CJ0A 4AEIL 3O6MH 4F57L 2BNUA 1YN7B 2AJXL 2CGRH 3EDJA 3QFDB 1YEIL 3QXTA 4ODSL 4U7SA 5H37G 4Y2DA 4CN1A 3LEYL 5GIRB 1TCRB 2Z31D 2H32H 3DXAE 4YDLB 4MQ7A 5B4MD 3O3DB 1NFDE 1RURH 3LV3A 3L5XH 3KR3H 2F53A 3RHWK 1NC4D 1U8QA 1FN4A 2SEBA 3GIZL 4W6WB 1J0HA 3GRWH 1N59B 1Y0LB 3QYCA 4L8SA 5DJCB 5IVZA 2I5YL 4M6NH 1QO3B 1MHCA 4ZODA 5IMOA 3GSVB 3VMNA 2VZUA 4B7IA 1F11B 4N0RA 3IDIA 1NMCC 5TFSL 2NY5L 3MQIA 4A2MA 2B2XL 1ED3A 2VLJB 2QQNL 1HHIA 3SE9H 1OTTD 2P5WA 3O11A 4L8BB 1ACZA 2ED8A 1OGTA 4KI5F 2H2PC 3T1FB 5ESVB 5BVPL 4RGMB 4OJFH 3PWUB 2CUHA 2OCFD 4OZIF 4Y4KB 4GRLC 2F15A 3S36X 2B4CC 5IVXF 4I2XA 5IEHA 3E3QC 4PFEA 4APQD 5KANI 5ALBH 4FP8H 3IGAB 4EDXB 1U36A 4OZFG 2Z9TA 1P7QD 4LKXB 3ROLB 1IARB 1ZGLP 1FGVL 4HEPG 2DYPD 3UYPA 3MNVA 4Y4FC 1NFDF 2J6EL 5T5NG 4HV8A 3MLTB 2FIKB 3VDAA 3MJ8B 1CCZA 3OV6A 2E9IA 2PO6B 2V2XA 5JHDD 4M61A 2O5XL 5TH2B 2DLIA 2GUOA 5D72L 2IWGA 4M7KL 3LQAC 1NLBL 1EH9A 4ZUUA 3CXDH 1A7NH 2EDNA 1KV3A 3GGWB 3NACH 4JDTH 4XNMA 2RJMA 3BX7C 4U1SB 3FT3A 5C0IB 1K6QH 5HDBF 4FABH 2DIJA 3T8XB 4XVSL 1FYTB 5EFIA 5IW6A 3QEQE 3V5DA 3RL2B 2P5EB 2EE6A 2HVKB 3BDYH 3HE6B 3WNKA 4M6MH 4NZRL 2YMXL 4S0SD 3MNZB 2ZSWA 1FZMA 5CZXC 3QQNA 4P2RE 1WF5A 4YEEA 4XB7A 1XZ0B 1FL3A 2AK4A 1AXTH 5DVNA 4M3KB 5IP4A 5D9SB 1DQLL 1OHQA 4G6ML 1XGUA 2GFBB 3FFCD 3EOBA 2XACC 1KYOJ 1CXFA 1T0MA 4G8GA 3SOBL 3NABL 3C09B 4XP9L 1JTOA 1W0VA 3MLVH 5JUEL 5E2UL 3BUYB 1FZJB 5SX5K 3IXTA 2ESVB 5HD8C 3GSRA 3UTTE 4OI7A 1CFSB 4EI5C 4OCRL 1RV6X 2VZ1A 2QV2A 1GVIA 1AD0B 4XVJH 2CR6A 1DQQA 1MFEH 2R2CA 1WZKA 5GZOD 1MCSA 3KYKH 4HXAH 3ARYA 4NHCH 1EMTH 5CAYB 1NMBL 3EFFA 1PBYA 2BJMH 1F2XK 5CILL 4V1DB 2IG2H 4LVHC 4OTXH 4QHUB 4JANB 1YEJL 2LQRA 3WFHA 3DSFH 4ZUTB 4G6FD 3UJJL 1SY6A 3UDWA 5FK9B 4Q6IC 4FXGB 5IVXA 4HF5H 3R0NA 3WIIL 3H9SE 2XPGA 2P49B 4XPTL 1A0QL 3JV6B 4RAVB 5IB2B 4NOFA 2N7AA 3MBXH 5AD0B 3FO9B 3GBNH 1KCSH 3DXAA 5DMYA 2P8MA 2XN9B 3BDXA 5HVHB 1YPZB 4X6BA 4LGSB 5GGTL 4DKEH 3BXNB 3MROA 1J1OL 2WQ8A 2IALA 4ZO8A 3VFOB 1F58L 3ZL4L 3TEUA 1QFOA 4OIBA 4N0UB 2RGSA 2UWEE 4Q0XH 5FYJL 3AREC 1T2QL 4FZ8H 4XHQA 1U8LB 4KY1L 2ENSA 3KXFD 1XIWA 3MO1A 5L2KD 5DO2C 3BO8A 5ANMB 4OV5B 1U41A 3VWKC 1E4KC 3KPMA 1AC6A 3DTXB 5CBAA 3OAZH 4N1EA 1J12A 2EKJA 3QQ3A 4LIQL 5IQ9A 4OLZH 4Y4HC 4KK5D 3MA9H 4IIQC 4M00A 1DP0A 5E2JA 5TE6H 3K2UH 5JXEC 4H0GA 2GTWB 2EYTB 3L1OL 3PG2A 4Y7MA 3ILQD 4OCYL 2YK1L 3GJEA 4XP5L 5FA4A 5KTEL 2EDQA 1YNKH 1KENL 3ZTNL 4YO0A 4QRTA 1U6AL 3O45B 4ZO7A 1I1AB 5ACZA 1EO7A 4GW5B 1Z0MA 1KBGL 3MMEA 2I25N 5I1AA 5BO1L 1Q9WB 1E4WH 4FQLH 1JI1A 2EYSA 1KXTB 2EIZB 4KVNL 3WDIA 2OL3B 5I2IB 3UC0H 4Y5VA 4UMGA 2Y6SD 4WCYL 2VQ1A 3KYOB 2F5BL 2DAVA 3OWEA 1WQVT 3WYRA 3SCMA 3VJ6B 3SDDA 5IMKB 3IETB 2XIDA 4M5YL 3K4ZA 2E7MA 3ARRA 1YEFH 2BSED 4XMPH 1FVDB 4NQDE 1OCWH 2AK1H 1MAMH 2EE3A 2C26A 3IFPA 1U42A 2Z8VC 5AG8A 1F3JB 4MDJA 1KJ3L 4XC1H 5DK3A 5GRJH 3VE0B 3KNBB 4HDIA 4ONFL 5JPNB 1QP1A 4M6AA 1U3HD 1CZ8H 4QRRD 4GQPH 1DQDL 3QEQA 5DEFB 3D6GA 3OHXB 2DJUA 2NY0B 5IR1B 2D9QB 3QZWA 5C0AB 3QUXC 3ALWA 5HGBA 3BGFB 3NFSH 5FGBA 5E8NB 5KSBB 5EU7C 2R2HB 3U48A 4Z7QE 1Z5LA 3ET9F 4YHOL 1U95B 2VC2L 3PABA 2EYRA 2A9NH 4P2RA 1GZQA 1WBYB 1IBGL 1M6OB 4JO2L 3UJIL 2LVEA 4R0LA 3BKJL 3JV5A 1CQYA 5EC2B 4F33A 2W38A 2EDJA 1JGEB 1MIMH 3CDGB 5MEPB 2COQA 1JWUB 3G5XB 3N0PB 4R4FH 1G6RA 3PJSA 1I7RB 4LPVA 3QPQC 3PUCA 3MLSL 2DQCH 4OKDA 1RD6A 4JE4B 3VXMB 3UTTA 1LO4L 1RUAH 1QBLH 3GM0A 4JFEE 2AV1A 2DLEA 5DJYA 1S9YB 3QAZC 4NKIH 4F7PA 4U6TA 4XVUD 3V8CA 1ZS8B 4M8QA 4NQED 5JOPE 2P5WD 4QLRA 5HDOA 4UIMB 3LHPL 5GHWL 2ICWB 5F7NC 2HT4C 1I8LA 1C7TA 4O2FA 1A02N 5E8DH 2C4FT 3DARA 1T1YA 5IG7A 4HS3B 2MQCA 2X70B 2JKXA 5K33A 4NJ9L 3ZYJA 4UNVA 3W39B 1QBML 3CVHH 3F62A 3E2HB 3FOLA 4X7CC 2HLAA 4UOJA 1C5CL 4YX2H 4AT6B 5DRWB 3NH7H 3HG1D 2OR7A 4A6YA 2XWTB 4NO5B 2XTJB 1MH5B 3OAUH 4OD1H 5E4EC 3X3GL 3EOAA 1DEDA 3H9SA 3RBGA 4K3DL 3LEVL 4UNTA 1CICB 4PRBA 1S7SA 3REVA 3QIBA 2PW2B 4WTWA 2NY3D 3U9UA 5DFVD 3WLBA 3BD5A 3RFZC 1G7MA 1NGZB 1BQHG 4FMKA 4RCAA 3CMOL 2RBLA 4NUGL 4OZGB 4KKAC 4S1RL 2JJVA 4XWOD 1A5FH 3QPXL 5F9WC 1NCAH 2UWEA 5B39B 2X4RB 3OKLB 3BPCB 5J7CC 5T1DL 2A1WL 1B4JH 3TBWA 3LCYA 1MI5D 3VG9C 5GS0H 1JF6A 5D2LB 2DIBA 4BSWB 2YKLL 2X9XA 1EEZB 5IV2B 2JJUA 1HHHA 5DJXA 1PY4A 1MCRA 2OQJB 3TO2B 5ICXA 1EHLH 1WLHA 5FYLL 2BVTA 5ALCH 4ORGA 3S3SA 4LPTA 4W4OA 5C07B 1UFUA 5FYKL 4MCYB 4RAHA 2IANB 4AK1A 1JV5B 1KGCD 1IAOA 1T1WA 3BPNB 3IAQA 5ACMA 4PTTA 5I8EA 3RZWA 5JIIA 4KZEL 2AXGA 2V5MA 3HR5A 3KG5A 4KQ3H 1V8HA 3SDCB 4G8GD 3D3VA 3DSNA 2EDKA 3TC9A 5EIIB 1CQKA 3DIFB 4RFOL 2ZCHL 4NZTL 1I8MB 1RIVH 2CH8A 3CFJB 1QLRA 1NMAL 4PR5A 5EULV 1HH6B 1IGFL 1YEIH 1ZHBA 5CWSB 4P23C 5JORB 1UH3A 4NQDA 4R7NB 5EU5A 3T0DA 5FUCC 3GIZH 4AEEA 1LE5A 5J9PB 4XCFL 4KI5D 5C0GA 2I5YH 1JHKL 5SWZD 3K4AA 5CIPA 2ICEA 4GW1A 5HBBA 5JXAL 2EE9A 5JA8B 4PGDA 2DF3A 2G60H 3D9AH 4K8RD 2V5SA 1SJHA 1H3GA 1BVKA 1BGXH 4WVRA 3F7VB 3WXWL 1OWWA 3TJHD 1ES0A 5EU3B 3JWOC 4RMRA 3ARDD 4YPGA 3X14B 5CKAA 4OM0L 4Z7UB 1GOGA 4LCUA 5EU4A 3O4LB 4FMFA 3ESUF 2NYYC 5CEZE 4QHNA 5DI8B 4Y16A 4DGYH 4OF3A 3B6SA 3RX8A 4MB5A 5F9OH 2X1WL 5BJTB 1DBMH 3LY6A 3NOIA 1IC1A 5EUOB 5JIPA 1VESA 4AH2A 2GITB 3ARBB 1P6AB 2ITDB 1AGFB 3WS6A 1FGVH 4JFEA 1JTTA 1SJEB 5DVOA 2J6EH 5KG9A 4A2LA 2OZ4A 3O8XA 3BT2L 1YYLL 35C8H 5EBWA 2HMIC 4L4VB 3GSNA 3QXDB 4UIKH 4YHNA 2VZSA 5DJZB 1EVTC 3MRBA 5GGQL 1JWSA 2VQTA 5BQ7A 1NLBH 1V7NL 1C8PA 2IPKB 2EDHA 2W9LA 1T3FA 2Y5EA 4MJ6B 3RWEB 4ELKB 5E6IB 3DROA 5E24E 3D0LA 2NX5B 5EZJB 4UTBL 3DETD 4GOSA 4O2CB 5C0DA 3VFTA 3VRJA 2UUDK 4XCEA 2ZG3A 2C1PA 4L3AA 2N7BA 1MFAL 3WD5L 2DLGA 5KJRL 4XCNA 5D93C 3NBNA 2CIIA 4FQ2L 4ZO6A 3PGFL 4OLYL 1HEZA 3D25B 5E1AA 3C6SB 4UDUB 5C71A 5C7XL 1I85A 4HD9A 3MR9A 3MV8B 4AG4H 1TJGL 2BRQA 4MNQE 5FCSH 2AXFB 2FLBT 4HMCA 5FYJU 3BPLB 4HKJA 4LSTL 4GAJL 4UT6L 3L5WA 3WUWB 2F8XC 3Q5YA 3HRZA 4F7EA 4PLNC 5ESAA 3TJEL 4WRLA 1XF5A 1LD9A 3WL9A 3SDYL 1T0NB 3L95B 3WJLA 2YZ1A 4MSWA 4RFEA 4R4BA 5KOVC 5AG9A 3MGTB 1MJ7L 4K7FB 5EA0L 4EIZC 4QHKI 5T1LA 3WHXA 4RQQA 4JFYB 2OLDA 4M5ZL 4MWFB 3U4EB 1LO3L 3VGFA 4QO1A 4HWEH 4J4PD 2AEQH 1UCTA 1DBAL 3MRJA 2GJZB 4OFIA 5EBMA 4IHOA 1X5JA 1Q9LB 3IXAB 2DI8A 5GJTL 1IGCL 4I48A 1MEXH 12E8L 3RWGA 3MV9B 1EERB 3MRDA 5JQHC 1UWXK 3WIFA 1OP3H 3RU8H 4HLZG 4WV1B 3UZEA 4P3WA 2EXWC 5CFHA 5IMLA 3JWNC 3QUMA 5CILH 4HC1A 1CFNB 3IDXL 3MRPB 2WLYA 3QNXA 1WK0A 2Q8AL 4XH2A 3UJJH 3MRQA 4PRAA 1IKFL 5CLTA 5AZEL 4DUWA 4FA8A 1PX4A 1I9IL 3KPTA 1OD9A 5B8CC 4FQQB 3QIUB 1P69B 1PG7H 3DUUB 4MJID 3TNMB 4WUUD 3WIIH 4JJ5A 4Z76A 1I3GH 4Y5XC 2R69H 2AV7A 4OAWB 3VXPA 3B8SA 1B2WL 4XGZA 4C55A 4H88L 1Q0XL 4JHBA 1QTYT 5FUOL 2OBGA 2PYFB 4NBZB 4YDJA 4C4KT 3NCFB 4LHJB 5GSRA 5GGTH 2QBWA 4J3OC 3CH8A 4OQTH 4PREB 2PXYC 4UINL 3GHBH 4H25A 3HR6A 2NLJA 5FHAL 4AIZB 3QCUL 1XFPA 4I3SL 4JGMA 2GJ6A 5FYJH 4RAUB 5ID1B 1WICA 4HBCL 3W2DL 3SCMC 4KY1H 4KTEH 4CRPA 5DJ2B 2X4SB 4LCCB 2DQEH 1GHFL 4JN2B 1H5BC 4LHUA 1B0GB 1TITA 4I9WD 3VWJD 3DWTA 3SGKA 1UVQB 2W60A 4BSJA 1D5MB 3AGVA 1BFOB 3LS5H 3WFDL 4YHYB 1NC2B 1MPAL 1KYOK 1RULH 3LKNB 1N7ML 1B6UA 1BOGB 4JFQB 3GKWL 5F3HB 2OP4L 2EKSB 1JZ6A 1BZ9A 1XGRA 1A2YA 2ARJA 1NCCL 4GAYA 2EDDA 2X4NB 4WGWB 4I18C 4NFCA 1KENH 3A6CH 3FB8A 3ZTNH 2WZPD 3KLDA 1U6AH 2VDQH 2CLVB 3UPAA 2YPLD 3PDDA 1D5IL 4XMLL 2NW3A 3HE7B 1D7FA 1KBGH 1ODAA 3O6FA 4TNWF 3E6HA 4ODUA 1ZANL 5BO1H 4P9ML 2ZPKH 4NCC2 4PJAA 3DGGA 4MXVE 4R0LC 1L9NA 1ZVSB 4O9HL 4WCYH 3KPPB 3RY5A 2XV6B 3IDGA 2F5BH 3KJ4B 1NAML 3VFVB 2J88L 3RGVD 3VFRB 1T6WA 5IROA 3STZB 2ESVE 4IS6A 3Q3GB 5E8PB 2Z35B 4NQVA 4DZBA 3L3HA 1QPXA 4NBYB 2VJXA 5BV7B 4TUKL 1WJ3A 3F8UB 1CT8A 2D4DA 2HWZH 4PJFE 4RMUA 3SO5A 3I3DA 4HPYL 1KJ3H 3RWHB 3AC0A 3F7YB 4ONFH 4M1GH 1I75A 1P9MC 3OGCA 1CTNA 3N9GH 4ONHB 5CD3A 2FEEL 2VN7A 2QQLL 3FB6A 1SVZA 1GC1L 4LLYB 4P4RA 1BD2E 3U79A 5F6IC 5I1KL 4V1DE 3VXSD 3AY4C 4XNXL 1MCNA 2WP3O 1CE1L 1NGXB 1NDMA 3RVVD 3QISA 2VZOA 4AMKL 1CR9L 2FATL 1UKSA 4FQ1L 4N1HB 5IT2L 3IU4L 3HAEB 4MNQA 4QHMB 2WANA 4XI5D 1LP9B 4JO2H 1IBGH 3ULUH 4L1DA 1I7ZB 3UJIH 3BKJH 1S5HA 4KK6C 5DYOA 2ZUQB 5IJVB 4JQIH 4WWKB 1M4KA 3WN5B 3VFNB 3ULSB 1S7QB 4JPKL 2C1OA 3QFJD 2X1XR 4MXVF 1YN7A 3ARFD 3FMGH 4GLRI 4P9HC 1TCRA 1FNEB 3QIBC 4P2OD 3T77B 3P77B 1C1EL 5TF0A 3MLSH 5DD6A 1LO4H 5CMAB 2IPTH 1N59A 4OFDA 3ARQA 3RY4A 5TE4L 4G6AD 5I75B 1QO3A 4D9RD 5LGJA 4DVRL 4KMQA 4PJFF 1DANU 1F11A 2VH5H 3L3DA 2G9HA 4ZD3H 3R8BB 5TQ2L 3MLZL 4YC2C 2Z4QB 5E5UB 2ZZUT 2PYED 3HI1A 3VXQB 3HMXA 1LK2B 2VLJA 4XXCA 5GGRB 3NFPB 5JPMA 4QXUL 4NJ9H 1CIUA 5TQ0L 4GUPB 4W4OC 1QBMH 4L8BA 1T21B 3TN0D 1T89A 1HQ4B 1C5CH 4MHHI 4WO4D 3QI9C 4O58L 5ESVA 1WBXB 3QR2A 3CSPA 1N3NB 3NGBB 4LOUD 4G80A 3E1F1 3X3GH 1O7VA 5A2JH 4PJ9C 3E8UL 5IHBA 3O8XD 1WAAE 5JOPD 1J05A 3IGAA 4EDXA 1EEUA 5E8OA 1S9XB 4ENED 3IVKB 1A6ZB 2BRRH 3CMOH 1ZLUK 2DKMA 3MLTA 2FIKA 3QQ9C 4EN3D 5IOPA 2PO6A 5J3HC 3JWOL 5T1DH 2WW8A 1G7JA 2A1WH 2PTTB 3LKOA 5E2WH 3ULUD 3F7PC 2XQBL 4ETQB 2ADGA 2DRUA 1CFTB 2QQKL 5E6ZA 1AGDA 2JELH 1FFNB 4OGXL 4RMSA 4XPAH 3WIHH 5TE7H 5C0IA 2BNQB 5ITBL 5FYLH 1AR1D 1EO8L 2B4CH 2FL5B 2YPKB 3BQUB 3O2WL 4PJ8A 4NNPL 4QRPD 4Q97A 4LK4A 3B8YA 1X5FA 5I1EH 4AM0A 3BKCL 4AIOA 1TQBB 3K4DA 4FXKA 5C0AE 4QNPE 1IAKA 2IQAB 2FSEB 2ZOKA 3WXVL 4QT5A 4QWWD 1INEL 2VKXA 5J8OA 2UZYB 3FT2B 5E08H 1XZ0A 4KFZC 5T1LD 5D9SA 1OOAA 3HC0B 3LQAH 1JN6A 1A6TB 2VAJA 4R9HA 1XF2B 2GFBA 4NM8L 4Y8DC 2HTKC 4M1CD 1NMAH 3I6LD 1IGFH 2WM0A 3FQWB 3UROR 4YHLL 4NSKA 3GJFB 3BUYA 3N85L 3VXME 2ESVA 2QHRH 3FCTB 3DJ9A 1CFSA 1X6LA 4D9LH 4PJFA 1J1PL 4F9LA 1V3MA 3CJJA 1KOAA 3PWPD 5ADOL 5C6WH 3TA3A 1F00I 3GSXB 4K3EH 5I0ZA 2GI7A 3GMLB 3LQZB 4L9LB 3QUZC 4WHTB 1SY6L 5JXAH 1I8IB 2Y06L 1FO0H 4C58B 5IFAL 4YHZL 4BK4A 5IWLA 4CVZA 4V1DA 4K8RL 4QHUA 1MVUA 1NLDH 3WXWH 4ZUTA 1SM3L 4QNPF 2Y07H 2ORBL 4C83A 5FK9A 4OM0H 4Z7VB 5T3XL 1YJDC 4YHIB 1KC5L 1VGEL 3VI4E 2P8PA 5E94B 4GRLD 5TPWH 2ZUXA 2E8YA 3MLYL 3UBXI 3JV6A 1UWEH 2VL4A 5INDA 1OAUL 2MMXA 5IB2A 3H9HB 4YDKL 5D71H 2X7LB 1I85C 5JMOC 4LSVL 3DRQB 2VTFA 1KCKA 5DR5H 5D1XC 3S98A 3PXHA 4OZGE 1TETH 5LXGH 1I9RH 1U8IB 1D6EB 1HCVA 1X5XA 2GIYA 3CXHJ 3ULVE 3OXSB 5K9OB 1U8LA 3BT2H 1YYLH 1J87A 4OV5A 3QO0B 5EZLB 5GGQH 1MCPL 3DV4B 1V7NH 2A2QT 4LLQB 2Q86B 5I8KL 1RU9L 3BP5B 2GTWA 3O6LH 1VFOA 2FB4H 3HCVB 4E9LA 1IC4L 5FV2A 2Q6WA 4MS8C 5KJRH 4Q9RH 1XR8B 4PIRF 4JFPB 4QOKD 1A1OB 4FNLL 1A9BA 3MFGB 4KHXH 1T7WA 4XPBL 5I18L 4ZAKB 1WAAA 4GW5A 3L6FB 5CZXD 5JOEA 3RUGB 3LIZH 4PGBB 1OF2B 4XBGA 1NPUA 1Q9WA 1WFTA 3C60A 3JWDC 4K7PL 1JNLL 1XCTA 2OL3A 4UI2A 5I2IA 4PS4H 4YUEH 3SO3C 1FCCA 1HQRB 3TJEH 2XKNA 3P4NB 3SDYH 3VJ6A 3NA9L 5FV1L 5IMKA 1OW0A 3ULVF 1LEKA 1CIDA 3DYPA 1I7UA 3AUVA 1OT2A 4S11A 2YUWA 3T2QA 2A9MH 1A7PL 3NA4A 4DUVA 4EI5D 3Q1SH 3KPRE 2EDFA 4POZC 4O00A 1GXEA 5I15L 4R26H 1F3JA 5KAQF 3BWAB 1L6XA 3VE0A 3KNBA 5I16B 3NCBB 2E7LA 3IF1B 1K8IB 2NCMA 4LGPB 5GJTH 1IGCH 1JI2A 12E8H 1NGQL 4UQ2A 3DV6B 1F97A 4XAWL 5DEFA 1J88A 1YDPB 3LB6D 1EEQA 5C0AA 3MBEC 3SHSA 1E6JH 1OAZH 4OIAA 5E8NA 4IMKC 5KSBA 3T08A 4P3CH 2R2HA 4PJDE 2QKIA 4JAMA 25C8L 2Q8AH 1EPFA 3DYOA 5T1KD 3SGJA 1G6RL 1WBYA 1ZMYA 3OR6B 1IKFH 5AZEH 3WUZA 3K2MC 3C5SA 4H1LH 5L88L 4L4TB 1I9IH 1JGEA 3T0VA 3CDGA 1A7RH 4JG0H 3IAPA 2KQNA 3MUGB 5MEPA 4YXLH 1KIUA 4B5EA 3G5XA 5EUOE 5GZNC 4H88H 4Q9CA 2Z92B 3KS0H 4QGYA 2J7LA 1MREH 3VXMA 1A1MB 4XP1H 1K3IA 1R3IH 1RIHH 2A0LC 2AJUL 1F6AB 1B88A 4XCYB 2WIIB 3QCUH 3U0PA 5INCB 1ZS8A 2OTWB 5I1JL 5LWYL 1VFMA 3QDMD 1N2RB 4UIMA 5JDSA 3MOBL 3S37L 1QUNA 2NY6C 2BHUA 4A6YL 2CJUL 3ZSTA 4M7ZB 1OSZB 3P3YA 4JDVB 4HG4J 3U6RB 1LO5A 4R96B 1JIBA 5KVEL 2VDPL 3QO1A 4PRIB 2X70A 2I9LB 3L3IA 3BP4A 4TULL 1RUQL 2BFVH 3WFDH 4BUHA 1MPAH 4AT6A 2MFNA 4M7JL 1N7MH 2FHBA 5DRWA 1U93B 3MUHL 3GKWH 3KVQA 2XWTA 4GKSB 2OP4H 4NO5A 4PJDF 1MH5A 1CS6A 1I3UA 4MA1C 4R97B 4GG8B 2APXA 1OARL 3MNWB 3V6ZB 4PRPD 1NUFA 3QUYB 3HS0B 1OAYL 2Z8RA 2PW2A 2Z93B 4XMLH 3LDBC 2R56L 4HHAB 4X80L 1NGZA 5EUOF 2YUVA 5D6CB 1FCGA 4OZGA 2GYSA 4O9HH 4ZXBB 5CBEB 4P4KD 3T4YA 5JLZA 1RZJL 3H3BC 3OKLA 3BPCA 3G9AB 1HI6B 3O41A 1P7KB 4PJ8D 5KSUB 3TVMB 4U1MA 2J88H 3VH8B 4H26A 4CNIA 4YDLC 2E3VA 5D2LA 4D0BB 4KTDL 4BSWA 4JZNB 4KROB 4HEME 4RBPH 1EEZA 2XOTA 5F1OB 2OQJA 1VENA 3MXVH 1BPVA 5E70A 5C07A 4GQ9L 4MCYA 2VXUH 4HUUB 1JV5A 1PEWA 3O2DH 1KLFA 3VXTB 4KK8C 4BQCA 2E7BA 3QUXD 3S35X 5L9DL 3A6BH 2YHGA 3MRCB 3FQTB 4XNXH 4X99B 2W9DL 5E95B 3GMQB 3VCLB 2ADIA 3SDCA 3WBDA 5F7WC 4D8PB 1CR9H 3G08A 4OCXL 3HPJB 1MCDA 3U7YL 3D18B 5CLWA 5EIIA 2UYLB 2XI9A 1T89C 4WEMB 2VABB 4N0CC 1PSKL 1LDPH 4RGMC 3ZHKA 4O51B 3CFJA 1JHLL 4FFZL 4G9FE 1INDH 2AEPL 5FKAB 4E41E 4Y4KC 1OTUD 3QHFH 2DQHL 2ADFL 1J5OL 3TA3D 3UAJC 5CWSA 3RDTB 1CD9B 4DGVL 4OD2A 4ZDHB 4IRJA 5JORA 2EIBA 3R4DA 4KI1A 1ZVHA 2I27N 3FJTA 1BD2D 2DLFL 3KPRA 5D1QA 4I3RH 2F54D 2DDQH 3FRPA 5F88B 5DD1L 3GSOB 1BVLB 4GFTB 1OY3B 2QSTA 4R2GD 4DVRH 3IFNH 4F9PA 1U9KA 1UZ6E 5EO9B 1HNFA 4JRYD 5GGSA 5TQ2H 5HYQB 4U6VL 4MD4A 2NY1D 5ISZE 1ZLVH 1Y6KR 3B9EA 5EU3A 5CP7B 4PJDA 1T5WB 5C0JB 3D1MC 5TQ0H 3RVXD 3IDMB 4J3XA 4OGAD 4NO0D 5H35B 2WK2A 3HNVL 4D9QE 2XY1A 5MENB 1MCEA 3EHBC 3RL1B 1TNNA 1JWMB 3HE6C 1WZLA 3NTCL 3G6JB 2OZ4L 4FTVB 1NBVH 5EUOA 4JKLA 4ZMAT 1DEEB 4NFDA 1U58B 3GSNL 3IFOB 1CGVA 4KKAD 1AGFA 3P0YH 3R8QA 2BVOA 4KAQL 2DBLH 1SJEA 1BOYA 1OTSD 3QBTB 4JRXB 1BAFH 3MUZ1 3PL6D 4X8JA 1ZGLA 5D6DC 3ZYOA 3C09C 3JWOH 2R4SL 1PEZA 1NKRA 2P45B 4JY5L 4ONOA 1JMZA 4M6OL 4TTDC 3DUSB 4G42B 3O9WA 2IPKA 4MJ6A 4OGXH 1MRCH 4ELKA 1MLCA 5E6IA 4F9LC 2DB8A 2NX5A 4X4ZA 2AJYL 1JF1A 1IC7L 1U8KA 4G6KL 1CYGA 4NNPH 4I0PB 1EHNA 4L4JA 4GT7A 2N4IA 3C60D 1JGVH 2VLKE 3Q0HA 5CGMA 4YK4B 4ELMF 4HIEB 3MLPA 5IWLC 4MA8H 2HFEB 2GTZB 4LBEB 3ZKMD 4Z8FL 3D25A 1OB1A 4WU7A 4UDUA 3I02A 1UC6A 3WXVH 3MV8A 1RFDL 2W91A 4E5XA 3EBAA 1R3KA 3CX5K 1AFVL 1CF8L 5BZWA 3F6LA 3TM6A 1MJ8L 4GW4B 4NM8H 5D7KE 1T0NA 3L95A 2APTA 3C8KB 2V6HA 3MGTA 4K7FA 4P23D 4YHLH 1OGAB 1CLCA 5HVHC 3U4EA 4MWFA 3S9DB 1W0WA 4YQXH 4L8DB 4O2EB 5FOBB 5D5MB 5HHXH 1YEDA 4Y19B 3ZDXF 3QUML 1J1PH 1DVFB 3M1BA 4JO1H 1XAUA 3K81A 1NUGA 2F8VA 1ORQA 3IJSA 1AKJB 3AROA 2WUBL 3MV9A 5KSAC 4KDTA 1NEZA 1SY6H 3JWDL 4ERSH 5JO5B 3C6LD 4WV1A 2Y06H 43C9A 1DDHA 5IFAH 5CINL 2X42A 1MIEH 5F7DB 2EDBA 3MYJB 2WBWB 2KZ1B 4GMSL 1FSKC 2G5BA 2X89D 4NO3B 4FQXB 1SM3H 1TIUA 1TMCB 1EFXD 3PWLB 1UURA 4WEBL 1KCUH 4NPYB 1TNMA 4Z5RA 4J12A 2MQ0A 5T3XH 4LASL 3L3JB 3OXRB 3QRGH 4HX1B 3QIUA 4OSUL 3DUUA 1NCWH 4PRHD 1VGEH 5KAQG 4G9FA 5CSZB 2FZ3B 4OAWA 4E41A 4CN4A 1NGPH 4BZYA 4LPWA 1OAUH 4WDIB 1I1AC 5DJ8A 4EI6B 43CAA 4YDKH 4LSVH 4PYGA 2PYFA 5HYJD 3WDJA 4PREA 2EDOA 5EWIL 4AIZA 1CGTA 4JFFE 1WEJL 3LMJL 3W9EB 4BQ6A 1NSNL 3IJYB 3QA3B 1AE6L 3ZTJG 3SQOL 3EFDL 4XCCL 4XWGL 4MAUL 2X4SA 4LCCA 2FNBA 4JPWL 1HYRC 1UVQA 4N9OB 5CEZL 1P4BL 4X4ME 2BNQE 5ISZA 1BFOA 4Y88A 1ZA3B 1CK0H 3IDJA 1PGRB 4QRUB 5D1ZB 5F8RC 5GS1B 1BOGA 4JFQA 1RUMH 5D7LE 4F7MA 5ILTH 1FLRL 5F3HA 2EKSA 5T3ZH 2MSPA 4M93B 4IMLB 4PJ5E 3LKSB 3VFMB 2NY0C 1QRKA 5FO9B 5EO1B 1P1ZA 1AI1L 1T66D 2R0ZH 3KPOB 1NDGA 5DUBB 3BGFC 4LSPL 4JHWH 2JJTA 4FNLH 3FRPG 5I18H 4LMQI 3HE7A 1J8HD 2P47B 4CJ1A 1RUKH 1MQKH 2BY2A 1LDSA 4QF1B 3GHEH 3JVGA 1YNLL 3VFRA 3D39E 1QD0A 4J2XA 3Q3GA 2Z35A 3VXUD 3HMWH 5DHVB 1A7PH 1A3RL 4NIKB 5IBLC 1Q1JL 3V4UL 4ONHA 3S3PA 1T4KB 1NBYB 1NGQH 4HLJA 4LLYA 4OUUA 4XAWH 2VLKA 4WW2B 1BQLH 1FNHA 4APQB 1G0YR 4PJGB 4RNRA 3SDXB 3DX7B 2ADJB 1JFQL 3SKMB 3CXHK 2DYPB 4EXKA 3WJJA 3S3JA 4Y8AA 4OV6F 4IRJD 1I7ZA 2XTJC 2A38A 4HJ0D 5ITFB 5L88H 5IJVA 5JHDB 2IC2A 1FNAA 3KPRD 3ECBA 5D1QD 3WN5A 1LEIB 3VFNA 1Q9OB 3S35H 1S7RA 2WV3A 3RY6C 4GRWB 4UILL 5JHLH 1X7QB 1CICC 2AJ3A 1CLYL 4HPOH 1FNEA 3HLAB 4RSVA 1O7SA 2H1PL 2E6JA 4Y89A 2PXYD 2BP3A 5HGGS 4JG1L 5TDPB 1L7TL 2VKWA 3P73B 3LN5B 4XPGH 3HUJB 3TBSB 4GS7C 2AJUH 2VIRA 5C08E 2X1OA 3HMXL 2V9TA 3QCVH 3SGDH 1SJXA 5BOPA 3HZKA 5LWYH 1F4HA 1YNTB 3LKPB 3MOBH 3Q5TA 3B9VA 2Z4QA 3VXQA 1XMWA 1Y6MR 5KVEH 2VDPH 4NNXB 5JA9A 1EDQA 3NFPA 1MAJA 3JUZA 3QDGD 5EZOL 1AR2A 3DO3A 1T21A 3QUKB 4P9HH 4ZFZA 5F3BB 2AXHA 3FFCB 2OTPA 2OI9B 1WBXA 1N3NA 5DLMH 1NCNA 4H0IA 4NFBA 1OSPL 2VO5A 1X4YA 1HZHH 3KDMB 1C5BL 1RMFH 4OLWL 5DURD 1HHJA 1QSFE 4H8WC 5F7KC 1HSAB 1WIUA 1DANT 5FO7A 1HXMA 2YD5A 1KTKE 3HZMB 3TT1L 2VSDA 3CLFH 1GGBL 3L3KB 4X80H 1S9XA 5D4QA 2YD8A 1NBZB 1QFWH 2ICES 2ITCA 1NEZG 1BQUA 3O9WD 1A6ZA 5EC1A 5F7HA 2R1YA 2E7CA 3R1GH 1A3LL 2YPVH 2YSSB 3ZSSA 3QEHB 2PTTA 2R39A 1X5KA 5I1CH 4ETQA 4FQJL 1CFTA 4X6DB 4NQXB 1IGMH 1XCQB 2ENYA 4G6FB 2GK0B 3IRPX 3SKJL 3VFWA 4PJHE 5KZCD 2BNQA 2VWEC 2QLVB 3KPQB 3B2UC 2NY2B 1ZKAA 4RZCB 5D7LA 2GT9B 4F80A 3ETBF 4F9PC 2B0SL 3NZ8B 3KJ6L 1KJ2H 1RJZA 4KJPC 5L9DH 2J4WL 2P7TB 3CAFA 3CSGA 4OCXH 3ILPB 3MRHA 3U7YH 3ZZ1A 2VDRH 3HC0A 3KXFB 1KB5H 1UH4A 5L2KB 1OP5K 4HGWB 1XF2A 1P6FA 4KUCD 2NPLX 2IAMA 3ZKNC 2X41A 4HG4K 3GMPA 2HJFA 3CZFB 1MCOL 4HQQL 1FL5A 2H2SD 1J5OH 3FQWA 5SWSE 4TNWK 2O93L 5D7JA 3GJFA 4HFWB 3D39A 1MCCA 3FCTA 3H9ZA 5LAXA 4GSDH 4OT1L 1P4LB 4F15C 5IFHH 3ARBC 5EUKB 3S8WA 4PB0L 1KELL 1TJHL 1RVFL 4JKPH 1RK1A 3MV01 1MFBL 4N90E 3H42L 4XBPB 5DD3H 3RJQB 3GSXA 5GJSL 4JHAL 3LQZA 4CMMB 4NUJA 4PJHF 4TVSa 4JKWA 3U4AA 1I8IA 1M7IB 2ZJSL 4WENB 3I9GL 4HIIB 1A7OL 5I1DB 4G9FD 3SE4C 2RCSL 5DD0L 5E6IC 2XNAB 1HE7A 3EJJX 1C08A 2IGFH 1ZT4B 1AGCB 1MCBA 3D85D 1HNGA 4K94C 4Z7VA 3KPNB 3IDUA 1NCDH 1EAPA 3ISWA 1DBJL 4IOIB 5EPMB 1OAKH 1CD1B 2VLLA 4EQ3A 3TH3T 1R5VB 3HTLX 3DURA 2OZ4H 2X7LA 2LVCA 1BJMA 2XKUA 3QJHB 1FQ9C 3BJLA 1C5DB 1L6ZA 3BPLC 2DMCA 1U3HB 1BEYH 1NKOA 3QQ9D 4QRRB 3T4AA 5IVNA 3OXSA 3VG0H 1TVBA 5ISZD 4LLDB 2HG5B 3FQNA 4JZJC 3RI5F 3J7HA 5HYSA 2EH8L 1N0XL 3P0VH 3BIBX 3QO0A 5EZLA 2HT3C 4BH7A 1Q8MA 2BNUB 4OZHB 1OWRM 1YJDH 2CLRA 1MJJB 2ZUVA 4HWBH 4N0YH 3MGAA 1GGCH 2Q86A 1AQKL 4NGHL 3BP5A 5DVMA 2VITB 2F53B 1UXSB 1IRAY 1FN4B 1U8QB 1YMME 2SEBB 2R8SL 3HCVA 3C5ZD 3IDNB 3L5IA 4L8SB 1R0AH 3H7LA 3CSBA 1XR8A 4KDTC 4J3VA 2PTUA 3HI6H 2OL3L 4WV1C 3KPLB 1S3KH 1CE6B 5GGSY 2BVPA 1A1OA 4RMTA 4Z8FH 3BKML 3IDIB 4ZAKA 4LSQL 2WBJA 3L6FA 1X44A 1OF2A 3K8KA 1JCKA 1ED3B 2DJSA 1RFDH 3TF7C 4LSUH 5MEOA 3NCYP 4CU6A 4Z18A 3KYNB 2R2BA 2X9YA 4NQEB 1HHIB 1IGTB 4BZ2H 1E6OL 2P5WB 3O11B 3QIUC 2HTKD 1OGTB 5IEKA 1HQRA 3DGCR 3MLWL 5CJQH 4N5UA 5JQ6L 3P4NA 2Q1EA 2AGJH 5KS9F 3T3PE 3GIVA 1TVHB 1KEGH 4YR6A 2ILLA 4I2XB 2VLKD 1IQWL 1MHEA 5EOTA 5HI5D 1UJ3B 2PW1A 4ZTPL 4X4YA 1DSFH 4HAGA 1T83C 3BWAA 4PJHA 1B0WA 3QUMH 5I16A 3QG7L 5KVMC 2EECA 3IF1A 1K8IA 2VR5A 4Z9KB 2DQIL 4F7TB 5C0FB 3MNVB 3QXWA 4DGIH 4OB5H 4N9GA 2WUBH 3DV6A 4AEHL 5I0DA 4G7YL 4HV8B 5IESL 5HHMB 4WTZA 3JWDH 4LCCC 1Q0YH 2FH6A 2FX8L 2NY3B 2XTLA 2XA8L 2DQDH 2GUOB 1D6VH 4LFHG 1PG7W 5GRZA 5FXCH 1LE9B 5D7KD 4HZLA 2UZIL 4YHYC 1DBKL 4JPIA 4MAYC 3FT3B 3P9LB 5DUMH 2ZWLT 1JPGB 2HKHL 4CBPA 4LASH 1MI5B 4OSUH 2W9EL 4W4NA 4R90L 2V5YA 1IGIH 2DQJH 5IW6B 3BN9C 1RHHA 3G6JE 4FTVE 5JZ7D 4JDZB 3HKFA 2DQFA 3IDYB 3HFML 5SWSA 4DCQB 2Z92A 1AGBA 5D1XD 2FX7L 4IRSD 5DQDL 1JNNL 1IM9D 3GBML 5D8JH 3MJ9A 2Y36L 3RWJB 3T3PF 3BVNB 3C8HA 2RAMA 4XCYA 3RIFF 5IHUL 5FUZL 2WIIA 1WEJH 4LQ1A 3TBTB 2OTWA 2AK4B 4YLQT 4DW2L 3KJ4C 3LMJH 1N2RA 2FBJH 4LEXH 1XGUB 1AE6H 5GRUL 3EOBB 3EFDH 1OSZA 4G8GB 4JPWH 2YA1A 5BV7C 3U6RA 4R96A 2FCBA 4PRIA 1E28A 3VMOA 1Z6JT 1W0VB 4P59H 1CD0A 5F7EL 4OCLC 2R1XB 3IXTB 2J8UE 3RVWD 3S96A 4LHQB 2ZOLB 4LCIH 2CKBH 2FYYB 4RGOH 1FLRH 4GKSA 5FGSA 4KKBC 2AP2A 4JY6A 1BQHB 4JFFD 1HSBB 2UVEA 3ULVL 3HS0A 1G9NC 2AERT 5ESQA 2Z93A 3NZHL 5L8JB 3MXWL 5F89A 5C2UB 4HHAA 5LCVH 1UT9A 3NPSB 1QHPA 3WFHB 4X4XA 4PLJC 2FJFB 3DOSA 1K4CB 5SWZB 2F58H 2ZUQC 3TNNA 4WWKC 5LBSL 4OZIB 3SE8L 2N1KA 3WN5C 1HI6A 1MUJB 1RUPH 5KSUA 5IVXB 3BYYA 4OFYA 5D7LD 5HSFA 4JCMA 4JZNA 4LQFL 3ARDB 4PJ5D 2GAZA 1A3RH 3OKDB 4OGYL 4X6BB 3MROB 1NFDB 4GAFB 4H8WL 3T2OA 1I1FA 2R1WB 4MQXC 2J8UF 5FGCE 4RRPA 2Q87A 1UWGL 5J13B 2VN4A 1QFUL 3TFKC 3B9AA 4IRZL 1FFOB 3MRCA 1FP5A 3ESVF 4HK0B 2IAMD 3GMQA 5D7IF 2QQQA 2CUMA 3VCLA 3BP6B 3PWNB 3BH9B 3MRRB 5GGVY 5CBAB 3HPJA 3D18A 1WC7B 3QQ3B 4K23L 5IQ9B 5D7JD 3MACH 3N1PC 1J18A 2VDMH 3D39D 1MJUH 5HYSG 3QQ4A 4YXKH 4O51A 4OD3L 3NGBC 1Z9OA 5HI4C 1CLOL 5T5FL 3DI3B 5D7SL 1FRGL 4HGMA 5FA4B 3W5MA 4F7CB 3RDTA 1L7IL 4ZDHA 1JE6A 4OF6A 4YO0B 2H1PH 2A0LD 2AEIT 1JGUL 5C6TH 1OAXL 2CO6B 3L7EB 3MMEB 1MQ8A 1YYMH 1CD8A 4XVTH 1MCWW 4P5MB 3PV6A 5F88A 4Z7OE 3GSOA 2EYSB 1BVLA 3PQYD 1WBZA 3CUPB 4Y5VB 1G1CA 4G5ZL 3V4PL 2VQ1B 1S8DA 1BMGA 4HIJA 4KDVA 4NRXB 4MX7B 5EO9A 3W9DA 2DLTA 4LRNL 3OZ9L 4G9DA 3SDDB 1CXIA 3FO0L 4YHML 5HYQA 3VD4A 4HWUA 4RDQF 4KKCC 2Q3ZA 1UM4L 4PG2A 5EORL 4U1NB 3SY0B 4HIXL 3BQUC 5C0JA 5EZOH 3IDMA 3IFPB 5ENWB 5H35A 3FQXB 4MDJB 2VXTH 4LRIA 4S1QL 3MODL 5FOJA 1QKZH 2BXYA 5E00A 1JUFB 3G5ZB 1QNZL 3MLUH 1OSPH 1TQBC 1JWMA 3PGCA 4L29A 5TDOA 5C08D 4NO2B 2APVA 4HW6A 3C08L 3G6JA 4KUZH 4FTVA 1DQML 2QR0B 3WKMH 3ALPA 4C4KO 5F7MC 5HDLA 3IFOA 1R3HA 4J7RA 5HGBB 1KN4L 4PV8B 1FVEA 5IBUB 2X4OA 1CN4A 4WTZG 1Z5LB 1VKXA 4GRMA 1HYSC 3PABB 2EYRB 4P2RB 1GZQB 1A3LH 5EBLA 3SDAA 1YEGH 4F33B 3U7WH 2WAHA 3EYQC 5BXFA 3H3KA 3VGAB 3M8OL 4DEPB 4Z7OF 2CKNA 5A2LH 1NJ9A 4G42A 1ZHKA 5LQBL 4DTGL 3AM8C 4FQIL 3BEVB 1J1XL 3SKJH 3K7UA 4LNRB 1ITBB 3SBWA 1GSMA 1QSFD 1Z9MA 2L7JA 3Q5OA 2CLZB 2WBJD 5HVGB 4MJIB 1YECL 5LVEA 4I0PA 3MRFA 4WUUB 3I85A 4L9LC 4WFEE 4PJXE 3O3BA 4ZUWB 1CLZH 1IQDA 5HTSA 1BZ7B 4PJGE 4XPFH 2DQUH 3UYOD 4KXZI 3VFPA 5GS3A 2GTZA 4CAGA 1CL7I 5DA4A 1FH5H 3HZYA 2R0WL 4KJYB 4O2FB 2XRAL 1OLLA 2J4WH 4J6RH 3CDCA 1RZ8A 5DZLA 4MDIB 2JE8A 5IQ7L 3TT3L 3VA6A 5IG7B 4N0CD 3N1FC 4S1DD 2FEDC 2C9AA 4LDOB 1S9WA 1EUUA 2HLAB 2JB6A 1QZ1A 5E0QA 3WLWD 3MLXL 4Y4KD 3QNYB 4WFFE 1MFDL 4UT9H 4GW4A 4A6YB 4GRWE 5CJ5A 3C8KA 3VW3H 3PV7A 4BKLA 1IZKA 1TCMA 4MYWB 3V52L 2V17L 3RZCA 5AAMA 3VWJB 2YUZA 4EUPH 5C0NC 3IU3A 5K9JL 3LAFA 4O2EA 5FOBA 1S7SB 3MCLH 3REVB 1KELH 2YRZA 3U9UB 1RVFH 3WLBB 4W6XB 1DVFA 4HS6B 5J56B 3H42H 4TSCL 5KVDL 4D2NA 1BBJA 2CMRH 1J0KA 4JHAH 4RGNE 4UNUA 2W0LA 5FHBL 1UH2A 2VDKL 1IAIH 5JO5A 5I19H 2YPLB 2EXYC 2ZJSH 4JPVL 1OPGL 4PJXF 1HXYB 4HWZB 3MYJA 4OLVL 1QA9B 5FGRA 5BW7C 1FYTD 1HHKB 1JPSL 4FQXA 5AYUL 4NCC1 3LEXB 4DFHA 1HIML 2IPUG 5SWSD 3AS0A 1HHHB 4K3GA 4NPYA 5ICXB 2Z91A 1MF2L 2OM5A 7FABL 3EHBD 2MTPA 2XWBB 3OXRA 4HX1A 4TSAH 3OKEB 3RGVB 5MERB 5SX4H 2F9BT 5CSZA 2FZ3A 5K59F 1N8ZB 2DOCA 3BW9A 1IAOB 1T1WB 4P5TD 2G2RA 1W72B 4K9EL 4ZAKC 4EI6A 1KG0A 2EH7L 2VXVH 3FN0H 2AXGB 3FN3A 3HR5B 2WINB 3PNWB 2RHEA 3RPIB 1AD9B 4RRPG 1YA5A 2I26N 2L7UA 4KPHH 5M95B 4J3TA 3LRGA 3OB0K 3HZVB 3F5WB 2NY5C 3C9NB 4YZFE 3VXSB 1EHXA 1DQJB 3QA3A 4CKVX 3IT8D 5A2IH 1QLRB 1VEMA 4XP6L 2NY4D 2OJEB 4TTDD 2XYCA 4PR5B 4MJ2A 3BSZL 1KLGA 1ZHBB 5E2VH 1QVOB 5D70L 1FC1A 1AQKH 3MZTA 5JW4R 4NGHH 3MRGB 4QRUA 5D1ZA 3X12A 2B1HH 5EU5B 3RAJL 1U8OA 5CEXB 2R8SH 2A83B 3QFJB 2YN5A 2CUIA 5C0GB 3LKSA 3VFMA 5DJ6B 2Z31A 4P2OB 2OL3H 4PP2A 5EO1A 2ICEB 1K5NA 3KPOA 5DUBA 4G6JL 4PGDB 3BKMH 1MVFA 4KJWD 1NC4A 1SJHB 4JFOB 3UTPD 4PYHA 4MQTB 2IBGA 1LVEA 4Z6AT 1ES0B 3KXFE 5CUSH 4MD0A 1S7XA 1SEQH 5TF1L 1E6OH 4YPGB 4QF1A 5BV7L 1JRHH 1P53A 1LEGB 3U1SL 3ABZA 4LCUB 3STLA 1JZ5A 1L9MA 5I66A 4QHNB 5F1KC 1YMMD 3GO1L 4N8CL 3SGEH 1YN6A 2XN9D 5I6XB 2EDRA 2XZQL 4YZFF 5IIEB 5DHVA 2D7TL 1IQWH 4FFYL 1RSFA 4Y5YA 3TN0B 1IEBB 1QFPA 2NZ9C 4YBHA 4QYOA 3EJYC 2AW2A 4JFEB 4P57B 5KSAD 2R4RH 1T4KA 1NBYA 4KRPD 2YZ8A 4PJXA 5ETUA 4AEHH 2AJZB 5KG9B 3O8XB 2BOBA 4APQA 3BD3A 5EBWB 4PJGA 4M7ZC 1BVZA 3STBA 4MA7L 3V6OC 4YHNB 2XA8H 1U2CA 1T1ZA 5DZNA 3ES6B 3SKMA 1P7QA 3VFSA 1GIGH 1HH9B 2LU4A 3VGGA 1T3FB 5EN2A 2D7MA 3DROB 2W65A 4EN3B 3NCJH 3Q6GL 4PGCA 5C0DB 5ITFA 3MUY1 3VRJB 2HKHH 5HYEA 4XCEB 3MJGX 2C1PB 1BQSA 4R97C 1LEIA 3CFIC 1Q9OA 3O2VH 4M9PA 5JDJA 5FM5M 3QUYC 1FV1B 1VEOA 2CIIB 4JM2F 1A4KB 2APBA 4PBVC 2ARJQ 2MPAL 3FFDA 1HEZB 4HFUH 2Q3AA 5E1AB 1WUNT 5DQDH 1JNNH 1ZA6B 3GBMH 4QRPB 5IFJA 2Y36H 2DM7A 3MR9B 4BSVA 1H8OA 3F65A 3OAYH 4ZXBC 5E5RB 5IHUH 1BBDL 4NZUL 3GSWB 4HKJB 4DZ8A 3GRWA 4EKXA 2KQMA 3RTQC 3CZJA 4DW2H 1YY9D 3TVMC 2GEEA 4F7EB 1YNTA 4TRPL 1XF5B 3UJTH 3WL9B<