3SHSA

Three n-terminal domains of the bacteriophage rb49 highly immunogenic outer capsid protein (hoc)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
303
structure length
303
Chain Sequence
b'AFTVSIQSNKRCFLAGDGFTLTATVAGDEPLPSNLTYTWTKDDQPHENNTATLTVADATSENAGSYKVTVQDTDTMTSVESEVFLMEEAELIVNITEPQHFYVSSQTDVELHATVKFSGGKTPADNYELHYSWSKGEDVIDTTQDITIQEFTADKNGVYTVKVWGESEDSAASASTKIMLATMNVDQDVVESKTVALGNEISLNYVVSEDIVGDSSGMPNLTIKYNWYLQREGQLSPTLIGSEVGEALEGFSITPDGHLFKESATYDDTAKFWCVAKLYQQIEDETVEVAASTSRKCSMEVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hoc head outer capsid protein
publication title Structure of the three N-terminal immunoglobulin domains of the highly immunogenic outer capsid protein from a T4-like bacteriophage.
pubmed doi rcsb
source organism Enterobacteria phage rb49
molecule tags Viral protein
total genus 58
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2011-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3shsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3shsA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3shsA03
3ORJA 4HKBA 5IBUB 1XZ0A 1U6AH 3VXTA 1EMTL 4ODXA 4OZHB 1ZLWK 3TVMD 4NDMB 4Y0GA 5TQ0L 4KK9C 4D9QE 3LB6D 5B38G 2BY2A 3RGHA 4K9EC 1TTFA 4GKNB 1HHGA 5E2UL 3FFDA 5J6GB 2QSCL 4QRUB 3KDMA 4OLYL 1JYWA 1KNOA 1DLHB 1GGIL 4LPWA 4HH9B 1T4KB 4HF5L 3KWWB 4G5ZL 5I16B 1DBAH 2PCPA 2HG5B 1A6ZA 4ZTOL 3MV7E 3D0VA 4OCSL 4X8JB 3DVIA 1PVHA 5J12C 1C8PA 1Q1JH 4LPTA 3ULVC 2OR9H 4P2OC 1BM3L 1DVFD 3IVKB 4MCZA 2HMID 3KNBB 5FOBA 2YPVL 2LU4A 4NBZB 3K7UA 1AP2A 5F3HA 3LMJL 5GRZA 5J13B 1FG2A 4PBXA 1S7WB 2IF7A 4DW2L 4WV1C 5EPMA 5BQ7A 3IJYA 4QNPF 1R3JA 3QO1A 5I71B 2UWEF 3IAQA 4HIHB 1V7NL 4P2QB 4WEBL 4YHKH 5LGHL 3E6FB 4OCXH 3QDGE 5F1NB 3RAJH 2XWTB 1RQ5A 4M7JH 5HI3D 4WHTA 4MHHG 3Q5TA 3JV0A 4RWHA 1VPOH 2FBJL 2R2HB 1BFOB 2EYTB 2J7LA 2VRAA 4R90L 3RGVB 2YUVA 3SGDH 2VZTA 2BVYA 4N0UE 4TQEH 4HPOL 3VGFA 5ISZE 4TPRH 4RGMC 1IM9A 4M1GH 4XC1H 5I8KH 3IJSB 1TZGH 2J8UB 3VFPB 3ARDB 5GS0C 4NNYA 5INDB 5KSAD 4EI5A 1NL0H 3W0WA 1T2JA 2WQ8A 4JG1H 5GISL 3QNXA 2YEZB 4HJGB 4M4PA 4WCYL 1ZSDA 3VU2A 4UBDC 2NY2D 3KPSB 1TJHH 3ALXA 3VI3E 4QTIH 1YN7A 4XXCC 1IT9L 5CP3H 4IIQA 2AQ2A 4FQIL 3SDDD 2I5YH 4ODVH 5E94B 5E8OA 3OXSB 2AW2A 3H9SA 2L4OA 4BFBD 4HG4J 3WNNA 1DQJA 1N6UA 3C60D 3KS0H 1FFOA 3QJFB 4LSPH 1QFUL 4IHOB 3OX8B 4XMLL 1I1FA 4UOW0 3V4VH 1LO4H 4YUEH 1EXUA 1ZTXH 4PJ9C 4L8DB 4L5FH 3PXJA 3QQNA 3RWGA 4KUZL 1MVFA 3WUWG 4R7DB 1RHFA 2ORBH 3NFSH 4NP4H 1XIWD 2D9CA 3FONA 2Q6WB 3DX8B 4YE4H 4ONOA 2FWOB 2D03L 1R3HA 5DVKA 3FQTB 1BFSA 2H9GB 1BBJA 1AO7A 1BEYL 3D39A 3T0DA 5ETUB 1BQUA 4AH2A 3MBXH 5ID1A 5D6DA 2IALA 3QDGD 1BIIA 1CQYA 3LS5H 2BRRH 3I84A 4KU1A 2XPGB 3IRPX 1A6AA 2BSRB 4YDKL 1HDMB 3KPLA 5ISZD 4MNQA 3OKLA 4YHMH 4KK5C 3C8HA 3SKMA 3HG1E 1BOGA 2Q20A 32C2A 2B1AH 1G7QB 2Y5TB 3MOBL 3ZTNL 1LWRA 4HUNB 4MLSA 2CUHA 2UUDK 4HWZB 3ZT7A 2CLRB 1D3CA 5FF6B 4OIBA 4Y2DD 4XPTH 3LRSB 4R2GD 5IW3A 4Z8FL 1O5DT 1CGUA 1OAUL 3DETD 2CQVA 5FA4A 2XKNA 5C0AA 1AFVH 3DX9A 2E9IA 4OM0L 3T3PF 3TIDB 3WXWH 1KCKA 2ZCKL 5F7EL 1AKJB 1MFDL 3OKEB 4QGTA 3RL1B 3WS3B 1HH6A 2XZZA 2CGRL 1T04A 1GC1C 1JBJA 1DR9A 1PGRB 4JFOB 4PRHA 5HGAB 2HTLC 4GOSA 1U8JA 3QXUA 1QA9B 4PJ8B 4PJBF 5HHNA 5IK3B 1FRGL 1I8MA 1UXWB 1LVEA 3MRRB 3L7EB 1DLFH 4LCWE 5DT1L 1KFAL 2I27N 4LSQL 4OCWH 1L9MA 3N85L 4M7KL 4KRMB 4K2UH 3B43A 5EO0B 4LLVB 4UQ2B 4L8SC 1PG7H 4XRCA 3OZ9H 2PTVA 3L95A 3P3YA 1T66C 5T3ZH 2UV3A 4QT5A 4MQXC 1ADQL 4MJ5B 3F5WB 9CGTA 5L7XH 5AZ2L 1DDHA 4J7RA 2Z8WC 3V6FB 3HRPA 3DECA 4XP5L 3QHFL 3HG1D 4JM2C 3O41A 4HIJA 2KL6A 4UIKH 2VXQL 5C0CB 4PJ7E 1PKQA 3BZEA 1IQDB 1T2QH 1OP9A 4PJCB 3MREA 1AR1D 5T5FL 3E3QE 5EU3B 2BC4B 2COQA 4YDLC 3CAFA 4J4PA 2ZOLA 1T20B 1S78C 4JY5L 4QRTB 1ZA6A 3WE6A 4Z5RA 4OKVB 3BP7A 3HZVA 3DXAE 2I26N 2A6KA 1IEHA 3P4NA 2PYEA 3PWJA 3MRGB 3FO9B 5C0EB 4D8PB 3RU8L 5MHSD 3GNMH 1KULA 1S7SA 3KLAB 2JJVA 4YIQB 1KLGA 1CL7H 1WTGT 4U1MB 3MYZA 3MNWB 1YN6B 4OZHE 1ZANL 2L0DA 4XVUD 2LAGB 3MGOA 3B9KB 3VGBA 1Z0MA 3IFPA 1KB9J 4WI3A 1M4KA 5FUOL 3LHPL 2RQ8A 3MZTA 1ZGLA 3MUGA 4B41A 2VN7A 4KVCL 2EKSB 4YBQC 5KSVB 4WUKH 5I1IH 4RMQA 3CPLA 4OZ4A 1UB6B 4IEFB 1OT1A 2E7BA 4LQFH 3OXRB 3S37X 4NFCA 4ZSOB 4I77L 3GMRA 4XBGA 2GJ6B 3CZFA 3G6DH 4GKSB 4ZUTB 2NXZB 4ZOCA 5BVJA 3RNQA 1MH5A 2DMKA 3O3AB 5IB2B 3VI4F 4GMTL 1YDPA 1ND0B 2NX5B 2W0KA 3REWA 3CVIL 1AGEA 4P2QE 1NCDL 4XAWL 1RUKL 4HIEA 1K2DB 2O5ZH 2ZUVA 3MRMB 1TVHA 4H5SA 4GXUM 2WBJC 3WLWC 2YN3A 4X4YA 4L1HA 3DXAD 3BPCA 4N5UA 4PP1D 2VDMH 1NANI 2NY3B 1P7QB 1ZT7A 5IFHL 3ZDXF 5I0ZA 8CGTA 5EU6D 1TJGL 1XZ0B 1A1NB 3VXTB 2J8UE 2DQGH 4NZTL 4ODXB 4PJEE 4U7KA 5BW7C 5LXGL 1EHXA 1VGEL 2YMXL 2GCYA 3TN0A 1HHGB 3LH2L 4F9LA 1FG9C 1HEZA 3KDMB 1JI2A 2APTA 1U2CA 3ROLA 4J3SA 1KNOB 3TO4C 2C26A 3V4UL 2NY6C 3KPSE 3OJVC 1HZHL 4BZ1L 3D0VB 3WHE0 3BKCL 1ZXQA 4HHAB 4EN3C 1H3PH 1MRDH 4N9GA 3GO1H 3QWRA 2W07A 1Q9KB 4MCZB 3O6FA 4LU5L 1JI1A 5D9SA 4UTBH 4R3SA 2HT2D 5F6IC 1W72L 5BS0B 3KPRE 4LRIA 3P9LA 4JPIA 4Y5VB 2ATKB 3SDAB 5CBEA 1WWWX 3F7RA 2IBBA 1R3JB 2Z0BA 3IKKA 1J10A 2R2CA 3QXVA 1OHQA 3D25A 4N0YH 4MAYA 5ANMB 4U49A 3BSZH 4P2QD 5GGVL 2EH7L 1FE8L 4WHTB 4JFXB 4K3JL 4YHIB 1IGJA 3D3VE 1QUNA 1G1CA 4I2XA 1UADC 5JW5A 5F7WC 1DN2A 3U4EB 3RGVD 4UT6H 1MFCL 2X4OB 5EC1A 1RMFL 5I1EL 2R0LL 1RZGA 5IW1A 1CLZL 2B2XL 3PP4L 3HR6A 3G6AA 4EI5B 1UJTA 3P11H 4JPWH 1MIEH 1TZHA 2XZCL 3ARDD 4YC2C 5FM8A 3W0WB 2X1OA 2EDWA 3QNXB 2VUOA 1KTKE 4M7LT 1YEIH 1ACYL 3EKCA 2JCCA 4OZGF 3GSQA 3R1GH 4B0MM 4MHHI 4FQCH 3JWOH 2QQLH 2VSDA 4P48A 2E27H 2H2SD 1ORQB 5C0BB 1G0YR 1MQ8A 3KPSD 1MCDA 3BRGC 2B20A 4IIQB 5CFHA 5ERWA 4FNLL 4XI5C 5GZND 4GRLC 3ZDZE 1FFQA 5E8OB 1BD2A 3MJ7B 3EDKA 4JO2L 1DQJB 1EEZB 3KJ4B 4R96A 4KPHL 2HTKC 4GKZA 4OD3L 3UTOA 3RWGB 1RUMH 3TBVA 3GIVA 4BSVB 4AEIL 1C5BL 3AFLA 3BYTA 3MRQA 1B90A 2FATH 3NA9H 2VZUA 3P4OB 3LQZB 1N4XL 5ID1B 2FO1A 2Y06H 1A7QL 1J8HB 2IALB 4MMZC 2XG5A 3CFBA 5HHMB 5IHLB 1R3IH 4XMKL 2IQAA 1J87A 4GRWH 2DQCH 3HFMH 3MLUH 2NY7L 2QTEA 1GYAA 3KPLB 3OGCA 4JN1H 4PJDA 3K8MA 5ILTL 4QHMB 3ILQD 1BOGB 4E0RA 3T2QA 1U41A 2DBJA 4Z7OF 5C9JA 2Q8AH 2DDQH 3RPIB 4M62H 4YDIH 5DC0A 3UTZA 1UWEL 1YJDH 1FL5A 1SMAA 4X99A 4HDIB 4Y4HC 1J7VR 3PGDA 3GSRA 3QUYC 1J11A 4X7CC 4PJCE 4I3SL 3NIFE 5T5NF 1JPTL 1MAMH 3K1KC 5HVFB 1D9KC 4Z0XA 2OP4L 5FA4B 2XKNB 1E4XL 2NNAB 5AYUL 2M2DA 4J8RB 4X80H 4NN6C 5C0AB 4HUUA 3DX9B 1MFNA 3V4PL 3T04D 2AV1B 5CSZA 4M7ZB 2C9AA 2FEEI 1PFCA 1YEGH 2Z31C 4XPBH 1AKJD 1HH6B 1NCAL 2W91A 3RTQA 4HUKB 1OWRM 5CJQH 3NA4A 2FLRT 3PL6A 2OXHA 2MSPA 2QQNL 3KYKL 4RIRA 5HVHC 5B3JE 1U8JB 2CDEA 5DJDB 3LQAL 1I8MB 4PJ8D 2NCMA 3E2HC 4CNIA 4DGYL 1VCAA 4WI2A 3AMKA 5C07B 1AXSA 1BZ9A 3K80A 4JKKA 4XRCB 3A6OA 4YFLF 3PP3K 3EOBA 3SN6N 2FO4B 4JPVH 4QT5B 5IBLD 1S7QA 3OJDA 1B0RA 1JWUA 2H3NB 1J0YA 1DDHB 5D72H 3RHWK 2X7LA 2XRAH 3S37L 4Y89A 4X9HA 3GBML 3LN5B 3O41B 2DIJA 1Z5LA 5E6ZA 3TA3B 4NNXA 4NQEB 4ZFZA 5GRJL 3TH2T 2FSEB 4KJWD 1D6EB 2DYPA 2YD1A 1N6QL 4GG6A 5D5MB 5C0CD 3HZYB 3NIDF 1DBBL 2EDOA 4JO3L 5F8QC 1LDPL 1KC5L 2OTPA 4W70A 1IL1B 2AGJH 1ZKAA 3WL9A 5DJCA 1OAYL 4JZJA 4YXKL 4HFUH 4Z5RB 4F57L 1CFQA 1EZVY 3S5LA 2FYYA 4ZO7A 1U8NB 2PYEB 4KI1A 4X4XB 3WFBL 2AVGA 5K9KA 3X3GH 3LQMA 5D7LB 3FZUD 1NGPL 1S7SB 3O2WL 4V1DB 1LO2L 1CFTB 5CJ8A 4WUUA 3QIWA 3BPNC 3B9AA 4YAQA 3QPXL 3N1MC 3PNWB 4MQ7A 5DQ9A 3BRFA 3MGOB 4OTXH 4PJIF 1WZLA 3IFPB 3NZHL 1NCNA 3BZFA 3RWFA 1CICC 3B9KD 1OM3H 5DD3L 3LKRB 4P3CH 3VG0H 2D7OA 2BOBA 5JUEH 2BP3A 4R8WL 3KGRA 4RFNB 3ZE0F 4UAOC 2H41A 3BISA 3ZSTA 5HI5C 1CT8A 4BQ8A 2W1NA 3MMEA 2UY7A 3RUGF 1BQLL 4QTHA 4Y16A 3QT2A 1OTTC 3GMRB 4XBGB 2WBKA 2V5RA 1W8NA 1J1PL 4YXLL 4NJAL 3VFVA 2QQKL 3STZA 2GJ6D 2NXZD 1MH5B 5FYLD 4UINL 3UPRA 4FA8A 5KS9A 4FP8L 5HVGB 5DJAA 3VE0A 3L3DA 1YDPB 4DK3A 3REWB 4NWUH 5AWNH 1AGEB 2NX5D 4GXVL 5L88L 5DO2D 4N1CA 4HIEB 4Y4FA 2JELH 5ANME 3WKML 2GK0A 3CSGA 5E0QA 3GKWH 3D5OF 4LSVL 1K85A 1FLRH 3Q1SH 5E9DA 2CMRH 5FO9B 1A6VH 3M07A 4OZIF 1GOGA 5I18H 3G5YB 2HVKA 5AZEH 1HOCB 4ERSH 1T5WB 1SHMA 2R0KL 3R06A 2Y7QA 5GRVL 1WBZB 1ZHLA 4YX2H 1PG7W 2NY3D 1P7QD 3NAAL 5JA8B 3RY6C 2FR4A 5JO5B 3I6GA 5CGYD 2DS4A 1HINL 5IF0A 3T4AA 4DN4H 2CUIA 3W0WE 1RZFH 2VJXA 2GCYB 3TN0B 3GIZH 5DD5L 3J8F7 2KQNA 1BF8A 5ACZA 1HEZB 3RWJA 3G9VA 3KS0J 1FFPA 3FMGL 2KDGA 1BAFL 1I7RA 4PD4K 5C0BE 3QZWG 5EIQA 4LK4A 4Z7WA 3L7FA 3ZDYF 5L8JB 1FDLL 3H9SE 5I9QB 5HYJB 4OAWB 2ZJSH 5ACLA 1UWXH 4OGAC 3QIBA 4GBXB 3HMWH 4TUKL 4NPYA 1HHHB 3JWDL 2X09A 3ZKMD 3EO9H 2IPUG 5DRNA 4FZ8H 2Q87A 5F72S 3IDMB 4JPIB 1AC0A 1FCGA 4ODWB 4H8WH 4EQ2A 4G7VL 4IRZH 3SDAD 3RX5A 3JUYA 4HSQA 5EORL 1AO7E 3D39E 3LD8C 1VEPA 1ZLSH 5D7KE 2DLEA 4U6VH 1K6QL 2V2TA 1NKRA 2CDFA 1DSFH 2VE6A 2EEBA 1XEDA 3K2MC 5JW5B 1OAZL 5EB9A 1CIDA 2HKHL 3C09C 3ROOA 3AC0A 4MNQE 3G6JF 1EBPA 1YNLL 5IW1B 3VWKC 3G6AB 3ZL4L 3BKYL 5IB5A 5F9DC 1TZHB 4GS7B 5DHYB 4EI5D 4PJHF 4MB4A 4YK4C 3W0WD 2IFFL 2JCCB 4I0KA 1R5VA 4FG6D 1F4HA 4Z7QE 1ED3B 1OCWL 4Y4KA 3DUHA 1N5YH 1CN4A 1D5XB 4HEME 4LVEA 4X6CB 5FUCC 1H5BA 5ERWB 5C0BD 1EVUA 1KGCE 4Z7VF 5EZIH 1UM5H 1GGUA 5FDWB 5C0AE 2D2OA 1A3LH 4WWKA 2P5EB 2DQDH 4NKMA 3BGAA 4R96B 1JJUA 2JJUA 4PGDA 2P46B 4GKZB 4LF3B 4M48L 3HA0A 4KZEH 3UYRL 4JDVB 1I1YA 3GIVB 5TQ2H 1A4JB 4MDJA 1FNEB 4PRHE 3GMLA 4HIXL 1HHIB 2CIKA 1A7OL 3MRQB 1GIGH 3K8LA 4XC3H 3O8XC 4RBPK 4Q9CA 4D0CA 4UIMA 2E8ZA 3K3QA 4XNMA 2DN7A 2EXWC 3H42H 5D7KD 2PXYB 3TZVA 4NYLB 3CFBB 5ESAA 2P5WA 5EO1B 1J8HD 4XTRD 4FHBD 2WLYA 4TULL 3BAEH 3QCVL 5HHMD 4O02H 5CMAA 4K3DL 3IYLW 2R29H 2EXYD 3Q3GA 3QEHB 4APQA 2NYYD 3TJEH 3OGCB 1EAPA 5I19L 3KJ6L 5DRWB 5J56B 4L4TA 4E0RB 5IGXL 5L6YL 5LWYH 1N26A 4ZOBA 5C9JB 2J5LB 4FQ2H 2KZ1B 3U82B 4R26H 3PDOA 2B5IC 4NQEE 3UTZB 2AJVH 2WAHA 3WO4C 1PKQE 3T08A 1NAMB 4LASH 5D5ME 4I4WB 3T77B 4F7EA 1AIFA 1X5IA 4XH2A 2R0WL 4Z0XB 1Q9OA 1CU4L 1FSKC 1UJ3C 3DMMA 4HUUB 2IBGA 3MFFA 5TFSH 1KB5B 1KGCD 1MFBL 1U42A 1QACA 4JKPL 5C0AD 4JPKL 4Z7UA 2ZUXA 2Y72A 5CSZB 2PYEE 3L6FA 4WY7L 1HKFA 5TE6L 3BRDA 4PRPB 3UYPA 1A6TA 4P59H 1CD1A 1ZK9A 3B2VL 5DSCB 5JR1H 4GLRI 4V1DE 4R4BA 4RFOL 3RTQB 5DHVH 2P44B 1CDCA 4RMRA 3PL6B 4Y8DC 2FX9L 3V6OA 2X4NB 5GGQH 4RIRB 1J9CT 2AXGB 4X4MA 2CDEB 1OLZA 3QXWA 5JDSA 3O6KH 1ZVYA 5JW4M 1P6FA 4HBQA 5DWUH 3F6IA 4K7FA 5SV3A 3RKDD 5TDPA 4I0PA 2NZ9C 5E6IC 5JMOC 3GSUB 1BZ9B 1MHPL 3S3JA 5T33H 4TTGA 4FMKA 5E2TH 5C07D 1OAKH 2OLDA 2GY7B 3M1BA 3SKOA 4YHZH 3OJDB 3L3IB 4M43H 1VFUA 2R9HC 1B0RB 1E6JL 3D1MC 2AEPH 2QJDA 1JGVL 5TPWL 3BUYB 3HNSH 4KKCD 1I7ZA 5JZ7C 4IRSB 1Z5LB 1KV3A 2DYPB 4GG6B 2G9HA 4HBCL 3TA3D 4K8RD 4NQED 5E7BA 2DRUA 1IFHL 2HRPL 3O2VH 4W6WB 3UC0L 4PLKC 2VDOH 1A02N 3WL9B 1T0NA 4UQ3A 3RWCA 4J4PD 1JNNL 5BV7B 1CFQB 4CU7A 3UZQA 4FQXA 1GZPB 4GRWB 2FYYB 1RJZA 3X14A 3JV6B 3IXAA 5K9KB 2PYED 5T5NG 2YD5A 5T3ZE 2Q1EA 3ALWA 4JO1H 1RJYB 4OLUL 1BJ1H 4TSAH 5D7LD 4C59B 4ZUSB 4WUUB 1HSBA 3QIWB 1SBSH 1RJCA 5FECB 4U1IB 4V1DD 4G6JH 1I1AC 3HMXL 5BOPA 4HS6B 4PLNC 3BE1L 4GW5B 5DQ9B 1G0DA 4R7NB 1A7RH 3MCLL 3KYOA 1QRNA 2D4DA 3GI8L 5F7FA 2ZNXA 3RWFB 5IVNA 2DQUL 5BJTA 3ES6A 3WIHL 3LKOB 2H2PC 4FN0A 5HJ3B 2BOBB 5IQ9A 1A6WH 4YGVB 3QFDA 3K0WA 5FHAL 5HYSA 2A1WH 4YHLL 2X2YA 2XN9A 3SKNA 1CT8B 2CXKA 4JKWA 1WT5C 3FO2A 1MPAL 3PHOA 4KAQL 5GGRB 1OD9A 3MLZH 4QTHB 4U1JA 4Y16B 4M8VA 3BPOB 1T7XA 2VLRA 4CBPA 3HI5H 3HPJA 3VFOA 2Y9RT 1LO3L 3VFVB 1TTGA 1IC5L 1FBIH 4G42B 5DHVA 2ERJC 1EEQA 3K46A 2OI9B 4P46C 3PWPA 1UM6H 3MV8A 3BT2L 1OPGL 5DJAB 3BEVB 4JCMA 4B53A 3L3DB 3DO3A 1T7WA 2AKRA 2R8SL 2HH0H 4CVZB 3QG6A 1WWCA 3BGFB 3BUTA 3GJFH 3U7AA 4Y4FB 4N90D 2B8OT 1G9MH 3ZKSD 3IDNB 5IT2L 5ICXA 4KI5C 4I2XE 3CSPA 5D7JA 1E6OH 3B8SA 1FZKA 4AEFA 4NQVA 3R06B 4JFYA 1XCTA 1ZHLB 2KH2B 3DNKA 3FQNA 5T3ZD 3L1OL 4H88H 2PTTB 4JFHE 5D7SL 5DTFB 3I6GB 3MRNA 3ZT5A 3QSKB 4RMTA 4TNVK 4YNYA 5IF0B 4IM8A 3P30H 4FOMA 3ZKND 4LEXH 3TN0D 2JCCE 3RWJB 5GGSY 3U2SA 1MNUH 3BJLA 4F7PB 1N8ZA 4GSDL 3WFEH 4HWNA 3V9FA 5A3IC 5BMFH 5I1GL 4Z7WB 4XXDB 1BD2E 2CJUL 4X8XA 2P5EE 3PDGA 1MIML 2K7PA 2ARJQ 5FYLL 2VISA 3QIBB 3QWRD 5HYJD 4X6FB 2FB4H 3M45A 1T2XA 4NPYB 1AGDB 1NFDF 4YFEA 1R24A 4WJ5A 3MV11 2J12B 1JWSA 4U7SA 5E4EC 1RUPL 1FLTX 4C56B 4ZUWA 3R8BB 4ZTPH 1YMMA 4RZCA 3QG7L 2CUMA 3WJJC 1JZ4A 5CEXB 1NANH 5HYQA 2XOTA 2Z8VC 5DD1H 4WHYH 2CDFB 3FTGA 5DFWH 3WNPA 1J86A 1OAXL 2VE6B 3FRPA 4TTDD 4HXAL 5TDNB 4DQOH 1UA6H 2JIXA 3ROOB 1CFSA 3MJ9H 3IJHA 2XA8L 4Y1AA 3MRBB 5F21B 1MF2L 1T1ZA 1YUHA 4JFHD 5LCVH 5IB5B 1TQCB 1DANU 1UZ6E 2VLKB 4NIKB 4RBPH 3TEUA 3TNMB 2NLJA 3H9HB 4ISVB 4ZPVA 2OZ4L 2ID5A 2V17L 1R5VB 5KVDH 2AK4B 1MFAH 4EBQH 2IG2H 3GJFA 2AJ3B 1QYGH 1D5BB 1YMHA 2DTSA 1M1SA 3O6MH 4WWKB 1RK1A 3LKNA 1IBGL 2QADB 4HJ0D 4NKMB 5JPNA 1JMZA 2P5ED 4PGDB 1H3VA 3EDEA 3OB0K 4PRPE 4YPGA 5GGTH 2VH5H 4HC1A 1I75A 4GAJH 5ALCH 1GRWA 3GMLB 2CIKB 4LFHD 4N5ED 4YBHA 5E5MA 1VESA 4ZDHA 1PG7X 1FIGH 2CRZA 5MERB 4L8BA 5DR5H 2APVA 3GMQB 2CR6A 4LNRB 3VWJA 1YEEL 5IUSA 3FT2B 3BP4A 4NZRH 1QD0A 5ESAB 4HCRH 1WAAE 2DQJH 3Q0HA 4G7YH 3F6LA 1YY8A 2PXYD 4XNXH 3MRHB 1RD6A 5CMAB 4J3WA 3UMTA 5C1MB 1X5XA 2Y36L 5D1QA 1EAPB 1DANT 1EO8L 4ZD3L 1MCPL 3FQWA 5E2JA 4NM4H 1RSFA 4YPJA 4P5TA 2CXGA 4L4TB 43C9A 1P2CB 4LVOB 2D7TH 5A2KH 3GSOA 5JIKA 3QPQD 4XNYH 2A9MH 1U2HA 2AAVA 4GG6E 4OM1L 4FQLL 4F7EB 5ADOH 3T0BA 1HYSD 1RIUL 2EO1A 4L1DA 2DD8L 1XGQA 1VA9A 1ZLUH 3DMMB 1BMGA 4M4RA 4Q9QL 1NPUA 3MFFB 2HT3C 1A21A 2YA2A 2QV2A 1NMAH 5E8DL 4GRWE 2XY2A 1T22A 4BQCA 4WEMB 4TNWK 1U6AL 5DEGA 3HUJA 3HHRB 3LS4L 1A6TB 2OR8A 3CCHB 1CD1B 3IS0X 4L9LA 3MJ9A 1P4IH 5F97E 4OGXH 4CW1B 3LEVH 4UB0H 2C3WA 3I02B 4JRYA 4PRPD 4ZFOA 4OFIA 4FQQA 1WK0A 4WUUE 4P9HL 4LARH 3RTQD 3FB8A 5AAMA 1F6AA 4MVBC 5FV1L 4AEHH 1PEWA 3PL6D 5DMKA 1NCBH 1ZHBA 2HFFA 4ZAKB 2PW2B 1DBAL 1HQRA 1KPRA 1UXSB 2JB5H 4JFDB 1G7JA 1AHWB 1VGKA 5TDPB 4KY1H 4I0PB 3T4YA 1LEGB 3NOIA 1JRHL 2C1OA 4YEEA 4HKXB 2AI0L 5F7MC 1CBVH 3NPZB 2DQFA 1MJ7L 5B38A 4O58H 4LOUD 3SKOB 4RISH 3FN0H 5IR1A 3SGKC 4LLQB 2XZAH 4OLWH 3V7MA 1KACB 3HS0A 5GGTA 1JPSL 3WXVL 4JQVC 5E95B 2UZIH 5KS9E 4MXWH 4IRSD 4E41A 4YHYB 4FABH 2DYPD 4MXVF 3DIFA 4NUGH 3BXNA 1W2KT 3D6GA 5EH1A 2O61B 4RA3A 3GSWB 4KV5F 4HCRA 2QQQA 1T0NB 1DBKH 3EO0A 4G8GB 3ZYIA 2DBLH 4FQXB 4M00A 4TPRL 5HDBF 1RJZB 3IDIA 4M1GL 3ALPA 2EIBA 3RI5K 1BQHG 5GQBA 1NFKA 1N5AB 2IPKB 2HJLA 1MCSA 1HSBB 4CDGC 2K1MA 4MS8D 3MJ8A 3QIWD 4WUUD 2GSIB 3PWUB 3RZWA 5E56A 4P23A 1EEYA 2EDRA 1QRNB 3OR7A 1ZS8A 1CGXA 5F8RC 4WO4A 5E2WH 5BJTB 1MELA 1QSZA 5E8NB 3QCTH 5EC2A 2I5YL 3TV3H 4Z78A 3H7LA 3QFDB 5GS3A 1RUAH 3VGGA 3NGBC 2XN9B 4MAUH 3SKNB 3VRJA 3PGCA 4AL8H 5C7XL 4Z7WE 5GS2H 3REVA 3A67H 1LO4L 4YUEL 1R5WB 1SJHA 4U1JB 5T1DH 3N9GH 1TJIL 1Q0YH 2ORBL 2ATPA 1YY9C 4DN3H 1MWAH 2O5XH 3PJSA 4Y16D 3HPJB 4DEPB 1V7MH 5F9WC 3VFOB 4P4KC 3U0TA 2R69L 1BBDH 4K8RL 4AIZA 1A8JH 1RHHA 3DBXA 5DHVB 4IJ3C 5KVFH 3C9NA 2AS5M 2OL3H 2ZPKL 3PWPB 4Y5YC 3MV8B 4OCLC 1I7UA 2IMNA 2X4TB 1LO5A 2AKRB 2I60L 2ADGA 5ICZA 1MFEH 2BHZA 7CGTA 4Y4FD 3WUWA 4KROC 2G60H 4XHQA 3O81A 3E0GA 3RNKA 3LKPA 1FZKB 3HE7A 3VDCA 4JFYB 1XCTB 3L5IA 5C6WH 3FQNB 1CDBA 3TM6A 3TVMC 4V2BA 4F80A 2NY0C 3QUXA 3LB6C 4RNRA 4R4ND 3HNVL 3NCYP 3MRFB 2H45A 5K9OA 4TUOB 1DBJL 1OSZA 3U2SB 1QFOA 4FTVA 1N8ZB 2AK4E 1J1OH 4LVNC 1C5CH 1KCSL 3IDJA 3TIEB 5IIEA 4NZDA 1YEJL 4R97B 4MNHA 2Z35B 3OKOA 1WC7A 3P40A 3S36H 1FYTB 1X4XA 3C6SA 3OKDB 3DJ9A 3QIBD 1R24B 2VERN 2N1KA 3GI9L 3L9RA 4G43B 4WJ5B 2DWEA 4R0LB 4LBEA 1JWSB 2D9QB 1JZ2A 2BJMH 43CAB 3LVEA 3GUTA 4ZUWB 4MA1C 3RA7L 3FQRA 3KLSA 4C56D 1YMMB 3RZCC 4RZCB 1M71B 4JRXA 4DJMA 3FRUA 4LEOA 1MRCH 4P3DB 4XVJL 4K2UL 3CJJA 3BIKA 3JTSA 2RFXA 5CCKL 1X6LA 1PG7L 4OZGB 5HYQB 4GG8B 3FTGB 4EXPX 1N7ML 5AYQA 3VJ6A 2X6MA 3F12B 1KG0A 5T3ZL 4FFZH 1IVLA 2HWZL 3BJ91 3OAUH 2D31B 4K9EH 2JIXB 3P73B 1OQXA 2ZCHH 1MHHA 5CILH 1CFSB 5KSAC 2XTLA 4J1UA 1MWAA 2YUZA 5HBBA 1U58A 3LV3A 1YUHB 3ARTA 4MQSB 4UIKL 1FORH 4L4TE 3ETBF 3NCBB 4LAQH 4NC2B 3I50H 1CE1H 3RVUD 3C2AL 2OL3A 4F15C 2VLKD 3CNKA 4ZPVB 4MDIA 1U93A 3D2UA 2NY2C 3ULVH 3VGHA 1HE7A 1KTLA 3SKJL 2FCBA 2CO7B 2AK4D 3OKNA 1YMHB 2VR9A 3SDDC 4Q74A 3GHEL 4X7SH 3WFDL 3C60C 1IGTA 1A6PA 1RK1B 3WN5B 1BHGA 3LKNB 4GRMA 3FQXA 4Z7UE 4WWKD 4P3WA 3U1SH 4KUCD 2QADD 3UBXB 3EHBD 4AT6A 3SDXB 1QFWM 1XIWC 2EDFA 5I73B 1S9VA 5DVLA 3V0WL 4NQCB 1JP5A 2X1XR 1V8HA 3BKML 5B3NA 4LP5A 1MRFH 3V6OE 3W81A 2DQEL 1ZWIA 3MRIA 4HWBH 2F54A 5GIRB 1J05A 5JPMA 2H1PL 3VXSA 1RJLA 1VFBA 4PG2C 4L8BB 5IKCA 1U92B 3VWJB 1GPOH 3LQAC 3WHXB 3VD9A 4WUKL 1ACZA 5DRZB 4H25A 2VITA 5GS0H 2R0ZL 1A64A 3U30C 4N8PA 3A6BH 4O4YH 1DEEB 3P0YL 4IMKC 5CLTA 1MHCB 3HZKB 3QA3B 4YZFF 1OTSD 5JNYA 3FQWB 1IGFH 43C9B 1SEQH 3U4BL 5JW3L 2OMNA 4L4TD 3GSOB 5DEFA 1G0XA 4Y2DC 5K93A 2AQ3A 4R2GC 5GSRB 4DVRL 4PY7B 3U9PH 4DOHB 4M6AA 2MJWA 5CHNA 3D9AL 1Z2KA 3T09A 3MXWH 1YEKL 1M7XA 1ONQA 3DMMD 4X7TA 3RDTB 1PSKH 3HZMA 1U3HC 4PJ7F 4WEUD 4PREA 5EUOB 6FABH 3QQ9D 4GQ9H 4JRYB 4D3CH 1EUUA 4FQQB 4XP6H 4EOWH 2KUTA 4ZMAT 3FB8B 2F8OA 3BKJL 1U91B 5DMKB 4OT1H 3MLVH 1QRNE 1IC4L 4MD0B 1MREH 1HQRB 4P2OA 3MACH 4ZAKD 1MCOH 1QBML 4LSUH 4HXBH 3T4YB 2J88H 4JFDD 1H3PL 2UVFA 3UO1H 4MYWB 4I0PD 4XAKE 2XN9E 3CDYA 2MQCA 4OZHF 3MLSH 5FKAA 2K9UA 3IFLH 1U9KA 3JBG7 4XNUL 4WV1A 3I85A 2EIZA 3QYCA 5IR1B 4I18C 2VDKL 5GRXG 2B1HH 2VLRE 4OI8A 3DVNA 1IILE 2NY1B 3S34H 3FHQA 1H3TA 1NAML 5TDOA 4NZUH 5KVGH 4HWBA 3MODH 2DQHH 3MV8E 3PWPE 1KIUA 1G6VK 1CVRA 1AR1C 1PZ5A 2CR3A 3JWNC 3DIFB 3BXNB 5KW9L 2BHYA 2BY3A 4U31A 1T7ZA 1KPVB 1LK2A 4Q6IB 2X70B 1KB5L 3FO1A 1NGQH 5CINH 4XPGH 1TPXC 4X5XB 5IQ7H 1UENA 2X89A 1Z9SA 1F42A 2J3SA 4GLRH 4J3UA 1GC1H 2EDDA 1N59A 2GJJA 2OM5A 3F7YA 5F1IA 1NMBL 2ARJB 3IDIB 4G8GD 4X7EC 5EZOL 4UV4H 4FQXD 5I1HH 4OUUA 4PGJA 3LEYH 4Z9KB 3V6ZA 2HJLB 4KWUA 2A73A 3GMNA 4XVUC 2CLVB 5KJRL 1J0JA 1YNTB 1E28A 4KDTC 3R1GL 4XCYB 4P23B 1EEYB 4UTAL 3DX6B 2EICA 1IGCH 2R2BB 3OR7B 3SOBL 1R3KB 2E27L 2Z93B 4WO4B 2VDPH 1QRND 4KJPD 4F37F 2AXFA 5EC2B 1GOFA 4PJ9A 5L2KB 2YD9A 2LAAA 5TH2B 5C09B 2J8UF 2VDLH 5IBTL 4N8VG 4K23H 4XAKD 2XN9D 4PRDA 2PKDA 5DJXA 3TYGH 4KTEH 4IRJC 3TH4T 2YD4A 1FYTE 1YEDA 3C8KA 4JHAL 4LSSH 3PJSB 2FJFB 5F9OH 4POUB 3U0TB 3AB0B 1HSAA 1ZT1A 3FHAA 2P8LA 3DBXB 3S4SG 1B0GA 3NA9L 3C9NB 1A47A 3JWDC 3EYOA 1WFTA 3ZHLA 4C83B 1I7UB 5F7YC 1J5OL 5CEYA 1YMME 1LO5B 3MV8D 3PWPD 3DVFA 2YC1A 2ADGB 5HHVH 1T1XB 4IOFD 5ICZB 4RGNB 5BV7L 1NLBH 3WD5L 2VQTA 2YR3A 1PX4A 3WUWB 1QFWL 1XGRB 2J4WH 3MLUL 4HIIA 4WWID 2R39A 2VXVH 1AJ7L 1U3JA 4PP1C 4WW1A 5KANG 4K07A 4G9DB 1M7DA 5TE4L 1TTUA 35C8H 5FGSA 1MJUL 1L7IL 3V52H 4Y1AE 1IAOA 4ELKB 3OKYA 2DDQL 2OTUA 3QUXB 3N50A 4RNRB 3AVEA 4YGAB 1WUNT 4YDIL 5J3HD 2RBLA 1BZQK 4KK6D 1FZOB 3VGAB 2FH6A 5F6HI 4WI9A 2DWDA 4M93B 4NO0A 1OSZB 4IS6B 3S8WA 4Q58C 1A9EB 4M6OL 4XPFL 1P5UA 2V2XA 3IDJB 5GS1B 4PPTA 1A5FL 4RX4D 2OTWA 4LCCB 5IIEB 1NDGA 5SV4A 3UPAA 3MUY1 3VW3H 2HT4C 1JNHA 4MNHB 3OKOB 1LILA 5IVXA 1GZQA 1JYNA 4PJGA 2J6EH 2HT2C 5D70L 1QQDA 3H0TB 3U7YH 5L9DH 1FYTD 2MHAA 5K59E 3MO1A 3P9WB 5IROC 5A2JH 3SDXE 1XF2A 4LBEB 2OK0H 4NQCE 3IDGA 4MA8H 1PBYA 4HWEL 1RY7B 3E1F1 3FQRB 2DQIH 4L8SA 1HHJA 3FT4A 1S7RA 3ZDZF 1HH9A 4H0IA 1VB9A 4JRXB 4LEOB 1YMMD 1NJ9A 2F74A 1KN2L 1R0AH 3BIKB 1Q9LA 3JTSB 5EU4A 5JORA 4QRQB 1VFAA 4H0GA 5DJ8B 2EH8L 3RVTD 2A6JA 2ED9A 2ZP0T 4IDJL 3VJ6B 1OAQL 2EDLA 3PUCA 1W0VA 1LEIB 3LSOA 4JPVL 5ENWA 5JQ6L 4JM2A 3CLEH 4NHCL 1F4XH 5SWSB 3BESR 4J1UB 3MFGB 2JIXD 4GT7A 3CDGB 1VKXB 1U58B 4ESKA 4HG4K 5IMOB 2IWGA 3SY0A 3L5XH 5DLML 4Y88A 5LGJA 4U7MA 4NN5B 4K3EL 3GJEA 5IFJB 2E6QA 1N64L 4HQQH 1U93B 4MB3A 5IEHA 3D2UB 3OKMB 2H2SC 5H2BA 1KTLB 3VXUA 4OLVH 2WBWB 3UJTH 3S6CA 3UTTA 2ITDA 1TNNA 3IDXL 3OKNB 4DOHE 5CGTA 5KN5A 2XZQL 2F5AL 3ZE1E 1F4YH 1NDMB 1NEZG 4GRMB 4F8QA 3P0GB 5A1AA 1GGCL 3PV6B 4N8CH 1JNJA 1OGTA 5GGSA 4AT6B 3DOSA 3HUJE 3O0RL 4P5MB 4P2CG 4S0SD 1S9VB 5ESVA 4JRYE 2AJUH 4PJCF 3NIFF 1I9RH 4NQCD 1OWWA 1ZWIB 3MRIB 3MUZ1 2LVCA 1J05B 3W39B 3VG0L 1RURL 1RJLB 1VFBB 5JUEL 4LMQI 4Q2ZB 2WUCL 4YWGH 5IKCB 4FZEH 4LSRH 3BFOA 3CXDH 2MKWA 1LEKA 3VWJD 2Y4SA 2G2RA 4D9LL 1FH5L 4K3HA 5H94A 2VITB 1CK0L 2WV3A 1H3GA 4PV9B 1E0OB 1PAMA 5JHLH 2J6EA 1NFIA 4QRSA 3AS1A 5B3JF 5C2BH 4LLUA 2PW1A 3IFNH 5DQJA 1FGVL 2DLGA 2ZSVB 1ETZA 1CFVH 4S2SA 3MLRL 2X10A 1JGUL 4I48A 3THMH 5DEFB 4HT1H 5C0JB 2X4RA 4NWUL 3VA6A 2IFGA 4PJBA 5AWNL 4OLXL 4RCAA 5EBWA 5ICYA 5I30L 4M5YL 4E41E 1BJMA 2JELL 3VXMA 4OUOA 1FLRL 4YH6A 2ZKHH 3HE6B 4AIXA 5CHNB 5F7LB 1N0XH 1YYMH 1ONQB 1T3FB 3H3PL 1EJOH 5BW7A 3A6CL 3U0WH 4BFIA 3LKQA 4HLJA 4HZAA 3D85A 3RDTD 4CGTA 4JY4B 3RIAK 3PGFL 4F2MA 1XF1A 1I3UA 4DN4L 1HXMB 3TO4A 1HHKA 1INEH 4JRYD 5JXAL 5EBMB 4M03A 1S9KC 2WINB 1QNZL 4PJ8C 3MLXH 5MEPA 4F7MA 4P2OB 5BVPH 3F7PC 2DJUA 2HKFH 1MVUA 5L2KE 3W9DB 4HS3A 3NTCH 5IBLC 1SMOA 2VXUH 3GBLA 3GSNH 3MBEB 3AS2A 3I3DA 5J9PA 5JW4N 4WV1B 2EIZB 3ZMRA 2DLFH 2WP3T 4AZ8A 2YPLA 4GMSL 2SEBA 5D8JL 3C6LC 4G80A 1FL3B 3QZWA 4KJWC 2F53A 2VZSA 4IRZL 1LHZA 3RY5A 5TDOB 4HUVA 1XMWA 1WISA 2CLZA 2NY1D 1R3LA 1I4FA 3DYPA 1XR9A 4EQ3A 5I2IB 2ZCLH 4F58L 1ORSA 4DAGH 1QHOA 1BX2B 4NHUA 4MZ3A 3DRQA 3TPUA 1KELL 1DSFL 4RGNE 4RGMB 3FO1B 1FC1A 4UMGA 4JR9H 1VERA 3SDYL 4QXUL 4HPYL 4WGWB 5F1IB 1N59B 3F7YB 5GPRA 2I24N 4A2MA 3VFGL 2F8VA 3DSFL 2JB6A 3FZUC 1OB1A 3V79C 3LZFL 4TVPH 5BZDA 1H15A 3V6ZB 4FQPA 5E03A 5HXMA 4EI6A 3RJQB 1PEZA 4K55A 1E28B 4XP9L 3U4AA 5TF1L 1A7NH 1EJ6A 1BLNA 3B9KC 4KJYB 2BSTB 4P23D 4X9IA 3CIQA 4Z95H 4FTVE 1HCFX 2N4IA 3CU1A 4WO4D 3QXDB 1EGJH 2A83A 5ITBH 1T03H 3RWIA 1H3XA 2C1PA 5E08H 5L2KD 4U1HA 4XVTL 5C09D 5DJXB 1G7MA 4PV8A 4OLZL 4TSCH 1G7PB 2X4UA 3C8KB 3NCEB 1T21A 5D4QA 2NXZC 1EX0A 1ZT1B 5IBUG 1NSNL 2P8LB 1AGBA 1E27A 1B0GB 1FIEA 4O51B 2P47B 5F89B 4Q0XH 3JV4A 3O3DA 3VXNA 4OIIH 2EYRA 1BGXL 2Z4QB 3H42L 5DO2C 5DD0H 2W9DH 3F62A 4JRXE 2YC1B 1P1ZA 4MCYA 1WZ1H 4Q9BA 4KHXL 2PR4L 1L6ZA 4Q6YA 1I3RA 1N0LA 3BAEL 4O02L 4RGND 4PRBA 2R29L 1FAIH 1L9NA 4D0DA 3G5ZA 4KTDL 4WW1B 5LJYH 1Q38A 3GSNA 4OFYD 2NY3C 1RUQH 2FJGB 5DYOA 4OI9A 3UJJH 4Y4HA 3MLTA 2I25N 1F97A 4G9FA 2IAMA 2OTUB 3QUYA 4DZ8A 3QUXD 5IB3A 1D9KA 4K71B 5IHUH 4JHWH 1CLCA 1WIOA 2DWDB 1IKNC 1UWGH 4JZOB 4HGWB 2GAZA 1AE6H 2ZUSA 1ES0A 3GBNH 2WP3O 3NN8B 4LHUB 2Z31A 1IEBA 4TSBL 1JZ3A 1DJSA 1DL7H 2OTWB 2W0FA 2YRLA 3QHZH 3ARBA 4DKEL 5KANI 1UFUA 1RZIB 2M1KA 5IVXB 2BNQB 1GZQB 2NZIA 4PJGB 2MOVA 4XCCH 2BFVL 2ZSWB 5DQDH 3LIZH 5JA9A 5FO8A 3OAZK 3ZKMC 2QHRH 3T2PA 4HX1A 3F7VA 4JLRA 3V0VA 5DK2B 5GGQL 4AQ1B 4S1SH 4Z7QF 3BP5B 3QISA 3ZKXC 4KHTL 4Y5VC 3SDAC 3MYJA 3C08H 1GAFH 3SEPA 2F54E 3FT4B 1S7RB 5DWUL 1HH9B 2V5YA 3VXSE 2LU7A 2V9RA 4JRXD 2HYMA 4RGOH 4XWOC 5DUML 1RZ7H 5JORB 1VFAB 2BY1A 3H7BA 2UYLA 3MV9A 1EGJA 5K9QG 3RKPA 3D0LB 5IMMA 3A0OA 1W0VB 4YHZL 3LSOB 5ENWB 4BKLB 4OV5A 4G6KH 3EYUH 5GGVY 1FO0H 1A1MA 5GS2D 4OF7A 4LLWA 4ORGA 2XG4A 4KRPB 3HNSL 4P5KB 1E4KC 4N0FB 1JTPA 1UT9A 4UUJB 1VEMA 4N0RA 5EZJB 5DUPH 2XTJB 5SWSD 2E7MA 3SY0B 4DKFH 3OPZL 3MXVL 3VMPA 2YKLL 3T0AA 1UZ8B 3NH7L 3GJEB 1N3NB 4ZFFA 2ADFL 2AJYH 4FG6C 3BGMA 1HKLL 1G6RH 5T1MB 3I9GH 5H2BB 3D2UD 5FO7A 2W9EH 1KPUA 4NNPL 3BN9C 1IGIH 2AK1H 3S96A 4H26B 4BSWB 5F93C 4KMLB 5GZOC 1CVSC 1E4XI 1AY1L 1NGYA 5INCA 3KJ4C 1HWHB 3OBAA 3FKUS 3DI3B 1OGTB 3TCXA 3ISWA 3MUHL 3MA9H 3Q6GH 5D5MF 1C08A 5ESVB 1CICA 5FYJE 2ITCA 1D7FA 1A7RL 1DFBL 4O9HH 3BMWA 1UKSA 3HC3L 2R56H 3CFDB 4P9HC 4FQ1L 1S9XB 1L7TL 3CX5J 1KJ3H 1WQVT 3GM8A 5C6TL 1ZEAL 5GJTH 3ULVE 1EHLH 2B0SH 1IGYA 3BH9B 4XTRC 1PD6A 3BO8B 2G2RB 3QR2A 5H94B 2EXYC 2NYYC 3U7WL 3VFMA 1OP5H 1NFIB 4QRSB 4MX7A 3RFZC 2DM3A 1RZ8B 1A6UH 4HJJH 3WNLA 3U79A 5FYKH 3WDHA 1II4E 4UU9A 4IDLA 4S2SB 4YO0A 1S7UB 1UM6L 1R5IA 1YZZA 4I48B 4X5WB 5B4MD 1BREA 4U4BA 1LGVA 2EDXA 3CUPA 2HH0L 2YS4A 2FLBT 3STLB 1S7TA 5L8KB 2OXGA 2FEDC 1PQZB 1ZT4A 4AM0A 4FFVD 3UZEA 3NMEA 2BRQA 1FN4A 1G9ML 1RVFL 4XPHL 1XCQA 4XPAH 1P7HL 3HE6D 4KQ4H 3RY6A 1E6OL 2FECL 1QSEA 4J23A 4BFIB 2APBA 1NCCH 3WDIA 3OAYK 3O6LL 4HC1L 4CL7A 3ARGC 3D85B 4M7ZC 1FO0A 4JQIL 3K4AA 4F2MB 2I9LB 3NCJH 2XI9A 5D6CA 1YNKH 2LE9A 3P30L 1HHKB 3SCMA 3L3HA 2VWEC 3GHBH 5FYJD 2QSTA 1CXEA 3QFJA 5MEPB 5I76B 1G6RA 3RKDC 5FCSH 3NACH 4JGUA 5BMFL 2C7UB 3ULVD 4P2OD 3GB7A 1MVUB 4BZ2H 3MRJA 4OQ1A 4WW2B 4HS3B 3LN4A 4NKIH 4W4NA 3BD4A 5D2NC 3BDYL 2MNUA 4JFQB 1CGSH 3MBED 1JGLH 3BVNA 4KKCC 3T1FA 3WJLC 3MOQA 2YPLB 5ESQB 5DZNA 3CMGA 2IANA 2SEBB 3EJZC 2GSGA 4U2YA 5E99H 4G80B 3P2TA 3QZWB 5JW4R 4NO3A 4LCIH 4ZTPL 1WGOA 2EDHA 2F5BL 5IVZA 4HUVB 3TA3C 2CLZB 4K8RC 4PJIA 1R3LB 3FB6B 2GIYA 5CEZH 1I4FB 4XBPB 5HY9A 1LK3H 1XR9B 4PB0H 1YECL 5DD1L 4NHUB 4UILL 5I8EA 1QKZL 1RFDH 2ICWI 3TPUB 1KCVH 5T1KB 4ZXBC 1T6VN 5IJVB 3VWKA 2X89D 4WI8A 1UA6L 3VFTA 3WIIL 4YBLC 3QUMB 3UP1A 2JB6B 1KEML 3TT3H 4L8CA 2R1WB 5DZOA 3D87B 3X3FH 5BZDB 1JUFA 4I3RH 4NM8H 4N9OB 2Q8BL 4UBDD 5BZWB 3VD5A 1UYWH 5D71L 2P8MA 1DQMH 2R4SL 3MLWL 1UQSB 1I3VA 2ZUTA 1BLNB 1Q0XL 4QNPE 5C71A 1MFAL 2OCFD 5CJOH 1UVQA 2HFEA 3T3ME 4U6HA 1C5DB 3S36X 4LLYA 1WBYB 4PGEA 3MV7B 1RIVL 2F58H 2FGWH 4JFFA 4DGIL 1IEAA 4JAMA 4JKLA 4JRWA 1B0WA 4RFNC 1KN4H 5KZCB 2A83B 1YPZA 2C1PB 4KJQC 2YSSA 3MROA 1YEHL 5DJYA 2BNQE 3K2UH 5IVXE 1SM3H 4PJGE 5GGTL 1JV5A 5D2LA 2DF3A 5KSBA 3O8XA 1T21B 2P24A 3NIGE 4Y19A 2JCCF 3TLRA 4EUPG 5EWIL 4JO4L 5GJSL 2BNRA 5GSVA 3WFHA 2Y25A 5KG9A 3JV4B 3VXNB 1XGYL 1JZ5A 2YK1H 4OJFH 4X6CF 1UCBH 4U1LA 2BVEA 4AG4L 4ENED 3B9VA 1JPGA 3W5MA 3X17A 5EU5A 5I8OL 3VFRA 5KVMC 3VXRA 3QUZA 2ADJA 1VSCA 3OB8A 4UDUA 3EO1B 2FD6L 4XP4L 3G5ZB 4ORZC 4KK5D 2AJSL 3W5NA 2QBWA 2D0GA 4HS8L 3DSNA 1EMTH 3DX7A 2L7JA 2VIRA 5E1HB 3GFUA 4OCRL 1IAKA 4G9FB 2IAMB 5E2UH 5EO9A 2XTJE 3WS6C 4CVXA 5ITFA 4DZ8B 4OLYH 3ZKNC 5C86A 2BXYA 2I9TB 5IB3B 3QDJA 1UJ3A 6CGTA 4NN6B 4BFEA 1I8IA 1CFNA 4QEGA 4POZC 4OCSH 1CD8A 2EDYA 3VXUE 1QLFA 3LKSA 4I13B 3UTTE 3PWLB 1J18A 4PBWD 2Z31B 1T80A 1BM3H 2GY5A 1I1RA 2YBRB 3F58L 3ARBB 4LHUD 2YPVH 4FFYL 1NGXB 3KPOB 3U6RB 1WIUA 3MRPA 3QRGL 5I9QC 1XH3A 1KBGL 3LMJH 1UZ6F 1I7TA 4GO6B 4UB0L 2BNQD 4GBXC 2HTLD 5L8LB 3G6JA 4LQ1A 1VHPA 2ICES 4OQTL 4DW2H 2NXYC 3F7VB 4NRXB 1V7NH 4WEBH 5LGHH 1NCBL 2XQYG 2C3VA 5E6IA 5KAQF 4GW4A 5JXED 3DHJA 2FBJH 4MXQC 4PGBA 4NBYB 4R90H 2ZWLT 2UYLB 4TTDC 2A0LD 4HPOH 1CDJA 5FKPB 1RZKL 4MQXD 1X7QA 2FH8A 2N56A 1TZIB 4RAVA 3N1FC 4OV5B 1A1MB 4LPCA 4LLWB 3QCUL 4Z7NF 5GISH 4KRPD 1CGVA 4WCYH 4MXWL 1CF8L 1SEBA 2XTJD 2HVJA 1WAAF 4ZFFB 4HK3N 3HC4L 5FA3A 2F19L 4PJBE 1IT9H 3E6HB 3B6SA 4FQIH 4MJIA 1ZLVH 2NW2A 5K9QI 5FO7B 3P4MB 3VXME 4JFZL 3HPLA 5IB4A 2WWMC 1QFUH 4XMLH 1ZVSB 3O11A 1XGUA 2OJEB 4PR5A 1NGYB 1K8IA 3QHTC 5INCB 5KTEL 4WVRA 1I1AA 4KUZH 4CRPA 1AD9A 5IOPA 3FO0L 1W8OA 4XCNB 1U8HB 4GG6F 3QEUB 1C08B 2D03H 3KPPB 4BK5A 3GMOA 3BH8A 4MJ6A 2ITCB 1BEYH 4XCEB 3DGGA 5E2WL 4LCWB 5E24E 1U8OB 5F7UA 4GRWF 2A74B 3VXPB 1RUAL 3IFOA 3S3SA 1RV6X 2PXYC 1BQHA 1YC7A 1MCJA 4YDKH 4AL8L 4ZS7H 3T2OA 1P84K 2V7HB 2ENYA 5T1DL 2BZDA 5JHDA 3VFMB 1DN0B 4CKVX 4RSVA 4P46A 5I1AA 1BBDL 3PIQA 3MOBH 3VH8G 3TBSA 4Z76B 1PKOA 2YPLE 3MRDA 4UOW1 3MNZA 4U1GC 3H6JA 3EZJB 1AD0A 3QPQC 4LLMA 4RFEA 4YO0B 1R5IB 4UT7L 2J5LC 2F53E 4TUJA 5CBAB 4Z8FH 2Z92B 2B7DT 3ULUH 1OAUH 1S7TB 3P0VL 1B6UA 4ZFGL 1ZT4B 1U3ZA 5IMKA 5E6YA 4AM0B 3WLWD 5F7HA 1Y18A 5JIPA 2VTFA 2G60L 2ZCKH 1SY6A 3FFCA 4O2EB 3FOLA 1MFDH 3CLFL 3KVQA 1NBVL 2ICEA 4IOSD 1INQA 2CGRH 1EDQA 2V2WA 1A3RL 5KS9F 1Z6JT 2XIDA 4WDIB 3D85D 5E2VL 4WU7A 3DTXA 4H1LG 5D6CB 3MLYL 2ZG3A 3EJJX 4P99A 3SCMB 3L3HB 1FAKT 3NVQA 4HD9A 3M17B 3JTTB 3CVHB 3DV4A 1KFAH 4LSQH 4OZFG 3N85H 4M7KH 1J1OL 2V5SA 3EYFA 2GI7A 2A6IB 1YC8A 3EW3B 3K1DA 4S1QL 2H26B 1WV7T 4PJFA 3MRJB 3S36L 2VC2L 1ADQH 5AZ2H 1T5XA 1CDGA 4XP5H 3TBTB 3QHFH 4PP2B 3ZDXE 1CLYL 3MJGX 2VXQH 1CE6B 1M7IA 5EBLA 1F11A 3C5ZA 3WJJA 4B50A 3BPLC 2YPLD 3C2SA 1WWBX 4IRSC 1UH4A 4LCYB 5E70A 1JHLH 4H20L 5T5FH 4L3EB 2FHFA 4U0QB 5DJ0A 4JY5H 4Z7WF 2BNUA 3HB3D 5CGMA 4UT9L 2LTQB 1U8MA 2XWJA 2HN7A 4DKDC 5LAXA 2QLVB 4DUXA 5T1KD 4DUWA 4X98B 5BV7C 3RU8H 4TOYL 3T2NL 3I2CL 4PYGA 3UTPE 3V8CA 4YK4B 1EA9C 4OV6F 3TH3T 1DUYA 5FYJL 4PJEB 4XHJC 1ZANH 3O3UN 1H0DB 1CE1L 3ARFC 3KYAA 3DV6A 2AJZA 3QIWC 4K7PY 5EU7E 4G9FE 2XY1A 4EEEA 5ACMA 4D9QD 1DCLA 3OKKA 1T0PB 3RVWD 1MUJA 3PWNA 2EE6A 3LHPH 3B5GA 4P49A 3DURA 1IM3A 2Z91B 4KVCH 2HFEB 3GKZA 4U6HB 4MSWB 3FB5A 2HFTA 4LLYB 2YRZA 4PGEB 5TGBB 4JFFB 1OTUD 1FNSL 3G9AB 1IEAB 1S7VB 4JAMB 3MV7D 1QSVA 3S35X 3U46B 4PRIA 1YPZB 4QHNB 3EFDL 2YSSB 5KZCD 5KBNC 3MROB 3U9UA 1NGZA 1EFXA 1GHFL 3IDYB 4Y16C 5D2LB 5DK0B 5KSBB 4A6YL 3RRQA 3O8XB 3BPOC 3KPRB 2LFGA 4TVPE 2X44D 4GMTH 5FB8A 2BNRB 3WFHB 2YWZA 3CVIH 4OLEA 5CJXC 5TE7H 1MLBB 2ADIB 4HMCA 1T6WA 1CR9L 4XAWH 1RUKH 2XQBL 5CUSL 3SPVA 5MEQB 2FL5A 1JPGB 3QP3A 3BGFC 4KUCF 5EU5B 4Y4FC 3D3VB 1MQKL 3VXRB 4MA7L 3MV9E 3QUZB 3L3GA 4UDUB 3A6BL 1ADQA 2PNDA 1CWVA 1TJGH 3WDJA 3DX7B 4NZTH 5F7KC 4KDWA 2VIRB 1J12A 4AMKL 5LXGH 4YQXH 1VGEH 2YMXH 1SEQL 2ZUYA 4R4NC 1GGYA 1IAKB 1NLDL 2GITA 3LH2H 5ITFB 2DL2A 4CVXB 4X6DA 4QXGL 3B5TA 4ETYA 2OYPA 4G9FD 4YJZL 2IAMD 1BFVL 3QDJB 2YPKA 5IEKB 1HZHH 5GGUA 4XNQA 1BVLB 4OCYL 4BZ1H 4KQ3L 4H0HB 4ZPTA 7FABL 1C12A 1OP3H 3IXTA 4QHLB 1QLFB 3LKSB 4GAGL 3MC0A 4ZOEA 1PSKL 4LU5H 1UB5A 1T83C 2Z31D 2DMCA 3SO3C 5I1KL 3ARBD 1XH3B 1I7TB 1W72H 2H32H 3KYNA 1EEUA 4NRYA 4O5LL 2E6PA 3VRIA 5A2FA 5DMGC 3ARYA 1QZ1A 5M95B 4PRNA 1G7IA 5C0IB 4TVPD 1KXVC 2PO6B 4OT1L 1GOHA 1A0QL 1C1EH 2C3VB 4YHNA 4JM4L 5T1LA 5GGVH 2EH7H 1FE8H 4OB5L 1G9EA 1MCOL 2BVPA 4HXBL 4PGBB 1URLA 5T3XL 5CP3A 3SGKA 5D7IA 4M7LL 1MFCH 4L4VA 3N1PC 1X7QB 2JTDA 2V7NB 2MPAL 3K81A 4RAVB 5HHQA 1LNUB 5FYJU 4JQVA 5I1EH 1A22B 2R0LH 3W11D 3WHE1 2B2XH 3PP4H 4DFHA 1SYSA 3OJ2C 3B2UD 2P8PB 5F88B 3KHOA 4ODUB 3ESVF 3HRZA 3RVUC 4NZUL 1KCUL 1ACYH 1GL4B 5KVGL 1SEBB 4UI2A 1I3GL 1MJ8L 5F1OB 1U8KA 3QIUA 1MCBA 4ELMA 4MJIB 5CINL 2NW2B 1NGQL 4LHQB 4Y5XB 3TF7C 5D96B 4UNTA 4JO2H 2E7LC 3HPLB 1RK0A 5IB4B 3T0WA 4ONFL 1BECA 5D1XC 1BWMA 1IQWL 4UV4L 4NBXB 3TESA 5I1DA 3O11B 4WWKC 1KCLA 5I1HL 4PR5B 4OD3H 4Q9RH 1K8IB 2ZUQC 1UM4L 5DVNA 2QADC 1QSEE 4Z6AT 4MJ4A 3LEYL 5IOPB 3B83A 4LAJH 3UDWC 1RU9L 4X6BB 4WNQA 4AEIH 1C5BH 3AXLA 3GMMA 5I6XB 3W9EA 3SGJC 3CMOL 4ETQA 3BH8B 4QY8A 1U8QB 2GUOA 3UCRA 4LHJB 2E3VA 1A7QH 3TO2B 2WIIB 3MLPA 1QO3B 5F1KC 4WFHE 2HJFB 5MI0B 4XMKH 5HI5D 4LCWD 3MCKA 3DHMA 2W92A 3HLAA 5B39G 1BQHB 1RIHL 2VDLL 2NY7H 4JDTL 2CKBB 4P4KA 1JRHI 5KAQG 5ILTH 5JHDB 1GH7A 3U0PA 4WRLA 1ZA3B 1W72A 2H32A 4Y5YA 5F9OL 5I1AB 3HAEG 4ODTL 3L5WA 1IAIM 1P4BL 3QI9C 1AI1L 4PTTB 3VCLA 3MRDB 2IANE 1F58L 1AD0B 2JJTC 4LLMB 3BMVA 4LSTL 4RFEB 4TUJB 2GFBB 4D9RE 4L3EE 4N8VA 1JPTH 4URTB 3V5HB 2OP4H 4LL9A 1E4XH 5AYUH 5CD5D 2FDBP 3V4PH 1FHGA 2J4WL 1G7LA 2BCKA 3CFEA 2VXVL 1J0IA 3FOLB 2CH8A 4HUWA 3TVMA 3S4SA 4JB9L 5AEAA 3RHWF 4M3KB 1INQB 4FQJL 4HKBB 1NCAH 2V2WB 3X11A 2IMMA 1OARH 4RWYL 2EDQA 1QFHA 2QQNH 3KYKH 2AEIT 3CFIC 3LPFA 5FYKE 3ZT6A 3INUL 4RRPG 3SE4C 3T8XA 1CDYA 2VDNH 3V6OC 5JLZA 3FFDB 3SCMD 3DV4B 5FUCE 5HGBA 4DGYH 2EIEA 1HIML 3ARQA 4WFHD 4ZAKC 5J4MA 2PCPB 1A6ZB 1AHWC 4JFFE 4I0PC 4NJ9L 2J6EL 2H8PA 1YPZE 2N7BA 3VFUA 4DCQA 4QYOA 4YDJA 2Y07L 5FOBB 1PZUB 2OR7A 4GAYA 1KYOK 3S35L 3S37H 1AP2B 1L0YA 3GBMH 5D2LE 1NCUA 5F3HB 5KSBE 4S1RL 3RZCA 1WFNA 1Q72L 4OKDA 1M7IB 4ZG1A 3C5ZB 1N6QH 1FG2B 4Y19E 4QKXB 2BNRE 5EPMB 1TVBA 4M6ML 5BQ7B 1HCVA 1DBBH 3IJYB 1LDPH 3HTLX 3QO1B 3DROA 1OF2A 5E00A 3WIFA 2MWCA 4D9RD 4YHYC 4L3ED 4M3JA 5DJ0B 1OAYH 4YXKH 1CZ8L 4F57H 2X9YA 2XWJB 1EV2E 1L0XA 3VXRE 5KSAA 3WFBH 5I66A 4FQXC 1G7HA 3O2WH 1IM9B 4GKOA 3OMZA 1UWXK 1JNLL 2AEQL 2GHWB 5MENA 1NBZA 4NNYB 1JGDA 3QPXH 3DV6B 4KKLC 4HGKC 5FYKD 3NZHH 1S8DA 4HQQL 3SDDA 1ZSDB 5DD3H 3OKKB 3IRZA 3BDXA 3QDJE 4JDZA 3PWNB 3TT1H 4R8WH 3DURB 5CEZE 1IM3B 2EE2A 3FB5B 1YN7B 5IFAL 5A16A 4G6AC 3QWOA 4HH8A 3SE3C 4CADA 4EJ1C 3I6KA 1JVKA 3K4ZA 4JFFD 3H9SB 1BQLH 1XIWA 3CFCL 4PRIB 5EN2A 1FFOB 5KVEH 1T0MA 1I1FB 1T7YA 4YXLH 2QQKH 1EFXB 1EXUB 5CZVL 1KIRA 5LQBL 2AXJA 4UINH 2AJUL 3G6JE 5H37G 4FP8H 1I9RL 1XT5A 4PG2A 3O8XD 3L3KA 3FONB 3KPRD 5FB8B 1QBLL 2HRLA 2H6PA 1R3HB 4P9ML 4GXVH 2BNRD 4HFWA 5L88H 1BBJB 1AO7B 3ARVA 1ZMYA 3D39B 1NEZA 5FAAA 4AH2B 4FZEL 1FL6A 4PB9L 4A2LA 4LSVH 1HWGB 3SPVB 5ISZA 4J6RL 1BIIB 5BCAA 4IMKA 1NUDA 5F6HJ 3D3VD 3L3GB 1JN6A 1A6AB 3QUML 5K59F 5C8JA 3W2DL 3VXRD 2R0KH 3SDXF 3QUZD 1FPTH 2WUBH 3BP6A 3NAAH 4PGCA 4MNQB 1YQVH 3OKLB 3PWVA 1HINH 4Y2DA 3SKMB 1QSFA 32C2B 5DD5H 3RJDA 2GITB 4XP1H 3O3BA 2NTFA 4KK6C 4X6DB 3PHSA 3NPSB 4NO5A 3KLDA 4G8IA 4NN7B 1HNGA 1BAFH 4XNQB 3QDJD 2BY0A 3KYMA 2ZKHL 5CEZD 4MJIE 1N0XL 1C12B 4QHUA 2D3VA 1U3HA 1FDLH 1IAIL 2IADA 5JIIA 1LE9A 4TUKH 4DVBA 5IB1A 5AUMA 4R97C 2XT1B 3OG6B 1REIA 3LEXA 3JWDH 1PW3A 3KYNB 4NRYB 3VRIB 4NQUA 4HZLA 4BM7A 1T04B 1MCFA 4PRHB 4I5BA 4G7VH 3QAZC 4R0LC 4PRNB 4WENB 4M02A 4JVWA 5EORH 3P9MA 2R4RL 4QWWD 5HI4D 2DIBA 5HHNB 1EHAA 2PO6D 4EDXA 4YHNB 4LPXA 3ZE1F 2GT9A 5T1LB 1D5MA 2BVPB 2IEPA 5IM7A 4XVSL 3RVTC 1OAZH 4JHZA 3NTCL 1MJJA 4I18A 5D7IB 5DUBA 3MX0A 2HKHH 2R9HD 3BWAA 5EUOF 4K94C 3L95B 5HHQB 1YNLH 5J8OA 4O2CA 2VZVA 1SYSB 5JHDE 1WZMA 3BKYH 4AQOA 1G9NL 5F7DA 1DQTA 5C0RL 4P4RA 4ZUUA 2IFFH 2G75A 4HIJB 5CS7A 1FNHA 1SYVA 1PKQB 3BZEB 2ICWA 1U8KB 4PLKD 5C2UB 1OCWH 2ZCLL 4BQ9A 3MREB 3QIUB 5IHBA 1EUTA 5DDHA 4ELMB 4XNZC 4KI5E 1CDUA 2Z8RA 3QNYA 2ZOLB 4MJID 2GW5A 3ILPA 1ZA6B 3WE6B 3BP7B 3FFCE 3HZVB 1DQDL 1KIQA 5F96L 2A6KB 5I1DB 3P4NB 3O45A 3PWJB 3WN5C 4M48H 2IPTL 4EZMA 3UYRH 2FIRT 1N6VA 3MNVA 1KLGB 4TRPL 4HIXH 1MCIA 3GMMB 4KMTH 5SWZA 1A7OH 4ETQB 3V7AG 4ALAL 4QY8B 3O2DL 3PHQA 4DUVA 2H2PD 1CYGA 5FUZL 1ROWA 3IAPA 1ZGLB 4TULH 3MUGB 3QCVH 15C8L 4IRJA 4YDVA 5ITBL 2IBZX 4MMXC 5E08L 3HNTL 3TP4A 5F9WB 2Z8SA 3CPLB 4OZ4B 4PJFE 3KJ6H 2WW8A 1FV1A 3KPNA 1W72B 2H32B 4NOBA 1MSPA 5IGXH 3CZFB 4Y5YB 4L3AA 5C3LD 5HPMA 5JHDD 4JQXC 3N1GC 4YHOL 5BVJB 3RNQB 1FNAA 5DD6A 3VCLB 3ARPA 4Q0XL 4XX1G 1LD9A 1F02I 5HDLA 4FFWC 4RMUA 4X9BA 1F13A 5DD0L 4N8VB 4OF3A 4XMPL 3BEWA 3DXAA 2R0WH 1CU4H 3HCVA 5F44A 1C16A 2BVOA 4QF1A 4K7PX 4KI5D 4H5SB 1TVHB 2E9WA 4JKPH 5EU6A 5LBSL 1FAIL 4JPKH 5IWLC 1KOAA 12E8H 4WY7H 4HUWB 5TE6H 4X4YB 2NY0B 3BPCB 4KZDL 3L3OA 3B2VH 3RDTC 1L6XA 2VZ1A 4BQ6A 1ZT7B 4RFOH 3SDCC 2MCG1 2VXSL 4QRUA 5BOZG 1DLHA 3T8XB 3SE9H 4BH7A 4HH9A 1T4KA 1DZBA 5FXCH 2OBGA 1I85C 3ROLB 3ULUE 4DGVL 2RHEA 5EA0L 4PBVC 5A3ID 1MHPH 3GJFK 1ZE3C 3IVKA 3KNBA 4JEGB 5D93B 3WV0A 1MY7A 3AM8C 3RVVC 5IROA 4N9GB 4QOKA 4PRIE 1E6JH 3VFUB 4DCQB 4QYOB 3O6FB 4YDJB 5TPWH 1QBBA 5D9SB 5C92A 3VA2C 3S88L 2JJWA 3ARZA 4R3SB 3RZCB 1DEDA 1UG9A 4S1SL 4HIHA 2ED7A 3P9LB 4HBCH 4KDVA 3C08L 1Y0LA 1GAFL 4LMQE 3C5ZD 2NY1C 5CBEB 1IFHH 2OJZL 3GRWL 3F8UB 1OF2B 2R2HA 1BFOA 2VR4A 2EYTA 3WIFB 1CXFA 3D25B 4I3GA 5FGCB 4RGOL 4MAYB 3MOAL 3ZYZA 1JNNH 4Q6IC 1K3ZA 1IGJB 4PJAA 2X5PA 2IGFL 4I2XB 4M8QA 3R0MA 3WUZA 1N2RA 1QFWI 1S5IL 4OLUH 5TJWK 1JK8A 4X0KA 1OW0C 4MJ2A 5EC1B 2YEZA 4HJGA 1IM9D 1NCWL 1RZGB 5MENB 1NBZB 3BE1H 5I8CA 2WIMA 3KPSA 3CVHL 4X6DE 1P6AB 4NWTL 2DQUH 3QJHA 3DLQR 3WIHH 4EIGB 4JDZB 3GSQB 1IZJA 1E4JA 4L9DA 2HLFD 3OXSA 1HI6A 4YHLH 3NCYS 3ULUD 5A16B 2AP2A 1F3RB 4CADB 3OX8A 3LY6A 2OX5A 4CN4A 4PLJD 1QR1A 1B4JL 2GYSA 2EZ0D 4L8DA 1BD2B 1JF5A 5EN2B 5I1CL 1D6VL 3DWTA 4R7DA 4HK0A 3H9SD 4TNVF 4PRID 3UTQA 2PYFA 1LO3H 2Q6WA 4EVNA 1IC5H 4HMEA 2AQ1A 2FWOA 2NY5C 1EFXD 3I3BA 3TBVB 2H9GA 3O9WC 3BT2H 1OPGH 3AB0C 4O9HL 4CU6A 5E7FA 2H6PB 2R8SH 1KLFA 1WEJL 2EYSA 1AGCA 1RULL 1FL6B 5GJTL 1EHLL 1AO7D 1MCRA 3V8OA 1RZJL 3D39D 3CFJA 2VLME 1JFQL 3JXAA 1AQKL 1F3DH 2IQAB 5EULV 1F4WL 2XICA 5D7IE 3RIFF 2VNCA 1VENA 1XR8A 3BP6B 1RZKC 1G7QA 4PGCB 2Y5TA 5D7SH 4PJDB 5FYKL 3SHSA 4MNQD 1FVCA 2CLRA 1QSFB 5FHBL 3UJIL 3FOMA 1DBML 5I1JL 2NTFB 1FZJA 3T0XA 3EDJA 3BX7C 4G8IB 1P84J 1FL5B 4X99B 4GSDH 3VGAC 1Q8MA 3PGDB 3GSRB 5DGRA 4M93C 3KYMB 4ELME 4WI4A 4WGVB 2VDRH 5I1GH 4XPAL 1AKJA 2Y1VA 1U3HB 2CJUH 3T0EC 4Z77A 2IADB 1MIMH 2CK0H 5GS1C 5DI8A 3WS3A 4LCCC 3NABL 5FYLH 2V5TA 2R15A 4DVBB 5IB1B 5AUMB 2DQTL 25C8L 2YD7A 3OSKA 3NCJL 1BPVA 3H2WA 3TC9A 1RUPH 4EDWL 4PJ8A 1QA9A 5GGRY 4CDHA 4HZLB 5IK3A 5J57B 4J12A 1UXWA 3D69A 3IU4L 3VMNA 3MRRA 3EOTL 3QG7H 4YXHH 3F65A 4PRHD 5B21A 1KF9B 5CWSA 4OCNC 3WIHA 4UQ2A 2BVUA 4TVSa 1D5MB 1L0QA 1YA5A 5T1LD 3KHQA 1OAXH 4CNIB 4HXAH 2VLMD 2E5EA 1AXSB 2X9WA 4MJ5A 3KR3L 1ZLUK 1AXTL 4EUPH 1OL0A 3BWAB 4UDTA 3SE8L 2KKQA 3EOBB 2NY4B 4UV7L 1CGSL 2XA8H 3C6LA 4U0RB 1S7QB 1MF2H 4MA3A 5C0CA 1JHKL 1I9JL 1JWUB 1UH3A 1IQDA 2X7LB 3UBXG 3V6BR 4Z18A 4P4RB 5AD0A 2G75B 2DTML 1W0YT 2OZ4H 2V17H 1DE4A 2FX8L 3Q6FA 4NNXB 3ULVF 4ZFZB 2ICWB 1TPXB 1CDHA 4QRTA 4PB0L 3GM0A 1QVOA 3RBSA 4OKVA 4NC1C 5DDHB 3QIUD 3IU3A 3QNYB 3S97C 1VEOA 3MRGA 1K4CA 5DJCB 5KSUA 3ULSA 4JZJB 1FVEA 1F8TL 4HLZG 1IBGH 3S5LB 1PLGL 3SQOL 4YIQA 1I8LC 3AU1A 1HYRC 2O93L 4K7PL 3MRCA 4PJXA 1QR4A 2PETA 4OCMC 1GCFA 4MB5A 4HAFA 3MNVB 5FGBC 3B9KA 1JF1A 2C4FT 5SWZB 1DQML 3ZYOA 4UOJA 3VFSA 1J1XL 3SO5A 3WFCL 4YAQB 4MQ7B 1A14L 3PHQB 1YEEH 3MGTA 5KSVA 3BZFB 3PXHA 5B22A 1QLEL 1P9MC 1UB6A 4XBEL 2RCSL 4TNWF 4IRJB 3OXRA 4ZSOA 4YDVB 2Y36H 2GJ6A 4GKSA 4ZUTA 2WQRA 3MMEB 1X5FA 5FYKU 3N06B 1YY9D 5HDBE 1EO8H 1FV1B 5SX5K 4ZD3H 1MCPH 3KPNB 4IMLA 3R4DA 4ZS6D 1J0KA 2HFGL 2DM2A 4OSUL 3FT3A 1TENA 4G6ML 2ZZUT 3EAKA 3STZB 1ND0A 2NX5A 5DD6B 3E8UL 5GRWA 3IGAA 3UPRB 3BW9A 3HC0A 1LD9B 5B4MC 4DK6A 5KS9B 4OM1H 1IGML 4FQLH 2KPNA 2VAAA 1K2DA 1UCBL 3VE0B 3MRMA 5A2IH 2DD8H 3BEWB 4OGYH 2BDNL 3Q5OA 2FX7L 5FGCE 4Q9QH 1QG3A 1C16B 2GK0B 3CK0L 4M5ZL 1P69B 5E8DH 1P7QA 5C0DA 3HE6C 4X6EA 5E9DB 4EUPA 3RWEA 2VDQL 1A1NA 3QEGL 1FGNL 3LS4H 3L3OB 3G04A 2HVKB 2NY0D 2Y7QB 4LLAA 2N7AA 2FR4B 4P9HH 4U2ZA 5FCUL 5MENE 1IKNA 4V2CB 1F90H 3T4AB 4BH7B 3AREA 3B9EA 5GRUH 2OZ4A 1KCRL 5ACZB 2PF6A 3C5JA 1KXTB 1BOYA 1FFPB 1KLUA 1TETL 1PX3A 4HHAA 2AXHA 5L0QB 1JRHH 1I7RB 4HEPG 2AI0H 1I1CA 1Q9KA 2CKBL 4MNGA 1MJ7H 2MMXA 3RI5F 3QH3A 3L7FB 4QOKB 4Q97A 3DRTA 5BS0A 1U95A 3K74B 2W9LA 5J1SC 2JLLA 3MBEC 2ICWJ 1JPSH 4Y5VA 3SDAA 2ATKA 3O6FD 1K8DA 3RIFK 3WXVH 4Z0BL 3VDBA 2OS7A 2B4CL 5DRNB 3T3MF 3RZCD 1Y0LB 5ANMA 3SBWC 4JFXA 5I15L 4YHIA 5ALBL 4NQDA 1YEFL 3U4EA 3AGVA 1SY6L 2J1KA 2F15A 5IVXF 1QLRA 2V2TB 4PJGF 4MAYD 5J11B 2W60A 2X4OA 4PJAB 1E4KA 1MEXL 2CPCA 4M8QB 3NIGF 1EHNA 4NRZA 1N2RB 1UGNA 3UX9B 1JK8B 4X0KB 4ONGL 4L4JA 4D0BA 4PJDE 3C87A 3I75A 1QSFE 4ODHL 5I8CB 5MEND 4YHPA 1BJ8A 3UAJC 3QQ4A 1ORQA 5C0BA 3QJHB 5E5RB 5C9KA 2AABL 5B8CC 4ZYKA 1HI6B 3MJ7A 5BXFA 4Y4KB 1EEZA 4JM2F 3VG9B 2MCPL 3AY4C 5C7XH 1H5BB 1NAKL 4H1LH 1QR1B 4MD5A 4XCFL 4S1DD 1TJIH 1RAMA 4HK0B 1BD2D 1BP3B 3UTQB 2PYFB 3G5VA 1CQKA 4BSVA 2R69H 4EVNB 1GXEA 4K8RH 4OZFH 2IQ9H 1I1YB 1Y6KR 2ZPKH 2F8XC 1V3MA 4MDJB 4M1DL 3P4OA 3LQZA 4KVNH 4PS4L 2I60H 4XT1C 1J8HA 2R23A 1PDKA 2EYSB 4ODSL 4D0CB 4UIMB 3VD7A 1AGCB 3AROA 4XNMB 4ENEC 5DVMA 5F9JA 3TZVB 3CFJB 2P5WB 4ZS7L 1LQSR 1ZGLM 3Q3GB 4B7LA 4QHMA 4JHBA 1JMXA 4APQB 1XR8B 4D2NA 5DFVC 1KENL 3RPIA 5E4IA 3HNVH 1FVCB 2Y23A 4HDIA 4XWGL 4LIQH 1JPFA 3FOMB 1QSFD 1FZJB 3PDOB 3ULUL 1DBJH 4K71C 2NNAA 2VQUA 4LP4A 4J8RA 1LO0L 1KCSH 4QHKI 1A7PL 1OLLA 1AIFB 4JVUA 1YEJH 2AV1A 2IC2A 4XH2B 1JYXA 1Q9OB 3ARGA 3VH8A 5MHSE 3KG5A 4Z77B 5DI8B 1U3HD 4Z7UB 3L6FB 1PY9A 3GI9H 5DJDA 2YD8A 3BI9X 4R4BB 4YZFE 1P7KA 3RA7H 3D69B 4JG0H 5SWZE 1KXQE 3WO3B 3WLBA 1IMHC 1F4AA 4NCC2 5CWSB 4XVJH 3TGXA 1AC6A 3ZE2F 5JDSB 5JXEC 5C07A 5CCKH 2NQCA 4KXZI 2BHUA 2VAJA 5D2NA 4BSJA 4EIZC 1MCNA 4K7FB 1WCBA 1N7MH 3EYSH 4U33A 5CJ5A 1Q1JL 2A0LC 2FO4A 2XXMB 4H1LA 2OR9L 2HWZH 3GK8H 3WJLA 2H3NA 5FM5O 4UDTB 4QGYA 4C57C 3M1BB 3C6LB 3FQUA 3LN5A 4MA3B 2NY4D 3TA3A 4OZFA 4NQEA 4KRPC 2FSEA 1D6EA 3C2AH 5D5MA 4LDEB 1I7ZB 3QDMA 3VFNA 3HZYA 5AD0B 4U1KA 2XTJC 1JHLL 3KXFA 5FM4A 1DE4B 1FZMA 3Q6FB 2G9HB 1IL1A 4YHKL 4ZXBA 4OCXL 3SKJH 3RAJL 1Y6NR 1QVOB 4M7JL 4WW2F 5I74B 5DURB 1KYOJ 3GHEH 1U8NA 1VPOL 2JKXA 5H35A 3WFDH 3IU3B 1XFPA 4X4XA 1CDIA 3ULSB 1K4CB 4KK8D 5KSUB 4UQ3B 1FVEB 5EU6E 2C4XA 3RWCB 5D7LA 1DQLH 4TQEL 5SX5H 5E9DE 4V1DA 4XC1L 3X14B 3AU1B 5I8KL 1TZGL 1CFTA 3IXAB 3MRCB 4PJXB 3CX5K 5D1ZC 1H3UA 4JGJA 2FECI 3V0WH 2E8YA 3UBXI 2HP4A 3BKMH 3PNWA 1NL0L 1NGWA 2EE9A 4OF8A 1JTOA 1JF1B 1OD7A 4JG1L 3U83A 5C3TA 2HA1A 2DQEH 3VXOA 5BRZA 3VFSB 1L4IA 3HI6H 3LKRA 5F7NC 2H1PH 5SWZD 3TCLA 1WFOA 2VLLA 5CP7A 3KYOB 1TJHL 3MGTB 2IH3A 3ZTJG 4QTIL 3ES6B 4F9PC 5JIHA 1S3KH 2AV7A 3KPTA 5IQ9B 4ODVL 2R0ZH 5HYSB 5DA4A 5DS8A 3WFZA 4LSPL 4IRJD 3P0YH 1ZLWH 3FO2B 3V4VL 1B4RA 3PHOB 1ZTXL 4QOKE 4IMLB 4L5FL 1MCKA 1H8SA 3FT3B 2VLRB 1KEGH 3NFSL 4NP4L 3U4BH 5JW3H 1QOKA 4RAUA 4YE4L 1S9YA 3IGAB 3BW9B 1IKFH 1A9BA 1NUNB 3HC0B 5TE7L 5C70A 5FK9A 3ZLQC 5EZLA 2VAAB 3OWEA 3MBXL 4DVRH 3QG6B 3IF1A 5FO9A 3D9AH 3G08A 3LS5L 3N1QC 2BRRL 1YEKH 3G5YA 1HOCA 1T5WA 5C0DB 3MRLA 2OMBA 4PJAE 1WBZA 4X6EB 3UXFA 4EUPB 5ICXB 3RWEB 5JO5A 5D7JB 2Y6SC 4YHML 5E9DD 3WS6A 3G04B 3MZGB 4NQVB 4YQXL 1ZHNA 3BQUA 2KZWA 2B1AL 4YFLI 4GXUN 3MRNB 3BKJH 2DLHA 4YNYB 3AAZA 3AREB 4WI6A 1IC4H 4XPTL 1KT2A 2EDEA 3C5JB 3MQIA 1QBMH 1KLUB 2CD0A 1A7BA 5HYJA 4OAWA 2HT4D 1AFVL 4XGZA 5C0ND 3WXWL 5DHXB 4M1CD 4MNGB 5F70A 4GBXA 3QH3B 4XNUH 1DVFC 4WW2C 1HHHA 2HMIC 2VDKH 3FN9A 3DRTB 1U95B 3TWCH 2VISB 5EIIA 4NQXA 4QOKD 1F3JA 1VADA 3IDMA 5F9AC 3ZKXB 2FJHA 4ODWA 1K8DB 3MGAA 1UH2A 4YFDB 4J3XA 1NAMH 3N0PB 3WEXA 1B88A 3VI3F 1T89C 1C1EL 1F3DJ 1MCHA 1DLFL 5KW9H 4BH8A 4PUBH 3H3BC 1TVDA 4NQDB 4OCWL 1KB5H 2MQ3A 3HB3C 4N1EA 5HI3C 3HAEH 1QLRB 4KKAD 4U6YA 3FCTA 2P5WE 3OZ9L 2W60B 4N0CD 1NMBH 3JV5A 2Q3AA 5EZOH 3MRKA 4NSKA 2OQJA 2VB5A 3UZVB 5EBGA 4NRZB 5CD3A 4WFFE 5CKGA 2EEAA 1ITCA 5DMYA 5L7XL 2VXTH 1YYLH 3B4NA 1MCEA 5DHYA 4X83A 3IJHB 4D0BB 4Y1AB 1KSRA 5KJRH 1T1ZB 3I75B 2YD6A 3F7QA 3O4OC 5E8EA 4UTAH 3DARA 4YHPB 3TFKD 1T2QL 1ED3A 2NLJB 3SOBH 3QQ4B 3RVWC 3PV7A 3RX8A 3QDAA 1D5XA 3I3EA 4X6CA 5FDWA 4G8FA 4ZYKB 2P5EA 5BXFB 1OTUC 3GJFB 1CD9B 4HAGA 5IBTH 3LOWA 4Y4KD 4LF3A 5DMJB 4MD5B 4Q9RL 3HI1A 2NR6D 2P45B 4JDVA 4JHAH 5JPNB 3GNML 3LDBB 1A4JA 1GVIA 3B3IA 1FNEA 3G5VB 1CL7L 2EDTA 2UUDH 4FXLA 1HHIA 3I6LE 4YPGB 4LCUA 2L7UA 2CSPA 1H8NA 3Q2CA 1J5OH 2G5BA 3GGWA 3C5SA 2R23B 2PXYA 2CK2A 4NYLA 4KMQA 5E5MB 5EO1A 4X4ME 2AERT 4ZDHB 4G6FB 5BV7H 2D7NA 3WD5H 5F9JB 3BP4B 1QFWH 4W4OC 3QEHA 3WNMA</