4OF6A

Crystal structure of syg-1 d1, crystal form 1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
LQQRIVEAPKDTLAAVGETAILTCRVEHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SYG-1, isoform b
publication title Extracellular Architecture of the SYG-1/SYG-2 Adhesion Complex Instructs Synaptogenesis.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Cell adhesion
total genus 26
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4of6A00
2BMKA 4LVNC 4ZPVA 5HYFA 4MNQB 2HVJB 4HWBA 2OR7A 1LO2L 5ALBL 4P5TC 4PJDB 4ZS7H 2FO4A 1GZQA 4PRPA 3S34L 4J7RA 4XP9H 4PJFB 3QIBA 5I1JL 5ICXA 3UTQB 1JZ5A 1FNGB 5EO9B 5IT2L 2PXYB 4OCXH 1CF8L 1OTSD 4ELKB 4UOW1 3VRLE 1YEEH 4Q9QL 4DVRL 2GAZA 1NGXB 5CJOL 4JPVL 4ZXBB 4PJGB 4AL8H 3WNKA 4JFFE 1FIGL 1E4WH 5BCAA 3HMXA 5HHNA 5C0DA 2WINA 4EUPB 2IQ9L 1EVUA 3PWPA 43CAA 5IVXF 4J1UA 5BJTB 4YHPB 5ALCH 1MFDL 1XCQB 1YYML 5IJVB 3FONA 1O5DT 2DQUH 5GRJH 5F1NA 3P77B 1JPST 4OGYH 4DN4L 2R8SL 3CDGA 4JREB 4JVWA 5JO5A 2YUXA 2Y07L 4S1DD 2XTJE 4GG8A 2BY0A 4M7LT 1A7NL 1OAXH 1JRHI 1NCUA 5L7XL 4NUGH 3JZ7A 2J6EL 4ODXB 3QUXD 1BFVH 1ACZA 3D0VA 1H3XA 3RVWD 2QSCL 2R1XB 1KXQE 4YPGA 3GMNB 2XKSA 3KPSA 3GSNB 1UB5B 3VXTB 4ALAL 3EOTL 1DE4B 3T4AA 1JV5B 1IFHH 2VQTA 2AJ3B 3MBEA 2X9XA 1YNKL 1JNHB 1Z6JT 3NIFE 5MI0C 4K2UL 4LVOB 2J88H 1V5JA 3KLHD 5GISL 1P7KA 5B3JE 5J11C 3ULVF 3JV4A 4HUWB 5EA0H 4HUKB 4P9HH 4OZHE 8FABA 3DLQR 2QSTA 2ARWA 5LXGH 3EGSB 4JO4L 4FQIL 1AGBB 3VFSB 4HIJA 3VFRA 3DV4B 4A6YH 4LLYA 5DUBA 5EU6B 4P99A 3VJ6A 5D2NC 2NX5B 3NGBC 2AXHA 5INCA 2DQHL 4NQXB 3CH1A 4QY8B 2B1AL 2AJZA 4QHLA 3PWPB 4NZDA 4WU7B 2MNUA 3SY0B 4PBVC 1BHGA 1X5FA 2GSGB 4Q6IA 4XCFH 2AP2A 1WUNT 1TZIA 2YSSB 5FA4A 1S9VA 3SCMA 1I8KA 4XI5C 3QFDA 4G9DA 5EZLB 3RY4A 4LGRB 2XZCH 1E4KC 1AO7A 1LE5A 4F3FB 1NFKA 5HHMD 1FHGA 3QUXA 2CPCA 5DFWH 3O0RL 4MB3A 5I9QB 1A02N 2KKQA 3D39D 4ZAKB 4FQ2L 3C5JB 1I3VA 4XCYA 2NY6B 2QQNH 4RGNE 4U1KB 4WU5A 5C7XH 4X6BB 3HZMB 1I9RH 2DB8A 2JB5H 4MZ2A 5EDXA 3FQNB 3NFPA 1ZHLA 4NQTA 4OCYH 2GTZA 3GGWA 4L8SB 3KPSB 4N1EA 3B8SA 5JW3L 2A6DA 3Q3GA 5H2BB 4YDJA 2IGFL 3KHOA 5E9DE 3AGVA 1K6QH 5BMFL 1MAJA 1HHIB 4JGUA 1KB9K 4EUPH 4XRCA 3DUSA 3U4BL 2ZOKA 3EFFB 3UZQA 3VXMD 4XNQB 3SDAC 1P6AB 4FNLL 4F7EA 4HK0B 3LQZA 2FZ3B 1FL6B 2QQKH 1XGTB 1B88A 1K8DA 3QQ4B 5C71A 4N9OB 4ZUVA 3ZYJA 1J0HA 2AAVA 5C08D 3LB6D 2R0KH 4LCUB 4ZG1A 4AEIH 1FDLL 5DUBB 4I48A 3IVKB 1FC2D 4OCMC 2W9DH 3GSNH 3QCVL 4KI5F 3ZTNL 3VGAC 1B4RA 1DZBA 1HNFA 3IAGC 3EHBD 2FBJH 2GQHA 1DL7L 2PR4H 2R1WB 4LRNL 3SGDI 1UXWB 1CK0H 1KYOK 3A6BH 3CSGA 2Z4QB 3SKOA 1CDCA 5A2KH 3UAJD 4XWOD 3BZ4A 3SCMB 1ZT1B 5J6GB 2BVPA 4W81A 3QWRD 5GSVA 1AO7B 3E3QC 2F54E 3MUHL 2X4QA 4R4FH 4Y89A 4D9RD 3D39A 4XTRC 3BW9B 4QXTA 3LKRA 1VFUA 1D5MB 1CDYA 1J5OH 1DTUA 1U6AL 3BQUA 1SEQH 5JHDB 1J87A 2LVEA 4HXBH 3ARXA 5HY9B 3QI9A 3AFLA 1QO3A 3SE4A 5D7JA 1A5FL 2VISB 4BK5A 4OAWB 4GXUN 4BQ9A 4WO4D 1BJMA 4YWGH 1QLEH 1PYWB 2LQRA 4WHCA 1CDBA 2DLFL 5I75C 1NFIA 3MNWB 5FGRA 4WFFD 1MNUH 5JORA 2HJLA 3I84A 5D1ZB 1FVCA 5F3HA 3UMTA 4WV1C 1GIGL 2FHFA 2PCPB 1X5XA 4IOFD 1XMWA 1BWWA 2BSRA 4AG4H 3S5LA 4PGZA 1PG7X 2FSEB 1CN4A 1G7MA 3C08L 1A47A 2LAGB 4GMSH 4NBXB 1T3FA 4ZFGL 5DMJB 4LVEA 1UGNA 5ICZB 4NQCD 1N5AB 2P5ED 5BXFA 2QQLH 2XA3A 3LS5L 4TULL 2WBKA 1QOKA 4U33A 1JPSH 1BQSA 2NY2C 4PJAB 4F2MA 1FZKA 4NSKA 2E7BA 3W9EB 4M7LH 5JW4N 5CAYB 3RI5K 2ZSVB 2PYEE 1FZMA 1D9KD 1QFUL 1AXSA 3C6SA 2BVPB 3MFGB 2NZIA 5GSVB 3O3DB 4H26B 4PYHA 1KENH 5F9OH 1XZ0A 2VMFA 2X4QB 3QQ3A 5HYSG 4QXWA 4HGKC 5CILH 4XVSH 3OSKA 1K4DB 1SEBA 4ORGB 4JFQB 4N1CA 3GMQB 5I1CL 2WANA 1PLGH 1RIHH 4O4YH 3LN5A 5JR1H 3QNZB 1R5WA 1S3KH 5FKPB 1UWXH 3EDJA 1RZGB 3NTCL 4QYOA 4JAMB 1PBYA 2J1KA 1W72B 1WJ3A 4IRJA 4O2CB 4Y16C 1FH5L 1CICB 3EO9H 3QEGH 4FFZL 3U7WH 2HJKA 3MACL 1JN6B 4RDQF 5I16A 3V4PL 4K94L 1JF1A 2Y06H 4TUOA 4Y5VB 5DEGB 5HHPA 1T1YA 2OMBA 3WLBB 5I1KH 2VAAA 3NCYP 4RX4A 4MD4A 4N0FA 2H6PA 2AABH 2YUVA 4KK5C 1ZEAL 4JRXE 3O4OC 3QQNA 4OIIH 1HHGB 1TLKA 4LAQL 1F58L 3CC5A 1S9WA 4XHJC 2F5BL 1CXFA 5ESAB 4PY7B 1UA6H 2Y1VA 5SWZB 1SMAA 4WI5A 5K33A 4NWTH 5DLML 4OLYL 3QIWB 1NKRA 1AQKL 1U8PA 4OBSA 1VEPA 3K0WA 1XGRA 2R2EA 5BQ7A 1PVHA 3HE6D 1LK3H 4CN4A 4PJ8A 4OZGE 3TNNA 4KXZI 1XF5B 3RX5A 5I8EA 3ARVA 5F1OB 4WI2A 3P11L 2FGWH 1RK1A 5ID1B 5LBSL 4GAJH 1HI6A 4CVUA 2HN7B 3BKYH 3PE9A 4R4BA 1I9JL 3PP3H 4L8DB 1F90L 3FFDA 3SBWC 1VFBB 4FQCH 2YD5A 2C7UA 2MWCA 5L8LB 3QB7C 4LCCA 2ARJB 2X7LA 3TWCH 4DJMA 3REWB 1HHHB 1BZ7A 1P6FA 1NL0H 5DD6A 3VFNA 3PP4L 3D0LA 4HIIB 3G5YB 1U93A 2IBGA 5ITFA 2NZ9C 3CSYB 5HHPB 4EZMA 1Y0LA 2ESVE 5JLZA 1HCFX 1QTYT 1OGTB 3TESA 5E4IA 3ARRA 1FLRL 1JPTL 1OM3L 2PNDA 3UTZB 2LTQB 3M8OH 2ATPA 1HYRC 3IDXH 3UBXG 1RU9H 4OJFH 2VXVL 5C07D 1J1XL 3LD8C 3T08A 3MV9A 4FFYH 2EEAA 3I9GL 3P73B 4M61A 1BVZA 3LDBB 3BXNA 5KSVA 4HC1L 1R5IB 3FO0L 1DVFD 1W72H 2CLRA 4FP8H 5C9KA 2ZKHL 2VZVA 3CFEB 3VI4E 4HLZH 5D6CB 2APWA 1F8TH 5EWIL 5AYUL 4JHWL 3QXVA 1PZ5B 4PGBA 3BP6B 1RMFL 4PS4H 3O2DA 4YPJA 5H37G 1L9MA 4FZEL 4JDVB 3UEZA 5J9PA 4JLRB 2QR0B 3TA3B 2AK1H 4NCC1 4U1JA 2Q8BH 4V1DD 4EI5C 5LGHL 4G8IB 4FG6D 3S8WA 5DVKA 1G6RL 5IVXB 3SE3A 2FX7L 2X4PB 2XRAH 4G6ML 1NQBA 4LCCB 4K3HA 2YC1A 4PPTA 4MXWH 4YDIH 4P48A 2A1WL 2W9LA 1NJ9B 2VLRE 3H9SA 4LCIL 4DK6A 1BD2B 4LKXA 4OZHF 1EMTL 1MCOH 2OTWB 1I9IL 1INDL 4L4TD 2RHEA 5AAMA 3RVUD 4HPYH 3BJ91 4KKBC 1KIPB 3RHWK 4XVUD 1S5IH 2BNQB 3JVGC 1LP9A 4BKLB 3W2DL 1DBKL 4P0DA 4G9FE 2A6IB 5SX5K 4OF7A 5JPMB 2AXGB 3MOBH 1JL8A 3RX8A 1DEEA 1Z3GL 2VL5A 4KQ3H 3F58L 3BE1H 3OPZL 1M71A 4ZO8A 1OCWH 3PF2A 4PJXF 1AJ7H 3SKJH 2FECL 2VDRL 1NGZB 4FQJL 3LRSB 5SV3A 1G9NL 3MV7E 1DVFA 1OTTC 1BQUA 4WHYG 1NFDE 4LSUL 1JYXA 2O5XH 5ELIA 1PD6A 3SDDC 4KFZC 2Y72A 3FTGA 4LU5L 4UAOC 5E6IA 2D0FA 2QJDA 1ZANH 3QG7L 4UDTA 3C87A 4L3EB 3FQXA 5DMGD 4I0PA 2MPAH 1YNLH 2UUDK 4JM4L 4XX1G 4KV5F 1IM3B 3VWJB 3PL6B 3QZWB 4YJZL 5C6TH 2ED7A 4Z6AT 1O7SA 1CZ8L 4YBQC 1MWAA 1INQA 4L5FL 4M7ZC 2NQCA 4D0BB 4NKQB 4HKXA 4MA8L 1OPGL 1KLGA 1SQ2N 1MCRA 1T1XA 3ZMRA 1S7UB 5BO1L 5HJ3A 1NCBH 4YO0A 1I8MB 1AY1H 1G9MH 2JIXD 4BZ2L 5I0DA 3S98A 3FB8B 3MGOA 2YC1B 2VITA 5TH2B 2FEDD 2CRYA 4OGXH 4W68A 3MV8E 1LNUA 1FL3A 1CGTA 3F6LA 4ODHH 1K8IB 3SO3B 3ARED 5GS1A 4NFCA 3ARDC 1A6AA 4HX1A 1IAII 2FD6L 4MJ6A 4DW2H 4RQQA 5GS0D 4Y4FD 2APFA 1EERB 3P30H 3VXOB 3AMLA 4WW2F 5K9KA 1PW3A 5FCUH 3EYOB 1UVQB 1JTTA 1FGVH 1KIQB 2Z91A 3KXFB 3QHTC 4HWEL 4P4RB 4UZGA 2VIRA 2CIIA 1BEYH 5IFJA 5JXED 1C1EH 1XF3A 4W6WB 4X5WA 5FM4A 5I19L 2YD2A 2D03L 1EBAA 4FQPA 3EOBB 4NQCE 2ZCHH 1WCBA 5D2LA 3ETBF 3HZYA 3KLAA 2CXGA 3FN0H 2DTML 3KPOB 4N1HB 4ODBD 5GRXG 4LPUA 3LIZH 1KN2L 4YHYC 3C6LC 3MJ6A 4XGZB 3TBYA 3D2UB 3V6FB 3O3UN 4HKJA 4KMTH 5EU4B 1XFPA 3RDTC 3FFCB 1G1YA 2YD6A 4M8VA 3V7AG 4MXQC 1Y18A 4KJWC 4KQ4L 3VFVB 5D1QA 1HSBA 1QR4A 3NFSL 4LVHC 4Y4HC 3H42H 4E42A 3I3EA 5HYQA 5HDLA 1AP2A 4PRIE 4Z7UA 2ZG3A 3C09C 3BRGC 3VXPB 2XA8H 3NVQA 5KSUA 2GYSA 2AXJA 4WDIB 3ULVH 1BOGA 3SQOH 1N2RB 1S78D 2A9NH 5MERA 3CFKA 3MXVL 1CD1A 1F4WH 3OKMA 2LU7A 3HZVB 5KJRL 3MRLA 4F8QA 5J3HD 3TBSB 3QIBC 4HX1B 4KH2A 4QRRD 4KGJA 4QXGH 4GXVH 1SYSA 4NNYA 4OLXL 4U3XA 5EN2B 1M7IB 4U6VL 2D7TH 5DK2A 1MLCB 1DFBH 4JG1L 4ZODA 1AGEA 5E99H 3O6LH 5GHWL 2H2SC 5F7EL 2VDML 3DX9A 3HFMH 1A4JA 4P2QE 3Q6GH 2VIRB 2FX8L 3I02A 4IRZL 3E8UL 3DXAA 4KVCL 1BF8A 1QSED 5CEZE 5I17B 5H94B 1X5JA 3DIFA 4JQIL 3BD3A 4NZRL 4F9PA 3QNYA 5TDNB 5F6HJ 1HH6A 3TN0A 3TCXA 4YAQB 4X6CF 3SDCB 1WCBB 5IQ9A 2Y7QB 5DJ8A 2FATL 3ZYOA 3KLAB 4PJBE 3ROOB 5L88L 2E6JA 5C0AE 4LLMA 1BMGA 5LAXA 3PGDB 1A14H 4XPBH 1JGDB 4XPTL 4HKJB 3S3SA 3TVMD 2BFVH 3F5WB 4KJQD 5DMIL 1CXEA 2VLJB 2NY1B 1DSFL 4NYLB 4EDXB 2FLRT 3H7BB 1FYTA 2NR6D 3TF7C 5D1QB 1HSBB 5CMAA 3UTTA 4BH8B 4Y4KA 1QRNA 3CPLA 2FDBP 3QQ9D 3MBEC 2XFXA 2VZ3A 4XCNA 3NPSC 1HQRA 3BGAA 1JYNA 1P4LB 1Q72H 3FMGH 3QWOA 1IGIL 2VDLH 1SJXA 2HTLC 1NBQA 3ARFD 4NQDD 2YUWA 1RURH 3DV6B 4PLOB 3OHXB 2Q86B 5E2TL 3B3IA 4Z76A 1GOHA 1BIHA 1X5HA 1CGXA 3U2SA 4WWKA 1E6JL 2YMXH 4KY1H 1OTSC 4NQED 4HCRL 1AD9A 1U8HA 2BCKB 3L9RB 1ZTXL 1NCCH 3HG1B 3W39B 4YGVB 1DLFH 4TSBL 4LHJB 4O2FB 3MCG1 4Q6IC 3S34H 2KZ1B 3SDXA 5KZCB 5I1JH 5C07E 3UCRA 4QOKB 4L3CA 3MUGB 1A1MA 4KVNL 2W59A 3QCTL 4WTZG 1I7TA 4HT1H 4PJEA 4X7TA 5HVGB 1NBVL 4DZBB 2AW2A 1X5YA 3QUXC 5L2JA 3RVWC 4DVRH 3U46B 4JPVH 3NZ8B 1FIGH 2UVEA 1ADQA 3CSBA 1U8KB 5F9JA 1ZHNA 3FT2B 4NBZB 2IQ9H 3RZWA 5TPWL 3D85B 1AGFA 3BPLC 3T0EE 4ETYA 1QBLL 4AYFA 4D2NA 3P0VL 1I4FA 2MOVA 4YEFA 1RAMA 4DN4H 3OAZH 2M2DA 3VFWB 4OIBA 3QUZA 1CD8A 2Y07H 4P4KB 3RWGB 2HLFC 3RFZC 1V3JA 5L7XH 2Q7NA 2BJMH 5F1IB 4NNXA 2J6EH 4S1SL 1IAKA 4OTXL 1G9EA 4Y19E 4KK8D 5D7KD 1UWEL 5J13B 1KJ2H 5DHVA 1BAFL 4GMTL 4XBGB 1OVZA 4PIRF 5CSBA 4XCEB 4MJ4A 2WBJA 4ALAH 3LS4H 4NQEA 5BVJA 3CFDB 3VH8B 4GG6E 1PEZA 1T2XA 5IEHB 1YNKH 1U8HB 2HMID 5C92A 5HBBA 5GISH 3VI4F 3V0WL 3VRIA 4OD3H 1WZKA 2C5DC 3ZDYE 1TQBB 3EYFA 2CK2A 5EC2B 3VFUA 4GLRH 3ULSB 3L6FB 1H3PL 1S8DB 4FQIH 4JO4H 4YXLL 4AH2B 1MVFA 3I85A 4GFTB 2VTFA 4CVZB 1PQZA 2OL3L 1I7ZB 3DNKA 4OF8A 4JFFB 3BQUC 1NC2D 5HVHC 1JGVL 3DI3B 2B1AH 5C0BD 2GFBA 2RCSL 3SDYH 1M6OA 4JHZA 3QI9C 3HPJA 3B6SA 3SE4C 5D7JC 3B5GA 5CLWA 2V7HA 4P2RD 2ZUYA 2C3VA 1HEZB 2C1PB 5T1KD 3MJ9A 1X5LA 2OJZH 2EDXA 2BVQA 3LRHA 1ED3B 3SGJA 4FQ2H 2EDRA 4M1DL 2Z8WC 4G6AC 3VRJA 3DRTA 3U83A 4HULB 5DUML 1C7SA 1DLHB 3THMH 5E8EA 2WIIA 4HIXL 4Z5RB 5JW3H 3LKSA 5E9DA 2D7NA 3TEUA 3SN6N 5D6DC 1ONQB 5E2WL 5BMFH 3Q2CA 4NGHL 3QPXL 5T5FL 4LNRB 4NRXA 1P5VA 3U4BH 3MLUH 3ZE1E 1AI1H 1X4YA 3HRZA 4Z0BL 4FNLH 2R69L 3EHBC 1MREH 1W2KT 4PGCB 3SOBL 5LJYH 1MH5B 4OZHB 1GL4B 3V6ZB 1X9QA 4XWOC 4RAHA 3QPQD 5JOFA 5DSCB 1FP5A 1RUAH 5CIPA 4U0RC 3BI9X 1UH2A 1QHOA 2BXZA 5L2KD 4N8VA 5D1XB 2I25N 4G8GD 1HHKB 5AYQA 3BZEB 4UV7L 3VD5A 4JKPL 1L0XA 1MRCL 1QA9A 4DCQB 3QCVH 3ZTNH 4YUEL 5J1AA 2FIKB 4RFEA 3MLYL 1ZSDB 4JKKA 1DL7H 3G5ZA 3JWNC 1CL7L 4R7DB 2F54A 5JZ7D 5IVZB 4IRJC 5EIQA 2DQFA 4K8RD 1MI5E 5CP7A 5T1LB 4R97B 3CU1A 1U6AH 5JOPD 4XX1E 1S7QB 2FGZA 3MMEA 2NNAB 4RGNB 2P8MB 1MF2L 4LBEB 3RVVC 1S7SA 2FNBA 2HT4C 5D72L 5GGUA 4NWUL 3IETB 1YY8B 2DKMA 1RSFA 4HC1A 4CW1B 2QL1A 5A40E 3MLWL 2MHAB 2BVEA 3NIGF 2BHYA 5TGBB 3SPVB 2X4RA 5ANME 4YNYA 3UPRB 2Z31B 3GO1L 2DLFH 1YMMD 4PJHF 5CZXD 1NGYB 2YPLD 3PHOA 4HAGA 1NAMA 2H9GA 4U1LA 3TO4B 4WEBH 2PF6A 4D8PB 1NC4A 4CNIA 3WE6A 4LOUD 5C0ND 5ESVA 2UWEE 2W38A 1MY5A 4RFNB 4ONHB 8CGTA 5DO2D 1YA5A 2N4IA 5TDPB 4D0DA 3LSOB 4LP4A 2EIDA 4PJ8C 4ODTL 2VABA 3G6AA 4U3CA 4XAKD 1EZVX 4AIZB 3RVTD 3C08H 3I6GB 3LV3A 4RNRB 4ZFGH 1JYVA 3AB0C 4ELMF 2A74A 1EO8H 1LGVA 2A2QT 3B2UD 1HSAA 5GGRB 4QRPB 3LS5H 4PP1D 4TULH 4WW2B 1WWWX 4BQ8A 2X40A 2QADB 3FO9B 2R56L 4C56D 4J3TA 5DTFB 4OFDA 4X9GA 5F7NC 1T89A 4FMKA 2PYEA 3BH8A 3L3OB 3DX7B 1TMCB 2VDNL 2HKFH 2IPKA 4MA7L 1QFUH 3OJDA 1A0QH 1J7VR 3E6HA 1FQ9C 3QJHA 3FQUB 4IOSD 2DQFB 2DS4A 2JCCE 3PWLA 1UFUA 5DQDH 4M7JL 5KANG 4XNUL 1WFOA 5F44A 3MMEB 4I77H 1H5BA 5F97E 35C8L 1FZOB 2AXFA 4YHLH 3MLXH 3EDEA 3NTCH 1BLNA 4H20L 4HS3B 2VXQL 4OM1L 3HS0A 4CVXB 4NQDE 5JW4R 3MOAL 5DJDB 5B38B 4TRPL 4O02H 4M1CC 3DMMA 2OSLB 3MRMB 3OKNB 4KHTH 3PGFL 3MACH 3OAYK 3V4PH 4ZMAT 1QACA 5DWUL 3T2NL 1ZLWK 3O8XA 1NLDH 4DTGL 5BRZD 1LO0H 3I6KB 5CWSA 1I3RA 1T2QL 3D87B 3CVIL 4QTHB 1FRGL 1IVLA 4LCWD 4JRXA 4PJCE 1IGTA 5MENE 5B39G 4CU6A 5FDWB 3IDUA 3KPMA 5I15L 1JWUA 3IXTB 4O51B 1A21A 1J05B 1F58H 1G6RB 4LAQH 4QWWD 3QEQD 4OKDA 4A2LA 2F5BH 4PTTA 2O5ZL 3PWJA 2IAMD 1H8SA 4CBPA 1QLFB 3P4OB 1FFPA 1K4CA 5DLMH 2IPUK 5LG1A 3V5HB 3V5DB 4OLYH 1MAKA 4GAFB 3ILPA 4M62L 1AQKH 2EIZB 5JNYB 3OJMB 1I1AA 5IIEA 4OZGA 2EDQA 1KCSL 1SMOA 3GMLB 3SE3C 5IBUB 2EE2A 4YDVA 5SWSD 5IW1B 3VI3E 4A2MA 3HE7B 3OJVC 5EUKB 2C9AA 3TV3H 3KNBA 5GS0L 2DM7A 3P11H 4X6CB 2DMBA 4NO0B 3VFPA 3K8MA 2DQJH 3L7FB 5DD1L 3VCLA 3OX8A 1IBGL 1BVLA 3IF1A 4L8BB 1FPTH 1X4XA 1JMXA 1YN6B 1ZA6A 5C09E 4LEXL 4YHKH 5JHLL 3WKML 2VOTA 5GJTH 2AK4E 1BLNB 4HS6B 1PY4A 1EUUA 1I1YA 1RY7B 1HOCA 5D7KE 3ARGA 2C3GA 3IRPX 3U30B 4GW5B 1BFOB 4QNPF 3MA7B 1IL1A 3PDOB 1RUPL 2JJTA 2ZUQB 43C9B 5CLTA 1DVFC 2ESVA 3K4AA 2XKNB 5DGQA 2UZXB 4RBPK 3L3IA 1FLRH 5E6IC 3MODL 4HG4J 1OM3H 1OD7A 3DVFA 2FEEI 4I0PC 1JWUB 2GITB 4JFYB 1ZA3B 1FVEA 5FYKE 4GW1A 1FNSH 5L8KB 4RZCB 4KRPD 2WLZA 2VQ1A 2Q8AL 1XR8B 2ADIB 1FFPB 1YNTA 2EDYA 3FO0H 4MX7A 1U95B 4PJ5D 2ZKHH 4BH7A 1T1ZB 4X6DE 1GXEA 5K59F 3CLEL 4MDIB 5EWIH 5AYUH 4BFEA 4JHWH 3BSZH 2MQCA 1MFAL 1YECH 5C9JB 1MRFL 4XZUA 3QDHA 4EBQL 3IXAA 1DBML 5HPMA 5EOTB 1GZPB 4JRYE 2Z8VC 2L7JA 2VDPL 5I6XC 2AJSL 4KK6D 3RVUC 1GGBL 2J8UE 1T04A 4FZEH 4JFDD 5A2IH 2VSCA 1ND0A 3N85L 1VADB 3ZE0E 2YZ8A 4GG6F 4AM0B 3Q0HA 3BEWA 3PQYD 3NCJH 3CZFA 1U92A 2CLZB 5GS1C 4H1LG 4FABL 2IG2H 3GJFB 5INDB 4OBRA 1N0XL 2FX7H 3ET9F 4XHQA 1ZLSL 4G6MH 1WBXB 1U3YA 3ZDYF 4IIQA 2VLRA 4DGYL 1T03H 1XGYL 1A9BA 3O11A 3QH3A 4LCIH 1VEMA 1XF2A 1I9IH 1INDH 2YD7A 3E6FA 3L95B 32C2B 1OF2B 3CFBB 4I8DA 4JZNB 5JPNA 3BH9B 4G9FA 4H25B 3W2DH 1DBKH 3SE8L 3P9MB 4YDKH 4JO3H 4QCIB 3R1GL 5IHZB 1GGTA 1A7PL 3W9DB 1CCZA 2C4XA 1KT2A 3VA6A 3F58H 3OPZH 2GI7A 3TO2A 3BO8B 1HZHH 5GS3A 3MV7A 4JJHA 1NFDA 1FVEB 5KVFH 2JJSA 4LSUH 5DQ9B 1NEZB 3ECBA 3G5VB 3BT2L 2CD0A 5L2KE 4HW6A 4MX7B 4G8GE 3STZB 3L7EA 5F7WC 2NCMA 1CFSA 1WBYA 3EDKA 2X4UB 3CDYA 2NTFA 4NBYB 4XC1H 1UM4L 3QG7H 4XZUB 3VD9A 3QIUA 4G8FB 4JM4H 3TIEA 5DJCA 2D31A 4RMQA 3UJJH 2WWMC 5AZEL 5I76A 1U9KA 3P4LA 3S7GA 2OK0L 3WSQL 1W0WB 1AR1C 1RZIA 3G6JE 4KROC 1B0GB 3GBML 4P23D 5T1DL 1KNOA 5FK9A 5HHMB 4L5FH 4XNXL 4MA8H 1OPGH 4JO2L 5T33L 5KSAD 5DD0H 3T3PE 1MCDA 2LE9A 4LCYB 2ERJB 2YD8A 1BBDL 5DRWA 3WXVL 5C0CE 4HJJL 5D4QA 4TOYH 3ARSA 4NT6A 4LHUD 4IIQB 5FO7A 3ALWA 3MV8A 2AI0L 3IFNH 3LKOA 2UVFA 2L0DA 2FYYB 2WQ8A 5FO9B 2Z8RA 3QXAA 1UXSB 1YY9C 4N0YH 1J9CT 3H9HB 2F58L 3QHZL 1RZJC 5FFLA 4QXUH 3MFFA 1P9MA 4EUPG 2A6KB 4F9PC 1IGYA 3VXMB 3I6LD 4KRNA 4U6TA 3TN0C 4MWFA 4GW4A 4R3SB 1A6UH 1HXMA 4NKIL 2DYPD 5IMMA 5GZND 2HH0L 1DQQA 4HGMA 2L4OA 3QXWA 4XP4L 5F9DC 3QDMA 1KULA 1NFDB 4HWEH 3AXLA 4ONFH 1ZT7A 3GJFH 5IR1A 1FNAA 3RJQB 2ZJSL 1OAUL 5I19H 3Q5YA 4I2XE 2D03H 4ESKA 1BVKA 1U8QA 4PLKD 5ACMA 5ERWB 5FM8A 2IH3A 3L3KB 3DURB 4Y4KC 5IM7B 3MO1B 4KUCD 2FWOA 4UIMB 2JK5A 1VB9A 4OFKA 4H5SA 4YZFE 1ETZA 1KN2H 1U58B 3ZDZE 1CLOL 4NUJA 5DA4A 4M3KB 1KNOB 4RISH 4MAYA 1RHHB 1LK2B 5SWQA 4YDLC 3IT8D 3NFSH 3PWNB 1BWMA 4JFPB 5DVOA 5FYKL 4WWKC 1KTDA 4PRIA 4O9HL 2J5LB 4Z77A 1BJ1H 4PRDA 2UY7A 4H88L 4LSTL 3LEVL 1I8LA 4P46A 5FCSH 1S7TA 2F53D 4NO3A 1E4XL 4MVBC 3VMNA 4U6YA 4OD1L 4CADA 4WO4B 4BZYA 1G7PA 1VFMA 2E7HA 3MXVH 3WS6C 1CU4H 5DEFA 4DFIA 5KJRH 5IHLB 5DA0B 3FRUA 4QF1A 1FO0A 1FV1B 5IHBA 1QSVA 4E0RA 4OLXH 3HC0B 4JPWL 3BDYL 2E9BA 3IJHB 4OGAC 4U6VH 5ACZB 2H32A 4JG1H 2FB4L 3RWDB 4LCWE 4P2QA 1OP5H 2VDMH 5EBLB 3PIQB 3PNWB 1XAUA 4PJHB 4PRNA 4IRZH 3E8UH 4BFIA 5E2VL 1G7QA 4I4WA 1FORH 2NR6C 2EDTA 3QEQE 4JQIH 4FQ1L 4NQCB 2P5WD 3W11D 5DJZA 1CFNA 2P5EB 2XTJC 2XWBB 1WBZA 4PJBA 3QUZC 1JGUL 2EC8A 3WN5A 5ID0B 4ODSH 1TTGA 5I2IB 1MAML 3QXTA 5C0AA 5DRZA 5J06A 2FO1A 5L88H 5F7LB 4AQ1B 4KJPC 1IGJA 1QBAA 1ZLUK 1Q94B 3AU1B 3MRNB 1D9KB 3H3PL 1I1FB 2X89A 4MYWB 4XPTH 4B7IA 4ELMB 1ZHKA 4N90D 5SWSE 2FJHA 1C16A 4P2CG 1JMZA 5I1LA 2HG5A 2WBJC 1CGUA 4L9LB 2NW3B 1JHTB 1KTDB 1LDPL 1X5AA 4M43H 4PJ9D 4ERSH 4YBHA 3T1FB 4OCRL 5HYSA 2XNAA 2YRZA 1IGIH 4HDIA 2OL3B 4X5XA 2VE6A 3KPRD 1JPGA 4PJCF 3E2HB 1MQ8A 2ZUSA 5KVGL 1NDGA 3EOAB 2VZ1A 1IC4L 1T5XA 4KJYB 2H8PB 4DQOL 5C8JA 2XV6B 2HKHH 4LPYA 1PKQA 1LO5B 4YC2C 3EO0B 3WFZA 4F7TA 4HCRH 5BS0E 3FQRA 4PJ7E 3ALPA 4TSAL 1B0WA 1JHLL 4EQ2A 1DEDA 5IW6B 4P5KA 4WI7A 1ZTXH 2P7TB 4RIRB 3PHQA 4K07A 3VXQB 1FGNL 3Q1SL 4P59L 1HH9B 3IDJB 3N1FC 5DEZA 4K8RL 4M6OL 3RY6A 5C0GB 3R8BB 2YUZA 1NDMA 3G08B 3U0WL 4K94C 2P5WA 3TNMB 5CGTA 3VI3F 4IOIA 2GTWA 1RV6X 2X44D 2EYSB 1VGKB 3L5WA 3OB8A 4P57B 1RUML 3QDJD 3B43A 4KVNH 3QCTH 4LLUA 3L3JA 3IDMA 1WBZB 4ZOCA 2B4CL 2CLVA 1LE9A 1JFQH 5LGJB 1KPRB 1RPQA 4U1HB 3HE6B 3BDXA 2R9HC 5DRZB 3SGJC 4QT5B 3EYSL 1A2YA 1QNZL 4JPIB 1ROWA 3T0EA 3S35H 5J7CC 2E27L 4FQQB 5TPWH 1NBZB 3P4NB 1D5IL 4PTUB 2HJFA 2WIMA 4EI6A 1YUHA 1OOAA 2WP3T 3P0VH 4JVPA 3JWOC 2BRQA 4X7SL 4Y8DC 1LEIA 4Z0XB 4WI9A 2BDNL 3ZO0A 1OWWA 1EHNA 2BVOB 4OV5A 3VXRD 1KJMA 5IFHL 3NFNB 1SBSL 4XBPA 4IMLB 4Y19A 3GHEL 5HHVL 4YHMH 3LEXB 3DJ9A 3GRWA 1MIML 1UWEH 1JPGB 5D7IA 4FFWD 2HWZH 4RMRA 2YPKB 2F8XC 5C8JB 3NIDF 2W0FA 3OBAA 2G2RA 5E5RB 4P2OA 1T20B 4HEPG 2PO6A 1CLYH 3W0WD 4J12A 4Z7VF 1UENA 3FQRB 4WENB 3T77B 1EBPA 2NY4D 4GBXA 2J2ZA 4LF3B 1YQ2A 4X6DF 1S9XA 4WW1A 5EO0B 5DK0B 4MD0B 1KFAL 2YHGA 3BP7B 2YA1A 2NYYD 5J12B 5DD5L 1F2XK 4ZOEA 4JFOA 2OLDA 4ZFOL 1F3JB 5C07B 3QDJA 3BHBA 1H3PH 3ULUE 4UDUB 4YXLH 1MHEB 3T4YB 3QYCA 3TFKC 2OL3H 5B3NA 2ED9A 4TTGA 3UBXA 3RWCB 5CCKL 1P7QA 2OMNA 4NC1E 3K1KC 4HLZG 3L3DB 5IB1A 4U1GB 1JGVH 1A2YB 4G43B 4XAWL 1E28A 3ES6B 3LRGA 1HHJB 1YPZE 4JY4A 2DWDB 1MVUA 1YYLL 3D25B 2G5RA 1G7JA 3R06A 4BZ1L 5I8KL 3QEHA 4P3CH 4MQ7B 4ODUA 2YOCA 1X7QA 3MRRB 4BYHA 1KCKA 4V1DB 3T0XA 3CMGA 2DBLH 1CGSL 4OQTL 2CIKB 3FQTA 4UQ3B 3C8KA 4L8CB 4M1DH 4U1SA 2WUBL 5HD8D 1FFNB 4R2GD 4GRLD 1Q9KA 5T5NF 4LFHG 1T5WA 3NPZB 4HIXH 3H7LA 3BGFB 2DDQL 4M9PA 1WQVT 3MYJA 3QFJE 4L4TB 3QUYD 4GG6B 1QEWB 1RJLA 1GHFL 4RMWA 1MHCA 3VMPA 3HI6H 1VA9A 4NGHH 3QPXH 3O2WH 1QPXA 5T5FH 1I3GH 2PW2B 4UOW0 5DRNA 4XP1L 3EYUL 5KW9L 3GI9H 4Z0BH 2R69H 5GGRY 5DRXB 4EN3A 2Q6WB 1WCQA 3RNKA 5EPMA 4EDWL 1QVOA 1YQVL 3WXWL 5DJ6B 4WEMB 1T89C 4I5BB 3EJZD 4XH2B 3OF6A 3X3FL 3BUYB 4J3VA 5F96H 3WFHB 1Z9OA 3AAZA 2O61A 2X5PA 5HDBF 2BSSA 1TETL 3PWVA 4UV7H 4Y88A 1MEXL 3QO0B 3QXDA 2G75B 4YHNA 4YUEH 1PX3A 3FB6A 1TZGH 3MLYH 5IB1B 1H5BC 1G9NC 3FT3A 3O3BA 5ISZD 2GY5A 4PG2C 2ZZUT 5IBTH 3HPLB 4OV6F 4FQHB 5DURD 3ZT7A 1PFCA 5F7DB 3X13A 1AHWA 4X4YB 5I1DB 3C60A 3QUKB 5GGQH 5AEAA 3BIKB 4W4OA 3W82A 5J6HB 3QR2A 4GKZA 3FOLA 4CMHB 1MI5A 5CZXC 3DYMA 2P24A 3DMMC 3HI5L 2ICEB 2D3VA 4R0LA 4QHUB 1KB5B 4LSVL 3ZE2F 2CMRH 4DGVL 5GGTA 3N0PB 5HHOD 3C8KB 2DJUA 2E7LA 3C8DA 1CDHA 3O8XC 1U91B 4U1SB 1MF2H 2JIXB 3L3GA 4HGWB 5DO2C 5HI3D 4YFDB 4AMKL 4PRHD 4NWUH 5IOPB 3CCHA 2BNUA 2CR6A 2C4FT 2Z35A 4GT7A 4GKSA 3MLWH 1Z5LA 2F53E 3MYJB 5ANMA 1JNJA 4MNQE 1A6WL 1EGJA 2FJFB 4PJDE 1MCEA 3FHAA 2GW5A 4AEHL 1A6ZB 4Y5YA 3VG9C 5FHAH 3AREB 3GO1H 1IQWL 4WJ5A 4M4RA 5DRNB 4U0QB 4PP1C 3HR5A 5LCVH 4PYGA 2UWEA 4Y4FB 2GJJA 3GMPB 4IRSD 1N3NB 2HFFB 1I1AC 1WZMA 3BGMA 5FO8A 2YD4A 1LEKB 5FHBL 2OP4L 2JB6A 3ME0A 4ODTH 1ES0B 4NO2A 2NXZC 1JVKA 1JUFA 1VPOH 5B21A 4X8JB 4U1MB 3GKWH 4Y5XA 2BSSB 4OSUL 4C4KT 3D18A 3MRIA 1T0PB 2W65B 3S37X 3MCKB 4POYA 1ZHBB 2UYLA 1Q1JL 2ICES 5KVDL 1EFXD 4YFLI 4MJ5B 1MFNA 4OF5A 2V2XA 1FCGA 1S7WB 1A7QL 3VXUD 3P4MB 3DTXA 4MA7H 4DN3L 3MRKB 3VFGL 4QGYA 1UKQA 3KYNB 2JCCA 1VCAA 4TYUA 3ARGC 4UILH 1CYGA 1GRWA 2R23A 4GH7B 2JF1A 2KUTA 2JJTC 4P9MH 3RAJL 1KELL 2OTPA 4XNUH 4HUUB 4MAUL 35C8H 2V6HA 3L3GB 3BPCA 2SEBB 1QQDB 4D9QD 4H20H 4MCZB 4UQ2B 4P3WA 4B5EA 3MOAH 3P40A 5ANMB 5CGYD 3OKYA 4JVUA 3ZKSD 3FB5B 3FZUC 4X6FA 4F7CA 1QBML 5TDOA 5DZOA 4XP9L 3RL2A 2IH1B 3CXHK 5DWUH 1C5CH 3T2NH 4LKCA 3HR5B 4LPTA 4QRRB 3V8CA 3X3GL 1T21B 5E24E 3QZWG 4DTGH 4IMKA 3ARBA 4MJ2A 1P4IH 2DWEB 4HUXA 1WFTA 3VXSD 5EU6E 1T2QH 5MENA 1B3JA 3CVIH 1FRGH 2E8ZA 2NX5E 1E4WL 4ZTPH 5BZDA 4M6MH 6CGTA 4R7NB 4ZUTA 2ZG1A 1KB5H 1UYWL 4NO2B 4MA1C 3OR6B 5I15H 3IFOA 1QSEB 2V5YA 1QLRB 4P5TD 1BF2A 1N5YL 1RZ8B 4FFVC 1IJ9A 1GCFA 2O5ZH 4OGYL 2MTPA 4R8WL 1ZK9A 2JLLA 5ICYB 2BC4A 2BNRD 1OAXL 3OG6B 1DP0A 4JANA 2RFXA 3U1SL 3W5MA 3IDIA 1KCSH 1A3RH 2P8LB 4PD4K 2XQBL 4GUPB 2N56A 3TVMB 3O4LD 3KPNB 1FNFA 3V4VL 3H0TB 2EKSB 5GS0H 3K46A 1TIUA 2ZNWA 5DMKB 3TIDB 1P53A 4Z18A 2O26U 5DD1H 5I74B 1YC8A 2HFGL 4NHCL 4S1RL 3TYGL 1WVZA 1IBGH 2VLKE 5C09A 2HTKC 4FXKB 3LQMA 5T3XD 3GJFK 4WFGE 3BWAB 3ZHDA 4PJ7F 2AK4A 4LEXH 3B9AA 2D7MA 3ARFB 4NQDB 5EBWA 2XG5A 5FB8B 1RZJH 5EA0L 3RWJB 4KI1A 2B20A 2EDJA 1U3HD 2LU3A 4LK4A 5CJ8A 4ETQA 2JJSC 3STLA 4I9WD 4XPHH 3QAZB 5DS8A 3W0WE 4JDZB 5CHNB 3U36B 3BDBA 4PJCB 4OUUB 3MODH 3HC3H 1XCTB 4JM2A 3O9WA 3QIUC 4JJ5B 3B9EA 4JHAL 4K7PX 1KTLA 3IRZA 3QXUA 5D9SA 1YMHA 1QFWI 3CK0L 4K9EC 5TF1L 3WJLA 2Q8AH 5EOCJ 4WI4A 3PWUA 3DGGA 1QFOA 3DX8B 4MNHB 4UU9B 1AGDA 1A1NB 5F7FA 3CLEH 4PGEB 3TBVA 1D5ZA 3K80A 4N8PA 4N8CL 1MRFH 4B53A 4EBQH 5JHDE 4JRYA 4HK3N 4F7PB 2GK0B 1I9RL 3QJFB 4ISVA 1DBMH 4OZFA 5CBAB 4WTZA 4LDOB 2CDEA 2VDPH 2J8UA 2AJSH 1JK8A 1WC7B 1DQJA 1O0VA 3I3DA 5FGBA 5GZOC 2Q3AA 1MIEH 5EIIA 2F74B 4I3RH 3N85H 4G7VL 2XY2A 2VR5A 3MGTA 2Z93B 3ZSSA 1UT9A 4LSDA 5C09B 1P9MC 4LARH 3QA3B 2NXYC 1ZLSH 3GZKA 5C0IB 4PBXA 4HWZA 3S9DB 4G42B 5D70H 4HLJA 4I18B 3R8QA 2E6QA 1XGYH 1UB6A 4K7FA 4APQA 2HFEA 4ZQKA 4NHUB 4Y1AA 5CS7A 4ETQB 1A7OL 2R0KL 4F15B 2N7BA 4HKBB 4IS6A 4AY0A 1M7DB 3SE8H 2W9DL 3R1GH 5BVPH 1A7PH 2B5IB 3BIBX 4J6RH 3SDAD 2VWEE 4PJAE 2X4NB 4M00A 2GJ6A 1MCSA 4X98A 5EU5A 4Z7VB 4GOSA 1BFSA 5D5MF 3BT2H 1QBBA 3CX5K 3PDDA 4DEPB 4X6DB 4PREA 4HK3J 3DGGB 3JWDC 4RSVA 4MAYC 1AGDB 2CGRL 1CQYA 3QNXB 1NC2B 2CO6B 3FB7A 3TZVA 1WSST 1UM4H 3ZZ1A 1TPXC 5C0BB 3MLTB 3RTQA 4HXBL 4Q9CA 1JF5A 3U4EA 2KQNA 1I8LC 4P46C 4MQSB 4X4XB 5AZEH 3MRCB 4QHNB 1SJHA 3G6JA 1DQJB 3UC0H 2AV7B 2DMCA 4P2RB 4I3SL 5HGAA 3WSQH 2OK0H 1RZKC 4YWGL 1UKSA 4OCWL 5FYLD 1IAMA 3GBMH 5T1DH 3RA7H 3RL1A 5T1KB 3OG4B 4XNXH 3V95A 3RZCA 4XTRD 1MNUL 4NZUL 4RDQG 5C0CA 3OKOA 3TPUA 3F7VA 3UTPE 1BBDH 3O6FB 4MLSA 1QYGH 3VWKD 3O81A 5DHYA 2KZWA 3D48R 4Y2OA 3U4AA 1N7ML 4AG4L 2AI0H 3BESR 4L4VE 4ZFZB 3WYRA 4APQB 3F12B 3HHRB 4OF3A 2H2PC 2BVUA 4F8TA 1AGCA 2C1OA 2F58H 4X8XA 4B0MM 1L0YA 3QHZH 3MRDA 4IJ3B 2IAND 3HNVL 3TPKA 4U1NA 3VA2C 4K3EH 1JZ8A 2HAZA 3FJTA 3WN5C 4NKIH 1FFQA 3TBTA 2HH0H 2XYCA 2BSTB 1U2HA 3TJEL 4PB0L 4XP4H 2E7CA 4KUCF 2ZSWB 3MJ9H 3UXFA 5L2KB 1KENL 4I2XA 2QBWA 1TVBA 2ZJSH 3X11A 4G8GB 1R24A 3HZKA 3HUJA 4UT9H 5CILL 1UQSB 5MEPA 3S4SB 1ZT4A 5HYJD 1VKXB 4XNYH 2YBRA 1S3KL 2NY2D 3DSFL 5IMOB 1DQLL 2PTTA 1IM9D 4UT7H 3VH8G 3MLZL 2YS4A 4UB0L 5JDSA 2EXWC 4M5ZL 3VXUE 5HGHA 5IK3B 3WIHH 3IDGB 4UBDC 3DUHA 3DYPA 3U7WL 5I71B 2ICWB 2OZ4A 3U6RB 4XB7A 4OCNC 2W0LA 1V7NL 2AEPH 1X6NA 4LSQL 1G0DA 2OI9C 3OKOB 5I1KL 3LKQA 4YR6A 4H88H 4O5LL 5C1MB 1TCRB 4KDTA 5C0FA 1E4XH 3RY6C 1OAYL 5CD3B 2DAVA 1U8OB 4KKNA 3N1PC 4Y16D 1YMMB 3ARWA 1JZ2A 3MRDB 2YPLB 4NKDB 1OTUC 3L5IA 1QD0A 5AUMA 2P44B 4MXVF 1EXUA 2NW2B 4OD2B 4JPWH 3BDYH 1H8OA 3VD3A 3RWHB 5T3ZD 5I66A 1TZHB 2FB4H 3HCVA 1NH6A 5ENWA 4KK5D 5JW5B 1KBGL 4NOBA 2VLMD 1Q8MA 3T0EC 5EB9A 5E2VH 1A1OB 2FGWL 1BBJB 2G9HA 4QHKJ 4YHIB 3VW3L 3BEVA 4XHJD 4FQ1H 4GQ9L 4LL9A 5I1IL 3RPIA 2V9TA 2GIYA 3BKYL 4S10A 3OQ3B 4G6FD 1AH1A 4MJID 3H2WA 1ZT4B 4C56B 1QSZA 2CRZA 4UINL 2BNRE 3F6IA 2XZAL 4FQCL 4HJGA 1RFDH 5IVXE 1BZQK 5JDSB 3DPBA 3U9UA 5EU3B 3ZKXB 3TWCL 5CBEA 5GJSH 2VN7A 5FOBA 1N59A 1H3UA 1ZVYA 2G60H 1NL0L 3VE0A 3SEPA 1TQCB 1UM6L 5IVOA 1MCFA 3B5HA 4I3GA 1URLA 1OD9A 4P2OC 3MREB 1D6VH 5LWYH 5D7IF 4Z7WA 3LN4A 2PO6C 1FZJA 4ZFOB 4KZDL 3LKPB 1SYVB 1G7HB 4OCRH 2DLTA 2ZUTA 1S9YB 4GBXC 1IE5A 5C0FB 4G8EA 4OQ1A 1RU9L 4DQOH 4TN9A 4OF0A 2V2WB 4FFYL 5F8QC 5EBMB 3S36H 1S7XB 2CDFB 4PJIA 5BS0A 5HHQB 5BRZB 4TSAH 4XWGH 4I9WE 4LSPH 4ENEC 1IEAB 4GXUM 1E27A 1FGNH 3ULVE 3Q1SH 4P59H 4LCWB 5GRUH 5HGGS 1J8HD 2FR4A 5GXBB 4K8RH 1TJIH 3NH7L 5DMYA 2OTUB 1UH3A 1I3UA 4OLWL 3V4UH 4KC3B 1IGFL 3CAFA 4L3EE 3U0WH 3ROLB 1KJVA 3QEQB 1F6FB 3DHMA 1DANT 1X5ZA 2IAMB 3V0AC 1F11A 1U36A 3RKDC 1RUMH 4R96B 1IGML 4JFED 1UZ8A 2Q8BL 2B4CH 1KGCD 3DARA 1DUYB 1XGPB 1Z9SA 4I0KA 4YBLB 5DGRA 3MJ7B 3LH2H 4QHMA 1QNZH 5D2NE 4NOFA 3WL9A 1Q9LA 5SWSB 3U9UB 1CE6B 1F4YH 2E27H 3AS0A 2V7NB 4GRMA 1KEGL 1JPFA 2ORBH 2Y5TA 3M17A 1OGAD 2A6JB 2X4OB 5E00A 1MCOL 3MR9A 4EXKA 3VXNA 4MS8C 1S5HA 1BZ9A 4N0UB 3D3VD 5JW4M 2BDNH 3TBWA 5DJAA 1BX2B 5FYKU 4EI5D 5IFHH 1U8NA 5DQJB 5D7LD 3INUL 5HHVH 2NYYC 2X4SB 4POZC 2BZDA 3O41B 4EN3C 3BKJL 3M1BA 4R4NC 3GIVA 5FM5O 1OCWL 4H0HB 3SKJL 4GS7C 1NGQH 1F2QA 3C5ZA 2NY5L 5DDHA 3KXFE 4NQVB 1KCUH 5TJWK 1YEDB 1R3LB 4PJ7B 5C0EA 1CTOA 4KKBD 3I75A 3ZL4L 5IB2A 1JRHH 4HIEB 1ZANL 2WZPD 4HKZB 3PJSB 1QSFA 2F19H 2MPAL 3PABA 2JJVA 4KTDL 4DVBA 5E5UB 4FXLA 5DD5H 1W0VA 5JOEA 3QUMB 2L7UA 1AHWC 5K9QI 4HV8B 5EZIL 3C60C 4C54A 4KRPB 5ETUB 1QG3A 5FF6B 1QR1A 2HT2C 2CK0L 1OTTD 3FFCE 5B39B 3WKNA 4NKOB 1FG2A 1IAIM 4PJ5B 1T83A 3PG2A 4KI5E 3L3HB 3SDDD 4R0LC 4GAYB 1B2WH 5B38G 3UROR 2E7LC 2ICWJ 1YPZA 5CEXB 4QHMB 3UTSD 1YDPA 4XAWH 4NQSA 2VN4A 5GGVH 2FL5A 5MEOB 4F58H 3N1GC 1YYLH 5JIIA 4BZ1H 4QRTB 2GSIA 2XWJA 5I8KH 5AAWA 4JFDB 3DO7A 3Q5TA 1YJDC 2QHLA 4M48H 1CXLA 2EYRB 4YBQD 5MEQA 1H3TA 3BP4A 5I73C 2J4WL 3PQYB 4Y5YC 5D7LA 1CGSH 1XGQA 4OQTH 4EVNA 3CFCL 4E41D 1ZOXA 4DW2L 3DETC 4JQVA 2HRPH 2NY0C 4OFIA 1XIWA 2HYMA 4NN5C 5IMKA 2XN9D 1TFHA 5D7SL 5EO1B 4X6EA 2JJUA 3EJZC 5IF0A 1FGVL 3QFJA 5I8CA 2R39A 3CU7A 2DDQH 1H3GA 3RIFF 3ZDXE 5DJ2A 1GHFH 3SJVD 1BEYL 4U6XB 4PUBL 1L0QA 1MCIA 2CDGA 4HFWA 3U7AA 5IBUG 4XP1H 1CFVL 3KPLB 4OT1L 4Y5XC 3RGVA 1U42A 5KW9H 3ARDD 4FXGB 5FECB 3SKMA 2A0LC 1EPFA 5IESL 2VRAA 4C83B 4QRQA 3PABB 2ATKB 3WXWH 2XTLA 4PY8J 1FVDA 1AKJD 3B83A 3RWEB 4ZPTA 3X3FH 1EAPA 2I07B 1D5XB 1IEBA 2R4RL 1I7UB 2VLJE 3QO1A 2EO1A 3SGKA 1XF4B 3IB4A 4XBEH 3H42L 4B7LA 5L0QB 5HYJE 5KSBA 1BPVA 3H9ZA 5BV7B 1IAOB 1WEJH 4J8RA 4X4ME 3QISA 2XA8L 3GIZL 3LQAC 2DIAA 5D5MB 2ZUXA 2IBZX 4A6YA 3ULVL 2XWJB 3C6LD 2A9NL 3DO7B 4XT1C 3NABL 4P23B 3IS1X 4ZUWA 1F4WL 4WY7L 3RDTD 5AZ2L 3FCTB 2FJGB 4PV9A 3GUTA 2EDEA 4G7YL 5GIRB 3T8XA 1U8IA 4S2SB 4YH6A 3DHJA 4LSVH 4LQ1A 5KSAB 3OR7B 4MXQD 4KJWD 3BPOB 3QUMH 4OZIF 4GXVL 3MRHB 2R0LH 3OB0K 1LD9A 3GMRB 4G3YL 4IMKC 2D7TL 3ARBC 5F89B 4MHHI 4AMKH 2A83A 4LHUB 3KR3L 3MLVH 1R3HA 3IJYA 1HDMB 3T2QA 4L29B 4L1HA 3O3AB 4HH8A 5EFIB 4JQXA 4RFOH 4MNQA 5IV2B 1U3ZA 4H1LB 4PJDA 3Q6GL 1A6WH 4WUUD 2DL2A 3OKLB 2CDGB 1IQWH 1KPUB 3UTQA 4PRPD 4Z7QF 2QLVB 1FNGA 3JUYA 5EO9A 2PXYA 3QIBD 3UJIH 2V5RA 2DYPB 2WM0A 1II4E 1NGXA 5T3ZE 4ZXBA 4K9EH 2CUIA 4NFBA 2MKWA 2F9BT 3JV5A 5FHBH 2OP4H 4EUPA 4XPBL 4ZO9A 3IDNB 4AIOA 1ACYH 2H2SD 1F3DH 3K2UL 2BFVL 4YHPA 5BJTA 1XCQA 2VLME 2WSKA 5IJVA 2Z8SA 3PWPD 1GGYA 3P77A 5SX5H 2DI7A 1PG7H 4OSUH 1A6PA 5HVWA 4LRIC 3WIFB 2ADGB 3P3YA 1DBBL 1T4KB 3IDYB 2B8OT 1Q1JH 5GSRA 2YKLH 4ODXA 1J12A 3QSKB 5L6YL 3DUUB 4JFXB 2R1XA 4MGXA 1AFVL 3VFGH 3GSNA 1UB5A 2J3SA 5JUEL 3VXTA 2FECI 3FHQA 1OAQL 1DE4A 2ENSA 3KDMB 4RA3A 3KPSD 4URTB 5HYIA 4RRPG 2AJ3A 2UUDH 2AV1B 2YMXL 3A67L 1JNHA 5KG9B 4MAUH 5H35B 4POUB 2ADJB 2EDOA 3R0NA 1NCCL 4NDMB 3MBED 1EV2E 1FSKB 2IF7A 3D69B 4ODWB 2D7OA 1NEZG 3NACH 3BVNB 1AQDB 2F53B 1OAZL 5EC1B 4HUWA 2HTLD 1YEIL 4JM2C 3S3JA 3O9WC 1GC1H 1DCLA 3BPNC 1BJ8A 1BQHB 3T3MF 1X5IA 2PW1B 1WWAX 2R29L 3EGSA 1QBMH 4Q74A 5BV7H 1AGBA 4JEGB 3VFSA 1PDKA 1CGWA 4NO5B 1ZLVK 2DQEL 5C6WH 3X3GH 3DV4A 1I7RB 3WJLC 4HT1L 4XNZB 3BYYA 4EQ3A 5EU6A 4YLQT 5BOPA 2CH8A 2NX5A 5FYLL 3ZLQC 1NANH 3O45B 3JV0A 1DQDH 3MRJB 4XNMB 4KAQL 1K2DA 1OQOA 4NQXA 2I5YL 4QY8A 5F9WB 1UYWH 4WU7A 1EHLL 2OJEB 3SY0A 2GSGA 3AC0A 2YSSA 2X70B 1N5YH 3GSWB 1KTRL 1CVSC 5EZLA 2HLAB 4WCYL 5FGBC 4R8WH 1FIEA 5D96B 3SCMD 3FT4B 4F3FA 3QDGE 1AO7D 4H1LH 5F1SA 3CX2A 3D5OF 4GKNB 2BJML 5GSRB 3GB7B 4ZAKA 3WFBL 2BSED 3C5JA 3U1SH 1RZKH 4U1KA 4X6BA 3HZMA 2XQBH 1CFTB 1KJ2L 3KLDA 5MHSD 1TVHB 3FQNA 1F3DJ 4L8SA 3V4VH 1U3HC 4TTDC 5H2BA 1OGAE 3LS4L 1HHIA 3V9FA 2HFGH 4NHCH 4O00A 4S1RH 4MNGE 3TYGH 4MD5B 4TVPD 4PJ9B 4CAGA 2HLFD 3B9KB 3EFFA 3TYFB 4XNQA 4CUCA 4JY5L 4HK0A 4OD3L 2VNCA 2FZ3A 1FL6A 4IHOB 1REIA 1A8JH 1XGTA 2VERN 4JGMA 3QQ4A 1NAKL 4KXZH 3WFDH 4FRWA 2GY7B 2ZOLB 1HILB 2GCYB 1B9ZA 4CN1A 3MA9L 4KK9C 3T09A 2MMXA 4LCUA 1R0AH 3BMVA 5HGBB 3VDAA 2EC9T 1V3KA 1DANU 5DJXA 3S97C 4NCC2 3IVKA 4NZTL 1ZGLM 1WITA 1F45A 4JZJB 3S3PA 1K2DB 3TZVC 4M8QB 4PJXE 4Y2DA 1K9TA 1KLFA 3RTQC 2R1WA 4XPAH 3SDYL 4JFHE 1UXWA 4JHAH 5FA3B 2Z4QA 5BZWB 4ZFFB 3ARYA 1ZT1A 5J6GA 5ESQB 2DKSA 1ZVSB 3DX6A 5JQ6H 3CK0H 4QRSB 5TF1H 2W92A 5DYOB 1KIUA 1J11A 1T6WA 3BW9A 4NPYB 2OJZL 2HT3C 1D5MA 3UZEA 3VG0L 4M3JA 3AS3A 3EUUA 4LLDB 3AM8A 1WAAE 4OIAA 3RZCC 1T6VN 5JHDA 3TH3T 4N8CH 4KV5E 3BQUD 5HY9A 3UTSE 3THML 5T1MB 3V0VB 2VISA 2FEEL 4OAWA 3QI9D 5T3ZL 5D7JD 2UZIH 3WHXB 4P5MB 1EJ6A 4G7VH 5A2FA 3NCEB 2X2YA 1PYWA 4XPFL 4HUNB 2VLKB 3MNVB 1FL5B 4ODVH 3MNWA 5A16B 3MLUL 4Z7OE 2FBOJ 1AI1L 3KYOA 3OKDB 3EO1B 5D1ZA 1MREL 4IEFB 2PCPA 4HUVA 4G6AD 2M8XA 4PV8B 4HH9B 1H3VA 2RJMA 1RUAL 2FSEA 2I60H 5IFAL 3SKNB 4L9DA 3GSRB 1A7OH 3SJVE 4O2EB 2BOCB 3W0WB 1I8IB 5ICZA 4LGSB 5CKGA 5DJXB 1UADC 3L5JA 2YD9A 1N5AA 5E94B 2NY4B 3HI1B 5ITBL 4FTVE 3T1WA 3G5XB 4UNVA 4QRPE 1P1ZB 5SWZD 5IB5B 1RHFA 4PJAA 3U82B 2H1PL 3BP5B 4Y2DB 3HUJF 4NN6B 4LLWB 3W9EA 1K3IA 2ZSVA 3SE9L 4ZS6C 5GPRA 2C3HA 3DX6B 3O3DA 4H26A 3WFEH 1B6DA 1RJZA 2CUHA 4YX2L 1P2CB 1A7RH 1K4DA 1ZXQA 1ZWIA 4ORGA 4JFQA 2CGRH 3GMQA 1UJ3B 2E3VA 2YEZB 3MUZ1 3VWKC 3GEWB 3QNZA 5CSZB 1VACA 5FKPA 1RZGA 4G80B 4YIQB 4JAMA 1BFTA 1PAMA 1W72A 4KDTC 3MRBA 4O2CA 3KYKL 4I3SH 1X6LA 4OCWH 1CICA 4NKMB 1KJ3H 1R3JB 3ZDXF 4NJ9H 5GGSB 5AD0B 4IRJD 3ESUF 1JN6A 4YK4C 3X14B 3D1MC 5DEGA 4Y5VA 4NZUH 4WEBL 3NMEA 4M1GH 3IGAB 3WLBA 3KYOB 3FQWA 4RGMC 4R2GB 1P4BH 4WHDA 4GRLB 1NMCB 3GMMB 4MA3B 4HUVB 2WP3O 1B4JL 2Y5EA 4RX4D 3U7YL 3RVVD 1RULH 1N7MH 2HT4D 3QUYB 1HHGA 3C2AH 4F37K 3ZHKA 5K9OB 5ESAA 2EH8H 1EO8L 4PY7A 4ONOA 1F5WA 5FUOL 3HNVH 5SWZA 1G7LB 4PRPE 3MRFB 3QIWA 1BQLH 2DM2A 4XVJH 4E9LA 4XXDB 2AJYH 3TJEH 4PB0H 2HKFL 3O3EB 3EJYC 2X05A 3KS0H 4HFUL 2EDFA 4PJ8D 1XF5A 2YZ1A 3RKPA 1A0QL 4JN2B 2EKJA 4H8WC 1RJZB 1OT1A 2R2HB 4XMKL 5D8JL 5GS2D 5ID1A 4X6CE 1I9EA 5DQDL 2HN7A 1ZWIB 4WWID 1QPPA 1CIUA 2EZ0C 4YXHL 4L8DA 4I77L 4OLEA 4X7EC 1IAIH 3Q6FB 1VFBA 3DSFH 3KPPB 1JTPA 1RJYB 1VACB 2DI9A 1DQLH 3MLXL 4YHLL 1AR2A 5DURB 1NBYB 3MLZH 4UB0H 3EYVB 2ARJA 3MRBB 5EUOF 4Z7WF 3HB3D 4GRWF 3REWA 4M5ZH 1HHHA 4O02L 4U1IB 3G9VA 4KHTL 5DJ0B 1A4KB 5CJQL 2X9WA 3MROB 4HIIA 3G5YA 4JHBA 1V7NH 2X4TA 1Z2KA 1RD6A 5HHOB 1BD2D 3CSYA 4LSQH 2XWTB 3HLAB 1NLDL 4N5EC 1J0ZA 3TJHC 1H8NA 4BM7A 3FQWB 1LO0L 1KLUB 1OGTA 5GGVY 1KEMH 1DN0A 2BNQD 2ZPKH 4CKVX 2E9JA 4O5LH 4PRHB 4L4VB 2YPVL 4ORZC 2C26A 3LKNB 3UTZA 2H26B 1OAYH 4FQXB 5HHXL 4DZ8B 4YGAB 5B8CA 2C3WA 4PR5B 1EEYA 4K71C 4OZIB 1JGEB 4M1CD 4M93C 3KPQB 3ZTJH 3P73A 2QSQA 3F7YB 5I30L 5ISZB 1R5IA 3MV9D 3JV6B 2E9WA 3CFEA 4PRBB 4QRUB 5D6CA 1OP3K 1PZ5A 4OFVA 4ZSOB 2ARJQ 3FO2B 3BP6A 3JUZA 1KBGH 1XR9B 5EU7E 1T66C 3KYMB 3TV3L 3HAEH 2F8VA 3MV01 2XPGB 5I1GL 4NRYB 3VD4A 3VW3H 4JDVA 3VWJD 2DQJL 4GQ9H 4JLRA 2QR0A 3TA3A 1JIBA 5I1IH 1PGRB 1ZS8B 2VH5L 3JTTB 4DKEL 4G8IA 4UINH 1FPTL 5A3ID 2AJXH 3GSXB 4HPOL 3UTOA 5IVXA 1EFXB 2XZAH 4YHKL 1YN7B 1BM3L 5E2JA 2X4PA 5GJTL 4D9LH 4MQTB 1OSZB 3VXUB 2J8OA 4NN7B 3KS0J 5L9DL 3ILQC 3OGCB 5MHSE 1KXTB 2V9QA 3RWFB 1NJ9A 1BD2A 2P46B 2VLLB 2OTWA 1UM6H 2GJZB 5D93B 1BECA 3C5ZC 3H9SD 2X4TB 1UH4A 1KIPA 1SVCP 1EDQA 5FV2A 5GRVL 3WO4B 1XH3B 2BNQA 4U6HB 4BKLA 3WUWB 4KZDH 3RBSA 2A6IA 1DN0B 1R6VA 5JPMA 2H45A 1CG9B 3GK8H 2AXGA 4MQXD 1G84A 4HEME 3GSOA 1F6AB 2DRUA 1LEGB 2I9TB 5B8CB 4JY6B 1EEYB 4HMEA 1NGZA 1CL7I 3LRSA 2NY3B 5C0JB 3ULUC 5EG6C 4CMMB 1FNSL 1DUZB 1CXKA 1DBAL 1A3LH 1OB1B 4NC1C 5F6IC 3VXSB 1T83C 1MFBL 3BSZL 1YECL 2MCPL 3NH7H 5FKAB 4L3EA 4OLWH 5E6ID 1A64A 4LVNB 1IGFH 5E2UL 1IM3A 3VWJA 3PL6A 4C57C 3QZWA 5LVEA 4I0PD 4K23L 1B0RB 3O2VL 5B4MD 3D2UD 1IGMH 2VXUL 4D0BA 5I18H 2BNRB 2RIKA 1U8MB 3NCJL 5HHME 4JN1L 5E4EC 5IGXL 5ACLA 4UTAH 3KJ4C 4G5ZL 4HWBL 2IG2L 3FN3A 1S7UA 4BFGA 4UI2A 3D39E 1I8MA 1UEMA 2XG4A 4JQVC 2BX5A 3FB8A 5A1AA 1XIWC 2MSPA 4UIKH 3O4LB 1EFQA 5TH2A 1T03L 1KEGH 1MLBB 1EIBA 3MRGB 5DFVC 5EOQH 1ZGLB 1K8IA 4FZ8L 4U7SA 1MRDL 3HMXL 1X5GA 4YDKL 2IALB 3OXRB 3RGVC 4JO3L 3VXME 3INUH 5HXMA 2DBJA 5F71A 3VXOA 4BQ6A 3BKJH 3GSOB 3EYOA 1UVQA 1HZHL 1KIQA 1AXTL 3KXFA 4P4RA 2NY5H 3BUTA 5KVFL 5IMLB 3DGCR 3AS2A 5C08E 4D0CB 3V79C 5TQ0L 3EOBA 1T0MB 3ZL4H 3OKKB 5MI0B 5E8OB 1M05B 3SGKC 4P9HC 4XC1L 2QEJA 3TCLB 2X1WL 1WAAF 5J11B 3SDCD 2BOBB 1ORSB 1LMKA 3KPOA 4KTDH 3OAYH 1FJ1B 2P4AB 3UJJL 4J3SA 4XGZA 1ZLWH 3D2UA 3V6FA 3QULA 3UBXI 1R5VB 3CUPB 5EZIH 1A6TB 2FX9L 4LLQB 5EU4A 3K8KA 3TT1L 3FFCA 4F9LA 2CK0H 1AIFB 2NMSA 5F88B 2NY7H 3RUGF 15C8L 4D9RE 3VFVA 3CD4A 5DD0L 5D2NB 3NGBB 4Z7OF 2HFTA 2RB8A 5D1QD 1NCAL 4TOYL 3VXPA 5IG7B 4OI7A 2CJUL 3PV6B 1FNHA 1SM3H 4WDIA 3ARZA 3IFNL 3HNSL 1WZ1H 3K8LA 4JQXC 1N2RA 2WWMD 5E1HB 1I1RA 1F13A 1G7IB 5KS9F 5HVFB 4N0YL 4Q7DA 1A6VH 1AR1D 3HZVA 4KROD 2J4WH 4QXUL 3TBSA 3CFCH 1CLZH 4ZNEE 4UUJB 4WFFE 4JZOB 5IEKB 3S96B 1A6UL 2PXYC 4ZDHB 5EN2A 1M7IA 1H15B 1J0JA 5GQBA 4PJFF 1MLCA 3JTSB 5D7SH 3RWIB 5I1AB 3NIGE 4ZXBC 1SHMA 4PG9B 4F33B 3HG1D 3OXSB 4ONFL 4TNVK 1CD0A 2J6EA 4PJHE 4PLJC 4PUBH 5I17A 5H94A 3U0TB 1NUGA 1YY9D 3FOMB 4AEFA 4PJGF 3DXAD 5TDNA 4NP4L 4RMVA 1CFVH 4OT1H 4JREC 1NGWB 4YAQA 3SDCA 2P5EE 2Y7QA 2P43B 2Q76B 3SDAB 5IESH 3TN0D 1ZKAA 3ROOA 2HVKB 5KTEL 4J3WA 5CEYB 3CH8A 3PGDA 4CVWA 5T3XH 1JGDA 3QULB 2AEQL 4ELME 3F5WA 4JDTL 4NZJA 1JWSB 2AKRB 4R90H 2K1MA 5CZVH 3GSVB 2VLJA 1PKOA 1M4KA 4RBPH 2R4RH 4RISL 3T65B 4NYLA 7CGTA 4EDXA 2E7MA 3H7BA 2OS7A 2ITDB 4BH8A 4X4MA 1FYTD 2XKUA 4MSWB 3VGAB 1P4LA 5CZKA 3UTTD 4NM8L 4Y4KD 5EZOH 4LVOC 1QRND 3FAWA 3GIZH 5DFTA 5BW7A 5JDJA 4NQUA 4X4ZA 3DV6A 2Q86A 3GBNL 3OHXA 3NABH 4AENB 1CU4L 3T0BA 4WY7H 5AZ2H 2V2TB 4G7YH 4U31A 5HGDB 2BCKA 3L9RA 4WWKD 4WNQB 4G3YH 1Z9MA 1UCTA 3KR3H 3HG1A 5HI5D 3W39A 4BQCA 2VR4A 4YGVA 3SQBA 1N8ZB 2XZZA 4HXAH 4O2FA 4MVBD 5HDQL 4OLZL 3OJ2C 2G5BB 1FORL 3ARPA 3VD7A 3RIAK 3BN3B 2IANB 4QOKA 4EIGB 1KJ2B 5I75B 3MUGA 4OKVB 2E5EA 1DN2A 2EEDA 1NCDL 4DZBA 4ODSL 4LEOB 1OWRM 5I9QC 1IGCL 4WV1B 4OGAD 3U46A 4ZAKC 4X7DC 3NZ8A 3IU3B 1U8KA 2GT9B 2IMNA 2NY6C 2COQA 3FT2A 4HZLB 3DROB 3D85A 3K2UH 5MP6L 3V5KB 4L8SC 4X7FC 3I2CL 4LAJH 1F02I 4X0KB 3VFWA 3VGDA 5HYJB 4P4KA 3RWGA 4M43L 1DBBH 2XTJD 4MMZC 2NY2B 5E5MB 4ERSL 3QUZD 5F1IA 1R3KB 3VU2A 1IM9B 3UPCA 2DL9A 1MCNA 1MCKA 5L6YH 3S88L 4XBGA 4KJPD 1DJSA 1AFVH 5JUEH 4XCEA 1AC0A 2HKHL 5IHUL 1OAQH 3CFDA 3VH8A 2WBJD 3F65A 5IEHA 3A67H 2WAHA 4M5YH 1MJUL 1QHPA 5EUOB 3ZYIA 2HP4A 3X12B 1FFOB 1OAZH 5DVMA 4LDLB 4U49A 2X1PA 2R2BB 4QNPE 1YEIH 5EC2A 1C08B 3ULSA 4Y16B 3L6FA 2R29H 1S8DA 4AH2A 3SCMC 1QRKA 4CVZA 2DQEH 5E1AB 1I7ZA 4C59B 4PRAB 1CGYA 1U8JB 5DJYB 5D1XD 1JFQL 5FYLH 4UOJA 4JFFA 5ADOL 2R0ZL 3AM8C 3Q5OA 4KAQH 2I5YH 4J4PA 3WBDA 3S35L 2IADB 1RK0B 1H0DB 1EHLH 2ITCA 3O4OB 4D3CL 1TDQA 2ZNXA 4OUOA 1T0NB 4WCYH 4F7MB 3WO3B 1HEZA 1M7XA 4G6FB 2C1PA 4OZ4B 5K59E 2B39A 2ED8A 4V1DE 3IAQA 5IB3B 1ED3A 5F7MC 3MNZB 1ITBB 3WFBH 1KCRH 4K3DH 4YHML 2JJWA 2H3NB 5D1ZC 2R9HD 3CDCA 1DLHA 3QEUB 1MHHB 4QTIL 1NPUA 2HWZL 3ARQA 5DXWA 4Z5RA 4TUKH 5T5NG 2CRIA 1ONQA 4CN6A 4L4TE 3X17A 5E9DD 1A9EB 2Z9TA 1CLYL 4LNRA 2BXYA 1GVIA 2VXTL 5ADPL 1KG0B 1J0KA 3HN3A 5FGCE 3P9LB 4JY5H 4Q58C 2X1QA 4ZYKA 1N0LA 5I0ZA 4PGCA 1MH5A 2VWEC 4OZHA 1CT8B 3V6ZA 2D0GA 1ORQB 1EH9A 1CXIA 3S4SG 4AQOA 5DSCA 1NAKH 2VB5A 4O58L 1XT5A 3MA9H 3RNQB 5D1XA 4ZUUB 3GHBL 1HHKA 5H8DA 4NJAH 4BSWB 4E5XB 3BZEA 2Q87A 1AXIB 3HA0A 1MCCA 4NZTH 4DCQA 1D6EB 1DDHB 4AT6B 1J8HB 4N9GA 2FIKA 1KIRB 1EEZB 1ZSDA 4PJXA 1V3MA 5E08H 4GAGL 1D5BB 4H8WH 1TVDA 3WNPA 2QADD 2ITCB 1HXYB 4HIHB 4R7DA 4OLUH 4WUKL 4P3CL 5IVZA 4GRWH 3HMWH 3LD8B 3MC0A 1S7RB 3QDGB 3OAUH 3G6DL 4JFEB 1CICC 1J86A 2F54D 3IJSB 4UMGA 3MRQB 4K7PL 1SY6H 5T1LA 2DBLL 5IB4B 4QGTA 3TFKD 1MCQA 1W0YT 3MRPB 4J23A 2Q7YB 3MBXH 5GGSY 3VG0H 1S7QA 3UYPA 2NNAA 1Q0XH 4Y5VC 2P8MA 4LBEA 3GJEB 3IAPA 1FN4B 3IETA 2IFFH 1RIUL 1YY8A 3RU8H 4CW1A 5CP3H 1OGAB 2MHAA 1C7TA 3IFPB 5T3ZH 5TGBA 3SPVA 4MNGB 3HI6L 3D3VB 4XPFH 3UPRA 2EYTB 2Z31A 3O2WL 4DKFL 5HI4C 1I3GL 1NGYA 12E8L 3ESVF 4EI5B 1ZLUH 3TO4A 4S11A 2RBLA 4D8PA 3GI9L 3O2DL 4ZD3L 4ZYKB 3QIWC 1IC5L 25C8L 2V17L 5HTSA 1NC4D 4ONHA 1JF6A 1SBBA 4M03A 2A73B 5TDPA 3LSOA 3G04A 4CU8A 5IFAH 5KOMC 4AIZA 3I6GA 4RNRA 3FAXA 4RAVB 5F96L 3LEYL 4PP2B 1C5DB 5GGRA 4QRPA 5ITBH 1UCBL 1HQ4A 4WW2A 4BSVB 4N9GB 3FO9A 3U0PB 1TZGL 3GSUB 4PJXB 4YFLF 5DTFA 3RIFK 1NLBH 2H1PH 1MJJB 2DN7A 5IBTL 3L3OA 2LU4A 3DX7A 2XZQH 3SE9H 4WI6A 5GGQL 2PYED 3TP4A 3MQIA 3FQUA 3DVNB 4YX2H 5DI8B 4H0GA 1OSPL 3U48A 3GSQB 4XP6L 3SDDB 2CMRL 3R4DA 1VHPA 2DQIL 2E6PA 1MCPL 4UAOB 3NCBB 1CR9H 1DR9A 3UTSB 1FZOA 1FYTE 1TITA 1HYSC 1KOAA 1QRNE 2ICWI 4HS3A 1MFEH 1XGUB 3QG6B 4CVXA 5DJDA 5B38A 2LTQC 3RUGB 3KYKH 3N1MC 3RVXC 3FRPG 4XCCH 1T80A 1JWMB 2OSLA 3FO1B 3MRMA 3CXDL 3OKNA 4RA0C 5FHAL 5KN5B 4J2XA 3DMMD 1G9MC 4M7ZB 4E41B 5JIHA 3GM8A 5LCVL 1T1WB 3LDBC 3M45A 4QRRE 3I6KA 2CXKA 2EXYC 3O8XD 4GJTB 5FYJD 2XN9B 4QTHA 3NN8B 1FFRA 1B4JH 1IQDB 3U7YH 5KS9B 4TUJB 1MWAL 2I9LB 4MCYB 3U9PH 5FDWA 4JRXD 3G04B 3SJVB 3IXTA 1VPOL 4O51A 1J05A 1E6OL 1G6RA 4KWUA 1QSEE 5FXCH 3EZJB 3GKWL 1ZVHA 4FTVB 5FUOH 4OFYD 1QLFA 3P4OA 3WS3B 3ARDB 3NA9H 3TA3C 1HQ4B 3V5HA 5IROA 1NMAH 3SDXE 1AD0B 3V5DA 4TNWK 1J0YA 1S7VA 2EIZA 5JNYA 2ZCKL 4ONGH 2R1YB 4PJEE 1BIIB 3GMLA 3HB3C 1I1AD 1YEGL 1AKJB 5AWNH 3MZGB 3C9NB 1V8HA 3VFTB 1JYWA 5IW1A 3HE7A 5FV1L 4LCCC 4HFUH 5EUKA 2NXZD 3TLRA 4UILL 3CVHB 4PY8I 4X6CA 3BISA 5IKCB 4NO0A 4XMKH 3WEXB 5D8JH 3L7FA 1UWGL 5C3LD 1RUKH 5DZNA 5GRWA 4P9ML 2JKXA 4YXHH 3ELAT 1XEDA 4L8BA 1J88A 2RR3A 4KKLC 1JI2A 1YN6A 2AGJH 5ECJE 1NUNB 4HS6A 1Q9OB 5IQ7H 4YHYB 3C6LB 1F00I 1MJ7L 4GW5A 1BFOA 3RDTB 3MA7A 3PDOA 4LASH 43C9A 5CJQH 3ARGD 4WHTB 2VJXA 1C5CL 1JNLH 2IQAB 2QKIB 1U8LB 2J8HA 5EOCL 2XKNA 3BD5A 3CFJB 4RCAA 2Z92B 4LVHB 4NQEE 3DBXB 4Y4HB 3GFUA 2CKBB 1P4IL 2ESVD 2GEEA 3ZKND 3VFOA 3ULVC 2EICA 1NMBL 3RPKA 1KPVB 3C09B 4RAUA 4TQEL 4Z95H 5LQBL 2YPVH 4Q9RH 4ZTPL 5CD5D 2VZOA 4M6ML 3REVB 1RJCA 6FABL 1KB5L 5DD3L 5HHXH 2GITA 4WUUB 2BMKB 4ZPVB 4IM8A 4JFYA 4OFYA 3VWJC 1ZA3A 3PL6C 3BIAX 3FZUD 5KVEL 2FO4B 1GZQB 4PRPB 4RZCA 2FIRT 4UT6L 1XR8A 2ADIA 5I30H 5A3IC 3QIBB 3U79A 5ICXB 1U95A 4RGOH 1S7VB 1T1ZA 3F7PC 3UDWA 4MDIA 4J3XA 3N9GH 1PJ9A 5C9JA 1A3RL 2APVA 2GAZB 5EOTA 1GZPA 5C0DB 5HHNB 3P0GB 1F97A 2W60A 2WINB 4J3OC 4LMQE 4UTBL 5KVMC 43CAB 5I1GH 4J1UB 3FONB 4FFVD 1HNGA 1VADA 1INEH 5F1NB 3TM6A 5B22A 2EDLA 2VH5H 3CDGB 4AM0A 4DKEH 5JO5B 2CLZA 3SO3C 4GSDL 4HPOH 2APXA 4MDJA 4MQXC 4GG8B 4KMLB 3GJFA 5INDA 1BM3H 5IUSA 2ID5A 3VFMA 1RZJL 1LP9F 1WBXA 3D0VB 5L9DH 4BQBA 4ZO7A 4KRMB 3MOQA 4YPGB 1QFWM 2I26N 5C2BH 2VLRD 1VENA 4BJLA 3L95A 2AJVH 32C2A 1OF2A 3CFBA 3IFLL 4JZNA 3BH9A 3IKCA 3T4AB 4XPHL 4F57H 4H25A 5KANI 3C5SA 3P9MA 4XP5H 3MBEB 3VFOB 2HTKD 4QCIA 3NPSB 5IHZA 4G9FD 3CVHH 4RAUB 3HC3L 3W9DA 4WIQA 4RRPA 1P7KB 2WWKO 3NIDE 3BO8A 3JV4B 3K2MC 5B4MC 2AEWA 4MZ3A 8FABB 1MCLA 3MV7D 5DQ9A 1NEZA 4Z7VE 4XC3H 4M7KH 3G5VA 4F9LC 3LAFA 4HD9A 1DBAH 4HIJB 1GH7A 4KI5C 1JZ3A 3ORJA 3VFRB 3STZA 1MFBH 3ABZA 2X4UA 3GKZA 1LILA 4LLYB 3VJ6B 2BK8A 4OM0H 2MCPH 4G8FA 1W8NA 5INCB 2DTSA 5E2UH 5C0BE 3CH1B 2W60B 2AJZB 4QHLB 1JI1A 3QIUD 2CKBH 4K23H 4Q6IB 2P47B 1MIEL 1W0WA 3O2VH 4I3RL 1TZIB 2MJWA 5FA4B 1S9VB 5FUZL 1B0GA 4P2RE 1I8KB 4LHUG 3QFDB 4G9DB 2VXUH 1LE5B 1T22A 5IVNA 4JN1H 5IGXH 4G5ZH 4LARL 4MDJB 4HWBH 4LCYA 3QUXB 4TPRH 5F70A 3L1OL 3VFMB 4N5UA 4OGZA 5TFSH 4XCYB 5D70L 4WU5B 1UZ6F 1YEFH 1N26A 2VXSL 4UNTA 3DVGA 3BPLB 1Y6MR 3NFPB 3CNKA 1ZHLB 2FYYA 1X5KA 5FO9A 1EZVY 2GTZB 3GGWB 2OR9L 3MV8D 1UXSA 1N6QL 2A6DB 1D7FA 5GZOD 3Q3GB 3H9HA 4YDJB 3IKCB 3NCMA 4FZ8H 1WIOA 1MRDH 2A6KA 3C5SB 3GBLA 3VXMA 1ADQL 3HMXH 1N4XL 5SX4I 4XRCB 3DUSB 4KZEH 4B50A 5BVPL 1VERA 4R3SA 3SDCC 2ZOKB 4CDHA 4J6RL 1YEJL 2NXYD 3CMOL 4F7EB 1GGCH 3LQZB 2B7DT 5DZLA 5D2LF 1AXTH 1MJ8L 5C08A 1K8DB 5D6DA 3QDMD 1QP1A 4ZUVB 3LZFH 1X44A 2NY1C 4Z8FH 5TQ0H 2HRLA 5ERWA 1KTKE 5D1QC 3V6OE 3L3KA 3DI2B 2P1YA 4DOHB 3DURA 4I48B 4EIZC 1IILE 5IM7A 3MO1A 4UIMA 4HCRA 2GHWB 1U58A 4X5LA 5BW7C 3H6JA 3QWRA 4LQFL 3UC0L 2FX9H 3SKOB 5HDBE 3TT1H 3ZSTA 4Z7UF 3BZ4B 3OL2A 3RA7L 3RGHA 2X6MA 2B1HL 1RHHA 15C8H 1LK2A 2J7LA 5I1EL 1T22B 3MCLH 3CLFL 3D39B 1J1PH 3PWNA 4X83A 4JFPA 5JOPE 4QXTB 2YXMA 1OARL 3LKRB 3NA4A 4MAYD 1BQHG 1UC6A 1NCAH 1QYGL 3BQUB 5HVHB 2ZWLT 4G6KH 1BGXL 4PRID 1JHKL 1F42A 1OL0A 2E8YA 1NANI 2CJUH 2W9EH 2W07A 3DVGB 3QI9B 4P46D 3HNSH 3WUZA 1QO3B 5D7JB 4WO4A 1NUFA 5EIVA 3ZE2E 1FV1A 1GSMA 4ZNEA 1EK3A 3FKUS 1YMME 3L5XH 4YXKL 2YPLE 4K3EL 1NFIB 2AQ1A 5HDOA 3OKEA 3HC0A 3BAEH 5JORB 3IJHA 3PGCA 5ACZA 4L1DA 4EKXA 2HJLB 5FYJE 1FVCB 5F3HB 3RWDA 4Y8AA 1GOGA 5EBLA 2BSRB 3PIQA 3PNWA 4PJHA 2VAJA 1AE6L 5C08B 3S5LB 3MJ9L 4XAKE 1RI8A 4P2QD 3RY5A 2H2PD 3KGRA 3KG5A 5CEZD 1G7MB 2VQUA 1QFHA 4NQCA 4X9HA 5F7HA 4UT9L 3SGEH 4NP4H 1T3FB 2P5EA 5E8NA 2VL4A 2XWBA 4X7CC 4P4KC 5ID0A 4XNYL 5BXFB 2VDOL 2QSVA 4C56E 5I2IA 2YK1L 4KUZH 3JWOL 1SVZA 4JKMA 5KTEH 4UT7L 1YEHH 4F2MB 4TVPH 1FZKB 1Q94A 4NSKB 3AU1A 1D9KA 3MRNA 5C0AD 1I1FA 4ELMA 1IEHA 5J13C 2AEQH 4X99A 1P84J 3T2OA 4U0RB 2M26A 4JDTH 3WIHL 1FZMB 2X89D 4ZUSA 1AXSB 3C6SB 3B9VA 1WIPA 4Z7NE 4WI3A 4LLAA 2AEPL 1XZ0B 3QQ3B 1J1OL 4L9LA 4FS0A 2NW3A 4WFHD 1JHTA 1SEBB 5HI5C 3UP1A 3WHE1 3T1FA 4NM8H 1U2CA 1KCVL 3LN5B 3CXHJ 1R5WB 1YEKL 1Z0MA 1Q38A 5A43C 1F4XH 2OL3A 3UJTL 1TQBC 3EOAA 4QYOB 2P48B 2A77L 3GBNH 2AERT 2DQCH 4KJYA 2H8PA 2EXWD 3IU4L 4IRJB 3CIQA 3BN9D 4UBDD 1LO5A 2Q3ZA 5I8OL 1ZGLP 2HJKB 4L4JA 3EO0A 5I16B 4JR9H 3ISWA 5IW6A 3OKEB 1JF1B 4TUOB 3VXQA 3PGCB 2P7TA 4RIRA 3SDXF 1T1YB 5BRZE 1HH9A 2VAAB 3IDJA 2CO7B 4MD4B 4N0FB 2H6PB 5C0GA 1VGEL 2BRRL 4OCSH 3G08A 4PJEF 4TSCH 4J4PC 3VRLF 1L7TH 1UM5H 3QCUL 5HDQH 3TNMA 4OLZH 3CC5B 1S9WB 2EYSA 1VGKA 2XXCB 4PD4J 4P57A 5E8NB 4KDVA 1OTUD 1L6ZA 4UNUA 1NCDH 4AJ0A 5LGJA 1KPRA 4U1HA