5L0QB

Crystal structure of the complex between adam10 d+c domain and a conformation specific mab 8c7.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'DIFLTQSPANMSVSPGERVSFSCRASQNIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFILSINTVESEDIAVYFCQQSNRWPFTFGSGTKLEVIRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disintegrin and metalloproteinase domain-containing protein
publication title An activated form of ADAM10 is tumor selective and regulates cancer stem-like cells and tumor growth.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/immune system
total genus 52
structure length 212
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l0qB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l0qB01
3U0TA 4HPOL 3RWDA 3WEXB 2Y72A 4W6XB 3EYVB 2AW2A 32C2B 4OLVH 4OUUB 4UTBH 5I16B 1WCQA 3CUPA 4G8FB 3JV4B 3VD7A 1S78D 5BXFB 1AGDA 3HE7A 1JZ3A 2EDYA 4QHMA 5DEGB 5SX5K 1UQSA 4M6AA 3MNVB 5ADOL 4PJXF 3OX8A 4D9LL 2J2ZA 5CSGA 3HUJF 1KV3A 2GW5A 1IJ9A 4QTIL 1NAKH 3X11A 5DZLA 3QUZB 3WNOA 1UGNA 5CMAA 4JVPA 5K9QG 5IHBA 2GJZB 3WIFA 4S1RL 4H20H 5T3ZE 3S96A 1TJHL 1MCCA 4HMEA 1MFCH 5IROC 2VC2L 4H88L 5EBMB 3MRKA 1H3XA 4NQVB 3UPRA 1XGQB 2E7BA 4MSWB 1FYTB 2Q76B 4CMMB 1I1RA 1UCBL 4FFZL 4HMCA 3ULVL 4K7PX 5K9KA 4R90H 3K80A 1JHLH 3THMH 2JJWA 5IB1B 5DHXB 2HKHH 4EZMA 1DN2A 4UU9A 4UQ3A 1ORQB 3MXVH 1TTGA 4KKBD 3W82A 2G9HA 1IRAY 1XZ0B 4LCYB 5FO7B 1GZPB 1N64L 1K6QL 1AKJB 1WK0A 3T0VA 1HKLH 1W72A 1A6UH 2FWOA 2YD4A 5KSAD 1Q9KA 3ZDZF 1XF3B 1BMGA 3NPZB 4J2XA 2WLZA 3LN9A 3BGFB 1CLZL 2OI9B 5DD5L 3NIFF 4AIXA 3RVTD 1Z2KA 4HPYL 1VFUA 2ZCKL 4HBCH 4RISH 5F93C 1VDGA 4HF5H 3PGCA 3IT8D 3GJFA 3RVVC 2BY1A 4UIKL 15C8L 3UTSE 1FL5A 5C70A 5EWIH 5E9DA 1UM4H 1YYML 1ND0B 1NCCH 1EPFA 2ZUTA 2P8PB 4LLYB 5H37H 1A0QH 1VFBA 4NO3A 4V1DD 1KENL 1GVIA 4NZUH 4U6XA 3V4VL 1JMXA 1MCOL 5JW4Q 4L4VA 3RDTB 5AUMA 2Y6SC 5D8JL 1JYNA 4IRZH 1MJJB 1AJ7L 2R56H 5J6GA 1SJXA 4NJAL 5IMKA 3TCLB 2YPLB 4HJGB 5D7IA 2YZ8A 1G7PB 5EU6D 3DSFH 1WQVT 3KPMA 4C54A 2AXHA 2BY3A 2IAMD 5SV3A 2BXYA 1WIUA 1PQZA 1FFRA 5E2WL 2WAHA 1JHKL 5SX5H 2GY7B 5TE6H 2SEBA 3MBXH 4AYFA 3BQUD 1VFMA 3VD4A 4P5KB 5FCUL 4Z78B 4PJXB 2NXZC 3I6LE 5DWUH 5I1AA 2FJHB 5L8KB 4G6JH 1FYTE 5KS9A 2JJSC 2VDOL 1AO7B 2IMMA 1MCIA 5EZOH 5BVJB 3FMGL 2J5LC 3NIDF 2X44D 5IROA 1MFEL 1LQSR 2N7BA 1ACZA 1K3ZA 4OV5B 3OB8A 3F7QA 5DFVD 1YMHB 1ZGLA 3OKDA 3MCLH 4MXVF 2HVKA 4EDXB 4JQVC 1AY1H 3QCTL 2HP4A 3MJ6A 3OAZK 4HKXA 5F6IB 3O4LD 3MV8B 3SY0A 3E2HC 4JJ5B 4ELMB 5I76A 4XWGH 4NIKB 1BQLH 3UTTD 2A6IA 4I2XB 4LHQB 4JDVA 1DSFH 4NKIH 3JTTB 3QNZB 2VLKD 3TEUA 4XBEL 4E41B 1CFSA 2KPNA 5EDXA 1LDPH 2CK0H 4MD0B 1CK0L 4DEPB 1SQ2N 4O2CA 2HLFC 4MJ5B 2KZWA 1MCKA 3IFLH 1MUJA 2FHCA 5HHMB 4NQSB 4N90D 4EBQL 4MWFB 4JFOA 5D96B 1YEKL 3GRWL 3MRNB 4KRLB 4PLJD 4UT9L 4B5EA 2FR4B 4NKOB 4X5XB 4NZTH 1HXYA 5DQDH 2D0HA 2XRAL 1HINL 4KRMB 4U1JB 1AXTL 4ODSL 2YPLE 4M62H 4X4XA 1IKFH 3RFZC 1FLTX 3SE8L 1CIUA 1MIEH 5IB4B 3W81A 1U91A 4P9ML 1NGYA 1U92A 3A6BL 1RZIB 1XGPB 4X7TA 3V79C 2EC9T 4UUJB 4RGNB 1M05B 3F5WB 4TUOA 3EYUH 1GOFA 4ODWB 3BN3B 3IDIA 5C0AD 4RRPG 3MRCB 3FRPG 5HGDB 4GXUN 2W0FB 4PJXE 1RK1A 2A73B 3OF6A 4X7FC 3QRGL 3C9NB 5ACMA 4NWTH 1L6XA 2Z93A 1AO7E 4YXHH 4JQIH 4ZS7H 5FOBA 1MPAL 2NW3B 4M5ZH 4Q9QH 2VLLB 3KPQB 4L4TB 2DI9A 2NY6B 4HLZG 5TF1L 1R24A 3RVUD 5GRWA 4ZPTB 1Q9OB 1RUPH 4PP1D 1K2DB 3T0ED 5DQ9B 3S35H 3W9DB 4HS3B 4FXGB 4PB0H 3DX8A 4HUVB 1VFAA 2DTSA 1EUUA 3LS5H 3MV8E 4U33A 4ELME 2Y36L 3HMXA 3MUGA 3QIBD 3F58L 3MUJA 5E99L 2F19L 4OIBA 1R3KA 4LVNB 1JPST 3JV6A 4NO2B 2DBLH 4I2XE 5C09B 5IW6B 4WNQB 4WDIB 5AWNH 3MO1A 3HZKB 1KLGB 3EYSH 5L2JA 1FZJA 4JQVA 3D25A 2EH8L 4ALAH 2P42B 5IT2L 1T1ZA 3U1SH 3G6JF 3BGFC 4E41E 5IMLA 2LABA 3GSVB 3OAZH 1I9RH 5CGMA 2P5WB 2D7TL 3F6IA 1IC7H 3MUY1 1YN7B 3OKNA 4ODUB 3E3QE 2B20A 4NN6B 4JN1H 3H7BB 3QO0A 2NY5L 3NBNA 2G2RA 1YYLH 4AL8L 1JE6A 2P44B 1RIVH 1R5VA 1S7UB 5HHME 1OVZA 2Q7NA 3U4EA 3O3BA 3N1GC 2DJ4A 4FQXB 5FKAB 1SBBA 2DL9A 5TJWK 3O3AB 1E4KC 2DQHL 3V6FB 3RHWK 1YEJL 2FBJH 5DK2B 1J0YA 4JR9L 4NZRH 2FX9L 3FN9A 4XTRD 3OZ9L 3RDTC 4X80H 3FT3A 3UTSA 2AEWA 1EERB 1I85C 3LPFA 1KTLA 1MI5B 5GRVK 35C8H 1D9KB 5C9KA 3O6LH 3FOLB 2A1WL 2DQJL 4RGMB 3WEXA 3B2UD 3QR2A 3EYVA 3VRJB 1MRDH 4OUUA 3T0DA 3HRZB 5I16A 4G8FA 2EDLA 3H7LA 4UI2A 4RGNE 1FFNA 5J56B 3JV4A 4NBYB 1NCNA 1Q72L 3U0WH 5BXFA 5DEGA 1LO0H 3KPRD 2C5DC 4AIOA 3SGDH 3MNVA 3CVIL 4EN3D 1D7FA 4LCIH 2JELH 4JZJB 1QNZH 1TVDA 2X2YA 2DD8H 4S11A 1UG9A 1A1OA 1F2QA 1V7NL 1WAAF 3K7UA 4G80B 5E56A 5D1XD 2W0LA 3QUZA 3LMJH 1C16B 4L4TE 4J4PC 1S7TB 2GJZA 1T89C 1P7KA 1A3RH 1OAQL 2K1MA 5EBMA 1JUFB 1TZGH 1XGQA 5CEZH 1X44A 5E8PA 1FYTA 4CMMA 4UINH 4ZFZB 1N5YH 4PJCF 1FLRH 3A0OA 5F6IC 5C09E 3D3VD 4KRPB 5IB1A 1JI1A 3QYCA 3BWAB 5KTEH 4BZ1L 3ARED 3MMEB 5DQJB 4KKAD 4UB0L 1ORQA 2NY4B 3ARYA 5CZXC 4X9FA 1E0OB 4Q6IB 4YX2H 1XZ0A 1UXSA 2P5WE 4LCYA 5FO7A 3JXAA 1GZPA 2QTEA 1U8MB 4FQCH 4P3CH 4U7SA 3HLAB 2ZUYA 2DQTH 3ULVE 1XF3A 2G5RA 3E3QC 3DUUB 5ALCH 1NL0L 1OM3L 5DK3A 1CXHA 5F7FA 3ZT6A 4OJFL 3ZHLA 3BJLA 4PLKD 2ZOKA 4WUUB 1S9XA 3BMVA 2J6EA 4POYA 3T77B 3G6JB 5D96C 4OD1H 4IOSD 3HA0A 3DMMC 1F8TH 1U3ZA 3IFNH 1NC4D 1EGJA 4HX1B 4DKAA 4DN3H 3DWTA 1RI8A 1NBZB 3AS1A 5HYEA 4LQFL 1MI5E 4YXLH 1ND0A 1E4KA 2AJVH 2P8PA 4LLYA 3C6LC 3PWNB 3E8UH 3AU1B 5I1HH 3SCMC 3RDTA 2HRPH 5GRXG 4PGCB 5EOQL 3UPCA 1ZKAA 2UZIL 1F58H 4RGNC 4JO2H 3TCLA 2YPLA 4JKMA 3MFFB 2X41A 4HJGA 4F37K 1G7PA 5FCSH 3QBTB 3TBSB 1AR1D 2V5RA 1AE6H 4ORGA 4OM1L 2EYSB 1X4XA 4I77L 1D6VL 3BKJL 3UX9B 5HSFA 1E28B 1I1CA 3CFJB 4MDIA 1W0YT 3BUTA 4MVBC 4PLNC 4LRIC 3NMEA 4DW2L 3DV6B 3OR7B 3RTQB 4WI4A 4DK3A 5I1IL 3M8OL 5DMGD 5B8CB 4P5KA 2UUDK 4PJXA 3L1OL 3O2WL 2XKSA 1DBAH 3QFJB 4YPGB 4J4PA 1AO7A 2FH8A 3I6KB 3LIZL 1T89A 5I8OH 1J8HD 4LCWB 3TGXA 4QT5B 5B39G 2VXSH 4K23H 3LH2H 1FIGH 1JNLL 3W39B 4FNLH 1A7OH 4XNQB 2YHGA 4LVNC 3WDJA 3PUCA 3V8OA 4H8WC 1YMHA 1VGKB 1N64H 4YXKH 3VI3E 4EDXA 5L0QC 3MV8A 1HZHH 4BK4A 4JJ5A 1OD9A 4ELMA 1AP2B 5GRYA 4I9WE 1HIMH 4I2XA 1HCFX 1IAIM 2XY2A 3JTTA 1B88A 3D6GA 3QNZA 4NN6C 1MVUB 5F6HI 4XP5H 3AFLA 1GAFL 4WUUE 4E41A 1U2CA 1LP9B 4MNGB 2CUMA 3G6JE 3OXRB 3TESA 3RAJH 2PYED 1U95B 5C07B 4MD0A 4WWKB 2BDNH 1HHIB 4NCC1 1MHEB 4NQSA 4MWFA 4QXUL 4TUJB 3NH7H 2EO1A 2HKFL 3A67H 2MJWA 3MRNA 4RGMC 2FR4A 1EZVY 4NKOA 4X5XA 3ARTA 1WZ1H 5HHOB 2FD6H 1OLLA 5KOMC 1HSBA 4YFDB 4PB9L 4U1JA 5BVPL 1CR9H 5A1AA 4TRPH 4L9LB 4BQ8A 2DTMH 4MJ6B 5M7QA 5IB4A 5LGHH 4HW6A 1NLDL 1RZIA 3KJ6L 4LEXL 4XNUH 1ZA3A 4NRXB 2BVYA 1M05A 4G9FD 4U4BA 4FS0A 4XX1G 4M3KB 1DE4B 2E8YA 3C87A 3CCHB 4WENB 4ODWA 4ZFOL 3BKCH 4RX4D 3MRCA 4BZ2L 5HGDA 3V7AE 2W0FA 4RA3A 5E8NA 2A73A 1AXSB 2OM5A 3C9NA 1SEQH 3QFJE 1OSZB 4LRIA 2Y5EA 2NW3A 3EZ8A 1WAAE 4N68A 3FQRA 2VLLA 4LCWE 3KPQA 4L4TA 1XGYL 3RIAK 5I17A 3ZL4L 1INEL 1OTSD 4CVXA 3QCVH 4D9RD 4ZFGH 4R7DB 4XCFH 2QKIB 3O2VH 2JB6B 4ZPTA 1Q9OA 2UUDH 1OB1B 2PF6A 1K2DA 1HCVA 4AZ8A 4LASL 2V6HA 1D6EB 5F1NB 3D5OF 1AGCB 3W9DA 4FXGA 4HUVA 3CAFA 3O2DH 4Q6IC 2EDBA 1I8IB 5GSRB 3R0NA 3V6ZB 3RY6C 5IBLD 3GSXA 4NO2A 1FVCB 1KCRL 3AUVA 1HHJA 2WUBH 4OD3H 1F6AB 4WNQA 4WDIA 3HZKA 1KLGA 3VFMB 2N1KA 4OZFB 5CZKA 3KGRA 2BMKB 3GHBH 3GSVA 4WGWB 1LP9E 4MNGE 2P5WA 5F97E 5EBGA 2HMIC 1EO8H 3TH4T 3NVQA 2WSKA 3MA9L 5C07E 3BRDA 3O6FC 1YN7A 4TNVK 4ODUA 4W4OA 4APQB 1HHHB 3TYGH 3EO1A 3O3AA 3V6FA 2L7UA 1DANU 4MAYD 5DHVB 5DK2A 2VZ3A 3RVXC 5C0RH 3MLRH 4WU5B 2GSIB 3VXQB 1BEYH 3P30H 5I1DB 4MMXC 3UJTH 4HT1L 1MI5A 3AMKA 4XPFL 5EPMB 3S5LB 4UILH 5I66A 1Q94B 3K4ZA 3QUXC 1GPOL 2WV3A 3VRJA 3A6OA 3HRZA 2FCBA 3OXSB 2AV7B 1JYWA 4AMKL 1LVEA 2H32H 1NFIB 4OQ1A 2J1KA 5C7XH 3BWUC 3OPZH 1IC1A 3QRGH 3EOYG 4NO0D 4JZJA 3BZFB 4AY0A 3RTQC 4JM4H 1MRCH 5B8CC 4R97C 1BAFH 2ZUXA 1DL7L 2VJXA 5DGQA 4G80A 1Z0MA 4HZAA 4Y16D 3IB4A 1C16A 4RIRA 4HFUL 4FQJL 4M43H 1KCSH 5J1TC 2VDLL 3O6KL 4GOSA 1NUGA 2OK0L 5KW9H 2N56A 1JUFA 3BD5A 2EDRA 2V7HA 2HJKB 3DARA 2YKLL 1I8LC 3BDBA 1ZS8B 4EDWH 3SDAD 3WD5L 4ZFZA 3WIHA 1NMCC 3PF2A 4MQTB 1G7HA 4DN4L 1WVZA 2GT9A 1JNNL 3BWAA 3O8XB 1T7ZA 5H35B 3MMEA 5DQJA 5IJVB 3WNMA 5A40E 1EHNA 5ELIA 1SM3H 3C60D 4Q6IA 3RY6A 3LQAH 1S7VB 3B8YA 1FRGL 1QPPA 4FQIH 2YOCA 5LBSL 3DX9B 2D7MA 5C0ND 3U6RB 1WWWX 5E95B 3HLAA 4EUPH 2R0LH 4M00A 1RZ7L 4WWKC 1RMFL 1FFPA 3DUUA 1I1AB 2NMSA 2E9BA 3CFDB 4LVHB 3WS3B 3ROLB 2ZCLH 3BZEB 3O6FA 4I48B 3G6JA 4YBLC 3NACH 5DTFB 4X7CC 4ZUUB 5FIEA 2NYYC 4U1MB 1EEQA 2DQJH 2VLRA 1M6OB 5ENWB 4XNMA 1Y6MR 5DD0H 1CWVA 4OFDA 2DLFL 4L5FL 4WHYH 2V9RA 3S4SG 4L9LC 4U1GB 5GS0C 3PWNA 2IQ9L 2IJ0C 3AU1A 4X9GA 1A6PA 3CFCL 2NY0C 2WBKA 4U1LB 1IMHC 4PGCA 4L1HA 4U1NB 4S1DD 2DQUL 3MFFA 1OY3B 1YNTB 3KXFD 5FYJU 4PJ9D 4I5BB 4OT1L 3TBSA 3DHJA 4OLYL 4K94C 4QHKI 4KGJA 2EYSA 2DMKA 4O02L 4Y5VB 1OP3K 3MROB 1E28A 1B3JA 3BXNB 2VXQL 3CFJA 5TDOB 4NN5C 4KJQC 3BGAA 1LO3L 3DV6A 3DVNB 3OR7A 3RTQA 2FJGB 4GRLD 5MHSD 1FZOB 3ULUL 1I4FB 4JRYD 5B8CA 3GBLA 3VXRD 3GJFK 3BYTA 4XNZC 3TT1L 3QFJA 2BJMH 4YPGA 5EIVA 1G7QB 4LPTA 3DETD 3MRGA 2NZ9D 3I6KA 1P4BH 3VH8G 1WAAA 4LCWA 4RMQA 4QT5A 5T5FL 4Z7NF 4Z7OF 4WFFD 4XPAL 4LLDB 4LEOB 3L5HA 4JGJA 4XNQA 1DBKH 1VGKA 4ZFOB 3WIIH 2FLRT 4JRWA 4U6TA 5JOEA 3ZSSA 4MGXA 3QCUH 1K3IA 2R0WH 1CT8B 2D03L 1Q1JH 2CJUL 4YHZH 2APTA 4J12A 5DSCB 3NFNB 3QA3B 2FO1A 4PJCA 1NDGB 1XIWD 5D9SB 1C5CL 4PJ5A 1J9CT 2NX5B 1MVUA 4FXLA 4KPHH 3ZDXF 1BQHG 1MCFA 3MV7B 4OI8A 2EDEA 4F7TB 1LP9A 4KTDH 4MNGA 3OXRA 4WI6A 2EO9A 5LXGH 3SGDI 3PV6A 1JYXA 4X7SH 1M71B 4Y2DD 5C07A 4WWKA 2F5AL 1UJ3C 1HHIA 1RVFL 3HE6C 4R4FL 3U4AA 1I1FB 1MHEA 3RGVB 1FPTH 3C8KB 4DKEH 2OSLB 3MJ8B 1HH6B 5F9DC 3EO0B 4KKNA 3MJGX 2OXHA 4NFCA 3HFML 4OCXL 5EG6C 1EFXD 3CXHJ 2A9NH 4JFZL 4N0YL 4C4KT 4PV8B 3L3OB 3CZJA 4UMGA 3S34L 3LEVH 4WTZG 4OM1H 4WV1B 4L9LA 4UDTB 1NGWB 3AVEA 5CILH 3JUZA 4HIIB 3TA3B 5JA9A 4EOWH 4MJ6A 1V8HA 3C5ZB 2P43B 4NRXA 1KIUA 5T5NG 3FO0L 3FZUD 2FX7L 1YEHL 1CICD 2FATH 4P3WA 4PUBH 4XP4H 1DE4A 3CCHA 1GHFH 2FNBA 3MODH 2Y06L 3V6BR 3S36H 2AJ3B 2DL2A 2QHRL 2X89D 3CSBA 5FDWB 1AXSA 3MLYL 2L4OA 5HI4D 3RPIB 1F4YH 4MNQA 5F7KC 5D71L 1OP3H 1ROWA 3E1F1 1KTDB 1S5HB 3SE4C 2VERN 5FYLH 4TNWK 3LKQB 2ICWI 4YDLC 5EUKB 3NZ8A 4R7DA 2QKIA 1ZLUK 2JB6A 1I3VA 1OB1A 5GSVB 3GJFH 3O8XC 5F1NA 1AGCA 4HQQH 3O0RL 2BZDA 1RUAH 3V6ZA 2D7QA 4N5ED 1FVCA 4C56B 4X6DF 3HNSH 5BOZG 5CIPA 4YAQB 1F6AA 1GAFH 5DLML 5EC1B 3BPLC 1AD0B 3VFMA 3SKUD 2NX5E 4NPYB 4YWGL 1T5WB 3U30C 5DO2D 1F90L 4IJ3C 1DTUA 4LFHG 3UBXI 2FHFA 1WLHA 5TE4L 4LHUG 3MV7E 3PL6B 4JFEB 4GMTH 4OCYL 2FSEA 3WKML 4NNYB 1K85A 3VG0H 1FL6A 3V6OC 3E0GA 1IGYB 4FQ1L 4HC1L 4HGMA 4MQXC 4APQA 1HHHA 1MRFH 3U9UB 4YGVB 1JK8B 4XMPH 3PNWB 4YBQC 2VXVH 1MFBL 2VDRL 2X4UB 5DHVA 4U1GC 1CZ8L 1CDYA 1UJ3A 3HG1D 5KVGL 5CLTA 2GSIA 5CEZD 4I18B 3VD9A 3DRTB 3VXQA 1PG7L 4NNPL 4OLXL 5EPMA 1BVLB 1NLDH 2XWTB 4WFEE 3S5LA 1Q94A 1PW3A 4X6EA 4N0UB 3TJHD 3OXSA 4F2MB 2AV7A 3MFGB 4Y5VC 2NY3B 1NFIA 2EXWC 1DQDL 4UT7L 4M7ZC 4O2EB 4AEHL 3RX7A 1WCBB 1G9ML 3BZFA 5GXBB 1NC2B 5ITBL 3OQ3B 5EOTB 3SDYH 3PJSB 3IU4H 2ARWA 1J1XH 3FO2B 2AGJH 3ZMRA 3HI6H 3MOBL 4H8WL 1IQWH 5D1ZD 5FUCE 4KQ4L 4Y2OA 2FH6A 1U8IB 3GSNL 4OBSA 3VW3L 5JXEA 4KZEL 3WFCH 1YY8B 2FECL 2VYRE 2VH5H 3SE4A 2EDOA 1ZS8A 2O5ZL 4Y89A 3ZE1F 4LOUC 3ILQC 5ALBL 4C56E 5EO1B 1FL3B 1OGAA 1IFHH 3MQIA 4P0DA 1GOGA 4O51B 4NQCD 4R96B 3ZZ1A 3O8XA 1ZLUH 5AG9A 4DKDC 5H35A 5IJVA 3QI9C 3MLZH 4JFEE 3EKCA 4Y4KB 1S7VA 1E27B 4MB5A 3DX9A 4O5LH 4WW1A 3U6RA 1CXIA 1MY5A 4CW1B 3G5VB 3SE9H 1CCZA 4K3DH 3QNXB 4YBHA 4X6DB 1I1AA 2F5BH 2R15A 3QXVA 1A6VL 3I2CH 3WS3A 3ROLA 3RGVC 4NO5B 3HC0B 4Z77B 3PP4L 3UCRA 1EJOH 4I48A 5GISH 4NM8L 2ATKB 4GRWF 1UC6A 5DTFA 2APBA 1I3RB 5HVGB 4PJ7B 4FRWA 4U1MA 1I8KB 2XTJB 3WFEH 3WJJC 1M6OA 5ENWA 2WP3O 1KFAH 4M7JL 4Q0XH 3C08L 4A2MA 2IAMC 1A9BB 3NCFB 4JM2F 4N9OB 4N0UE 3O6ML 3UTOA 1CDCA 1NQBA 3RBGA 4U1LA 5B21A 3QEHB 4FQLL 5SWQB 4OFKA 5CHNA 3BQUC 5TQ2H 1FORH 4U1NA 4HK3J 3UROR 1S7XA 1YNTA 2NY2B 4I5BA 1QSEB 3KYKL 1JGDB 3KPLB 3NAAH 4TVPL 4FQJH 4YHYC 1YJDC 4LAJH 4Y5VA 3K1KC 2Z8SA 3IDGB 1YEGH 3MROA 1M7DB 3BXNA 1H3PH 1MQKL 5TDOA 5EZLA 3VXSD 5D1QB 1R5IB 3G5YB 2W9EL 3DVNA 2FJGA 5DFVC 1FZOA 5GRJH 1RFDL 2DKSA 2YKLH 1I4FA 1CE6B 2DJSA 3WD5H 2A6JB 5FUCC 2XN9D 3S88L 1UWGL 2QADB 3BX7C 2NY1D 1G7QA 3IYLW 4HK0B 3D69B 3N9GL 1JNNH 3PDOA 4CDHA 4Y0GA 1NGQH 2XZQL 4P23B 1C8PA 1BJ1H 1CI5A 4LLDA 4LEOA 1G7MB 2B8OT 4UZGA 3FHQA 1ADQA 1XF2B 4OBRA 4UNUA 1N5AB 3ULUE 4LRNL 1QOKA 1Y6NR 1K4CB 4C4KO 1XF4B 5DJ8B 4YO0B 5ISZD 1MFAL 4DTGH 4GG8B 5HI3D 2L0DA 5IR1B 5DD3H 1A7QL 3EDJA 2XFXA 4YLQT 5DSCA 3NFNA 3QA3A 3ARFC 1NDGA 5J12C 4F33B 4FTVD 1ZT1A 1PKOA 4X6DE 2NX5A 1HILB 1IGFH 3NPSC 4PLJC 3MRBB 3DI2B 4TVSa 4LLVA 1N4XL 1FGVL 1PVHA 3MV7A 5EH1A 4F7TA 2VDQL 2HFTA 1MREH 3N1QC 2MCG1 4EI5D 3B5HA 3EDEA 3K2UL 4LHUD 4PJ7E 5F72S 3CMOH 4YHML 5L2KA 1A5FL 2AK1H 2XTJE 3PWJB 2HWZL 4ZNEE 5JUEH 4LAQL 4PYHA 3G6DH 1OAZL 2FEEL 4I18C 3DUSB 3RGVA 3C8KA 2YRLA 4Y4HD 2VN7A 2ICWJ 2AJYL 2OSLA 2PW1A 3MJ8A 1HH6A 3EO0A 4YHIB 2X09A 3JWOC 3EO9L 1E6OH 4PV8A 3L3OA 4PGDB 4XPHL 2HTKC 1DN0B 1OCWH 1S9YA 3RQ3A 1CLOH 1B2WH 1F42A 3GSWB 1AFVL 2BFVH 2NY3C 4WV1A 2PETA 1QSEE 1NGWA 1TXKA 2W1NA 4UDTA 4HIIA 1BLNB 4HKJB 4LKXB 1QRKA 5JOFB 1KN2H 1DBMH 3VJ6B 1ZGLP 3QEQA 3C5ZA 2VLJB 5D6DC 2E6PA 5CWSB 5ECJE 3VWKB 2PXYB 5E2VL 2OTUB 1TVBB 3UXFA 3D0LB 1KPVB 3QDGD 3M45A 4J3UA 5JIPA 2AJXL 4OSUH 1CGYA 1JF1B 4RMVA 3H9SB 3OB0K 5FDWA 4JFFB 4N8CH 4LSSL 4AG4H 3NOIA 4OLZH 3ARBD 2BOCB 5LJYH 2OX5A 2QLVB 2CO6B 4GLRI 1MELA 3BW9B 3K8LA 1KTDA 1S5HA 3DPBA 3QAZB 2DM2A 5IBUG 1Z3GL 4BFIB 5CJ5A 3GEWB 3LKQA 1X5AA 1LHZA 5ESAB 1RV6X 2KDGA 5EUKA 4WI8A 2X4SB 1BVKB 1WWAX 1H5BC 2DQFB 4NZJA 2EYRB 1EGJH 3HZVB 1WBZB 3RZCD 1B4JL 4F8TA 3EAKA 1T1WA 5I1EL 1IILE 2CDGB 1CL7H 1KC5H 4RCAA 4C56A 2YD8A 3ZE1E 4CVZB 5EC1A 4YAQA 4KI5F 1TTUA 4C57C 1RZKC 4HIHB 4XP9L 1ZANL 1AD0A 2NR6D 2Q3ZA 5IBTH 1T5WA 3IAPA 5IHUL 3W5MA 4OD2B 3H3PL 5E2UL 4OF6A 5J4MA 5BS0A 3PL6A 4K3EL 3GSNB 3V9FA 4NNYA 4A6YL 2B5IC 5F7NC 1JN6A 4K9EC 3GBML 1QSFB 3MREB 4XMKL 3V7MA 3RU8H 3NCYS 1QO3B 2FIRT 1IGYA 1PLGL 2DQCL 3ARGB 2P5ED 5EC2B 3DO7B 1SYSB 4XCYB 1GOHA 4ZD3H 3RKDD 3U9UA 4CN4A 1JK8A 2FEDD 1NAML 9CGTA 5TE7L 5LAXA 5E7BA 2X4UA 2K7PA 4LU5H 1YECL 5T3XL 4MA7L 5F8QC 4I18A 3DRTA 1WTLA 5FM5M 3C5SB 3Q6GL 4DZ8B 5E08L 1BVLA 1ZGLM 2XWTA 1GJIA 2AKRB 4ONFL 3B9DA 3TO2B 4GMSL 1W0WB 1CYGA 4MLIA 4N0UA 2NY2C 1FAKT 5JQ6H 2VLJE 1U3JA 1KCVH 1CFBA 1G9NC 4MXQC 4NC2B 4F2MA 2Q8AL 4P46B 3IDXL 1H3VA 2ZPKL 4E0RB 4M5YL 3V52L 4YC2B 3MUZ1 3GM8A 5L9DH 2B7DT 4O2EA 4WFHD 3H9SE 3WXWH 1WCBA 4JFFE 5D6DA 1NC2A 5D71H 5B22A 5LCVL 5EOTA 3PJSA 1MWAH 1PKQB 1U9KA 4WWID 3FO2A 1FNSL 1U2HA 1RULL 1RUKH 3DROB 1FE8L 2BNUA 4JRXE 5F1IB 2VIRB 1J1OH 1YQVL 3P77B 5CJBA 1FO0B 4BQCA 1I9JL 1JGLH 4S10A 1U8PB 5AYUL 2RQ8A 4P23C 1U8IA 3OB0H 4Z8FL 1TETL 5HTSA 5JPNB 1IGJB 1YY8A 5ILTH 5GS1C 1R0AL 1HEZA 1Z0NA 1J0HA 1PX3A 5B4MD 3MOAH 2A9MH 4F7EB 3ZTJH 4KUCD 3CXDL 1FVEB 3MLUH 1ZTXL 4AH2A 1RUQL 1P53A 4HWBL 5EO1A 1FL3A 1A14L 1I8MB 1D5BB 4R96A 3B3IB 1LD9B 5KOVC 2VTFA 3HC4H 3QQ9D 1EO5A 3WKMH 2R0ZH 4XH2B 1O5DT 1T0PB 4KTEL 1LEKB 1E27A 3BD4A 3RWEB 1QSFE 4CW1A 3G5VA 4KMTH 3SQOL 3QNXA 4X6DA 1NFKA 1CZ8H 1UACL 1IAOB 1AQKL 1M1SA 4Z77A 4NO5A 4HXBH 3T3ME 2ATKA 1ZK9A 5CZVH 5F9WC 3CVHL 3MCKB 4GKNB 4XAKD 1OQOA 2CGRL 1I3RA 4LSTH 4PJ7A 1HKFA 1EEZA 1I8KA 4ZNEA 3P0YL 3Q3GB 3BJ91 4HCRL 3HR6A 1QSZA 1NDMB 5DDHB 3QUYD 1A9BA 4HJ0C 1BX2A 1OAYH 2DIJA 1DQDH 4RGOH 1NGZB 3QEHA 4JDZA 5SWQA 4JM2C 4OCLC 2RAMA 5C0JB 5JOPE 3T0BA 2H6PB 2MWCA 3PHOB 4ONOA 5I6XB 1QSEA 5F21B 5DURB 1UWEL 1JGDA 3KPLA 4PBXA 4P4KC 3QHZH 3MGAA 4XP6L 1PKQE 4H8WH 1A9EB 5L8LB 3RA7L 1M7DA 2VSCA 3D9AL 4LP5A 1DZBA 3HE7D 2LAAA 1V5JA 2RIKA 4HV8B 1FZKB 3G5YA 1SJHB 4B0MM 2DM7A 4P5TB 4ZSOA 1CE6A 2WBJD 4OTXL 2DMCA 2VDML 1YEIH 4GG6F 3TJEH 3X17A 2KZ1B 1S7RA 4NP4H 5F7DB 5DVOA 3BPCB 1IAKA 4HK0A 4IIQB 1F11B 3D69A 4CU7A 4RFEB 1ODAA 3E6FB 4M1CD 4P23A 5HY9B 1CDUA 1KIQB 1VGEH 1XAUA 4ZPVB 3D2UB 4DGIL 1MF2L 5GS1A 2R4SL 2R9HD 4IOIB 1XF2A 3WXVH 1T6VN 4K71B 1N5AA 3ARXA 1U8NB 1K4CA 4HDIB 2IPTL 5DJ8A 5DJDA 4MS8D 4FQ2H 3FTGB 3HHRB 4RFOL 5IR1A 4EEEA 3CFIC 1QFWL 3QJHB 4F33A 1ZA6B 4ZO8A 3PP4H 4H25B 1G7JB 2E6JA 3ARGC 3MRBA 1F02I 3P11L 4JFHE 1FHGA 4P2RB 5DZOA 2DICA 4QXGH 4HJJL 5BJTA 4JO3H 5DMIL 1ITCA 3PWJA 1UYWL 3DBXB 2VWEC 5CINH 4PD4J 5FYLD 1CGXA 1QFHA 1KYOJ 2ARJB 5D7JB 2W07A 2ITDA 4D3CH 3QUKB 1N2RB 3V2AR 5SX4H 4HUWB 2VRAA 4LIQE 3VI4E 3ARQA 1AI1L 4PGDA 4GBXC 1DN0A 1PJ9A 1U8LB 4HBQA 5T1LA 5E9DD 3ILPB 2EIDA 3GSWA 4A6YB 4GSDH 1T21B 4O9HL 1I7RA 4WI2A 5DUPH 1I75A 2Z31B 4HKJA 3WIHH 4LKXA 4HC1A 4N8VB 5JOFA 1B0GB 3VJ6A 2VLJA 1DQML 1L7TL 3CMGA 4JM2A 2V7NB 4HD9A 4XAWL 5CWSA 3VWKA 4L4VD 1BWWA 2PXYA 3UAJC 1Q0XH 2Q3AA 2V2TB 5HYJB 2OTUA 1NAMB 1TVBA 1T0MB 3D0LA 2OZ4L 1JZ2A 3FRPA 1L7IH 5FA4B 4P4KA 1R3JA 4X9HA 1EMTL 1JF1A 1KG0B 5LKNA 3H9SA 3CSYB 4ZOCA 4JFFA 3WUWG 1FYHB 4XC3L 3VGGA 3CLFH 5IBLC 3BW9A 4K3HA 1JGUH 4JRXA 4BFIA 3O11B 5FOJA 1T2XA 5ESAA 4UNVA 4P2YA 3A6CL 3O9WB 4JANB 4N8PA 2X4SA 1CFVH 2WLYA 5DD1H 4JY5L 1T03H 2XOTA 2B2XH 4NYLB 4N1EA 1JVKA 3X13B 5GZND 1PSKH 3DIFB 4R8WH 2EYRA 5FYJH 3VMNA 2PN5A 1WBZA 2ED7A 2R1YA 3LVEA 1DANT 1B6DA 1CXKA 3MRPB 1JTOA 2CDGA 4K55A 2X05A 1BP3B 4LBEB 4CVZA 4HIHA 2E7LA 4TQEL 4WCYH 1IM9B 5D2LB 2O61B 3V5DB 2EDKA 1JF5A 4P2RE 2DDQH 1NLBL 3OG4B 2VQUA 4KI5C 5D72L 4R9HA 3KS0H 1IGTB 3TNMB 4NUGH 1QSFA 3MREA 2YD5A 1QO3A 2NLJA 1FNEB 2WUCL 4GKSB 3HI5L 1KN4H 1QFUL 2XI9A 5EC2A 3ARGA 3DO7A 1SYSA 2I60L 4XCYA 4N9GA 3G08B 3O4OB 1E4WH 5HHXL 2C9AA 5DC9B 3SDDB 3X3GH 2VR4A 1J05B 1RY7B 3PGFL 4NM4H 4TSCL 5D7SH 4O00A 1EVTC 5INCB 1V3MA 2X4NB 4GXUM 4U3CA 1S7WB 3OR6B 2BVPB 2VDPH 3BP7B 3C5SA 4I3RL 3W2DL 4WY7H 4JPVH 2AKRA 3LHPL 2O5YL 4DZBB 3KPSB 4YDIH 3TO2A 4X7DC 5CEXA 2ED8A 1W0WA 4WFGD 4I3SH 4WTXA 4Y16C 5I6XC 3OWEA 5KVEL 3UJIH 3RVVD 4U1IB 1S8DB 2JCCB 5HYJE 1H8OA 2QSTA 4XX1E 3VGHA 4P46A 1E6JL 3CX2A 4N0CD 4E0RA 2AXFB 1PG7X 3BE1L 4KFZC 5FHBH 1OLZA 5T3XE 3CVHB 4D94A 4M48L 5MI0B 3ARWA 3EGSA 4NJ9H 1FNGA 4G7VH 2X1QA 2A6DB 2UVFA 2Y6SD 3P73A 5EU4B 3SDAC 5D7KE 1S5IH 1PKQA 2P7TB 4ODTH 3DROA 5F1IA 4WW2F 2VIRA 1J7VR 2FGWH 3DXAA 3IDMB 3P77A 1FO0A 4LGSB 4PJFB 3FFCB 1A22B 1DEEA 1U8PA 2P48B 1N7MH 1P9MC 2W0KA 3QG7H 1AD9B 1JPGB 1TPXB 2FX8H 5EULV 5JPNA 3OF6D 5FV2A 1IGJA 2D3VA 5FECB 4NRZB 4PR5B 1CQKA 4HXAL 1DLFL 2VDKH 1EVUA 4K71C 4F7EA 3GIVB 5EA0H 1FVEA 5IV2B 5E6IB 5F9OH 5JW4R 4O58L 2NXZD 1I8MA 3B3IA 3PXHA 3KYMA 1LD9A 4KY1L 5CLWA 1PG7W 4LPUA 5D2LE 2QQLL 4PFEA 3QNYB 4FZEL 4JFQB 4HS6B 2OMNA 3OSKA 4XH2A 1MCDA 2IH3B 5BCAA 2IH1B 5GS0H 1IT9H 4I0PC 4AT6B 5C0BD 2NY7H 4DVRL 4IDJL 5HHVH 3IRZA 2V5TA 4GS7B 3HAEB 4XPGL 1HI6B 4K94H 1G0DA 2B0SH 5DJ6B 5DJ2B 4S1DC 3LKNB 4GKNA 4M1DL 4XNXL 1DR9A 5E8DH 1MSPA 2BNQD 4J1UB 2MPAH 3Q3GA 1CDHA 1P6FA 2K7QA 1WGOA 3JWDC 3ZKXB 1NDMA 3KPSE 5DDHA 3HS0B 3S4SB 5T5NF 5CEYB 3BISA 3DGCR 2JCCE 2HLFD 1NGZA 4ZOBA 4KHXL 4M93B 3V4UH 4GUPB 4OCNC 2R69H 4Z76B 5HYSB 3UTSD 1SMOA 5C0JA 4X6BA 5IJKC 1GGIL 3PHOA 3VFUB 3X3FL 3IXAB 3DETC 3WO4B 1CL7I 3ZKNC 4FOMA 1YQVH 3EFFB 5CIPH 1A9EA 3QFDB 1MJUL 1KPUB 4HS8L 5TDNB 1MHPL 4WEBH 4ZMAT 3FRUB 4HV8A 1FZKA 1DVFB 4HWNA 4PJFE 3FFCE 1RUMH 1P7QB 1SJHA 4UV7H 1BGXH 4JKKA 2WM0A 3HNVH 2IPKA 4Q9RH 2XQBH 5JZ7D 5KJRL 4JDTL 2E9IA 3BPCA 3QUZD 3QDHA 1F11A 3SO3B 3E6FA 1S7SB 2OR9H 1P9MA 5HY9A 2E27L 1KIQA 5IQ9B 1UM5L 4ZPVA 4WW2B 3D2UA 5L7XL 5EZIH 1A3LH 1SVZA 3RNQB 4IOIA 1H0DB 3I6LD 4PJGF 1U8NA 1CBVL 4P9HC 1SYVB 1FYTD 5GJSL 1TMCB 4FQPA 1F4XL 1BJMA 1TVHB 2J3SA 5SWZB 1T66D 3FTGA 5F9AC 3SKMB 5IMMB 5DXWA 4OZIF 3LQZB 4OCSH 3K4AA 4MAUH 3GHEH 3QJHA 1CGUA 1S9VA 5I30H 1AQKH 1OTTD 2BRQA 1ZA6A 4H25A 4AEIL 1G7JA 1BQHB 5T33H 1UM6H 2CRZA 1JTPA 3IJHA 1J5OH 2AEPH 1RPQA 2PTTB 4P2RA 1UB6B 4I0PA 1MNUL 2QHLA 1A6WH 4NWUH 1OW0C 2XZAL 2YA0A 1A6ZB 2HG5B 2OL3B 3T65B 4RFNC 4R26L 3DBXA 3S3SA 3WDHA 4J6RH 2F74B 4BFEA 4NC0B 1C1EL 1GC1C 2ARJA 5D7JA 3TIDB 3TBVB 2EXYC 1IC5H 3QUKA 4JFYB 4N1HB 1ULVA 1CICC 4ZS6C 3V4PL 1QLRB 1DUYB 1K8IB 5CCKL 1OPGL 3ILPA 4ETQB 7FABH 5CFHA 4A6YA 2WMPA 2DQGH 1T21A 3AS2A 2FHBA 2Z31A 3VFTA 4GXVH 1B0GA 1YEFH 2NQCA 3MRFB 4PRDB 2V7NA 3RDTD 1ZHKB 3VDBA 2V2TA 2YZ1A 5HYJA 1NAMA 3VE0B 2ADJB 1T0MA 4YPJA 1V3LA 3RWHB 2YPLD 3V8CA 1TZIB 5GZOC 4RDQG 3VGEA 4QRPB 1KG0A 3CSYA 1KBGH 1I1YB 1ZLSL 4TPRH 3T8XB 5KVFL 3O45B 4DGYL 1KXTB 3P4MA 1TPXC 4X99B 4N5EC 5EU7E 2B1AL 4LARH 1KTRL 2B4CL 2HFEA 2HFGL 1P7HL 4F57H 3ESVF 3O11A 3H42H 4GJTB 3SOBH 5IFHH 4BSWB 3O9WA 4JANA 5DEFB 5DO2C 5E6IC 5GIRB 3LEYL 3IDYB 4YJZL 3LN5B 3L3DB 5JDJA 4NYLA 1MFDL 3X13A 3DIFA 4KH2A 2OJZH 2PO6B 4Q9BA 4GG6A 1G7LB 3DX7B 3QQ3A 4J4PD 1AO7D 5SWZE 2QSVA 3MRPA 1IE5A 1HHGB 1X6NA 5CJXC 4YHOL 3T04D 4XMLL 3FQTB 2AEQH 4LBEA 2VLKB 3OMZA 5C6TH 1IM9A 5D2LA 2E7CA 3QXAB 1IGIL 3J8F7 2O61A 3V5DA 2L7JA 1ZOXA 1QYGL 1IKNC 3MV8D 2HLAB 4GS7C 1N3NB 3TV3H 4LVOC 1UYWH 4OGXH 2X1WL 1IGTA 1QA9B 5TFSL 5EBWB 4U0QB 1MAJA 4YEFA 1DQLL 4NC1E 1FNEA 4GKSA 3BT2H 5CZXD 4OZIB 2AK4B 2G75B 3MR9B 3MUHL 5HI5C 3G08A 1E4JA 4JKPH 4KZDH 4KDTC 1BBJB 4E41D 4JPKL 5ID0B 2CIIB 2XA8H 1J05A 3NTCL 4E9LA 3HPJA 2Z92B 2PR4L 3OAUH 4YZFF 4XBGB 3QG6B 5INCA 1SY6L 3AXLA 2X4NA 4JO4L 1S7WA 1FBIL 2WIMA 2BVPA 3OR6A 4M93C 3BP7A 5TDPB 4Z7VF 3I50H 4OF5A 5MENA 5J3HC 3ESUF 1CLYL 3LDBC 4DZBA 3H6JA 4FA8A 3IF1B 1ERNA 3WFBL 1FP5A 3GKWH 2QQNL 4U1IA 1S8DA 2CKBL 2JCCA 1F5WA 1ADQH 1J8KA 5T1KB 5TGBB 4OKDA 4M02A 5C0AB 5DR5H 2AXFA 1VHPA 3LS4L 3NCJL 4F58L 3IU3B 4QRPE 1T7WA 2B39A 2Z8VC 3C6LD 3CVHA 5LQBH 2EE3A 4JO1H 1MCSA 1D5IL 3T2QA 3EYOB 5HGBB 5EU4A 3C6SB 3FN0H 2GUOA 1L9NA 5GGQL 1WFOA 4RGND 4OCWL 4HHAB 4QRQB 1MCHA 5LG1A 3KR3H 3IDMA 4OQTL 5EU7C 4PJFA 3FFCA 3SO3C 1CD1B 3CFEB 3BVNB 1A7NL 3T0EB 2VR5A 1AD9A 2QSCL 1A7PH 5IESL 1JPGA 2FB4H 4IRJB 4WW2C 1QUNA 1G6RB 3CK0H 1EHXA 4NRZA 2PW2B 4PR5A 2X4TB 3JSSA 4MVBD 3BGMA 4XVUC 1NCBL 3GIVA 2BSTB 2VXUL 3D0VB 3LCYA 4OF3A 5IV2A 4L4TD 3VGDA 5E6IA 2VLKE 3NA9L 2I5YH 3SO5A 1OAKH 1N59B 3MLVL 5F88B 2VITB 5SX4I 4TSAH 5D72H 4KAQL 4ODHL 5GHWH 3QNYA 4ERSH 4JFQA 3JWNC 3MACL 4HS6A 4F9LA 2MNUA 5JLZB 1HDMA 2IH3A 4XXDB 2J8UF 5JW3L 4FFWD 5CJXA 3UYPA 3IFPB 4MA8H 2RBLA 3ELAT 2IH1A 3NZHL 1ZT7B 4AT6A 5CP3H 5C08D 1X5GA 4WJ5B 4OZIE 2AK4E 4EXPX 2MKLC 1YNLL 5EOCL 3CLEH 4NC1C 4F7PB 3PGFH 3HAEA 1HI6A 3UJJL 5EB9A 3BDYL 4U6VH 4C55A 1NCTA 2P5WD 3EFDH 4PRAA 3BKML 1ZVHA 3ZDYE 5DJ6A 3SGKA 4OB5L 5CBAA 5DJ2A 1YJDH 3LKNA 3LHPH 5GJTH 2RR3A 1YNKH 4JVWA 2JLLA 4M1GL 3ULVD 4KDTA 1U3HB 3HC3H 4DQOH 4LPCA 3HS0A 3S4SA 3TO4B 4EXKA 5KAQG 1NUDA 4KK6D 5DT1L 6FABH 1OARL 2D0FA 4G6KL 3GZKA 3RUGF 2DF3A 3QUMH 4X5WB 5E4EB 5C0AE 4EN3B 4Z76A 5HYSA 5GGVL 4ZAKB 2GSGB 5HHPB 3VFUA 2WIIB 1A2YB 5D5MB 4EUPG 3BH8B 2QQKH 3L5JA 4OLVL 4QOKB 4UTBL 4OI7A 2W38A 3EFFA 1VERA 3QFDA 1KPUA 5B3JF 4J3SA 5ICXB 5TDNA 1DQQB 4LSUH 1DVFA 4H1LH 4LCCB 4XC1H 4K8RC 1P7QA 4XCCH 3T0EE 2GQHA 2R4RH 5FUZH 1BIIA 4GQPH 1NAKL 3D3VB 5IEHB 1S7SA 5K9JH 4H20L 5IQ9A 1FAIL 4WW2A 3ALXA 1MFCL 4XVSH 1PEZA 3RNQA 4D9QE 1H0DA 4PY8I 5D2NC 2ZOLA 1SYVA 1TVHA 1QACA 1MCRA 1WBYB 5SWZA 4R90L 4ZDHB 1LK2B 4S2SB 4IDJH 3SKMA 1KELH 5IMMA 4U31A 1RK0B 4OZFG 4KRPD 1AH1A 1Y18B 3JWOH 3LQZA 3RBSA 1RJLB 2EC8A 4Z7WB 3IVKB 2APWA 4Y4HC 5E03A 3N50A 3MXVL 2E7HA 2NY4D 3GSRB 1BQHA 3GM0A 4X83A 2HJFB 2PTTA 1UB6A 5DFTA 1HKLL 1A6UL 2J8UB 4I9WD 4R4NC 1A6ZA 2HG5A 2OL3A 2VL4A 2KQMA 1LO4H 4M03A 2ZSVB 1ZEAH 4FZ8H 4GW5B 2GJ6B 2IADB 2HMID 4HBCL 4RISL 3TBVA 4AQOA 3O6FD 4GAYB 4JFYA 4HF5L 4QCIB 1K5NB 4HIXH 3NFSH 5F7UA 1QLRA 1DUYA 5BV7B 3AROA 5EWIL 5FYJD 2HT4C 3H0TB 3BAEH 1UM4L 1K8IA 1NCCL 1MCNA 1LILA 2VLRD 4ETQA 4YZFE 4WGVB 1A0QL 4XPTH 4KVNH 2YS4A 3IDUA 1I7ZB 4NZUL 4QOKE 1S9KC 4BSVB 3RVXD 4JFDB 5C0DB 3MRFA 3G6AB 4PRDA 2DRUA 1T5XB 4IRZL 1ZHKA 1T1XA 1WZLA 2R56L 2ADJA 3CDGB 3KYNB 3LPWA 2EICA 4PREB 3RUGB 3RWHA 1JL8A 3DSFL 5D70H 1TZIA 2F8XC 4QRPA 1MJ7H 4EQ2A 4JDTH 1BFVH 2RJMA 1I1YA 1RZKH 3T8XA 3O45A 5I9QB 3WJLC 4IRJC 1J8HB 4MX7A 1DBBH 2X42A 4X99A 1ED3B 2XT1B 5TE6L 5IBUB 3MBXL 5HYQB 2VQ1B 4MHHI 4ZFFB 3RTQD 4LF3B 5A16B 4BSWA 4K9EH 5DEFA 3S37L 5GIRA 3J7HA 3SDXB 2V17H 3VFRB 4G6JL 1LGVA 4MD4B 6CGTA 1QPXA 2PO6A 3DVGB 3DX7A 5EZOL 2W65B 5I1JH 4IHOB 1HHGA 1KGCE 4LCWD 5DVKA 4F8QA 3FQTA 4Z7WE 3RJQB 2ZJSH 4J23A 3MCLL 1YY9D 4DKFH 3MV11 3CPLB 3C2AH 1KJVA 3QXAA 1AY1L 3U48A 4XWGL 2J8UE 1QA9A 3PG2A 3L7EB 2Q8BH 3WUZA 5EBWA 4JJHA 1DSFL 1G9NH 1RIHL 4NKIL 4XT1C 2UY7A 3VDAA 2MQ0A 4HUKB 2HTLC 4EI6A 4OZIA 4BQBA 2AK4A 2ENYA 2G75A 2XACC 4PJ5D 5AZ2H 4M4RA 2GJ6E 2R8SH 1BBJA 2CDFB 5A2IH 4DUXA 3MRHB 1LDPL 2CIIA 2CK0L 1HWGB 2B1HH 2Z92A 5C07D 4WWKD 2BOBB 3U79A 3QG6A 1OL0A 5DA4A 4X6FA 3IFLL 1KJ2H 1WICA 1WIPA 1KB5H 2HJLB 4ZAKC 2X10A 3N0PB 1TJGH 3LPGA 4JFDE 1KJ3H 4KQ3H 2MCPH 3BEVB 4NZTL 3KLHC 2NYYD 5DQDL 3FQWB 3T4YB 2X4OB 3RWIB 3KLAB 2HYMA 5L6YH 2GI7A 5T1KA 2ZUUA 4M62L 4PJBB 5C0AA 3WSQL 1IKFL 3RUGE 5F7HA 3FKUS 3IU3A 2CLVB 5GS0D 1MIEL 2AS5M 1W8OA 5HGBA 3C6SA 3RVWD 5J06A 1J8HE 2KUTA 1GSMA 4WVRA 4Z95H 2OS7A 4FP8H 3EYUL 1CDIA 4QRQA 3ETBF 2Y9RT 3KDMA 1XCQB 3O3EB 5FV1L 5IHZB 1CD1A 3CFEA 3BVNA 3SDXE 3F7YA 2ADIB 3WJLA 2HT2C 2VUYA 4IRJA 4DFHA 4NWTL 1G6RA 4JKLA 5CUSH 2PW2A 3OKOB 4JQIL 2BCKB 2X4TA 4MNQD 5EIIB 4ZS7L 4YXHL 4KJQD 4M5ZL 5I71C 4Q9QL 2BSTA 1F45A 2R2BB 4AQ1B 2X4PB 3LZFH 4P3DB 2P49B 1RUPL 3S35L 5F88A 4OI9A 4PB0L 3LS5L 1TCRA 1QBLH 4GRWH 5JLZA 3S7GA 4XXDA 1KCKA 3UEZA 2VL5B 3VRLE 2DBLL 4UIMA 1X6LA 2I25N 1MIMH 3REVB 5AWNL 1ZWIA 3EYSL 4WJ5A 2C4FU 4M6MH 1LWRA 4ALAL 4WHCA 3U1SL 1DUZB 1EEUA 4F7PA 3BP5A 2X1OA 4X6CF 1QR1A 1I9RL 2YC1B 1IC7L 3TT3H 5C8JB 2XTLA 4JN1L 5HD8D 1YYLL 1RIVL 2V2XA 1RHFA 4LKCA 4APQD 3VFPB 5LVEA 1U3HA 4PJIB 5GGTH 4NHCL 3NIGE 3TO4A 4JG0H 1MCPH 2FBJL 2GIYA 1EHLH 5I15H 5C2BH 4HLZH 4NZRL 5I1LB 1PY4A 4LPYA 5IVXB 4X80L 4X5WA 4PJBE 5C0IB 4ZO6A 5IGXH 4NO0B 2A0LC 35C8L 4ZAKA 2GSGA 3O6LL 2EECA 1NCDH 3ES6B 2WIIA 4YUEH 3BH8A 1CF8H 1MRDL 1HH9A 4KDWA 4QOKA 2VN4A 2C3GA 3U0WL 1KCUH 2Q86B 1LO0L 5ICXA 1DQQA 4D9RE 2BVUA 3GSUB 2XXMB 3HTLX 4LCIL 2JELL 1QNZL 3QIWB 2DD8L 1CTOA 4HH8A 2F53B 4MJIB 2FGZA 3F65A 4PS4H 2HFFB 3MRMB 5JMRA 3LMJL 2H9GB 1NMBH 2IFFH 2VABB 1PYWA 2MHAA 4ODHH 1A3RL 1GH7A 1KIPA 4P2QB 3V0AC 1TZGL 3C60B 4QRUB 2GAZB 5CEZL 5JXED 5T1MB 3QPXH 3F6LA 4UINL 5B38B 4JEGB 1P4LB 5AAWA 1N5YL 4XVTL 1FLRL 1Q0YH 1WBYA 3Q5YA 4ZDHA 4S2SA 2DLGA 1A6AB 1RK0A 1OGAD 3KYOB 3CXHK 3N1MC 2UZYB 5D4QA 4DK6A 5KTEL 1S3KH 1RJLA 3S97C 3IVKA 3O8XD 2XWJB 3SN6N 2VUOA 4YX2L 3GSRA 3DURB 3CH1A 4LGPB 5IHLB 2HJFA 4YHPA 3VXPB 2IPUK 4FQCL 4P3CL 1I7TB 2J8UA 5HPOA 2H26B 2DQTL 1GIGH 2GK0A 3EOTH 3L3JB 3IFOA 4K3JH 3NFPB 5ALCL 2ZSVA 1KT2A 4PJIE 4GW5A 2XWBB 2GJ6A 3QIUB 2IADA 1BZ7A 3FL7A 3RPKA 1TNNA 3VFVA 1FO0H 4GAYA 4OD1L 1MJ8H 1F8TL 5BRZB 4QCIA 1K5NA 4X6CB 3IFNL 1LNUB 3HI1A 4DN3L 2FIKB 4MQXD 2E8ZA 4GKOA 3H0TA 4Z7QE 3KXFB 4YXLL 4S1SH 5MP6H 2AJVL 5C2UB 2OR8A 4U1SB 4YBQD 2RHEA 3GI9H 1UB5B 1NFDF 1I7ZA 3E8UL 5I1HL 4BSVA 1WF5A 4JFDA 2H2SC 1OAXH 1T2QH 1NSNH 5C0DA 5CJQH 4CU8A 3G6AA 2HRPL 4O2FB 2DM4A 2BNRA 4JQXA 1T5XA 1F58L 3JTSB 1Z9MA 3CDGA 3MLXH 3KYNA 4JO2L 1LMKA 4PREA 4JRYB 5GRVL 5C0GB 3RUGA 2EDDA 2JJVA 1I9IH 1CIDA 2VKXA 1X4YA 1AE6L 1EA9C 2ZKHL 1RU9H 2F53E 5GZNC 2R0KH 4MJIE 1SY6A 3WUWB 5E24E 1A7BA 2VE6B 3L3GB 3VRIB 1U8HB 1JRHH 2LTQB 1OOAA 4JKWA 2EXWD 3SKJH 2J7LA 4KK5D 1FAIH 1ZAGA 3AAZB 1ED3A 5BOPA 5FA3B 5HYQA 2VQ1A 4ELMF 4ZFFA 1T80A 5A16A 4P2QE 2IBZY 3SDXA 4OAWB 3MRJB 1DBAL 3VFRA 4MD4A 3OV6A 4WHTB 3DVGA 2XNAA 5I8OL 1HE7A 1A02N 2W65A 3T3PF 4IHOA 3QO1B 3WYRA 2VXSL 4K23L 1XIWB 3U7AA 3LH2L 1FIGL 4FNLL 1A7OL 1HYSC 2ZUQB 4GQ9H 4ZOEA 4AK1A 4LIQH 3SKOB 4YXKL 3CPLA 4PJEF 1HZHL 1KNOA 3INUH 4HH9A 1BECA 4RMSA 4LOUD 2EZ0D 3ILQD 1HIML 5D93B 1NBYA 4NSKA 3L7EA 5E1AB 3Q48A 3QI9D 2ESVB 3GMPA 1A8JH 4PJDF 5KANG 4XP5L 2NX5D 4MA1C 3BIBX 2LQRA 2CDFA 3MV7D 1QFOA 3RAJL 5ICZB 5BRZE 4X6CE 1FFOB 5HYIA 4P2OB 4N0CC 4J3VA 4I3GA 5L2KD 2BDNL 2BOBA 3KXFE 1CTNA 2EDTA 4JY4B 4D0CA 4HAFA 5FGSA 5L88H 3RGVD 2HJLA 3NH7L 3A67L 3U2SB 4G6MH 3CZFB 3BEVA 5CKAA 1GXEA 3GMQB 1WZ1L 2FD6L 1IL1B 3T4YA 2X4OA 3RWIA 3KLAA 5MHSE 1A1MB 1CR9L 4PJBA 4TRPL 5GGSB 1BD2A 1U42A 4U3HA 4ZQKB 1F4WH 2CLVA 2DTML 2YEZB 4WFED 3UTQB 5LGHL 5AAMA 2ENSA 4XNUL 3GO1H 3QEQD 3C5ZD 5E0QA 1NFDB 2OTPA 5CD5C 1JPSH 3MV9D 5C3LD 3S37H 4BJLA 4Y5YC 3KVQA 3BKCL 3EOAB 5DK0B 1XCQA 4D0DB 2YXFA 3O3EA 5KN5B 2C7UB 3BI9X 2ADIA 5IFAH 2DLIA 1SEQL 4HMDA 1PFCA 1VFOA 5EIIA 3OKOA 2APFA 2Y25A 3WE6B 3FHAA 3WHXB 1HN1A 3ARRA 3LN4A 5CGYD 3TWCH 1T3FB 3QCVL 4JB9H 4ZFGL 2YSSB 4XCFL 4P57B 3O2VL 5K9QI 2IC2A 5I1GH 4WO4B 3ULVF 4JG1L 3I75A 3O2DL 4KDVA 1RIHH 1FC2D 5J13B 4IM8A 2VL5A 1CDBA 1RZJC 2WUBL 5DVNA 4OD3L 4C56D 2NZIA 3REVA 2JB5H 1J0JA 4RMUA 1R5WB 2ESVE 3LEXB 4BUGA 5KBNC 2HH0H 1IAIH 1DUZA 2APXA 3L3IB 2DOCA 2F15A 1DCLA 3GHBL 3PWLB 5BS0D 3PL6D 1EO8L 1CE1H 5C8JA 2G60H 4PJEB 3ARFD 5DMJB 3MJ9A 1GGBH 3EJZC 3TYGL 1J86A 4OIIH 3C5JB 4PJIA 3K0WA 4PJDB 4Z0BH 4ZXBB 1MLCB 4KXZH 3PDDA 4ZO7A 1PZUB 3T09A 3WSQH 5C0RL 3MLRL 4Q2ZB 4RDQF 1BEYL 3I3DA 5C0IA 3P30L 1EV2E 3UJTL 1G6VK 2VSDA 5HJ3B 4UILL 3ES6A 3GIZH 1KCLA 3VXNB 4F7CB 5ADPH 1JP5A 1OTUC 4DCQB 5JZ7C 1SJVA 3QUZC 4FN0A 4JAMB 1AQDA 3GNMH 1NFDE 2HTKD 1RZFH 4ZUSB 5I8CB 3U36B 4FHBD 4P9HH 2Q86A 2NY3D 2D9QB 5C7XL 3OPZL 5D1ZB 2F58H 1NH6A 3GSUA 5IVNA 4UTAL 3QIWA 2XYCA 4TSBH 3B5GA 2F53A 1VPOH 4JM4L 4JHWH 1MRCL 2Q6WB 4MJIA 1BAFL 5C86A 4BKLB 1JZ5A 2HFFA 1T66C 2AQ2A 2VISB 3FT4B 2VAAA 2GFBA 4Y5YA 2H9GA 1T7YA 2VABA 4M43L 3VI3F 1P1ZB 1KCSL 3CX5K 4FG6C 2R1XB 4X9IA 5FYKE 5FEBA 3RX8A 4F9PC 1OTTC 4H26B 4HSQA 3EYQC 3UMTA 4U2ZA 4P2QA 5KW9L 2ADFH 2IF7A 3C60A 5E70A 4QRUA 2GAZA 4XRCA 3DNKA 2ZUQC 5E2TH 5FUOH 2VQTA 5T1MA 3LRGA 2ZZUT 4EDWL 1RJCA 1P4LA 1UZ6F 1GC1H 1FG9C 1AGFB 3OKLB 4XNYH 3T3PE 3KYOA 3U4BH 2OI9C 1P5VA 4PRPD 3ARZA 2XWJA 1AR2A 1GL4B 1SM3L 4HUUB 4LSQH 4L3CB 5KSUB 4P5MA 1PY9A 3DURA 1RURH 3LQAL 4FQIL 5FB8B 2C3HA 3VXPA 4PJEE 3WDIA 1N6VA 4M8VA 5ERWB 3G5XB 5HDOA 3ZTNL 1I7TA 3QH3B 2R0LL 2H26A 5DYOA 3L3JA 4NHCH 1MEXH 3ECBA 3PIQB 2R1WB 1OAUH 3LD8B 2XWBA 2ZCLL 3QIUA 4PJDE 3ME0A 3NACL 1TQBB 5EN2B 1FG2A 5BRZA 4X6CA 2VZVA 1LNUA 1BFSA 4KC3B 2FIKA 3CJJA 3KXFA 32C2A 2XTJD 5DD0L 3R8QA 4LMQE 1UB5A 4NBZB 2AAVA 5JHDB 2KKQA 5KSBB 4QTHB 4OLEA 4O2FA 2AQ1A 4POZC 3IXTB 3VXSB 4G42B 4YQXH 3HMWH 5FAAA 2DYPB 4HUMB 5C0GA 4QXTB 4DJMA 3EOBB 2NY2D 4LLMB 3NA4A 4QY8B 5F70A 1QSED 4UQ2B 3WUWA 2X4RB 4MXQD 3L3GA 3VRIA 4K7PY 1U8HA 3WHE1 2DIAA 1FZMB 1G1CA 4JHAH 2NXYB 3AAZA 1KPRB 4J3XA 4NQVA 1ZSDB 1IGCH 5HHQB 1CGTA 4MSWA 2Q76A 1MCJA 1FDLH 1C08B 4OAWA 3MRJA 4XVTH 1PX4A 2GEEA 2IG2H 1N8ZB 4GAGL 5AZEH 2BJML 1AIFB 2WQRA 3NN8B 3KWWB 4WHTA 1WEJH 1P4BL 2APVA 4F9PA 3QO1A 5INDB 5K59F 1V05A 1LP9F 4P23D 4L3EB 1CU4H 5J13C 1K9TA 1DBKL 1XT5A 3S37X 3WIIL 4E5XB 5ACZB 3UC0H 1AKJA 4ZTOH 3WFHB 3QCUL 2R0WL 4IBLT 1Q1JL 3VFOB 4YHZL 4DEPC 1J0KA 4RWYH 4GW1B 4LSVH 2PCPB 5E1AA 5GS2H 5KAQF 2ESVA 4P48A 1D5ZB 3I02B 4KPHL 3B83A 1U8KB 1YPZB 3BRGC 1DFBH 1EH9A 4KTDL 5LXGL 5FHAH 4FFVC 5ICZA 4X7SL 1OSPL 4ZXBC 4P2OA 3GSOB 4NQEB 1FH5H 5BO1H 5DRZB 4JY4A 2LU3A 1FPTL 3HZMB 5IW1B 4BK5A 4LSDA 4DKEL 1IVLA 5JXAH 2VKWA 3H9ZA 3U2SA 1MJJA 1WJ3A 5JHDE 1WUNT 2A9NL 3CZFA 5KSBE 3MRQB 4G3YH 3EDDA 3GMQA 1UZ8B 4HG4J 3VXSE 3LEVL 2W60B 2ZKHH 4PRNB 5T1LD 4CL7A 3DI3B 5CILL 4HJ0D 3TPKA 4EOWL 2YEZA 3QDMD 3UTPE 3UTQA 1JPTH 4M6NH 3MTRA 4KHTH 3MA7B 1HYRC 2VLJD 4JM2D 4AM0B 1FVDB 1NFDA 4ZO9A 2RCSL 3VFNB 2FATL 4PUBL 4XP4L 4Z78A 2NY6C 1GHFL 3VXMD 4CDGC 3EOAA 3UDWA 2FJHA 3MODL 2BVQB 5DK0A 4D0DA 5KN5A 4P4KD 2C7UA 1H8SA 3S36L 3HZYB 3H9SD 1W72L 4JFFD 5BVJA 1F4YL 3ZE2F 5EFIB 4KKLC 4FFWC 4OF7A 3MYJB 1JNHB 2OL3H 3IDJB 4OV5A 5FYLL 3WE6A 1HHKB 1T3FA 4JRXD 3K8KA 4L3EE 1YC8A 2YSSA 1IC4H 4P57A 4QGTA 4WO4A 5CP7B 4M9PA 4HQQL 5IG7B 1RUAL 5TQ0H 4PRIB 3WFDH 1F4AA 5DVMA 5ID1B 4YK4B 4FQQB 1UZ6E 3U7YH 3OKEB 3ULVC 3HNSL 4W4OC 4Y19B 5CAYB 3IS1X 2XZCH 2EH7H 3LEXA 4FQXC 4P49A 3U7WH 5FYKU 3S35X 1BFTA 4KK6C 1YPZE 3L3IA 3PWLA 4GMTL 5DA0B 4MJ5A 2AABL 3VG0L 4PJEA 4NQEE 4OZ4B 1QSFD 4F15B 5DJZB 1D9KC 3ARGD 1HQ4B 1MRFL 1JRHI 1Y0LB 4PV9B 4RQQB 3C5JA 4XMPL 4K8RH 2VXVL 4PJDA 3CSGA 4ZXBA 1MLCA 1A4JB 2ED9A 4UDUB 1YUHB 25C8H 4Q2ZA 5JW5B 5ACLA 4N8VG 4JZJC 1XGPA 3DSNA 4MB4A 4V2BA 4UUJA 4EUPB 2ORBH 3VXNA 4F7CA 3MBEB 3F5WA 2JJTA 4NGHH 5M95B 4DCQA 3W11D 1U6AH 4JAMA 1KEGH 4GBXD 1VB9A 3SKNB 4ZUSA 1QP1A 2A83B 3U36A 5I8CA 3WV0A 4PJ8B 2P46B 4P46D 4U6YB 3TN0B 4HULB 1G0XA 1I3GH 2W59A 2Q6WA 3C09B 3SDYL 4HEME 3IU4L 3UAJD 1J1XL 2AGJL 4BH7B 2VISA 3FT4A 1P84J 3TCXA 1UT9A 3HI6L 5A2KH 1CD8A 1V7MH 4KRPC 5I75B 2QSQA 1P1ZA 2BSED 1IQWL 1J0ZA 3DXAD 2MQCA 2R1XA 5FO9B 4OGAC 4OF0A 2IANB 5DQ9A 1CFNB 4H26A 4HS3A 3QHTC 3QHFH 2NY4C 1X5HA 1PZ5B 4JG1H 4KV5F 3RIFF 3WFCL 2VH5L 4PYGA 1HSAB 1D5MB 4RAVB 2P8LB 5IW6A 5C09A 3WKNA 2FLBT 2DKMA 4PRIE 4PD4K 3BEWB 5D6CB 1KYOK 1AGFA 1VEPA 5IB2B 4ZTPH 1IFHL 4Y19E 4HIJB 5K59E 4M3JA 4PJAB 2M8XA 3R1GH 3Q1SH 2EKSB 3MLZL 4L3CA 5KSUA 4LSRH 5FB8A 4OGYH 3H7BA 2H41A 4O5LL 1H3WM 1S7UA 4HWUA 1K8DB 1AGEB 3G5XA 3T1WA 2ATPB 3QH3A 2IBBA 4FQXA 5FKAA 3HNTH 2OJEB 3SE9L 5AYQA 4G8GD 4K3DL 3GK8H 3PIQA 2F5BL 2R1WA 3I2CL 5HHOE 4KI5D 1E4XH 4YE4H 4JFHD 1EJOL 5GISL 3QXTA 3FB6B 1T7VA 4KUZH 5EN2A 1D9KA 3F7VB 1QVOB 1TDQA 3I9GH 4N1CA 3FOLA 5E00B 2BSSB 3WFEL 1G6RH 3WFZA 1KFAL 4Q0XL 1QHOA 4JLRB 1DDHB 1UEYA 5SWSB 4W81A 1IAMA 1I9EA 4WUKH 1JBJA 1QLEH 2X1XR 5JHDA 5I8KH 4QTHA 3HE7B 2VXTH 4QHMB 4ODVH 4UTAH 2C1PB 2O26U 4G42A 3VXSA 5TQ2L 1CD9B 1FORL 2DYPA 3CIQA 2WBJB 3EOBA 3QPQC 4LLMA 4QY8A 4UQ2A 4P59H 5DURD 3NAAL 2X4RA 4POUB 4FFYH 4PTTB 1S7TA 1YEGL 1FZMA 1H3PL 3QEGH 3DX6B 3PABB 1KPRA 1J88A 2IANE 1ZSDA 5GRJL 1IAII 3BESR 1YY9C 4JN2B 3F7RA 4PJHB 1QFWM 1C08A 3QXDB 4XVJH 1XF1A 1N8ZA 1AIFA 3NN8A 3KWWA 5K9KB 3ZE2E 1NGPH 1NGQL 5INDA 4XP1H 3VWJB 3LSOB 4L3EA 4B41A 3D2UD 1JGVH 4UT6H 1RZ8B 1A7RH 4KXZI 4ODBD 4E5XA 5ACZA 4XXCC 1U8MA 3WFHA 3ZTNH 3ARDB 2OBGA 4GLRH 4Z9KB 4DTGL 3VFOA 5DD3L 4GW4B 1Q9KB 1WFTA 5CKGA 4HIEB 1F2XK 3DYPA 4GW1A 3WN5B 3HAEG 4WUUA 2PCPA 1HK6A 4G5ZH 1IGFL 1D5ZA 3T77A 4NBXB 3I02A 4F15C 3MRDB 1BZ9B 1T6WA 1U8KA 3KPPB 5E94B 3G9VA 5DFWH 4HWEH 4HX1A 3ABZA 1P69B 1NBZA 1MREL 3GBNH 4P2RD 4I0PD 2W0PA 1MCWW 2GTWB 3CMOL 3D39B 4Z7UB 3GSOA 4NQEA 1F6FB 3VFGH 2AK1L 5JUEL 43CAB 3EHBC 1A47A 4M7KH 5DRZA 3G6DL 3T2NH 1BFOB 3UYOD 2AJZB 3JV0A 5SWSE 2YUWA 4NO3B 2NY5C 5IW1A 4U6XB 3RVWC 4QXWA 2YMXH 4OCRL 2YUZA 5HYSG 3MBEC 3MRQA 5HDQH 1E6OL 3ZE0E 4OM0H 3QISA 1OCWL 2W60A 4CUCA 3UZVB 1CLOL 1B2WL 2BFVL 3D18B 4PRNA 5D7IB 4HEPG 4PJ8C 3SQBA 3AY4A 4K7PH 2Z31D 5EUOB 1KN2L 1DBML 3GRWA 3MA7A 4AM0A 3C09C 2MTPA 2JKXA 3G9AB 3VFNA 1BJ8A 5FFLA 5HYJD 2IGFH 3BPOB 4OSUL 3DECA 3V0VB 2BVQA 4GAGH 4AENB 5JDSB 4FABH 1DQJB 1UA6H 4PJHE 3ALPA 2C4FT 2P24B 3HZYA 3ZKND 4ZNCD 4YHLH 4YDKH 3QDJB 2OTWB 4N8CL 4AG4L 4OLUH 4OLZL 5EFIA 3MYJA 1JNHA 3CU7A 3W39A 5J1SC 2UY6A 2H3NB 4M7LH 3DHMA 4HGWB 4OKVB 3O9WD 3BZDA 1VEOA 4U2YA 1VESA 1EGJL 5CP7A 2BK8A 4G43B 1AP2A 4KV5E 5IQ7H 1LE9B 5I76B 4PRHB 1EDQA 4PRIA 5FXCH 1CL7L 1KC5L 4MJ4A 5HD8C 5ID1A 4FQQA 3OKEA 1PEWA 4Y19A 2DI8A 4APQC 1NCWH 4ONHB 4XXCA 5IBTL 2QQQA 3FT2B 1IZKA 1IM9D 2JE8A 1OSPH 1U95A 3MOQA 2Z8WC 2AEIT 4O4YH 3D39E 3RU8L 4Z7UE 3KPOB 3UO1H 4OZ4A 4LPVA 5F96H 2VO5A 5DJZA 4TUJA 2Q87A 2CIKB 4ZD3L 4NQDB 1HQ4A 1QBMH 1Y0LA 4RQQA 1UADC 1ZT4B 3RP1A 5HHOA 1A21A 2LV4A 4I1NB 3FJTA 1A4JA 4LU5L 1YUHA 1J12A 4X4XB 3C8HA 5D7IE 5JW5A 2V9TA 2M26A 3VGFA 5ABDE 5MEND 1U91B 2EXYD 2X9XA 5F7LB 5EUOE 4EUPA 4F80A 3MBEA 4MYWB 4LL9A 2RCSH 4X7TB 4ZS6D 1GRWA 4YDJB 5JQ6L 1P2CB 1KCVL 2DWDB 1CG9B 4KKCC 3ARSA 1KF9B 2A83A 2R2HB 2X4QB 4PJ8A 3ZHKA 5F9JB 1HXMB 4U6YA 2CO7B 1W72H 3H3KA 4WIQA 2KL6A 4RMWA 3TN0A 5L9DL 1CD0A 1OSZA 5EU5B 4JHZA 3WXWL 2A77H 5JXEC 1NEZG 2C3XA 3QDJE 2X7LB 3B2VH 3W9EB 1MWAL 3NABH 2E5EA 5E8EB 1G1YA 3ZT7A 1CGSH 1Z5LB 1RUKL 3OKYA 4YR6B 1KOAA 4JPWH 4NFDA 3ULUF 1J1OL 2YD3A 5GZOD 2NXZB 4ZUWB 1JGLL 4OUOA 5FO9A 2IANA 1D6EA 3FFCD 1PZ5A 1F00I 1XCTB 5A2JH 3RI5F 5ILTL 1I8IA 5GSRA 5ESQB 1YEEH 1J1PH 4RAVA 5GRUH 2P8LA 3MOAL 2A9ML 1XR9B 4Z18A 4PRHE 3VXUB 4YHKH 1CXFA 5J6HB 3BEWA 1R3KB 3MLUL 5D6CA 5TH2B 3QQ4B 3ARDC 5C0BB 5E6ID 4OZFA 1BWMA 4HIJA 1INDH 2BMKA 1I1AC 5CGTA 3T4AB 3E2HB 3HC4L 4L8DB 3LKPB 4LVHC 1EBPA 4PJ7F 3WN5C 2AABH 1NJ9B 2EKSA 5EORH 2R0ZL 3PGDB 4W70A 2V5YA 4YIQB 4M7LT 1P4IH 3MLWH 1K8DA 1AGEA 2VZOA 2ATPA 2BNQB 2G2RB 3QO0B 2IEPA 1NBQA 1HQRB 2OJEA 4KMTL 1X4ZA 1H8NA 3MRLB 4NQDE 4YFLF 43C9B 4WU5A 2O5XH 2NNAB 1ZXQA 4BQ9A 4HXBL 3SJVB 3FB6A 3TNNB 5CZVL 5I1DA 3RX5A 4XGZB 3F7VA 1QVOA 4C83B 4LSTL 2F8VA 3W0WB 5I1KH 2BSSA 5HI5D 4YNYB 1JWSB 3BN9C 1X5JA 2FRGP 2XXCB 1ACYH 5K9OB 4JLRA 2BSRB 1DDHA 5SWSA 1M7XA 1T83C 3FAWA 2X9WA 1OAYL 4YHNB 1FFNB 4KK5C 4RGOL 2OP4H 5T1DH 1ZHLB 2C1PA 4TOYH 4PGBB 5J3HD 2WBJA 2YA2A 3GI8H 3BPOC 1A1OB 4BYHA 1EK3A 1JJUA 3QHZL 1PGRB 4EJ1C 1NBVH 5HBBA 4PTTA 2GY5A 1AXIB 5GS2D 2AJUH 2BRRH 2D0GA 2YPVH 3EDKA 2V5MA 2QV2A 3DX6A 3PABA 1P7KB 5EU3B 1DVFD 2HJKA 1P7QD 4JN2A 2I9TB 1YEIL 4PJHA 3QXDA 3TJEL 5E8PB 3MJ9H 5TPWH 4S1QH 2EZ0C 3QEUB 4NP4L 4UV4H 4TYUA 3VXUE 1C5BH 3PP3K 5C0BE 1VGEL 3VWJA 3LSOA 5DEZA 5DUMH 3TM6A 1RZ8A 3I6GB 3WXVL 1IM3B 5F71A 1TIUA 4XVUD 1UXSB 1X5XA 1CFQB 1H3TA 2XKUA 3T0XA 3ARDA 4FQ2L 1ZV5A 5SWZD 4GW4A 1CDGA 4CMHB 2BNQE 2ERJB 1KTKE 4HIEA 3CFDA 5CS7A 3WN5A 2YRZA 3BZEA 3MRDA 2ZOKB 1S9XB 4KJPC 1BZ9A 5AEAA 3KPPA 5E94A 4ZUUA 3SJVE 1LE5B 2OQJB 4N0FB 4QXGL 2XG5A 5HHNB 2GTWA 3CFBB 3PE9A 1CFTB 3D39A 1NMAH 4JO3L 4Z7UA 3W0WE 4WV1C 43CAA 3ZLQC 4Y8AA 4LLWB 1BFOA 2WNGA 5CINL 2AJZA 5DJ0B 3TA3C 3V5KB 1GCFA 5T3ZH 4HKBB 2H1PH 3C5ZC 4D3CL 2VLMD 3DGGB 4KWUA 4BQ6A 4KROB 5DJCB 3HMXH 3I3BA 2Q7YB 1MHHB 3SHSA 2OR7A 3D18A 3O41B 2ZCHH 3VGBA 1T83A 2J8OA 4GSDL 5JQHC 2WWMC 4ORGB 5DUPL 1F3DJ 2DQEH 3WIHL 4I13B 4LPWA 5FF6B 5EUOA 1OWWA 2W9DH 3WHE0 2AXJA 3B9KB 3STLB 3U46B 3OGOE 4MDIB 1Q0XL 5CGYC 3LB6C 1JF6A 4DAGH 2AI0H 4G7YH 1SBSH 1L7IL 3V0VA 4AENA 2WZPD 1RZJH 4QRPD 5JDSA 2AP2A 1DQJA 3QSKB 2P24A 3TC9A 3HUJB 3QDJA 2OTWA 4LDLB 3CLFL 2Y4SA 1KACB 2CRIA 3EIFA 1JGUL 4K8RD 2H3NA 5EO9B 2EDFA 4DUWA 3OKKB 3DO3A 4ZFOA 4HGWA 4OKVA 4NDMB 1WZKA 1CFVL 1E4XI 5DD1L 3S36X 1T03L 2B2XL 3KPTA 2DN7A 1CT8A 1PSKL 1WSST 4R8WL 3D85B 5FYJL 3PL6C 2P47B 4RMRA 4G43A 1LE9A 5F7EH 1QRNB 2PO6D 3RKPA 4PRHA 1WT5C 5D9SA 1CVSC 3NCYP 3ARVA 3PP3H 1MWAB 2ARJQ 2DQDH 5C92A 4Y5XB 3CX5J 4XZUB 3T3MF 5E1HB 4ONHA 3RGHA 4WCYL 3I3EA 3FT2A 4JVUA 1M71A 4ELKB 3NCMA 4LFHD 2MMXA 2DDQL 5DZNA 5IB5B 1JI2A 4IDLA 3RRQA 2IALB 4MXWH 4NUGL 1I1FA 3KPOA 2PTVA 3KPNB 1SEBB 1KN4L 2X1PA 4OCRH 2CIKA 4NQDA 1QBBA 2AK4D 2OXGA 1E4WL 3S8WA 3DMMB 2HA1A 1ZT4A 4ONGH 1LO2H 5IVOA 3NCBB 3X3GL 4QRTB 2CUIA 4NM4L 5I18H 5D7SL 1HSBB 4R4ND 2J88H 2YD1A 4ZG1A 3MGTB 3TA3A 1FN4B 3CH8A 2R29H 3C6LB 2VDPL 1GZQB 5IFJB 4WY7L 3LKSB 4JPVL 4YDIL 3SCMB 3JZ7A 1JFQH 4I3SL 1EZVX 1ZA3B 4YDJA 2UVEA 3UJIL 1P2CA 2DWDA 4HWZB 1CG9A 2HT4D 4QRRB 5DVLA 2R2HA 2X4QA 5F9JA 2AJ3A 5T1KD 4CRPA 1HXMA 1WWCA 5FHBL 2I26N 3QZWB 3RPIA 4URTB 5DC4B 4UAOB 5E8NB 5EU5A 2AV1B 2NW2B 4CVUA 4NJ9L 4G7VL 3HUJE 1FFQA 1BVZA 1UVQB 2X7LA 3W9EA 5FO8B 2ZNXA 4LGRB 4Z5RB 1S5IL 5E8EA 3TZVB 3HCVB 3I84A 1Z5LA 3FQRB 4ODTL 2J6EH 4YR6A 5I17B 4M4PA 2FGWL 3JBG7 1BQUA 4CVXB 3FCTB 1KSRA 4ZUWA 5GSVA 2C3WA 4WI9A 1N7ML 4KTYA 3QG7L 4RBPK 2NTSP 2JJSA 2FX8L 2V2WB 1XCTA 4PPTA 3ULUC 2CMRH 4IRJD 1BQSA 1KEMH 5ESQA 3L5XH 4Y4KC 3BSZH 1BF8A 3QWRA 1QRNE 1XR9A 2VDKL 3P0VH 3VXUA 5EA0L 3GSXB 5J6HA 5TH2A 3QQ4A 3LKOB 1HHJB 4LSPH 4NPYA 5F9OL 4X4ZA 5C08B 5C0BA 2AJSH 3PDGA 1H3GA 4CMHC 4JY6B 2ERJC 4JFEA 5L0QB 1N6QH 3T4AA 1R3IH 4L8DA 3LKPA 5DRWB 4D9QD 1NJ9A 4OLWH 1JMZA 1WT5A 3PGDA 5JA8B 4YIQA 3UYRH 4QYOB 5GS0L 2UWEF 1IT9L 2BNQA 2XTJC 4YGVA 3FO1B 2NY7L 5CJOH 4AIZB 3PNWA 1HQRA 3B6SB 4KK9C 5HHVL 3ZDZE 3VI4F 3MRLA 3EO1B 1NKRA 1Y6KR 2ADGB 3NIFE 3ZYIA 1DLHB 43C9A 3RWGB 2NNAA 3ALWA 4K94L 2Y1VA 4U7KA 1QTYT 2B0SL 3SJVA 3GDBA 3TNNA 2JIXB 4FMFA 4XGZA 1N0LA 4GAJH 5E8DL 4C83A 5DS8B 2HTLD 5ANMB 3W0WA 3LAFA 4YNYA 1JWSA 2MPAL 4KK8C 5I66B 4KROC 5K9OA 1UKSA 1QKZH 12E8H 2BSRA 1RIUH 1U3HD 1TJIH 1N26A 4XPBH 4PTUB 3TO4D 4CBPA 4YHNA 4UOW0 1BPVA 5FYKH 3S6CA 3ISWA 4QGYA 3B9KC 4QRRE 3V4UL 1ZHLA 1OT2A 2R69L 5D1QC 3MLSH 4PGBA 3ET9F 3LOWA 4ZAKD 1DBJL 4YEEA 3FB7B 1XH3B 3ROOB 4JZNB 3KLHD 1MAMH 2QADC 2XQYG 4QOKD 4E42B 3EDFA 1FGNH 4RIRB 4JFPB 3G5ZB 4DWHA 1LK3H 1X3DA 2DI7A 4WEBL 2HRLA 3UZQA 5JR1H 1U8OB 3L3HB 1NCAH 2ZUSA 3ZSTA 5EU3A 1RUML 4M6OH 4UV7L 1BGXL 2I9TA 3L95B 2V7HB 3HNVL 4Q9RL 2XQBL 3QEUA 3TVMB 4L8BB 3RY4A 3CU1A 1A6TB 3VA2C 3AGVA 4O51A 4QWWC 4U7MA 1IGMH 1G7HB 2OR9L 5C08E 4KVCH 2GT9B 3NIDE 4U3XA 2HT2D 5EZIL 4XHJD 3L9RB 3P4OB 1A3LL 4RBPH 4Y4KA 2O93L 4Y5XC 4Y1AB 3I6GA 1IM3A 1Z9SA 5I1CH 4MXVE 3P9LB 1CFQA 2Q1EA 2CKNA 2ICCA 1FNHA 4LNRB 1KGCD 4OCSL 4MAUL 3GHEL 4Y4FB 4DGVH 1BBDH 1FFPB 5I30L 5DMYA 2YK1H 3HC0A 4LDEB 5KVDH 5E6YA 5JHLH 1JWMB 1V3JA 4EIZC 5T33L 1ITBB 1UM6L 2Y07L 3O6FB 1J5OL 3DTXB 3TYFB 2AEPL 1B0WA 3N85L 1LE5A 2OQJA 3IAQA 4N0FA 1EO7A 1A6WL 4NWUL 5HHNA 5JORB 1N0XH 3CFBA 5FM5O 1CFTA 2DS4A 3CDCA 4HPOH 2VLRB 5ANME 4XNMB 1VCAA 2UWEB 1FJ1B 4J6RL 1SHMA 4LLWA 5DJ0A 3V5KA 1YZZA 3KLDA 1FCGA 3BO8B 4HKBA 1QR4A 4ENED 2GJ6D 1IC5L 4R3SB 3VWKC 2PXYC 5ADOH 3KG5A 2NCMA 1I85A 4K2UL 3DGGA 4D9LH 3MNWB 4PP2B 5DJCA 1Q9LB 2Q7YA 1MHHA 3QUXB 4JZOB 3P2TA 7FABL 3O41A 2DQGL 4QTIH 2WW8A 2FL5B 1ZMYA 3IDGA 5A43C 5FF6A 4L8CB 4GXVL 4UAOC 1CLCA 2LFGA 5E5MB 1YEFL 3B9KA 4JFDD 3STLA 4S1RH 3U46A 5D1QA 1R5IA 3FOMB 4ZODA 5C0EB 1TJHH 2BNRD 3QAZC 2A0LD 2VC2H 3N06B 4H88H 3TZVC 5IW3A 1BOGB 5GRZA 2IPUG 2A6JA 3QB7C 4R97B 5EZJB 1UCBH 5H37G 4FFZH 3QDAA 3ULVH 2QL1A 1KBGL 3HUJA 4TPRL 4TVPE 3EYFB 1G9MC 2EKJA 3MRGB 1G7MA<