1GJIA

Crystal structure of c-rel bound to dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
275
structure length
275
Chain Sequence
PYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKIRTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFILCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIVFRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of proto-oncogene product c-Rel bound to the CD28 response element of IL-2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transcription/dna
molecule keywords IL-2 CD28RE DNA
total genus 49
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gjiA02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1gjiA01
3QXUA 2XN9D 4P4RA 5FB8B 1KJMA 4EUPB 2X4PA 1L7TL 4JFFE 3SKMA 1CVSC 4DGIH 3FN0L 5GS0H 2P5ED 4Z7VB 2YN3A 1Q1JH 1DQJA 4NSKA 4XPTH 3S34L 4FABH 3RIAK 4MJ2A 4NO0A 1WWCA 5EO9B 5KOVC 4TTDD 2VL5A 5C0FB 2MCPL 2P24B 5DD6A 4OCWH 4JDZB 5IW1B 1CGSH 5M7QA 4KKBD 4YC2C 2NTFA 5CBEB 1EUUA 2QKIA 4X4YB 2A83B 4LCWE 4O2FA 3I6LE 3RWGA 4EQ2A 4LSTH 2Q6WA 4HWEH 2R4SH 3D2UD 1EUTA 3DRTA 4NZUH 1U8LB 3MREA 2X4PB 1QSVA 2GJJA 1TJIH 3KPSE 5GGUA 5FA3A 4BH7A 5DHVB 5GS2H 5L7XL 4HFUL 2J2ZA 4YGAB 4WO4C 4KPHL 3FJTA 4H26B 4D9LH 5J8OA 4UOW1 2GW5A 1WEJH 5ISZD 4HJGB 3FRUB 3G6JA 4OD3H 5GQBA 5JW3H 1F3DH 2H2SC 1PZ5B 1P2CA 2D0HA 2YMXH 1IC5H 5T3XD 2QHLA 1HN1A 1OW0C 3ARBB 1UJ3A 1QLEL 1NMAL 4HWBH 4P59H 4OM0H 3WN5C 2MHAB 3KPPB 3ZHDA 5BQ7A 4QHMA 4QXWA 3CD4A 4NCC2 5IVNA 1RIVH 4Z7UE 3EJZD 1KCRL 4IOFC 1G7LA 1CK0L 4JFXA 1U8JA 4KC3B 2J8UE 1JK8A 5EUKB 5F7LB 4L3ED 2ZUQB 3NIFF 1ORQB 3U36A 1YNTB 1FNFA 1EHXA 4JHWH 4I13B 3TFKD 3NCYS 2V7HA 4ALAH 5FDWB 3O3AB 4LPCA 5EU4B 5C0CB 5F88A 4F7MA 1AC6A 2EYRB 2NX5D 3ZTJG 5KS9E 1U91A 1W0WA 3HAEG 4FRWA 5I1CH 1RUQH 4PJDE 1MHHB 4PRPA 2EDEA 4JFOA 2VDPH 4WFFE 2NY7H 5DUPL 5KS9F 5DVOA 1MIMH 1DVFA 2XG4A 2A74B 4CL7A 1S9XB 4PJDF 2XKUA 1NFIB 1TITA 3P3YA 3SY0A 1WBZA 1KCKA 1KENH 2NY4C 4JVPA 5FK9B 3QFDA 1WZKA 1KPVA 3PHOB 1NFDE 2DQCL 1KLFA 1A64A 2X4NA 2WWKT 1EMTL 4PP2A 1AY1H 3RY5A 4PRPE 3ARDB 5KOMC 1NKRA 3J7HA 4JM4H 1T0NB 4JRXB 3RY6C 2Y4SA 3A6BL 5LWYL 4QYOB 5CCKH 3VFWA 3MFFA 5DEGB 3WS6A 1A66A 1EH9A 1Z9MA 4JQVC 3ZE0F 2B5IC 3CSGA 2JIXB 1NBYA 5M95B 4BH8B 4OV6F 5TE7H 2Q7YB 2CLZB 5HHXL 4JPIB 1Z9SA 1ZTXL 3E8UL 4ENED 3HG1A 2DI7A 3OKNA 1X5GA 1BQHA 1GOGA 3HFML 5BW7A 3JWOC 4O9HL 1DLHA 2BP3A 1Q0YH 4PFEA 4BQBA 4PJIA 2RFXA 3BPCB 4R26L 3PQYB 3NFSL 1YEHH 4FFZL 3HNTH 4O51A 2XQBH 1A7OH 3NABH 5DD0L 3S37L 5DLMH 4JQVA 4GAYB 5CIPA 4YR6A 1RZKH 2XWBA 4MNHA 2C7UB 2HT2C 4TSBH 3VXOA 4JFPB 1U8QA 3E3QC 1QFHA 3VWJD 2GTWA 5KVFL 4F8TA 2VZOA 5IOPA 1GZPB 4KY1H 1KN2L 4PREB 3NIFE 4S10A 1SMAA 2NZ9D 4NC2B 1CLZL 3JVGA 3MNZB 3U2SA 3QEQE 1JGVH 5F96H 5JORB 2OI9B 5DD1H 3DO3A 1EFXD 3BZFA 1IC1A 1MAJA 2FD6H 2VUOA 4I3RL 4XPBL 3VH8G 1HCFX 3QIWC 4MCYB 1GPOL 5ESAA 1DQTA 3BW9A 3UYPA 1UH2A 1IAIH 2EXYC 4X4ME 3ULVD 1X4ZA 2HFGH 1JGUH 3ARWA 1IM9D 5DXWA 4NRXB 4NT6A 2YHGA 3EGSB 5IESL 3QUZB 4YHZL 5IV2A 3H3BC 5SWQB 2CJUL 2P47B 3ARBA 4PRID 5DQ9B 4RGNB 1BFOB 3ZSTA 2B4CC 2Q7NA 1RZGA 3LKOA 5LBSH 1IGFL 15C8H 3DV4B 2X7LB 4G6MH 3VDAA 3L5WB 3MLYH 5MEND 2ITDB 4N0UE 5CAYB 4NBXB 5HD8D 15C8L 5D1XA 3SKMB 5EPMA 4W6YB 4F9LA 1S3KL 3GIZL 4KUCF 3GSVB 3W11D 3WUWB 4LLYA 3AS1A 5FKPB 1ZHKA 1X5AA 4I3SL 4Y1AD 3GO1L 1CLOL 1DLFH 3HZVB 3O6LH 1QQDB 3D0VB 3TJEL 3VG9C 1MFBH 3FTGA 4XP9H 3QG7H 4GRMB 2NTFB 5CD3A 3FCTA 1F45A 4D9QE 3C6SA 3LKRB 1G0YR 3NOIA 4MB3A 3VWKA 1G9ML 2AI0H 4TTGA 4PTUA 2PYEB 2WUBL 3KXFB 1KTKE 3U6RB 3THMH 2NX5B 4I0PD 3CDCA 3GUTB 4APQB 1UH4A 2N7BA 4DCQA 2DQIL 4FN0A 1ZLUK 2DYPA 4WV1A 2UWEE 1LK2A 3ISWA 1ZANH 4M02A 1UWGH 4YHIA 4G6FD 4OQTH 5JLZA 3OPZH 5KSAC 2EC8A 2XQBL 1JGLL 3ARED 3PL6A 1W2KT 4PJ9A 5IFJB 2WLZA 5EIIB 1IZKA 4OZHE 2IJ0C 3G9AB 1ZLWK 1WFTA 5E9DD 3IFOA 5DK3A 3BZDA 2BMKB 4O9HH 4UILL 4YHNB 2C9AA 5ID0B 1MUJA 1MJ7L 4GMTL 3X12B 4UTAL 1ZTXH 2HJFA 2X4QB 4CUCA 3TBTB 4YJZL 5GZND 2F74B 3ARDC 4JFED 3GSWA 3MV7E 4BZYA 2HTKD 2W38A 2FZ3B 2ZCHL 1MCQA 1EVUA 5F9JB 5FV1L 4NKMB 4I5BA 2ESVB 4NKIL 4D94A 5I1HL 1RZJH 1Y6KR 1NCCH 4KTYA 4NN5B 3SGKC 1BLNA 2DICA 1WWBX 5IM7A 5D9SA 4YBHA 5HVHB 1KGCD 2OSLB 5I30L 1I7UB 3V6OA 4GLRH 4ORZC 2QSVA 4G80A 2FX8L 1J7VR 1OD7A 3AREA 3BE1L 3BN9C 4K7PL 3VFVA 5LQBH 2LVEA 3QUZD 4AEFA 3C5ZC 1WC7B 5DD5L 4G8FA 3UO1H 4LPUA 3UP1A 4G9FE 3HAEA 3AUVA 3DGCR 4YO0B 5D7IA 3ZKMD 2P7TB 1LE5B 3OTTA 2JJSC 2Q8BL 1MIML 5HHNA 1YY8A 5E56A 4RBPK 4P99A 2I07B 2D3VA 2F5AH 1WCBA 1S7TA 3RWDA 3OKKA 3W9EA 3BW9B 1UXWB 3FFDB 1ZSDB 2XN9B 1G6RL 1J1XL 2XKSA 4LSVL 4X6DA 5D7LB 2XN9E 3WHE0 1MJ8H 2XTJB 4V1DE 5T3XL 5DJCB 4RFEA 5JW4N 3TH2T 3ZDXE 1SJVA 1U58B 3LN4B 1NEUA 2YRZA 4ZS7L 1U58A 4NHCL 1RUKL 3IFNH 1RIVL 4F80A 1NSNL 2L4OA 3QDJD 4OUUA 2X70B 3BGMA 3AAZB 3KPRE 4HZLA 4F57L 1QLEH 4JJ5A 3H42H 1A7PL 2AK1H 2BY0A 2WQRA 3MTRA 1VFAB 2QQQA 2YMXL 3S35L 1WICA 1QQDA 2EIDA 1ZHNB 2NY0C 2HJKB 1RHHA 1CFBA 1LHZA 1AGBA 3ME0A 3VG0L 5D2NA 1RZIA 2VXVL 3MR9A 4NHUB 4RFOL 2JCCF 4IMKA 4S1SL 4GRLC 5IR1A 3VH8A 4WTXA 3WFEH 3IDMA 1M7IB 4HMEA 2XYCA 1JFQL 1YZZA 1SYSA 2ARJB 5HDOA 4BUHA 1DBBH 1G7IB 3RWJA 3MNVA 1OAYH 4I2XB 3WKNA 2C3VB 3SPVB 5KSAA 1ZS8A 2GHWB 5FUCE 1EXUA 5I9QC 4OZGF 1VGEH 4ZS6D 2AV1A 4QT5B 4WEMB 3PABA 2OJEB 4XNYL 3T2OA 3SJVB 4JREC 1EFXB 4K23L 4IRJA 2VKWA 3BO8B 2G5RA 5IKCB 3K7UA 1VADB 2VQ1B 2XT1B 1ERNA 2F54D 3GHBL 4L8DA 5J06A 5AZEH 1VERA 5I73C 4EQ3A 4J8RA 4NNPL 3T3PE 1P1ZA 5FEBA 2ZSWB 4RCAA 3SGEH 2FX7L 4QKXB 4XCEA 2NY6B 1QBBA 3KG5A 3S35X 1TIUA 4Y5VA 3Q48A 2EDKA 5MENB 4XPAL 5ELIA 2Z31A 1RURH 2Q20A 3FAWA 1WFNA 3WXWL 1WITA 1UXSA 4NFBA 3VMPA 3F58H 3QG6A 3HRZB 4PIRF 3DURA 1FNSH 1JRHL 5DI8A 5I8EB 5C7XL 1DFBL 4PJGE 5JMRA 2NXYC 1U93A 1R24A 1YEDB 3DOSA 3QIUB 3TN0C 1CLOH 2BXZA 4O2EA 4UU9B 4JHBA 3FRPG 25C8H 2DIAA 5C9JB 1ZHLA 2Z35B 4JFYA 5E08L 4MD4B 5L2JA 2Z35A 3P11H 4PRDB 1FFNA 2AVGA 1MAML 1A2YA 3TWCL 1W0VB 1RK1A 3V8OA 1FP5A 4K71B 2HN7B 2YZ8A 2Z0BA 3FN3A 1F13A 4OIIL 1IAOB 3JBG7 3L3DB 5ISZB 1NCWL 2O5YL 1TLKA 3OAYH 2R56L 3MBEC 3EHBD 3QQ3A 3QR2A 3ZKXB 3EYSH 4DOHE 1SJEB 1WAAA 4XNUH 4YFEA 3IDXH 3GHEH 2BSSB 5IFHL 4KKBC 2BSTB 1NDGB 3IKCB 5T3ZE 2ICWI 2UV3A 5E24E 4X83A 4Z0BL 4UQ3B 5DVLA 1J10A 1OL0A 4YDKH 3DUHA 1KBGH 2ZOLA 2DJUA 5SWSA 4L8CA 1H3UA 1LDSA 1KTDB 5CEZH 5CP3H 1NUDA 3KAAA 1HK6A 3Q3GA 4EDWH 1B4JL 3BI9X 2OZ4H 5TH2A 2MKLC 1Z5LA 5C0RL 1YNLL 1YJDL 1YJDC 4JVUA 1V3MA 3KLAB 1YPZF 5JNYA 1I7ZA 3JTTB 1EEYB 4AY0A 1LGVA 1VKXA 2H1PL 4M7ZB 1KJ3H 5IQ7H 5LKNA 4NGHL 3QQ3B 4OB5L 4AT6B 3RNQA 2P5WB 3ALPA 1ETZA 5CEZD 4JG0H 5E8OB 1RIHH 5E8OA 2YD9A 3HS0A 1CVRA 1ZAGA 5GRUH 3VGFA 4LRIC 4U6TA 2A6DA 3ETBF 1A7OL 4LNVA 2CK2A 2YWYA 4X5LA 3GMNA 1L7IH 5CS7A 3UDWC 2IBGA 1AXSA 4XNXH 5L8JB 3MRQA 5MEPA 4B50A 1W72L 1SM3L 4J1UA 4FP8H 3AS0A 1MLBA 2E27H 2OL3A 5EUKA 4OLYH 3QHZL 1Z5LB 3LVEA 4FQXB 3SDAB 4E42B 3V4UH 3TBVA 2O61B 1E4KA 4Z9KB 4NQDD 4NQEB 1C5CH 4KTDL 1FFPB 4JRYD 1ZT7B 3PE9A 1H15A 5CEXB 5TE7L 3LV3A 3KS0J 1RIHL 1HHIA 1NMCC 3QRFM 2EE2A 3KXFE 2X6MA 1IC4H 4P9ML 4J3UA 4TUKL 4OZFG 3E6HA 3BAEH 3E2HC 4YAQB 3B3IA 4LNRA 4R7DB 5C07E 1XT5A 3KYOB 4Y1AE 3C5ZA 4P46D 1B0RB 2NW3B 1RUAL 1MCDA 4PY8J 3UTSE 3TA3D 1EMTH 1KEML 5T5NG 1IAKB 5EC1B 4Z77B 4DVBA 1FPTH 4IRSC 1ED3B 4LFHG 1DLHB 1V7ML 2ADGB 4NRZB 5JHDD 2BHUA 1I85A 1TFHA 3QNZB 3MGTB 4Z0BH 2ED8A 4E0RB 4PV8A 2JJTC 5JORA 5F7KC 1XGQA 3SO3C 3QDHA 4ODVH 3NPSC 4OCRH 2YKLH 3BGAA 2IGFL 5HHMD 1NBYB 5AYUH 4RDQF 4NWUH 3PABB 4NO0B 1Q9LB 2R4RH 1MLCA 4Y88A 4MHHG 2NY6D 4KVNH 2FWOA 3FO2A 4HT1L 3H3KA 3MRPA 1JHTB 4QHNB 5I1AB 1AGDB 4W4NA 4YEEA 3MRPB 4MJ5B 5DQ9A 5HDQL 3QA3A 1G84A 3TO4C 3P11L 1RZGB 4U1LA 5E2VH 4XRCB 3ULUE 3CNKA 3GRWA 2MQ0A 3O3BB 1QEWA 3HZMB 4ZUTA 3DRTB 5DRNA 4Y2DD 3D87B 1KIPB 2FBJH 2GUOB 2J8UA 5I76A 4P3DB 2VQTA 3SE8H 1H5BB 5C1MB 2B1AL 3F58L 3QFJE 4RWYH 2K1MA 4MA1C 3K4DA 3BQUC 4P2OD 4Z7UB 5T33L 3LPWA 5GGTA 5F7NC 1MEXH 3MX0A 5D7JD 3RX5A 4ODXB 3SEPA 1GZPA 2DLEA 2XICA 3L3JB 4IIQC 5HYSA 4K9EC 1M7DB 1N0XL 4DW2L 1HH6A 5K33A 1OGAE 1WTGT 3NCYP 4QOKB 3EUUA 4BZ2L 4MXQC 1OGAB 2GUOA 4ZNEA 4CAGA 1Y6MR 2J8OA 5IF0B 5L0QB 1T03H 4FXKB 1FCCA 3FL7A 2OJZH 1SJXA 2W59A 5E8EB 4RFNB 5DRZA 4U1GC 4NNYA 3MRBB 1T83A 3OQ3B 2D03H 4LPWA 3S36L 5DRZB 2PW2B 3O6ML 1D6EB 3O3EB 2AEPH 2DYPB 5EWIH 4KQ3L 4NO3B 3ILPA 4LLUA 4UT6H 1WZ1H 1UM4H 5F1KC 1WWAX 4DQOL 5T1KB 3RVXC 4G8IB 4PJFA 4DVRL 2OTWA 4YXHH 4PGCB 4FABL 3L3OA 1C7TA 4DGVH 2EDJA 1FNGB 4CJ0A 1CXIA 2F54A 5JQ6L 2VXUH 2ZG3A 1P7KB 4LLVA 5C08D 3MUZ1 4Z5RB 5L88L 1H3WM 1S5HB 4TVSa 3QWOB 4PP1D 3ARGA 2X1XR 1IEBB 5JOPE 2D2OA 4GW1A 5D2LB 5JNYB 1MCWW 4GW1B 4NKMA 3C8KB 4QRTB 2ESVA 1DZBA 3V6OC 4R90H 4P4KA 3HMXH 4RZCB 1FAKT 1PX4A 1OAKH 4MLSA 4I9WD 2WIIA 1N6QL 3VXPA 1FNGA 4QHMB 4HUUA 5I8KH 1P9MA 3BKYL 4F7CB 4JZOB 3BDBA 2AK4A 3DSFH 4EN3B 1MFAH 4FQ2L 4GRLD 5TDPB 1RZFL 2UWEB 1YMMA 2YPKB 5C6TL 4M48H 4HDIA 4Z6AT 3PV6A 3QPQC 1UCBH 1UM5L 3O2WH 2H6PA 3VXSA 1P5UA 3L1OL 5F6IB 3TP4A 5C0JA 2AK4E 4ZFZB 4MJ4A 3GJFH 3KPNB 4AJ0A 4PV9B 2IBBA 1TNMA 1GGCH 4JN1L 1J05B 5CP7B 5SV3A 5EU4A 4N8CH 2JLLA 3E3QE 1OGTA 5TE4L 3LY6A 4QRTA 4HG4K 1TTGA 4YK4C 3ULUC 3QUXC 4HUWA 4LLAA 2DQJL 1D5XA 4B7LA 3GMQB 4QXGH 4M62L 1T89A 3CDGB 1J0YA 2NXZB 1S7RA 2OP4L 3JTSA 3BD5A 5I1LA 1T1ZB 5E8PB 1HZHH 2X1PA 4E9LA 5I66B 2DDQH 5INCA 5E2WL 2E7HA 2CLZA 1KUMA 1T5WB 3MA9H 5LXGL 4PG9B 3WIIL 3RWCA 3KPOB 2AJYL 1P7QD 2LVCA 3LKNB 3V2AR 1OTTC 2DIBA 5HGHB 2R39A 5TJWK 4E5XB 4HIJA 4P9HH 3V52L 3ZTNL 1YEEL 4NKOB 4ELME 1DDHB 5GGVL 3DUSA 2JELH 1A4KB 1B6DA 3GI8L 2DQEH 1NL0L 2AXJA 4JN2B 4M7LH 1S5IL 3VI4E 1N2RA 5KSUA 4YDJB 3M8OH 3V5KB 1QSFD 4L4JA 5L8LB 1IM3B 4X5WB 3I75A 2BVOB 4U6HB 3T2QA 5A40E 4KKAC 4H20L 2AJZA 4JPWH 4GXVH 5AEAA 4L4TE 4CMMA 3F7YB 2HJKA 4LLMB 4X4XA 5DSCA 1QSFB 2DYPD 3UZQA 3TBSA 43CAA 2ADIB 2DKUA 3P0GB 3H9SD 4Y5XC 4DEPB 4HF5L 4U1HA 1JNHB 4XBEL 3L3JA 5T1LA 3RVTD 4ZUWB 3IJYB 5ANME 3GFUA 5FO9B 2R2CA 2VDRL 4YXLH 1E6JH 1PG7X 3WJLA 4GG6F 1PEZA 3ILQC 3R1GH 1EXUB 5LGJA 2Y07H 1RULH 4WCYH 2V2XA 2VOTA 3MFFB 5FUOH 1HXMA 3EJYD 4ODHH 1BD2A 2RB8A 5D7JB 2Q8AH 4P2RA 3O2VH 4DZBA 1IM9B 2Y5TA 4ZYKB 4Y4KB 5F9AC 3GSQA 2I9LA 1HYSC 4HJJL 3KLSA 3OG4B 3NCCB 3BPLC 4KZEL 2PTUA 5ANMB 5I8EA 1H3VA 1IQDA 1LNUA 1ZK9A 5HGAA 4GT7A 4ZUWA 4TSAL 5DC9B 1OTSC 4ZAKD 1PQZB 1TZIA 5ACMA 4U0QB 4G3YL 3ZYIA 3ARQA 5TGBA 1FE8H 2CIIA 2NXYD 5EOCL 5T1DH 1C5BH 2V17H 1XGUA 2VL4A 4V2CB 2NPLX 1YEGL 2VITA 4L5FH 5AZ2H 3TN0A 4FFYL 1XZ0B 4HGWA 4PB9H 3MROA 5A2IH 1JVKA 2H9GA 4CKVX 3N85H 4NNYB 1AGBB 1LEKA 2QTEA 3NA9H 4RGOH 3GBML 4LVHC 2EDXA 1ACYL 4OLZL 2HJLB 3BVNB 3GO1H 4Y4KA 2ATKB 1NAMA 3BPNC 5ECJE 5E00A 3HR5A 4ELMB 2B1HH 3DIFA 3GSNL 3GIVA 4IJ3B 1GZQA 3ZE2F 3MLRL 4JKWA 1GZQB 4OGZA 1P6FA 5HHPA 4JCLA 4PB9L 4UU9A 3PP3K 1DUYB 3B6SB 3HAEH 1AO7B 3SDCB 4KK8C 3WKMH 4MXWL 4EI5A 3UTSA 4BFEA 3K3QA 2F54B 2EC9U 1FVCB 4Z8FL 2IADA 4MYWB 4NN7B 2R8SL 3B83A 1TTFA 1BJ1J 3B9EA 4POUB 3G5VA 5CZXC 3S88H 4IHOA 1TMCB 1XF3A 3TN0D 3DSNA 4KVCL 4LCCC 3O4LA 1GPOH 4N5UA 4RAHA 1UA6L 1YEKL 3MV8B 4TN9A 2HJLA 3BVNA 1NC2A 4LCUB 3U4EA 4OCMC 3WLWD 1J1OH 3CGTA 4MNGE 2UY7A 3D85D 5F9WC 3KJ4C 3DXAE 5F96L 1AGEA 3VFTB 1Z6JT 2UUDH 4NOBA 4TSCL 2OSLA 4L4VA 3MREB 1QKZL 3NZHH 4WCYL 4MZ3A 2IALA 2UWEA 3FFCD 3V6BR 3U7YH 4BZ1H 1RMFL 4XCFH 1I1YB 1U8NB 2BXYA 3O8XC 1ZVSA 4IMLB 2A73A 4E5XA 2Y6SC 1ADQL 3ZT5A 2BERA 4O58L 3OHXB 1U91B 1F4AA 1BVLB 4U1KA 2EICA 3GMPA 4D8PA 2Z91A 3NABL 2B2XH 4U33A 4JZJB 1JNNL 3E6FB 2IANB 2HT4C 4FFZH 1U41A 1IL1B 5TDOA 4H20H 3CDGA 3PDDA 4OCXL 4R26H 1U8HA 5HBBA 5EO1A 2FHFA 5E7BA 5I75B 3O4OB 1P7KA 3JVGC 4X4XB 5DSCB 4EN3D 1RI8A 4GW5B 4PJAB 2HJFB 3ILQD 2X40A 1WT5C 4Y19B 5EZIL 3ZL4L 2FIKA 4HIHA 3O0RH 2PUQT 3O6FA 4XNZB 5FYJE 2MFNA 1JN6B 1QFWL 3TNMB 3U46A 4PGDA 1UYWL 4S1QL 1QOKA 2WQ8A 1JMZA 2AJYH 1DUZA 2DD8H 5D7SL 5EZLA 5CCKL 5FGSA 1HHIB 1OSPH 1F3DJ 2BY2A 4WNQA 4YHKH 5A16A 5SWZB 3DBXA 3ARFC 4WUUE 1BIIB 4N8VG 4AIOA 5FGCE 4BQ9A 5BXFB 5INCB 4KKLC 4CVZB 1S9KC 2Z8WC 2ESVD 4D9QD 4EUPG 4U0RB 1EAPA 5DDHB 3FOLB 3OKEA 3GJFA 1HQRA 4BSJA 3BQUB 2OBGA 3MRCA 1SVCP 1OAZH 1N5AA 1WV7T 3DGGB 4XAWL 3ZDZF 5HSFA 3L1OH 5F9JA 4LK4A 5TQ0H 3MUHL 3UJTH 1UB5A 4X98B 4EI5C 3RVWC 4G6AD 1D9KB 1ZVYA 1JBJA 3HKFA 2VZVA 1DQJB 3IYLW 4NSKB 1ADQA 1BBDH 4QTIL 2O26U 3MUY1 4Q6YA 4JRXE 1CDYA 3GMMA 3PP4H 1NANI 2PCPA 1OAKL 3OKOA 1QSFA 2E9IA 2QQNL 2ADIA 4D0CA 3MRIA 5ILTH 2W60A 5I1IH 4PRBB 4RISH 4R4BA 4Q6IA 3TBYB 4URTB 4NHUA 4I18A 1GGIL 5KSBB 3SKNB 2GYSA 2DMKA 3PGCA 3HPJA 2I9LB 4ZUSA 1A6WL 5FXCH 4UI2A 4P5MB 4CMHB 4HCRA 5L88H 1BQHG 4NUGL 3QDAA 5TPWH 3RVXD 3JV5A 4WDIA 5DUMH 3SO3B 4P59L 1LO5B 5B39B 1WIUA 4NCDA 4N0CC 2YPLA 4N0UA 4UDUB 3NCJL 1T1XA 4ETQA 4I48B 4I4WB 5H35B 4ZDHA 3BP4B 1AD0A 1K2DA 3A6OA 3O8XD 2VABB 4GXUN 3S9DB 1JGDB 4D9LL 5I6XB 2VL5B 4MGXA 1J0IA 4XI5D 4LQFL 3TEUA 4OZ4A 2AEPL 2A6JA 1VPOL 2NNAA 3ZMRA 5F1NA 3MNVB 4GRMA 3QI9C 3DIFB 5IIEA 4JPKH 2W07A 4Y1AB 4WTZG 4G8EA 4QNPE 5GJTH 2BNRE 1IMHC 3VGGA 3KPRD 4TRPH 2DQFB 5KAQF 1YQVL 4S2SA 4EN3C 4WHTB 1MWAA 1MJUH 3VRLF 3OL2A 4D3CL 1CGSL 3MROB 5ENWB 1N0XH 4NDMA 2NYYC 1W8NA 4J3WA 4L3CB 4PJHE 4HS8H 3G5ZB 4WW2C 4MAYA 1RZ7H 1IGJB 2YD1A 1J8HE 4H88H 4HJGA 5T33H 3GMPB 4D8PB 3SDYH 5IK3B 3VI3F 4DGIL 3R8BB 5SWQA 4JHAH 1YYMH 1I3RA 3LKPB 5FUZL 1LD9A 3IJSA 5ALCH 2YUWA 4G8EB 1DSFH 4LCIH 5EC2A 2Z8RA 1ZEAL 2FNBA 2I25N 3V6ZA 2J88H 1A6WH 3OF6A 3W0WD 5TDNB 1IGYB 5DRWB 4EDXA 4JFXB 4NC1C 3N1FC 1MFCL 4LHUA 1KJVA 4XCCL 3WNLA 4L1HA 5BMFL 3VFPA 3AMLA 3NAAL 1XH3A 4OZHA 3RX8A 2CSPA 2IAMC 5JR1H 2JJUA 4CN4A 2V9RA 4J6RL 1NANH 2DWDB 5GXBB 4PS4H 4XMPL 3LD8C 3HHRB 1FG2B 1OQOA 3PIQA 3RKDC 1RQ5A 4IS6B 5ABDE 1T21B 4Y4HA 3QFJB 2HFEB 1A1NA 5C0CD 5BO1L 3HNVH 5TQ0L 1NBZA 4ENEC 2MSPA 1BFTA 5EO0A 3GGWB 3MGOA 3V4VH 3AREB 3C60A 2CR3A 3CFCL 1T7ZA 5DTFA 1KJVB 1V7MH 3OAZK 4XWOD 4CW1B 1UH3A 3G6JF 2BRRH 2W0KA 1P7HL 3O4LB 3U36B 1B3JA 4N90D 3X13A 1X7QB 3MXWL 4X99B 4YQXH 4XP1H 3DTXB 2AEQL 3F62A 5E2UH 5MEQB 3RKPA 4LSQL 1U93B 4OGYH 1CTNA 5T3ZH 3UBXG 5IMKA 4LASH 3DPBA 3ROLA 2PYEE 4X6BA 3PHSA 5GIRB 5C0EA 2AJXL 4LEOA 3AU1A 2BNRD 3HZKB 4WRLA 3V0VB 2CUIA 3BX7C 5E6IA 2JIXD 3ES6A 4NQED 3U46B 4MDIA 4O5LL 3TO4A 3LEXA 3QHZH 2W0LA 2YA0A 2DAVA 1CIUA 4JFFA 1T2QL 4XXDB 5JOFA 1F90H 2XQYG 3HN3A 4ZPTB 1W72H 5DF0A 3RZCA 3RPIA 3PWVA 3EFDH 4XNXL 1R3LA 3V5KA 1RIUL 1QLRA 3NH7H 1L7IL 4KWUA 3NIGE 1WUNT 3G6AA 3MXVH 4LF3B 1KCUH 1FZMA 4Y4KC 2QR0B 5EN2B 5TDPA 4R4NC 4LEOB 2OK0L 4RRPA 3QULB 1WC7A 1BJMA 5GIRA 5E95B 2BOBA 3ZKXC 4BA8A 4TVPL 3LKNA 3NZ8B 1RMFH 4XCFL 1RJLA 2A38A 3NZ8A 3MCKA 4C83B 4ISVA 2W65B 4Q9QH 5JDSB 5T1LB 3IXTA 4TNVK 1FH5L 1YNLH 1QKZH 3NZHL 3RNQB 3CC5B 4KHXL 4KK9C 1PAMA 2DTML 5EU6D 2EO9A 2VH5H 3GK8L 1HKLL 3IDIA 3ARZA 2IFFL 2VERN 3PHQA 1T4KA 3FMGH 4KHXH 2FHBA 4ZODA 2HP4A 2UYLB 2P24A 3ARFD 3TJHD 1RHHB 1FH5H 4WFHE 5FYKH 1DQLH 1KIRA 4Q9QL 3EYSL 2PTVA 5D96B 4Y5YA 4HS6B 4GQ9H 1DR9A 3MRRB 3QT2A 3LS5H 7FABH 2GKIA 1VEPA 1T1WA 3BDYL 8FABB 1IAIM 2X4UB 5BS0A 4FTVB 4P23B 3VXUA 5EORL 5F21B 1KB5L 5HGBB 1TJHL 4AL8L 1QRKA 4OM1L 1S7WB 5IGXH 3ROOB 4B41A 5IEHA 3TH4T 3JXAA 1S7QB 4X9GA 2NY3C 5IMLA 2AABL 1AR2A 1UJ3C 4EOWH 2PO6C 4OLZH 4PP1C 1CT8A 1BOYA 1JUFB 3T4AA 4QRPD 2HT4D 5D6DC 1LO0L 2A6JB 4XGZB 2XG5A 4Z78B 3HR5B 3PWJA 4Y5YC 4YNYA 4PY7B 1WBYB 5GGSB 1L0XA 3GDBA 3WXWH 4EXKA 3WFHB 2D7TH 2Y36H 3QJFB 3Q1SH 3WFHA 5DQDH 3DHJA 3LKPA 1IT9L 1NUFA 3SDCA 4QWWD 5CSZB 4XNQB 2QQLH 4QRPE 3VXUB 3RUGE 4J2XA 3KPQA 5J6GA 4Z7VA 4CDHA 2OQJB 5DGRA 1U8IB 1X5XA 4NDMB 1N26A 4CW1A 1QYGL 2YBRB 3AS2A 4QRSB 1T66C 1FL3B 4WTZA 2OTUB 5E6ID 1BD2D 4G9FB 3DURB 4RA0C 3TYGL 3ZE0E 4KKNA 5D1QB 5EU6A 2DMCA 2JJWA 2BY3A 3QA3B 5D9SB 5FGBC 4U7KA 4MD0B 3IKCA 3H8NA 2FECI 1QPXA 5TDOB 1K8IB 2BOCB 1NCUA 3M07A 5F9DC 5HHME 5CSGA 43C9B 5T5NF 2P45B 3KR3H 4F7CA 4N5ED 5JIPA 3D85B 4G42B 3T2NL 5DFVD 4X6FA 1ZGLB 1JMXA 5HDBE 1JTPA 4HF5H 2H8PB 4MAYC 1MUJB 4IMLA 5J57B 4JRYE 3EYVB 5EU6E 3FKUS 2APXA 2V7HB 3GI9H 3JTTA 2DJSA 1BQLH 4U1GB 3L3KA 4YBLB 5KTEH 3LQAC 1MFCH 4XCCH 3TESA 1I4FA 1W72B 3VG0H 1CG9B 3JWOH 1F97A 2CH8A 1IGIH 3NCMA 2QL1A 2DQEL 4KXZI 3WUZA 4WFFD 1XGRB 5DJ2B 3SDDD 3TO4D 3LQAH 1Z9LA 5JUEL 1CQYA 2ZOLB 3ZTNH 1NCTA 3PNWB 2YD6A 1S8DA 3QULA 3N9GL 1QSEA 3V5DB 3OR7A 4PJEE 5ICYA 3LQMA 4DKFH 3BMVA 4FXGB 4LLWB 4CVXB 4PJ8D 4JHAL 4YO0A 1IAII 2DDQL 3ALXA 1PZ5A 3IDYC 2FJGB 2IH3A 3VW3H 4Z7UF 1MCBA 2R29L 3V5HA 1RZ7L 1TZGH 4JR9L 4YHIB 2PF6A 3CXHK 4W70A 3H7BB 3RGVD 4QXGL 2CD0A 1K6QH 4MNQD 3VXRD 5EZJA 3MACL 4XVJL 1I7UA 5F3BB 1C7SA 5TE4H 4N8CL 2N4IA 3EKCA 4KV5F 5H2BA 3F12A 4ZD3H 6FABL 1BEYL 5E99H 1QR4A 4QHKJ 3OV6A 1MCRA 2H32A 5FYKU 1INQA 5DT1L 3R0MA 2Q8BH 1TQCC 3DXAB 2F53E 3GSWB 1B0WA 5B4MC 3QJHB 2FATL 4JFDD 4Z7OF 1J18A 3QXDA 4G6KH 4UV4L 5I18H 1JZ7A 5LAXA 1BQUA 2FJGA 2IH3B 4F7EA 4UQ2B 1DBAH 1MRFL 3O41A 1FRGH 4N90E 1O5DT 1A8JH 2ENSA 4GAGL 5GJSL 3WS6C 2HT2D 1AGFA 3GSXB 1D5XB 2P4AB 3FQNA 4RAUB 5J0BA 1R0AL 2OCFD 3W9EB 3D39E 1HEZA 1RPQA 1JNLL 2UYLA 4JPVH 4D0CB 1IEHA 4RX4A 3RDTC 3X3GL 4ZYKA 2YEZA 4X0KA 1S9WA 2QQKL 3QUMA 1AGDA 1LE5A 4JPVL 4GLRI 4R0LA 3VA6A 4PRNB 1C1EH 4UQ2A 4IRJC 4PJ5A 3RKDD 4R96B 3MRLA 3MNZA 4C57C 4IDJH 5KS9A 2X70A 1H3PL 3BGMB 1V05A 2DM4A 3CFBA 1H8SA 3LKQA 6CGTA 5TF1H 2DQTL 2BC4A 4RRPG 4ZOBA 5D5MB 3BYYA 3EYUH 4IRSB 4NQXA 4ODTH 1U8PA 3AY4A 1MCSA 3C6LD 5BV7H 3KYOA 5I18L 1LE9B 4ODUA 4X7TA 1A7BA 1UG9A 3FQRA 4RMWA 2F5BL 2IAMB 3S36H 4GSDL 5DT1H 4MAYB 4KZDL 3T0VA 1LO4L 4WIQA 4XAWH 1EEZA 2ZNWA 2QSTA 2ATKA 4Z77A 3BZ4B 3PGFH 4S1RL 2X10A 3QH3A 2BNQA 4G7YL 4I0PB 3CDFA 1F4XH 5HGDA 2PXYD 1ES0B 3MA7A 3T3MF 4N0FA 4MQSB 3QPQD 4P2YA 5EPMB 1MRCH 5J6GB 4P5KB 2VIRA 3KWWA 4Y5XA 3STZB 1TZGL 3EHBC 4JR9H 3VFGH 2BJMH 4ZOEA 2IADB 1MSPA 5CGYC 3L3GB 2Q87A 1HXYB 4TNWK 2VXSL 3I3EA 3D9AH 4KJPC 2YUZA 2OTPA 1DQDH 4GG6E 3O8XA 3TF7C 1XIWD 3W2DL 5EOQL 5DWUH 1NAML 4P5TD 5ANMA 1JYVA 3D3VD 2EH8L 1B88A 1QFWH 2C1OA 4LVNB 3LRSA 4EUPH 4MVBD 5I1JL 1F3JA 5C3LD 1P1ZB 3KS0H 3P0VL 3GMLA 5FHAH 2HTLD 2KZWA 1A9EB 4NZJA 1PY4A 5IIEB 1F4HA 4U2ZA 2ILLA 1SY6A 5CILH 4ZTOL 1ZHLB 4JFYB 2VC2H 1ACZA 1MQKL 1NUNB 5CBAA 5B22A 3QUML 3MLUL 1FVEA 3MLTA 1WAAE 2YD4A 4I3GA 3X12A 3UZEA 5J1TC 1K2DB 4IJ3C 2DBLL 4YFLF 4K3JH 2XXCB 3MJ8B 4L3EE 4ZXBB 1QACA 2XZCH 4WFEE 1EV2E 1TQBB 3ECBB 3Q0HA 3HC3H 2E7CA 2HFGL 4ZFGH 4Z7NF 1BJ8A 2UZYB 1M71B 3NCFB 1U8OA 4OTXH 1D7FA 2FB4L 2NY1B 2EDBA 1A2YB 3MRJB 3WFDL 1HYRC 4HS3A 3G6DL 1CLZH 3MCLL 5FHBL 1OOAA 3SBWC 4PLNC 1RK0A 2A9MH 1YEKH 4AMKL 5ITFA 4YXKL 1U3JA 1MFEH 4KVCH 2XKNA 1GYAA 3SE9H 4XBPB 4NNXB 1L9NA 2AW2A 4PJ5D 2A1WL 4MA3B 2ZNXA 3L9RA 2MWCA 5FYJU 1DN0A 5DK0A 3X17A 5A16B 4ODWA 3HI5L 4Z8FH 2NY5L 2OR8A 3Q1SL 4S1DC 3G6AB 4GFTB 4M7ZC 4JM2B 1C5DB 3R8QA 3NPSB 3MO1B 4NO5B 4OD1L 4MJID 5EFIA 5ICZA 4AM0A 1Q38A 4WWKC 1OD9A 4QRRA 1A7QL 3FO1B 4R8WL 2V5RA 3F8UB 1IAKA 4X8JA 5EC1A 3BP7B 1I8IB 3BXNA 4YBQD 5JA9A 5DJAA 1KTRL 4LVOB 1SM3H 1I8MB 2GK2A 4UBDC 4Y16B 2GSIA 2QSCL 4ZXBD 2W9EH 5CJXC 1CD0A 5E5RB 1FSKB 4NKOA 5EBMB 3AGVA 1X44A 4ODWB 1PJ9A 4OBRA 1GIGL 3PIQB 1KB5H 5KN5A 2EDHA 1QFWI 3BH9A 4F3FB 1LP9A 3I2CH 3EDDA 4A2MA 3LS5L 1KJ3L 3A6BH 4AEEA 5LWYH 4DZ8B 3T3ME 4UT9H 1T1ZA 4PG9A 5E8PA 4JFZH 1NGQH 3QQ4A 4GW5A 3PXJA 4PJAA 3U7WH 1F11B 4AK1A 2XWJA 2UWEF 4FXLA 5DJCA 3MOQA 4GKOA 1BF2A 5GS0D 3FMGL 4OI7A 1E4XI 3SDDA 3QUMB 4TUOA 5HHMB 1X7QA 4BFGA 4PR5B 3CK0H 1XF2B 2BDNL 4HIXL 5C09A 3D48R 3OF6D 4OFYA 4KGLA 3HLAB 1IC7L 1OT2A 5HYJD 1DANT 3WN5B 4HSQA 4RMSA 3ZKMC 4G7VH 1J86A 4P3CL 3EDKA 2G9HA 3RZWA 1QO3A 3VD4A 2R1YB 1XR8A 5GGQL 5I1DB 3L5IA 4M7JH 1MAMH 2PETA 1FFPA 4LIQE 1TVBB 4M1CC 4WI4A 1GGUA 2FJHA 4FFVD 3I50H 3PQYA 4WTWA 1BGXH 4NQDA 1X5IA 1KB5A 1U3HB 3B2VL 4OKDA 5BRZB 1E6OH 1BP3B 5CKGA 3B43A 4TNVF 4LHJB 5IJKA 4U3CA 3QI9A 1CT8B 4XWOC 1INDL 5IB1A 4M7LL 4ERSL 1F6LL 1OP3H 5DJXB 1NBVL 1PKOA 4IMKC 2JELL 1FYTD 1NJ9A 3TV3L 1CBVL 1OP9A 4KRMB 3FQXA 5D70H 4PY7A 3MBEA 3CFJB 5I2IA 5KBNC 5KG9B 5ESVB 1TETH 2XRAL 4GBXD 1N5YL 5F6HI 3OG6B 2OTWB 2NLJB 4HFUH 3WLBB 4LLQB 4RAVB 5L7XH 3MA7B 4KROC 1FN4A 2NY4B 4LSSH 1DCLA 1FVDB 4KHTL 4GW4B 4LLDB 3VXMD 3O3BA 5KZCB 3MLWL 2FX9L 4PJXE 1MWAB 2XZZA 1PKQA 1MCPH 3QEGL 2Z31D 2DQJH 3K8MA 2OR7A 3D1MC 5E8EA 5BRZD 3VE0A 3DX7B 1LDPH 3ULUF 2Y7QB 1WIOA 2K9UA 3QZWG 5KVDH 1ZE3C 1EEZB 3CFCH 2NNAB 4F33A 3L3KB 5LGKA 3MLPA 4OZ4B 1ORSB 4HS6A 4LP5A 5IT2L 2Y23A 4DN3L 4X4YA 5D93C 3BPLB 1NDGA 2E7LC 1BFOA 3O2WL 1TZIB 1UM5H 2ZG2A 1QFWM 4KAQH 2W0FA 3VXPB 3ARDD 4PB0L 4AQOA 5FCUH 1JI1A 2CO7B 3CDYA 3HR6A 3IDUA 4G43B 4XPTL 4WEBL 3LEYH 4LDOB 3VWKB 1EIBA 1L0QA 1YC8A 4X6FB 5DVNA 1CE1H 1FFNB 3QUYA 4PD4J 1GCFA 4G8GD 4RMTA 5I76B 3MRNA 5JR1L 1AIFA 5ADOL 3S6CA 4K8RH 3QWOA 3LN5B 2M2DA 2OMNA 3VXNA 4YDLC 4QXUH 1VADA 2PXYA 4JKPL 4QRRE 5T3ZD 3FB5A 3P0YL 4LAQH 4XHJC 3LRSB 4PG2C 2YRPA 3IDJB 3KYKH 3QHFH 2F19H 3MBXH 1ZT4A 1ND0A 3M45A 1HNFA 5BZWB 4F37K 5ALCL 5C09D 5BQ7B 4G8IA 2VMFA 4Y4HD 5J6HB 1D6VL 2L7JA 3FT3A 4K8RD 3KDMA 1VFBA 1BVOA 5J56B 1C5DA 4PJBE 4O2CB 3KPQB 1VFBB 1PYWB 3DRQA 1QSEB 5KJRH 3KHQA 1OM3L 5HI5C 4KROD 1CICB 5DHVA 2WNGA 4MA7H 4Q9RH 4HIHB 3BIKA 1MCWM 2EE6A 4DN3H 3QJHA 4LARH 4OLVL 1I8IA 3BXNB 4L1DA 4PJAE 4PLKC 1HHJB 3FB5B 1NGXA 4KJQC 4XX1E 5GGTH 3E0GA 1T0MB 2H2PC 4JN2A 3CXDL 4Y2OA 3EYQD 4H1LB 4R97B 1KEGL 1II4E 5A3IC 4G5ZH 2H26A 5K9JL 2XZQH 2WLYA 1BZ7A 5ISZE 3HZYB 1QUNA 4LGPB 2EDWA 4YHLH 1T5WA 1M4KA 5F1SA 5J89A 3BP6B 4NQTA 5DD5H 3UYOD 5C0JB 5DUBA 1IKNC 4XCYB 1DEEA 1MEXL 3ET9F 4ZAKB 1VKXB 3V7AG 1OAXL 2AXFA 3OAUH 4MDJB 3VMNA 5IMOA 5I19L 1INDH 4X80H 3STLA 3I75B 2WANA 2EDTA 2CLRA 3IU3A 4PJBB 4PJ5E 2RGSA 2J7LA 2UZIL 5KSUB 4KKAD 3BEWB 3RJDA 4HIIB 4PJ7A 3OKYA 1CDIA 3Q6FB 1YMMB 3HZKA 3QEUB 1A6VL 4R0LC 2FWOB 3RUGA 3WHXA 2K3TA 1XGTA 5ILTL 4G8FB 5I17B 1DVFC 5D71H 4UZGA 3E2HB 1MCHA 5A2KH 1FZKB 4KDWA 3T08A 2WBJD 4OBSA 5GGQH 2AGJL 1S9VA 5B38A 1CDHA 5IQ9B 5K9OB 4BKLB 5D8JH 4XP4H 5EZOH 3QNXA 1MVUB 2KQMA 5I8CA 2R4RL 2OMBA 1KIQA 1Y0LA 2C4FU 3H7LA 5EUOA 5MEQA 4OCSH 5EZLB 5AYUL 3VFWB 4NC1E 3UJTL 1FZMB 3FZUD 1AFVH 4XX1G 4PJ7B 4I77H 2Z92A 2CQVA 3ABZA 1E4KC 4UV7L 3WDJA 2E8ZA 1OTUC 1RUPH 1V7NL 4WUUB 5DMGD 2ESVE 3C5JA 1I8LA 3PWUB 3MLSH 3SKNA 5K9QG 4P57A 3MLZH 1I9RL 2PN5A 3CJJA 4P3WA 3FB8A 4XXCA 1R5WB 3DV6B 2KDGA 4MB4A 4WY7L 3ARYA 1JF1B 1NGYA 5B8CA 4ZOAA 1NGQL 1J5OH 1TNNA 4OT1H 4HQQH 3I2CL 1SVZA 2JCCB 2LABA 5L9DL 4UOJA 3QEQA 4O51B 2CKBL 4P9MH 1Y6NR 3BIAX 2G2RB 1TJGL 4S2SB 3WFBH 1NGWA 3QG7L 4MAUL 2CDGB 3BP4A 5DJXA 5E4IA 1FGVL 4MNQB 3VXRB 1FORH 1KNOA 1IM9A 2Y5TB 4L8DB 3VWKD 3ZKQD 4F9PA 4I3SH 4XVSL 3QCUL 2QKIB 4LDLB 1MWAH 1AGCA 1BFVL 2CUMA 2GJ6D 4WFED 4OLYL 2F8XC 1YEDA 3QIUA 4M1DL 3HNSL 4FP8L 4GG6A 4G6ML 1J0KA 1MPAH 1CFQB 4H8WL 1E4JA 2VITB 3AC0A 5CHNB 3F7RA 4DUVA 4KI5E 4M43L 3MRKA 3ZHLA 5B39A 4BSVA 4HCRH 2GJ6E 1H5BA 2Z31B 1EJOL 2EH7H 3HTLX 5GGSY 3UMTA 3RWEA 3FO2B 3CSPA 3QAZB 1HQ4A 4HAFA 3GBNH 2VNCA 4XPGH 2OTUA 2FEEI 4Q0XH 5LJYH 5F7EL 4EVNB 3IDJA 1IGCH 4MA8L 5JLZB 4LCUA 3GSUB 5E9DB 4W4OA 3WFDH 1U8HB 3QCTH 2V7NB 4X7SH 3RWGB 5CEZL 2XOTA 4JY6B 3JV6A 1IGCL 1I3VA 4X6CF 3ZKND 2PYEA 4HV8A 4W6WB 3UZVB 1B2WH 5GGRY 5BJTB 4K7PY 2FSEB 5DD3L 4XP6L 1MIEL 5GISH 2ZCKL 1EJOH 4N8VB 2A73B 1S7XA 2DJ4A 4N1CA 3RU8L 2R8SH 1FFOB 4YUEL 2R56H 3FCTB 3RIFF 4ZO8A 2VJXA 3S37H 1I1RA 3BJ91 2BFVL 2WV3A 2J6EL 4FNLL 3VRJB 1YC7A 3DX9B 3D3VA 1MPAL 1FGNL 4PJ9B 4L4VB 5F3BA 2B20A 3NFSH 3QUMH 5BXFA 2VQUA 4KMTL 5IB4B 2ORBL 4UT7L 5D1QD 2JB6A 4FXKA 1TPXC 4UINH 1IKNA 3QIBD 1EEUA 1FORL 4FQXA 3SDAA 1XF3B 4ZAKA 1MCKA 3RGVB 5FO7A 4KTEL 1PVHA 2GTZA 4U7MA 5I9QB 1CXHA 1NAMH 4J3SA 3QQNA 2CKBH 4NNXA 1U92A 5BVPH 1DQDL 1G6RA 1U95A 1UACL 1KCSH 1YN7A 3KLHD 1P9MC 5DJ2A 4K71C 1SYVA 1A9BA 3ULVL 3ULVC 4YGVA 1GL4B 2MQ3A 4NZDA 4F8QA 3M1BA 2F58H 1MRCL 1UCTA 2WP3O 4KZEH 1GXEA 3MRJA 4J1UB 1BF8A 1INEH 2PYFA 1ODAA 4FZ8L 3QXTA 3H9HB 4DJMA 5E6YA 1HIMH 1GGBH 2VZUA 3S4SG 4JFDB 4PP2B 1I3GL 4GBXC 2BSED 1HHKB 1J05A 1DQQA 1YY8B 2RHEA 3G08B 1I9IH 1XGPB 4G6JL 4J3OC 5E9DE 1UWXK 2NY7L 3PV7A 4Q97A 3PWNB 3CPLA 1X6NA 3HCVA 2W9DL 2GAZA 4LF3A 1VGEL 4IBLT 4YR6B 1FFRA 1UWEL 2ARJQ 1IE5A 4PGZA 5IVZA 5ID1B 3MZTA 3OR6B 5F1IA 5BZDB 5DFTA 5CGMA 5C0GA 1OAYL 1L6XA 3TCXA 1U3YA 4X8JB 3PWUA 2MOVA 4MDIB 1J9CT 2CXGA 4HZAA 1KCRH 2Y1VA 4RFOH 1JI2A 4O4YL 3C9NB 3BPCA 1DDHA 2ADGA 4LLQA 1LK3L 3RI5F 2DL9A 1A6TA 4WI5A 3IDGA 3U2SB 2EXWD 4OM0L 1K4CB 1PY9A 5LGJB 5K93A 1F6AB 2AKRA 3ZT6A 1NPUA 3H42L 4NQXB 4F57H 1U8KA 1S7QA 4FQLL 3ARGC 4C54A 3QIBC 2DQDL 1OAXH 2G2RA 3OB8A 1HXYA 4NJAH 3C5ZB 2YC1B 5JW3L 4R97C 1NSNH 5L2KB 4QOKD 1DBAL 1UJTA 2AXGB 2P43B 1U8QB 5BOZG 5LXGH 4ZG1A 5DFVC 4F33B 1UC6A 2IF7A 1MF2L 1YEIL 3AXLB 5E94B 4YHLL 2AJSH 3RRQA 5ITBL 5FF6B 1KC5H 4K8RC 2P5EB 2ZUWA 1JRHI 4G8GE 2X9XA 4NWTH 4NZRH 1AP2A 4HWEL 1WGOA 3C5ZD 3KXFD 3ZYOA 3U48A 4YDJA 3GSVA 3BZEA 4CN6A 4PJ9C 4QHLB 5L6YH 1BMGA 3TN0B 3VJ6A 5ERWB 3KYMB 4QRPA 4PBWD 3OKOB 2F5AL 1G7MB 3IAPA 1LE9A 4ZSOE 1ZHBA 5DS8B 2NW2A 3OJ2C 4OCWL 4XPHH 3OGCA 2MMXA 3MJ8A 2ADFL 4ZXBA 3EZ8A 2R1XB 5LG1A 4G9FD 1D3CA 1I3GH 2A6IB 3WSQH 5ACLA 5LCVL 3S34H 2DQUH 3QDMB 4PJBF 4ODXA 1QSZA 3GKWL 2IQ9H 5CD3B 2W0FB 4I0CC 1INEL 1SY6L 4YDLB 4JAMB 5HJ3A 3SPVA 5KSAB 2XTJE 4V1DB 3SGDI 1JZ6A 4F7TB 4OZIE 5C0BE 1MRDH 1EBAA 3D0LA 5JUEH 5ERWA 5EC2B 1G7LB 1UQSB 5I1KL 5E7FA 5BS0E 2R0WL 5KSVB 4QHLA 3EDJA 2FEDC 4POZD 4LLVB 1MCFA 4ELKA 1C16A 3RAJL 3SJVA 3I3DA 1T7XA 1RZJL 2R1XA 2QHRL 3KNBA 4WV1B 5KTEL 3K1DA 2ZCHH 5L2KD 3ZDZE 1OB1A 2VDML 1A1OA 1T04A 3JV0A 4H25B 4OFIA 3C8HA 5EIQA 1X3DA 4PGBB 4UTAH 1MCOL 4I1NB 3Q6GL 1MJ7H 2UVFA 2DM3A 1CD9B 2ARJA 1D5IH 4PRPB 5HVWA 3NTCL 4WEBH 4XNQA 1AH1A 4NN5C 3WMSA 2MCG1 4DVRH 4KMTH 2A9NL 3OJVC 3F7PC 2VDLH 2ZUVA 5DJYA 2X05A 4Q74A 2HYMA 4C56E 3LZFL 5MHSE 5ICZB 5E1HB 5FA3B 1X5LA 5D7IF 2VLME 1JGLH 3H9HA 3CU1A 4APQA 4HJ0C 2AEIT 4X9FA 1T6VN 4GRLB 2NX5A 1U8MB 2VZTA 3VXNB 3EDEA 5CZKA 3BMWA 2VZSA 1P4BL 4XAKE 5C0DB 2NZIA 4JKKA 1T03L 1MIEH 5GISL 1T0MA 2DBJA 2FX9H 5LGHH 3QIBB 1VA9A 5HI4C 1AHWA 1LO3H 2BVYA 2CDEA 1OVZA 5IP4A 2ERJC 3IKKA 1K5NB 2Z93A 1TETL 2XRAH 4PJ9D 3BIBX 1RAMA 1NBZB 1PYWA 3RVVC 4GRWE 5JQHC 5KAQG 3NCEB 3MUJA 4FXGA 4LLWA 1CBVH 4MA8H 4JDTL 4S11A 4RIRB 5I16A 5T3XE 4GBXA 4E41A 1JWSB 4GRWF 3SE8L 3QUKB 1DQQB 3G08A 4XXDA 3BEVA 5JOFB 5ETUA 1CTOA 4PJIB 4EI5D 2WK2A 5IBTH 1CU4H 5C09B 1J1PL 3TNNB 2KBGA 3D3VB 4OJFL 1CG9A 4EOWL 1IL1A 1Q9OB 1BGXL 1A1NB 4GKNA 2P42B 3MLVH 3IT8D 1R5VB 1K85A 4JGJA 1R3IH 5FKAB 4R2GC 5HY9A 1BD2E 4H8WH 5E2JA 2EZ0C 1S7SB 4MHHI 3JZ7A 1JE6A 5L2KA 5IMKB 4NOFA 4OZIF 1MREL 4U1MB 3FOMB 5JXED 1YMMD 1MWAL 3STBA 1UM6L 2X4SB 3T04D 5GRVL 2DQHH 2XNAA 4N9GB 4R2GB 3U9PL 1I7ZB 4AT6A 2GTZB 4FFWC 3KPLB 4PJ7E 3BGFB 1ITBB 1FGVH 1NCAL 5EBLB 5CEYB 1OQXA 1IC7H 1EZVX 5IROA 5IHZB 3ARPA 1FO0L 1GHFL 3TNNA 4RMVA 1LVEA 2IFFH 4MSWB 3RZCB 2CLRB 2VLLA 5D7KE 2Y25A 4XBGA 5SX5H 1CFTA 4ZQKA 5CINL 3S7GA 5BVJA 1G7QB 1Q72L 2Z4QB 1QA9A 1I1CA 1T20A 1I1FB 1FPTL 2HLAB 3PGDA 2RCSL 2X9YA 1EHLL 1CI5A 4U6YB 1AXIB 1JHTA 2WIMA 4QHNA 3LN9A 4HEME 1DEEB 4U6YA 3MRRA 4EIGB 2SEBB 3FQXB 2VDQL 3N1PC 4HIJB 1TPXB 4X5XB 4J4PA 2BVPA 3FQTA 1G7JB 4UV7H 3JUYA 2H3NB 1K4CA 2KH2B 2VLLB 3ULUH 5DO2D 2H41A 5DEGA 3VGDA 3GNMH 2VXQL 4HH9B 4JY5L 1EGJA 3FQRB 3T8XB 2VDKL 4X6DB 5D7JA 1TZHA 2GQHA 1JHLH 1H3TA 4D0DA 5JPMB 5IKCA 1YUHA 1MREH 2AGJH 1MI5A 4GG8B 4JDZA 5GRWA 4YPJA 4APQC 4GOSA 1F8TH 4YDVB 5D7IE 4OD1H 1ZLUH 1WT5A 1WWWX 1U3HD 3RWFA 3ESUF 2Y9RT 4R96A 4NCC1 3P4OA 2VLRE 4PJCE 3C6SB 3I9GH 1A6VH 2WWMC 3QAZC 5GRUL 2NXYB 1S7UA 2JJTA 2V7NA 4Y19D 4B0MM 5IBTL 1DBKL 3RBGA 3VJ6B 1AR1C 4N0RA 4R3SB 1N59B 1I85C 1KIPA 3TIEA 1BOGB 1CE6A 1VFUA 4YXKH 4HPOL 2EEDA 3TZVD 3C5JB 3OAUL 2YBRA 5HHOE 1EO8L 4Q6IB 2PXYB 3G6DH 1JPSL 3AXLA 1JHKL 2XA8H 2V2WB 3HE6D 4RGMC 3K8KA 4J23A 3VRJA 4LVOC 4FQJL 4LSDA 3BSZH 4YHOH 4Z76A 3L7FB 4ONGL 3V4VL 4LOUC 4L3EA 5K9JH 4YH6A 3I6GA 1N8ZA 2FCBA 4P2QA 2B5IB 1MJJB 4KGJA 3VXQB 3GHEL 5FO8B 1RK1B 3TYFB 3QDGD 4V1DD 5JHLL 3X14B 5I1CL 2OI9C 3VI4F 3B5GA 4L9DA 4WI2A 3T4AB 4WVRA 3TCLA 3KJ6L 5FO7B 1LEGB 3X13B 3A67L 3LDBC 2XZAH 1KN4H 4LU5H 2J4WL 2JE8A 3SKOA 1NGXB 4DGYL 4LVNC 4MA7L 2AK4D 2GITB 3FB7A 2WSKA 2NY1D 3L7EA 1CR9H 2YXMA 5GRXG 2ERJB 4PLJD 25C8L 2MHAA 3KPPA 1U8OB 1DBJL 4YWGH 3TVMB 4DWHA 2ZUXA 3Q6GH 5D72L 5I1KH 4XVTH 4UAOC 3RNKA 1FBIL 1MHPH 4IIQA 4LEXH 4MXVF 4L4TA 3QRGL 3G5YB 1QP1A 4H8WC 5CJOL 1MH5A 4L8BA 2CUHA 3AU1B 3MRFA 4LOUD 3BP6A 4U3HA 2IQ9L 3Q2CA 3I02A 3KYKL 4H0IA 1IAOA 3L3DA 4XPFH 1V3LA 2LU3A 4JKPH 3O4LD 3LS4H 4OD3L 1HHGA 3T2PA 1MCIA 3DTXA 1SHMA 3MZGB 4M1GL 5ADOH 1NAKL 3JWDL 3V0AC 4ZSOB 4NZUL 4KUZH 3IDYB 1ZSDA 2XI9A 3LEYL 4NQVA 1AR1D 5IB2B 3GRWL 2AJUH 5DEFA 2RIKA 4PJFF 3BIKB 3Q3GB 1LWRA 4Y7MA 4UIMB 1T5XA 1JZ2A 1F4YL 4QRUB 3PHOA 3BWUC 1KPUA 1RUML 2F5BH 2P7TA 1DBMH 3UYRH 2DTSA 3BFOA 1MF2H 1YEIH 5KVDL 5DR5L 3MV7D 4M4RA 3O41B 4RBPH 2DWDA 1IFHL 4S0TD 4F7EB 3CPLB 4YE4L 3MJ7B 4XH2B 1CFVL 4I9WE 5BZWA 1UFUA 2DQDH 1RJCA 3INUH 3VWJA 2BVOA 1OTTD 5IMMA 3SGDH 3S8WA 1MAKA 4XCNB 5IB2A 1CFTB 2VISA 2BNUB 4EBQH 2J6EA 4UNTA 3MO1A 2R9HD 4Z5RA 3SE3C 1T7VA 4QHUA 5D70L 3WNNA 3ARGB 5C3TA 2CRMA 4EBQL 4IRJD 4JZNB 3VGAC 3IXTB 2EDRA 3S5LB 5I1IL 3NMEA 2AJVH 4HK0B 5HVHC 3ULUD 2E9WA 1OT1A 3LN4A 1FL5A 2QQNH 1U95B 3QO1B 1KOAA 1FL5B 2BC4B 3Q5OA 5ADPH 2YK1L 2GT9A 4U4BA 5KVMC 4Y2DB 4YE4H 1FRGL 5HHVL 1CGTA 3K2UH 3PJSA 2JCCA 1MRFH 1BBDL 1QD0A 1WF5A 2V9QA 5BS0D 2XN9A 4KQ4H 2K7QA 2IAND 3Q6FA 2BNUA 4LP4A 3RP1A 3CFIC 2BZDA 1ROWA 5EU7E 4MJIB 2A77L 3O45B 3SE3A 1IRAY 4EIZC 3DVIA 1HIML 3FONB 4DN4L 1GGTA 4M7KL 5BS0B 4FZ8H 3VFNA 1OAQH 1A4KA 1MOEA 2W9DH 3ZYJA 1QHPA 3DMMD 4M1GH 3VD3A 2HLFD 2VUYA 1P4LA 2V2XB 3ULVH 1QNZH 4M6NL 3AM8A 3QDME 1AD0B 2FIRT 1T6WA 5FGRA 2VABA 3S3JA 1I1AB 1OP3K 3V6FA 4JGMA 3VI3E 4XGZA 4U1IA 5ICXB 5CJOH 1DN2A 3REWB 5D93B 5I17A 5LQBL 4G9DB 1YECL 1N5AB 4LEXL 3IETA 1N3NA 4U1NB 4GMSL 3TFKC 2EEBA 4MD0A 2X4RB 1ZT1A 4KMQA 4YBQC 5KZCD 3ZE1E 4JAMA 4KJWD 4F2MA 5DJDA 2APVA 2CIKA 3MV01 4UT7H 3T0EC 4A6YL 3WFZA 3HC4H 1FHGA 3ROOA 1GC1H 1CR9L 5K59F 4JO1H 5DJYB 3WEXB 5FKPA 2DLGA 3GKZA 4LLDA 3SGJC 4L8SC 1FGNH 1KN4L 4LU5L 5M94B 4KTEH 2CLVB 3GI9L 1ZHBB 3WE6A 4M5ZL 3QEQD 3QP3A 4JZJC 2OX5A 3L6FB 3FRUA 3CX5K 3QUXD 2D7MA 3IVKB 4PBXA 3QUZA 5KG9A 4XC1H 4V2BA 4UILH 2QV2A 2F54E 4KV5E 4HGKC 1E4WH 5C71A 2YXFA 3PWPB 3QJFA 4CU8A 1MHCB 3ULVF 1H3GA 1PG7W 1B2WL 4BZ1L 1RFDH 3SDXE 3GSNB 2N1KA 2ZPKH 3HMWH 4FQJH 4KROB 3BZFB 5EFIB 4X7SL 1UQSA 5JOEA 1GGYA 3TLRA 3E1F1 3HB3D 5CUSL 3DYPA 3O11A 1E28B 1M1SA 3HE7B 1DQML 5SV4A 3L95B 2CDGA 5BJTA 3SE9L 1ITCA 1F4WH 2ENYA 1B4RA 4HPOH 1VEMA 1SBBA 3VGBA 1CGVA 4M6OL 1D5BA 5DMKB 4OF3A 1V3KA 4Z7QE 5SWSD 4XH2A 5KN5B 1YMHB 1P53A 4GKNB 3C6LB 1AKJB 2VLJA 4HCRL 3CCHB 4XC3L 2QADD 3LSOA 1KT2B 4N0YH 2ZUTA 4ETYA 4DKEL 3A0OA 5DJ0A 3DX6A 4Y5VB 3WKML 4FHBD 1A3QA 5DA0B 2UUDK 5KVEL 4WHTA 3MGOB 2Z8VC 3VDBA 1S7VA 4YX2L 2X41A 4HLZG 2HTLC 3KPNA 1VGKA 1FDLL 4LMQE 1A6AA 4XVSH 5DJ8B 4KDTA 4NRYA 3C8KA 4WI9A 2PO6B 1RZJC 4U7SA 2VXTL 1H8NA 3ARSA 4ESKA 3B9KD 2Z9TA 1ZXQA 1DN0B 5DK0B 3OSKA 2IANA 2DKMA 5J1AB 1K4DA 4E41E 1X6LA 4PRAA 4ZMAT 3I3BA 1K4DB 1BFVH 4G42A 5I66A 3BDYH 2JIXA 4F3FA 1I7TB 1AKJD 3QZWA 2CJUH 1K8DB 2JCCE 2R69L 3MRFB 5IESH 4CGTA 5HD8C 1YEFH 3FOLA 3WL9A 4JVWA 4IOSD 4GRLA 1KG0B 3QXVA 5ESQB 4AEIH 4D0BA 4MAUH 2WBJB 2X4TB 4YZFF 3DXAD 4KDTC 3QUYD 4DAGH 5CINH 5GSVA 4OCYL 1I8MA 3U0TB 4NP4L 4NUJB 5L9DH 2VH5L 1V7NH 5SWZA 4X7CC 4HBCH 4P2OC 2FBOJ 2ZSVB 2R23A 5FUOL 1EJ6A 1RJYA 4OAWB 5ACZA 4MD5A 1QRNE 5BV7B 1T20B 2HLAA 3U9PH 4TPRL 4HFWA 5C0EB 1WTLA 3MLZL 3W0WE 1UM6H 3PGFL 3P9WB 2FIKB 4Y4FC 4DN4H 2JK5B 2PXYC 3NFNA 5I71B 3U4BL 1FNLA 4NO0D 4PJDA 1CZ8L 2GFBA 5DJDB 2YPLD 5EBLA 3QNZA 2CK0L 5K9KB 3SDXF 1KB5B 3V0WH 4RGND 1MELA 3C2AH 5EUOB 5DHXB 3DX8B 1J0JA 1F90L 2A6DB 1P4IL 1VSCA 2LV4A 1MCNA 4H0GA 5DC4B 4Y4KD 5HHVH 3DJ9A 1RVFL 3M1BB 3OJDA 4JO4L 5ADPL 1BM3H 3W0WB 2HKHH 4PJAF 2VDNH 5AAMA 5F1IB 5BZDA 4UB0H 2R1YA 2ZJSL 4Z7UA 1KIUA 3LMJL 2BOBB 3WHXB 2FJFB 5HHXH 1QR1A 4H1LG 5MI0B 1JYXA 1QRNA 5JPNB 4PRNA 4W6XB 1CFNA 1T1WB 2GK0A 3C5SB 4TULL 5TGBB 2NY1C 3RUGF 5HGDB 1PQZA 4X80L 5KSAD 2VR9A 3U4AA 3RPIB 1FO0A 2DQFA 2GSGA 1YEJH 2G5BA 4XP1L 3BN9D 3CFDA 3OJDB 3WUWA 1BOGA 1E4XH 4P2RB 3P9MA 3D3VE 1P4BH 5I6XC 5ESAB 2NMSA 3BH8B 3WD5L 1AHWC 2BRRL 1SEBB 2FYYB 4XB7A 3QDGE 3ZDXF 3D18A 4HKXB 4Q6IC 3SBWA 1RHFA 3D25A 1D5BB 1DBML 3UYRL 2FATH 3SDCD 1AO7D 2VO5A 4FQCH 1JPTH 1WBXB 5JDSA 1CDUA 1UCBL 2X1OA 1I3RB 2A9NH 5FECA 3EO0B 3K74B 2VWEE 5E99L 5KJRL 3OKMB 2OL3H 2XFXB 4ZD3L 3RZCC 3CMGA 3DSFL 4PS4L 3CXDH 4MD4A 5L2JB 1A6ZA 5C07B 5C0AE 3KYMA 1K6QL 3HA0A 3RL1B 4HMDA 5J3HC 4Q9RL 4RDQG 3VE0B 1JGEB 4RMQA 2F19L 1T83C 3MBXL 1RV6X 3L5XH 2V2TA 3UTQB 1A3RL 5JHDB 5CJ8A 3S4SB 1LO2H 1JV5B 4KJYB 5GS1A 4AIZB 4LPXA 3MV8A 3FB7B 4BFIB 1HI6A 1Q94B 1O0VA 8FABA 4K8RL 4RAVA 3B8YA 5J6HA 2GY5A 2LAGB 3LKOB 5EUOE 1HH6B 5C08E 1FVCA 1MJJA 3F7VB 4BH7B 5DJ6A 1Q0XH 3JWOL 1ONQB 3DVGA 2HN7A 2FSEA 5DD6B 3CFKB 4KAQL 3ULSA 1C16B 4RGNE 5EO9A 1TVDA 2G60H 4FQCL 3A67H 4BSWB 2J8HA 3O2DH 5D2LA 4BSWA 1MJUL 1CE1L 4X99A 1A3LH 5E9DA 1T66D 2I60L 1XIWC 1LDPL 4G43A 4PJBA 1OTSD 1UZ8B 3WNKA 3OZ9H 3OWEA 5I74C 1YEJL 4LCYB 4BZ2H 3D85A 3F7VA 1FC1A 1ZA6A 5F6HJ 3C60B 3QUXA 1QFUH 5IT2H 3ZDYE 1JWUA 1I1YA 1MH5B 1U8NA 3O6FC 5F7DA 1WBZB 4D9RD 5MEOB 3GJFK 3G6JB 1N5YH 1A6AB 3MSPA 5DUBB 1A02N 1I75A 2XV6B 4GKSB 1PFCA 4X6CA 1XH3B 4KDVA 4OZHB 3BEVB 4JANB 2ZJSH 5IG7B 5H94B 4L29A 1NMBL 3L7EB 4UB0L 3OXSB 3O9WA 1N2RB 2EYTA 2UZXB 3U79A 1WJ3A 1EX0A 1IARB 3FQNB 4NUGH 1LK3H 4H1LA 5EBWA 3WYRA 5CEZE 4MWFB 1S9XA 2R0ZL 5DK2B 5H2BB 4KRPB 5DZOA 2Z93B 3NGBC 3N1QC 1Z2KA 3C2AL 4WU7B 3NACL 4OLXL 2Y06L 5JDJA 3BJLA 1F11A 3DUUB 1U36A 2WAHA 3DVNB 4U1JB 4R2GD 1U9KA 2YD7A 2R2BA 2F74A 1F8TL 2HKHL 2HVJB 3RDTA 4XAKD 1RZ8A 3NIDF 2ZUSA 3NFNB 4TQEL 1NGPL 2VLRA 4PJCA 1PW3A 3HE7C 4U31A 1GC1C 1U3HC 4QTIH 1E6OL 4JRXA 4K7PX 4L9LC 4P3CH 4PJXA 3MJ9H 3V0WL 1CDBA 3TA3A 2CKNA 2D7PA 1FZJA 5E2TL 4OCRL 5GSRB 1RJYB 3GNML 4JY5H 1AD9B 5TQ2H 5IMMB 2AJZB 3KPMB 2IMNA 1Q9WA 3T1FA 2HLFC 2DQGL 3ARBC 5ID1A 1UKQA 3GGWA 1GGBL 1YPZB 1AXTL 2H6PB 4WUUA 1D5ZB 1IQWH 3FT4B 3VXSB 4DTGH 4FFVC 1XR8B 3VXMB 1MCEA 4Y16D 2ICWB 1EPFA 4M3JA 4LRNH 3IS0X 5D1XC 3VXME 1N3NB 3VU2A 5A3ID 1QR1B 1U2HA 2APFA 5KSBF 1IKFL 3MFGB 4JFZL 4YHKL 4JFEA 1SEQL 3HLAA 1HKLH 2OM5A 1AQDB 2YPLB 4TUKH 3QFJD 5J12C 3PHQB 4OCYH 1NCBL 4PJ7F 5IBLC 5C0AD 3CVHH 1UURA 4YBLC 1TZHB 3IGAA 3UJJL 3MOBL 3IGAB 2VXTH 2EDQA 2DI8A 1NAMB 4U1IB 5ICXA 4OGXH 4C83A 1C5CL 1S9WB 3IXAA 1A14L 5J12B 1L0YA 3K0WA 3IDMB 2YD5A 3FONA 4C59B 3QDMA 3FQTB 4ZUSB 3AREC 2EC9T 1T80A 4U1LB 4LPTA 4PREA 2WINB 5EUOF 2OK0H 1L9MA 1AP2B 4NJ9L 3VXUD 2HAZA 3T0BA 3CH1B 2FGWH 2X7LA 2IH1B 3QCVH 2C3VA 2VR4A 4FNLH 2B2XL 4FQ1L 3NFPB 1BVKA 2QSCH 3GMMB 4HXAH 1XGYH 4MNHB 4YUEH 2OR9H 4Y8DC 2PW1B 4UUJA 4YHML 4H26A 3RFZC 1MLCB 4DK3A 1T2QH 4PYGA 4OKVB 3O6FD 3ZSSA 4NGHH 1FL3A 5I1GL 4LSPH 4GG8A 4MMZC 5KVEH 1HE7A 1IGTA 4I0KA 3VXSD 3RVUC 5E94A 1XFPA 5HHPB 4N0YL 3QPXH 1JL8A 3IJHB 3MCLH 5BRZE 1YYLH 2D7OA 3V6ZB 5J11B 4NQDB 4CNIA 1BZ9A 3IJSB 4P48A 4WFHD 4M6OH 4ZFFB 4JJHA 4QT5A 5FYLE 2H9GB 2A9ML 5E70A 3DMMA 3FO9B 4WGVB 3HPLB 3SDDC 5DGQA 1UXSB 3L6FA 2L0DA 5E0QA 3UBXA 2V2WA 3IVKA 4H25A 3C08L 1U3ZA 4HWZB 5HDBF 1KELH 3GSUA 2VLRD 3N0PB 3ORJA 4WJ5B 1KULA 1A0QL 2YD2A 1BAFH 3P40A 4Z7WB 2FGWL 1ZGLP 3SDCC 1AGEB 1XCQB 3VFTA 1UZ8A 4JO1L 1E4WL 2WBKA 2MKWA 4LBEA 5D1XB 4NQVB 3MV9D 1TQBC 3NTCH 1N59A 4OFVA 4QNPF 4OLUH 3GBMH 5F7DB 4XCYA 2A6KA 3MRMB 1DFBH 2NYYD 5JMOC 2M1KA 2VDMH 1Y18A 4PG2A 3UJJH 4JQIH 3EJYC 1NGZB 4ZTPH 5IW1A 4F9PC 5CWSB 3MLUH 4K7FB 4U1KB 1BPVA 3W2DH 32C2A 3V9FA 3OHXA 1YN7B 2ICCA 3IFPA 4PJEF 1CXEA 2EYRA 4RZCA 2R0KL 4JFQA 1JZ4A 1FE8L 3MC0A 3B6SA 4JO3H 2X1QA 4HW6A 4JHZA 3H3PH 4NN7C 3HG1D 4W68A 3R0NA 4XWGH 2IPTL 3G5YA 5E03A 1MFDH 1GOHA 1UEMA 4CVZA 1U8JB 3OB0K 4P46B 3DARA 3CFKA 5MI0C 2O93L 5FUCC 2JB6B 3LRHA 3SQOH 2AQ2A 2GCYA 5FK9A 3SDYL 5DJAB 4YEFA 4NBYB 5IWLA 3I02B 3O2VL 5LCVH 5I73B 3LEXB 2Q8AL 5HHNB 1QNZL 2EYSA 3R4DA 3UTTD 5E8NB 1LO4H 4LKXB 1UJ3B 2IG2L 4PJEB 3TO2B 3HI1A 1PZUB 4OCSL 3MJ9L 4ZO9A 1KLUA 4C58B 2APWA 3ROLB 1ZA6B 1F6FB 3K2UL 2RR3A 3UTPE 2YC1A 5TF1L 3HZYA 3UTTE 2P8LB 4TQEH 4Y2DC 5AUMB 4M03A 4QRRB 1UKTA 3L3IA 4Q2ZB 4RFEB 3W82A 1PGRB 1CWVA 1ORQA 5F7HA 7CGTA 1VPOH 2X4OA 3D39B 4OZFB 2WBJA 2X4TA 1HQRB 3EFFB 4OLXH 1D9KC 2R0ZH 5E5MB 3KPLA 3CC5A 3EYUL 2FJHB 5JOPD 3OXSA 4U6VL 4QOKE 1KIQB 1Y0LB 3T0WA 1SBSL 3VWJB 1VHPA 1JNLH 1S5IH 4K94C 3S98A 3ARFB 4XTRD 3BD3A 4NFDA 5E6ZA 4P2QE 1F3RB 1C1EL 3INUL 1P4LB 2BVUA 4I48A 4I4WA 5B4MD 2PW1A 4RA3A 4UUJB 4N1EA 4XP5H 2NW2B 1SBSH 3CZJA 1SEBA 2FYYA 5B38G 3RUGB 4HKZB 4BK5A 2XWBB 3WXVH 3PGDB 5HDLA 2ID5A 3VXMA 3S96B 5DR5H 3MA9L 5KANI 2YEZB 4X0KB 2AAVA 3HPJB 5E2WH 3HUJF 3MLXL 1A1MB 3P9LA 4GUPB 2MTPA 3RWFB 4QTHB 5J9PB 1R3JA 4JFHD 1R0AH 4GG6B 3H9SE 2XWTA 4Z7VF 5EA0L 2ITCA 1G6RH 4UNUA 4TVPD 2N56A 1FZJB 2PR4H 3TPUB 1ZLSH 1AGFB 3GSXA 4YK4B 2EIEA 4JDVB 4AH2A 4UV4H 1NAKH 3JWDH 4IRJB 4JN1H 3FO9A 2DM2A 2EIZB 4YFDB 3D6GA 1Q9LA 4GRWB 1DTUA 4N68A 3KPOA 3O4OC 3LS4L 1WBYA 2VZ3A 3EYFA 1KCVL 4FQ2H 4GQPH 6FABH 3JUZA 4U0RC 2HRPL 3QIUD 4JY4B 3UJIH 2B7DT 4WEUD 1HCVA 4L4VE 5DHYA 2NY4D 3N9GH 3PL6C 4NIKB 1HINH 3P4NA 4LBEB 2ITCB 9CGTA 5CP3A 3HMXL 3MV7B 3VRIA 3B9KA 3LQAL 4GAYA 5I71C 1NGWB 2YSSB 2HFFA 4U1SA 2FH8A 5C8JB 3IDNB 4R7DA 4OD2B 4QRSA 1T0PB 1T3FA 3HB3C 3QG6B 5INDA 1JGEA 1ZHNA 1J88A 5I1HH 4DKFL 5FYLD 1U0QA 2GY7B 4DGYH 3OAZH 4TNWF 4HUVA 2XZAL 5I1AA 1LEGA 2VDOH 5F1NB 2VXUL 1FBIH 2FLRT 1KLGB 1A1OB 1T04B 1ND0B 3RA7H 2CDEB 2NY2D 5FECB 3QNYA 5JA8B 2AV7B 4WU5B 3QIWA 3QH3B 4YWGL 1IGIL 4L3EB 1DJSA 1IEAA 4PB0H 2YUXA 4P2QB 4UIKH 3RVVD 1JZ5A 1K9TA 5F93C 3WO3B 5FGCB 5SX4H 2CKBA 3WNMA 2F53D 3GJEB 1IGYA 4EDXB 5EWIL 4ZNEE 4P3DA 5DVKA 3O6MH 4ODUB 4X7TB 1ZANL 4M00A 1FG9C 1N6UA 4YFLI 1PSKH 4NQSA 2BSRB 1F3JB 1MCJA 2I5YH 1ADQH 2LQRA 32C2B 5DD3H 2DL2A 5IG7A 4F9LC 1TXKA 1G6RB 4HKBA 4JE4B 3CUPB 1I9JL 2IWGA 3BP5B 3H0TA 3U7YL 4Y4HB 1J0HA 4WFGE 3RVUD 2CRYA 5C6WH 43C9A 4IIQB 3QFJA 2AK4B 4P4KC 2AI0L 3WDIA 3P4LA 1K5NA 4BSVB 3WEXA 4RMUA 4A6YA 1EO8H 3MLTB 4FQXD 3SDAD 5MERA 2PO6D 1NBVH 3RBSA 1G9MC 1IVLA 2ZKHH 5FYJD 2B1AH 3W5NA 4JFDE 4ZS6C 3TO4B 1CCZA 1LO0H 3GBNL 3QDJB 2FBJL 4WUUD 5IM7B 2B39A 5DEZA 3KJ4B 3RVTC 1DLFL 2H32H 4X7DC 1IT9H 4HXAL 1EBPA 2BNRB 2DB8A 5DQDL 5DURD 2P8PB 4FQ1H 2Y36L 2D7TL 4OV5B 5IGXL 2Y72A 3IB4A 1YQ2A 5HDQH 1NH6A 1TJHH 4AL8H 1ZGLM 4NJ9H 4PRDA 3U4BH 3CU7A 4POYA 5DA4A 4W81A 1W0VA 3HE7A 5DYOB 4P2OA 3GSNH 1YNTA 5IBLD 4M3KB 4X8XA 5EDXA 3RGVA 4QHUB 2VDKH 3CVHB 4HKJB 3ZZ1A 3FT2A 5IEKA 4NRYB 1CL7L 5KW9L 1HYSD 3HRPA 2VXQH 4PJEA 3ILPB 4LLUB 3DO7B 4ODVL 4L29B 4QGYA 3EYOA 4L9LB 1WCBB 2EYTB 1L4IA 3DBXB 4L8CB 5D1XD 3TIDB 4YIQB 4NBZB 5T1DL 5BW7C 5I1EL 2GI7A 5EOCH 4AM0B 1JGVL 4HKZA 5ICYB 4FQIH 2V5SA 1KEMH 1KG0A 2W91A 5DYOA 5ESQA 2FEEL 1EHLH 3W9DB 2N7AA 5I0ZA 1YEFL 1T5XB 2R2BB 2EKSB 5I8OL 2NCMA 1KPUB 3P73A 3EIFA 4I8DA 2OXHA 4TVPH 3BAEL 1OF2B 1OAUL 5F88B 1TVHB 3KVQA 1XF2A 2H2PD 4MXVE 2DQGH 5IHUH 4QYOA 3AMKA 4PV8B 1AE6L 1LO5A 1AFVL 4P5TA 1T2JA 1EAJA 1A6PA 1OTUD 4QRPB 3VXUE 5IHBA 1ZVHA 1A7NH 4GKZB 3NIGF 3DHMA 4OZIA 1C12B 5D5MF 1HOCA 4YXLL 4DZ8A 3VCLA 4MQ7B 3CZFA 5D8JL 3AFLA 4MCZB 1EHAA 1BQSA 4PRBA 1KSRA 1OWRM 1RJLB 3JV4B 4PGEB 4O5LH 2BVTA 2QADC 3UAJD 5E4EC 4OZGA 3ZYZA 1JNHA 2CDFA 1PG7H 2Q86B 3T0XA 3OMZA 2WBJC 1J8HA 2Y06H 3EFDL 4XC3H 5HI4D 4RQQA 2WW8A 3PWVB 3FQUA 3PJSB 1OCWL 4LASL 2EDFA 4ONOA 2YSSA 2VLKB 3MV7A 3IDNA 3VFSB 3ARTA 1VENA 4D0DB 2BX5A 2Q3ZA 1NFAA 3PF2A 4YPGB 3FQWA 4HPYH 3MXWH 3MRCB 2XACC 3FAXA 3NN8A 1BQHB 5HGHA 3SJVE 4LSUL 1P5VA 4DVBB 3TVMD 3MBEB 5I2IB 4M6ML 1NKOA 3QDMD 1H3XA 2FB4H 3F6LA 3N1GC 4X4ZA 1KBGL 1LD9B 1MHCA 1RFDL 3LZFH 1I9JH 2VTFA 3QNYB 4Z76B 3I6GB 1WCQA 2AEQH 2VDLL 2WZPD 3FQUB 5GS2D 3U7AA 3SDXA 5LGHL 4JDVA 4AH2B 2VDPL 3IDXL 1BVKB 1K3IA 4M5YL 3MRGB 4WW1B 2J8UB 4JQXC 1NCDL 3BH8A 4HK3N 3CAFA 5D7LE 5A2FA 2V2TB 3UROR 3B8SA 2NXZC 2BHZA 3L5JA 5BMFH 4JHWL 1UGNA 1YPZE 4FTVA 4P23A 3DX9A 4RNRB 1ZT1B 5DHYB 1RU9H 4JCMA 1UZ6F 3L5WA 4PLJC 3HE6B 4NO2A 1QSFE 1IGMH 3EBAA 2J88L 5HYJE 2FHCA 4F7PA 1CDJA 2ADJB 4HAGA 3FFCB 4BQ8A 1FYTE 1R3KB 2VDOL 3SDXB 4ZFOA 3BHBB 3X11B 1FSKC 3MV8E 3VXQA 2KQNA 2XPGA 1BJ1H 5FO8A 5CLTA 3TPKA 1SY6H 2VN7A 4RWHA 4QRQA 1FJ1A 4MS8C 2GJZA 3VFPB 1LO2L 4NQSB 2I26N 3RWHA 3U30C 3D9AL 3P0YH 2A6IA 4LAQL 3LIZH 5FDWA 1AO7E 2P5WA 4QXUL 4Z95L 5HPMA 1A9EA 2C1PA 2BNQE 1IAMA 4CN1A 1K8IA 2BOCA 1IJ9A 1CS6A 4J7RA 3UJIL 3GSNA 4LGRB 1YYML 4XCNA 5FUZH 4G7YH 4ZO7A 1JTTA 3PWPE 3TVMC 3U9UB 1TENA 5SWSB 3B9AA 4XNMB 4LLYB 2OL3L 4OLEA 5GJTL 1EERB 4LPYA 4YXHL 2A0LD 3I6KA 1U8IA 3W9DA 4YHYB 3OXRB 3UTPD 1UM4L 3QO0B 4XZUA 3FRPA 1NUGA 4XPHL 3VFOA 4PGJA 5D7IB 1KGCE 1IGJA 3QQ9D 4MVBC 4NO3A 4KQ4L 2EYSB 4D3CH 3DYOA 2VLRB 4PJCB 2GSIB 3QO1A 4L8SA 3WD5H 2MCPH 5DMKA 4TRPL 3SGJA 5C6PB 1ZT4B 2V5TA 3JWDC 4CADB 4KJPD 1VB9A 4NJAL 4MSWA 2AJ3A 1U6AL 4FQLH 3U0WH 3PDOA 4PRHB 1CGXA 3CMOL 1L7TH 1KC5L 4NO5A 4Z7OE 4N1HB 1JFQH 5FOBB 4EZMA 3F12B 5FOBA 4PJGF 2R1WB 4TULH 3WL9B 3U6RA 1Z3GL 1QZ1A 1B0GA 1XIWA 5EIVA 3ARBD 4JPIA 2X4SA 3WXVL 3EYVA 2BY1A 3LD8B 4O4YH 5C0CE 5E5UB 3WJJC 2D7QA 3GMRB 1WZMA 2X89A 5CP7A 1XF1A 5CWSA 3LMJH 4BQCA 4DUWA 5IQ9A 1ETZB 4WI6A 5D7JC 3S3SA 2XTJC 4XI5C 4PJGB 4PTTB 4JO4H 5TPWL 2EXYD 4YHPA 4OAWA 4DOHB 1T21A 1DE4A 3MOAH 4JREB 1IFHH 3T65A 4NHCH 4LHUD 4HX1A 2AXHA 1AQKL 2Z4QA 4JZOA 1X4YA 4HIIA 4KK6D 3I50L 1GGIH 2CK0H 4XB8A 5E2VL 2APBA 2XTLA 2QJDA 4L4VD 3TM6A 3QFDB 4ZFZA 5I16B 3VCLB 4LCCA 3TBVB 5GZOD 4I18B 2HH0L 1AJ7H 1JWSA 2AXFB 3IXAB 5HPOA 4JFDA 4D0BB 4TUOB 4KVNL 3MV8D 2X9WA