5L0QB

Crystal structure of the complex between adam10 d+c domain and a conformation specific mab 8c7.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
DIFLTQSPANMSVSPGERVSFSCRASQNIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFILSINTVESEDIAVYFCQQSNRWPFTFGSGTKLEVIRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An activated form of ADAM10 is tumor selective and regulates cancer stem-like cells and tumor growth.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/immune system
molecule keywords Disintegrin and metalloproteinase domain-containing protein
total genus 52
structure length 212
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l0qB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l0qB01
5C0AD 4WFFE 4LQFL 3CK0L 4OZ4A 3X14A 1BREA 4ZNEA 1K3ZA 1KIRA 1ZHLA 2P8PA 3MA9L 4YHNB 1YUHB 2QHLA 1OAUL 4GOSA 4FQPA 1I9RH 5EH1A 2ATPB 3MBXL 3QJHB 5CZKA 2VDOH 1A4JA 1OGAA 1T2JA 1YNTA 1KB5L 1Y18A 1MHHA 3DHMA 4PRIA 3VI3F 1JNJA 4GBXC 4WI7A 3JSSA 5BJTB 3QFJE 1YNKH 4YIQA 1OAXH 4YWGH 2VKXA 1CF8H 2ZUSA 3PWJB 4Y5XA 2FX9L 3JWDL 5H8DA 3EIFA 3QIUB 2F54B 3RHWF 3F5WB 4P4RA 4XVUD 4GW5B 1EO7A 1C8PA 3MJGX 3G08A 4XBPB 3VFSB 4NQUA 3PGCB 5I1CL 3RJQB 1YMME 3KGRA 3KWWA 4Y89A 3HZMB 4RDQF 2JJSA 3RBGA 3GO1H 1OTUD 4X6DA 1JGLL 1OWWA 3FB5B 4JG1L 1QFPA 3BSZH 4L4TA 1A14H 3FAWA 5J3HD 2UYLB 1X5AA 2A0LC 2YPVH 3FQTB 5BRZA 1OAKH 2DTMH 1DLHA 3FZUD 3MRQA 4CNIB 2EDJA 1WAAA 1FNFA 3Q1SL 1DSFH 1BIHA 1RIUL 2ZCLL 4M3KB 4ZSOA 2D9QB 3GHEH 1CL7I 2ITCA 4LKCB 1FGVL 1RI8A 2P48B 2BVQA 1HNGA 1NANI 5HY9A 2AKRA 2UZIL 3QFJB 1NCAL 1MF2L 1CGYA 1QUNA 1S9WB 4NO5B 5JOPD 2AAVA 3GMRA 5T1KA 4NUGH 4K8RH 1QD0A 4MJ5B 2NR6D 5JW5A 1P9MA 5D1ZC 3ARGC 2ADGB 2WQ8A 3HA0A 1LEGB 3DVFA 3QHFL 5GZND 3OAYK 1F90L 3NH7H 3QHZH 5I1AA 3D18A 4R26L 3T3PF 5IW6B 4P5TA 4BH8B 5MEOB 3O11A 4ZG1A 4S1RL 3MXVL 3KAAA 2HN7B 2J88H 5EORH 3VWJB 4RWHA 3CX5J 5DRXA 3K1KC 3FFCB 3V4UH 1BJ8A 4LQFH 5F7LB 3RUGB 2R0WH 4QOKD 5IB1A 2Z35A 4BZ2L 2O5ZH 3CCHB 1T22A 5C0BA 4K7PH 4CN6A 5MERB 1YYLL 3SKNB 2IANE 4YO0B 2Y6SD 3QH3A 4J3TA 5KVEH 1UCBL 4BELD 4LF3A 1GHFL 2YUWA 4HWBL 4P3DB 1QR1A 3ULUF 5HJ3B 3UJTH 2C26A 3E2HB 5C8JB 2XXCB 3Q6FA 1XGQB 1CFNA 3HR5B 4M1DL 2O61A 4U3CA 1F5WA 3LY6A 5IK3A 2JB5H 1I1YA 1P9MC 5D1ZA 1IEAA 4ZPVA 1KPRB 2BVQB 4EVNA 3VXSA 1IC4H 3MJ8A 1GGCL 5D7LD 4GW4A 4E41A 3QUXD 5J6GA 4OM1L 5IHLB 5J0BA 1IFHL 1L7IH 1ZHKA 1S78C 1A6VL 3CC5B 4P4KD 3TVMC 5IMOB 1RMFH 2NLJA 4S1DD 3JVGC 1K5NB 2RAMA 3D39B 3K2MC 2NCMA 1F6FB 2NR6C 3IDNA 1H5BC 1LP9F 5GRVL 3AXLB 3RVVC 4JLRB 4MA1B 2J5LC 4NQVB 4N8PA 4O51B 2DN7A 2Z92A 3VFTA 1PVHA 3EDFA 1MEXL 1NAML 3EBAA 1D6EA 3U83A 3MQIA 5DJ6B 3I85A 4PJ8C 2WW8A 4CU8A 2LV4A 3QAZC 3BKML 5TPWL 2BK8A 2B39A 1N6UA 4JFXB 4JQIH 1FV1B 4H8WL 3Q5OA 5A3ID 5EN2A 2O5YL 3VI4E 2OTPA 4GKSA 4DUXA 2FBOJ 4KVCL 3S34H 2DKUA 3HI1B 5DURB 5IVZA 4NO3B 5E4IA 3HR6A 3PF2A 1PEZA 2H32A 4WNQB 3TO2A 2NXYD 3S35X 4PY8I 2D31A 1KNOA 4YR6B 1HXYA 2XI9A 4LMQE 1GGBH 3WS6C 5I73B 3IU3A 4JPVH 1YA5A 1PAMA 4TTDC 2VDKL 1EAPB 4PLJD 1MIEH 4TSBL 4YDIL 3MRIA 3SDCD 1Q9OB 5MERA 1F4AA 4P9MH 4F37K 3HC0B 4MJIE 4L3CA 2XTJB 4XCNB 3VW3H 2EEBA 4MXQC 3C5SB 3NABH 5EC1A 1WCQA 1FNGA 2B1HL 1U41A 5C8JA 4LSVH 3BUYA 3TP4A 4Z77A 1U8JB 2LTQB 1BD2A 5E5MB 3QUZB 4KGLA 5E6IA 3NZ8B 5T1LA 1IC4L 1RHFA 1HEZB 3JUYA 3OSKA 3NAAH 3V7MA 3MNZA 2VH5L 2ZSWA 1CK0L 4F9LA 5HTSA 4X9BA 5I19L 2AJZB 2UWEE 4XP9H 1W72H 4OGAC 3E6HA 3OGCB 1RK1A 2OQJA 2DOCA 5BZWB 5GQBA 1UXWA 3LKRB 3VRIB 3C87A 4S2SA 5JO5B 3C9NB 1BFVH 4DZBB 1GGCH 4JANA 3GIVA 2KZ1B 1DQJA 3BPLB 4Z76A 3D69B 2KQMA 4UDUB 4D0DA 5IWLA 1TQBC 4QXUL 1G9EA 3RWIA 2CGRH 3LPFA 3K8KA 4ESKA 3FO9A 4XP1L 3HNVL 3UYRL 4X6FA 4N0UE 5B8CA 3UTPD 4I4WA 4H25B 2X1OA 3DV6A 3QEUB 1QYGL 3K46A 4ONHA 3RKDD 3PWPE 3L3DB 1OP5K 2DMBA 3F8UB 2DS4A 1H8NA 4RCAA 2A6DB 3UPCA 3TNNB 2C3HA 5SWZE 1AO7D 5HYJE 3VXRB 4NQDE 1ZLWH 4KTDL 4ODXB 4NHCH 4OCRH 4OQTH 4JRWA 4YEFA 5DJ2A 1OF2B 1A0QH 1AD0A 4Z7WF 3ALPA 5HDBE 1KPUB 4JFEB 3WFDL 2O5YH 4QRUB 4NCC1 3DI3B 5L2KD 4E9LA 1S9XB 5KSBA 5I1KH 4NC2B 1DBKH 5FCUH 1F4HA 5IWLC 2DIBA 4OUUA 3QXWA 1UWEL 4MWFB 5ESVB 3WN5C 3WLWD 5EU3A 5EG6C 3DVNB 5IB5B 2CLZA 5DRNB 4RGNC 1FVEB 1VERA 4PG2C 4XXDB 3D87B 1G7MB 1NFIA 3LKOA 2CDFA 3IB4A 4LAQH 4W81A 2V7NB 2VN7A 3DRQB 2HFTA 5FYLD 4LBEA 1MCPH 2OZ4A 3S96B 3BP7A 4PP2A 3LD8B 2AXFB 2BVUA 4MJIA 3D39D 1DUZA 3LKPA 4LLAA 5CBAA 1NMBL 5IEKB 5J3HC 3OXSB 3QZWB 1I9JL 3KPPA 2PYFA 3UBXB 3RWCB 3PWVB 3TFKC 1IAKB 3DRTA 4JZJC 5E00B 4ZSOE 2J7LA 1FN4B 4JHWH 1CL7H 2VJXA 2FX7H 4EI5A 4J4PD 4M9PA 4WO4B 5IROC 1MCEA 4G7YL 5KBNC 3PQYA 4J1UA 4JFEE 3STBA 5C86A 1NCUA 3O6LH 5GJSH 4LARL 3MCLL 2VLRA 1LWRA 3BH9A 3P0YL 1CGTA 3QNYB 1X6NA 3B6SB 4KHTL 4EN3A 3C60B 2GJJA 2HFEA 1LD9A 3H9HB 4NKIH 1EEZB 3MR9B 4N0UA 4XX1G 3T2QA 3THMH 4BA8A 3P9MA 5DVMA 1C08A 5F9JA 2CLZB 5EU6A 3SKMB 4L4VB 3QRGH 2J8OA 1CG9B 3BN3B 3LKSB 4AENA 4LCCC 2J6EH 5CINL 2BC4B 4CJ0A 5B38A 2P43B 2GT9A 1X5HA 3R0MA 5B39G 3JTSA 3OAUL 4XTRD 4HBCL 2HKFL 1PZUB 2MHAA 4RBPH 1H3PH 1U8PB 4P5MA 5IVOA 4FQHA 4POZD 2R4RL 3P4OA 4X0KB 3VFRB 1PYWA 2MMXA 4B50A 2RIKA 3I9GL 2ZOKA 1IBGL 2W9DL 4NHCL 4OCRL 2AS5M 4M8VA 5EOQL 3BP6B 3SY0A 4K3DL 3G6JA 1WC7A 4Y4FD 3E6HB 3OGCA 1QFOA 3G5XA 1PZ5A 1OP3K 4NM4L 5IMLB 1ZT4A 5I1EL 2CLVA 1ZVSB 2E6QA 3GZKA 4WWKA 4AL8L 3TF7C 4XC3H 4AG4L 3OR7A 1KTLB 2V5SA 5DQJA 1IQWH 4KRLB 1AD9A 2Q8AL 1BLNB 4ZS7L 3SKMA 3AMKA 5FYKD 5E03A 3QDMA 4KJQD 4IRZH 4D3CL 4Z7QF 5CJ5A 5I8OL 2VIRA 1IC5L 5BOZG 2ITDA 4I48B 4FQQA 1BBDH 1BVKA 3BZ4A 3ESVF 4LCWB 4RIRB 4NZTH 3VXQA 4KI1A 3P30L 1IEBB 4TVPL 3KR3L 5C9KA 5MEND 3HNTL 4W4NA 2VZSA 4PP2B 5T3ZE 5I74C 3UO1L 1HQRA 5I1HH 4OM1H 3L3GB 4WIQA 2Z9TA 3MA7A 2HVKB 3QUXA 1CLYL 1G9ML 4NO0A 2NX5E 1PLGH 1NEZG 4O4YH 4M7JL 4IS6A 2LVEA 1PQZA 3SDAA 5HDLA 3RWGA 4WI3A 3FT2A 4KRPD 3LMJH 1AIFA 4N0YH 1T1ZA 2X41A 4LVOC 1P7KB 1PLGL 4O4YL 3VXMB 3WE6B 3MRKA 3HG1B 3NPZB 1A6TB 5DFTA 3O2DH 4NKDA 5IB4B 2B5IC 2FO1A 5KS9B 4PRPE 2FIRT 3FT4B 2FGZA 3UX9B 1N26A 5DC9B 2DQTH 3U1SL 3VXRD 4OZGA 1JV5B 5C0DB 3BOVA 5BZDA 3DGGA 4JRYE 2F8XC 3G6JF 4JDVA 3CU7A 4MMZC 4U1SB 3KPOB 4BUHA 4OFYA 4M4RA 3DYMA 3NA9L 5IBUG 1I1RA 3QUMH 3V5DA 1U95A 4KVCH 1FVDB 1KLGB 4UAOB 5IW1B 4KAQH 3QDJA 1YPZE 2A6JA 3CAFA 1EERB 4OGYH 1YMMA 1YC8A 4ZXBC 1Q1JH 3FB8B 3ZKXC 1RZ8A 3DMMA 1ZS8B 3ARZA 1U8OB 4JFDD 1T0NA 3UBXG 2CDFB 4OF8A 2ADGA 5FOJA 4FA8A 4Y4FC 2A6KA 3TC9A 4RFNC 4ODVL 2KDGA 4XT1C 5DT1H 3U30C 2HN7A 4NM8H 1N4XL 1EO8H 1GC1L 5GJTH 5CFHA 1HHHB 3PP4L 4XP5H 1ZA3B 3N0PB 1HXMB 3GHEL 1DEDA 1GRWA 5GSVA 4LVHB 4IIQB 1HI6B 1LEGA 3TYGH 3O6KH 1WT5A 1QSFE 3BPNB 4M5YL 1D9KA 1QBML 1SMOA 2IH3A 2X9XA 4G8FB 2NY4D 2R1YA 3OKKB 2LQRA 5J7CC 1G0DA 4HZAA 3PXHA 4OZFG 2FBJL 5SV3A 1A9BA 4Z95L 2V17H 4WI6A 1ZHNA 1MCFA 1UG9A 1CFNB 4FP8H 3WNKA 3DX6B 4YPGB 3VGDA 1TJGH 3JV6A 4CMMB 2JB5L 4WHYH 3OR6A 5KSAA 5FDWB 3MRIB 5C0CD 4Z8FL 2EEAA 2F53B 5HGDA 2XG5A 2X4SB 4UQ3B 3KPRB 3LQMA 1T80A 3U4EA 1CLYH 4WWKC 1JGVH 1F13A 2NY6C 4ZOEA 1Z0MA 4PRPD 1WUNT 3SPVB 4N5ED 4GG6E 4UB0L 3SCMB 5C6WH 1GYAA 2UUDH 1YZZA 4PLJC 1QPXA 4Z6AT 4NWTH 4U1LA 4PREB 2WLYA 1IEHA 3V4PH 4GRMA 5DUBB 5E6ID 1JTOA 4PGDA 5FV2A 1WWWX 2YXFA 4M6OH 3V5KA 4ETQB 3DXAA 4LSRL 4WDIB 5BW7A 4ZFOB 1RIUH 3X11A 1P7KA 1U8NB 2C1PA 3PV6B 3VFUA 1O7VA 2J8UA 2C1OA 1MFCH 2DDQL 5IFHH 1MJ7H 1FGNH 4GKSB 1E4JA 2HMID 5K93A 4RGMB 3GSNB 3NACL 5FYJD 2ZSWB 2VNCA 3GJFB 3T3ME 1KYOJ 4D0CA 3P0VH 2COQA 4U6YA 3U0PB 1IGTB 2WIMA 3I6GB 2V9TA 3QEHB 5E4EB 4LLWB 5TDOB 3H3BC 4CVXB 3QFDB 1KUMA 4NGHH 1WTLA 4HWEH 4Y5XB 1CGSH 1FFNA 2N7BA 4JGMA 5EA0L 3VRJB 1P4IH 2CIKB 3FOLA 1INEL 5JUEL 3I6LE 3HC0A 2BFVL 1AXSA 4HWNA 1S8DA 5HGHB 1RUQH 4U6VL 3SJVB 1FFQA 5E2TH 1I1AC 3D39A 5LG1A 2VXUH 1RD6A 4RNRB 2CSPA 2EDHA 1S7WB 4CDGC 3O6MH 3K74B 4HQQL 4OFYD 5D8JL 1NC2A 1P1ZB 3IJYB 4ETQA 2PKDA 5EDXA 1DN0A 1UCTA 3BYYA 1T83A 4LASL 3AMLA 2VZTA 4EKXA 4PR5B 3OQ3B 2PNDA 4KRPB 4NJ9H 3R06A 3QDGA 4J4PA 5DD6A 4LCIH 3MXWH 1G1CA 5I73C 5DD5L 1BOGA 1Q0YH 4NT6A 1G1YA 4LKXA 3T0ED 1MWAL 4OF6A 5SWQA 5EO0B 1QRND 4S1QH 3ZTNH 2Q86B 1KTRL 2OL3A 4R0LB 5EUKB 4FQXD 4AK1A 5GJSL 4J7RA 2WBWB 3E8UL 1AGFA 5CJQH 3HI6L 5DO2D 2OSLB 1H0DA 1HHJB 4X4XA 1TETH 3U4AA 4LFHG 4P2RA 4YUEL 1H3UA 2X05A 1OAUH 2NY3C 1RU9H 4RMWA 2B1AL 2DQHH 3MSPA 3MUZ1 4X8JB 4L3EB 3U7YL 3QAZB 4NHUA 4N0CD 3PL6A 4QCIA 3FRUA 4LEXH 1I1AB 2E3VA 1JPST 5DZLA 4C57C 4EI5D 1E27A 2J4WL 1EA9C 4ODUA 4V1DE 1X5YA 4PJAA 5HDOA 3CFEB 4M6AA 1FNSH 1R5VB 3QZWA 4HJ0C 2IQ9H 1MRCL 5BOPA 1MJUH 2BY0A 3GKZA 3VMNA 3L5WB 1T22B 4RMUA 1R3KB 3O3BB 5DSCB 3MUGB 3DX6A 1UB6B 5J1TC 4QXUH 5J8OA 1TZHB 3C8HA 4PY8J 2JTDA 4X6EB 1S9YA 2JELH 4JM2A 5ILTL 9CGTA 1VKXA 5I1KL 4CDHA 1UT9A 2UVEA 3AY4A 1NFIB 4JEGB 1FVEA 1LO2L 4XXDA 3KHQA 4B5EA 1S3KH 3NMEA 1FIGH 3ARFD 3KPMB 5MP6H 3OKYA 4QOKE 2X4NA 2IALB 4K94H 4MA7H 1FG9C 1BZ7A 3MV7B 5SX4H 3RI5K 4AEIH 6CGTA 4H20H 3RGVB 4MNQA 1KC5H 5I17A 1YPZB 1LK3L 1FDLL 5CCKH 3DX8B 1U9KA 1IAKA 5L8JB 1EHXA 5D72H 3ME0A 3PDOB 1G6RB 4ZTOL 1BQHG 2LAAA 2DQCH 2GI7A 1FVCB 4O5LH 4UOJA 1N7MH 1QO3B 2VUYA 4MAYA 3VD4A 3MODH 1J05A 5AUMA 4MJ4A 3DV4A 2DWEA 2Y06H 2F54A 4CNIA 3ORJA 1QLEH 4YBLC 3BZFB 5DD5H 2DI7A 5GS0D 4OFKA 4QHMA 2E9WA 4MQ7B 2HFGL 5TGBB 1CGXA 1BJ1H 4K7FA 4F9LC 3BEWB 2VSCA 5L6YH 3Q2CA 2QQKH 4YFDB 2NY0C 3S6CA 4PLNC 2ERJC 5JQ6H 1SJVA 4M6NL 3WSQH 2CUIA 3ABZA 4P49A 2XZAL 3OR7B 4N0FA 3RL1A 4MXWL 3KPMA 3O8XB 3TBWA 3U7AA 3ULSB 1A7QL 3CFKB 2ZUVA 4LQ1A 4LBEB 1B0GB 3GSQA 1L9MA 1URLA 4DGYH 5I2IB 1XF3A 2D7NA 5T1LD 4MAYC 3QDMB 1RZJH 4NNXB 3FO0L 1R0AH 4X6DF 1A4KB 1CLZL 1U58A 2IF7A 4HD9A 2XWBA 1M7IB 3MLRL 5EZJA 4YDKH 3QI9D 5F1OB 5GRZA 1UB6A 4KQ3H 3P40A 2WINA 1XH3B 1FGNL 5FYJU 1TQCB 1YY9C 3NTCH 2VDNH 4PYHA 1VGKB 4Y1AB 1FYHB 2H6PA 3VXOB 4N0YL 2AK4B 4YHKH 4XPAL 1PZ5B 3NPSB 4RAVB 4KKBC 1G7PA 4M43H 3V0WH 5KVFH 2H3NA 3GBML 1F45A 2VQTA 3R8QA 5MEQA 5JW3H 3RAJL 5HVHC 2BRRH 2W1NA 5C0BD 3FQUA 1Z5LA 1MI5E 3MROB 4FFWC 1DEEB 2XZCH 1I3RB 1IKFL 4ZOCA 2XKNB 3U9UA 3WL9B 3X12B 4QHKJ 1QLFB 1MFBH 1DSFL 4Z7OF 1VFMA 3HC3L 4X99B 3TCXA 1R5IB 2JCCB 1MCOH 2D03L 1OAZH 2IAMA 2BVYA 4ZO9A 5T1DL 1DVFA 3LKSA 4LSSH 1RVFL 3P73A 2I24N 3EGSB 1BM3H 3WUWG 1B4JH 3VXSD 3FQRA 3KPQA 4K3EH 5HDQH 3T65B 1J0YA 5TE6H 3PNWA 2M26A 4XNXH 1G9NL 3TBYB 4K07A 5HHPB 4QRPB 5IM7B 2RCSL 5LXGH 1M1SA 1OT1A 1CXFA 1T7YA 5D2NB 3RI5F 1I7RA 3RZCD 3GBLA 5I16A 3NFNB 4XNMB 3UMTA 4L8SC 5FGCB 1LNUB 5HI3C 3NFSL 3LZFL 2CKNA 2JKXA 3OB0H 5AYUL 1CICD 4LVNB 5EU6E 2H9GB 4M1CC 4CBPA 4KJQC 2NY6D 1NMBH 4N9GB 5J1SC 4M7LL 5AYUH 1TZGL 5DWUL 4B7IA 3MBEA 2VDOL 5I9QC 1RZIA 2XTJD 3CMGA 4U1GC 5DK2B 5EBMB 1ONQA 3BUTA 4EDXA 5D7LA 1ORQB 4ZPVB 4MXVF 1X5IA 3SDCB 4OTXL 2ZCHH 4FZEH 5FHBH 3QHTC 1FZOA 3BX7C 2VWEC 4Y16D 1UWGL 5F72S 3EYFA 3VE0A 1GGUA 2AJXH 4N1CA 2CPCA 3CU1A 2LVCA 1DQML 3EYSL 4XXCA 5ELIA 4U1NB 3GMPA 2YPLE 4J12A 3OXSA 4A6YA 3KXFA 5DEZA 1X5XA 1KIPA 1KXTB 2A9MH 1NL0L 2DB8A 4KDWA 3VFVA 3GK8L 1CDCA 1N59B 4M7LT 1A7BA 1C12B 1N3NA 4MNGE 2XKNA 3O2VH 4ZFFA 5HHQB 1WIUA 3GFUA 4DUVA 3RIFF 1KG0B 1IT9L 3ARED 4KJPC 4C83B 2E7LC 4ODXA 3AFLA 1RIVH 1KEML 4H8WH 4U1LB 1KJVB 1RZFL 4MA7L 2YMXL 3S3SA 4AEEA 3IAQA 3LKNA 1A7PH 4Q74A 3IDXH 3K2UH 2OR9H 2YD7A 1T5WA 5BMFH 2BVPA 1M05B 1G7IA 3KS0J 2R1WA 3UTZA 1J7VR 2ADJB 3SE3C 5IQ9B 1WT5C 3HI5L 3V7AG 3WDJA 4YXHH 1ETZB 3N1GC 4JFYB 3TBTA 1A9EB 2OL3L 5HHXL 5KVGL 4PRAA 3QXVA 4X6FB 3WNOA 2CUHA 1V3KA 3REWB 1E4KC 4OKDA 1CFBA 1EGJA 1NGYB 5HDBF 5DJ8B 3QDJB 1KJ3H 3V6BR 5F7EL 5ESAB 5JW4M 3BRFA 3L3IA 2NNAA 4JO1L 1PY4A 5KVMC 3P9LA 3C5JA 5GPRA 5IVNA 3W0WA 1MLBB 3ARBC 3L5HA 1Y6KR 2BY2A 2R2EA 4I3RH 1MHPL 3LEYH 5L9DH 4PJIB 3WO4B 3SGKC 1TDQA 3FCTB 1ULVA 1Z2KA 3OWEA 3QDMD 1WIPA 4MA1C 1U3HC 4AIZB 2H2SD 4ONGL 3U7YH 2VXTH 1MIML 2AV7A 2BJML 1NGQL 2CDEA 4RAUB 2P7TA 5C0IB 1FC2D 5C6TH 1LMKA 1UJTA 4APQC 1G7JB 3X3FH 5JIHA 4HH8A 4ODSL 4LSQH 4LHUA 2VABB 2L4OA 3HZKB 5IV2B 1UEYA 3OF6D 5DHVA 3HTLX 5D6CB 2BSSA 2RBLA 2VQ1B 2LFGA 2XNAB 4Q9BA 3FJTA 1IRAY 4XH2A 3STLB 4KMTH 5I1GH 3KXFB 2AI0L 1MHEA 1EVTC 5FYKU 4JM2D 5EC2A 5FOBB 4BYHA 2HG5B 5T1KB 1DLHB 1U8MA 3SBWA 4NHUB 4WU5B 4KDVA 1KOAA 3KLSA 4GLRI 5F88A 3TT1L 5BJTA 1W0VB 1MAML 4Y5YC 3FOLB 4JM2F 1TENA 5DRWB 1DDHA 4ISVB 2MPAH 3HE6B 5EFIB 3RWFA 2UZXB 5IUSA 1I8IB 1JWMA 1U8LB 1RIVL 1FNSL 3FQWB 3C60D 1QFWM 2RFXB 4KKAC 2ESVD 4JRXB 4WW2B 3V6OC 1LP9A 2VAAA 4G3YH 2DM3A 5B4MC 3G6JB 5TE4H 4XXCC 1G9NH 2NY5H 4RGNE 3AXLA 2BRQA 3GSXA 4QT5A 3JWNC 3SE8H 1JHKH 1EHLH 2KQNA 4WU7B 4X6DE 5I76A 1JUFA 1PFCA 3LDBC 2AJSH 5DEGA 3IDIA 5FUOH 3AS0A 2XN9A 5BV7L 3PWUB 4QLRA 2H41A 3IAGC 1I3UA 4MCYA 5BVPL 3TZVB 1T21A 4BZ2H 2YD8A 3GJFA 4YO0A 5IVXA 4FZ8H 5HD8D 5DK2A 4GW4B 4XC3L 1S7TB 3RGVD 3ZMRA 4HPOL 1FC1A 2XKUA 4LRNL 2HFFB 2W9EH 1A5FL 1MCBA 3K81A 3RNQB 3AREB 4U6TA 3Q6FB 4PP1C 5GISL 1NGWA 1X9QA 3IFOB 1XF1A 5E8DL 3ZDZE 4R90L 1BF2A 4HHAA 5CBEB 3KLHD 1H0DB 3D18B 5ADPH 1T7XA 1FFPB 1MHCB 1Q8MA 4HXBH 4A6YL 5JNYA 3C8KB 4JM4L 3V7AE 4OZIA 5D1QC 2AV1B 5C7XL 3S35H 1HZHH 5F1KC 4QF1A 3QUYC 4BQ6A 2VLRE 5C0AB 1H15B 1FE8H 3S97C 5HD8C 3NCEB 2ADJA 1JMZA 3OHXB 2DF3A 4OLXL 1G9MC 5J1AA 3Q0HA 3O4LE 2Q7YB 3WJJC 1U8KB 4UIKH 1EEYA 4R7DA 5FA4A 1G7LA 3RUGE 2EDTA 4Z5RA 4BUGA 1AP2B 1B90A 2F74A 1A7NH 3LN9A 4JFPA 4CMHC 1LE9A 1T0NB 3WIHA 2IANA 4TTGA 4GAYB 3F7QA 4JFZH 4KUCF 1A7OH 3KYNB 2V2TA 1ORSB 5T3XL 5MENB 5IHUH 1CGVA 3B9VA 4OF3A 4KTYA 4DTGL 3HCVA 3HLAA 4MAUH 2FRGP 4Z7VB 1N0XH 1XF5A 2IG2L 3M17A 4HX1B 2G2RA 4WU5A 2ICCA 1JL8A 2I26N 3P4OB 1YN6B 4HIHB 1H3VA 1B0RA 4HFWB 4NQXA 1WZ1H 2W9LA 2VZVA 1NFDB 1HWGB 1HN1A 4QRSA 2C3VB 2I9TA 1QO3A 4LHUD 2XWJA 4ZD3L 2X4TB 1OB1A 3F7PC 1PW3A 3G04B 1MJ7L 1U8IA 4BZYA 1IC1A 4UT6L 5LXGL 4X83A 1FNAA 1AJ7H 5JHLL 3O4OB 5ACMA 4R7NA 5I18L 5I17B 5EORL 1WV7T 4TPRL 1FO0L 5D9SB 4U1SA 1ED3B 2X1QA 3B5TA 3EYVB 5TDNB 2EDKA 2YC1A 5FUOL 1BQUA 4YE4H 4V1DB 2GCYA 1B9ZA 2SEBB 4JM2B 3QIWA 2CO6B 1FZJA 1BVLA 3MZTA 1DJSA 2DYPB 2OMNA 3GSRA 1SBSL 1UYWH 4ONGH 4XWOC 3V6ZB 5IP4A 3W0WE 5MENA 3GNMH 5T3XD 1EH9A 2EEDA 3BZ4B 1KB5H 4IOSD 3PWLA 4NSKB 1LO0H 2F54E 5FUCE 3C6LC 4Y4KA 1NLDH 3ARDB 4FP8L 4DGVL 4JDVB 4IHOB 5SWSA 2VQUA 4PRIB 1YNKL 5FO8B 1I3VA 2BZDA 2P49B 2EIDA 2VDRL 5SX4I 3LPWA 3QUYB 3KPRA 3U30B 2OTUA 3STZA 4XP9L 4G8IA 3OHXA 5FAAA 3CMOL 5C07D 4IDJH 4F7TA 1JFQH 1QRNA 3FN9A 5F1IA 2AXFA 2GY7B 2CO7B 4R7DB 3IFOA 5FA4B 3RU8L 2AEPL 2R0LH 1AGCA 1R3IL 2AJ3B 3FO9B 3GJEB 4CVWA 5DJYA 2X4RB 1NCWH 3MBEB 1BGXL 3CSPA 5IM7A 4NQCD 4NZUH 1RSFA 3LMJL 4ZUVA 5GS1A 3N9GH 2WWKT 1JVKA 4LP4A 4F2MB 1PKOA 1FG2B 4GXVL 1JGUH 1DANU 5DMJB 1FORL 3O6FD 1HOCA 1CT8A 1EEYB 1S7TA 1KT2B 1TJIH 3QXDB 1EIBA 2Q6WB 1HILA 2AEWA 3TBSB 2GT9B 3FZUC 4ZOAA 1Q0XH 4P46A 2EYRA 3G6AA 5D5ME 2Y5EA 3EOAB 3ES6B 2YD4A 1F4WH 1ZSDB 1S7UB 4YDVA 4DFIA 4CVZB 5IHZB 1ZE3C 2AXGB 1MJUL 2R4RH 4R4BA 3D2UA 5K59F 5E2UL 5IFAH 2G5BB 4OZHE 2R0KH 1RUMH 3ULUH 4O00A 1VFOA 2QV2A 2NTFB 4R6UA 5FGRA 5CSBA 4CU7A 4JO1H 1LE5A 1XGUB 5CEXB 4AYFA 5F8QC 5JHLH 3U9PL 1GH7A 1G0YR 1XH3A 3IFNL 4G6AC 4P2RE 3C2AH 4LLDB 3O4LB 3W0WD 5TDPB 2DIAA 2W59A 2EH8H 3KYKH 2EDYA 4EOWH 2IBZX 2MTPA 2Y7QA 4R0LA 4IRZL 4D3CH 1AD9B 2IGFH 1OL0A 5L8LB 4F33B 5KS9E 4K7PL 4XWGL 4MD0A 2PYFB 3ARDA 5FGBA 1EEZA 4JREB 4U33A 2VXSH 4RMQA 2OYPA 3G5XB 3OKLB 3VJ6A 4KKCC 1F6LL 4Z7WE 5GHWL 4OZFA 1RZGA 1VFAB 4DOHB 5C07E 4EDWL 1G7QA 3F58L 5DUMH 3VD9A 1J1XH 4I2XE 4G8IB 1AQDB 1GJIA 4R26H 1MCWW 4WUUE 4YHIA 2OL3B 4N90D 5EUKA 5F9OH 4H0GA 4N9GA 1K2DA 4RGMC 3VU2A 3KPRE 2GJZB 2BOCB 5F1NA 2EYSA 3HKFA 5LGHH 1CD8A 4NRZB 3HUJF 4Y4KB 1M7XA 1VADA 4PRHA 4S1QL 1YPZA 1CDGA 4PJEA 1J8HE 3L5XH 3L9RA 3V79C 5EOTB 1LE5B 5HPOA 1R3IH 3ROOB 3SN6N 3WLBB 3UPRB 3HE6C 3QCUL 1OWRM 1RURH 5CINH 4R2GB 4F3FA 1OTTC 3H42H 3SE9L 3P4NA 4X5WA 4Y5YB 1AXSB 4HH9B 4NQVA 1IGJA 1B2WL 3LH2H 1T3FA 1T1YB 1UZ8A 4JRXE 5JMOC 4UIMB 1HQ4B 1N6QL 4WWKB 5JR1L 1MVFA 3MLTA 4QRQA 5BW7C 4PBVC 3MUGA 3OB0K 4ZUWA 5J13C 3FN3A 1OCWL 1A9EA 3WNMA 3ARYA 2CJUH 2NX5D 4KVNH 4MNGB 4DCQA 3RWEA 4XNUH 5EULV 3BP6A 4JY4A 5F1SA 2K1MA 4GRWB 1JIBA 1H5BA 1RZJC 3QNXA 1UWEH 5DJAB 1JNLL 4OB5L 4UDUA 5FCUL 2ZKHH 3OZ9L 3NZHL 4QCIB 2YD2A 4XCEA 3HPJA 2Q1EA 1K5NA 2O61B 4WO4C 2YN5A 3IJSA 3SQBA 3VG9B 4HG4J 4QEGA 2O5XL 3CXHJ 4JPKH 3A6CH 1ZT7A 4LKCA 5ALBH 1FYTA 1MFBL 4HQQH 3PHSA 4LCYB 3MZGB 3O6FB 5D7SL 3TLRA 1X4ZA 2WNGA 4C56E 4HK0A 3FONA 2MJWA 4HZLB 1JRHI 1CXLA 2APTA 1X44A 3BDBA 3J8F7 1KJMA 1U6AL 5BS0E 4OM0H 1S9YB 3PL6B 4Q97A 1EFXB 3S37H 3P9LB 2ADFH 4RFNB 5EU7C 3CH1A 1EPFA 2HT4C 4UIMA 2BJMH 4Z8FH 3LQAL 1QSVA 3ARPA 5CIPA 5GRJL 2VB5A 4XI5D 4G9FE 1HHHA 3BIKB 3OAZH 5E8EB 4ZYKB 1JV5A 5C0DA 2P8MB 5I8CB 1L7TH 5IMKB 5KSVA 2HFGH 4GAGL 1FCGA 3BWUC 3EFDL 5BQ7A 4WEBL 3VFPB 4L29A 3VWKB 1X5JA 4O2EA 5DLMH 4UDTA 3VXMA 3RY6A 3V6FB 2YA2A 4QRPE 2DQEH 4JO4H 5HYSA 3FB8A 5L6YL 3QULA 2ZUQB 4M48H 32C2A 4QXGL 3PL6D 4ZPTA 3MLVH 3OKEB 3A6BH 1BD2D 1FLRH 2EYSB 4MXWH 2X4QB 1ADQH 4P5TC 1Y18B 5EBWB 2NZ9D 1MCIA 3SKUD 3HC4L 5C3TA 1AFVL 3O41A 4NDMB 3K8MA 3FQWA 3UXFA 1RZJL 1IAIH 4LCUB 2MPAL 3ARXA 5SWSE 3BGAA 1Q9WB 3NIGF 5BO1L 1IM9B 3GSUA 1A22B 1Q9KA 2FJGB 5HHVL 4L3CB 4I77L 2CR3A 4AT6A 1FFOA 4RMSA 3HZMA 3BHBA 1I8LA 3JV0A 5E8OA 1AY1H 1QA9B 2VL4A 4FQIH 4FHBD 1KPUA 4UUJA 2EIZB 3FHAA 2Z31A 3HFML 2Q3AA 4Z77B 1OAYL 3VGHA 1YPZF 3DXAB 2R56H 2B20A 2OZ4H 4O9HH 2V2XB 1UACL 3MROA 1P69B 4M02A 2BDNH 3K8LA 4YDJB 3L3OA 4YFEA 4PV9B 1HIMH 1S9KC 4JPVL 3ZKMC 4X99A 4BSJA 3QIWD 2DLTA 2FIKB 5HI4D 3LN4B 2W38A 1G7QB 4PUBL 3TNMA 2EO9A 2Y1VA 5IG7B 3KYNA 1CIUA 5KTEH 4TUOA 5DS8B 3IFLH 5J89A 3EGSA 5K9JH 4Z7UE 3ARBA 3O3DA 1O7SA 1A7PL 4GBXA 5I8OH 4Y19E 5F6HJ 15C8H 1UEMA 4HKJB 1F58H 4FXKA 3L95B 4Z7OE 3OR6B 5KSAB 3LEVL 2X4OB 5IIEA 5D5MF 4W4OC 4OI9A 4ZODA 4MLIA 4PJGA 2ENSA 3RTQB 2UWEB 5KSBE 3U0TB 4X9FA 2DQGH 3CLEH 5TFSH 1KJMB 3TPUA 4Y4HC 2BXYA 4NZRH 1NCWL 1CN4A 2H6PB 2YUVA 4NQSA 4Z9KB 3WYRA 4GAGH 5DGQA 1ES0B 1AGFB 2FWOA 4LLUB 2ZUQC 1C7SA 1C5BL 3E8UH 2YRLA 2X42A 4O2FA 2QL1A 4RX4A 1FZKA 2Q76B 1NAMB 3QEGL 4JHBA 3TH4T 3WIHL 4FQHB 1C08B 3IJSB 5SWSD 4M8QB 1NBZA 3MFFB 5IVXB 5H35B 1EZVY 4JJHA 5D7IB 3MBEC 1KCUH 2F8VA 5F1IB 1QPPA 5D7KE 4PJCB 3IRPX 4PJXA 5DD3H 1IZJA 3DGCR 4AENB 2ICEB 1YEJH 4CN1A 4U3HA 2EKSA 5IJKA 1DBBH 3JTSB 1NAKH 2EO1A 3RX8A 2UWEF 4X5LA 2XQYK 3ULUE 3LOWA 3MGTB 4XNUL 4Q9QH 4HS6A 1HYSC 2F58H 5DDHB 5DRXB 3UTZB 5GGTH 5FUZL 3VWJA 3NZHH 4JZJA 4Y16B 1XF5B 1OOAA 4R8WH 4A2MA 1LEIB 4HDIA 1JNLH 4U7SA 1CFVH 2CDEB 2PXYA 1ED3A 4FMFA 2YZ8A 4XPAH 3FONB 1U91B 2AABL 4NPYA 1WJ3A 1R6VA 1R3LA 3KPLB 1EEUA 1LO5A 3MRBB 5T5NG 3RZCB 2ID5A 1RHHB 3BAEH 2MNUA 2VXUL 1NC4B 3QEQE 4YE4L 5D6CA 3GSRB 3V6ZA 1JCKA 4RA3A 1BVLB 1UM4H 5ERWB 1JWSB 3F12A 3B9EA 1CYGA 4IJ3B 2ERJB 1VPOL 3EZJB 2ZCLH 3BEVB 3DIFA 4J3OC 4MSWA 4WEMB 5E95B 5SX5H 3UTSD 2Q8BL 4HC1H 5FO7B 4OCSH 1KB9K 3QDME 3B8SA 3RNKB 4OCYH 5B3NA 1B88A 1CLCA 1NCDH 3VFPA 2R2BA 1YJDH 3QXUA 4QRRA 3VWJC 1RVFH 5BV7C 2X2YA 3NH7L 3QHZL 5JDJA 5I0ZA 1JGVL 5FB8B 1J11A 4F8QA 3C09C 3OKNB 5CJQL 1JYXA 3MRGB 4MLSA 2FEDC 3OKDA 4EQ2A 3W0WB 2DM7A 4OIBA 5D2LE 2QQKL 4NOBA 4LARH 3VH8A 5EBGA 3G5YB 3JBG7 5HHME 4PRDB 1RY7B 1UB5A 3DX8A 3MXVH 3PHOA 3JUZA 2E9BA 3RGVC 1ZLVH 3EO1B 2QJDA 2Z8WC 4LGSB 3WFCL 3BPOC 2NY3B 1MCPL 4GW1A 1NBZB 5TE7L 3OG6B 1I8KB 2C7UA 4CW1A 5FECB 2NY5C 1JPSH 1MY5A 1J1OH 2GIYA 4S10A 2NY1D 3IDIB 3QEGH 4H1LG 4P2QD 1IM9D 3MACH 3ULUD 5F21B 4EIGB 3SE4A 4NKOA 1UGNA 1XT5A 4UTAH 2YEZA 3B9KD 3RA7H 1I4FB 2DWDA 2HP4A 5L2JA 1JBJA 4FQCH 4WUKL 2VXQH 5C08A 4UZGA 1UXWB 3LKRA 3BN9C 4XNYL 4DZ8B 1AQKL 1UQSA 1S7VA 2AJYH 3UPRA 2KKQA 3GIVB 3BE1L 4LRIA 1SJHA 2XA8L 4Y0GA 3WFEH 1N5AA 1SYVA 4JN2A 4Y5VC 3H3PL 4U1IB 2DQUH 4OUOA 1CG9A 1BFOB 4P2YA 2PW2B 2IADB 1LO3L 4OFPA 4XPTH 1R3JB 4AQ1B 4C83A 3SKJH 2UY7A 1OSPH 4LLUA 5T1LB 4MCYB 4Q9CA 4OIIH 1Q0XL 3SDXE 5KG9B 3TZVC 4G80A 1FL3B 1NCNA 1J0KA 4KPHH 1EUTA 4XH2B 1F58L 4YHML 4ODWA 3RWGB 4UILH 2UWEA 1WISA 2B0SL 2LABA 4XGZA 1TZIB 5ITFB 4JFDB 4L9LA 1ZGLP 3ZE2F 3B2UD 3I50H 4WHDA 3MV11 3RBSA 3VXNB 1J0JA 3E1F1 3QT2A 4JANB 1RK0A 3V6OA 4D0CB 1WBZB 2G60L 4UNVA 3CZFB 1OM3L 4GG6B 1MIEL 4BFIB 2OR8A 1S7UA 4KRPC 5I2IA 2BVOB 2FJHB 1HXYB 1TETL 1X4XA 2EIEA 2NY2B 3QPQD 2ATKB 4EOWL 3T0BA 3L5JA 3TJHC 4KROD 3W81A 3WUWA 1K6QH 1SJHB 1HE7A 3NABL 2EE9A 4PY7A 4G43A 4K71C 4NO0B 5D6DA 4TYUA 3RVXD 1J1PH 5H2BA 2VAAB 3LV3A 1ZOXA 4P9ML 1KLUB 4G7VH 4ORGB 1MHPH 3LEYL 4M00A 5F3BB 3CVHB 4XPBH 1NLDL 5D7JC 4HUNB 3X3FL 1T5XA 4NJ9L 5HYQB 2HLFD 4JGJA 5ID0A 2QSCH 4X8XA 1YUHA 1D5XA 4G9DB 4JAMA 5AWNL 3VCLA 1QZ1A 1G7JA 3VWKC 5J6HB 1SJEA 4XVTH 5GGUB 3CLFH 1M6OB 2FGWH 3U7WL 5KVDH 2NPLX 4DZ8A 3GMOB 4Z7UF 2YPKB 1DEEA 2X09A 4KRMB 2RQ8A 1DANT 1BPVA 4I3SH 2ZPKL 4QY8A 1IL1A 1TTFA 3HMWL 4XVSH 1RK0B 1B0RB 5C08E 1V8HA 3B4NA 3HB3C 3UP1A 5A2JH 2OCFD 1D3CA 3GK8H 4I0PB 2P1YA 3WNLA 4HAGA 1PG7W 3QO1A 3SGJC 1DUZB 1DUYA 4XNQA 1HHIB 3DXAD 3CC5A 2OJEA 4PJ8D 4AEHH 5B39B 5JQHC 2HRPL 4YNYB 2A9NL 3O6FA 2VR5A 4UT9L 1BJMA 3BQUA 3LKOB 3TH2T 4D8PB 3I50L 1FBIH 5HYIA 2MHAB 1F2QA 1UKTA 4IIQA 4K3EL 2A6IA 3MRGA 5LAXA 2BNQB 3UC0L 1CCZA 1YDPA 4H8WC 5C0AE 2GITB 2VLRB 4HF5L 4C59B 1JZ4A 2FJFB 4JFEA 5I1IL 1I3GH 1HINL 3HG1E 2BCKA 3G5VB 3TBVB 1MELA 4W6YB 5I18H 3MRCA 1A9BB 3QUZD 4JVUA 5FFLA 5LGKA 1IILE 3SKNA 2DWDB 4QNPE 4XPHH 4B7LA 2Y5TA 1NCBH 3C6LD 4HZLA 3WIIL 4ZTPL 2KPNA 2DLFH 5EU4A 5EO0A 3H7LA 4K7PX 2BVPB 5JZ7D 4U0RB 1PX4A 3WCYA 2Y36L 1QFWL 5ID1A 1ZT1A 2X4NB 1FNLA 1DUYB 4DEPC 2FSEA 5I1AB 5JXEA 3EYQD 4M48L 3BKYL 4EUPB 2J1KA 3QSKB 2PTVA 5JPMB 1RFDL 2YKLL 4EDXB 1FRGL 2F5AH 3TFKD 5A2IH 3OAYH 1JPSL 5I75C 5FO8A 1HKFA 1WCBA 2R1XA 5FYKE 1INDH 3SDDD 2E7HA 4IMLB 4NCDA 3WUZA 4RFOL 2FBJH 5D9SA 1JMXA 3OJMB 3ULVH 4ZFFB 5HHQA 2AJXL 4HUUA 3GIZL 3GUTB 3DVGA 3D0LB 4DVRL 3MJ7A 3N85L 4EBQH 4UT7H 4W68A 4HFUH 4A6YH 1CWVA 5GZOD 1LILA 4O2FB 3BD5A 3P4MB 1CXIA 1KPVB 1KACB 2JJTC 4RX4D 4BKLA 4N8CH 4IRSA 1E28A 4F7PA 1RZGB 1VFAA 3GMNB 4H5SA 4YK4B 1YC7A 1ONQB 2JJTA 2R39A 5MEPB 5I1DB 4QYOA 1A7NL 1AQDA 3TCLB 1A6WL 1IKFH 1W0VA 3MRNA 4U2YA 3GMMA 1R3HB 4P46B 4ODHL 4JQXA 2Z4QB 1OAQH 2VLKD 1FO0A 4YGVA 4WTXA 3V95A 2OM5A 1S9VA 2WWMC 3MLRH 5DQ9A 3HPLB 5D1XC 1B2WH 3AROA 3LH2L 4ODUB 2DDQH 3AS3A 3WEXB 3AM8C 3QUXB 1KF9B 5AZ2L 4WVRA 4XZUA 1W2KT 5E99H 4NRYB 2W60B 5LBSL 2VITA 1PYWB 4OLWL 3LN5A 1BOYA 4XX1E 4Z0XA 4HF5H 4C55A 5C07A 3WUWB 1KEGH 4KUZH 2EECA 3KPSA 1RK1B 4MDIB 4I0CC 4YHLL 2YSSA 3QHFH 1CXKA 1SBBA 4RAUA 3NN8B 3KLHC 2DLFL 3N1QC 1ZGLA 2BSTA 2CRYA 3AS2A 4XVUC 3FO2B 4PP1D 1FSKC 4NQSB 4JGUA 5KJRH 2XZCL 3UROR 4P57B 3S5LG 4UUJB 5BVPH 5CP7B 5DQJB 2EZ0C 3IKCB 3PIQB 3KYOA 4KI5C 1PDKA 2ED8A 4PRNA 4YDJA 1CVRA 1NUFA 4Q6IC 3V8CA 4M5YH 5A1AA 2XY2A 3U36A 3R4DA 4PJAE 2EDNA 1DBML 1NANH 2GSIB 3NPSC 3PWUA 1FL6B 5AWNH 3GRWH 2IMMA 5JHDA 2A74B 4BFEA 3EW3B 4U6XB 2Q86A 5JLZB 5EC1B 1ZSDA 2A2QT 4N0RA 4NZRL 1FJ1A 2WBJC 2XT1B 2AJ3A 4NQCA 1EFQA 1KB9J 2AVGA 2X70B 4LDLB 2FH6A 4JFQA 4JFHE 4LLMA 2VWEE 5L88H 3MLSH 5IJVA 1AY1L 1E4WH 2PYEE 2P4AB 5DLML 5BXFA 5EOCH 4ENED 1BZ9A 4R3SB 2HTLD 1HH9A 2PF6A 3EDDA 5GRWA 3RHWK 5ISZA 2C4FT 4NPYB 2G9HA 1F3RB 5DEFB 3GKWH 4GRMB 5DUBA 4X9GA 4PJCF 5GGRY 2OR9L 2P5WA 3DIFB 4JG0L 3G5ZA 3HNSH 3GMNA 4H5SB 4HJJH 4WHYG 3FAXA 4MCZB 3TA3C 2P24A 3PWPB 3OXRB 4Z7NE 2EXYC 3QG7H 3LHPL 4ZO8A 1MPAL 3G6DL 5EC2B 1OGAE 1T1XB 4HJJL 1PSKL 3TA3A 1E0OB 3VXTB 3RVUD 4GAYA 3ROLB 1R3HA 1L6ZA 5F6IC 4N8VB 2NXZC 3BDXA 4WW2F 5DJ0B 3TNNA 3C8DA 5D1XB 1QHPA 3BEVA 3PP4H 4MSWB 4XP5L 2C3WA 4PRBA 1WFTA 3DPBA 5IFAL 1H3GA 3QIBB 4PJ7A 2CKBH 2YUXA 4JO2L 3SHSA 3VG0L 2OI9B 1UJ3B 2UY6A 4MA3B 3LS4L 3DX9A 1INEH 1UWXH 3KPPB 3QPQC 5ACLA 1J1PL 3ZE1E 1CQKA 3ULVF 1TJHH 3EOTL 4QRRB 1FH5H 3DUUA 5F9DC 4GQ9L 2XZQL 4OV6F 4WWID 2VUOA 1JF1B 2I9TB 1XZ0A 3RVTC 4ONHB 5JPNA 2YRZA 1NGZB 3IVKA 5GSVB 1CZ8L 2PXYB 4KDTC 1YEDB 1A1MB 3S4SG 5K59E 1NFKA 2B0SH 2VLKA 5CEZL 1T66D 2NXZD 1AKJD 1CL7L 1P2CA 1JF6A 5DR5L 2X7LA 4D0BA 4S2SB 4PJ5B 3H8NA 5K9JL 1FL5B 1I9JH 4LPYA 1X5KA 5CP7A 1DQJB 1ORSA 5GS2H 5CJOH 3QJHA 2FECI 4Y5VA 1MWAH 4JFHD 4IRJA 3TZVD 1V3MA 2ICWB 4LP5A 1K4DB 4U1MB 3PWNB 4P2OC 2PYED 1P84J 4CADB 4MJ5A 2VDMH 1G7LB 4OLUL 5J11B 3U36B 3QUZC 1VA9A 4MDJB 1CICA 1MY7A 5EIVA 5EOTA 1MRFH 4QNPF 4JKPL 3VRIA 1RMFL 1T5XB 4O02H 4P5TB 3GKWL 2G9HB 5IW3A 4L5FH 5CGYC 2W0KA 3UJJL 2APXA 3GSOB 3P4NB 4X5WB 4YEEA 3D3VA 4X8JA 4JY5L 4MX7A 4NQDD 1NDGB 3EYOB 2XICA 1W8OA 3NCFB 3PUCA 5TPWH 2QBWA 3MRKB 3R06B 4TSAH 1EGJL 5JIKA 1EEQA 1WC7B 1DBJL 5JHDD 3LN4A 3BGMB 2VXQL 2E6JA 5GSRA 1OPGL 1JK8B 3K4AA 5E94A 1T7WA 2HKFH 5D4QA 5ACZB 5DJAA 1QSFA 4LSSL 4KHXL 3RWJA 2ZKHL 2YA1A 1A14L 2AJSL 4WW2C 2YK1L 5F7NC 4YGAB 5DJZA 4TVPE 7CGTA 5AD0A 8FABB 1NBYB 4N0UB 3JTTB 1FVDA 1KLGA 4L1HA 3T4AA 4KTEH 3QISA 4FFVC 3N1MC 3MLUL 1MUJA 2EDDA 4FQQB 4PJGB 2HJFA 4HJGA 3IXTA 1IGCL 3VMOA 4BSVB 1D9KD 2BFVH 1S7RA 4F9PC 4IDLA 3MC0A 5CLTA 2A73A 2W9EL 4LLQB 3EDJA 4R97C 2D7TL 4WJ5B 1E6JH 3MRDB 4HPOH 1JPGA 1MRDL 2ARJA 5GHWH 4L3ED 4GH7B 2Z92B 3MV8B 2YD1A 2XZQH 4NN7C 3HZVA 4ZNEE 4UTBL 1UM6H 1UCBH 5C09D 4JFED 5CS7A 3MNVB 4XNZB 1FPTL 2GJ6A 5FOBA 3CFJB 1KJ2H 4EDWH 2MKLC 4P23A 4PJBA 5IT2L 2VSDA 1KLUA 3FB6B 3CK0H 4TUJB 1FN4A 1L0YA 3LCYA 1AH1A 3N85H 4EBQL 4KK9C 2J88L 3U46A 3TWCL 3QRFM 1CFTA 3WD5L 4RRPA 3REVA 3HZKA 2BHYA 2X1PA 1KIUA 3EOAA 4WFGE 4HWUA 3VRLF 3G6AB 5D7JB 12E8H 2H26A 3C5ZC 3MRCB 5JW4Q 3ULVE 4PB0H 3QA3A 4XAKD 2IALA 3EFFA 1F11A 1S7SB 1TXKA 1MCHA 2JJSC 1RFDH 3QJFB 1WSST 4YFLI 2YA0A 2YS4A 5F96H 1CQYA 1YN7B 1AXTL 3LPGA 5D5MB 4R90H 3FCTA 4TSAL 3SPVA 3R8BB 3QUYA 1KFAL 5GGVL 2BP3A 2H2PC 2BNRE 5IMOA 4ELME 1CLOL 1D9KB 1J12A 4P2QA 5C0GB 2WP3O 4MYWB 1O5DT 2R9HD 5DJDA 1F6AA 3PP3K 4DUWA 3PQYD 3BIAX 3UTSE 4RWYL 3MRFB 4NKMA 4OQTL 3NFPA 1HHGA 3K3QA 3QI9C 3SBWC 2Z31D 5LAXB 1DBBL 2G5BA 3DECA 3JV6B 5DJZB 3QWQB 2FD6L 4X4YA 1CD1A 1CR9H 4FFZL 1KN2L 3BW9A 4BK5A 2H8PB 2OTWA 4KQ3L 3C5ZA 2VLJD 3RWHA 4OGYL 3MJ9H 2QTEA 1JE6A 4XPFL 4MHHG 5AAMA 5INDA 2Y5TB 3HRPA 4ELKA 5ABDE 5E24E 1IKNC 5CHNA 4XC1H 1OAYH 1HILB 5MI0B 4IOFD 4Y2DD 4CMHB 1YDPB 1JWSA 3M45A 4YDIH 4M93B 1L0QA 1EO8L 5GJTL 3RVTD 1B0WA 1IT9H 3WKMH 2IBBA 4KU1A 2F19H 2QKIB 4K2UL 2OXHA 3VRLE 3P77B 4HK0B 3BPCA 1NCTA 5LQBL 3HE7A 4NO2A 2Y07H 4YDLB 1LEIA 5JORA 2QHRL 5EZOH 5EPMA 2P5WE 4GW5A 3OKNA 3M8OH 1QNZH 2AQ3A 2R2CA 3BP4A 2X89D 4Y4FA 4ODSH 5K9KB 3ZKXB 1RHHA 2N1KA 5EO1A 2AXHA 2FGWL 2DJ4A 1F3DH 1IKNA 3BDYL 5KS9A 1T1YA 5H37H 5KJRL 3F62A 3KPTA 2R2HA 2VAJA 4KGJA 4FRWA 5F7EH 2AERT 2XN9E 2D4FA 4NZUL 1S9WA 3BEWA 4HKBA 3FB7A 3BZEB 5ESVA 2J6EA 3CH8A 3T2NL 2GEEA 5ISZD 3WXVL 5D2LF 2FZ3B 3VRJA 1SY6H 2VLMD 4LLYB 4U1HB 5TJWK 1ACZA 1DBMH 3PQYE 1HQ4A 2XWJB 5DD1L 5E1AA 1KTKE 4KJWC 4M1DH 4YQXH 3RTQC 1RZIB 5EBMA 3S37X 4P4RB 1DVFD 1PGRB 2V5RA 2RGSA 3Q6GL 1BZQK 4OLVL 3UJTL 3ZE2E 1L4IA 1A3RL 2ZJSH 1NCCL 5F7WC 1JPGB 1WK0A 2YD6A 3FTGB 1YNTB 4P2OB 5FK9B 5CIPH 3FT3A 3PNWB 2IQAB 5FO7A 3EDEA 3UTQB 4PLKD 1JWUB 3FB5A 1DQMH 5BO1H 1JZ2A 4O58L 5C0AA 1S9XA 4PLKC 5E99L 1MFCL 2AK4D 3NVQA 5IBTH 1QRKA 5E0QA 1NSNH 1JGEA 1D5ZA 5KN5B 1C1EH 3S3PA 5FO9A 5HHNB 1G9NC 1HYSD 4AM0A 2AK1L 4NBXB 3CNKA 3F5WA 3O3UN 3F6LA 1EHNA 4E42B 4YHLH 5CBEA 2R4SL 3FO2A 4BSWB 5DJ6A 1AO7B 1W8NA 3AAZB 2AGJL 4ZS7H 4FTVB 4LDOB 2OZ4L 1KN4L 5JOFB 4L1DA 5F9JB 2AABH 1T89C 3P9MB 5D8JH 4S11A 3IKCA 4XPTL 2ATKA 3IDXL 4G8GA 43C9A 1T0PB 3S37L 3NBNA 1R24B 5GS3A 3AGVA 2IPUK 4F7TB 4MS8C 4UV4H 2F53E 3SDXF 1CS6A 3GMLB 2Z4QA 4FQJH 5J4MA 1PKQB 5AZEL 2HT2D 2FIKA 2RR3A 3MYZA 4WI8A 3GSVB 5H94A 1GGIL 1KULA 3T1FB 4Y2DB 4UU9B 5L8KB 5F7YC 4FQ1H 5KG9A 3D6GA 4QXGH 3O8XC 3HZYA 4KI5E 3ARBB 4PGJA 5D7IF 3UZEA 4WDIA 5C0RL 2JE8A 1A1OA 4I5BA 1F8TL 3AREA 4OGXH 5SWQB 2WWKO 3CPLB 3DX9B 2NY6B 2BNUA 1KIQB 5C2BL 4CKVX 2VDQL 3WFCH 1ZK9A 1MVUB 3JWDH 2AJUL 3BN9D 3SGDI 3ZDYF 2HFEB 3MNWB 3PWLB 4R7NB 2E7LA 4X6CF 1Q9WA 3MV7A 5HHMB 5B22A 1HSBB 5AEAA 1YEFL 5EUOE 1MWAA 2VL5A 4FFYL 2BNQD 1TTUA 5ADPL 3VWKA 1CK0H 2BSED 2SEBA 1IAMA 2VRAA 5E8OB 4KXZI 1NH6A 3P0VL 1HNFA 3QCVL 4WNQA 4GLRH 2CXKA 3M1BB 5GGRB 5DHYB 5IQ7L 1F4XL 1YN6A 4LCWD 2Z93A 1OTTD 2PTTB 4X9HA 5ADOL 5DUPH 4HCRA 1BIIA 3HS0A 4PRBB 4EVNB 1RZ7H 4JZJB 3GO1L 3KXFE 4WY7L 4YXLL 2L7JA 3FTGA 3RKDC 4ZFZB 1OVZA 3SDDC 2ADIA 4YHYC 2M8XA 1U8IB 3QEHA 3I6GA 2QADD 1CFVL 3T3MF 2YPVL 4HUUB 3DUUB 3TA3B 4JO2H 3VXTA 5AYQA 1VACA 1GC1H 5HYJA 4Q0XH 4YC2B 4I9WD 3HG1A 4U4BA 4F7CB 3S98A 1EK3A 4K94L 1I1FB 5HHOB 4O2CA 1DBJH 5EO9B 5TQ0L 5JA9A 4X5XB 1MLBA 5TQ2L 4JDTL 4QHMB 1OW0C 5ALCL 3MV9B 4EI6B 5GS0L 2FSEB 4QTIH 3G04A 4K3HA 4LFHD 5DFWH 1JP5A 2XWTB 4PGCA 4BK4A 2VXVH 4H25A 1J86A 3CUPA 3NA4A 1U91A 1X4YA 4AMKL 1T0MA 1OGTB 5CLWA 4KI5D 1N7ML 4GMSH 1V05A 2V9QA 2H32H 1MCSA 3CFCL 1RQ5A 1RUPH 3BJ91 4PTUB 5DFVC 3MLXH 1QLRA 3FOMB 3HHRB 5BV7H 2PO6B 2FLBT 4OAWA 1TCMA 1U92B 4LK4A 1QBBA 3NCCB 5GRYA 4PJHE 1NAMA 1IGJB 3H9SD 5KZCD 1ZWIB 4I4WB 2APFA 2X6MA 1JTTA 2IFFL 4M6NH 3WSQL 5KSUA 2VE6B 4M6MH 1S5HA 1T2QL 3RDTB 4X4XB 3L6FB 4NBYB 3QO0A 2ZP0T 4OLZL 2FJFA 2OJEB 2HT3C 4IOIA 2I5YH 4MNGA 5CKGA 1NMCB 2EE6A 3BO8A 3D5OF 3BQUB 3T8XB 3D85A 2GTWB 4C4KO 5FEBA 3ALWA 3FFCD 1RJYA 1QSEB 1H3TA 5BZWA 1ZLVK 1A1NB 1A3RH 2ZJSL 1RUAL 2R0ZL 3OJDA 4OF7A 4WO4D 3GB7A 3KXFD 4MQSB 4QRRE 3CFEA 3SQOL 4YDLC 1MFAH 5E6IB 5AG9A 1PSKH 1CE6B 2APWA 4C4KT 2G75A 2X9YA 3QO1B 3MJ9L 4TUJA 2E7CA 4JFZL 5DI8B 4LSUH 3K80A 3IS1X 5CZXC 4M93C 1MJJA 1QTYT 2A9ML 1QFHA 2C4XA 4TNVK 1ZLSL 5DMGD 1AGDA 4F7CA 5JW4R 3ZHLA 4WJ5A 1JYWA 4WV1B 3K2UL 4ACPA 1A6AA 1A4JB 1OGAB 1TPXC 4HHAB 5F70A 1CDYA 5CP3H 4PJAF 3UYOD 6FABL 4LLDA 4X98B 1BQHA 1CFQB 3EOBB 4FXGB 1I8IA 2VO5A 4I8DA 5IMMA 1OP3H 3D25A 3MNVA 4OIIL 5CSZB 1WFNA 4HWZA 5TQ2H 3RL2B 2FL5B 5D96C 4ZUSB 4UT6H 4XCFH 4LSDA 3U9UB 1ZA6B 3ESUF 4OCXH 4PGZA 3OX8A 5D1QA 4JHZA 1P53A 2J8UB 4U1JB 1NKOA 1ACYH 1AE6H 3VFOA 4GKNB 4NC1E 1DCLA 3H9SE 2VLLA 2YZ1A 2QQNH 5DMIL 2IAND 2JIXA 4TRPL 3TWCH 4PGDB 5IMKA 4PJ8B 5ALBL 3WJJA 4FZ8L 1JRHH 2O93L 1AI1L 1T6VN 4MJIB 1ZT1B 5J57B 3P0GB 1EHAA 1FJ1B 2DQHL 3MOAL 3W9EB 3RP1A 1UQSB 4Z78A 3TBYA 3WL9A 3X12A 1J88A 4PJHB 4JVWA 4PRHE 1ZANL 4ETYA 2BSRA 1RJCA 1NC4D 3L3IB 3MLVL 3C09B 1G7MA 5CD5C 2XWBB 2E6PA 4EIZC 1TZGH 5DWUH 4GKZA 1I1AD 4BSVA 3DYOA 4JM4H 1QQDA 3MJ6A 1BJ1J 2IPTH 1GIGL 1LK2A 1EZVX 1KBGL 4DKDC 5EBWA 4I18A 5KOVC 4KQ4H 2ZZUT 1BMGA 2YOCA 3KPNA 3MMEB 4G6AD 2F54D 3CFKA 3HUJB 3QR2A 5B21A 4HGWB 4TOYL 3CDYA 3VDAA 5JORB 3WS6A 5C7XH 3HI6H 1MAKA 4HKXB 2P7TB 4G9FB 4XNZC 1A02N 5GGSB 4WHCA 4JN1H 5INDB 5FA3A 3QI9A 1T0MB 2X4RA 5DFVD 2DKSA 5EO1B 1IGIH 1UENA 5IB2B 3VFMA 2BSSB 2VQ1A 1KB5A 5E2WH 1TMCB 2JCCA 3VXUD 2VZOA 3O2DA 4LVNC 5IQ9A 1KPRA 2B4CL 4OAWB 5SV4A 5CZVL 1GZPB 2ICWA 4QTHA 2DQFA 4OF5A 4K94C 5IB3B 3S96A 4XCEB 4KTDH 2WM0A 3L3JA 3UTQA 3A6CL 4E0RB 4ZO6A 4A6YB 4X4ME 3LIZL 5MEOA 1VFUA 4V1DA 1VEPA 2QKIA 2OP4L 3VFRA 4XB8A 2E7MA 4AIZA 3FFCA 4NO5A 2HJLA 1LK3H 3BRGC 5EU3B 3EKCA 5DMKB 4FS0A 3S4SB 1N3NB 5J9PB 1T6WA 3ARGB 4NKDB 4KZDH 2DLIA 4F58L 1C1EL 3NIFF 4MJ2A 3DLQR 2FO4B 1NCBL 2IAMD 2PO6A 3E0GA 3ZKNC 3D3VB 3JVGA 3PE9A 3QIBA 4JZNA 1EFXA 1JZ5A 4GMTL 4M1GH 4XCCL 3KLAA 5J06A 1U3JA 1IGCH 3KYAA 5EU6D 3TEUA 4YX2H 3BWAB 4C54A 3GMOA 5H2BB 1C12A 3T0XA 2J8UF 4ZFOL 4JHAH 3X13A 5C0FB 1P5UA 2O5XH 2XTJE 4JPKL 3ETBF 1ZXQA 1XCTA 1XEDA 2IFFH 1QFWH 3KJ6L 4I0PA 4G9DA 4JAMB 5JOPE 2P5ED 2V17L 2KBGA 4BFBD 1U3YA 5JIPA 4XPBL 3QQ3A 3MOBL 2FATL 2B1HH 3DO7B 4LU5H 4YR6A 4NIKB 1TQCC 1DQDH 3G5ZB 2NW3B 1DZBA 4NFBA 3B8YA 3BH8B 4TUKL 3ZYZA 1N5YL 2VDRH 5C0CB 5T5FH 5F9OL 1XGUA 2DYPD 3BKJL 4GAFB 2XXMB 4MAYB 3MRBA 3UTPE 4HXAH 3IDGB 1XGYL 4I2XB 1XR9A 4GRLD 5BXFB 1Q38A 1KIQA 3PABA 1KCLA 4ZXBD 4O02L 1MCWM 4U1JA 2AI0H 4F33A 4R4BB 4LOUC 1MRFL 2WUBH 1NL0H 4Y2OA 1UA6H 4FTVE 4PRID 5ENWA 2HH0L 1AO7E 1CD0A 1IAIM 5HYJD 3ARDD 1YYML 1HIML 5JMRA 1ADQL 2DLGA 2HJKA 1GGTA 3OKLA 3VJ6B 4I5BB 2HH0H 3X14B 1LO5B 2FLRT 3MOQA 3WHXA 1CT8B 4F7MA 3TIDA 3SY0B 2BNUB 5ETUA 4PJCA 3V4VL 4XRCA 4L3EE 2IWGA 5LVEA 4JPWH 2GJZA 4RMVA 5CCKL 1ERNA 2V5YA 4QXTA 1PY9A 5GZOC 3IDJA 4N1EA 3O81A 4ONFL 1Q72L 2DQFB 2CK0L 4ELMF 3MGTA 2M2DA 1YNLH 3DNKA 5EOCJ 2CIKA 5FYKH 2JJWA 2IC2A 3AVEA 1K6QL 1HEZA 2R69H 5ITBH 1KJ3L 4N0FB 5C0GA 4K9EL 2K3TA 3H0TA 4ZUUA 2P47B 5EUOF 5HVGB 2QQLH 5DJXB 1DTUA 3QXAB 4L8BA 2C3XA 1R3JA 3IGAA 3KDMA 1V7NL 3V5HA 4YZFF 5TDPA 3O9WD 35C8H 7FABH 5HI4C 1KJ2B 4J8RA 1NGPL 4N5EC 3VW3L 1F8TH 2D3VA 3KR3H 3HUJA 3QDGB 2X44D 1T2QH 3WBDA 4K7FB 1F11B 4OCWL 1Z9MA 2ADFL 2A1WL 2YSSB 3L95A 2HWZL 3PJSA 2HJKB 3ARWA 3BD3A 4IRJD 3HMXH 2K7QA 1U8NA 3MGAA 2Y23A 2YXMA 3WJLA 1I3RA 4LCIL 1FP5A 4F7MB 4LPTA 1FE8L 2OI9C 4PJDA 1OLZA 1BX2A 3MACL 2BMKB 3SGJA 1A6ZA 3DRQA 4KY1L 3CDFA 1INQB 2WIIA 4HIXH 3GSNA 1PKQE 1UWGH 4R4FH 3QIBD 3LRGA 4I2XA 3BPNC 2NY4C 4IRJC 3P4LA 1B0GA 4OSUH 4KK8C 3OKDB 2LAGB 4HXAL 4MJID 4PRIE 3LKPB 4U1KA 5IKCA 3BKJH 1DN0B 5CJ8A 2NLJB 3TCLA 4HIEA 2EDFA 3A6BL 5DQDH 3T04D 4QRUA 1WWAX 3V0WL 4UQ3A 3NGBC 5D7JD 4EI5B 3UYPA 1B6DA 3RX5A 5K9QI 1H8OA 4Y4FB 1S8DB 5HGHA 1A7RH 3EO9H 4DGIH 3OJDB 3UJIL 2A6DA 3O41B 1JPFA 1XF4B 2J3SA 1MNUH 5JOEA 3QNYA 1DL7L 3OAUH 3W39B 1QSFD 4FQLL 1LP9E 1CXHA 5E9DA 2DM2A 1M7DB 2Y4SA 3B43A 2DQIL 5IBTL 2GW5A 4R3SA 4J3VA 4G3YL 1P6AB 4RA0C 1RJLA 1W72B 5L7XL 1DBKL 5SX5K 4XP4L 2ENYA 2HT4D 4GAJH 5C0CE 3T0AA 4G6FB 2XPGA 1TCRA 1YEKL 2UZYB 1AHWC 4W6WB 3T0EA 1A3QA 4KTEL 4NGHL 4LDEB 5HGAB 5J56B 2XN9D 2ZOLA 4LHJB 3LZFH 1S5HB 4MJ6A 3S5LA 1VPOH 1W0YT 3QQ9C 5C08B 1IMHC 3PDOA 2DICA 5DC0A 5IJVB 3SKOB 1INDL 4OBSA 1I1AA 3TT3L 3IETA 2VLME 1QBMH 1F2XK 1UFUA 2FHFA 2KZWA 3QDGE 3D85B 4ZAKA 1LQSR 4PV8A 2Y25A 2GITA 4DGYL 3K4ZA 5CUSH 4YPJA 2X4OA 4NQEE 5DRZA 4Y19D 4Y8AA 3O4LD 5EU5A 3JWOL 2DD8L 2ED7A 4KKLC 4OV5A 5TH2B 3TV3H 1QNZL 2EDWA 2OSLA 4ZYKA 3RVUC 5SWZA 1NKRA 4AY0A 3T2OA 4L9LC 1I9IH 1L0XA 3L1OL 4Q2ZB 4HWBA 3VFNA 3BPOB 5JO5A 1LO4H 3SDCA 3F7YB 2AKRB 3H9YA 3HLAB 4NWUH 3ZE1F 1MAMH 2E9IA 3QJFA 1QQDB 2D0HA 4JY5H 1NGYA 3O45A 4N68A 3WO4C 2EDRA 4N8VA 2CD0A 2MQCA 4L5FL 2IPKA 1ROWA 1HQRB 3TN0D 3NA9H 3O3DB 1ZLUK 2QQQA 3N9GL 3DETD 5DK0A 4ALAH 4OF0A 2DQJH 4NN5C 4RNRA 4U6YB 3U0PA 4JRYB 1SJEB 4XAWL 2VMFA 4RZCA 3S8WA 2IQ9L 2RJMA 1TJIL 4G8GE 4IS6B 1AXIB 2VLJA 2OQJB 3SDAD 1YQVL 1BFVL 3P3YA 2YD9A 3LS5L 4X6DB 4HH9A 4LHQB 1ZGLM 3ZTJH 5DJCB 2ICES 5F6HI 1NSNL 3QNZB 3FT4A 5ISZB 4JB9L 1HCFX 5F7MC 1GOGA 2NX5B 2EIZA 3E3QC 2X10A 1IEBA 3BQUC 2XNAA 2H1PH 4PJ8A 5GGVY 3F7VB 5I8KL 2JIXB 2NY1C 3HMXA 4EJ1C 2FL5A 4PBXA 3ECBA 2QEJA 2KUTA 3IXTB 3P11H 2E8ZA 4PV9A 1CI5A 3BKMH 1F00I 2F15A 3GNML 4TULL 4XP6H 3SO3B 1J0ZA 5JHDE 2NW2B 4NZTL 3I3DA 4XWGH 4F15C 4ZS6C 5HXMA 1T20A 1T1ZB 3MXWL 1KC5L 2V2WA 4JE4B 4U0RC 4WV1A 1QP1A 5I1HL 3IDYB 3WKNA 3WFBH 3HI5H 1MVUA 3GSVA 5H94B 5FYJH 5A2KH 4BFIA 2Y07L 3MRLB 4XVTL 3VWJD 5CSZA 5J6GB 2VDPH 4PJ5E 5I66A 1JHTB 3QG6B 2I27N 1KCSL 1G9MH 4HAFA 3RIAF 2XA3A 4QHUA 3LD8C 3RU8H 2ZNXA 5EOCL 5FM5O 1ZHLB 2P8PB 3HE6A 3BI9X 4NKIL 1FLTX 1LD9B 4MGXA 5L88L 4GRWF 3ILPB 1AXTH 1AGCB 1BQSA 1QVOA 1FSKB 2FR4B 3O8XA 1LDPL 4JLRA 4GG8A 3EYOA 2E27L 4WCYH 3T0EB 1WZKA 1I1CA 3FO1A 4L9DA 1OHQA 3MOBH 3X17A 5FV1L 1G84A 4EEEA 5DD0L 4G8GD 3SO3C 3I3EA 1J10A 3Q3GA 4YHYB 5C2BH 1FNEA 2HKHL 1IC7H 3BGMA 1DQLH 1FG2A 5IFHL 3QIUD 4LEXL 4CJ1A 2D7PA 3LIZH 5JXEC 5B39A 2ILLA 3IDGA 4ALAL 2YD3A 3I6KB 2CDGB 3LEXA 3LRSA 4U0QB 1G6VK 4CMMA 3LS5H 5I8EB 1BAFH 1NMAH 4PG9B 2I60L 3QUKA 2BOBB 2OL3H 4L8DA 4J6RL 4O9HL 1IGIL 1YY9D 5I30L 2XQYG 2FD6H 3WNPA 1YEIH 5DTFA 3CFDA 3PHOB 4BSWA 3HAEG 4HW6A 4OLEA 3PP3H 4HC1A 1RZ7L 3HAEB 1LO3H 2BCKB 2ZSVA 5I1EH 1FFRA 4MAUL 2EC9T 1K3IA 5D70H 1I1FA 5HHOA 3VFGH 3W82A 4J23A 5IBLD 4NZDA 4ZSOB 3SGEI 4MHHI 1P4IL 3FOMA 5I71C 2YR3A 5FM4A 1VFBA 4QHLB 2GSGA 3ELAT 3OKKA 5F9AC 3W9DB 3F12B 2XWTA 2Z93B 3I9GH 3LQZB 4H0HB 4EUPG 2MFNA 3MUY1 4ZDHA 4IRSB 4KZDL 1TVHB 4GUPB 3P77A 3PGFH 1KJ2L 3EJYC 4QHKI 1Z9OA 3PGCA 3RRQA 4P23B 4PJBB 4JY4B 1YJDC 5D2LA 5DGRA 3GHBH 3OKMA 2FX8H 4Z7NF 1DE4A 3QWRD 4Z7QE 4ZNCD 4MB4A 3S4SA 4Y1AD 2HVJA 2JB6B 3G9VA 3LKNB 3TN0B 2VISA 1X7QB 3H9SB 3O9WA 2PW1A 1NUDA 3WIFB 4CL7A 2MOVA 3ZT7A 4BH7B 3KWWB 5DTFB 1BHGA 4L8SA 3JWDC 5CZXD 4NWUL 3VA6A 4D9QD 1BWMA 3LKQA 1FRGH 1A7RL 2O5ZL 4JREC 5C0ND 3H6JA 5KSBB 4NNYA 3FQTA 5BRZB 4RFEB 3NFNA 3L7EB 4XNMA 5INCA 4RGOL 4WV1C 1P6FA 3FKUS 4K3JL 3U2SA 3RA7L 3ULVL 3IXAB 4Y5YA 2WK2A 2X1WL 4Y19B 4C56B 4WI5A 3E6FA 4HEME 1XGPA 3GSNH 4XBGA 1U0QA 2P46B 4HSQA 3C9NA 1AGEA 2EIBA 1IVLA 4FOMA 4KMTL 5AZ2H 1KCVH 4ZMAT 1I7ZA 4YAQB 2R0KL 1YMMD 4XCYB 3HAEA 5JW3L 4NM8L 1T03H 5GGTL 1LK2B 2FEDD 3BSZL 4TSCH 4Z0XB 3DSFL 3H2WA 1FAIL 4Q7DA 5F44A 3RX7A 2W92A 1ZLSH 4M43L 3IGAB 4XP1H 3TYGL 3L3DA 4P5TD 2IQAA 4OI8A 1GZQA 4KZEH 1PEWA 4LKXB 2QADC 5D93B 3ZDXE 4P5MB 3PABB 3L3KB 3HPLA 5T1MA 4EZMA 1EV2E 1TVBB 2FR4A 1QSEE 4OD1L 2OJZL 1C5CH 4NC0B 3RDTC 3TIEA 1C5DA 4M5ZH 4Z95H 3W11D 4KAQL 4EN3B 1PBYA 4P57A 4XZUB 43C9B 3UBXI 2ZUYA 3L7EA 3GDBA 2PYEB 5L0QC 1FYTD 4UINH 1HH6A 3PHQA 5FGSA 1BP3B 3RWDB 1JI1A 1YQ2A 3P30H 4WO4A 1T04A 4H26B 3OJVC 4HLZH 4JFOA 1ACYL 1BFTA 1CE1H 4NRXB 4DN4L 2R2HB 2Q76A 2VISB 1KXVC 4NBZB 3FL7A 1NBVH 3MLYH 3QUMA 5GGUA 3KPNB 3MMEA 4U2ZA 1J8HB 2W0PA 3B6SA 5ICXA 4JO3H 3OF6A 1AI1H 2V2XA 1HHJA 5I1LA 1U8MB 3BXNB 1J0IA 3QEQA 5FUCC 2OR7A 3EYUL 2QR0B 4Z7UA 2EDLA 2VYRE 4LPWA 1I9RL 4FXLA 3WXVH 4IJ3C 4I3RL 4QT5B 4L8CB 5A2LH 4J3SA 1OAXL 1HSAA 3EYUH 5EBLB 3U2SB 3TN0A 5HYFA 5D93C 4DW2L 4DOHE 2WANA 1NLBH 1JWMB 2VC2L 3VXUB 4MQ7A 4P2OA 5FK9A 2OBGA 4PGBB 43CAA 1EBPA 1NDMB 3TZVA 4EXPX 2YBRA 3O0RL 3ARSA 5C09B 3EO0B 3ARGD 2Z8VC 1AGBA 4XVSL 5SWZD 3DVGB 1IM3A 4D94A 4HKBB 2DLHA 5E1HB 5KVDL 3U7WH 3JV4A 5C9JB 5EIIA 1JFQL 4JJ5B 4OD2A 1VHPA 4HLZG 4G42B 4XHQA 5DI8A 3QB7C 5IROA 5DHVB 4Q0XL 4S0TD 1NBYA 3MGOB 1J05B 5AUMB 1S7VB 4DK6A 4RQQB 1PX3A 2ZWLT 1UA6L 3S5LB 1BVZA 1UVQB 2DQJL 4HUVB 4HFWA 4NQXB 1IQWL 3ZKSD 5I0DA 5FYLH 3WNNA 1T1WA 2P24B 1FH5L 3O45B 3Q48A 2EH7L 1HXMA 1MJ8H 1KGCD 4HDIB 1CTOA 3QQ9D 25C8L 3GUTA 5J1AB 1E6JL 3OL2A 4JDZA 3S34L 1X5ZA 3SJVD 2EDEA 1KEMH 1TCRB 3LDBB 1U42A 3OBAA 1ZEAH 3A6OA 1UWXK 4D8PA 2FO4A 2W07A 2XRAL 2EC8A 3EYQC 2ORBH 3QIUC 1LO0L 4L4JA 3BGFC 2G60H 1XGRA 2AW2A 1YEDA 4K7PY 3SDCC 4N5UA 4K23L 1KB5B 3V2AR 1IQDB 1FHGA 1I9EA 3QQ4A 4O5LL 2ESVB 3ZKMD 3LQAH 1SEBB 2FWOB 1CDHA 5CEZD 3RWEB 2VZ1A 1RIHL 3VGGA 4AL8H 4HBQA 1U2HA 1FL5A 2DD8H 2MKWA 3ZDZF 5F7UA 4G9FA 4NN6B 3RFZC 1DQTA 3EFDH 1CE1L 3NCJL 3F7YA 4NYLA 3Q5TA 4Y88A 2DJUA 3CSBA 4P48A 4AJ0A 3MCG1 5KSBF 1MCQA 2DQEL 4JO4L 2WZPD 5A3IC 5KAQG 5DMKA 3MLTB 2P5EB 4DW2H 3TT3H 5TE7H 3SCMC 3VXRA 2DLEA 4KWUA 4DCQB 3OKOA 1QKZL 5A16A 5CD3A 2JF1A 2YBRB 1UZ6E 4JHWL 2CMRL 1F97A 3ZT6A 1II4E 5D5MA 1WBXA 3UO1H 3BFOA 4M8QA 4PTUA 5C07B 4JDZB 4OBRA 1IE5A 3IU4L 4D9LH 3ALXA 4FFYH 3WLBA 3SKOA 2GJ6B 3CVHA 3KPSD 2NY7L 3SCMD 1LP9B 1MRCH 4M03A 3GIZH 5DJDB 5DUPL 1BWWA 3VCLB 4N0CC 3WEXA 1A1OB 2F74B 4HGMA 5FM5M 5E2WL 3REVB 4G6KH 4KROC 3CZFA 5CD5D 5FF6A 5I76B 4EI6A 4NFCA 5D71L 5I66B 2NY3D 3MBED 3WN5A 2CIIB 3QEQD 1ORQA 2YPKA 1N64L 2R15A 3BQUD 4PYGA 3SDDB 4QOKA 4EXKA 5MEPA 2FNBA 1E4XL 3SJVE 2FHCA 1FFNB 2C1OB 5GGSY 3VFGL 4ONOA 3UEZA 1OAZL 3RWDA 1H9VA 4P4KB 4PJXE 5DJXA 3ZL4L 1FL6A 2B2XH 5DVKA 4OCYL 4JR9L 5JDSB 4M62L 1EGJH 5D7LB 1D5XB 5J6HA 5TE6L 1JGDB 2QSVA 1VB9A 1VENA 2W0FA 3TPKA 1BM3L 5E5RB 5MENE 4KUZL 4OLYL 1QBLH 4H88L 3WFDH 3IRZA 3I3BA 4URTB 3QWOA 3EYFB 3VE0B 5D1XD 1G6RL 1G0XA 3CVIL 1XCQA 4RBPK 4YBHA 3MLPA 3V4UL 1AR2A 4X9IA 3U9PH 1IGYB 2XIDA 3WXWH 5C0BE 4UMGA 1LNUA 1QA9A 1MI5D 3BHBB 1GOHA 4LLQA 3ARFA 3TO2B 2IJ0C 3G9AB 1ZANH 4PJBF 3VH8G 5CIPB 4G5ZH 1SVCP 4YC2C 3KYKL 3QYCA 2DL9A 1IGFL 5CP3A 4F57L 1U3HB 4P2QE 1PD6A 3QIWC 1NGQH 5FYLE 1Z6JT 3VXPB 4XMLL 1NUNB 2D7MA 5TF1H 4KC3B 1I4FA 5L2JB 2G75B 4ZTOH 2YRPA 2AEQL 4NDMA 1AHWB 3T77B 3ULUC 1TZIA 5ITFA 1I8KA 2C7UB 5GISH 4KKBD 1M71A 4LIQE 2Z31C 2FX9H 1AGDB 5HHNA 5CGTA 1MCLA 5FO9B 2LU3A 5C0EA 5F93C 1MFAL 2A6IB 4GRLA 1K4DA 1NAKL 4PJ7B 4HULB 3DURA 3AREC 4KJPD 5EZJB 2GFBB 5HSFA 3HE7C 5KW9L 3SOBL 1KCRH 3ZE0E 3EUUA 4JFDE 1CTNA 1OAKL 2DTML 3IDMB 4LSUL 5B8CC 3GM0A 4X0KA 1I85A 2AJVH 3CVHH 1P84K 5JPNB 1JF1A 3LVEA 4TUOB 5DS8A 3U4BL 1N59A 3UTTA 3QZWG 1A1MA 3B9KC 1KYOK 3MTRA 1GCFA 2FZ3A 3BP4B 4FG6D 2HA1A 4QRQB 1GPOL 4WWKD 2XPGB 3W39A 3GJEA 4ZS6D 1IC7L 4KI5F 1P2CB 2OK0L 2E7BA 3AAZA 2JK5A 3DARA 4KKCD 3EZ8A 1YYMH 4YDVB 5K33A 3UPAA 4XCFL 4IRJB 5E8PA 1U2CA 3CDGA 5E08H 2CK2A 3GBNL 4PJIA 5J12C 3V4VH 2VLKB 5IGXH 1AR1D 4RWYH 2UUDK 5EU7E 3QDGD 2YC1B 4N9OB 4Z7VE 5I30H 3WFBL 2X7LB 3MJ7B 4D0BB 5ID1B 3VG0H 4XI5C 1FVCA 3S3JA 2QSQA 2VDKH 4KJYA 1TITA 3MRHA 5IVXE 3UTOA 1FAKT 1RIHH 1P4LA 4HS6B 4NNXA 2PW1B 4GRWH 4POUB 2EDQA 3WIFA 3C2AL 4GFTB 2HVKA 4TPRH 4MJ6B 3SDAC 1F42A 2PTUA 3L3GA 3DROB 3FMGL 4NO0D 1WBYA 4XC1L 5TGBA 4MNQB 4L8DB 3BP5B 4TULH 5FKPA 4M6ML 1DFBL 3G5VA 1KTDA 3TBVA 4S0SD 3JXAA 3CGTA 4NQCE 1AIFB 4R0LC 1RUQL 4U6VH 4OZFB 3DETC 1VESA 2ARJQ 3H7BB 5E2VL 3UTTE 5C6TL 2PUQT 3GRWL 4WCYL 4RAHA 5L2KE 1MCRA 5C0IA 2VXTL 1CGUA 3O9WB 5DHYA 1W72L 3D3VE 1PG7H 1CU4H 4FQXA 3TM6A 1WF5A 2VH5H 5BQ7B 1GVIA 3T65A 3MNWA 4FZEL 1DR9A 3LEVH 3N1FC 4LU5L 5CBAB 5IB3A 3HMWH 1FZOB 4UTAL 2ADIB 1MWAB 5DSCA 3S36L 1MUJB 2N56A 5F3HB 3UZQA 3RZCA 2HLFC 5D2NA 1N5YH 4X6EA 4PJFB 1LO4L 2MCPH 4Y16A 2AJYL 1T66C 5D7JA 4NRXA 5GGRA 3VG9C 4NUJB 3S88H 4Z76B 1K2DB 1OQOA 4Y5XC 3VFSA 2FB4H 1SY6A 4AH2B 4JZNB 3TVMD 4KK6C 4X7TA 2IBGA 1YN7A 1UACH 2FEEI 3EO0A 3QEQB 3T4YA 4U49A 4M61A 5GGVH 4K3JH 2C9AA 4YHNA 4NJAL 4HS8H 2BNQA 4RGNB 1A6WH 1E4KA 4JY6B 4M62H 1XR8B 1R5VA 4OFVA 2IG2H 3ZT5A 3EJYD 3WO3B 5HVHB 3U0WH 3DI2B 4PJ9A 3CSYB 1OCWH 5C2UB 4Q9RH 1DP0A 2H9GA 4HUMB 5T1DH 4CRPA 3B2UC 1OPGH 4PB9L 3O4LA 2GAZA 1DVFB 2E9JA 1WEJL 4FQJL 4P23C 1DBAL 1V5JA 1J8HA 5ICXB 1FAIH 3QUMB 4JCMA 3AU1B 5F3HA 2P45B 5IOPB 1WTGT 4AEFA 2LU4A 4XP4H 4CVXA 4PRHB 1LEKB 3BH8A 2R4SH 1Y0LA 5T3XE 4XBEL 3LSOA 4LRNH