1Q9LA

S25-2 fab unliganded 2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-2 Fab (IgG1k) heavy chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
total genus 43
structure length 219
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9lA01
4M6OH 2CRZA 1FNLA 1DDHA 4H20H 4JZNA 2R56H 5E1HB 2VC2L 3D18A 3I3BA 5D6DC 5FB8A 3X14B 3GMLA 4H8WH 5CLWA 4DOHB 1IFHL 2DQHL 1CDJA 1IRAY 2HFTA 2H1PH 3K74B 2B39A 3SQOL 2D03H 3U7WH 5DQ9B 3MXWL 3LY6A 1A7NL 3AS1A 2A9NL 1G7LA 2R29L 4HCRL 2PXYB 4I3RH 1I1RA 3U0PB 1JNLL 1MHPH 1R5IB 3PGCA 3GMQB 1BFSA 3GSXA 1UWXK 1LEGB 4ZOCA 1T83C 1QLEH 3HMXL 4LHJB 5CJ5A 4XH2B 1EEYB 1KUMA 3QEQA 4OCLC 4MX7B 5INDA 2IH1B 4U1JB 3IFNH 5C0JB 1W0WA 3RZCD 4YHKH 5J6GB 1BWWA 2JB6A 3C6LA 2GTWB 2NZ9D 1ZLSL 4WFGD 1K8DA 5DLML 1CI5A 3ALWA 4Y2DC 3JZ7A 1T6WA 2DTMH 3TNMA 1VPOL 4ODVL 3QJFA 4QXTA 4U1SA 4UOW1 2YN5A 1AGBA 2EIDA 5JW4R 5GZOC 4S1SL 3MRBB 32C2B 3OJDB 3MUGB 4I2XA 5K9JL 5ACMA 5KSUB 1XGPB 3TJHD 1YYLH 2GCYA 4WTZA 4HIEB 1NFIA 3STBA 4K7PL 3OF6A 4P3WA 5CBAA 4Y1AB 4XPAL 1RJLA 4OLWL 4KI5F 2R4RH 2FRGP 2DQFB 4XC1L 1ZHNA 2OJZH 4I4WB 2ICWI 1F4YL 5CJXA 1ZKAA 2OP4L 4YHLH 5B21A 4APQA 4IJ3C 5IVXE 4LF3A 2CK0H 4QOKD 1FNEA 1FVEB 1YEGH 4R0LB 1MAMH 1RUAH 1R6VA 5F1IA 5FUOL 4ENED 3VFVA 3WIHA 3DX8B 3QQ4B 4TQEL 1JHTA 1IKNC 4XBPB 4XPTH 2UV3A 5JNYA 1GIGL 1RIVH 4JLRB 4Y8AA 2CDFB 3L3OB 4L3EE 1S9XB 5BOPA 1OTTD 4LIQH 5HSFA 5I1AA 3R0MA 4EQ2A 4GG6F 2VZSA 3EHBD 3QIWB 1GOHA 3VXUA 3WSQL 5CS7A 4OCXL 1A21A 2BSRA 2I07B 3GJFB 1RJZA 3KPSB 1DZBA 2JCCB 1K6QL 3KJ4B 4LLDA 5C07B 1MIMH 1N6QH 1V5JA 2QKIA 2YEZA 4JPVL 1IGYA 4FZEL 4JFDD 3MOAL 4U49A 4GAGH 3O4OC 3ISWA 5AAWA 5CAYB 2NXYB 4YDJB 4KQ3H 4IOSD 2AJSH 1A1MB 3HUJF 4JRYB 3WNNA 4Z7NF 1LO2L 4XTRD 1DBAH 3MOQA 4PG9A 2OL3H 2HT3D 4PR5A 2B1AH 1UYWL 3SDXB 2QQLL 3EOTL 4NHCL 1T5XB 1CFSB 1UA6H 2RIKA 4NN5B 4B7IA 4KKAD 2NPLX 4YDVA 3ZYOA 3SHSA 4F9LC 2NY0C 1FC1A 1XF3A 4HT1H 4NN6B 5E6IA 3UAJC 2QV2A 4HIIA 1RK0B 2XQYK 2HP4A 4P46A 3CVIH 4HH9B 1ADQL 2HRPH 4F7MA 4NN7B 1ZLUK 3AGVA 4OV5A 4P4KB 1DQMH 1G7PA 2VDRH 1EPFA 3KXFE 5I15H 3P0VL 5CMAB 5GRVK 3GNML 4OLUH 2VMFA 3WKMH 2HN7B 5E08H 4HULB 25C8H 2I26N 3N0PB 1XF2B 3VMOA 5SWZB 4K8RC 1J86A 3FB5B 5JO5A 1I8KA 3L3DB 2H32A 1TETH 2VDKH 1VEMA 2VXSL 5IKCA 1B0WA 3QO0B 5DS8B 5D7IA 3K2UH 5K9OB 4TUOB 2DQJL 2ZUXA 2AGJH 3CXHK 2H26A 2A9MH 4E0RA 3IU3B 4HUWA 4P2OD 5D2NE 1KLGB 1FZJA 2OYPA 3NPSC 3DSNA 2ADGA 3EYUL 5F9WB 1JRHI 2BVUA 4ZSOE 1NDMA 1S3KL 3IFLL 3O3EA 4HS3A 1CTNA 2GSGB 3LKSA 3RWHA 3FQRA 5I16A 3MR9B 2YD8A 4NO2B 4BFGA 5LXGH 4R26H 4OZFB 5TQ2L 4OAWB 1GGUA 2Z0BA 3WIFA 2AABH 4KI5D 3GKWL 3PQYE 2DS4A 3MV11 4JPKL 2VE6A 3RVUC 1JYVA 2BHUA 2E7LC 1R3LB 5E8OB 5J3HC 5JW5A 1AH1A 1ZS8A 1ZANL 4LCCC 4AIZA 2GSIB 1AGCB 3VRLE 3E6FB 5FK9A 3QI9B 4LCUB 5IMOB 3WHXB 4J8RA 4ONGL 3AAZA 4Z5RB 1I9JH 4C56B 5E2WL 1INDL 3REVB 3EYSH 3U82B 3VXSA 4U6VL 3ARXA 5LKNA 4HGWA 5A43C 1S7WA 2VL5B 3QFDB 2CD0A 2H9GB 4GRWE 3QUKA 3D0LB 3H9HB 3S9DB 4GAFB 2DBLL 1JK8A 4U1NA 5F6IC 3IFOB 5CHNA 4CJ1A 1ZHKB 3UTPD 2BOBA 4D0DA 3BZ4A 4JKKA 3BKCL 5H37G 1B90A 4PRPD 3CFJA 3UCRA 4DOHE 2GKIA 4X98A 5CINL 3QDME 3VFGL 1CGWA 2DDQH 5T3XL 4JFZL 4ONHA 2QHRL 1MNUH 4H20L 3TBVB 1MCQA 1K2DA 1NLDL 3ARDB 4QEGA 5I17A 1ZLVH 1KB5H 4NQXA 1I8MB 3MMEB 2VITA 4H8WL 5AD0A 3HMWH 2H1PL 1T7VA 3U7YL 1X5FA 3EDDA 3U7WL 1DVFC 1IEHA 4MNGB 5D2LB 3WLWC 4L1HA 3D1MC 2OTPA 4BZYA 2ICES 1CFTB 3PGDB 5KS9B 1JYXA 3KNBA 5DVNA 1T04A 1EMTH 4JHZA 3W0WA 2BRQA 3QUXB 1EBPA 4LASH 4ELME 1ZHBA 3U46B 5I1IL 4KV5F 1NEZB 4OZGA 2VZ1A 1QLEL 1FL5A 4KROC 4JFEB 1C1EL 1CGSL 3F7VB 4WWKD 2KL6A 5C0DA 3VMNA 4NUJB 1CT8A 5HHOD 2CH8A 4PJEA 4KJYB 5T5FH 5BVJB 2VLMD 4DCQA 4J4PD 4GXUN 3S96A 1WCBB 4WEUD 1Q94B 4HC1L 4WJ5B 1PSKH 3BGAA 4PGCB 1D5MB 5LGHH 4U33A 4W4OC 2FJGB 4EIZC 4RA3A 4H5SA 1CDBA 4DJMA 4Y1AE 3WHE0 1A6AA 3U79A 4UDTA 2ESVB 4JB9L 5E24E 5FGBC 4CVUA 2A1WH 4F15C 3PWJB 4LFHG 3KYKL 4JR9H 3DI2B 3GSQA 3QDGD 2GK0A 1K4DB 5KVFL 1EHLH 3L6FB 3FO1B 1WIPA 3OX8A 4RFOH 5IBUB 4GW5B 3WN5A 3STZB 1OAXL 3P73A 5H2BA 1RD6A 3I2CH 1QBMH 2VZ3A 3QXUA 5EOQH 3Q1SH 1JRHH 4A6YB 4CVZB 4G9FD 4KTDL 4ALAL 3I84A 5TE6H 2VDLH 1CZ8L 1RZJC 1S9VB 2Q76A 2IH3B 2BXZA 3ECBA 1GC1L 2EIBA 1X5HA 4M7LL 1FNGB 4QXGH 3P11H 4RZCB 3VRIB 2Q20A 1F3DH 3KPSE 4KK5C 2HLAB 4HKXB 2JCCE 5C07E 3LPWA 4NUGH 2MNUA 4FQLH 5J13B 3AB0C 3MGTA 4CRPA 3RAJH 3C09B 5F44A 3H3KA 1U0QA 3IJHB 3ES6B 4IRSA 2IWGA 3ZT7A 1F3JA 1OLZA 2WINA 4YWGH 4HKZB 1VENA 3CVHB 4MB5A 5HHVH 4MMZC 4JRYE 3V8OA 1H5BB 4JO2L 4HPOH 3VDAA 2WUCH 4UBDC 1RUQH 4MS8C 4GMSH 15C8L 3SDXE 3VD4A 2W9LA 1EVUA 4MCZB 5IJKC 4KY1H 4C55A 5KTEH 1UM4H 1U8IA 2AJSL 1OTSD 2R9HC 3BD3A 1ONQB 4GBXD 4D9RE 4ZXBA 4Z7OE 5EO0B 4NQDB 5DMGC 5EULV 3CFCH 1ND0A 2VDNL 1DBAL 3MZTA 4M62L 5IB3A 1NCCH 2OL3L 3EJYC 5I75C 1P84K 1KFAL 2XKNB 3K80A 2BSSA 4RMWA 1XGTA 3K4DA 3WS6A 4O58H 3PDOA 4RGND 2G9HA 2N7BA 3Q6GH 3ZTNL 5AG9A 4DUXA 3JV0A 3SE4C 4KQ4L 1JF5A 4OSUL 1P4IH 3PWNA 3U1SL 2YC1B 1XEDA 4JGMA 4J3TA 3RZWA 1C16A 1FFOB 3CVIL 1JYNA 4N1EA 5JLZA 2HRPL 1K8IB 1EEZB 1SQ2N 1UWGH 5IFAL 5IVXA 5SWZE 3ROOA 4LP5A 4KJWD 4JVPA 3RWIB 3MRCA 2DLHA 1FL3A 1T0MB 2HA1A 2ITCB 3WHE1 2IJ0C 4PREA 5E70A 5DJAB 2Q7YA 5E08L 4U6YB 1VFBB 3CC5B 5F9OH 1FN4A 4D0BB 3S88L 3HE6B 1K4CA 3ARUA 4TNVK 4L3EA 4NO0D 2JJVA 1F4XL 4G6AC 2R0WL 4LKCB 1D5ZA 5DJYB 5CKGA 3U2SB 1QSFD 1WICA 3OPZH 5D1QD 1SY6A 3BVNB 3ZKNC 4PJFB 3CPLA 2UUDK 4UQ2B 1EUUA 4NZRH 3RUGB 3TJEH 2BOCB 3CSBA 2OLDA 2FDBP 2FR4B 4UINH 2N7AA 3HS0A 5I8KL 4K94H 1A7QH 4NCDA 4UTBL 3X17A 3QDAA 3T3PE 2VR4A 4JQXA 1S7VA 5GSVB 4RAUA 4YXHL 3UTSE 3VXPB 4WU7B 3BH8A 3AMLA 2XNAB 4G7YL 1YEJH 3RZCA 1PZUB 3SY0B 4AEHH 3GUTA 3P9WB 3B9KD 2PW2A 3MA7B 3PHQB 2IADA 3VFSB 1KJ3L 3P0GB 4LLYA 3KLHD 2EXWC 3HI1A 3BMVA 3GSNH 4LVOB 4ZDHA 4C56E 2ZZUT 3L3KA 4NSKA 3FONB 3G6DH 1DQQB 1XMWA 2CJUL 5C09E 2ADFL 2VNCA 1QZ1A 1RZGB 1ACYH 4OI7A 4GKSB 3TYGH 3PABB 1I9JL 4O2FB 1OSPL 1G1CA 1WWCA 1Y6MR 5DA4A 4MNQE 3KXFA 5HGGS 1BQHG 2VQUA 1C5DA 4HIXH 2P5WD 4PJAA 2O5XL 4G8IB 2VZOA 4LVEA 4OGXL 5HYFA 1SYSA 3QQNA 4M7KH 1BM3L 3I9GH 3UDWA 4PBWD 4JANB 3TBWA 3IXAB 4PJGB 5HPMA 3S36X 4HV8B 4P2RB 4H1LB 4Y5XC 4ZAKD 3U36A 3QIUD 5DURD 4QOKA 4LOUD 4LQFH 1GOFA 4HMDA 1F4WH 4FQXC 1FYHB 1NGQL 1MNUL 2FIKA 4XRCB 2YD9A 5D2LE 3RX5A 1QBLH 2J8OA 5GRUH 1UGNA 5C9JA 5D2NA 1KB5L 3RL1A 4PJ8D 1MFCL 3KPLA 4UTAH 5KS9E 1HQ4B 1WWAX 3FQTA 3EDEA 3DXAB 1BECA 3HMWL 4XHQA 4ZSOA 2E7MA 3CSYB 2H41A 4BSJA 3NZHH 4OLYL 1P7KA 3SGJA 3IJYA 4HPYH 3WLBA 1V7MH 1F6FB 1TZIB 4NRYB 5KN5B 1DJSA 2DL9A 4Y89A 1X5KA 4AMKL 5GGUB 5TE4L 1ES0A 3BEVB 4JFEE 4PRAA 5KVGH 1FZMA 5E2VL 3U4BH 1U8KA 1RZKL 3PQYA 5HGBB 1CQKA 2E8YA 4JFDA 3BW9B 5D7LD 2CKNA 1J11A 1KC5H 4ZQKB 2BRRL 4OD3L 5JW3L 1A4JA 1KCUH 2EDRA 4AH2A 1I9IH 1B4JH 2XWJB 2BCKA 3QUZC 1RAMA 4GKZA 2X4TB 1NCDH 4P3DB 3PWLA 1O7SA 2X89A 5KVMC 1ZA3A 4X5LA 3QSKB 4X80L 4FZ8H 3LS4H 3SDAC 3ZDZE 4QGTA 3BP6A 4XP1L 2PTTA 3MRMB 1TTFA 4X5XA 8FABB 4ZFOB 2ESVE 3I02B 1CU4L 1PSKL 3U4EA 4CU8A 2X1WL 2EEBA 3TA3B 1H0DB 1KTDA 5A3ID 3OZ9L 1R0AH 3EOBB 5E7BA 5ITBL 1VACB 5ICYA 3BP4A 3G9AB 5HHXL 4MHHG 2Y07H 3VWKC 2DLFL 5E03A 3X14A 3F7RA 5KG9A 5M7QA 1Z2KA 4NJAL 5FKAB 2NX5D 3QDMA 2LQRA 1NMAL 3PGFH 3S3PA 1C12B 3MACL 4NWTL 4R7DA 4JFXB 2MMXA 2WIMA 1SHMA 2ZSVA 3D85A 1EFXB 5IBUG 2HTLC 2OS7A 1IJ9A 4YDKH 3FB6A 5I6XB 3B2UC 4X6FB 3OAZH 3RTQB 3SGEI 4LP4A 3Q1SL 3S35L 1BZ9B 4YE4H 1ZGLM 3OBAA 5DVMA 1YEFL 2H6PB 5CD5D 3W82A 3WIIL 1LEGA 2J8UB 2AP2A 4OBSA 2VQ1A 4WW2F 3MYJB 2OR9H 2CRIA 4QY8B 1KXVC 2XG4A 5AWNH 4J12A 1BBDH 1LO5B 5D8JH 1A9BA 2MOVA 4U1JA 3P11L 3RWJA 4ELMA 5KSVA 3ARRA 1REIA 3N1PC 1BQUA 3FT2B 5F9DC 2IG2L 4LHUD 5D93C 5F7EH 5J12C 4EN3A 2GTZA 4RQQB 1WBXB 3LHPH 5BS0B 3RAJL 2FZ3B 5D1XA 4NT6A 3QR2A 2X1QA 1GZQB 3RIFF 2Z8VC 3CDCA 3WFCH 2WWMC 2WBKA 2B2XH 2XZQL 3IGAB 1QUNA 5EU6B 3RGVB 1FG2B 4YWGL 5DJZA 2EDJA 2NR6C 1EFQA 1MLBB 3CNKA 4OTXH 4EI6B 2D9QB 3RNQB 3LH2H 4NPYB 4EDXB 3GBML 1GL4B 2ZG1A 3MRBA 3OJDA 4L4VD 1V3LA 2IFFL 1EEUA 5GQBA 4LPUA 4U6HB 4XC3L 4BFIB 2HT2D 5HI4C 1NCCL 4I5BA 4I4WA 4JVUA 1TQBB 1X5IA 5J11B 1WF5A 4XNXL 5BZWB 1OP3H 1U58B 4O58L 1ZLWH 4CMMB 3IJSB 4WDIB 2RFXA 3AFLA 4XX1E 4ZFZA 4TN9A 1ED3A 3Q6GL 1MCSA 5CD3A 1FVEA 5C0BE 2AW2A 3QA3A 3RNKB 4R0LA 1UEMA 2YSSA 4LIQE 1FJ1A 1FFNA 4TUKH 4PP2B 5IOPB 1MCCA 1OSZA 1B0GB 4S1QH 1I7TB 1CS6A 4D2NA 1FQ9C 4XX1G 1RFDH 3KWWA 5JXEC 1JN6A 2YPLB 3L3OA 4G8GD 4HS8L 1KJ2A 3Q5YA 1XCTA 1IKFH 1JL8A 3ZKSD 2VYRE 3QIWA 2J6EL 4Q6IC 5ESVB 1PY9A 3GJFA 3DX7B 5F9OL 3KPSA 5GS3A 4PJFE 1BAFH 4DGIH 3OKOB 5C07A 3JVGC 1JZ2A 3G6AA 3RUGE 1BVKA 5A2LH 4S0TD 3T1FB 4ODXB 3VD7A 5E5UB 4JPWH 1QLRA 3UC0H 1G6RL 4KK9C 5TJWK 2VXQH 3QEGH 5B4MD 5IVZB 5IMKB 1JPGB 4P2CG 1JNNH 5T5NF 5BQ7A 1UB6B 1K3ZA 4NCC2 4NZRL 4O9HH 5TFSH 5E8EB 3AM8A 3RI5F 4X6CB 3CJJA 4YHIB 4EXKA 5L6YH 1XIWB 3ULUC 2E7CA 3SDXA 3PHOA 4NHUA 4TSAL 5EPMA 3BN9C 4DQOL 1A7QL 3KPQA 3D69A 1MH5B 1FORH 2HFFA 4PGDB 2DM2A 1Q9OA 1NSNH 5L9DL 3UPRB 1QHOA 4J3OC 1J7VR 1RK0A 5EZIL 1H3TA 4JHAL 2HH0H 3MV8B 3TGXA 4HH9A 1R3HB 2WBJB 3GSNL 3KLAB 4PBXA 3U9PL 1C08B 2CIKB 2B4CH 5EU3A 3QRFM 3ULVE 3RVTD 3K2MC 4KAQH 4TPRH 1BVLB 1IARB 1A1NA 3LQZB 3QUML 4C83B 5KSBF 4JM2C 2HN7A 1IGIH 3L9RB 4QCIA 4XP4L 1TZGL 3I50H 4X6DF 2G5BB 3EIFA 3SGEH 1XF2A 3AS3A 5SWZA 3BGFC 2EE2A 4PJGE 1A2YB 3FB5A 2FX9L 4NC0B 2GT9A 5A1AA 1G9NH 2VR9A 1CFBA 2X4OA 4WO4A 3M1BB 3QDGA 2VDPL 1EERB 1D6EA 4FRWA 5DS8A 4P57A 2DKUA 4P23B 2HKFH 5BXFA 3PDDA 1A6UH 4F8QA 2JIXA 4QRRB 1DQJB 4GW1A 4G9FA 2WBWB 4NKDB 4XAWH 4YAQB 5E1AA 4U2YA 3NGBB 3HPJA 3Q3GB 3G6JB 3HAEB 5I8CB 3PP3H 2B7DT 3KPPA 3DRTB 1MJ8L 4I3SL 3VGGA 3GIZL 3WNPA 1IC5L 1OAQH 2AK4D 3TZVC 4NO2A 1T20B 1GAFL 3KYNA 4MCYB 4D9LH 2HMIC 1AR2A 3R06A 4LCIH 2P46B 5F70A 3TO4B 1GSMA 4DGYL 4RX4A 3UTSA 4ZTOL 2ZSWA 5F89B 4HPYL 4CNIA 5GS1A 3R0NA 1V7ML 5IBTL 1KEGH 3QCUH 1JGVL 5EORL 5JHLH 1L6XA 2APFA 4CMHB 1DSFL 1WFNA 4LCUA 3SDCC 4Z5RA 2N4IA 3TVMB 3REVA 1BQHA 5DEZA 5C09A 2EO9A 5D1ZB 5MP6H 3EO0A 2QSQA 5I2IB 3D0LA 3KYAA 3W5NA 1GPOL 1T66C 5EZJA 3SE9H 4FZ8L 5ICZB 3OSKA 5F88A 4HUUB 1LD9B 1FIGL 4MQXC 1C7SA 2BJMH 4MNQA 1BOGA 1MCKA 4PJ7B 2M2DA 1OGAD 1Z3GL 1R3IH 4YHZH 5AYUL 4WFEE 1G9MC 2IAMC 4F3FA 5DEGB 1LE9A 5GRWA 2RBLA 1MRFL 4LEXH 1A1OB 2XA8H 2H8PB 5GGSB 2F74B 4ZPTB 5FV1L 1UM5H 5MI0C 1HXMA 4G6ML 4FFZL 1I8MA 3MMEA 2NY1B 2C1PB 2ARJA 2CPCA 4HW6A 4X9IA 3TF7C 3WDJA 2IMNA 1XF4B 3PWVB 1R3KB 2OQJA 1TQCC 3DETD 4J3SA 3QHZH 3UEZA 3MCG1 1BZQK 4HLZH 1T1XB 4YDKL 3DBXA 3SOBH 5C3TA 1NBYA 2EDBA 3DUUA 3RQ3A 4FFVD 4QTHB 2PO6C 5I8EA 1N5YH 5ERWB 2H2SD 3F5WA 1B0RB 4NO5A 3DARA 5D1QA 4G43A 4NQCD 4I9WE 1Q1JH 4NNXB 4Z8FH 3H0TA 2W0LA 3O9WD 4IIQB 5EU6E 3GSVB 1FV1B 4WGVB 3O81A 1TTGA 2QQNL 2A6DB 3K1DA 4Z7QF 4PYGA 5ACZB 2ORBH 3DO3A 4F33B 1PX3A 3NIFE 5L0QB 5CSGA 4Q9RH 4IOIB 5ACLA 2W65B 3E3QE 3QAZB 3V9FA 3NTCL 2BDNH 2ERJB 3OTTA 4BSWB 3WFCL 1V05A 2DQTH 3NOIA 4NOBA 5E2TL 1IAKA 4JFFB 4JG1L 1GYAA 4JO3L 4Y4FB 1UJ3B 2PETA 3LH2L 3DV4A 4KHXH 1NCAH 2ESVA 3F7YA 3VXOB 1U3HC 4DVRH 4GRLB 2R0ZL 5I1GH 3LEVL 3V0VB 3MRRB 5GPRA 2BNRB 1K4DA 2GFBA 3MRFA 4WIQA 3ZKMC 2W60A 3FO1A 1YEDA 4L29A 2CDGB 3GJEB 4EZMA 1W8NA 4FFWD 3Q5TA 5I30L 4K8RL 1F45A 5BV7H 2VLJD 1N5AB 3RKDC 2BK8A 2UY7A 2MTPA 2ITDB 2OXHA 4QHNA 5SX4H 1MFBH 3O8XC 5C9KA 3ARBD 4F7EA 5JHDE 3CFDB 3GSWB 3D9AL 2IH3A 5IHZA 4PJ9D 1UB5B 3OXSA 4MLIA 1IAMA 1Q0YL 4RZCA 5DQJB 4V1DB 1L0XA 5EU5B 2VTFA 3EO9H 4AJ0A 4OCWH 2EH7L 3QIUA 3KYMA 1RFDL 5GGQH 3H7BB 4Y16D 3T8XA 5C0ND 1HH6B 5IEKA 2RJMA 1YEIH 3IJHA 2GHWB 1RURL 1Q72H 3SO3C 3ZZ1A 4Z7WF 4PJ8A 1AI1L 4PB0H 2G75A 3U7AA 4AG4H 4HKZA 1D5XB 2DI7A 2YK1H 1NCBL 4LSRH 3EYQD 1HNFA 4X6CE 5DQDH 3SCMB 1BHGA 5C0IB 5I66B 2FL5A 2HTKC 1I8IA 1FNSH 2AJYH 1KLUA 3QXDB 1ONQA 1LEKA 1JNNL 3S5LB 4TOYH 4G5ZL 1V7NH 5EO0A 7FABL 4O9HL 4RNRA 4Q7DA 5D7LA 3ZHDA 1KPRA 5D7JB 4JG0L 3MLRL 1BLNB 3V7AE 3EYFA 4PRNA 2A2QT 2VLRD 4HKBB 4E5XA 2BSTB 3PXHA 3VCLA 2VDML 3C6LC 1AKJD 5LG1A 2DQCL 1NSNL 5DRZB 2YMXL 4HUKB 3V7AG 3FCTB 4R2GD 4JDTH 1NFDB 2CUMA 4Y7MA 1FFOA 2C7UB 1EEZA 2H3NB 2WQ8A 3EZ8A 5BO1H 5C0BA 3B43A 4O2EB 2ITCA 4TPRL 5CJ8A 1A14L 3QULB 4PJDF 3JV6B 2DM7A 4Y2DD 5DJAA 4OLVL 3DX9A 3C08H 3D25B 3T2QA 1L7IL 4GG6B 1UCBH 4P3CH 4YXLL 3PJSB 1DFBL 1ULVA 2YXMA 1W72H 4N0FA 4QRRE 4PY8J 5GZOD 2AI0H 1G9NL 2BC4B 1WT5A 3GBNL 1CIDA 4YQXL 3T0WA 1RZFH 5I1JH 1BBJB 3G6JE 2PW1B 4QRSB 5CJXC 5DUPL 4G6JL 3DVGB 2VABA 5J9PB 1G7IB 5J56B 1A6UL 4D8PB 3RUGA 2BOCA 3HUJB 2OL3A 4U0RB 2W38A 4M03A 4XAWL 1UWXH 1A3LH 1U8LA 4H88L 3HAEG 3V5DB 1OP5H 4NRZB 4L8BA 4CL7A 3BEWA 3L95B 1VADB 2JJTC 4U1GB 4HXBH 1FFPB 3T04D 3VFNA 5I18L 3BIBX 3C8KB 1WAAA 3MUHL 5DR5H 1JV5A 4KJQC 3DVNA 4NRXB 1YN7B 2YXFA 5GGTH 2C4FT 4WWKB 2O61B 4CVXA 5C0CD 5HHOB 3DROA 4MB4A 1NCWH 1RZGA 1U8PB 4HUXA 2AS5M 1TZHB 2F58H 4PBVC 4L4VA 2QLVB 5FYJL 1URLA 3L5JA 1KT2B 3CFKA 4PJ7E 4UU9B 1MLCB 3MJ7B 5EIVA 2P5ED 2B1HL 5FGRA 3SE9L 4JANA 2BJML 4UOJA 4PJGA 2Z4QA 4KUZH 5IESL 4OFVA 4HV8A 3CXDH 2X7LB 3VGAC 4MJID 1AGEA 3NN8B 2PF6A 1A22B 5E6IC 2Z8SA 1CLCA 2OTWA 4RMUA 1QVOA 3FN9A 2XA8L 1WBYB 3B9VA 4NQEB 1UM5L 1YUHB 2IBZX 1R5VA 1AIFB 4U1KA 1RZIA 2NY6B 3UAJD 3V4VH 3ZHKA 3MV01 4JZJA 4P2QD 5E99L 4G8GA 3ZKXC 4XCEB 1JPSL 4WHTB 3CSYA 2ZCHL 2AJXH 5J6HB 1J1PL 2P8MB 1F58L 3QHZL 5GJTH 3GJFK 3O45B 1MCEA 5KN5A 1I75A 2GAZB 3HE7A 4MD0B 1U8OB 4R8WL 5GGUA 2DJ4A 2E9BA 1TVBA 4CN6A 1YMHB 4DVBA 1E28B 5T1DL 2JB5L 1UENA 1NMCC 4FN0A 1H3PH 3BWAB 1H8OA 5CEXB 2OXGA 5IK3A 3CDGB 1U8JB 1VGEL 2X4TA 2B0SH 4P3DA 4P5TD 5T1MB 4PY7A 1B2WL 3HI5H 1F8TL 3D3VD 1ZT4A 3GGWB 4XGZA 1YNTA 4PB9H 4BQ8A 4WRLA 3MRMA 4Q9RL 3IETB 5F9JB 2UY6A 1YPZB 4FQCH 1IT9L 3RY4A 2YUVA 1KJVB 2C1OB 4PJCB 5GS0H 5K9KA 3IU4L 4LPYA 3OJ2C 4NOFA 3TA3A 4QHLA 5C08B 1M71A 4XVUC 3UPCA 5F7MC 4HBQA 4TSBH 4OV6F 1LWRA 1D9KA 3EOBA 4POZD 1DANU 2BNRE 1VACA 1YN6B 4Q9CA 2C3HA 2RB8A 2EH8H 1KB5A 5I73C 4RISL 4NIKB 4Y88A 4FQ1H 5C0AD 3HNVH 4WU5A 2P24B 2V17L 1FFRA 5FKAA 5I1GL 1M7DA 4JJ5B 4NWUL 3HNSL 2APTA 1PKQB 3HPLB 4TULL 4UIKL 4PJ5E 3RVUD 3QQ3B 1NH6A 5CZXC 3L3JB 5J3HD 3QCTH 4UILH 2J7LA 4MXWH 5AZ2L 1TJHH 3CU1A 4Z95L 2F54B 4HKJA 5FIEA 4IOFC 4Z0BH 2IGFL 3EYVB 1BZ9A 4F9PA 5L2JA 4BELD 1RUKH 2FHCA 1KEML 1U2CA 4QY8A 1WTLA 2YN3A 1LO5A 1Y0LA 1LO4L 1JHKH 4NKOB 4QRUB 4F7TB 3H9SB 3P9MA 1I1CA 4TYUA 2XXMB 1T0NA 4M8QB 4RQQA 1WBXA 1VFUA 3P4OB 5ISZD 2FZ3A 3SKMB 1QSFB 4FNLH 1YEIL 1DR9A 3RY5A 2OZ4H 3MA9H 5IBLD 1Q72L 4PB0L 2CGRL 5JZ7C 4U6XA 2F53B 1HHGB 1WZKA 4XP6L 1JGDB 4JFQA 1I4FB 3RNQA 3VJ6B 5DC0A 3W9EA 2X70B 4PIRF 2DQIH 4ZUTA 1NUDA 5HY9B 4GKNA 3QXTA 2DKSA 5JTWA 1DVFD 5KVDH 3DO7B 4PD4J 3LRSB 1WZLA 3V7MA 2BX5A 3CSPA 1DUZB 2SEBB 2XZCH 1NFDE 1H8NA 2BVOB 3WNOA 2A73A 3EOAB 4UNTA 1U95B 3O41B 1T21B 4K7FA 3OAYK 4HWEH 2Y23A 4HX1B 2V9RA 4HDIA 2CQVA 3X3GH 3N1QC 3RNKA 4S2SA 1J1XL 4KROD 4HH8A 5IB2A 3GIVB 1RV6X 3SEPA 5TDOB 2MWCA 3D39B 4IRJB 2BVQB 1VSCA 4GG6E 1OGAA 5KSAB 1JZ4A 2UYLB 2P5WB 5D7SH 3T4YA 4U2ZA 5JHDA 2L0DA 2VJXA 4IS6B 3REWA 4JY4B 2AJVL 4KTEL 2YUXA 5ECJE 5GGRA 5JOEA 1GHFL 4NKQB 5C0RH 5HYQA 5ESVA 3DX7A 3TCXA 4AENB 4MJ6A 4YUEL 4LMQI 7CGTA 4X7TB 1W72L 5DURB 5C92A 3HUJE 2E6QA 1E6JH 5L2KD 4ODXA 2D7MA 5FYJD 4M43H 2CLRA 1BREA 4I48A 3DTXA 3C6SB 3L7EA 2JK5B 3WN5C 1A64A 5I1JL 2FLBT 5IMKA 1JPGA 4PFEA 5B3NA 2EDXA 4Q74A 1UB6A 2W0FB 5IEHA 3GB7B 4WV1A 1IGJA 3P0YL 3MJ6A 1T5WA 3RWEA 4XXCA 4Z76A 1W0VB 1R5WB 3L3IB 1JPFB 1MJJB 4LLQB 1PZ5B 4PJIF 5CIPH 1EK3A 1MH5A 1YA5A 1PFCA 1FLRL 4PGDA 4XBEL 4MAYB 4U1IA 4OGZA 1G9EA 3HG1E 1T6VN 1QKZH 1IM9D 4NNYA 2CIIB 1A7BA 3LEYH 2FEDC 3QDHA 1AC0A 4IRSC 2YRZA 1TLKA 3P4MB 2CLVB 5SWQB 4KK5D 3F6IA 1KCLA 5IWLA 4OT1L 5GGTL 3VGEA 3IYLW 4OUUB 1ZSDB 5LVEA 1A9EB 1FCCA 1KJMB 5HHMD 4HIJA 1AE6H 2ZG2A 1I3UA 3N1FC 5DUMH 3LSOA 1A2YA 1FDLH 4PRHD 5E94B 4ZXBC 5JOFB 1CG9A 4P5MB 4I18B 4UBDD 5DHYB 1JWMA 3PV6A 4EKXA 1EJ6A 3WEXB 3LOWA 4OGYH 4P9MH 1RUPL 4J2XA 3WS6C 5ESQB 4KC3B 3QH3A 5FYLL 2R9HD 4NQEE 2VLJA 1DQJA 4WEBL 2NX5B 4NKDA 4OZIA 4YAQA 2R1YB 1NGZB 2Z8RA 4GS7C 4NKMA 4AM0B 3ARED 1H3GA 4TNWK 3BN3B 1M4KA 2EKSA 1X5AA 4OLZL 1AHWB 3PWPD 1F2XK 2DB8A 3FB8A 3FB7B 1BF8A 4YHOL 1AO7B 4WFHD 1FLTX 4YHYB 1C5BH 1RULL 1V3MA 1IC1A 4MCYA 1LGVA 4UV7H 4M48H 4Z78A 3QXAB 3V52H 4MA7H 4OCRH 3GSNA 2VDQL 3UTTE 4Y4HA 4G6KH 4NQVB 4FQQA 5GJTL 2V2XA 4PJBA 3X12B 3C9NB 2YBRB 2IALA 3LEXB 3WUWG 3GK8L 1BD2B 1DQDH 1T22B 4LHUB 4YXKH 4XPHH 4DWHA 5CEZH 3TCLB 1GGCH 3T2NH 2EIZB 3ILQC 4RA0C 4FP8L 4JO1H 4LSVL 3G5ZA 1YPZE 4M1CC 4G6AD 4PJCE 5T1LD 2B0SL 5DMIH 3QO1A 3L3GA 3BMWA 2YKLH 3GSUB 5C08E 3X11B 4LSTL 1EO5A 2D7PA 3AMKA 5ICZA 4H25B 3ZKND 4JQXC 1LD9A 3PIQB 4O4YH 5T3ZL 4U1MB 5I71B 2IMMA 4UMGA 4L8SB 3RZCC 3V5HA 3I6GB 1SJHA 1YMMD 5EOTB 1BOYA 4QHMB 3VA6A 5J1AB 2ZKHH 5DEGA 4QRPB 2NZ9C 1U8MB 1VFAB 1A1OA 1AXTL 1MFAL 1PKQE 3QRGH 1MRDH 2VLKE 3E8UL 3MRLA 1XGUA 2C1PA 3INUL 2YHGA 4P5KB 3CMOL 4FQ1L 2DF3A 4M61B 2L4OA 3IAQA 4EBQH 2F54E 2P49B 5ILTL 4XMKH 4R96A 4M4RA 1XF4A 3AXLB 1R3KA 4OFYA 5ID0B 1S7XB 2DM3A 3A6BH 4R3SB 1E0OB 1YJDH 3W9DB 3TJHC 4R97B 2GQHA 3NABH 2MKWA 4HLZG 1N3NB 4CW1B 5MEOB 1N64L 3QCTL 1T1XA 1TJHL 4G8FB 4LPWA 3J7HA 1FGNH 3H9SE 4QTHA 5HYJD 1TCRB 2R8SH 5ERWA 4O51B 1AFVH 3UDWC 5IW1B 2XKUA 3CH1B 3UYOD 3E6HB 3LKQB 2UUDH 3H2WA 3CUPB 4WFHE 1HXYA 1HSAA 4IIQA 3TESA 3DVIA 3CDFA 3VFTB 2ICWB 4QWWD 3O6MH 3ULUL 4F33A 5DFWH 2F53E 4ENEC 4HUVB 1BFOB 4IOIA 3VXRB 1UKQA 3MLSH 3TYFA 1L7TH 2AXGA 2NYYC 4EEEA 3QPXH 4I0PB 4M1GL 2VXTL 5D2NC 3ZDYF 5BZDB 4GXVL 2W59A 3VXTB 4HS6B 1N7MH 2BHZA 2XI9A 3V4UL 4MYWB 5T3XE 1FSKC 4XMLH 3SGJC 1SBBA 1SEBB 3EHBC 4L8CB 1AGFB 3LN5B 2UZIH 1MEXH 4GRLA 4JJHA 4WCYL 3UO1H 3GM8A 3QNXB 4PJHF 5C0CA 1MFNA 1QFWM 4XP5L 3V0VA 5DD6B 1KN2H 5M95B 2A77L 2QEJA 3J8F7 4ERSL 5BJTA 5MHSD 2WMPA 4BZ2L 2NY3B 2W0KA 1F11A 1SYVB 2FO4B 3VD3A 1HOCA 3D39E 5T33H 2ITDA 2EE6A 2YPKB 5KANI 2P5EA 1CFVH 1HI6A 5DUBA 5FM5M 4PJ5A 1P7QA 1DEEA 1F6AA 3GMOB 3CFDA 2DLTA 3QUZD 3X3GL 4WW2B 4ZOEA 3UXFA 3RU8L 5J7CC 3GMRA 3JV4A 3ARGB 2P8PA 1QRNE 5JMRA 4X4ME 2HVKA 3JWNC 5EU5A 2N1KA 3SDAD 1VKXA 3VXMB 4LVNB 1A0QH 3JWOH 4HD9A 5ALCL 3CFBB 1WCQA 2A6KB 3NZ8B 5EC1A 5FUCE 1YECL 5EN2B 5C0RL 2IBBA 3GSRA 4GQPH 3FO9B 1CXEA 1I7UB 1MREL 5F1NA 3ULUF 4HJJL 4YIQB 3BPNB 1E6JL 4K3EH 5C7XL 1V8HA 4O2CB 5JXAH 1JUFA 3SCMA 1FH5H 5C0IA 5I66A 1UM6H 5A2KH 3ZHLA 4HWZA 2K9UA 5E8PA 4P9HC 3QXDA 5HHPB 3KS0J 4I0CC 5EH1A 4DTGL 2HTLD 4QHUA 2V5YA 3GHBL 5E5RB 3SPVB 3OAUH 4L9LA 1S7SB 4P5TA 2EDHA 2XRAH 4P2OC 4JM2F 2XY2A 5LCVH 2ZUVA 3D3VA 5D7KD 4EN3C 1FZKB 4FQHB 3FCTA 1U8HB 1NFDA 5D1XC 2GEEA 3LEYL 4ZS6C 2C7UA 4KHTL 2J4WH 2DQUL 1RIUL 1TNNA 5D72H 4BSVB 3VI4F 2FJFB 1ZLVK 1T1WB 4L8DB 5J06A 2ZPKH 2WWMD 2X1PA 3UTZA 3IFPB 2O26U 2MQCA 3BPLB 1L0QA 2E9IA 4IM8A 1F90H 3FAWA 4LAJH 1Q9KA 4NZUH 1A6TB 4EJ1C 4L5FH 3BUYA 5JR1H 4QRSA 1I1AB 2BY3A 3DVGA 4H0IA 3F58H 1NJ9A 1T4KB 1AO7E 4ODHH 4D8PA 4M7ZB 2AQ1A 2V5SA 1J0JA 5HI4D 4FXGA 4R0LC 1PW3A 1Q9WA 2Z8WC 5CIPB 4NRZA 2A6IA 3E2HB 1NAKH 2V6HA 5ITFB 3BIKB 3THMH 2HFGL 1OARH 1XCQB 1YEKH 2GUOA 4OIAA 5CBEB 1HH9B 4KKNA 2AEIT 1H3UA 2VN4A 3V0WH 4UV7L 3BXNA 1QBAA 1BD2E 4MA7L 3QIWC 3ZYJA 2OCFD 2MCPL 4NZTL 4NQCB 4I13B 5FHBH 4F37F 3BSZL 4EQ3A 1YN7A 3KJ4C 2EC9T 3HG1A 4JAMB 4AQOA 1MJ7L 3O9WB 1A6VL 5KSBB 2M26A 3ARFB 5EBWB 4OFDA 1OF2B 3OKMB 1RJYB 1CICB 4X6DB 5IMLA 1LO0H 4OF5A 2YPVL 4JFYB 4LNRA 3AM8C 2ATKB 4HAFA 4PRID 4C58B 5DMIL 5TF1L 4RAVA 4KK9D 3DUSA 4QRPE 1G7JB 4FQPA 3AVEA 4IMLB 5EOCJ 3QHFL 4AIXA 4YBLC 5E0QA 4LLUB 3RIAK 5KZCB 4XMPH 1QEWB 3ULUD 1NBVH 5SV4A 3NN8A 1CR9H 3UJTL 1G6RB 1PG7L 1RSFA 4KMQA 3DX6A 5EOCH 1CBVH 3WXVH 2XN9D 1NC2D 1AD9B 2D7NA 1EBAA 3LB6D 3MC0A 5H8DA 4G3YH 1HEZA 1RPQA 1ZWIB 3EO1B 4XCCL 3DRQB 3CLEH 4RWHA 1RIHL 3B8YA 3QNYA 3ARBB 1DLFL 5J6HA 3IB4A 2VO5A 4L3CB 3A6BL 4JDVA 1YJDL 4Z6AT 4UDUB 4M02A 5ETUB 5CJQL 3P9LB 4HIHB 3CFEA 4MD0A 1KCKA 3OKYA 3WUWA 2NLJB 4JM2D 4ZOAA 3FQXB 4WO4C 1YMHA 4TUJB 4EI5D 3O4LD 3UTTA 1FGNL 2EYRA 3FT3B 5IROA 5EU4B 3VXRE 4NQUA 1P5UA 2EDFA 3H3BC 3BH9B 4OD2A 1T7ZA 2AQ3A 5C0GB 4FQ2H 5IMMB 2ICEA 3OJMB 3ZTJG 4F7PB 4RFNC 1J0HA 3ARSA 3IETA 1YPZA 4HAGA 3W11D 1L7TL 4PJCA 4V2CB 5K59F 2NW3B 1CLOH 4F58L 1WFTA 5B8CB 1MI5B 4JKPH 3W39B 4OZ4B 4Z77B 4Y19E 1MCFA 3VFMB 3B4NA 3UBXB 3EAKA 3QWOB 5E8DH 1MUJB 4DAGH 1VFMA 5GS1C 3T0ED 2VLRB 3VFOB 1RVFL 1KULA 1UH3A 3UO1L 1HZHH 4LHQB 3RY6A 3RPIA 1AKJB 4UIMB 1PKQA 1LK3L 5F96L 2VLKA 1MOEA 1K9TA 4KZDH 3CIQA 2RCSL 1OTSC 1OTUC 4PRHA 2F54A 3U30C 1IAOB 5LGJA 1JVKA 5AZEH 5T33L 3EYVA 5E6YA 2D0GA 4HFUH 3MLTA 3VXME 3WMSA 4IEFB 3TP4A 4KMTH 1LDPL 3GRWH 3QT2A 4XVSH 4Y2DB 3HLAA 4YHML 4DZBA 5F1KC 1KIRB 5HJ3B 3MNVB 4PTUA 1T66D 2AK1H 3AREA 4Q2ZB 3JWOL 4MQTB 4MAUL 2HJKB 2P45B 3PWPA 4UI2A 2X9XA 3SKMA 3WIHL 4M7JL 4NBYB 1QR1A 2D31A 4KJWC 4X0KB 5DK0B 3S34H 3P30L 1UACH 4BZ1L 5E4EC 1HHGA 4NQTA 1KIPA 43CAB 1SM3H 2CKBH 3ARZA 3DV6A 3G04A 4IJ3B 1FH5L 5HI3D 3MRGB 2AJZB 2I9TB 3DO7A 4JQVA 5JPMB 4GW4B 3HC4H 5D1QC 3IXTB 4WFFD 3VE0A 1YQVH 1WC7A 5C6TH 1EH9A 5C71A 1N59A 2EDDA 2WP3T 2YD4A 5IQ9A 5FO8A 3WFDL 4UNUA 1HWHB 2FHFA 4PRBA 4XNQB 1U95A 5FM5O 2FEEI 5T1LA 5BVPL 3QBTB 4KKCD 1LO3H 1HCFX 1L9NA 4E41B 4BQCA 5LCVL 5BMFH 3F6LA 3OXRB 1OCWH 4D9QD 5H35A 1ROWA 3D39A 2XZZA 5KSAA 3IDIA 2J4WL 3ZE0E 3B9KC 4ETYA 1YMMA 4GUPA 1DBKH 5I1EH 5I1LB 5D72L 3TNNA 5C6WH 1IE5A 1INEL 2K1MA 4IS6A 3CLFH 4H8WC 4OZHE 2V7HA 2XTLA 1QRNA 3KGRA 2D4FA 4B0MM 3MODL 1AY1L 1F97A 3L5WB 2FH6A 4Z7WB 2C3XA 4N5ED 2X4NB 2ARWA 2XTJD 2MPAH 3GMNA 4YK4C 1X6LA 3C6SA 1II4E 1CLZL 5B22A 4HK3J 5C2BL 4DW2H 5JR1L 5ANMB 1JGLH 5H94A 1CE1H 4M5YL 3S8WA 1BJ8A 2NY0B 1KCRL 1ZA6A 5HGDB 5DTFB 3QG7H 2W0FA 5T5NG 4NBZB 4MZ3A 1NUGA 4ODSH 3KVQA 1UVQB 5DFVD 3MBXH 4ZFFB 2QJDA 4X8JA 4GRMB 1JPFA 5DJ2A 4HWBH 1PZ5A 2CR3A 1MSPA 4ZAKC 2OM5A 2AKRB 3O8XD 4YDIH 4J1UB 3QIUC 3EJZC 2KBGA 4MAYA 4IBLT 3FFCB 4WW1B 3NIGF 4JM4H 4FQIL 2CDEB 4ETQB 4CN1A 2CLVA 5SWQA 2UZXB 4PJ8C 1OM3H 1T89A 4Y4KA 5CKAA 2VAAA 3VG0H 4ODWB 4JVWA 2F19H 4ELKB 2Q86A 2XZAH 1YNLH 1U91A 3DHJA 5DHVH 5A2JH 3HNTL 4PJDB 2LAGB 2X4QB 1CK0H 4UV4H 3R8QA 1W72A 4ZPVB 3D0VA 1FAKT 2ENSA 2CLZB 4ZUWB 5ADPH 1ZXQA 5JQHC 3NPSB 5IFHL 4JRXE 5J1SC 2PTVA 4ISVB 4PV9A 3WEXA 1G7HA 1TTUA 4L3AA 5DFTA 3BO8A 2XFXB 3OGOE 2HTKD 1XGYL 4RDQF 1NQBA 4MJ5A 5FCUL 4ZUVA 3OAZK 5GHWH 4DKEH 5IV2A 1CN4A 2AVGA 1NDGA 5F7DA 3O0RL 5BW7A 2ADIB 1JWSB 3FZUC 2EE3A 1A02N 2I60L 1H15B 2I25N 1RHHA 4KVCH 1S7TA 4LRIA 4HK0B 4N9OB 5FGSA 3ZKQD 3QG6B 5JPNB 1HYSD 4HFWA 4LCCB 2DL2A 3C6LD 5GGSY 4BKLA 1ZT1A 5D7IF 4G3YL 2V9QA 3IRZA 2ICCA 4IRZH 3FTGA 3H9ZA 5GS2D 3SJVB 5C0EB 1QFWL 3HI6H 5CEZE 1TVHA 3D5OF 2FGWL 1OGTB 5IB4B 3WL9B 5EIIB 1J8HB 1I3GL 1ORSA 5L7XH 5GRJH 1HQRA 3LEXA 5F6IB 1PLGH 4UT6H 1WT5C 1OAUL 2P8LA 1RZ8B 4WI7A 3AY4A 5ISZB 3V6FB 1JNHA 3C5ZB 1CFQA 2C26A 1FAIL 2Q3ZA 2W92A 3BKYH 1ORQB 4HHAB 1EZVY 4U1LA 5CD5C 1NGWA 3GSOA 2Z91B 3ARPA 4XAKE 1MI5E 3VH8B 3NCFB 1B4RA 3FMGH 1IQWH 3KR3H 4OIBA 4H25A 1OP3K 2WW8A 1NAMB 2CO6B 4WUUD 1ZLWK 3KYOB 4APQD 4TRPL 4LMQE 4U1MA 3O2WH 2G2RA 4JKLA 4L8SA 1G0YR 5DYOB 5EOTA 4QHMA 4JKPL 5DZLA 2DIAA 4OFKA 4LEOB 2R1XA 5GIRA 3UBXG 3M07A 1FYTB 4KRMB 1T2QL 2G60H 4MSWB 4P5KA 3G5YB 3K8LA 1HZHL 3QNZA 4JHBA 1VEPA 3VXUD 3A67L 1A3RL 4KJQD 4ZYKA 4R3SA 5EDXA 4KROB 4P49A 4K3DH 1CF8L 3B5HA 1FG9C 3WV0A 3IVKA 4JGUA 3MGOB 5B39G 4A2LA 3CZFB 1X5GA 5EO9B 3IKKA 4JPIB 4FQJH 5DD3H 4YX2L 4Z7QE 2X4RB 4POUB 5IW1A 3GRWL 3FOLB 3FO2A 5CILL 1U6AH 3LKQA 1F5WA 2Z31A 4BUGA 3MCLL 4YO0A 3O6FA 3BQUA 1I3VA 1CXLA 2J12B 3N85H 1LEIA 4QO1A 1ZGLB 1J1OL 5L2KB 1WJ3A 5E9DE 1B9ZA 2UWEA 1AC6A 4HZAA 2BNQD 3VXRA 4F15B 3GMPB 3FKUS 5DRNB 4LSPH 4I0PA 1O0VA 4NM8H 3U0WL 1IL1B 3VA2C 4PGZA 3RWGB 5TDNB 1U3ZA 4JZJC 3VXTA 3D2UD 4OZGF 4HS6A 4P46D 4OJFL 2Q8AH 4K9EH 2YD2A 1JPTL 2OBGA 3QUYA 5F7WC 3SDDA 5I1DB 2J2ZA 3BP7B 4M9PA 5L8JB 4QRQB 3LN5A 4JHWL 4N8CL 4PJEF 4DUVA 1DN2A 3HE7C 4MNHB 2FATL 3MO1B 4WY7H 3A6CL 4Y19A 2YRLA 4IDJL 4E41E 4M1DL 4RRPG 4AQ1B 3MV7D 3BKJL 1S9YB 5B4MC 2V2TA 1SYVA 3QWRD 2FO4A 1ZVSA 1M7IA 4PGEB 5I8OL 1J05A 1UQSB 5T1KA 3W2DL 3C2AH 1BZ7A 3AB0B 5HVGB 3V6ZB 1HINH 2VDOL 1U92B 5IW6A 5BMFL 3JTSB 2NY2C 1OCWL 1FVCB 4UT7H 43C9B 3R8BB 2R0LH 3MRNA 3OR6B 1KGCD 3TA3C 2XWBB 1FBIL 3VXMA 5EBLA 3I75B 1D9KC 5DVOA 3C2SA 4MGXA 4G42A 5EO1A 4GQ9H 3CFBA 3EYOA 2VL4A 3OV6A 1U8NB 2OZ4A 3CLFL 1GGIL 1NC2A 3BAEH 3MRIA 3PF2A 1FL6B 4XVUD 5ANME 4WI5A 3T3ME 1I7UA 1OWWA 1SJVA 2FHBA 1JGEB 3LZFH 3PP4L 1YYML 2KKQA 5I75B 1BQLH 4YIQA 2X4PB 3RDTA 4FXKB 5AUMA 5IR1B 4JO4H 4Z7UE 5I6XC 5SWSE 4P4RA 2XPGB 3BX7C 1JGLL 3I6LD 5DRWB 4ODTH 1CE1L 4R90L 3MRJA 4KJPD 4FTVB 4EI5A 4Y2OA 1X9QA 4F9PC 1E6OH 4PRDB 3F65A 3LMJH 2R0KH 4W6XB 3FFCE 3MBXL 1CL7I 4X6EB 4NM4L 1SY6L 3DIFB 4IHOA 3SPVA 4CDGC 3LRGA 3NCJH 1ETZB 4KRLB 1R24B 4YDIL 3HZKA 5D5MA 4K7PY 4JQIH 4FQHA 1P53A 1U8HA 4RGMC 3V0AC 5FO9A 5FYKE 1G1YA 2DYPB 2BNUB 5CJOH 2R2HB 4M00A 4N9GB 5DI8B 2IAND 4BSVA 5FM4A 5INCB 1I9EA 4QRTB 1WZ1H 2F19L 2I9LB 4R9HA 2EXYC 1KNOB 3BT2H 1I3RA 3DMMD 3T0EA 2QL1A 4DN4H 1CQYA 1H3XA 1CK0L 5DK2A 3TWCL 5CSZA 3MV9B 1MIEH 3KLSA 5ADPL 5LWYH 1KPUB 4XPFL 4POYA 4NO3A 5FA3B 1IEBB 4OZHA 3WO4C 3WFBL 5IVXF 3LDBC 1I1AA 4G80A 4MHHI 3W0WD 5ID1B 3LV3B 3TO2A 4D0CB 4NC2B 3ZE1F 4ZUSA 2Y5TA 3SO5A 1HILB 3CGTA 4CJ0A 4DN3L 3O11B 1HHHB 1S5IL 3SJVE 5CIPA 1KENH 4RMSA 5IUSA 2I5YH 4NGHH 5KW9L 3MRQA 1YC8A 1IM3B 4JY6B 4PJIB 4ZS7L 1I1YB 1J8HE 1XCQA 2VLLB 1ZK9A 1OAYH 2DWEA 3ROLB 5CBEA 3B2VL 1MRCH 2E5EA 5FECB 1EJOH 5HYJB 2GI7A 4R4FH 1E27A 4YC2C 2F5BH 4IRZL 5HHNB 5E2UH 3C5SB 3HI6L 5JMOC 5BRZD 5LJYH 3RA7L 1U8QB 3AUVA 4UZGA 2ENYA 5FKPB 5A16A 1X5ZA 4ORGB 4OZFH 3JWDH 4D3CL 3I6LE 2QADB 5L7XL 5GRJL 1HDMB 5DHVB 5F7HA 3DETC 3LN4A 1QO3A 1PQZB 5EUOE 1CFNA 4WENB 5KANG 2LE9A 1CDGA 2EYTB 2NY4C 2FYYB 2FEEL 4ESKA 4Y5XB 5DD1H 3FOMA 4XPGL 1DBBL 5I19L 3BDYH 4WV1C 5EZLB 3L5XH 3LKPB 2IQ9H 2R4SH 4FQXB 2H2SC 4XXCC 4HBCH 5DWUH 4EUPH 2MHAB 3O3BB 3KR3L 4HXAL 3HKFA 5IP4A 1BJ1H 1RMFH 2J5LC 3VXNA 3VFPB 1FYTE 2BMKA 4IMLA 2CSPA 1D6VL 2WUBH 3IDXH 4HJGA 4JRXA 1QEWA 2FJHB 3OAYH 3P4NB 3HC3H 3DSFH 3EOYG 3LKOB 4S1DD 2JJSA 3WXWH 3QIBB 5FO7A 1X5YA 4O02L 3MRDA 2JELL 1MQKH 2CXGA 5ALBH 4PJAF 1MCWW 4BJLA 1HIMH 3RHWK 4TSCL 3VMPA 4XBGB 5IWLC 3TM6A 4X99B 3RPKA 1QSEB 1TNMA 1OHQA 3MJ8A 1OPGH 1ZWIA 1KIUA 4W6YB 3V6OE 4E42A 1AQDB 5E00A 4IRSD 1I7ZB 4YDLC 3QUZB 4WTXA 4HMEA 1A6PA 4UDUA 2FGZA 4PTTB 3P9LA 2YD6A 1A6ZB 2GJJA 4TUJA 5DSCB 1CL7H 4KK6C 4C57C 1WZMA 1KG0A 3JTTA 2NY7L 3WD5L 2DQGH 4FFWC 3MZGB 1M6OB 4XCYA 4LU5L 2E27L 1HHJA 5EU4A 4BQBA 5HGAB 5TH2B 5CGMA 2Y1VA 1CE6B 3QCVH 1CVSC 4P9HL 1WFOA 4K94C 4QTIL 3WKNA 3ELAT 3H7LA 3UJJH 4JFHE 2ZNXA 4MA3A 3BFOA 4PJ9C 3VWKB 1FC2D 3IAPA 5KVEL 1BX2B 3K7UA 3EGSB 5B8CA 1IC4H 3CDYA 3W39A 4KDTA 4I1NB 1A6WH 3VFMA 1P69B 3OKDA 4K9EL 1IGFH 4ODUB 4K23H 4LKXB 4Y4HC 5TPWH 2WWKT 2A83B 3B6SB 3VRLF 3DURB 2ILLA 3MLZH 3NIDE 5K9QG 4JDZB 1QYGL 1DQLH 4OKVA 5GRYA 2DOCA 4OM0H 3EYQC 2ED7A 2D7TL 4UIMA 3VFRB 4GRWF 2A0LD 1YZZA 2DQDH 5B3JF 4DKFH 5MERB 3ZDXE 2N56A 4L3ED 4LARH 3FFDA 4JKWA 5B39A 2J88L 1RJCA 5D93B 3C2AL 5J12B 4GAJH 5DZNA 2YUWA 3ILQD 4WHCA 3UYRH 2PYFA 1Z9SA 5HYSG 4X6BA 3SE8H 1AP2A 4Y5YB 4M1CD 3SKJL 3GMMA 3VG9C 4A6YH 1FVDB 2YA0A 2V7NB 3OG6B 1KIRA 5CUSL 5HJ3A 3U9UB 1TPXB 4KZEL 1VGKB 1J5OH 1YEHL 1OP5K 1NMBH 3T77B 4FS0A 4R2GC 4ZD3H 4U1HA 1WITA 1FZOA 5DMKB 4NC1C 2FX8L 2QQKH 1GGBH 5DK0A 3I6KA 4BH7B 1XR8B 4NDMB 1SEQL 5I76B 2LVEA 2VUYA 1KJ2L 5ESAB 5E9DA 4FTVE 5F3HB 3OKLA 3V5KB 2PNDA 3VU2A 1J0YA 3G08B 3TBTB 1A7OL 1OB1A 4FABH 4ELMF 4NP4H 5DD5L 1PDKA 4NQSA 5FAAA 3HZVB 2ZJSL 3CVHH 1ZEAH 2Q8BL 1CGUA 4PJHB 2AJZA 4PG2A 1RK1B 3VRJA 3X3FH 3LMJL 2ZOLB 3KXFD 4AEIL 1IKNA 3Q6FB 5DK3A 4TVPE 3H42H 3IF1A 1DBMH 3QDJB 3HB3D 4MDJA 1MCWM 4XNQA 1N4XH 4QF1A 4IIQC 5J8OA 2KQMA 4E41A 1QLFA 2WIIA 3T65A 4LSUL 3NFPB 4Q6IB 4WUUA 1OL0A 2F8VA 1N6VA 5IG7B 4DZ8A 5IF0B 5CJOL 2GYSA 2K3TA 3MV9E 4KPHH 1UZ8A 4UB0H 4XNMA 2NYYD 1WZ1L 4QXWA 5FFLA 2Z92B 3DGGB 4GSDH 1Y18B 2R23B 4GRLC 1YQ2A 4HG4J 3W5MA 1S7QB 4DN4L 3ESUF 4OD1H 3MBED 4CGTA 3BGMB 2XN9B 5ANMA 1MF2H 1P6AB 3S37H 2XT1B 1RU9H 1EXUB 3PQYD 4XXDA 5HGDA 2R39A 1AR1C 2Y9RT 2APWA 3O2VL 4Z7UA 1P1ZA 4AYFA 3MCKB 5D96C 5SWSA 1O5DT 2X89D 4ZFGH 4XPBH 4YFLI 2GJZA 2AKRA 4KRPD 3S36L 1O7VA 1A7RL 2G5RA 1UADC 4JM2B 1SBSH 3VWJD 3O4LB 2A6JA 1N26A 1A4KA 3GI9H 3KJ6H 2IFGA 2FBJH 2MFNA 4RAHA 1SVCP 2BNQA 3SKOB 3BGFB 5F93C 4OQTH 4X5WB 4ETQA 4LVHC 4PLJC 3RWDB 1QNZH 2OTUB 2X4SB 2P4AB 3LIZL 3SDXF 3D2UA 4X9BA 4P0DA 1RUML 1WLHA 2GY5A 3BPCB 1MCOL 3SCMC 2W9DL 4Z7OF 2ZWLT 3MREA 1ZTXH 3QDMD 4LLWA 2R2EA 4MDIB 5DD1L 1XR9A 3TBSB 3BDYL 1HHIB 4ONFL 4QGYA 2CK2A 2Y7QB 3D85D 3FT4B 4NKIL 5FYKU 2LABA 1Z9MA 1DUYA 3MV7A 1QHPA 5F7FA 1XH3B 4L9LC 1INQB 3TZVB 3QWRA 3ULVH 3WNLA 4PV8A 4P5TC 1IC7L 2A74B 1I85A 5D70H 1QQDB 3IDXL 3AROA 1WWBX 1QSEE 1T7WA 1Q9LA 1BIIA 1XF5B 1P4LA 4LLMB 1FGVL 3WBDA 3WXWL 3RJQB 4K3HA 2FECI 4G9DB 1M1SA 1KB9J 2VISB 2FD6L 5ABDE 5JPNA 5GSRB 3QG6A 4H1LH 1S5HA 4F80A 5IHUH 4EN3D 4ZUUA 1JHLL 2KH2B 3V4PL 2Y25A 1KELH 4JE4B 1WTGT 1VESA 4POZC 3B3IB 4V2BA 5D1XD 1FO0B 5EIQA 3SDCB 2J3SA 4F2MA 4XZUA 4S0SD 3SJVA 1UXWB 5DC4B 3V6BR 4ZS6D 3LKRB 1ZV5A 3FQNB 3UROR 5EIIA 4LLVB 1T1YB 5HXMA 1H3VA 5TGBA 1NGYA 2P43B 1NFKA 3RVXD 4MMXC 4LFHD 4OUOA 5JDSB 12E8L 3HRZB 3KHQA 2FB4H 1OAZL 3LS5L 4U7MA 3IDGA 4XWOC 3C5ZA 4Y1AD 1XZ0B 1IBGL 2IAMB 4XWGH 1MCPH 4HZLB 1DCLA 1T03H 4EUPB 2E7HA 3L3HB 5EUOA 2UVFA 3RRQA 1IQDB 2X9YA 2FCBA 5MI0B 3MGAA 2DICA 1NAMA 1D5BB 2HVJB 5DDHA 5AAMA 3F12A 4OCSH 2NNAA 4M93C 3BOVA 2NXZC 1TQCB 5CWSA 4UQ3B 4EVNA 5EA0L 2O5ZL 3HRPA 5HD8D 4S1RH 1IGFL 4K23L 1FYTA 2B4CC 4X4XB 3C8HA 5IBLC 2CXKA 4M6OL 3EFDH 2HLFD 4CADA 2VZUA 2MKLC 1I7RB 2PO6B 2ATPB 2IANA 5IM7B 2R56L 1KPVA 1DQLL 1YY8A 4Z0XA 3QIWD 4OM0L 3DOSA 5F1OB 3MROB 3KPSD 1MY7A 3DMMA 3QFJB 5C0FB 1ZHLA 5C07D 4F7CB 1J8KA 1G9NC 4DKFL 3KPRB 2D03L 4LARL 3V6OA 3TN0A 1EO7A 1LE5B 3MGOA 1X5JA 3CZFA 5D6CA 4WNQB 5DJCB 2NXYD 3UYRL 4I3RL 3L1OH 3STLB 4JZOA 3O3DB 4JRYD 3OMZA 1SJEB 4LSQH 5HDLA 3FQUA 1MHPL 4MA8H 4N0YH 3KDMB 1TXKA 2VXUH 1WEJH 3ZDYE 1TJGH 5I74C 3RI5K 2AERT 1J5OL 4MQ7B 1DLHB 1ZGLA 1F2QA 3MNZA 3C60A 3EFFB 2E6JA 4YGVA 1P4BH 2XACC 1U3HB 4D9RD 5T3ZE 5DEFA 1Z5LB 4R4ND 3IFNL 1UXSB 2EDKA 1RZ7H 3BDXA 4YHKL 3RWGA 3IRPX 4OCMC 1DBJH 1X7QB 3M8OH 1L9MA 5BOZG 1KOAA 1S9WA 4PJHE 3PWUB 5FYJU 4P4KD 5F8QC 3BP7A 1GZPB 5BRZA 4P48A 2M8XA 3RWFB 2DTML 1E4WH 4MNHA 4YFEA 3QDJE 1Z6JT 3CVHL 3PE9A 3EDFA 1AGDA 5SWZD 1UCTA 1YYLL 3QJHB 1HCVA 3MFFA 1LK2B 2EKJA 2C3VB 4LSSH 5CEYA 4L4TB 5HTSA 3BZFA 3H42L 3ZDZF 4WO4D 2VR5A 4JFPA 4JREC 1DTUA 1N4XL 2R4RL 4JZNB 3NFNA 3A0OA 3D18B 2EEAA 5ADOH 3GRWA 5FXCH 3MXVH 5HYSA 2OJZL 1U92A 2CUIA 4W4NA 3GMLB 2JIXD 3VGDA 5JIPA 2IQAA 4YHLL 3SO3B 3QWQB 3N1GC 2WP3O 5ENWA 4XNUH 2CK0L 2FO1A 4PGBB 1YEGL 3LN9A 1MAML 1RUAL 3NCCB 4O5LH 1KYOJ 1G7LB 5IJVA 4AEEA 2DLGA 4XPTL 2H2PC 2BVPA 1S7UA 4DEPC 1RIVL 4GSDL 2FWOA 5C1MB 3PGCB 3GSXB 3RY6C 4OD1L 5DRXB 4RX4D 3UTSD 3QEQB 4LIQL 1Q0XH 4G8EA 5INDB 4OQ1A 2CKBA 3KPNA 2X4PA 4OGAD 4I77H 5FA4A 5IR1A 1W0WB 2VRAA 1MIML 1N6QL 3M17A 2JB6B 2ZUUA 3C6LB 3QI9D 3EJJX 3FRUA 2ZCKH 1JYWA 5GGRY 4C56D 4GAGL 1K8DB 4KQ3L 4X6EA 1HYRC 3DIFA 1OTUD 5MEPA 5C09D 3TNMB 1XGRA 4U7SA 1FRGH 4QXTB 4U1SB 3K4ZA 2DWDA 2PYEB 1AGBB 1IGMH 2OSLA 1R24A 3LKNA 3AREC 1RI8A 4MJ2A 2B1AL 4I2XB 3LQAH 4MNQD 3BYTA 3OGCB 1UA6L 3IDMA 3CX2A 2DYPA 3SKNA 2BNUA 5CBAB 2W9EH 4OQTL 4HT1L 4YHNA 2IPKA 1ZHNB 5E8NA 2I9LA 1MCLA 3GO1H 3BP5B 4QKXB 1DQML 4RMQA 2VDRL 5I1CH 3FAXA 5I15L 4AL8H 2KDGA 1XAUA 1FNEB 4OLUL 4LCWB 5E5MB 3WKML 4GXUM 4JQVC 4WHYH 1NCUA 3MJ9H 25C8L 5F1IB 4RBPH 3VFVB 4Y8DC 3NACH 1JHTB 5TQ0H 4Q0XH 3C5JA 5JNYB 5BV7C 2HKHH 4MWFA 4PJXB 2HWZH 1TETL 3QUXD 4MXQC 3QEHB 2VDKL 3ZMRA 5DO2C 2E6PA 2X44D 4NFDA 5I1AB 1UFUA 3K2UL 4YZFE 4PS4H 3VXUB 3TPUA 4JFED 1YY9D 3TIEA 1J9CT 2AGJL 4HWBA 1RJZB 2A9ML 4XNZC 3PL6B 4LLDB 4N90E 2QKIB 2YEZB 4MD5B 4BUHA 1IGYB 4M5ZH 2QSVA 5DA0B 5FECA 3HAEH 3ILPA 5JW4N 1IZJA 3RUGF 2OR7A 1IAII 4OZFG 5LXGL 4R26L 1A5FH 4ORGA 4JY5H 4X7FC 4PR5B 2AABL 2P1YA 5DHVA 5IGXH 1P2CA 2ESVD 4FXLA 5IIEB 2Z93B 1H3WM 2EYTA 4FG6D 5FUZH 4TTGA 3MRHA 3VI3F 2ADJA 3B5GA 3MQIA 4XCNB 3VGAB 2WLYA 1XF3B 3WYRA 5E6IB 5I1KH 4XWGL 5MENB 1WAAF 5EZLA 2FIRT 4EUPG 3MLWH 4F7MB 5CGTA 4OV5B 3EYSL 1BWMA 5HHQA 1G7PB 4HLJA 4JN1H 1I1FA 1CDYA 4KVNH 4ZO6A 4X9FA 4NJ9H 5DJ6A 3ZKXB 4QWWC 3P4NA 1OW0A 4Z18A 3QIBA 4GKOA 5CZKA 1BGXH 2R2BB 3HA0A 2HJLA 1DL7H 1YNKH 3QEUB 3HZMB 5JO5B 1I8KB 2H32B 5HI5D 3EJZD 3HR5A 1T89C 4Y4KC 2LTQC 3QFJE 1B6UA 3DYOA 5IKCB 1VHPA 5GJSH 2DDQL 3KPRE 5D7IB 2E9JA 4MNGE 1NMCB 4RIRB 4PJGF 2K7QA 1I7ZA 4E0RB 4HUWB 1PX4A 1T2JA 2E3VA 2YD1A 4PTTA 3MRKA 4UT9H 1A6ZA 3IDYC 2ADGB 3MBEA 1KCSH 2BY1A 1WWWX 5DSCA 5JUEH 4HS3B 4HJ0C 3LKSB 2R15A 3WE6A 3RWHB 3FQRB 3SDYH 5I16B 1QSVA 5IB1B 1S78D 3CH8A 3H3PH 1T7XA 1EMTL 4U31A 5HGAA 4LDOB 4LASL 4S10A 3MLXH 3MJGX 3WIFB 2VXUL 1NEZG 3UJIH 2VE6B 4R7NB 5I73B 5I1HH 2WLZA 4YNYB 1P4BL 1D5IH 4LRIC 1ZS8B 4AT6A 4AIZB 1BX2A 3FZUD 3VXQA 3VW3H 3EGSA 5T5FL 5HVHC 5FK9B 4M6MH 5TDPA 1LNUA 2O5YH 3NFSH 2HFEA 4J8RB 3VWJA 3AAZB 2YOCA 1IEAA 1MJUH 1WVZA 3VXSB 1BVZA 4HGWB 1S7WB 5LGHL 5CZVH 5C0BD 3QUKB 1FFQA 1T80A 2V2WB 4L4TE 4U1NB 1JK8B 2WNGA 2EICA 3AY4C 4QT5B 4D0DB 3BZ4B 3D48R 2A1WL 2MQ0A 1JFQH 3U48A 2RAMA 4JR9L 5JW4M 5MERA 3D6GA 2IPTH 5DQ9A 2X1OA 1EHLL 4ONHB 3F7QA 1K2DB 4G6FD 1I9RH 4RFOL 2PXYA 5ADOL 3U0PA 3Q2CA 3I3DA 4NQXB 4Y5YA 2VITB 3I2CL 1R5IA 1QBML 3ALXA 5EOQL 1JRHL 3GMQA 2V7NA 1P9MA 3NMEA 2WZPD 3S4SB 1VGKA 4XH2A 2VDLL 5TE6L 1EEYA 4MX7A 2IH1A 5F9AC 1IAIH 4M9OA 2X05A 3QEQE 1KLFA 1MVUB 4RGOH 3FO0H 3NAAH 3KNBB 4QXGL 5C0JA 1T04B 3TT1H 5J6GA 1JMZA 3W0WB 1LP9B 4J3UA 1ZHBB 5E95B 2GTWA 4NUGL 4FQLL 4OZGB 5I76A 1FL5B 1UWEH 3V5KA 1VCAA 1UZ6E 1A7PH 5C0DB 4PJEB 1EVTC 3G9VA 5HHVL 3HZVA 4DCQB 4NQDE 2PYEE 4HPOL 32C2A 2WUCL 3MUGA 2CRYA 1RK1A 1RUQL 4GMSL 5KSUA 1XGPA 1QFUH 4HIEA 4M6AA 4KY1L 3ULVD 3K4AA 5KTEL 1UM4L 4Y1AA 2Z31C 1YDPB 3O6FC 3BQUC 5JXEA 1HNGA 2DQFA 3CFCL 2VC2H 1A6AB 4N68A 5EU7E 4UDTB 1IFHH 2DQHH 2PN5A 5GS0C 4I0PC 4URTB 3SQOH 1JF1B 2VWEE 3GSQB 4Y5VB 3MXWH 4O00A 4JN2B 1A7NH 2A9NH 4LCWE 1P4IL 5DGQA 3OX8B 4HCRH 3QUYC 3WN5B 2MQ3A 3DX8A 4KDVA 3QQ4A 3SDDC 1KACB 4XBPA 3U83A 3P73B 2OI9C 4OF3A 1JNLH 1UWGL 2BP3A 4JLRA 2XQBH 2CDFA 4MXVE 1S7QA 3O3UN 4PJXE 1S9XA 3HMXH 4BFBD 4YEEA 1JWUB 4HUMB 2Q76B 5IFJB 2I07A 3HE7D 2NY3C 1LQSR 2JCCA 5ICXB 1BJMA 2HWZL 5JOPE 1EXUA 5HDOA 5FHAH 1ZLSH 1EAPB 2LU3A 1BIHA 4NYLB 5DLMH 3OPZL 1JMXA 3NA4A 4YDJA 1WIUA 1F3JB 1A1MA 3MCKA 4R4BB 1VPOH 4ODVH 4JRYA 1NC4B 3TJEL 5HGHB 6FABH 4S1SH 4UINL 5HDBF 4K94L 4KFZC 1T5XA 1I8LA 2NY2D 1CFSA 2RHEA 1EA9C 4K7PH 5EUKB 1WUNT 3BESR 3LB6C 3TA3D 1YEJL 4XPAH 4ZXBB 2EDNA 4AEHL 5FOBB 2OTUA 4X7DC 1D9KD 1ND0B 5IB3B 3GI8H 5MENE 3BPNC 2OP4H 5IGXL 4P4KA 5DMJB 3RDTC 4WFED 5CMAA 3G6DL 4I3GA 2G9HB 4AZ8A 4MDIA 3V95A 4GS7B 2GJ6B 4EI5C 4DKAA 5FUOH 1ACYL 2W1NA 2Y7QA 3TYGL 2W0PA 1EFXD 4TQEH 1PVHA 1C16B 5FDWB 2APVA 3MLWL 3S37X 5JLZB 1GIGH 3L3DA 3O3AB 5IVXB 3ROOB 4P2RE 4HIXL 3MRCB 3PDGA 1GJIA 1FL3B 1BMGA 1QQDA 3QO0A 2QR0B 4QHKJ 4GO6B 2GIYA 5K9OA 4PREB 4TUOA 4ODBD 4M7KL 1XF5A 3I9GL 4OCXH 1BGXL 3IU3A 3W11C 4H1LG 1KLGA 4JPVH 3DXAE 3BRDA 1CVRA 4FZEH 4LQFL 3IKCB 3MOAH 2JKXA 5SX4I 1F4WL 3RBSA 4TTDD 3B3IA 1QFPA 2X40A 2GSGA 3TIDB 4I9WD 1KBGH 3MR9A 3T0EC 1QBLL 5GRUL 4OZFA 5EU6D 4OZIF 4UTAL 4OAWA 1T1YA 1UYWH 3EOTH 3HS0B 3QXWA 4NHCH 2B5IC 1Y6NR 3NZHL 3PV7A 2EXYD 4RAUB 1I1AC 1R3LA 3BH8B 5E8OA 3RZCB 2GSIA 5KVGL 3GUTB 1AGCA 3E6FA 3U4BL 3TV3H 3QI9A 5IMOA 3WHXA 4HZLA 2IADB 3EDJA 1KC5L 2BY0A 4EUPA 1ADQH 4LLYB 4C56A 1KCUL 5F7YC 2LAAA 3ARWA 4ZDHB 4PJBF 1I9IL 1B4JL 2VL5A 3QFDA 2H9GA 3L3KB 4NSKB 3P0VH 5I1HL 1NCDL 3VXSE 3SKUD 1PGRB 1D5IL 3GNMH 3H9HA 3OWEA 3IFOA 5IW3A 3LS4L 1JE6A 1ZHKA 2NY5H 4W70A 1GGYA 4M6ML 3NFSL 2OK0H 3RJDA 1MAKA 2VH5H 5F21B 3KXFB 2XG5A 1C5DB 5GGVH 2VXSH 4PJAB 5KOVC 5CZVL 4OCNC 5JHDD 3ARVA 3KLDA 1I7RA 3TBVA 1R0AL 2DQJH 3ARDA 3TBWB 5HPMB 2Y07L 3O2DA 2WWKO 2V5MA 5HI3C 3U36B 1F4HA 4LGRB 3PGFL 3KPRA 4QOKB 3S98A 3EYUH 3HN3A 1J10A 1S3KH 3IFLH 4MNGA 5D2LA 2J8UE 4WNQA 5DJCA 2FIKB 1CFTA 3PGDA 2NY4D 1I9RL 1F4AA 5KS9A 5C9JB 5D2NB 3RL1B 4QLRA 3S7GA 3QUXA 3FQTB 2DN7A 4UOW0 3U46A 5DF0A 4KKCC 4YE4L 4FHBD 1XIWD 1LP9E 1NEZA 2JJSC 3S4SG 2VSDA 3IJYB 4JPKH 1DLHA 5BS0E 3WLBB 2WANA 4OZGE 4J3WA 2OR9L 4JFEA 1MCHA 3F7VA 5D8JL 1BBDL 5DJXB 5AWNL 2YD3A 4NUJA 4PY8I 3CCHB 3NAAL 4RGOL 1ES0B 4PRAB 4KJYA 1ERNA 5BVJA 1KTLB 3L5IA 4CU6A 2EDTA 1FNAA 4JFDB 1WCBA 5F7EL 4Z7VF 1Q94A 3LHPL 1A4JB 1INDH 4WJ5A 5FGCB 2NTFB 4PGCA 4U6VH 4AH2B 2BCKB 1D5MA 4GKZB 1NUFA 2FJGA 2B2XL 3RWFA 1ZA3B 2DBLH 4N5EC 4OTXL 4WI4A 3BP6B 2XTJC 2CMRH 4X5XB 3MRPB 3BKCH 1Z0MA 3PWJA 1QFUL 3U4EB 1NLBH 5CINH 5F6HJ 1NCTA 3VFGH 5T3XH 1BF2A 1KTDB 5F8RC 4JEGB 4JFZH 3L6FA 2QHRH 4KK6D 1NLDH 5ICYB 3BP4B 5DFVC 4GW5A 4P23D 3STZA 4CDHA 4QRRD 5KG9B 2DLEA 4A6YA 4CVZA 1CGTA 3OHXB 3U7YH 3QDMB 4M3KB 3UYPA 3U6RB 1Y6KR 1PYWB 4R7DB 2YPLE 5B8CC 4U3XA 4PGBA 2DLIA 1S9VA 4KDTC 2P7TB 2ZSVB 3D85B 4TUKL 3K81A 1FNGA 3FB6B 4S1QL 3VRIA 1JIBA 3TBYB 2HLAA 4HKXA 3WS3B 2XQBL 5I1IH 3TO4D 1PBYA 5DRXA 1IKFL 2VQ1B 4Y4HD 1YJDC 1NBZB 2C3GA 4OF0A 3ES6A 2VKWA 1Z0NA 3DHMA 1C1EH 1CGSH 3KG5A 1A9BB 3SGKA 3VFWB 1BAFL 4P2OB 3RWJB 4ELMB 3CVHA 5KSVB 4DGIL 2DI8A 2Z35B 1H5BA 1MWAB 4DGVH 3PNWB 4EN3B 3CK0H 2GTZB 4HC1H 5FHAL 4JPWL 1MY5A 4YFDB 3UC0L 4MCZA 5D1XB 4NT6B 4WI3A 3TVMD 2VXQL 3QEGL 5F7LB 1OVZA 4LPCA 5D1ZD 4MZ2A 3MUY1 5DJZB 4NQDA 5TFSL 2PYEA 5L6YL 6FABL 2QHLA 2XKNA 4JB9H 4J6RH 2MJWA 3KYKH 3MV8E 3OGCA 2ZCLH 4LPTA 1FORL 4LDEB 1HYSC 4GG8B 5KVFH 3LQMA 5IT2H 2YC1A 1PAMA 2GJ6E 2HH0L 4I5BB 3GI8L 1OAXH 3CU7A 2IF7A 1K8IA 3BP5A 4XHJD 2NY1D 3BKMH 3RWIA 3WJJA 2RFXB 4KTDH 5EG6C 4ALAH 4XB8A 2B4CL 4ZFZB 2UZYB 5E7FA 4KAQL 1T0MA 3B5TA 4ONOA 1ED3B 4OFYD 1QPPA 4LCWA 1CZ8H 4UAOB 4WHYG 3QA3B 5E5MA 5CD3B 4PG2C 1IGIL 1NFDF 2YSSB 4KUCD 3ZE1E 4U6YA 1VFBA 1FJ1B 1FFNB 3CC5A 1GC1H 3NA9H 4M7LH 3I50L 4YGAB 4D0BA 1OSZB 3HE6A 4PRPB 2JJTA 4PJXA 3C8DA 3KWWB 1JN6B 3QEHA 2EECA 4CUCA 4LKCA 1KJ2B 2KZWA 1XCTB 5DJYA 4LSDA 4RMTA 3U2SA 3BVNA 1JPST 1HWGB 4PJFA 2HKFL 4UQ2A 4APQC 1OQXA 3PL6A 5TF0A 2EDQA 1J0ZA 1QTYT 3G6AB 4MD5A 2FR4A 3JWOC 1BVKB 4JO2H 15C8H 1QLRB 2V9TA 3BIAX 1G7QB 4XT1C 1E4KA 5GSVA 5AEAA 3VXPA 4WU7A 3EW3B 4OQTA 2XY1A 2XNAA 1KBGL 1OAQL 3SY0A 2AXHA 5BQ7B 1QP1A 3MA7A 3MX0A 1WQVT 3PHQA 4D9LL 4JFFD 2VDNH 4HWUA 4M62H 3QPQC 4Y4FD 3VFSA 4LCIL 3PHOB 1KFAH 4NHUB 3FQWB 5EPMB 3KPQB 5IIEA 3D69B 4WFGE 2Z93A 4GRLD 2HFFB 3FONA 1DQQA 1KEGL 3QCUL 4YBLB 3ZTNH 5JHLL 5DZOA 4XCNA 1Q9OB 5CP3H 2BNRD 1U2HA 1ZOXA 4KQ4H 4X7CC 4OSUH 4GKSA 5MENA 4I0KA 3TV3L 3U1SH 3PABA 4O2FA 3HHRB 1PG7W 3NCBB 5IFAH 4ZO7A 5EU3B 4G8IA 1GXEA 2RQ8A 5MP6L 4PJ5D 1AR1D 4PJAE 1A1NB 1P7QD 5HVFB 1B88A 1WV7T 2AEQH 1P5VA 4QCIB 2NY5L 3IXAA 3S88H 2R2BA 2OK0L 4MD4B 4LPXA 2VH5L 4P2RA 4V1DD 3QEUA 3HZMA 4H1LA 1R3IL 4YHZL 1F4XH 2GT9B 4A2MA 2R0WH 2X4OB 5GGVL 4N0UB 4WO4B 3QDGB 1D6EB 4P46C 5GISH 4X7EC 4QOKE 2DMCA 2OX5A 4LEXL 4P57B 3CSGA 4XRCA 1GOGA 4RIRA 5BXFB 3HTLX 5CFHA 4PLJD 1QG3A 2JIXB 4GLRI 3MLVH 1HQ4A 4GW1B 3DXAA 4G9FB 5E1AB 3BPOC 5L8LB 5I8KH 3HPJB 4UTBH 5CGYD 3OR7B 4RFNB 1U9KA 4YXHH 1WK0A 3SCMD 3ZE2E 3KPPB 1TZIA 4NRYA 1KSRA 4G7YH 2AXJA 3BEVA 5IB1A 1WSST 3KYNB 1I85C 3QZWB 3SOBL 2DJUA 3R06B 5HGBA 4ZQKA 1U42A 3BW9A 1KJ3H 1N5YL 5D7JD 5KAQF 3UTSB 4JFDE 2ZSWB 2XWJA 2PUQT 2ICWJ 4R7NA 4CNIB 5GS1B 5FGCE 3KPOB 4YNYA 3NCYP 1Q1JL 2CJUH 4Z8FL 2ADFH 2ZP0T 5CP7B 4JFFE 4KKBC 3VGFA 2ORBL 3ZTJH 1ZGLP 5GRXG 1OSPH 1HN1A 8FABA 4ZFOA 3I02A 1NBQA 2BDNL 1BQHB 5J57B 1H0DA 2O5XH 4GBXB 5C09B 3U30B 4OGXH 3EO0B 2DQTL 5B3JE 2V2WA 3PXJA 5EZJB 1BM3H 5F88B 1T2XA 2DAVA 1YPZF 3WJLA 4KHXL 1NCAL 2CMRL 4MNQB 1BOGB 4QT5A 4PJCF 3GFUA 4DVRL 2EZ0D 4RGNB 3C5ZC 4K71C 1WBZB 1NLBL 3NCYS 4KJPC 1C12A 1X6NA 2E7BA 4F3FB 4JFXA 3IS1X 1LE9B 1NGQH 1EFXA 4F57H 2XYCA 1HXMB 1FPTH 4K3JH 4XWOD 1MFCH 4X6FA 4TVSa 1UEYA 3RTQA 2ARJB 5BV7L 4V1DE 4J23A 4MA1C 2H6PA 3F62A 1MFBL 3OB0K 2J8UA 1EZVX 4OLYH 3HCVB 2OQJB 5E4EB 3S4SA 5A40E 4GOSA 1LMKA 3MYJA 2COQA 3ESVF 1MVUA 1YC7A 4AMKH 5TE4H 5I9QC 3DBXB 3EO9L 3ARYA 1L6ZA 5E2VH 4OCWL 4NO0B 2NXZD 1RZKH 1NBYB 1LP9A 3FT2A 3DUUB 1MCRA 5GGQL 5I8EB 5JW3H 2BRRH 4OD3H 3W81A 5DMYA 5BS0A 1J18A 3F5WB 4NO5B 5D1QB 4G43B 3OKKB 1GZQA 1IMHC 3DMMC 3IGAA 2OR8A 5EU6A 3RGVA 3HG1D 1FG2A 4AG4L 4ZOBA 5EFIB 3H0TB 4F37K 4X80H 4N5UA 1MLBA 4EI6A 3V6OC 3TN0C 2YK1L 3MNWB 1DE4B 4NPYA 4EDXA 4LSRL 3ME0A 4XP1H 3WDHA 4DGVL 1JF6A 4KI5E 3CK0L 5DQDL 1CU4H 1J0IA 5C70A 2QBWA 2MSPA 1FNSL 2AJYL 1YDPA 3S5LG 3B9KB 3OZ9H 2Y36H 4TOYL 4U6HA 5ITBH 1V7NL 1IAKB 1FE8H 35C8H 4BFIA 4ZMAT 1U93B 5HHXH 2APXA 1TITA 4K55A 3DV4B 3C60C 1WISA 2JF1A 2DLFH 3F7YB 5BZWA 4J6RL 1U58A 4CMMA 3IJSA 4NJAH 4WDIA 1NMAH 2ZCLL 1JF1A 5EBMB 4NWTH 3ABZA 3MACH 2X5PA 4Y5VA 3RWCB 3MRFB 2GFBB 4JN2A 5IT2L 2W60B 1PKOA 2F15A 1YEDB 4BH8B 4L29B 4GLRH 4PP2A 4JDTL 4YK4B 5IOPA 4NQED 3DNKA 3UTPE 1B0GA 1N0LA 1I7TA 4Q9BA 2NY6D 3BKML 3S35H 4PRPE 1KCVH 4QHNB 5BO1L 2YPLA 1YEFH 3WIIH 3KAAA 1JWUA 1F3DJ 4F7EB 1XT5A 3UZEA 4WI2A 1N6UA 5IHZB 3C08L 3OXSB 5IFJA 1UCBL 4P3CL 3NA9L 2E9WA 3S3JA 3RHWF 5ICXA 4ZO8A 4ZAKB 3OKOA 2X1XR 3UBXI 3QIUB 1MCNA 2IG2H 3KYMB 3T1FA 3UTTD 2AI0L 4Z7NE 3T8XB 1EAPA 3PG2A 4RFEB