The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
58
|
sequence length |
303
|
structure length |
303
|
Chain Sequence |
AFTVSIQSNKRCFLAGDGFTLTATVAGDEPLPSNLTYTWTKDDQPHENNTATLTVADATSENAGSYKVTVQDTDTMTSVESEVFLMEEAELIVNITEPQHFYVSSQTDVELHATVKFSGGKTPADNYELHYSWSKGEDVIDTTQDITIQEFTADKNGVYTVKVWGESEDSAASASTKIMLATMNVDQDVVESKTVALGNEISLNYVVSEDIVGDSSGMPNLTIKYNWYLQREGQLSPTLIGSEVGEALEGFSITPDGHLFKESATYDDTAKFWCVAKLYQQIEDETVEVAASTSRKCSMEVVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the three N-terminal immunoglobulin domains of the highly immunogenic outer capsid protein from a T4-like bacteriophage.
pubmed doi rcsb |
| molecule keywords |
Hoc head outer capsid protein
|
| molecule tags |
Viral protein
|
| source organism |
Enterobacteria phage rb49
|
| total genus |
58
|
| structure length |
303
|
| sequence length |
303
|
| ec nomenclature | |
| pdb deposition date | 2011-06-16 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |