1GJIA

Crystal structure of c-rel bound to dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
275
structure length
275
Chain Sequence
PYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKIRTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFILCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIVFRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IL-2 CD28RE DNA
publication title X-ray crystal structure of proto-oncogene product c-Rel bound to the CD28 response element of IL-2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transcription/dna
total genus 49
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gjiA02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1gjiA01
1G0YR 2XY2A 5GZOC 3IU4L 5KS9A 1K9TA 1A3QA 1CZ8L 5IB2B 2AP2A 5GS2D 5I8OL 1G7PB 3M1BA 3UAJD 3L1OH 1WZKA 4UQ2A 4PYGA 1IARB 3G5XA 1KB5A 3RNKA 4OM0H 4DOHB 4RAVA 1GPOH 2HFGL 4OIAA 4XPTH 4CL7A 1AE6L 1XF5A 5EUOF 4BKLB 1RUQH 4KJQC 2NX5E 1MCFA 5K9KA 4G8EB 1A02N 4H1LH 3TO4A 1NGPH 4XCCL 3IDJA 4IMKA 3OJDB 4NQSB 1RIVH 4NQEE 4UTAH 2P8MA 5IG7B 1KPRA 3BPNB 3QFJE 4PJAA 4XPAL 3P4NA 2IC2A 5IBTH 1MLCA 3CCHA 5LJYH 1JJUA 3UMTA 1E4WL 1WT5C 1IJ9A 5ABDE 3BFOA 3HI5H 2NY6C 1UM6L 3G5YA 2CIIB 5KSBA 2NY3D 4HZLB 3X13A 2P46B 1EFXB 3PP3K 4LP5A 3HPJB 3UTOA 2GJZB 3CDFA 4Q9RH 4YFEA 3PDGA 1ZANL 1AFVH 5D7LD 3NAAL 1QRNE 1QA9B 4OSUH 4U1KA 5IFAL 4U05A 5F6HI 1E4XI 3MBED 1JGUH 2QLVB 1MHHB 2ITCA 4G9FE 1BJ1H 4HK0B 4P5TD 1CXHA 5H8DA 2B0SH 3GMLA 3PQYA 5TH2B 4HULB 2KBGA 4ZFZA 5SWSD 4IMLA 3T3MF 3D2UD 5E95B 4PLOB 3N1MC 1KACB 1KENH 4R4NC 5FYJE 3C6LA 1J0YA 3E6HA 4U1IA 1ORQB 2BC4B 3P4MA 4XNQA 4HPOL 4M5YH 5DTFB 5IR1B 1PG7X 2HTKD 3FZUC 5DFWH 1YQVH 4JFOA 1S7SA 1A4KB 5TE7H 4Z7VF 3TIEA 4OLVL 4Z7UF 3ZYIA 5E94B 1EO8L 4DKEH 4Y2DB 4P4KC 5IHBA 1MAKA 1WITA 2IFFH 4XWGH 4WU7B 3QAZC 3PWPE 5IVXF 1ORSB 4X6CB 2JJUA 2LU3A 3TEUA 2FSEA 5GIRB 3MLWL 5IV2B 1DSFL 3BI9X 4ZUSA 3W9DA 5IMOA 3WDJA 1A7RL 4LSQL 1IEHA 4OZHB 4FXKB 3KS0J 5KVGL 2Z8VC 3C8KA 4LPCA 2Q7NA 4QF1A 4F7CB 4AEIL 1DN0A 3RWJB 4Y88A 4I0CC 3BRGC 3ZKMD 1LO4H 2FX8L 3P11L 3HC0B 1I3GL 3WE6A 4AG4H 5ANMA 3PE9A 4JZJB 4OKDA 4QHUB 1X5AA 1SEQH 2PETA 1OTSD 1D5MA 1E28A 1NL0H 3DMMD 1VFMA 3Q5YA 1FFOB 3MRQA 4KJPC 5HYJE 4UT7H 2V5YA 4DZ8A 5LAXB 3CFEB 1F11B 1NCAL 1MIML 5HGGS 4ZTOL 2WLYA 4NWUH 3MLRL 3BKJH 1V7ML 4WV1C 1QUNA 2VDOL 1U8QB 4LHUD 4R96B 1E27B 4XMKH 2ATKB 1BIIA 1ACYH 1XT5A 3BQUC 4YIQB 5DJ6A 4L8DA 1T20A 4XVSH 5L2KD 1M7DB 5DC0A 2FJHA 2NY4C 4PBWD 3TBYA 3SDXA 4P4RB 4OGYH 1JTOA 3QIWD 3NH7L 4YPJA 1T1ZA 3BZDA 2ADGB 3HAEB 1RQ5A 1FNLA 1NGXB 3D0LA 4ZNEA 4WUKH 1R5IB 3OXSA 5MEOB 1JPTH 2XKUA 3D3VD 5T1DL 1PQZB 5BVJA 3ISWA 3HG1E 3U4BL 3TT1L 1B0RB 5DK0B 4MX7B 3QEUA 1K8IB 3ZDYE 4ZYKB 2UUDH 1T5XA 3B3IA 4PGJA 5DEGB 1Z6JT 3D5OF 5GGRY 1CTOA 4PJ7E 4CU6A 4MSWA 1IAMA 2Z31A 3EO0B 1S5IL 4UV7L 5AZ2L 4DQOH 3QA3A 4Y1AE 5H37H 3Q6GH 2VSDA 1N4XH 3QB7C 3T8XB 1U3HB 4XNYH 4XXDA 5GGQH 4Q2ZB 2JJSC 3O6KH 4Q74A 1MFBL 2RFXB 4MQTB 1CFSB 1VADA 4M61B 2GSGA 3F5WB 4E5XA 1YMHB 3IRZA 2E7CA 3QUXB 1VKXB 1T89A 3QXVA 3WXWL 2ZCKL 2VITB 1LVEA 2N7AA 2VAAB 4K3HA 4GRWE 4KZDL 1IKNA 1AGBB 2UWEF 3C08L 4PJGF 4DN4H 4TN9A 5DQ9B 1UXWA 4HXBL 4XPGL 1T0PB 4HWNA 1A0QL 3VFWA 2AK1L 2H41A 5GS1A 5JOFB 4IRSC 2WMPA 1C1EH 4PG2A 1J8HA 4O2EB 4UUJB 3AROA 4LPXA 3QI9B 3T0EC 5F7FA 3T1WA 5JTWA 5BO1H 3GMNB 1EK3A 5FM5O 1BQSA 3GMOA 4OGXH 5CEXA 5FOJA 1CDIA 3PV7A 1QBAA 5KS9F 4NOBA 1RJYB 3GHEL 1MRDL 4WU5B 1T0NA 4TUJA 4ZUUA 2DWEA 3O6FA 2Q7YB 4F9LC 1JZ6A 1MJJA 4LSPH 4ZS6C 3SE3A 3BRFA 1UKTA 1Q9OA 3CK0L 3M45A 4HUVB 5D5ME 4JN2A 2PF6A 4NP4L 4WTZG 1I8MB 1LP9E 3HUJB 2KZWA 4XTRD 1JV5A 2DYPA 1KC5H 1P4IH 3VRIB 4Y4FB 1LDSA 1S9XB 1BD2B 5E8DL 5ESVA 2Y7QA 4HFWB 3U0WH 2N7BA 4L4TA 4LLUB 2HH0L 2GEEA 1BFOB 4H0IA 3M17B 1ZT4B 1HHHB 4MDIB 1JWSB 4OZGE 1WC7A 2WLZA 3WFEL 3OZ9L 1JE6A 5HI5D 4JR9H 1UH2A 4ZNCD 4D0DA 2V17H 1X6NA 2BNRA 4WNQB 2P5ED 5EOQL 1NAKL 4LQ1A 3UBXI 3CFBA 4HX1B 1SVCP 1OP9A 4OF5A 4ALAL 5CGTA 1VESA 2P5WA 4OLYH 5T3XL 1PX3A 4UDUA 4NQCB 3O2WH 1BFVH 1TZHA 3EOYG 3RIAF 3O2VH 4NO5A 3MOAH 1MWAA 3CXHJ 3ULUD 5BS0E 2OTUA 3GI8H 4FQCL 1VFAB 3K2UL 1KCSL 1FC2D 4PJCE 3VXUB 5CJQL 2R1XB 3L3JB 2R9HC 5CD5C 5CGMA 5L0QC 3J7HA 1LD9B 5JHDB 1G6RA 3GMPA 4ZFFA 4YXLL 3NTCL 5EU4A 3QQ4A 4Y0GA 4NC0B 3QH3B 4CDGC 1A7PL 3JXAA 2VL5B 5CWSB 3V0VB 1MCSA 5E4EC 4L4VA 5ICZB 3VWKD 3TGXA 4J7RA 3JWDC 5MEND 1JRHI 4RMVA 4RIRB 5F6IC 4J2XA 3FO9A 1KYOJ 2NX5A 1BVKB 3MNWA 3DXAE 1V3LA 5E99H 2OTWA 5IHZA 1MHEA 3DX6B 3CSYB 3O4LB 2GSIA 2OMNA 1QG3A 3SDAA 1NUNB 4I4WA 2Q6WA 2BXZA 2W65A 2JCCF 4NQEA 4XNZB 2X6MA 3SOBL 1NBVL 3TBWB 3LV3A 2PNDA 5J6GA 3TZVA 4P3CL 4WW2A 4C56E 3MRNB 4V1DD 1OP3H 2J8HA 1EUTA 1I3RA 4L9LB 1BFTA 4FN0A 4HJJL 2O5YL 5F1OB 5L7XL 4RSVA 6FABL 1U8MA 3CXDH 1AR1D 5IFJA 2IPKB 2APTA 1U8PA 2EYSB 5AD0A 4X8XA 4E41D 1WCQA 4KI5F 4NPYA 1QRNA 3MBXH 3RVXD 2VN7A 2YMXL 2R2EA 3BJ91 5HHME 1DQJA 5E6IB 2WIIA 5EOCJ 2FZ3B 5KSAD 5FO8A 4G9FA 2PR4L 4WO4A 4G43A 4KRPB 3MRLB 4J4PC 3QQ9C 1RUPL 4PB0H 3GRWH 5SWZE 1I1AB 2EH8H 4KJWD 4ORZC 5GGSB 1H5BA 3L3DB 4TUKH 3S35H 4O2FA 4XX1G 1JGVH 1PZ5B 3PGFL 4WFED 3P4LA 3RVTD 2FYYB 2X70B 1PYWB 2K7PA 4D2NA 5L6YH 4GUPA 4IM8A 2A6DB 1JCKA 3MV7D 2DLHA 4O51B 3BOVA 3KDMB 4FZ8L 1D9KA 3O4OB 1M71A 5DUPL 1I8IA 4DOHE 3AVEA 1YY8B 1R3JB 4EN3D 1YEIH 3DPBA 4U3XA 4KC3B 5CSZB 2NXZC 5D8JH 2YUZA 5IIEB 2QQNH 1UWXK 3PWPA 3FT3A 1Q8MA 5TQ2L 1T3FA 4QRTA 4OLWL 4EUPA 1L0QA 2P44B 1UVQB 4BFIA 2H6PB 4YHYB 1E4XL 1NC2A 2X4QA 4OFPA 3SKNB 1RHHA 2Z93B 1GC1C 3RDTC 4RA3A 4UINL 4ERSL 4MB4A 5IT2L 2OR8A 2C3VB 4JDVB 1MFAL 3GKWL 4M8QA 2J4WL 3BEVA 4KFZC 5EO1A 2B1HH 2RCSL 5MP6H 4M5ZH 2QQLH 5AAWA 5K9JL 3STLB 4YDJB 1OSZB 4NN5B 2XWBB 4HWEH 4X7EC 2OP4L 4H8WC 3CFDB 4DK6A 1IBGH 2BSTB 3MLSH 3OPZH 5BMFH 3RY6A 4B5EA 5HI3D 5EIQA 1ZVHA 4ZXBC 3F58H 5A2FA 1F58L 4N0YL 4YQXL 5C0DA 4Z78A 4L3CA 1MCPL 1XF2A 1QKZH 1AJ7L 2FJGB 2VLJB 3IJHB 4XC1L 3PWLB 2AXJA 2QSVA 3JTTA 1IAOA 5CKGA 5ILTL 3UTTD 2GFBA 2AJUL 3PNWA 5EU6B 3VFSA 5HYJA 3TCLA 3F7QA 3VFNB 4QHMB 3RWEB 1WBZB 2J88H 2X1QA 3A67H 4R6UA 2ZCHL 4M6NL 1T7VA 2HT3C 1A1OA 2VH5H 1H3PL 1IEBA 3Q6FA 2LAAA 2FWOA 2P24A 4QRPA 3QG7L 4PRPD 3PV6B 2VYRE 3HR6A 4QT5B 4RX4D 2YOCA 4WHTA 4MJ5A 3VGEA 1FNEA 1T03H 2AXFA 4MS8C 4JG1H 4MJ6B 4CN6A 4M8VA 1HDMB 2Z4QB 4PY7A 3WL9B 2IANB 5LG1A 1MCLA 1AGDA 1AGFB 2E7LC 1CFNB 4UAOC 4X6CE 5SWQA 4IHOB 3V7AE 3N85L 2IBZX 3SKJL 1YNTB 1QBLL 3AXLA 3MRBB 5INDA 4JGJA 2XG4A 1MAMH 2VO5A 3IS0X 3MO1B 4OZHE 2DD8L 4KJYA 5FGBC 2AABH 1CD1A 3VFUA 1V3MA 5KANI 2MNUA 2W92A 1S9VB 4QRUA 1LHZA 1ZTXL 3C6SB 1WFNA 3F7VB 4I2XB 3RWCB 2WBJB 1DBMH 1U8KB 5SX4I 3MV9D 5F1NA 4XI5C 1BAFL 3LS4H 3VA2C 2W60B 2QQQA 3MFFA 4Y1AA 2IPUK 2J5LB 3QIUD 2DF3A 4CN1A 3GSXB 2H3NB 3DETC 1NC4D 4YHNA 2I26N 2CDFB 4NGHH 3VRLF 1B4RA 4OKVB 1CICB 3IAGC 5GGVL 5AYQA 3EFFA 3MYJB 2O61B 1U8IB 3KPSB 4P49A 1OGAD 2XFXA 1JP5A 3LAFA 5DDHA 2P4AB 1XGYH 1WJ3A 2BNUB 3GBNL 4HS3A 4RNRB 1FZJB 1L6ZA 2C1OA 1V05A 3NIFE 4KK6C 4Z76A 5DYOB 5C0GB 1I4FA 3SPVB 5KSUB 3V7MA 2ICWB 3V6OC 2YD8A 3KLAA 1S5HA 5EZLB 4PD4J 4GRWH 3CZFA 3FB5A 4Y5YB 4JY6B 4Q9BA 2G2RA 5K9OA 4G8GD 4YAQA 3QEQB 4TTDC 5J9PB 5EBMA 1RIVL 1HHGB 2ESVD 5AG9A 1XZ0B 4HIIA 3D18A 4UTAL 1NAMB 2JK5A 3BP5A 1WBXB 2HMIC 3LOWA 4MA1B 2DQJL 1T7XA 3O3EA 3KHOA 5D6DA 4G6ML 1J05B 5M94B 4WW1A 5E2TH 4PTUA 3LPWA 4P2RB 4JFQB 1IM3A 2BHYA 3IETB 2DI7A 3GSWA 4ZPTB 2QHRH 1EGJH 4B53A 1UCTA 4S1DC 3X3GL 1YJDC 1YPZB 2RHEA 1INDH 2JB6A 4OLXH 5FCSH 4JFDD 3B9KA 4NN6C 3QEHB 2VR5A 5D5MA 1U36A 4U1SB 3SHSA 1AFVL 1B88A 4ONGL 4LRNH 3ZHKA 4HWZB 1LP9A 3IXTA 4OSUL 4JFXA 3FQWA 1JGUL 3MRJA 4AL8H 1NLDH 5JHLL 4M7JH 5ID0B 1Q94A 1G9NC 4MLIA 5JW5A 3EDFA 3SDCA 3UPRA 3CU1A 1HH6A 5BJTB 5LGJB 3GBMH 1KENL 4XHJC 5JNYA 4OZGA 1S7XB 3K7UA 1FVEA 2IBBA 4K94H 4PRDA 4POYA 4CVUA 4WHYH 1J0IA 1QLFA 2QKIB 2F5BL 2EEBA 5ECJE 4IJ3B 5C0FA 3S34H 4HUXA 4PRAA 5TE7L 3H6JA 4OF7A 4DKEL 4JFHE 5TPWH 4MD5A 3BYYA 3DVNB 4UBDD 1PSKL 4NOFA 1DN2A 1HXMA 1OWRM 1UFUA 3DV6B 3VXNA 2ZKHH 5BS0A 1EPFA 4FFZH 2C3GA 1I8LC 3P0YH 4PJCA 3I6LD 3TVMD 1C5DA 1E4JA 3FFDB 1A9BB 3QWQB 4FRWA 4OD2B 1XGUA 1KULA 2IGFH 1FIGH 3WN5C 3CFJB 5DJ8B 3JSSA 4I9WE 1XFPA 4OUUA 5I8CB 3ARGC 1FSKC 4PV9A 3GJEA 4POUB 4PS4H 4P5TB 4GSDL 2YHGA 3VI3E 2APVA 3O6MH 5D1QB 3HC3H 3P9MA 4OQTA 4RWHA 3JV5A 3PWNA 5F88A 2HKFH 2HT2D 1MI5B 4FQXD 2CKBB 3HUJE 2EDWA 1JZ3A 4LKCA 1DLFH 3DXAA 4YXHH 1RZ8A 1BD2E 4EVNB 4GG8B 5DD1H 4AG4L 2G9HA 2VJXA 1BP3B 1RU9H 1RI8A 4LQFH 5IB4B 1NL0L 1U58B 4AIZB 5HGDA 5IQ7H 5F70A 4UT7L 4M1DH 5BZDB 3BRDA 1MY5A 4BK5A 4C56A 4Z8FL 2IH1B 3FOLA 2HLAB 2IQAA 4LOUD 1NGZA 1LE5B 2QR0B 3UTZA 5I71C 2HWZL 4NUJB 1A3LH 3BIKB 1PZUB 5GHWH 4LPTA 3CDGA 1KSRA 3OKKA 2VWEC 3CSBA 1IAIH 1ACYL 3H9SD 1FNGA 2O5XH 3QULA 4NQCE 4BSWA 4KGJA 5DURD 1T21B 1P4BH 5FHBH 1ND0A 2HFFB 1T66C 3TH3T 1JRHL 5IOPB 3VXUE 4QXTA 3KGRA 3OHXB 3TPUA 4X99B 4YHPB 3HI1B 3HS0B 3DGGB 4TNVK 5EU7E 4U7MA 5SWZA 4W68A 2V9TA 4GKNB 5DMIL 3PHOB 5EC1B 5CHNA 2P43B 1ZLWH 1JHTA 4JFFD 4WUKL 5JHDE 3O8XD 4HCRH 4W6XB 3BZFA 2FNBA 4PRID 3MLTB 1GGCH 5B21A 1G7PA 2Y5TA 5ACMA 5DWUL 4DGYH 1BZ7A 1CGTA 5BCAA 1UWGH 4MQ7B 3D39D 3DMMB 3RUGF 1T7WA 4HEPG 4YHZH 4QOKD 1RUML 5ENWA 1TQCB 5KW9H 4YUEH 1N4XL 5GZND 1UJ3C 4BKLA 5GGQL 4NDMB 4YC2C 3O6KL 5I75B 5GISH 4G8EA 4Y5VB 4LHUB 2YUXA 3PF2A 3S5LG 5FK9B 4KTEH 3DBXB 4QCIA 3LRGA 1W72B 5I8KH 1G7QA 3V5HB 4KKLC 4OCYL 2AJVL 4XP1L 5I15H 3KNBB 3ARBC 3WUZA 1OAKH 3JUZA 1D5XB 4PLKD 4X8JB 4BQCA 5EUKB 3MJ9A 1WFOA 2NY6B 4PBVC 5C0RL 1JL8A 4PJ7F 2BVTA 5F96H 2FLBT 2VXTL 1Q9WB 4HZLA 2A1WL 2E9IA 4MAYD 3HPJA 1HIMH 1C1EL 3KYMB 4WDIB 2VDNL 2VRAA 5AZEH 4AENB 3D3VB 5TDPB 3U9PH 5HHOD 2XN9B 3FQTB 1QA9A 3IDIB 3WO3B 4DKFL 1QVOA 3ARUA 3IB4A 4NHCH 1MHHA 1CLZL 4JG0L 1TJIL 5TH2A 3EOAA 3O9WD 3MRPB 3FL7A 4U0RB 3CPLB 1UXSA 4Q6IC 4GAYA 3CMOH 3EYQD 1N59B 4GRWF 1ORQA 2A6KA 2BC4A 2Z8RA 3ZT6A 3T0DA 4LSPL 4MJIB 3PJSB 2V7HB 1IC7H 1ADQL 1CFVH 1UACL 1A4KA 4WFGD 3HZYA 5LKNA 3V2AR 4P4KB 4ENED 4EEEA 4Y2DA 3LIZL 4DTGH 4X7DC 1CXFA 3QAZB 5J0BA 1WWBX 4WU7A 5J11B 3VGBA 1JIBA 2NR6C 4ONHB 1CXLA 2VQUA 3TC9A 4GW4B 5I76B 1T04B 1ORSA 5J13C 4HD9A 1TQBC 4BELD 5E8EB 4OFYD 4F80A 5I1AB 2DMCA 2VB5A 3G6JB 5EU3B 3MC0A 1A2YB 2RR3A 2MPAH 4OLYL 1FORH 4M1GH 4NBXB 4A2LA 4G3YL 4W4NA 4X0KA 1BFVL 3RWHB 5D5MF 4K8RD 1UYWL 4PIRF 4G42A 5DJ0A 3O2VL 3RWJA 3MOAL 3LN4B 5GGRB 1UWEL 1UEMA 2PW1B 5FYKD 4MHHG 5EH1A 3HC0A 4N1CA 5A3IC 4K7PY 1OF2B 5J56B 4RFNC 5C6PB 1NH6A 1X9QA 1U2CA 3R1GH 4RAHA 1LDPH 3HNVH 3U0PA 2VLJE 1J0KA 3R0NA 1FFOA 3VXTB 5EU6E 1XF3A 4OCWH 3CFEA 1E4KA 1F11A 1S8DB 1ZHNB 4HBCH 1T4KB 5F7DA 3VJ6B 4WV1B 1G7MB 3REVB 5FYLE 4HC1H 5JPMA 5I6XC 5ITFA 4URTB 4R96A 5AWNH 3TBSA 5F3HB 3BQUB 2NY2D 2O26U 3GSRA 4EXPX 1X4YA 2PCPB 5D1ZD 4Y4HA 5CP3H 5C7XH 2NY4B 3DRTA 3ESVF 2IANE 4P4RA 5AG8A 4HHAB 2NZ9C 2ADGA 3HAEA 4HKZB 3NPZB 2B39A 2OLDA 4JPKH 4P2OA 1MPAH 2NPLX 1R5IA 5MEOA 1PQZA 3VG9C 3CXDL 4P3DB 5DK0A 1K8IA 5CFHA 4R7DB 5DHYA 4ZYKA 4I2XE 2OBGA 4OAWB 3FO0L 3OBAA 3V5KB 3KYNB 2EO9A 1JPGB 1QFWI 3EO0A 4S11A 2FGWH 3AUVA 4HKXB 5I9QC 1NFDB 3T8XA 4Y4KA 4PB0L 4Q2ZA 3K74B 1RJZA 1XIWA 2RFXA 3DHJA 1CFSA 3BWAB 3DSFH 5KOMC 4JY4B 4BK4A 3CH8A 3UO1L 1OCWH 3FO1B 3QUXA 5GPRA 1T2QH 4LCWD 5A2IH 3KPSE 4MA3A 3Q0HA 1QNZL 3G6DH 5L6YL 2VITA 3EO9H 3RNQB 1SEBA 3TM6A 3IAQA 4HV8B 5CAYB 2YXFA 3PWVB 5DVMA 2EDLA 2UYLA 3CX5J 2X4TA 1AGBA 5DQ9A 5JIKA 4Z6AT 4KHXH 5F6HJ 2X4SB 2WW8A 5HYIA 3GNMH 4P59H 3ZE0E 4IRSB 3L5JA 4EI6B 3TBVB 5JOFA 3HC4L 1EAJA 3O2DA 4O2EA 5HPMB 1F6LL 4OFIA 3TN0A 2D4FA 3QI9A 4OB5H 4HH9B 5F9JB 2EEAA 3QEQE 3GMNA 1CE6B 1L7IL 4P5MB 1RV6X 4GFTB 4RDQF 1RZKH 2ARJB 2EE3A 3VW3L 4LNVA 1BBDH 2F53D 3RU8L 1YY9C 1D6VH 4M7ZC 5EZOH 1A6AA 2EDKA 5EIVA 5DMYA 4FFWD 4P2RE 3I6KA 3UJJH 3UEZA 2Q7YA 2XQYG 3X3FH 4XP9H 2IG2L 3BXNB 4JHAL 4M5ZL 4JKMA 3ULVC 1P2CB 1TITA 2XI9A 3HZMB 2E6PA 4KKCD 4XBPB 3UTSA 1YPZE 3TYGH 4LIQE 3VMNA 1FYTB 3MR9B 2HFEB 4P23D 1G0XA 1I8MA 3HUJA 3ZO0A 3O3DA 2E27L 2XWJA 3AC0A 4WFFE 5BMFL 1F42A 2LVEA 4Y4FA 3VRIA 1FPTH 4Y2OA 2Q86B 3BVNB 1S9XA 2YXMA 1RJLB 1S7RB 4HFWA 3I3BA 4RFEB 3BDYH 1NKOA 2EIBA 1BFOA 3M17A 4NZUH 1ZT4A 4ZFOL 4IDJL 3P4OA 4Y5XB 4EN3B 1XF4B 4K2UH 5JOPD 4ODVH 4PGEB 4LEOA 3IF1B 3VXRD 3WNMA 1IKFH 4WNQA 2WAHA 1P5VA 1X44A 4X9FA 5T1KD 4HX1A 1J5OH 2YRZA 3EKCA 1ULVA 1Y6MR 1WEJH 4U2YA 1NANH 3LHPH 3NCJH 2OSLA 3LEVL 4DFHA 2V2XA 4NUGH 5E6YA 1GOHA 2GYSA 4NQCA 4Y16D 4ZPVB 3QUYD 35C8H 4ZO8A 4X4XB 1PX4A 4EDXB 3DNKA 3UYPA 1T03L 1OPGL 2DLFH 4JG1L 1N5YL 3S96B 2Z31C 4APQD 3VXUA 1BVLB 2R1XA 5IB3B 3L3JA 1DE4B 1EHXA 2CK0L 5L0QB 4XCFL 2XXMB 3OKLB 5EB9A 3EJYC 3IDGB 3OV6A 5D7SH 1I7RB 1MAML 4XAKD 1LD9A 2PW2A 3C9NA 5JHDA 3NN8B 5F8QC 3JWNC 4JLRB 3QDMD 1FVDA 3SCMD 5D1XD 1T89C 1PY4A 1WZ1H 3HMXL 4TNWK 3QH3A 1T22A 1VB9A 3TNNB 4J8RA 4A6YB 5IJVB 5E4EB 1UWXH 2VL5A 1DBML 3V0VA 1YMMA 3AB0C 3W5NA 3KJ6H 4RBPH 4X4ZA 1IKNC 3LN9A 1UZ8B 4RGNC 3CFKA 1NBQA 1JNNL 5F6IB 1FC1A 4ODHH 2XYCA 1EO7A 4RIRA 1LNUB 5BV7H 4TSAH 1MI5E 4O5LL 2AEPH 4Q97A 5GS1C 4X6CF 3CDYA 4XMPH 4AM0B 3DX6A 5IROA 3DVGA 3EYSL 4RISL 2PTTA 5I1IL 4PRPB 1BQHG 3PWJB 4OZHF 4ZO9A 4JN1L 3F7RA 3PIQB 1P1ZB 2Y4SA 4PJHA 5E9DB 3RTQD 4WUUB 1W0WB 1G7LA 4L9LA 1MH5A 1LK3H 3O6FC 1IGCH 4KMQA 1KCRH 4JPWH 5TGBA 1T7ZA 3Q48A 2YD1A 1DQQB 2EYSA 3SGDH 3KYAA 1RZJC 4KQ3L 3IU3B 2YBRB 2HTLC 4HUUB 4KV5F 1EV2E 5E6IA 3IKKA 1LEGB 1TTFA 3INUH 3QNZB 4I77L 4WY7H 4ZD3L 1U3JA 1OP5H 4YHMH 4DVRL 1KUMA 2VDKH 4OM1L 3KPMA 3MRLA 2P45B 5E2TL 1A9EB 1I1AA 4ODSH 4PGCB 3GZKA 1JZ7A 2DWDA 5IBLD 1SMOA 3L3DA 5CINL 4RMUA 1EGJL 2LFGA 5DQJB 4CGTA 1PZ5A 5FO9B 4HKBA 1CGYA 4N5EC 1INDL 2X70A 1PYWA 3DI3B 4OFDA 4OLXL 1BJ1J 1OWWA 3EIFA 4O51A 3VD7A 4LRNL 3KDMA 3NZ8B 5F1IB 4XP5L 3RZCA 1YEJH 1IQWH 1IAKB 4HBQA 2C7UB 4YDKL 3F7YB 5CSZA 4NQVB 4L3EB 5IIEA 3R0MA 1P6FA 2AJXL 2XKSA 1WICA 2H2PD 4WI4A 1NDMB 2H6PA 4Z7QF 3IXAB 4K94L 3KPOA 1ADQA 1MREH 1X6LA 1EDQA 1DBAH 2BSED 3MXWH 2VXQH 2D7PA 4N9GB 3QDGD 4QY8A 2EO1A 4JREC 3EDDA 4K23H 2WUBH 3JTSB 2ESVB 1JMXA 3FAWA 4LLVB 5E5MA 1BEYH 5T33H 5C07B 4G5ZL 5E1AB 2ZKHL 4FQLH 4LP4A 3STLA 1YEKH 3RWGB 2FDBP 2Q87A 1JZ5A 2XWBA 1JUFA 1PEWA 3D3VE 3PGDB 1JMZA 4BFEA 1AXTL 4OGAC 3QHZL 3CFDA 2XN9E 5C6WH 5DK2B 4DFIA 2BSTA 4ZXBB 4YFDB 1MOEA 1FIGL 2F9BT 1F4YH 3EAKA 4JFDB 4NO0D 3U6RB 3O11A 5LGHH 3CU7A 3SDAC 3SKOB 3MA9H 2FJGA 2GJJA 3PWLA 2VNCA 1JPFB 3F62A 5EU6A 1ACZA 1HYSD 3VFNA 2DKSA 4QHMA 4TTGA 3O6ML 4MJIE 3RWEA 3TZVC 4WW2C 3UJIH 5CLWA 4JO2H 4YGAB 5I17A 3GSNB 2HKFL 2H32B 4U49A 4U31A 3UXFA 5B38G 1RMFL 3BUYB 3PV6A 2R0WH 2Z35B 1DLFL 3ABZA 4YXHL 4QT5A 1NSNL 1TMCB 1RU9L 2Z4QA 3P0VL 4LQFL 3VFTB 5T1LD 3LB6D 4YHOL 2IANA 5E08H 1LILA 2PXYD 1AGFA 5IQ7L 1CFNA 1KNOB 4M1DL 3GK8H 1WQVT 3FT2A 4WO4C 4M62H 1NCNA 4IHOA 1MFEH 2BVOB 3LRSB 1B4JL 1P7QD 3MRBA 1RUAL 1NGQH 3G6JE 3MLYH 1A3LL 4CUCA 5GHWL 4F57H 3T4AA 1U8NB 4ETYA 4KRLB 3ZTJH 2O5XL 4JFPB 4NBZB 1S9VA 1P4BL 3QUML 5FHBL 1SM3L 1HZHH 3F7VA 1FYHB 4MNQD 2G5BA 2ADJA 3TJHD 5MERA 1HSAA 1U8KA 4QRSB 3LKRB 3QCUL 4QRQB 1D9KC 4F37K 2ED9A 2UZIH 3CUPA 3EO1B 2W60A 2EDTA 4IIQA 1VENA 4LLDB 3OJ2C 2IEPA 4WGWB 3ARED 1Z0MA 4HAGA 1GOFA 2OL3H 1CD9B 3GSXA 3B2VH 2R23A 3L3OA 3MRMB 2CDFA 2KQNA 3SQOH 1CICA 2QSQA 4UT9L 1GGCL 1FZMA 3MYJA 1U8IA 3SKMA 5C6TH 3QXDB 5HD8C 4XMLL 4PPTA 2OQJB 2W07A 1N26A 1GHFH 4RNRA 5CEZH 4D8PA 2JJWA 3SGDI 5CBAA 1UWGL 4JY5H 5EWIH 4XNXH 4ZOBA 5F7YC 3ULUL 5DYOA 5JQ6H 4YHZL 3SPVA 5KW9L 4XCYA 5KSUA 1TVBB 2J2ZA 1KB9J 2ICWA 4V2CB 1P84K 2GTZB 2HT4C 4IRJD 4GLRH 5GRYA 1NBYB 5GISL 3QHFH 4Y5YA 2DQTL 4YBQD 1QEWB 1QFWL 5KSVB 4HUMB 3QEQA 5C3TA 2FIKB 4KTEL 1HHGA 3RY6C 4FZEH 1K4DB 5DJZA 4E0RB 1NAMA 3PL6D 3UC0L 1XR8B 2W0PA 4GH7B 5DUMH 2BVQB 3ARDD 3DOSA 3P9LB 3V4PH 3U0TA 1OAKL 2DM4A 4P2RA 4GW1B 3LKOB 3QNYB 3IETA 2PYED 1NAMH 2YPKB 4MNHA 1U9KA 2Y6SD 1B0GB 3BH9B 3O0RH 3PHSA 3QDJD 1QOKA 2FH8A 4QTIL 4NN6B 4Y19D 2VZUA 3QEHA 1BPVA 1YNKH 4U1SA 3WXVL 3O8XB 2XZCH 4F3FA 4PRIB 1M1SA 4HWZA 4WJ5A 1NUGA 1NDGB 3T09A 1BQLL 4NHCL 3MLPA 2V5TA 2B4CC 2BY3A 2VLKD 1NFDE 3PXHA 3ZE1E 3FQNB 1AH1A 4X7SH 1RUKH 4NM4L 1FCCA 5BJTA 2F15A 2D0FA 4QOKB 1C08B 3GSOB 5I1HH 4W6WB 3MREA 3C09C 2EDOA 1QR4A 2BNQD 1IC7L 3N1PC 2UZXB 2YA1A 2KZ1B 2M2DA 2NQCA 1CFVL 4LLWB 2FATH 5KZCB 4Z0BL 3BH8B 3CAFA 7CGTA 4Q7DA 2VLRD 1OM3L 3SGEH 2RBLA 1JVKA 3VH8B 3DVNA 3L3KA 4M43L 3DV6A 4ZFOA 4R4FL 1PD6A 4X6BB 2WP3O 4PJXA 2OI9B 5T5NG 5IMKB 3ARFD 4GMTL 4PREB 3FFDA 2VZ3A 3FO2B 2KH2B 4KTDL 4PYHA 4U0QB 4OV5B 4MAYB 3WN5B 4JFEB 1ZLSH 1KFAL 2AJYL 4O4YH 3CFJA 5DJ8A 3ARGB 1FSKB 1DQLL 5D7LA 3NCYS 3GMRB 5HHOB 4PP2A 3U30C 5I1GH 3G04B 3MBEA 2AAVA 3ZKSD 1QHOA 5L9DL 4P5TA 3BZEB 1VACB 3WNOA 1CDUA 5SWSA 4TOYH 3D2UA 5EPMB 3AY4A 1FYTE 3T65B 3LZFH 3OL2A 4WFEE 1MI5A 2CKBA 4B41A 5C0AD 5F89B 1SQ2N 5F9OH 2JB5H 4GG8A 3VWJD 4CBPA 4NN7C 2FEDC 1LO2H 1QSEB 3BGFC 3R1GL 3HMXA 1LDPL 1DBJL 5IB4A 1U58A 4HQQL 5A2LH 2WUCH 3JV0A 4AIZA 2EKJA 5BZDA 3KPRD 4UIMB 2F19L 4OCWL 5D6DC 2XPGA 2VDQH 5DK3A 2X7LA 2IH1A 2GK0B 4HBCL 5IW1B 3ELAT 2HLAA 1OQOA 2H9GB 5I71B 1JNJA 1ZAGA 1LE5A 4OZFB 4YK4C 1Z9SA 3BIKA 2EDYA 5I1EH 5FHAL 5DZOA 1IL1A 2EYTA 3H0TA 4POZD 2DQCH 3B9KC 1T21A 4C83B 1TCRB 3IDUA 3LN5B 1D5ZB 1U42A 5F7MC 3BGAA 3OHXA 4X99A 2R8SH 4RAUB 2Y36H 5GJTH 4YHPA 4PGZA 3SDCC 3ZSTA 5GS0C 3NA9H 3N1FC 2ZOKB 5D70H 2AJZB 5J57B 4GKNA 3PHOA 5EC1A 4JPKL 1N8ZB 2EC9T 1SJHB 2X9YA 2ZCLH 3P0GB 1J1PH 3TH2T 2N56A 2B5IC 4JEGB 4LHJB 5SX5H 1MCJA 5I66B 3W11D 4MQ7A 1WISA 4KK9D 5DRWA 3DMMA 5FDYA 1ZHKB 5FCUH 4KRMB 5B4MD 1O5DT 1CK0H 4UMGA 2BSRA 1UJ3B 4YC2B 3VXMD 4NDMA 3FN3A 1N6VA 4N8VB 1IGYA 1MCEA 1DL7H 3DSFL 4Y5VA 4LHUA 4GXUM 2AS5M 4KUZH 1T2QL 4JPVL 4PRPE 3LVEA 5FK9A 4TVSa 3G6DL 4KVNH 4LVNC 1W72A 5D1ZB 4Y7MA 4KKNA 3V5HA 3OKMB 4HZAA 4KPHH 4H5SB 5L2KA 1TTGA 3KNBA 1CFTB 5E9DE 3HMWL 2NY1D 1D5XA 4X8JA 4F15C 2DIBA 4WUUE 5HVHB 5EUKA 1A6TB 4MHHI 3IFLH 3R06B 1YEGH 1F4HA 2VABB 4BSVB 4JVUA 3QIWA 4NKMB 3I6GB 2AERT 4N0FB 3LRHA 3VGFA 1LE9B 5E8NB 2J8UB 2X4OB 2XZQH 2MFNA 4ONOA 2ZOLB 3SN6N 3VXSB 4NZDA 4JKWA 1L0XA 3B9AA 3D3VA 4WI3A 4AENA 3DV4A 4FA8A 3MUHL 3L3HB 3HTLX 4OB5L 3FQTA 4ODUA 4PTTB 3ECBA 3RGVD 4EDWH 1RZKL 4PJDB 3TV3H 1BBDL 4CKVX 4M4RA 1D6VL 1JF1B 2FX9H 3WS6C 4Q6IB 1G1YA 4P2YA 3CPLA 1PG7L 4AK1A 4OLZL 3MJ6A 1CD8A 3K8KA 5GRJH 1KCVH 4XP9L 3C8HA 3QO1B 1N59A 3CDCA 1FL3B 3PJSA 3TYGL 1KEML 2YZ8A 2Z0BA 5JXAL 3T3PE 1HKFA 1G1CA 4D9LL 1P69B 3ROLA 1P53A 3CSGA 4LCWB 3STZB 4LF3B 3RHWK 1CBVH 1FPTL 5BOPA 4NQXB 2P49B 1WBYB 4K9EL 1FN4B 3QXAB 2HRLA 4W4OA 4L3EE 3RBGA 2ZNXA 1RZGA 4IOFC 4NZUL 4TVPE 1A5FL 1A21A 3BZ4A 5IUSA 4GW4A 5J13B 2CDEB 4K2UL 4ODVL 1TQBB 1T04A 5I76A 2XKNB 4K3EH 5DXWA 1I1FA 2F54D 4TQEH 2EDJA 1IKFL 5I1AA 1T1XB 5A2JH 2CRZA 3MOBH 43C9B 1WAAF 3G6JA 5EU3A 4NO2A 4X9IA 1J5OL 2JJTA 4HK3J 3X12B 1A2YA 3LHPL 1R3KA 3QUZD 3QFDA 1YPZF 3H3PL 3NFSH 3EZ8A 2ESVE 3RWHA 35C8L 3AS1A 3M1BB 3K80A 3DUSA 2FECI 4UQ2B 3STBA 5GSRA 3G5XB 1KB5B 4M1CC 3RNKB 2RQ8A 4XHQA 1UM4L 2DLFL 3GHBH 5C07E 3LN4A 5FECA 3T0BA 2NNAA 1MCNA 4NT6B 3WIHA 1A7OH 2PW1A 4FABH 4FP8L 3VFOB 5IK3B 5D96C 4M7KH 5K9KB 2E7MA 3OKNB 3BP4B 5FO7B 5D7SL 5KVFL 4JFDE 4XGZB 3ZKND 4YEFA 5IFHL 2DQIL 3MLXH 1BECA 4PJ8C 2OZ4A 2P8MB 3QUMA 1W8NA 1RZ7H 2E8YA 3T77B 3VXTA 2IMMA 1K4CA 3P4NB 1L7TH 2R0LH 1DQML 3O45B 1JYVA 1Q72L 1YEEH 3H2WA 3MRCB 4OCSH 4XB8A 4QTHA 3VJ6A 4HH8A 4WV1A 5I6XB 2OZ4H 3FHAA 1KN4H 1CGXA 5BV7L 5KSBB 4TSAL 2HJFB 3X13B 5F3HA 3BQUA 3VXRB 2MQCA 4HFUH 2D7OA 1IE5A 2P5EA 1FLTX 5T1KB 2Y07H 1IVLA 1J1XH 4XMPL 5T3XD 3S4SG 4J1UB 2PUQT 5IGXL 1NUDA 3W2DH 4U1KB 4K7FB 2VKXA 2GK2A 4QWWC 3G08B 4X7CC 3GMLB 3PQYB 4ZFZB 4PJ5D 4WTZA 4QGYA 1DCLA 2R0ZH 2BY2A 3H7LA 3HE6D 4APQB 3E6HB 4U1IB 3VG9B 1IGCL 1BM3L 3P4MB 4XNQB 1BMGA 5CIPB 3SE4A 5JLZB 2YEZA 3UP1A 1Q1JL 3BISA 4TYUA 2CLRB 3TIEB 4OAWA 3LKPB 3V5KA 4BZ1H 3VI4E 5D1XB 4PRBA 1VEPA 3ARYA 5DJYB 4D9QD 4Y2DC 1F90H 1JPGA 4HUNB 5I9QB 4CMHC 4LGRB 1WLHA 1CU4H 4HKXA 2KPNA 4B50A 1NFDA 3KYOA 3PABA 5GRUH 4OLUH 3VDAA 2J1KA 4ODSL 3VWKA 5TE4L 4NJ9H 4XVJH 5MENA 4JY4A 2FSEB 3IGAB 5AYUH 4G8FB 5B39G 3FO1A 4HGKC 1GGUA 4F7EB 3U1SL 4LSUH 1A6VL 2QEJA 3V0WH 4ZUSB 5IMOB 4CADA 3RNQA 1G7HA 1D5IH 3PWVA 5I1JH 3C8KB 1IQWL 3QPQD 4XWOC 3BMWA 3KPQB 3P73B 5ERWA 5CUSL 2ZUQC 2BP3A 4HIXL 4UV4H 5J3HC 3V6OE 1DN0B 1HHIA 2X4SA 1VGEH 5C08D 5CZXD 5BOZG 1G7IA 2DQGH 1AO7D 4DKAA 2F8VA 5CBEB 4V1DA 4YZFE 1RFDL 4EI6A 3VG0H 1A1NB 4HH9A 5F9JA 1XEDA 3OKDB 1OY3B 1AXSA 1MREL 1S78D 3D0VA 2ZJSH 1DBAL 1A22B 2ARJA 1CF8H 2VXQL 3MXWL 4LARH 4M7ZB 4X80L 2OK0H 2DB8A 1D5MB 5KSAA 4DZ8B 2R1WB 1DUYA 4WHDA 1E4KC 5T33L 4XBPA 3HZMA 5CZVL 4I3SL 4NKIH 1YEKL 4M6MH 1IGJB 3GSVB 3MR9A 4PRIE 4G6AD 3AS0A 1S3KL 5H35B 1U8OB 3ZKXB 1XAUA 2Q86A 1S7RA 3MV7A 5A16A 1T20B 4RFEA 3C5JA 1H9VA 1SMAA 3LMJH 4Y4HC 4LVEA 5LGHL 4X7TB 4Y5XA 4EN3A 1XF4A 3L95A 4QOKE 32C2B 2LAGB 3V79C 1S9YB 2MQ0A 3C5ZD 1ZLUH 1FBIH 3MRDB 4NFDA 5FUZL 3DYOA 5FIEA 1JNLL 4P2OC 3S36H 3WIFB 1VSCA 5LGKA 1AD9B 3L5XH 3QEUB 2R0WL 2D7TL 3W0WD 1YN6A 5IM7B 1T5XB 3B3IB 4EDXA 1LEKB 5HYQB 2XRAH 2UZYB 3C60D 25C8H 4MSWB 3S96A 1JF6A 3NABL 1JGLH 2PO6D 3QA3B 4LFHG 5E08L 1U6AH 1IQDA 3HE7D 3NFPA 1NQBA 2BSSA 4NQDD 4M62L 5IB3A 3BP7B 1CLYH 4Y4KC 4JFEE 3K8LA 3Q1SL 4Z5RB 1NGQL 2G60L 1XIWC 1I7RA 2GSGB 2NTFA 3TFKD 5I2IA 3HI6L 5FFLA 4GKZA 4KMLB 5HHOE 1MJ8H 3M8OH 3P2TA 2GY7B 4PJ9D 4NO0B 5IJVA 5EBWB 3AB0B 3WNLA 3CXHK 1FO0L 3KLHC 4RGNB 2UZIL 4Q9QH 1MCOH 1QPXA 4A6YH 5GRVK 3ARBD 3UTTA 1HE7A 3MCKB 1LNUA 4QNPE 3MV11 3VFWB 4XBEH 3HNSL 1JI2A 3RI5K 5CD3B 1R0AL 5IKCB 2XXCB 5GS1B 4UIKH 2OL3L 4XVUC 3JWDH 4NQUA 4TULH 4LFHD 5GGVY 4AM0A 2AEIT 3SQOL 4JVPA 3TN0C 1PJ9A 1QSEE 4PRPA 5AAMA 5DO2C 5C6TL 5IVZA 4GAJL 3KYKL 4ODXB 2PYFB 2GJ6D 1B3JA 3LPFA 5HHXH 1B0WA 3EHBC 1J87A 5CEZL 1P1ZA 3IVKA 4HWBL 1JHKL 5E9DA 4XNXL 4WUUA 1W0WA 5T1LB 3A0OA 4GRLD 1NEZG 2DWEB 5F72S 2PXYB 3PDOB 2WIMA 2VWEE 1IMHC 3I2CH 4HSQA 1KYOK 3EJZC 1P7QB 2YUVA 5E8OA 4JN2B 4XNUL 3IU3A 2X5PA 3UPCA 2YBRA 1A7BA 2NY5L 4HUUA 1OAZH 2YS4A 4R4BA 3S3JA 1IT9H 1LEGA 2Y7QB 4Y4FC 3QNZA 3LEYH 5J12C 4KDTA 3BN3B 5D7IA 1T2XA 5DRZB 5HYSB 1I1YB 3V4PL 3MV9A 2BDNH 3G9AB 1A9EA 2DQUH 4PGCA 5FYKE 5BXFB 5FO9A 1YYML 4D0DB 4JFZH 2BNRB 3AREB 4ZAKD 1YN7B 2ARWA 4NBYB 2X09A 4JJ5B 4KROD 1NC4A 4JRXD 3UDWA 2BY0A 1YNKL 2P5WB 5DD0H 3BAEH 3RJDA 1II4E 4UDUB 1UB5A 3I9GL 1TZHB 2VQ1B 1CI5A 1OGAA 3H9YA 2XNAA 3F7YA 3FN0L 4NQVA 2LQRA 4Q58C 1KXQE 2I60L 4X7SL 1FJ1B 2W0LA 1EEUA 5D71L 1CGSH 4WENB 3T0XA 12E8H 2JIXD 5I1HL 1KIPB 5C9JA 5EU7C 1KJ2L 4YHKH 1QSVA 4N9GA 1G6RB 4JREB 5IEKA 4ZFFB 2FATL 5D4QA 1F8TL 1GC1H 3TA3D 3QQ4B 3JTSA 4HIEB 4ELMB 3WIIL 4NO3B 2ESVA 1U3YA 5HI4C 4L1HA 3D6GA 4D3CH 3TO4D 1IGFH 4LLVA 5TJWK 4RRPA 1GGIH 2KKQA 2CRYA 2DDQL 4JFYA 1N64L 4L4VB 3KXFD 3ARTA 3GEWB 1Z9MA 2J8UE 4YE4L 1WIPA 4MVBD 3VXSE 2DTMH 2PYEB 1KF9B 2P8LB 3ZE1F 3PGDA 2Z92B 3FO9B 3U7YH 1CT8A 5DK2A 3QDJB 4ZXBA 5F7EL 1ZLSL 1A6PA 3MA7B 3QRFM 1EZVY 4JFDA 5IHZB 5F9WB 2ATPB 4OUOA 4PJDE 4H8WH 2AQ2A 2GSIB 3SDAB 5IROC 3D85D 3SKOA 3OAZH 2W65B 2Q6WB 5KN5B 3NOIA 2D03H 4X6EA 1VERA 1WSST 4CDHA 1IM9B 1JPFA 4ONFH 2C4FU 2G5RA 3TZVB 3IFPA 4GXVH 3P77A 4JO4H 4ZUTB 5E2UH 1QBMH 3DECA 4HGWB 1MCQA 3ESUF 4L9LC 2H32A 2IALB 2HN7B 3LZFL 1KBGL 4H0HB 4TNWF 4LCWE 2FECL 5DC9B 3C6LD 1HOCB 2Z35A 2EDRA 3GSNH 3BEWB 2YA0A 2H32H 4NPYB 5C3LD 5EORH 2UVEA 4JM2C 1J9CT 5B3JE 2WIIB 1T7YA 3VFTA 1MQKH 5E6IC 2VLME 2E9WA 2WUCL 4JQIH 4WO4B 5DMGD 5ITBH 5MEQA 1JPSH 2GHWB 2VDQL 1I7ZA 3NCBB 3LRSA 1I1AC 4LPUA 4O2FB 3TVMA 2C3HA 4I18A 3AS2A 1U8NA 5HHVH 3AM8C 3RVUD 4JFPA 2DQCL 1A7QH 1SY6H 1D9KB 4XH2B 4QRSA 1M71B 4RMRA 3LKRA 1I8IB 4QRQA 3RZCC 4U6XA 1BZQK 3EO1A 1RK0A 1SYVB 2R8SL 2Y36L 5B8CA 4LLDA 3BUTA 4LVOB 3NA9L 5D70L 2IF7A 4BFIB 5F3BB 1UENA 3MRMA 4G7YL 3U83A 4FQXA 4N0RA 1HN1A 1MCKA 1ED3B 3QUKA 4X83A 3C2AL 3CLFH 1QFOA 3QXDA 5F7HA 2CIKA 3DLQR 4KI5D 1ZT7A 4M8QB 4UNVA 3QDAA 5C2BL 4KVCL 3B9EA 3OAYK 4X5XB 5FCUL 1X3DA 3V6OA 4N5UA 1TVBA 4YPGA 1UGNA 4NNPH 5KSBE 4Z18A 2GTZA 3VXRE 1NBYA 4Z7WB 5JXED 3RVVC 1S7UB 5KSVA 4U1LB 3U79A 5H37G 1K4DA 4JDTH 5C0DB 1I9RH 4Z78B 4MXVE 2BJMH 1MUJB 3GO1L 4L3CB 2GQHA 2DAVA 1XF2B 3P9LA 2QQKH 2XA8H 1IAOB 4GW1A 2GFBB 4OCMC 4EI5D 3VFSB 2YPKA 2J3SA 1EEYB 5DMJB 3MACH 3OKOB 4GG6A 4KWUA 4K07A 4U1JB 5DR5H 1KLGB 4I0PD 4PD4K 3BH9A 5DUBA 1KN2H 4MXWL 2FR4A 2I5YH 1U91B 4JFFA 4XAKE 2FWOB 1CVSC 3O8XA 4QRPB 4PRIA 1YJDH 4MD4A 2HJLB 4M6OL 2E9BA 1FQ9C 3DO7A 1PLGH 4EDWL 4WHTB 4MJ5B 5H94B 3TV3L 4G6FD 3ORJA 3MLVL 2FX9L 1HHJB 4PY7B 3D39A 5E7BA 4QOKA 5SWQB 1G9NH 5GRJL 4PB9H 1KCVL 2HLFC 3WJLA 3SGKA 1YYLL 3KPPB 1AHWA 1BWWA 3EYOB 1CQYA 5D6CB 2ZUTA 4PJEA 5C70A 2ORBH 4N0CC 4LLWA 4KJYB 3JBG7 3BH8A 3VFUB 1CBVL 4GKSB 4QRUB 1JHLH 1NLBH 3VH8A 5C92A 4K3DL 1NBZB 2YD5A 2NXYD 1XGTA 5IB5A 1A6UL 4X6BA 4ESKA 3VD4A 1BQUA 5L8LB 1CR9H 4PREA 4ACPA 4IIQC 2WSKA 4WIQA 4AMKH 2EXWD 2L4OA 4TQEL 4OV5A 4MAYA 1GAFL 3MOBL 3VGAB 3BPLB 4YHNB 2HVKB 1MHPL 1WZLA 1X5IA 5ACLA 2D31A 2EZ0D 1CICC 4H88L 3EFFB 4S1SL 3U30B 3V6FA 3GMRA 5HHOA 3MRFB 1OGTB 1KT2B 2XFXB 4U4BA 4X6DA 2XWTA 5KOVC 5C0EB 4HS3B 2WM0A 2E6QA 5L8JB 4XPBL 1EXUB 3ULVE 2ADFH 3BZEA 1BF8A 3BKCH 3S5LA 4KKAD 2D4DA 1OAYH 1A7OL 1VHPA 3T65A 1S5HB 5KJRL 3TJEH 5A43C 1HK6A 3L3IB 2GITB 5F89A 2WWKO 2G2RB 3HZKB 4Y5YC 4L8SA 4NN7B 3VXPB 4WI5A 1V3KA 4P2QB 1LO3H 3BGFB 1ZWIA 3MFGB 4N9OB 5EBMB 3MLXL 2F8OA 4LMQI 4Z7NF 4G7VH 3D18B 1BX2B 3BP5B 2W0FA 3V6BR 1DBBL 2YUWA 4M93B 4MA1C 3X11A 4UIMA 1OT2A 1FO0A 4WW1B 2DQDH 1A66A 1YEEL 2K1MA 4LK4A 2GK0A 2H9GA 4CVZA 4OZFA 5EOCL 1E6JH 3F7PC 4KZEH 1HSBA 1OAXH 2A9NH 2F54B 3UCRA 1TJGH 4OFYA 5DJ2A 1VPOH 3B9KB 4LL9A 2OYPA 1WFTA 1J1XL 3QDGE 4TSCH 1LP9B 3LN5A 5I0DA 1D5ZA 3P3YA 4FQQA 1V3JA 3FQWB 5BZWA 1INQB 3QNXB 1Q94B 3UAJC 4HWBA 2BZDA 3T04D 5IBUG 3UPRB 3ZYJA 1EEQA 5ELIA 3DI2B 2ZOKA 2AJZA 1YUHA 1IEAB 2XTJD 4LGPB 3ZDZF 1N8ZA 1FVEB 4EXKA 5D7JD 1SJHA 4PRDB 1GGBL 1RJCA 5C86A 2B5IB 5C0FB 3FHQA 4HUXB 2BHUA 1DP0A 2FRGP 4X9BA 4PLJD 4RGNE 2QJDA 4MD5B 1ZHKA 3ZMRA 1CU4L 1FH5L 3IS1X 5EU5B 1W2KT 3VXNB 8FABB 2YN5A 4FTVB 5GRUL 5L88L 4MQXD 5FGCB 4N8VA 1HINH 5GGTA 3WKNA 2CLVA 4XVJL 2P47B 2P1YA 4FFYH 4HIHB 1UUSA 5AYUL 4LVNB 2NY3C 3RX5A 5IHUH 5GJSH 1JI1A 5D1ZA 1K6QH 4AEFA 1I9IH 3MRRB 3OKMA 5L2JB 4F15B 4L5FH 1N0XH 3WUWG 5I1JL 3GJEB 5FUCC 4FQIH 5KBNC 4GT7A 3VFMB 3MBEC 4HUKB 3R06A 1Z3GH 4UV4L 2VABA 5DD6A 4P5TC 2PTVA 1VGEL 3I6GA 3ZTNL 4FS0A 5EBLA 4N0FA 2DQGL 4PJ5B 3MZTA 4NQED 1LE9A 3P9MB 5DEZA 2X4OA 3QFJD 5F88B 3VXSA 3VG0L 2HYMA 1WCBA 1LGVA 3GIZL 4WWKD 4H25A 1Q9LB 3MLUH 4LKCB 2VXVL 3DXAB 4O9HH 2HTKC 4LARL 1OAUH 5IMMB 4LAQL 2DRUA 1JF1A 5T3ZE 4G9DB 3VE0A 4HJGA 4HT1L 4LAJH 2VXUH 4K7PH 1QRND 3CZJA 3JWOL 3MRIB 3LEXA 5SV3A 3OWEA 2IPTL 2QADD 4EUPG 4LSVH 5IVOA 5F7UA 1HEZB 5DI8B 2P5WE 3F6LA 1URLA 4RQQB 3FMGH 4LCWA 3QULB 4BSWB 3V4VH 4YZFF 4LF3A 3GJFH 5GGUA 1FN4A 4FFVD 1NFIB 3QXAA 3LMJL 3N1QC 15C8H 1E6OH 4P5KB 2CDEA 3BT2L 2NY0D 4AIXA 2XKNA 1EBPA 1A6WH 1AO7B 1OD9A 4ISVB 1AGEA 4H20H 5TDOB 1T1XA 43C9A 2DMBA 2Y06L 4J12A 4JJHA 1H0DB 3S36L 3PWPD 3GI9H 3X12A 4P46D 5C09D 3ZKMC 3V4UL 1DTUA 3IDXH 4YHIB 1UURA 4ELME 1P9MA 2YWZA 1F3JA 2Y5TB 1NC2D 1BZ7B 3CVHL 4NJAH 4Z7VB 2F53A 1U3ZA 5T1MA 4L4VE 3GMMA 3O6LH 1D5BA 4F7MB 3SBWA 1JGLL 1OTSC 5ENWB 3DMMC 4NT6A 1U6AL 3BESR 1GIGH 2PYEE 3VFOA 1TQCC 1NCWH 1NMBH 5D96B 1KB5H 4LSTL 4OJFH 5IK3A 4KI1A 4LPVA 3QDJE 3OKNA 3BP4A 4GAGH 5FO7A 3ZLQC 4Y19E 5I75C 4XGZA 1KTLB 4Y5VC 4MDJB 1X5FA 4DGIL 5HXMA 1A7NH 4HPYL 4PJ8B 4QXGH 5DVNA 5EO9A 4QCIB 4P9ML 2BVYA 3E1F1 5CSBA 5D72H 4EQ3A 1G7QB 3T77A 4Z95L 5EOTA 2XT1B 2UVFA 2Q20A 3VFRB 3O45A 2V5RA 3MRCA 5E5UB 4Q9QL 1ROWA 1AY1H 3FB6A 3QIWC 4WVRA 2HJFA 3T2NH 3VXRA 4UIKL 3EFDH 3T2PA 2R29H 4PGBA 3CNKA 4AEHH 3JWDL 3VDCA 5T1KA 1F13A 4J1UA 2IQ9H 2A9ML 3V52H 1QVOB 5FUOH 4LDLB 4Y16A 3W0WB 3QUYA 4K7FA 3BDBA 3RRQA 2H2SD 3PGCA 3R4DA 3G08A 5HHXL 3LQZB 3EOAB 4X98B 1LEIA 3C60B 1L9NA 1FE8H 1UXSB 4U0RC 1NUFA 1XMWA 2PO6B 4GAYB 5CEYA 4APQA 3HE7B 3QRGH 4NQDB 2A6KB 3VD5A 1U2HA 5ALBH 2DLGA 5CIPA 1IC1A 4DWHA 5JLZA 1B2WH 5CP7B 2Y1VA 5D2LF 1XGRB 4NCC2 4MZ3A 3RWDB 2CLRA 3HZYB 5E5RB 4ORGB 3LKPA 4K3JL 2C3XA 5D1XA 1IT9L 2Z9TA 4CMHB 5DJYA 5IJKC 1NCBL 3OKEB 3HG1D 4W4OC 3ZE2E 5J11C 2BDNL 4BFGA 4PJFF 2R4SL 2ZUUA 1CGWA 4GMSH 3IGAA 4G8FA 2IMNA 3QO0A 4F7EA 4MAUH 3MODH 1YEHH 5DZLA 3WKMH 5MEPA 1ZGLP 1ZSDA 5DD0L 2JJTC 4X0KB 3SDDD 4N8CH 3B5HA 2ZUQB 4C59B 1FFNB 1QTYT 2ZUVA 3KPQA 3P73A 4OZIA 2FHCA 4ZQKA 4G42B 1MFCH 5DJ0B 1C12A 1DVFD 1GH7A 3DARA 1P4LA 4RGOH 3RTQA 5CBEA 1CCZA 4GRLB 5E2WH 1CGSL 5E24E 3VU2A 2Z8WC 4Z77B 12E8L 2BX5A 3JVGA 1N6QH 4Z7WE 1A1NA 4NCDA 2CXGA 3OKDA 5HVGB 4RMTA 3L7EB 3PP4H 3BGMB 2DQEH 2VR9A 4YHKL 5LXGH 3A6CH 1GC1L 2C9AA 4XTRC 3U0PB 3EDKA 2AEQH 3CX5K 2WWMD 3K4DA 1IGFL 1QYGL 1XF3B 2LU4A 2R1WA 3B2UD 3DX7B 2X4RB 5EA0L 3ZKQD 4WHYG 4UB0H 5F7DB 4NCC1 4PJGB 3NACH 3T4YB 3HLAB 5JPMB 5JA9A 1IGJA 5ITFB 3GSVA 1KGCE 1RSFA 3TBSB 5HI5C 3ULVH 4QRPE 2QSCL 5E7FA 1YA5A 3U7YL 3P30H 3GSRB 5H35A 1U8OA 3U48A 1OTUD 1S7WA 5CCKH 2JKXA 1IFHH 4H8WL 5C0CD 1DBKL 4Y4HB 1RIHH 2NYYD 1OSPH 3DRTB 2AV1B 3I3EA 5KTEL 4KGLA 3QCTH 2D03L 3B43A 4X7TA 3ILQD 5D2NB 1VDGA 3RVWD 5F7LB 1TZGL 1SBSL 1Z0NA 32C2A 2E3VA 2R2BA 3OGOE 1S9YA 3DYPA 1X5KA 3MRDA 4JO4L 3ULUC 2Q8AH 5J4MA 1Y18A 4P2OB 5E2UL 1QBML 1S7TB 4J3XA 3WIFA 2JIXB 4M7LH 5DC4B 5HHPA 4BQ8A 2J8UF 1AD9A 4P99A 3PHQB 3QZWB 3SE4C 4IOSD 4H1LB 4LLAA 2R0KL 5DHYB 5IM7A 3GSNL 1R3LA 3QDGA 1LEKA 5HYQA 2EDFA 3KLDA 5EORL 1KCUH 3TWCH 3IFOB 2Q76B 3FCTA 3W39B 3BSZH 4PJDF 4JQIL 5FGRA 2VC2H 3K1DA 4Y4KB 2EDQA 3BP7A 3L5WA 2DBLH 1RJZB 1XIWB 5I0ZA 3VWKC 4Z5RA 1N7MH 2CLZB 1EEZA 4MA3B 5HHVL 3O3BB 3WFBH 1SEBB 5C0BB 1A7QL 1SY6L 2XZZA 3MCLH 4NO0A 5EBWA 3D85B 4HLZH 2UYLB 1YECH 2LE9A 2R2CA 2X4TB 5HDBE 2JELH 3RIFF 1MCBA 1S7VB 3SY0B 4R2GD 5C2UB 2YD7A 3MCKA 5CD3A 2VOTA 1QSFD 5IKCA 2VLLB 3CD4A 2B1AH 5JW3H 1T6VN 3CSPA 3TN0B 4HLJA 4NQTA 3EBAA 4P2QE 4JGUA 3RPKA 1AR1C 4ODTH 3CLFL 5I19L 4ODXA 2PYFA 3NZHH 2D7NA 1A6AB 2EDXA 4KMTH 2MKWA 1W8OA 3RVXC 3I6KB 2EH7H 3MV8D 5T1LA 1NCTA 2PXYA 3VFVA 4DN3H 5KSAC 3OB0K 3PDOA 4CU8A 2HG5B 2R4RL 2EDNA 4ZS7H 3UTSB 3LQAL 2F54E 4RDQG 4UT6H 1P7QA 4KJWC 4P57A 1AC6A 2FEEI 4FQ2H 5TF1H 4C56D 3O3DB 2XWJB 3QWRD 1HXYA 4M9PA 3HFML 4OD3L 3RVTC 3ETBF 5CMAB 5J12B 4G6KH 4JDTL 1RZJH 1I9RL 1MRCH 4LDOB 2XZAL 4KQ4H 5FGSA 5DRZA 5B38A 2VZSA 5HYSA 1I1YA 3T0VA 2XA8L 3U7WH 2JCCB 2Q8BH 3P4OB 2YRLA 4PJAF 4Y5XC 4LEOB 4EN3C 3UBXB 1FAIH 5BXFA 4NC1C 1P5UA 2CSPA 3Q3GB 5T3ZH 4DKDC 4ETQB 3AREA 1YDPA 4RFOL 1YN7A 1KN2L 4XXCA 4JJ5A 4M48H 4HG4J 1F4AA 2I5YL 4YHLH 3UTPD 2YD4A 3BE1L 5KSBF 5SWZD 2OSLB 1YJDL 2V2XB 3WLWD 4GS7C 5I30H 2VQ1A 2J6EL 1T80A 3H42H 1P7HL 3HB3D 4TRPL 3FONA 2ZZUT 4R8WL 1N3NA 3WJJA 1FJ1A 1G0DA 3LH2H 4FTVE 2I07A 3BPOB 5FGCE 3QR2A 1YNLH 3L7FA 1G9NL 1TTUA 4PB9L 1MWAH 1KIPA 1XGPB 4NHUA 4U1HB 4CU7A 4GJTB 2EDBA 5JUEH 2PW2B 3DJ9A 3C9NB 2ORBL 5T3XE 4Z9KB 1F00I 1FVDB 4PG9A 2V7NB 1D6EB 4HIEA 2V5SA 4ELMA 1T22B 4NO3A 4J8RB 5K93A 5HI3C 4C54A 3PUCA 1G6RH 1NLBL 1YMMB 2L0DA 4PJ5E 1TJHH 3I3DA 4ZG1A 1KEGL 4HGMA 3CFKB 4D0BB 3QT2A 2PYEA 1C7TA 2P8LA 2WK2A 4FMFA 2Z92A 4MCYB 1I9EA 5GQBA 1NMAL 4JM4H 4XZUB 3L3GA 4RWYL 3QDJA 2CUHA 4I5BA 3MA7A 4Y19A 2ATPA 3DVGB 1R3IL 2PTTB 4EQ2A 1EFXD 1MCWW 3WFCH 5KN5A 5JIPA 4D9QE 3CVHA 1RPQA 5J1TC 1IM9A 1ZK9A 3L9RA 4G80A 4G6FB 5HBBA 3IU4H 2ADFL 4PJHB 1K8DA 1AR2A 4D94A 5I8OH 4ZUTA 2BERA 3I02A 4ODWB 1G7LB 1MH5B 1I9JL 4HGWA 5F1SA 1OAYL 3V7AG 2IALA 2VL4A 2HN7A 2XG5A 5TGBB 2BNQA 1HOCA 3WSQL 4OBRA 4L29A 3BEWA 4UDTA 2D0GA 4LBEB 1H3WM 4JM2B 4M3KB 1LO3L 4YFLI 2WBWB 2VLRA 2E8ZA 4G7VL 4LLMB 4BQ6A 3F12A 2RGSA 1RVFH 2FBJH 3QIBD 4XCCH 3KPMB 1O7VA 4KDTC 3QHTC 1EJOH 2NXYB 5ALCL 1AO7E 4YXKH 3T3ME 3BW9A 2DWDB 5DEFA 1GGTA 3B9DA 2QHLA 4KK8D 1E6JL 3ULVF 4BZ2H 7FABL 2A9NL 4HKBB 4UQ3B 3QIUC 1VPOL 4DZBB 5FYJH 2O5ZH 3BHBB 1HWGB 1M6OB 3UDWC 2OR9L 4Z7VE 1BF2A 4XH2A 3RZCB 2V2TA 3MJ8B 4B0MM 1SYVA 5IFAH 3SDXF 1M05B 5F3BA 1FZOA 3KPOB 3S9DB 4OTXH 2YPVH 1ED3A 1WTGT 5C0AA 4EUPH 4BFBD 2CXKA 4QY8B 3VWJA 1JTTA 5DJCB 4HPOH 1CYGA 1PVHA 4J3OC 1MHCA 4YGVA 3FRPA 5E5MB 4K9EC 4X5XA 4OLVH 3HAEG 4C57C 4OCRH 3W81A 4PY8I 4YFLF 1U8LA 1TLKA 1HINL 1JUFB 3TP4A 3ILPB 3E2HB 4Z7WA 3EYFB 4FFYL 4GRMB 1S7UA 1L9MA 4AT6B 4U1LA 3UYRH 3LDBB 3QWOA 1JZ8A 1I85C 5K33A 3W0WE 5ISZB 2C4FT 5IHUL 1K6QL 4HF5L 1I9IL 5J1AA 1MUJA 3O11B 3MLWH 4L5FL 4QYOB 3BKYH 4O02H 4CVXA 4QHNB 4LSSL 4R7NA 1A7RH 4LSQH 4AIOA 3TPKA 1H15A 1ZEAH 4UILH 1EEYA 4NQDE 3RPIB 3OKOA 1KB9K 5KVGH 4U1JA 1KLGA 5I17B 1QR1B 3MXVH 5TQ0L 2X1OA 4AEIH 1U91A 1RK1B 3ZHDA 3MLUL 2AGJL 2HJLA 3SDYL 4O9HL 4AH2A 5H94A 2FX8H 1IC4H 1T0MA 3THML 5HHNA 1I3GH 3ALWA 4R26H 3S88L 4LCIH 5CJ5A 2C1PA 1S7QA 1HHJA 3MSPA 1FDLL 3I84A 3S97C 2QV2A 2B4CH 4N90E 1KELH 4QO1A 2IJ0C 2VXUL 4K7PL 3FT2B 3Q5OA 4NYLB 4DGVH 4UBDC 2DM7A 3KPLA 2DI8A 1PDKA 3KPPA 4JO3H 3EYOA 4J3WA 4FXGA 3HNTL 5D6CA 3TVMC 4KUCF 3T4AB 4I18C 1U3HD 1UC6A 4J3VA 4MCZB 3LD8C 4ZTOH 3FMGL 1V7MH 4IOIB 1TFHA 3HRZB 5D93C 4GKSA 1NFAA 2ZP0T 3RFZC 3QUXD 2G5BB 2ADJB 4YJZL 5MERB 5IESH 1HSAB 2R39A 15C8L 1NBZA 3CC5B 1GZPB 1E6OL 3CUPB 1CWVA 4IIQB 1NFKA 5BW7A 1A6WL 4R90H 5B8CC 4IS6B 4JFHD 3V6ZB 4H20L 4P9HL 4NZTL 2OM5A 2R23B 4KXZH 1QFUH 3L3OB 1GCFA 2HVKA 2JTDA 3GMQB 3RKDD 2QSTA 3GI9L 1FZMB 2HT2C 2ICCA 4FQXC 3IDXL 3SKMB 3MRFA 4XP4H 1OGTA 3WNPA 1KT2A 1DFBH 5F97E 4KK5D 4CN4A 3RAJH 3QI9D 3L1OL 3V0AC 5C0EA 1CDBA 1K3ZA 5E56A 1EXUA 4D8PB 5CBAB 4OM0L 2R2HB 2EE9A 4U3CA 4PJGE 2A0LD 4I9WD 1FL5A 1GPOL 4XPTL 1KG0A 4XCYB 1GIGL 1NMBL 2QADB 1J7VR 1RUQL 4OJFL 2R1YA 1OARH 2YD2A 1S5IH 4UV7H 5AZ2H 3L3IA 2Z91B 2GITA 3PG2A 4GAGL 4LOUC 1EBAA 3HZKA 4CJ0A 3T0AA 3VXPA 1NGPL 4P2QA 5EN2B 4CW1B 5DJZB 1BX2A 5D72L 5D2NE 2X4PA 3O3AB 5IBTL 3U0TB 4U1GC 1SYSA 3WXWH 4Q9CA 1BD2D 2ZCKH 1F02I 3NGBC 4MNHB 4QHLB 2YA2A 3HI5L 2VQTA 4KZDH 3C08H 3T2NL 2F54A 1CD0A 3H7BA 1F3DH 4F9PA 3EFDL 4XPGH 4AEHL 4Q9RL 1CTNA 5DF0A 1CXIA 4F3FB 3O8XC 5C09B 1CFQB 4WJ5B 3QUZA 5HGBB 1H3GA 2F58H 2EEDA 2GCYB 5DJDB 1INQA 3QNXA 2B0SL 5KVEH 4OCXH 4NQCD 5HY9B 4MXQD 1RURH 4LU5H 1FE8L 4X4MA 1IEAA 3QRGL 4HWUA 3A6BH 4WW2F 5ALBL 3GHEH 1QP1A 3MREB 4M5YL 5GS0H 5GZNC 1MRDH 3WJLC 3SGKC 3VXUD 1AHWC 1B2WL 1YQVL 3NVQA 1ZV5A 5C0BE 4MMZC 2X42A 2EC9U 3CK0H 2AXGA 1OP3K 4GBXD 5JZ7D 1OB1B 1FP5A 1JN6A 1H8SA 2EICA 2IFFL 2XIDA 4XWGL 1FL6B 1QFWM 3L3KB 2ZSVA 5EU5A 4ZFOB 2FEEL 3SO3C 8FABA 1H3UA 5E8DH 3NIDE 4FTVA 4JAMA 4PLKC 2D9CA 4PJXB 4YDVB 1AP2A 2OI9C 2HH0H 5LCVH 4HIHA 1J10A 2NY3B 4MAUL 3MODL 3WFEH 4WGVB 4MAYC 1YEHL 3WKML 5D7LB 3T1FB 5EDXA 3MRRA 5L2JA 4PP2B 5EOQH 4QEGA 2O93L 3MBEB 2J6EA 4QHKI 3O4LD 3VFMA 1CFBA 2QBWA 4ALAH 5IVNA 4GQPH 1X7QA 2RJMA 5F1KC 1MFCL 4X9GA 2FL5A 3MTRA 1NKRA 5SWSB 3BN9D 4PJ5A 1WWWX 3UTSE 3D2UB 3O9WC 3RUGB 3TNMB 4FHBD 1TENA 2EDEA 4TUOB 1LO4L 3EYQC 4JHZA 4FQCH 1U95A 3OB8A 4D0CA 1Q9LA 3K2UH 3DX9A 4OQTH 4JPIB 1ETZB 2DQEL 3ME0A 4L8SC 5IMMA 1UJTA 5LXGL 1BGXH 5EZIH 1SEQL 3WS6A 4G9DA 1JBJA 4ENEC 2JCCE 4XC3H 4OGZA 5DHVA 4FG6D 3MRIA 3S4SA 2XPGB 4OZ4A 2X7LB 4P2CG 3PP3H 3NACL 4NWUL 4KKBD 1A7PH 3BKJL 5J89A 4KRPD 3VMPA 3K4ZA 1HEZA 4XMKL 5DI8A 1IL1B 1FNSH 2EYTB 4RQQA 3H0TB 4M3JA 2IPUG 3CFCH 4K71C 2VE6A 4GXUN 1IFHL 2OS7A 4JB9H 5EG6C 4XVSL 1NFIA 4KXZI 4PLNC 3SDDB 2VZTA 4P5KA 4KY1H 3EYUH 3KPNA 2MQ3A 4OGYL 1B9ZA 4K8RC 4BYHA 1QFHA 5C08A 1I8KB 1JGDB 5IF0A 3RWIA 1DVFB 1YEDB 2XY1A 4WEBH 1YC8A 1AO7A 1JFQH 4ISVA 4OI8A 5TDOA 3LSOB 4OD1H 1NBVH 1JPTL 1F2QA 1H0DA 1UCBH 4P3CH 3SJVD 3AMLA 3G6AA 4YHIA 3RGHA 3FQUA 4OCLC 1HQRB 2O5YH 4JHBA 4U1NB 2FB4H 1GSMA 3ROOB 6FABH 2WP3T 1H3XA 4Z7VA 2A73B 1FVCB 2NY5C 1BOGB 1YMME 3TWCL 5GXBB 1NEUA 5CLTA 3D9AH 1B6UA 5DRWB 4F7MA 4NNXB 4S0TD 3BSZL 4DQOL 3OGCA 2BSRB 1K2DA 3Q6GL 2YMXH 2VC2L 4HXAH 1C16B 5I1CH 5IVXA 1RZIA 4XNYL 2DBLL 3EW3B 4GQ9H 3VCLA 4NRXA 1IGYB 2DIAA 1KTLA 1OLZA 3DRQB 1RUPH 4MDJA 4OI7A 3C8DA 4PJ8A 2NY2C 1OTTD 2X4UA 4FQPA 3PGFH 5D1ZC 5C8JB 5C0CB 4N0UA 5L2KB 3C87A 4U3HA 3OXRA 3VFRA 4PJHE 3D69A 1VEMA 4C4KT 2JELL 1EMTH 2MSPA 4DN4L 4CVWA 5HVHC 3ZDYF 3GIVA 3QIWB 4FZ8H 3ZTJG 4PP1D 3C5ZA 2VLJD 4F8QA 3MJ9H 5I1KH 5JW3L 3DV4B 3MLZH 4S2SB 1QFPA 5TQ2H 5BO1L 4ODUB 4ODTL 3ECBB 4CAGA 3W9EB 1X5HA 1QHPA 3W0WA 4OGXL 1E4XH 1F4WH 4YBLC 4KMTL 3LQZA 4X98A 3C60A 4UINH 4DUWA 2L7JA 2PO6A 2CRMA 4U6HA 5CGYD 3HE7A 4DN3L 5KAQF 2A74B 4G8IB 4NQDA 1MFAH 3GKWH 4Q0XH 2J4WH 3QDHA 5HDBF 3DWTA 3FT4A 4XCNA 1IRAY 4UT6L 4F2MB 1CL7H 2RCSH 5CP7A 1UH3A 4MWFB 1XGRA 1MF2H 3RWDA 5K9JH 1TZIA 5TF1L 4HMEA 3ROLB 4ORGA 1KC5L 1P4IL 5FB8A 2EDHA 5C0ND 1CG9A 1BJMA 4G6KL 1ES0B 3OKEA 3U0WL 1J1OH 4LNRB 4KQ4L 1REIA 2X9WA 1RZGB 1F58H 4F8TA 3BZ4B 2Q3AA 2ENYA 4IDLA 2WBJD 4JR9L 1FAIL 1GRWA 5LQBH 1MCPH 1B90A 1I1FB 1AJ7H 4NKDB 5FKAA 2V17L 3QXWA 4XC1H 5DD5H 5C9KA 4NO2B 1FNHA 3OF6D 1DANT 5IB1B 1R3KB 1J8KA 3QFDB 4WTWA 5H2BA 4PRNB 5KG9B 2ZCHH 3O2WL 1P9MC 2NCMA 3DUSB 1H3PH 1FFNA 3S36X 2VIRA 5CEZD 3RJQB 5GSRB 1KCKA 3H42L 1LP9F 4ODBD 4ZUWB 3KPSD 4BH8A 1QQDB 3UJTH 5FECB 3GI8L 1ERNA 4WI9A 2NNAB 3LKSB 3MV8B 4FFWC 4GRLA 3SBWC 4BQBA 1EO5A 4GO6B 5FXCH 4Z77A 2NY7H 1HHKB 1MWAL 4GOSA 2V9RA 2L7UA 4KKCC 3ZYZA 4OZGF 1VFBB 3L7EA 5JUEL 3BGMA 5ISZE 1BREA 1G7JB 3SKJH 3U9UA 4P23C 5FYJU 4X4YB 3FQXB 3QUMB 3DTXA 1IAII 1K4CB 1Q9KA 1T1WB 1N2RA 3DX7A 2X4RA 5ICYA 1Y6NR 4QTHB 1TJHL 2UWEA 4PJGA 3T4YA 2BCKB 3I75B 3HLAA 1ZTXH 2XTJE 2HRPH 3IDNA 4WI7A 1EH9A 4ZAKA 3HRPA 4PJCF 2P5EB 4KRNA 1QLRB 1NEZA 5E99L 3K1KC 2DM2A 4JRXA 1FFQA 3L6FB 4S1QH 2NZIA 1EJ6A 1NCCH 2WINA 3WFCL 2AV1A 4Y16C 3QUYC 5D2NA 1BJ8A 3OB0H 5GGVH 2K7QA 1XR9B 1ZXQA 4WFFD 3AAZB 5EO0A 4QXWA 2YC1B 3GBNH 4APQC 1S7TA 4LASH 1Q0YH 2JIXA 1FNFA 2N1KA 2GW5A 3HAEH 2YEZB 3PHQA 3QZWA 4H1LA 1HILA 2IBZY 2VDLH 3MBXL 3TA3A 1MNUH 1NJ9A 1AXIB 2Q76A 3IFOA 1AGCA 4PRBB 3W39A 3SCMC 5D1XC 3W5MA 4DCQB 4XCEA 1RVFL 2FBJL 2CJUH 4M4PA 3KYOB 3KXFA 1EJOL 3PABB 1X5JA 3WHXA 4YXKL 3GRWL 3R8BB 3E3QE 2EH8L 4O58H 3VWKB 4TUKL 3S35L 2DQJH 5T5FH 1JGVL 5MENB 4G6MH 5L8KB 4BZ2L 5IWLA 2CLZA 3FFCD 1KJMB 3O3BA 2DKMA 2PN5A 5FYJL 4CADB 2O5ZL 5C0BA 1G7HB 3X3GH 5IW6A 4S1RH 3D85A 4FNLH 5DGQA 1JPST 5ERWB 3GDBA 2VUOA 4ONGH 1S7VA 1YEIL 1HHIB 3SY0A 5E03A 1PW3A 1UG9A 1G7IB 2K9UA 5D8JL 2QQNL 3GSUB 5DFVD 2VLLA 4V1DB 3RTQC 5JHLH 4ZSOB 2KUTA 4JZOB 1WF5A 2A6JB 5D1QD 3JVGC 2EXYD 4Z0XA 4OTXL 2YPVL 1AXSB 3D0VB 4E41B 4LSDA 3O2DH 2MHAB 1MI5D 5I8EB 3QP3A 1CL7I 1QO3A 2F5BH 1ZLWK 3ES6B 4F33A 5KSAB 2B1HL 2PKDA 3QIBB 5MP6L 1DUYB 2QQLL 2HG5A 4OCRL 3GM8A 1CIUA 1FG2B 3X14A 4DVBA 3TYFB 1PSKH 4HWEL 1F45A 5IBLC 3CLEH 5C09E 1IBGL 3RX7A 4DUXA 5EZJA 3MLSL 3OPZL 3UYRL 2DKUA 2HFTA 2AK4D 5CMAA 3ZKXC 3F58L 1ZE3C 1KTKE 3MV7B 5A16B 3C5JB 2E7HA 1QKZL 1ZS8A 3BKYL 4O02L 1JWMB 2JCCA 3L95B 3MUGA 1ZEAL 4FXLA 4NKOB 4UILL 3UBXA 4HJ0D 4ELKA 3Q3GA 4ETQA 2J88L 3S98A 3A67L 3MXVL 4LHUG 4YH6A 2H2PC 5D9SB 2W1NA 4GSDH 4LLYB 2VH5L 5BRZD 2J8OA 4GS7B 3WFDH 2IAMD 4M02A 1YN6B 1X5LA 5GZOD 1IC4L 2XQBH 2A6IA 4XAWH 4R26L 4LCIL 4PJXE 1IQDB 3NFPB 2B4CL 2BSSB 1KELL 4OF8A 5ESAA 4DGVL 4QLRA 5IMLB 1ZKAA 4U1HA 1XGPA 4PR5A 5DJAA 4JO3L 1H3VA 2NTFB 5I2IB 4KJQD 3RWFB 5D7LE 2IADB 4GKZB 4Z8FH 4N8PA 5E6ZA 5JXEA 1VEOA 4ZOAA 2AABL 3FB7B 5FUCE 2V7NA 1D6EA 1P7KB 2HWZH 1FFPB 2YSSA 1TPXC 3OR7A 1WK0A 1ZGLM 3MRHA 5IESL 3NCMA 4JZNB 5SWSE 1GZQB 3LS4L 2BOCA 3RUGE 3OG4B 4D0BA 2WANA 3UTTB 3WHE1 2X1PA 4EI5A 4I1NB 4PFEA 1JRHH 4R90L 4MCYA 5KVDH 3ZZ1A 1HYSC 3VA6A 4I0PA 4XZUA 3A6OA 2NY6D 3SQBA 1ZVSA 1QFUL 4NGHL 3GSQA 2F8XC 1F6AA 2ENSA 1SVZA 4CJ1A 2Y25A 2FCBA 3DHMA 1WWAX 5DMIH 5IVZB 4XP4L 1DFBL 3RAJL 1J0JA 3B6SB 1XGYL 2XN9D 3IVKB 4KH2A 3CH1B 5DWUH 4ODWA 3LB6C 4X9HA 2PXYC 5CS7A 3JV4B 4R4ND 1OARL 2NW3B 3T2QA 1RUMH 5E8OB 4JDZB 4MJID 4LBEA 5CJBA 3FZUD 4JM2A 5ESQB 4R4BB 4F7TB 5FDWB 4HIJA 4LLMA 2BOBA 5F21B 2XA3A 5D7IB 4P4KD 3LKQB 3TJHC 3MMEB 3MV9B 5DMKB 2MOVA 4OCYH 2AJVH 4XP1H 2QHRL 2VAJA 2DJ4A 1K5NB 3DSNA 1W0YT 3QIUB 3AM8A 3NIFF 3HHRB 3MRKA 1VFUA 1A4JA 3AREC 4UQ3A 1RY7B 2X4NB 4DZBA 4XXCC 1NC4B 1KIQB 4K3GA 5C0RH 3BHBA 1M6OA 4WI6A 1U92B 2VXTH 2A1WH 1UB5B 3H3BC 4UOW0 1ONQB 4R97B 3SE8H 1OGAB 2VDNH 2F58L 3MJ8A 2XNAB 4AL8L 1ZT1B 1NLDL 4M7JL 4U1MA 4DKFH 5JDSB 5KVEL 3QEGH 4OCXL 4NC2B 1RURL 4LU5L 3WJJC 2NW2B 1UKSA 2LTQC 2BVPA 3GBML 1CLZH 3ARVA 4JG0H 1M05A 3JWOC 1TJIH 3DROB 2ARJQ 3A6BL 4WI8A 3OTTA 5C9JB 1XH3A 5GS0L 1RZFH 4IRJC 2X05A 4M00A 5IEKB 1A14H 5C0CE 3AFLA 1Z5LA 4YBQC 4G8GB 5DJCA 3S34L 5L2KE 1IILE 1ADQH 3BPCA 1LK2A 5TPWL 2ZG1A 4JHWH 1UACH 1J18A 4JFYB 3PL6C 5ICXA 2GAZB 1PFCA 3ARDC 4KJPD 3LIZH 4FFZL 3P0YL 3P40A 3IDYC 5DLMH 5IHLB 2R69H 4PV8B 3ZHLA 3EYVA 5LCVL 3ILPA 3EYFA 1CT8B 3R8QA 2Y6SC 4GRMA 5HDOA 1FGVH 4AT6A 2IGFL 4RZCB 1FNAA 5EC2B 5ISZA 1IGTA 5F9WC 4RMQA 3MPCA 3BQUD 2M1KA 4QYOA 4X6EB 2ZG3A 1NANI 4QHNA 4PS4L 4PRHD 4OFKA 1E0OB 3BO8B 3IFPB 3RPIA 5CZKA 2NY4D 4G3YH 4J3TA 3P77B 3J8F7 3HC3L 1QR1A 2NLJB 3MGTB 1UYWH 5D7KD 4FQ1H 1FRGH 1RK1A 5D7JA 3UROR 1UWEH 2VXSH 3NIDF 3IAPA 4OQTL 5FYLH 2UV3A 5DD1L 1OHQA 4NZRH 2W38A 1BGXL 5EZIL 4GBXB 5JPNA 1EERB 4J3UA 4AEEA 2VR4A 4XC3L 4NYLA 5MEQB 3ZT5A 1I7ZB 1OL0A 1QSFE 4EBQH 1MVUB 3OX8A 5FF6A 3TVMB 1VA9A 3GUTA 4I18B 5BV7B 3ARFC 3VI3F 3LD8B 1QD0A 4MCZA 1FNSL 1IAIL 2X41A 5D93B 4IOIA 3HRZA 4LCCC 3CFCL 1KTDB 3IKCB 3HKFA 2DLIA 4JB9L 3HUJF 3CC5A 4U6XB 5SX4H 1GZPA 5JW4M 2I9TB 4KY1L 3EYUL 3MV8E 1N0LA 5IEHB 1RK0B 5E0QA 4OBSA 5B8CB 4Q6YA 4I3RH 3DX8B 4WEBL 4IS6A 1JFQL 4LVOC 3V6ZA 4OD1L 3QFJA 2WQRA 1SJEB 3GMQA 3FQRB 1UCBL 4HCRL 4FQXB 1L6XA 4IRSD 3QUKB 4WWKA 3MGAA 3DYMA 2BVUA 2C5DC 2CIKB 2FB4L 3MROB 3T0ED 1ZT7B 4DGYL 2CPCA 3VWJC 4UOJA 3SO5A 4Z7OE 2R2HA 5CJXA 3D9AL 3Q2CA 2F74A 4YUEL 3KPTA 4YPGB 3FO0H 4HXAL 3GRWA 5I1CL 1INEH 4Y8DC 3HN3A 4GQ9L 3WUWA 1JK8B 2LV4A 2P5EE 2Z91A 2APWA 4W6YB