5L0QB

Crystal structure of the complex between adam10 d+c domain and a conformation specific mab 8c7.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
DIFLTQSPANMSVSPGERVSFSCRASQNIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFILSINTVESEDIAVYFCQQSNRWPFTFGSGTKLEVIRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Disintegrin and metalloproteinase domain-containing protein
publication title An activated form of ADAM10 is tumor selective and regulates cancer stem-like cells and tumor growth.
pubmed doi rcsb
source organism Bos taurus
total genus 52
structure length 212
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l0qB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l0qB01
4ZUUB 5BVJA 4WFHE 1Z5LA 3NIGF 5ACZB 1S7RA 5F44A 2DQTH 3O3AB 1IC1A 1KACB 1FYHB 4OI9A 4IOFD 5KG9B 4DEPB 1D9KD 1AC6A 4HJJL 4PYHA 4M93C 3EZ8A 1K6QH 1HSBA 2PF6A 3RVVC 4ELMA 1OPGH 1YEIL 3T0EC 5I74B 4EN3B 3RHWK 3FOMA 4LSTH 1FDLH 4MD5A 4JCMA 5F8RC 3QJFB 5EO1A 3T0EA 4FQJH 4HIIB 3B9KC 1TCRA 4HZLB 5HVGB 5GSVA 1VFBB 4BSWA 1KIRB 2V5YA 1A7PL 1QLFA 1JUFB 3IU3B 5AG8A 1QUNA 2R23B 5D7JA 2EYTA 5D71L 4D8PA 1WVZA 3KYOA 3SPVB 2DKSA 1MF2H 3MRJA 4GQPH 1HKLL 3TT3L 4NC0B 5JA9A 1QBLL 3LRHA 3SKJL 2DQGH 3QO1A 5E9DD 2ZOLA 5GS0C 1R0AH 4LAQL 3RL2A 1BMGA 5FECB 2HG5A 4QTHB 4XMPH 4H0IA 5F7HA 5IFJA 3BX7C 2ZUQC 3IFNH 5HI3C 1IZKA 1QPXA 5JPNB 1XIWB 3B9EA 4NZRL 3TYFB 3CGTA 2P8LB 4JFQB 5FOJA 1UC6A 4KRPC 4PJFA 4FXGA 3CFBB 4C56D 3QR2A 1JWUA 3Q5OA 4ONFL 3ALXA 4MXVE 3EDJA 1KB5B 2CQVA 2HT3D 4L3EB 4MNQE 4MXWH 1XAUA 4OD1H 2E7HA 4PJAA 5KS9B 1P7KA 2LVEA 4NZUL 1J86A 1OTTC 4RZCB 5TE4H 5TE6H 2J6EL 2VDLH 5DZLA 4KHXL 4MX7A 4XVTL 3TH2T 4X6CA 4Q9RH 2QHRL 3T2NH 4RMWA 4FFWC 3VXPB 4JPKL 4OBSA 2ADJB 1SMOA 3S6CA 3SKMB 3MROA 3MRDB 1HHGA 4GT7A 3G5YA 4H1LG 1PZ5A 1CICB 3MUGB 4QOKB 5EN2B 4XPHL 5K9QI 1MWAB 2E27H 5GIRB 2XQBL 3VFPB 4J12A 3C9NA 5FKPB 3F5WB 5IP4A 3EHBC 3DETC 4KAQL 2EDTA 5TDNA 2BHUA 1QBAA 4H88H 3OKDA 4JHAL 3WIHA 1KOAA 2IANA 1JWMA 3T0WA 3S88L 5HHME 4HEME 4JFFD 3FT3B 5MEQB 1JGLL 1WEJL 3TO4B 5BV7H 4DZ8B 2JLLA 2VC2L 3EKCA 5LBSH 2V5MA 1I9EA 1Q9WA 4LBEB 1SBBA 2NLJB 2CRMA 3H9HA 4BZYA 5T3XD 1IM9B 4HXBH 3S35X 1FV1B 3CX2A 5EA0L 1D3CA 4XNQB 1WQVT 4OKDA 4JKMA 4FMFA 2XRAH 4PJCE 2AQ1A 3U82B 3RVTC 4CDHA 2VQTA 1I9IH 4L4TA 4GQ9L 3N1FC 3U2SA 4O9HH 3UTPD 5TF1H 1WZKA 4POZC 1AQDA 3PQYE 4HUUB 2R4SH 1I8LC 1UVQB 3DV4B 5D1XD 1KXVC 5EORH 3C60D 4LHUD 4RWYL 2A74B 1BQSA 4Y4FA 3T4YB 3B2VL 2R2HA 1I8LA 4DGYH 1W0WA 1JPGA 3H2WA 2VRAA 1RIHL 2EDKA 1CFSB 3LIZH 3D3VE 2X4OB 1CLZL 2OTUB 1BZ7B 3EFDH 5LQBH 4WGVB 4OGZA 5I8CB 4QRQB 1HOCB 1XGRA 5L6YL 4YHYB 4WHDA 3T65A 4NP4L 3ZKNC 5E99H 1JZ6A 4NHUB 1CE1L 1CIUA 2AEPH 2X4PA 4OV6F 3VWJB 1CFBA 2A0LD 2CLZB 1H5BA 5T1LA 4PJGF 3T77B 1RSFA 1X44A 1YQVL 4X4XB 2EXWC 1K4DB 4D9RD 3RY6C 3PGCA 5DK2A 1Z0NA 4RFOH 1WFNA 5E08L 1TETH 5C0IB 4Y1AE 3MLXH 4GSDH 2KBGA 2R1WB 3VFUA 3OB8A 1LHZA 4JM2D 4NSKA 5GGVL 2QQKH 2DJUA 1OSZA 1PG7H 4XWGH 3ZE0F 1Q0XL 1VEMA 4UNTA 4NQSB 5CEZL 1MCWW 5AUMA 1JTPA 2V9QA 3QRGL 3BGMA 4OZIA 1UKTA 4FFYH 1PKOA 1AFVL 4NQVA 1IKNC 4OB5H 5F6IB 1VSCA 1MHCA 5C0JB 3MLUL 2Z93A 2CDEB 1MLBB 1ZWIA 2O93L 4J1UB 3W9EB 1T7YA 4QRPB 3C08H 2BNRE 4WU7B 2XWJB 5C0BB 1TZGL 1FVEB 4LPUA 4AEEA 1I8IB 2X7LB 4J4PC 3MNWA 4RGOH 4XPBL 2CLVB 3GBNH 3IDXL 3LDBC 3NFPA 2VLME 5JXED 2IQAA 2J8OA 3D25A 3L6FB 3VXUB 1WV7T 3EYQC 1CD0A 5FYJD 5CBEA 4W6XB 4PLJD 2AV1A 1R5VA 5J89A 3GJFH 3IJYB 3IDIA 1JGDB 1MJ7L 2BVPA 4R97B 4UDTB 3QJHB 5ICXA 4P23C 2MCPL 5DRXB 1Q1JL 1LEIA 3V4PH 3HPJB 1JNHB 5LWYL 2GAZB 1LEGA 1MCOL 2X9WA 5DUBB 2QQNH 1IAII 4P23A 3FONB 4XC1H 3VH8G 4ZPVB 2AS5M 3C5ZC 3KPPA 5D1QD 1BWWA 5DURD 3T0VA 2ZSWA 3LEYL 4Z5RA 1EBAA 3C5ZA 3LS5H 3CUPB 1F4WL 4Y16D 1FL3B 2FATH 1E4JA 1Q38A 3RVWC 2FX8L 3RJDA 3NPSB 3CVIH 1J1PH 3RL1B 3UJIH 1TZIB 3MO1B 3INUH 3MRIB 4PRID 5DEGA 3MA9L 3HLAA 1X9QA 2IPUK 1ADQH 1NUFA 4ODTH 4M6NL 2VISA 4H8WH 5FUOL 2H2PD 2YK1H 1KLUB 3VFVB 2D0FA 5E03A 1K8DA 4LVHC 2XA8H 1JVKA 3HAEB 3F65A 1JV5B 1ZHLA 2XTJB 3H3PH 3S37L 4OQTL 2CO7B 5CFHA 1UJTA 5IB1B 2NY6B 5GJTH 1J10A 3SQOL 4WJ5A 3NCMA 3HR5A 1GCFA 1V3MA 2EIBA 1GRWA 1I7ZA 3VI4F 5I6XC 2PO6D 3HFML 3MYZA 4NKOB 1UB5A 4IMKA 4KV5F 1JMXA 1ZXQA 3N0PB 4DUWA 1MVUA 4XMKH 2R4RH 3MRGB 2F53A 1H3WM 3MZTA 1B4JL 3LN5A 4F7TB 2IBZX 3H9SE 4QYOB 1ZVSA 1VKXA 4UIKL 5IMLB 1NCAH 4JO3L 1KNOA 3T08A 3GKWH 2NXZB 4ELMF 3KJ6L 5GRVK 5IVXE 3LQMA 1S9VB 5D7SL 5IMKA 4YC2B 2X4UB 4QRSB 2DDQH 4GRLA 2VDPH 3CX5J 3CPLB 1JN6B 4LSRH 4PJ8C 1TJIL 4YFLI 3RUGE 4WDIA 5I1EL 1CXKA 4WIQA 4H1LB 1JNJA 1KCSH 5HYSA 3QAZB 4M5ZH 5CJXC 5KVGL 4XP4H 2ZUSA 4PJ8A 3RGVA 4NBZB 4KROB 4UDUB 1CN4A 2PETA 2AGJL 2VYRE 3MRPA 5JDJA 1XEDA 5HYJE 1FP5A 2P24B 2BRRH 4L1DA 2ADIB 3L5WB 2M1KA 3WLBA 3V6ZB 4GAGH 3RZCC 2X70A 1F00I 2DJSA 4Y5VB 3HRZB 2QKIB 5DD3H 4QWWC 4LHUG 3T3PF 1HYSC 4JKPL 4JG0L 3RWCA 4G9DB 2BDNL 2LU3A 5DA0B 4H26B 5MEPA 3TLRA 2L7UA 4CNIB 3FRPG 3AROA 5BZWB 1XCQA 4N9GA 3SDXA 1F6LL 1D6EA 3M1BB 4LHJB 3QDHA 4Z78B 3TFKD 4PP2B 4Q6IB 2VZ3A 4L8CA 4HJJH 4G3YH 1HHHB 2R56L 3VXMD 4PP1D 4XBGB 3EFFB 3WNMA 43C9A 1X7QA 4CMHB 2DQHL 1ZSDB 4IRSD 1RFDL 3ES6B 5IW1B 1JGVL 4YFDB 4ORGA 3SGJC 5IEHB 3V0VA 5J9PA 3U48A 1T1XB 1KC5H 1VACA 1RVFH 4KUCF 3V5DA 4QHUB 1EEZA 4UB0L 1GPOL 2PYEB 4PJ7E 4ONHA 2NY0D 3QHZH 3VXSB 2LE9A 3I9GL 4PJ5A 1YN7A 1HKLH 1S9XA 5F7MC 3SKJH 3DX7B 1QEWB 4GLRI 1KJVB 4U6XA 2PCPB 4NKDA 3MBED 4LCYB 4OD2B 3V5KA 5CEZE 3NCJH 3X14A 3BZEB 1YYLH 4RRPA 2N1KA 5F7DA 4KFZC 3UBXA 1QSFE 1A7OL 1XGPA 2VLRA 3K46A 2APTA 5D9SB 2Q6WA 4UMGA 1IAOA 1NLBH 3ULSB 4I13B 1B0GA 4TVPL 4ONFH 3RWFA 2VXVL 4E5XA 1W0YT 4YWGH 3HI5H 5BVJB 3TA3C 1S7RB 2DM3A 2CRIA 5GGSY 5D93B 1J7VR 3AC0A 1Z3GL 1JF1A 3FHAA 4NNYA 4KHXH 4G6AC 1HSBB 4XVTH 4EOWL 1IGMH 4KTDL 4ORZC 2YRLA 5DT1L 4JPKH 2XKUA 4Z7WE 2P8PA 2H32A 4M93B 4G9FA 3E6FA 5F71A 2ZCHH 1A6AA 5B8CC 3T0EB 1TCRB 2CUHA 3IYLW 5F6HI 5GSVB 5A2KH 4BSWB 2X40A 1BVLA 4IJ3C 4OUUA 3V95A 3TNNA 1ZT4A 5CGTA 2R2EA 2XQBH 3B9KB 1CT8A 1QLFB 1NFKA 2JCCA 5C8JB 1MHPL 5B4MC 1AR2A 1Q8MA 1NEUA 3SN6N 1SY6H 4YGVA 2PUQT 1LE5B 1Z9MA 3KYOB 4M6AA 5I8OL 3MRJB 1S7XA 5GRWA 3SJVA 4PB0L 4V1DD 3S88H 4Z76B 4F7MA 3OJDB 5CHNB 3BPCB 1UM6L 1JGLH 2ZOLB 4B5EA 1LK3H 1WEJH 4L8SC 3RL2B 3VGFA 4CDGC 3QQ9D 4YQXL 12E8L 1TJHL 4OCNC 1N8ZA 3V5HB 1CS6A 5LGHH 1QPPA 1ERNA 5FA4A 2ITDA 1FAKT 2ZUQB 3BUYB 5KJRH 2QL1A 4PJFB 3RA7L 2VZUA 4LLUB 3L7EA 4HUXA 1RJCA 1LD9B 4KRPB 4ZO6A 4PJBF 4K3HA 1CK0L 1EMTL 2C9AA 3GNMH 2WIIA 1P7KB 2YN5A 4PBXA 2BFVL 1OF2A 2NY2D 3SE4A 5IW6A 3VFGL 1FO0L 2FEDD 1INDL 3NCFB 4HK0B 2J8UF 4RAUB 5DD5L 1MLCB 4L9LA 4OLWH 1FHGA 4MX7B 4JQIL 1G9EA 3D2UB 2AJ3A 2ADFL 4ZS7L 4HUKB 5C0RL 4PG2A 3VH8B 1LO2L 3QEQD 3FQNB 3B2VH 3VDCA 3UTSD 3WIFB 4LSPL 2HP4A 3PWNA 1RZGA 3FFCA 3ULVC 1P4IH 4MQXC 5F72S 4R2GD 2P8MB 4BJLA 5L6YH 3CD4A 5TGBA 1I3GL 4JDZB 2IANB 3LKOA 1ZGLA 4KK8D 3DV6A 3DUSA 2KZWA 3QUMA 3QEUA 1W72A 1JMZA 5D96C 2BY2A 1DR9A 4UT9H 2FH6A 2C3HA 5I2IA 3H9HB 5ILTL 4XP6L 4K94L 3CJJA 4C83B 5IB2A 2FHBA 4J3WA 3VDAA 4OIIL 5E08H 3VE0A 4NRYA 4JFDE 3IDGA 3W9DB 2QSCH 3FT2A 1N64H 4HSQA 2FIKA 2H2SC 3BZFB 5T5NG 3VU2A 1Q0XH 4GS7C 3QDGD 3FO9B 4CVZB 5DUPH 1DQJA 4NQEE 3WJJC 1GJIA 3DVIA 3RU8L 2D2OA 3QRGH 4X6DF 1XGTA 2HFGL 4KTYA 4JFDD 4PJXE 1AFVH 4L5FL 5I1JH 4ETYA 2P5EB 1ROWA 5FYLL 1AGDB 1FG9C 3HZKB 1YECL 2FWOA 2GFBA 4EIGB 3BESR 1ONQA 2YN3A 2EDWA 2R2HB 5F3BA 3BKCH 4ZOAA 4XX1G 1KXTB 3HHRB 1DP0A 1TZGH 1EZVX 1LK2B 3GB7B 1K8IB 1GL4B 4P0DA 2B20A 5KAQF 1SVCP 2RGSA 5B21A 1MJJB 3TWCL 3T65B 1CD8A 2GCYA 1A6WL 2CMRH 4KJYA 4U1NA 3MOAH 5BW7C 5JR1L 2E9WA 5IOPA 1NCNA 5IVOA 3KLHC 3ARTA 3IDYC 3CDFA 1GGTA 3ARVA 3T1FA 1G0XA 2PW2A 1MJ7H 4PJAB 1AXSA 3MLPA 1OD7A 1R5WA 2VWEE 4LGPB 2DQEL 3BT2L 4LNVA 2VMFA 2MCPH 1OAQL 1Q1JH 5D5ME 3KYAA 4LPXA 5LWYH 1WLHA 4MYWB 4NSKB 1A3QA 1MCOH 3ZO0A 4KQ4L 4JY6B 4TUKH 1JGEA 1KTRL 1J1OL 3NCYS 1RUKL 2WQ8A 4G43B 5BVPH 5AUMB 5I1IL 5DJ0B 1YMMD 5E2UL 4R90H 3BGMB 4OZIB 5AG9A 1CD1A 3MA7B 5C07D 2P43B 1KCUL 5DJAA 3HE6D 1A14H 3HG1B 5MENE 4TVPE 4Y2OA 2Z93B 5DEFB 1OTSD 4K7FA 4M8VA 5I1CH 5C09E 3C5JB 4D0DA 5IR1B 5IESH 4ELKA 4ZFOA 2G5RA 4MD4A 4CW1A 4TULL 5I1AA 3HC3L 5C1MB 5GGSA 4E41E 4O2CB 3LS4L 3VXTB 3KPMB 5T33H 2XYCA 3CH1A 3EO9L 2FO4A 3S37H 4L3CA 4OZFG 4PRHE 2H41A 1J05A 1YPZA 4N1CA 5IBTL 5EBGA 3D25B 3SQOH 3KR3H 4FQXC 5E6IC 1KJ2L 3LDBB 3OX8B 3NPZB 4HBCH 5CBEB 1MCCA 4RMQA 4HDIB 3EDEA 3X12B 4LF3A 1DQMH 1ZTXL 1JYXA 1R5VB 4GAYA 4LAJH 1C8PA 3IDIB 1AO7E 1MCLA 4XCNA 5C0ND 4NQXA 3TIDA 1V5JA 5ACMA 3UROR 4NJAL 3U0TB 5FO7A 4UIKH 1NEZG 1UXSA 5ICXB 2YD5A 2EIZA 5BRZE 4HS8H 3VW3L 5SWQA 1UA6H 4NZDA 4JPWL 3C6SB 4RAHA 5D7SH 4U6HA 4P23B 2KZ1B 3KPPB 2VXTL 4PGDA 4ZXBA 2RQ8A 2XPGA 3RVUD 2ZSWB 5I1EH 2DTSA 2EO1A 4OCRH 4IHOA 4F58H 4Z5RB 3C5ZB 4TQEL 1UQSB 4JB9H 4P4RA 3UTQA 4MCYA 2ZG1A 3QH3A 4HUMB 1CL7H 3PWUB 4P2QB 2YMXL 3P0YL 4HX1A 2KQNA 3HLAB 3I85A 4ODUB 4LDOB 4GKSA 2VISB 4XHQA 1QSEA 3B2UC 4GBXA 4LPCA 1UM4L 1YNLL 4PGEA 4KJPC 2CK2A 4YDLC 3DO7A 1ZHLB 1A7QL 1SEBA 4D3CH 4LVHB 3WL9A 2P49B 1IGYA 4OT1H 3PWPD 4WJ5B 3HR5B 2ERJC 4F2MA 1C5DB 1XGYL 3HTLX 4LVOC 2R56H 4ONOA 5DD1L 1MVUB 3MV8E 2F53B 5I6XB 1TVBA 3W11D 1I8KB 2QHLA 4HHAB 3QIWA 1N59A 1BIIA 2DQHH 3FQWA 5ERWB 3I6GB 3O4LE 1ZVSB 1VGEH 3O9WC 1VKXB 3VFTB 4EI6A 1F90L 35C8H 4EIZC 5IGXH 2GY7B 3O9WA 1MI5B 2IADA 4NC2B 4PLKC 2XZCH 5D7KE 4Y5YA 4ACPA 5IMKB 1ZLWH 1NGZB 3LZFL 4UB0H 2H8PA 1RIUL 1FFQA 5D2LA 1YC7A 4JFHE 2BVEA 1IGFL 3MJ8A 4A2MA 4MNHA 4PJ8B 3DECA 4JY5L 2YXFA 5HHQA 5CBAA 1KB5L 3PGFL 1VGKB 2WK2A 3MRPB 3GRWL 5DGQA 4AEFA 2Z31C 1UYWL 3SCMA 1MREH 1A7OH 2VDOL 4KK9C 2X70B 2Z31A 1J8HD 2HJLB 4LCCA 2FYYB 4LDLB 1NAKL 3RZCB 3GMNA 2VXVH 3DO3A 5SX5K 3ULUF 4PTTA 5MEPB 3MACL 5FYKL 2NZ9C 4JFEE 4MJIE 4I9WE 4NNXB 5ID1B 1D6EB 5GS1A 1OAZH 2Q8BL 3WDHA 1AP2A 1I85A 1XZ0A 1Q9KA 2GJZA 4RA3A 5A2LH 4O58L 3R06A 4LQFL 43C9B 4KTDH 5DT1H 4P46C 3X13A 4OUOA 1XFPA 1ACYL 3ZTJH 3TESA 3OKEB 4P9ML 1XGQB 4WW1B 4MA7H 3RTQA 5KSBA 2VLKD 4N9OB 1Q9LB 2NCMA 3NBNA 2VZ1A 2DS4A 2CK0H 3V0VB 5J9PB 3MNZB 1MCNA 1VACB 3LAFA 4HUWA 5B3JF 1WK0A 5JZ7D 1OSPL 1Z9SA 4TRPL 2Y5TA 2BNQA 5GQBA 2WBJC 1UH4A 3RI5F 4EBQL 1AI1L 1OAYH 5EULV 4DKFL 5JW4M 4GRWH 5FUZL 3RWHB 5HDLA 1S9XB 4UUJB 5D7LA 1UM6H 2YC1B 2VLLA 4LEOB 4U6XB 3IRZA 1HILB 3HMWL 2D7NA 3CSYB 3X14B 4RSVA 5F7DB 5BZDA 3UBXB 1XGPB 4UBDC 1FAIL 3CLEH 4M4PA 5DC0A 1WBZB 5K9JH 2IWGA 1S5HA 2BOCB 3HZMA 3T4AA 3DGCR 1RJYA 2ED9A 5KS9F 3FQUA 4G6MH 3TYGL 1SQ2N 4NQDE 1T5XB 4WU5A 3VFGH 1CG9B 4GKNB 3LH2L 3QDMD 4EUPH 2VAAA 1ITCA 4MJ6B 1BD2A 3P77A 4NNYB 2QQQA 4RISL 1VFMA 3TA3B 3K7UA 1NMCC 1P7HL 3EDKA 2VH5H 4AQ1B 2ICEA 1ZT1A 3BWAB 4WFEE 1IAMA 3MMEA 4BELD 1FE8L 2ADFH 1MJ8L 1OD9A 4NQDD 1EJOL 4K8RH 4Z7OE 4X0KA 1EFQA 1LO2H 2H32B 4G9FB 3E6FB 1A6AB 4JVWA 4D2NA 4LSPH 5C86A 1Y6NR 2W92A 1KSRA 4EQ3A 1OAUL 1EHNA 3AXLB 2VZTA 3GMOA 1NJ9B 3TNNB 2V7HB 1R3KA 1MCRA 2R2EB 5B8CB 1FG2B 1I1AA 1CT8B 2NY7L 4UINH 2JCCB 3GSXA 3SGDI 4IJ3B 5SWSA 4WUUD 3MV7D 1MCHA 3KXFB 2AXGB 2NTFA 2JIXB 2L4OA 1I3GH 2QLVB 1S7XB 1L0QA 3SJVB 4QY8B 1NANH 1Z0MA 4Z7VE 4OFYA 5D1ZD 4PGBA 4IDLA 4ZOCA 1T2QH 4X7SL 4XVJH 3C09C 1M7XA 2V2WA 3NOIA 4L8SB 1Z6JT 1N8ZB 2WLZA 5ILTH 4XP6H 1PSKL 4K94H 5DYOB 1CFVL 5KVEL 2ITDB 3CXHK 4IOSD 4OIIH 5CZXC 5HHVL 2Z91A 4X80L 4TTDD 3VGEA 2HRLA 2I24N 2D0HA 4G6KH 4X5WA 1FNEB 4HPYH 2EKSA 4OSUH 3SE8H 1A6TA 3BKJL 3LKQB 2B39A 4I0PA 5JHDB 2ESVA 2AJVL 5BOPA 2WIIB 1OF2B 5F7UA 4EDXB 4UT6L 3RU8H 1FRGL 1NEZB 3KPRD 5FYLH 4PJDA 4XH2A 2AJ3B 4M7LH 3CXHJ 3DXAE 4R8WL 1YECH 1ZLVH 1JHLH 1D9KA 1T6WA 4H20L 5L2KB 4YEFA 5GRZA 1F58L 3MOBL 3VD5A 2Y36H 1YNKH 3WNNA 2Z8WC 4U2ZA 4YHMH 4TVSa 1JPFB 1C16A 4IM8A 4S1DC 3BZ4A 2YEZB 4QRRD 4YFEA 4HW6A 5JW3L 2BY0A 1C12A 5BO1L 3TWCH 5TGBB 2E6QA 4OZGE 1VADB 1HXMA 1WTGT 3QCUL 4NKIH 3MLRL 5IIEB 1OGAD 3BGAA 2BSSB 4WHYH 1EAJA 4L8DA 1VENA 2A73B 5TDPB 5JR1H 4P5KB 4DKEL 1I7UA 4YX2L 1P7QD 3ZE2F 2BHYA 3ZT5A 1UG9A 5C08D 4WWID 3QEUB 5KSVB 2X9XA 1R24A 1W72B 3O6LL 2GJJA 1YPZF 1FGNL 5E9DA 5I2IB 3UAJD 4HQQL 5HDQH 4AH2B 4WV1C 5D96B 1FYTE 3VE0B 3LB6D 3QWOA 4NRYB 3WHXA 3IDGB 3GKZA 4QHLB 4NPYB 2FIKB 1DBJL 4Z7UB 4KQ4H 4M62L 4F9LC 3V79C 1IGJA 3QBTB 2Q86A 1P2CA 3GHBH 4LLMA 1DQJB 1QACA 2CXGA 1MPAL 3HPLB 4APQC 4C56A 5E2UH 4GS7B 1DQLL 4JCLA 1D5BA 1U91A 2OK0L 4N0UE 2RAMA 3OKKA 1CDYA 1QSZA 3HNVL 1VFAA 3ARPA 3BZDA 1NGWB 5ISZE 1G7HB 1B9ZA 3QDJE 1NBZA 1BJ8A 3AY4C 1DLHB 4J3SA 5C0CD 5HPMA 3HC3H 3AY4A 1HXYB 3OB0K 2PW1A 1CLYH 1CXLA 3HMXL 3UDWC 1EXUA 1OWWA 4P2OD 3EO9H 4Y8AA 1CLOH 4YZFE 4X5XA 3G6JB 5F9AC 4BH8A 4LPTA 5IBTH 4N8VA 2VLJE 4HV8A 3E8UL 3UDWA 3UPRA 3VA2C 5ESAB 3A67L 3CVHH 4D0BA 3CFDA 2GHWB 4G8EA 2Y6SC 5A2FA 2H26A 3GZKA 4UQ3B 4HC1H 4MA8L 1OP3K 3ZDZF 3PWVB 3NIGE 4JFFA 3T1FB 2PW2B 4NJAH 1AXSB 1E4KC 3QUYD 1R5WB 3EO0A 4LP4A 1RZJL 3IDYB 3T1WA 5KW9L 3Q6FB 5DUML 3L3DA 5JW4N 3VW3H 4K7PH 5C0AE 1H9VA 2AJYL 1ITBB 5DRNB 2YZ8A 5IQ7L 1JGEB 1A1OA 1KLGB 2VXTH 3FN3A 1ZOXA 3VXNA 4LCWD 3JWDC 4NDMA 4TQEH 4OIAA 4R4ND 4G8IA 4RMUA 4ZAKD 3PWJB 3G9AB 4BFGA 4S0SD 4MS8C 2WLYA 4K7FB 4XVUC 2YMXH 3FRUB 5D2LF 5GZND 3SE3A 3JWOL 3S36X 4Q9CA 5CZVL 3WJLC 3BKML 3ULUH 5D4QA 4ZFOB 3O8XC 4MD4B 4PJCA 3BEVB 1I9RL 5GGSB 1X5ZA 1MCEA 3OAYK 1WWAX 1UM4H 2B4CH 2DTMH 4ZS6D 5TDOA 3JTSA 3BP4B 4H5SA 1ZV5A 4JPVL 4YHPA 5SWZE 5DJ2A 3PQYA 3MLVH 4N0CD 1J05B 4M5YH 4XP5L 2E5EA 5AZEH 4UI2A 4F3FA 1W2KT 2GUOB 3VGGA 3VGHA 4F57H 1JF6A 1KG0B 5T3ZL 5EO0A 3U9PL 4HK3N 3SO3C 5CP3A 1JI1A 1NC2B 4FQXB 3PUCA 3W0WB 3LQAC 5E6IB 4G80A 3D3VA 3VRLE 4BFEA 4NQXB 5L0QC 3WSQL 1BIHA 1RUPL 3QFJB 2AABH 5INDB 5FO7B 5FHAH 5EUOA 1UXSB 1BREA 4FQHB 1M71A 1RZ8A 5CCKL 4PJEF 3D39D 1GVIA 4ZFFA 3EUUA 4U6HB 3F58L 2RB8A 4JRYD 4KI5E 2FHFA 2W59A 4RFNC 2AW2A 3AM8A 2JJSC 4QGYA 1S7WA 4IHOB 1JGUL 5BOZG 3OXRA 2CH8A 3MRNB 1IGFH 1YY9C 2BMKA 4QKXB 3E6HA 5H37G 1QBML 4P4RB 4JJ5B 1LO3L 3K0WA 2W60A 3K74B 3MLTB 3LKNA 5GGVY 1BFOA 4NWTH 4XGZB 3DRTA 3GRWH 5ECJE 1LNUA 4K9EC 1G84A 2F8VA 2VDOH 4QXTA 2C26A 4Y19B 4AG4H 1CU4H 2J4WL 3FQXB 5A3IC 2KQMA 4TOYH 4FXLA 4J23A 1IE5A 1NAKH 5B39A 3DO7B 1UEYA 2W0PA 4L4VE 4S2SB 5E2TH 1RJLA 1Q94B 1T1ZB 3EOTL 5FYKH 4I0KA 4EQ2A 2EEDA 3WL9B 4YDLB 2I5YH 4JN2B 1MWAH 3G9VA 4F2MB 1LO0L 4EI5D 2YWYA 5JXEA 4DFIA 5CSZA 2ERJB 3BD5A 4JDTL 3X3GL 1N59B 3FQWB 4LVOB 1KCVH 4X4YA 1NDGA 4P9MH 4HF5L 1JHKL 4EI6B 3CLFL 4Y4KD 3DX6B 1FN4A 1G6RB 3BN9D 2R29L 4Z7QF 4ZTPL 1RZFH 3CMOL 2UUDH 4M00A 5I76B 4I2XE 3ZYOA 3O9WB 2IADB 1AJ7L 2DLTA 2EDDA 1NUNB 5GS0L 4HMCA 3TT1L 2EE9A 3QCTL 1OSPH 4RBPH 4TRPH 2WWMC 3UTTB 2UWEA 3MTRA 1EAPA 2NY1D 4EBQH 1A9EA 5BS0D 5E7BA 3CAFA 1MEXH 4RX4A 1IQWL 1H15B 2R1YA 5L7XL 3MJ8B 1PEZA 2HFEA 1YEJL 2EDNA 5D1QA 4MNHB 2DI9A 3QEGL 3CCHA 1LMKA 3MCKA 3GSOA 4JY4B 5DO2C 3FMGH 4OJFH 3ARUA 4P49A 1RUML 3LKPB 1XGUB 2P7TA 4Y0GA 4Y16A 2P45B 2CXKA 3ARED 3KHQA 5INCA 1NC4D 2LU7A 1FAIH 5DJCA 4KGJA 1HH9A 4PJGE 1N3NA 2Z31B 5ESVB 4PRIA 5E70A 2CKBA 3GMQA 1CFNA 3MGOB 3OR7A 4AIXA 5AZ2L 3GMNB 2VO5A 2PXYD 5HYFA 5D70L 2E9JA 4UNUA 1J0ZA 1E4XI 1J0YA 2YD6A 4WI8A 4YO0B 5DQJA 2JE8A 5ICZB 2C3XA 5E5UB 3QG6B 5GS3A 3L5IA 2CR6A 1AP2B 4RISH 3PF2A 3Q3GB 1Q9KB 3ARDD 4QHMA 3ZE0E 3CNKA 3HS0A 3R06B 5CEYB 3WIHL 4M9OA 3QISA 3VDBA 4M7KL 1IKFH 5DQ9B 4W4OC 4P46B 4PJDF 1A02N 2A6KB 3BO8B 5ABDE 3V0AC 1JZ2A 3QPQD 3FOLA 3D85D 1CZ8H 2NY7H 5FB8B 4XPGL 5IG7B 1E4XL 2N56A 4HJ0D 4P2RD 3HUJA 3N85H 1UACL 3B6SA 1HWGB 4JRXE 4WWKC 1N6VA 2FB4L 1K5NA 2WBJB 1U8QA 4IMLA 4KUZL 4X7SH 2FECI 4JDVA 1OW0A 4GG8A 4H0GA 1D7FA 1T7VA 4LRNL 5EO9A 1TFHA 3O2VL 4U1KB 1NL0H 1KFAL 2IAMD 4M43H 5BZDB 5EFIB 4PBVC 1MUJA 3L3GA 2IPKB 5KVEH 2ZG3A 5TF0A 3THML 5DQDL 4Y4HC 2VABB 4BZ1H 4F33B 2YD2A 3T4AB 1YDPB 5FGBC 4OLZL 3QUXC 3K8KA 4Y4HA 4WU5B 4MAUL 2V9RA 4MDIA 2WUCL 3SKUD 4UT6H 1FRGH 4BKLA 1AXTL 3QZWG 3QUXA 2FECL 3Q48A 5LG1A 4O51A 2IPTH 4ZTOL 2K7PA 5A2IH 3MQIA 2ICEB 1SMAA 4JANA 1ZLSH 3MMEB 1LQSR 4DQOL 3IDJA 5KOMC 4YNYA 4R8WH 5HY9A 5DLML 4KJQC 3GBML 3VXRD 3NCYP 1NMCB 1QRNE 4H20H 1F58H 5LCVL 3VXMA 1BQHG 1S7TA 4OCSL 5DJDA 1I8MB 1PBYA 1R3KB 3U9UA 5T3ZE 2AK4D 1A1NA 4YUEH 1J5OL 2FR4B 1N5YL 4IRSA 2AJZA 1ETZA 1U8NA 5JLZB 2Y4SA 4JFOB 3MGAA 2NTFB 3QCUH 3MLRH 3MXWL 1AXIB 4HG4J 1SJVA 5IHUL 2XTLA 5I30H 1BJ1J 1LP9A 4PGBB 4YX2H 1OB1A 2I27N 4AYFA 2GJ6E 4KTEL 3O6LH 1FGNH 2NX5D 1HQRA 1JNNL 3NIDE 3SKNA 1UWXK 2HN7A 4NZTH 5I0DA 1KIPA 3C09B 1U58B 2Z91B 1XF2A 2CIIA 4KV5E 3HZVB 2EKSB 2X6MA 5KVFL 1QVOA 1RK1A 3U36A 3SGEI 5FOBB 5ITFB 1II4E 1FL6B 4NUJA 2ESVB 4X6BA 1DQDH 4JRWA 1NAMA 2XG5A 1T0NB 1AIFA 1DQLH 2ICES 3ABZA 4O2FA 4ELME 2CJUL 4QXGH 4HJGB 3ZLQC 4N90E 3QIUC 2CLRB 4HWZB 4XH2B 5CIPA 5DVMA 1QSFA 2HKFL 1FZKA 1X4XA 4PY7B 1NGPL 1FORL 4HLZG 3F7VA 3ZDXF 1MHEA 1TJGH 5HJ3B 3KYMA 4N90D 2DL2A 4I3RL 3BZ4B 3OF6A 1R3LB 5J06A 3QXDA 3TO2A 2YA1A 2BSTA 4PJHF 4KVNL 3NCEB 1T3FB 4L8DB 3EYFB 4X4ZA 1ZS8A 1LO4H 1KPRA 1I7UB 2WUBH 3KG5A 4ZUVA 3T3PE 4GMTL 1EGJA 4ALAL 4M03A 2VXQL 4KMTH 1MJUH 4YR6B 1QA9B 5ANMA 3RJQB 1IL1A 1P6AB 1AGCA 4KC3B 5HGHB 4H1LH 2X4NA 5I8EA 2DQCL 1G7PB 3PDOA 5GGRY 1MAML 8FABA 4BK4A 5I19L 3Q5YA 4DOHE 1VESA 3R1GL 2C3WA 2AJYH 4FZEL 1TTFA 4WV1B 5B22A 3KNBA 5IQ7H 3ZT6A 2EO9A 4YXLL 3FFDB 1IGJB 5K59E 1E0OB 5GZOD 3O45A 5EUOF 1LVEA 1NMAL 4YHIA 2UZIL 3LRGA 3UJTL 2HJKA 1D5BB 1U91B 4RFEB 3WKNA 2NXYD 2VZSA 4PRDA 1EHLL 3B3IB 4APQB 5JQHC 5F1OB 3UEZA 1WZ1L 4HFUH 1HIML 4QCIB 5JOPD 2BSRA 1KN4L 5T1MA 3TPUA 2VITA 4JM2F 5CZVH 4NCDA 3BKMH 5IJKC 1N6UA 1GSMA 4PS4L 2VERN 5EZOL 5HPMB 3P4OA 1CDJA 1DTUA 4GOSA 1I9RH 2GQHA 4MNQB 1GXEA 4MHHG 5IJKA 5CILL 2PW1B 4HKXA 3BP5B 3VRJA 1WAAF 1EXUB 3UTSA 4QT5B 4PIRF 4JPVH 5FCSH 1CBVH 1INEL 1KYOK 2R1XA 3GHEL 4LK4A 1F11A 4HV8B 3O2WH 4YHZH 4XP5H 3NACL 1EK3A 4IS6B 3RNQB 3BDYH 3TBSB 5K9QG 1D5ZA 4MWFA 2VSDA 5L8JB 3IXAA 5TH2A 2MKLC 3HC4H 1M6OA 4XXDA 2YS4A 3U1SL 5DMKB 3NN8A 4M1CD 4WI2A 2B1AH 1AGEB 3L3DB 4GRMA 5C2BH 1JTTA 2HMID 3K4ZA 1RZIB 4YDVA 4F37F 5HHMB 3F58H 1CF8L 3EYOA 1P69B 4L4TE 5KTEL 3VFOB 2DYPA 1BQUA 3VXNB 3DUHA 1DBKL 1IAIM 1AE6L 3UTZB 2C3VA 5ALBL 3DX9B 4FQIH 1BOGA 2W0KA 1A9BA 2I07B 3FB7A 3IGAA 1QBMH 4GMSH 4EDWH 5AYUL 4I77L 3JUZA 2O26U 1LO3H 2D4FA 1AGBA 2UWEF 4JFDA 2NY4D 3PHQA 4G6JL 1MRFL 2E7BA 1RHHA 3B8YA 4KK5C 4PJCB 4BUHA 4JLRA 1E6OL 3MLWL 5TDOB 1IEBB 2OXHA 3JTSB 1T1YA 1ED3A 3O8XB 1SJHA 1BJ1H 4YHPB 2DM7A 4ZUSA 5DJ2B 3B5GA 2OLDA 4X8JA 3PQYB 3QRFM 3O6FC 3OKOB 2X89D 3VMOA 4KZDL 3ESUF 4XRCA 2W0LA 3VCLA 3MFFB 3U79A 1AD0A 3ARBC 3UBXI 2AK1L 1QFUL 4ODWA 1G7IA 3P30H 4OFPA 5EU3A 5HI4D 4FQ1L 2VTFA 4XNMB 3IETA 2DLEA 4QLRA 3MCLL 3ARBA 3D3VB 4JDTH 3VA6A 1DE4A 2PNDA 3X3GH 5C2UB 2N4IA 1DQQA 2F54E 2IMNA 3MUZ1 3SO3B 3K81A 4HF5H 3MJ7B 2O5YL 4BUGA 4FABH 1M71B 2J8UE 5L0QB 4ZTPH 1RZ8B 3CMOH 2P44B 3QIBC 1AJ7H 2BY1A 5GS0H 3LPWA 3TT1H 5F9OL 3UC0L 3GSNA 3TM6A 3V8CA 3PP3K 5EZLA 1JHTB 3OQ3B 1BQHB 2G75A 2VWEC 1RZ7L 2MKWA 2BMKB 2DQDH 4Q97A 1YEJH 3QXUA 5CINL 3QEGH 1YMMA 2EH7H 3HUJF 4Y1AB 2EIDA 3RPKA 5C07A 3QUKA 3N9GH 3MLYL 1CVSC 5IEKA 1LNUB 5C6WH 4BK5A 3HE6A 6FABL 1RUQL 3CFCL 4G7YL 2Q3AA 4QXTB 1MCIA 3HC0A 5GGTL 1CQYA 1X6LA 5AAMA 3P40A 1KTDB 1RAMA 4AIOA 3MODH 5B39B 4LNRB 2IG2L 1RJLB 4KZEL 3BQUD 5D70H 3DMMD 3KPLA 5MENA 5IFHL 2FRGP 3X3FL 4HCRH 5T5NF 1KTKE 5F1NA 1P5UA 2CD0A 5DD0L 2BNRB 3MJ9L 1PFCA 1ZA6A 3QHFH 4WO4D 4NIKB 5EOCL 3QCVH 1XF5A 3PP4L 3FO1B 4DVRH 4IRJC 4IBLT 3WIHH 4X4YB 2CUIA 2X1WL 4MGXA 3FB5B 1W8NA 4IOIA 1CFTA 4RGND 5DJYA 2XFXA 3N1GC 5HYEA 4HXAL 1R3HB 1KPUA 1MRCH 3L3IA 4KKAD 5J1TC 4M4RA 1NPUA 1UACH 3MRKA 5H2BA 4OGYH 2R1YB 1G7LA 5IVZA 2RFXB 3TBWB 4BFIB 3O2DH 1WIUA 3MCKB 5C0DA 1OCWH 3BGFC 3JV4A 3O2VH 1HCVA 2P7TB 1KFAH 1S7VA 1MRDL 3CDGA 2ADGA 2GTZB 5INCB 3ALPA 1HH9B 3THMH 4JPIA 1NSNH 5DQDH 4K8RD 4XPFL 1ZAGA 2BRQA 2CKBB 1CFNB 3TBVA 3V7MA 3KPSD 3S98A 4KKBC 4YPGB 5E94B 1GZPA 2AXHA 1CE6A 3RKDD 5I1DA 1N7ML 3GMLA 5FM5O 4ZTOH 2YXMA 4DQOH 3PWPA 3T8XA 2F58H 2Z8SA 4R26H 2CO6B 3ZKSD 1L0YA 1T4KB 3R0MA 1X5IA 1ORQA 1I9JH 2WV3A 4P4KC 1M7IA 5IWLA 4HS6B 4OCSH 1C7SA 5HXMA 3SDDD 4I48B 4KDTC 3QUML 3D0VA 1KELL 1W72L 4P4KA 3OGCA 1TQBC 1FIEA 1N5YH 4CU8A 2I9TB 2Y9RT 3VFSA 5CJ5A 2DQJL 3IF1A 1BF2A 3NH7L 4ODBD 3MXWH 2H1PH 3DSFH 3MX0A 1K5NB 3H9SB 1RK0B 3HB3C 4E42B 3IDNA 1U8QB 4WWKB 4IMLB 1X4ZA 1FVCA 5HTSA 4JDVB 1I1CA 4HGWA 4GG8B 4PGZA 4OZHF 1EO8L 1JNNH 1ES0A 5IVXB 1NCUA 3HI1A 3SDAC 3BIKB 5FYLD 1MUJB 4P5TD 3TH4T 2FO1A 1OT2A 3OG6B 1HSAA 1KGCE 3IVKA 2BVTA 2XKNB 3RUGB 3SDAA 4UV7L 3CU7A 4M3JA 3VWKC 4MCZA 4DTGL 4TUOA 2D9CA 4Y4HB 4M6OL 1IC4L 5IBLC 3SDXE 3D0LA 1J8HA 3BSZL 3RX5A 3W81A 3AU1B 1A64A 4BKLB 3QUXB 4O51B 5HYJB 3B9VA 5KSAC 4S1QL 4JANB 4QF1A 2EDLA 4YNYB 1OAXL 1WGOA 3WFDL 4ZQKA 3IT8D 5DFVC 5KSAA 3ZHDA 1L4IA 2RBLA 4KQ3H 1PLGH 5F97E 3PABA 2A2QT 1MHHB 5DJDB 1YUHA 3EOAA 1RU9H 3IJHA 1DBMH 3FB6B 3U9UB 4C57C 2ZCKL 4MJIA 4XCFL 4OF5A 4RDQG 3ULVF 3EYVA 5GGUB 5JIPA 3QQ4A 2VLKA 4PJ5E 5EU5B 4C59B 2HTKD 2X4SA 4LPYA 4YHLL 2FHCA 2JB6B 2QSTA 3PGDB 4KVNH 3IFLL 4ZDHB 5E5MB 2DRUA 3RNKA 3F7RA 1F6AB 1F5WA 1DANU 1OB1B 3V4VH 4MVBD 5M7QA 1BX2A 1F45A 3LHPH 1J87A 1JF5A 4ALAH 1GH7A 1SM3L 4FTVE 4Y2DC 4HWBA 4DAGL 3ILQD 4OAWA 2VLRE 2C5DC 5FF6A 3LQZA 3SKNB 1ZMYA 1B90A 2HN7B 2DQCH 4PBWD 1KIPB 4K71C 1KXQE 4QRUA 5CS7A 2Q76B 4Y2DA 1MFCL 1GGIH 1MAMH 2FL5A 1FNSL 3MV9D 4PJ7B 3PL6C 1JPSL 1U6AH 2CIIB 2R2BA 4G42A 4KDVA 5EOCJ 1RK1B 3F7YA 4FZEH 4BQ9A 1J18A 3O41A 4NUJB 3JTTA 3GSWA 3PL6A 3TJHD 4ZFOL 2P5WE 4YAQA 4U1MA 5I8KL 1NMAH 5C6TL 4L9DA 2UZIH 4D0CA 3UJTH 1CTNA 5CJBA 5K93A 4O2FB 4R0LC 1E6JH 4N8PA 5DI8B 3CFJA 1WZMA 1QSFB 4MZ2A 3NZHH 4NOFA 4U1JA 1HIMH 4WW2F 3DHJA 3F7VB 2WQRA 4O00A 5MERB 1MHEB 3QIUB 1U8MA 4LARH 2N7AA 2OQJA 4OM1L 4GG6A 1FNGB 3G6DH 2DIAA 4PS4H 4NQDA 4Y88A 2MQ0A 2NNAB 3RI5K 3VRIA 1U3HD 2XN9E 1XF1A 3NMEA 4P48A 4UTAL 1RI8A 4NM4H 4KY1L 5FFLA 1N6QH 4KWUA 2A9MH 1B0RB 2BC4A 4OQ1A 4MDJA 3TO2B 5K9KA 1U93B 5IHZA 1E28B 2EE2A 4Z0BH 1DUZB 2I25N 3OMZA 4Z7WB 3BVNB 1FZMA 3MV7A 4WUUA 2GTWA 3FQRB 5IUSA 1CXHA 5EBWA 2E7CA 1CGVA 1C1EH 1YEFL 3QG7L 2Z35A 2B5IC 3W2DL 1IL1B 3S5LG 5MP6L 1AGCB 2R8SH 5B38G 2AXJA 2X4NB 3HRPA 2VIRB 4X7TA 3GI9L 3PDOB 2OJEB 3CC5A 8FABB 4GXVL 4ENEC 3MRLA 2EDYA 5TE7L 4EUPG 3ULUD 3IDUA 5MEOB 5CD5D 1CF8H 1MIEL 4Z7VA 3DYMA 5KTEH 3O45B 2MWCA 4L29B 4G8FA 4YHIB 4K23L 1AE6H 1CR9L 1X5HA 4EN3D 3RWEB 3IDMA 2E7LC 1KJ3H 1GGUA 2F5BL 5AYUH 1EEYB 4I77H 3G6AA 4PTUA 5B3JE 1CDUA 4NO0A 4NWUL 5SX4H 2BSRB 1P4LA 1QFWI 2Q1EA 2X1QA 5T1MB 3EYSH 3REWB 3MC0A 4G6JH 1FQ9C 2VDNL 1AGFB 3TH3T 3QB7C 3GIVA 5EIIA 3FFCE 2F5AL 1GC1C 3V6OA 4GKZA 2XNAA 2A1WL 3GDBA 4GAJL 3BYYA 2G9HA 4OCYH 4QNPF 3VRJB 1K2DA 3P4NA 5C0EA 3BRGC 1G0YR 2D31B 4ZFGH 1KENL 4YIQA 4BZ2H 3WMSA 5DJZA 4KZDH 2XWBA 1G6RL 1YNTA 2HT2C 2PYFA 1ORSA 1HI6B 2G2RB 1D5ZB 1QFWL 1QFUH 4MWFB 4N1HB 3GSUA 5KS9E 2HTLD 4LKXA 1UZ6F 3IXAB 2HT4C 3MYJA 3MCLH 4OLYH 2YR3A 1DZBA 2W1NA 3L5XH 1M6OB 4XPAH 2X10A 3OXSB 4D9QE 2EYSB 1NFDA 2W9LA 1OP5K 1H3PL 1P7QA 1S8DA 2E6JA 2O5YH 5IMMA 2GK0A 3NN8B 3RP1A 1MCKA 3KS0J 3PV6B 4L3ED 4OZGA 2DWDB 1KULA 4YDVB 4D94A 5HGAA 3EYOB 5F9OH 3O81A 2DYPB 2IMMA 4MB5A 2MTPA 3N1MC 4ZNCD 3SHSA 1P1ZB 4PRPE 1LEKA 2C3VB 1RZ7H 1BOGB 1A9BB 3IGAB 3WFCH 1BP3B 4K7PX 5CINH 3RIAF 2XKSA 1M7DA 5FYKD 4KHTH 1CICD 4QOKD 3CSPA 3S34H 1UXWB 2DLFL 3CK0H 5C9KA 2AEIT 4AEHL 5FO8A 4DN4L 4RNRA 1A8JH 1N2RA 4XC3L 2VDRL 6FABH 5FM8A 5HHPA 3Q0HA 1R5IB 3E2HC 5GGTH 4JLRB 4AMKL 3JV6B 1JYNA 1HH6B 4ODVL 4OM0L 5I1GL 4NQEB 3SE9L 1UZ8B 1I3RB 3DVNA 7FABL 2D7MA 1ED3B 2DD8H 1HEZB 4PJXB 2H32H 4ZUSB 3GJFA 4X8JB 5F1SA 2IG2H 4XI5D 3ZKMC 4C58B 2DQUH 4XMLL 3TO4D 4GW1B 3K4DA 2C4FT 2WW8A 3B83A 4HMDA 4XRCB 3X3FH 3KGRA 2KDGA 4R7NB 1AD0B 1RZKL 3O6FB 4GW4A 1G7IB 5EU3B 1OARH 1IM9D 3GMMA 3MJ9H 3BW9A 3IETB 1JWSB 4WNQA 5E00A 3ARBB 4OLXH 3PP4H 5E8NA 2ZG2A 4CN1A 1HDMA 1DQQB 1G0DA 3GO1H 1H0DA 3BE1L 3RWIA 5KVDH 4PG9B 4BYHA 2X1PA 4JFZH 3TN0D 1A6VL 4NN6C 2V2TB 4OKVA 4LVNC 2VR5A 3QIBB 2D03H 1EHXA 1RHFA 3LPFA 4LLQA 2G75B 4XAWH 1BJMA 25C8H 1NCCL 2R0WL 2HLFD 1ADQA 3TVMC 2OTPA 2VN4A 4OD3L 5EC2A 2IBBA 5D5MB 5HD8D 5FYJU 3QUKB 4XNYL 1MRDH 4EZMA 3D69B 2R9HD 3HC0B 4YBHA 2B1HL 4U3HA 3UYPA 4XPFH 3ZE2E 4CVXB 4JQVC 3D1MC 2UVFA 1IQDA 4I8DA 3VWJD 3BPNC 1YPZE 4L4JA 3U7WL 2KH2B 4Q0XL 5EOTA 1PX4A 4JQVA 1CLCA 4PGJA 5MENB 1UB6A 2OTWB 5E8EA 5C09B 3VG9C 1T04B 2K3TA 4HUNB 4UTBH 4ETQA 2YPKB 1WTLA 5IB5A 3DX8A 3ULVH 4E41B 2YSSA 3F7PC 2HLAA 3ZSSA 3ISWA 1G1CA 4PRHB 1RY7B 4IRJB 3P0VH 2CDGA 4TSCH 2XFXB 3G08A 1YJDC 4MNGA 1KELH 1W72H 3H7BB 4Q9QL 4HIEA 1EERB 1IC5H 5ITBL 3ZL4L 1HE7A 3IRPX 2DQJH 1JTOA 2FJHA 5DJ8B 4OZ4A 2AV7A 1MCFA 4FMKA 2MMXA 5F1IB 1AO7B 4N5ED 1V3JA 3RFZC 3Q1SH 4JRYA 5GGRB 2AQ3A 2R0LL 4TSAH 4QRPD 2OZ4A 5TQ0L 2AKRA 3I75A 5C0BD 1MY5A 2X1XR 3I6LE 5BRZB 4KI5C 1HHJA 5L9DL 1S5IH 1S7VB 3F12A 3WIIL 1QSEE 5IKCA 5GGQL 5IB4B 4X6FA 2ARJA 3BGFB 1U8OA 3MV01 1ZEAH 5GISH 5E5RB 4J7RA 4UV7H 3ZDZE 5FM5M 3VXUD 3VG0L 4DTGH 5I1DB 5EU6E 3S5LB 1IC4H 3R4DA 2MNUA 3BSZH 3GMLB 1KBGL 5DVOA 2ZOKB 4WRLA 3L3KA 1VPOH 5E2WL 3S35L 3S4SG 1FO0B 5J13C 3KS0H 4AL8L 3T8XB 3RWGB 1A4KA 1JFQL 5DTFA 2IFGA 3DRQB 2F8XC 3EW3B 4WFFD 3MOQA 1S9KC 3LRSB 5A16A 1ORQB 4L4VA 3DVFA 4HAFA 1FNHA 1WC7B 2Y06L 5KANI 1K85A 1XCTA 4XCFH 1KEGL 1Q72H 4P4KB 1L7TL 3FN0L 5D2LE 3WDJA 4Y4KA 4GG6F 3IF1B 2H9GB 1TQBB 4NC1E 4K2UL 3T0BA 3MV8B 5FO9B 2EDFA 2V5SA 1Z2KA 4M48H 3E3QE 4HUVA 4RA0C 1U8JB 5DMGC 4HKBA 3O4LB 4Z6AT 1XF3A 2V6HA 2LAAA 1JBJA 5BS0A 3I6KA 1SM3H 3O3DA 1P53A 1MELA 4DAGH 5I66B 5D8JH 5J3HD 3C6LC 4N0YL 1VEPA 1WJ3A 4OGAC 2XTJD 1HSAB 2EIEA 2JB5H 1FNSH 5EH1A 3FL7A 1LDPL 1A6PA 3K2MC 3SDAB 2GT9A 2PR4L 3AREA 5CP7B 5GXBB 2Z4QA 4GFTB 1U41A 5JO5A 3LV3B 3IJSB 3D0LB 4U7MA 1L7IL 3FAXA 2AJUL 5I8KH 4PB9L 2NPLX 3VWKB 5C6TH 2VQ1B 1YEGL 1A2YB 3MFGB 5LXGH 5DDHA 4N0FA 4KKCD 4HK3J 4PJEE 5E8PB 1A4JB 1U2CA 2LU4A 2PXYA 3O3BA 4LEXH 5KSAB 2NY6C 4KK6C 2NXZD 1SY6A 4NRZA 5KSBE 1QR1B 4ISVA 1KN2L 3ARDA 1RV6X 1BAFL 3DPBA 5FDWB 1SBSL 4JFEB 4MJIB 2UV3A 1NFIB 4YBQD 3KPTA 4UTAH 1J1XL 3GIZH 2BNQE 4NO5B 3KLAB 3QQ4B 2VQUA 4M8QB 3H3KA 5M95B 5CSGA 5F96L 5ICYB 2JTDA 4KROD 3D85A 5D7LE 3H3BC 4YDKL 4I18C 3U46B 4P2CG 1WISA 3RNKB 1XF4A 4XTRC 4CADA 4HS3B 4LSQH 4J8RB 5T3XL 1SVZA 4MB4A 1UCTA 2DQFB 4OCWL 4ERSL 1EX0A 1YEFH 2EDHA 4Y5XA 1YEKH 2CDFA 5CGYC 2X4TA 5MP6H 5FF6B 2DM2A 5MHSE 1RIVL 1YMHA 3GMPB 2DLHA 3GI9H 4Y2DB 3U4AA 4AZ8A 3ELAT 2R2BB 5CUSL 3OR6B 4YJZL 2NW3A 3SO5A 2IAMA 5TE7H 3F7YB 3C2SA 4K71B 5H8DA 2EDJA 3O41B 4PV8A 1EEQA 1G7QB 1DLFL 3GSWB 3PL6B 5JMOC 3VD3A 2ATPA 5ALCL 5SV3A 5ID0A 4YAQB 4U1MB 5IROC 1BD2E 4LCUA 4X6EB 4LSSL 1XR8A 3QUZC 4K23H 1CR9H 4W81A 5DC9B 2E8YA 2A38A 3WE6B 3W39A 3CFJB 2IGFL 4U1JB 5BJTA 4NWUH 4R0LB 5KSUB 4WGWB 4WEMB 2AI0L 2OQJB 3T0XA 1ZA3A 3B43A 4FFVD 4K3JL 5CEXB 1REIA 3U7AA 1PYWA 4NQDB 4P3WA 2F5AH 5CJOL 2A1WH 3VRIB 3QT2A 2PYED 1F97A 2JJVA 3QNXA 5SWSE 3RHWF 3VXSD 1F4YL 2A6DA 4U0RB 3I50L 3MSPA 2BC4B 3VFMB 1FLTX 3BXNA 4YDJB 1GOFA 4OLEA 3PJSA 5IHZB 4QHKI 4WTZG 2AK4A 1G6RH 4XXCA 1S7QA 2LABA 2WAHA 2E3VA 1QRNA 1IC7L 5ETUA 1FH5L 2H3NA 4X4ME 1KJ2B 4NM8L 2OR9L 3GSRA 4WTWA 4X7TB 2VE6A 5JORA 2BVUA 2B5IB 4OTXH 2VDML 4J6RL 3MRLB 1U8PA 3BH8A 3C8KA 1ZVYA 3H6JA 5HHOE 2WWKT 3S8WA 4FFZL 3VXOB 4Z7VB 3E0GA 2ZUTA 2V5TA 4FXKA 3LKSA 5IFAH 4DUVA 4PJDE 4K9EL 5CZKA 5M94B 3IDMB 1L9NA 5MI0C 3RVVD 3T0ED 3G6AB 3MLZL 4PTUB 3V0WH 4NO0B 1P4LB 4R4BA 2DLFH 4AEHH 1BF8A 2CGRL 5IB3A 3P9MB 3B9KD 3GIVB 4U6YB 4XC3H 5EIIB 6CGTA 4OFVA 4HPOH 4GKZB 5F88B 4WFGD 1SJEB 4HIXL 3VFNB 3DNKA 4ODVH 4Q2ZA 5JTWA 5E6YA 1K2DB 2RJMA 3P4NB 5C0EB 3EJYC 2IJ0C 4X9BA 4YIQB 1FVDB 2BCKB 4XMLH 4ZOEA 5HHXH 4OV5A 3DXAB 1YNTB 1T66C 2PYFB 4HGKC 2AEQL 4ODHH 5GS0D 1F3JB 2VKXA 1MOEA 3LMJL 1T5WA 5D7JC 1E4WL 4JKKA 5DRWB 4LKXB 3FO2A 5E9DE 5HI3D 3MYJB 5C0FA 2BX5A 2VXUL 3WLWC 3UO1L 1IAKA 1P7QB 1S8DB 1WWCA 1UM5L 3QFDA 4G6FB 1V05A 4KRPD 4AM0B 5IMMB 4P99A 2CPCA 3KYNA 3R0NA 1RULL 3IXTA 4OZGB 3S4SB 5IF0B 2J3SA 4HEPG 4P9HL 1A6VH 5JUEL 1KT2A 3WUWA 5HGAB 3OAUH 3PNWA 1QQDB 4P3DB 3WS3A 3HAEG 4C56E 5EUKA 3QPXL 1OTTD 1X4YA 5DVLA 3D2UD 5IJVA 2HRPH 3TZVC 1LEKB 2R0WH 1C5CL 1MCPH 5JA8B 2CKBL 1C5BH 1A6ZA 3K8LA 1JPST 3U4EB 5EU4A 3TZVA 3GFUA 1M7DB 2V7NB 4NFBA 3DBXA 4OD3H 4FFWD 1FYTB 5DMIH 3TBYA 5FO8B 2W65A 2QQLL 2BNUA 3GI8L 4XPTL 5IBUB 3TGXA 3EDDA 1PKQE 4LCIL 4R3SB 4DVBA 1I1YB 3T2QA 4LFHD 4U6VL 4XWOC 2XICA 5BXFA 5F70A 2IAND 4MHHI 3ARSA 3E2HB 3B9DA 5HGDA 2SEBA 3ARWA 3EHBD 4N0UB 2ZKHH 3DETD 3U7WH 4Q0XH 3LEVH 3L95B 1MNUH 3N1PC 5I16A 2BZDA 3NAAL 5ISZB 3QDJB 3DUUA 4JE4B 4XBEH 5TQ2L 4LASL 1DFBL 43CAA 5IW3A 4JFFE 4WNQB 3GSVB 3NVQA 3BEWA 2YD3A 3WD5L 2P5EE 1H0DB 4ZFZA 3RWIB 4X7DC 3EGSA 5T3XE 1S7SA 5FA3A 1D6VH 2VLJB 1JPTL 5JDSA 2X44D 4Q9QH 3B5TA 3RVTD 3JV5A 1PG7W 3ZDXE 5ITBH 4FRWA 1NKOA 1Y6MR 5ESQA 5JW5B 2P5ED 4NNPH 5L88L 4NN6B 4ZO9A 1FNAA 4XAKD 3L3HA 4LVNB 3LKRB 1BZ9A 1EBPA 1EFXB 1U8IA 4POZD 2R0LH 1XT5A 1PX3A 4JVUA 4XBPA 5TQ0H 3UTPE 1S78C 3HZYB 3TVMB 4JVPA 4KRLB 3G04A 1LGVA 5L9DH 4PJHE 5DHVH 5C0AB 3WIIH 3WXVL 1FFRA 5GGQH 1JNLL 3UXFA 2D7QA 4NN7C 1NMBL 3RVXC 2ORBL 3C2AL 3I02A 3UYRL 1SEQL 1GOHA 4BM7A 4Y4FC 4YHNB 3ZKND 1G9ML 1OT1A 1KBGH 3BPNB 4EVNA 3F62A 2KKQA 5H37H 3GUTA 4QHKJ 1T80A 5E2WH 3OKMA 2X89A 2W9EH 5EC1B 4AL8H 5DR5L 1ZE3C 3VG9B 3EBAA 3MXVL 5EUOE 3VGDA 4LIQL 5ACLA 1MCQA 3OKLA 1NCWL 2HLAB 3WV0A 1H5BC 1PQZB 4D9RE 1QLRB 1FL5B 5EBMA 5SWZB 3ARFC 3O11B 1M05A 5DHXB 1DN0B 5GRVL 3QI9C 3FZUC 3G08B 1D5MA 4U1HA 5FGSA 1CFQB 1L7TH 1P6FA 3ARFA 3FN0H 4HIEB 1DL7H 2O5ZL 4QTIH 2D7TL 4XHJC 3GMRA 1L9MA 2FJFA 3IKCB 1YC8A 3QI9A 3HG1D 4OZ4B 1U92A 4PJBA 1S3KL 4E0RA 4X7FC 2WWKO 4I4WB 2ILLA 4IDJH 2F54A 1AQKL 1WAAE 2AKRB 5IVXF 1RMFL 4KGLA 2J8UA 4ZSOA 2FZ3A 4Z77B 2W91A 3UZQA 1H8NA 2J1KA 4JO2H 1WFTA 5DSCB 2OJZL 1DSFH 1KTLA 3RUGF 4X6FB 1WWBX 2ARJB 5GRUH 1U8OB 3PIQA 4J4PD 1LDPH 4LU5H 2XWTA 3V6FB 1AHWA 2X41A 2CR3A 3ARGC 2I26N 4O5LL 5DJXA 5DWUL 3P73A 1MFEL 5KBNC 2AJUH 1PAMA 1NLDL 3JBG7 5FEBA 1YEGH 3EYQD 3ARGA 3L3JA 4P3CH 2FX9L 4PUBH 2DN7A 3BQUA 3DMMA 5FYJE 2VL5B 1A4KB 5AWNL 5D6DA 1OTUC 4OGXH 4ODXA 5J13B 1KN2H 3FTGA 4L4VB 3RZWA 2WINA 3IFOA 3LN4A 3Q5TA 4P23D 1A5FL 2FSEA 4WO4A 4UIMA 4MZ3A 1B4RA 1XCTB 1EGJL 4O2EB 5HYQA 2QADC 1C7TA 4JFXB 2UWEE 3C5ZD 1I4FA 2W9DL 3BDXA 4J2XA 3OPZH 4MAYC 4U2YA 4YDKH 5E8OB 5DD6A 4YXKH 4P2QD 3FO0H 3BP7A 1D5IL 2BJMH 4HKZB 4MAYA 5D2NA 3RVWD 1UENA 4X6DA 1NCBL 2NQCA 3STLA 4X7EC 3I6KB 3P9WB 3RGHA 1Q0YL 3PHSA 3O3DB 1WBXA 1TCMA 2C1OA 3L9RA 4I2XB 4WUKH 4YHKL 4PJ7F 3FJTA 4F7CB 1JRHI 2JK5A 4PRIE 4TUJA 1E27A 3L1OH 3JWDH 3C6LB 2GT9B 5DK0A 1AR1C 2Z4QB 1YY8A 3GSQB 4Z95L 5ALCH 3BP6B 4LFHG 1FZOA 3KPSA 1Q9OA 4FOMA 5DDHB 2F53D 3VXQA 2FGWH 3AAZB 3KDMA 2X9YA 3LEXA 4BH7A 1IAIL 2RIKA 3G5XB 3TV3L 4P57B 4MLSA 4CVUA 4Z8FL 3ME0A 1JRHL 4UT7H 4PJGB 1P84K 3MRMB 5T1DH 2APWA 2DQIL 3HE7C 2AI0H 4ISVB 1MI5D 4NJ9H 3QEHB 3M8OH 4WY7H 3A6BL 3T09A 4IMKC 1GZQB 3HE7A 3EZJB 3HUJE 3NA4A 3SKOA 3UZVB 2RR3A 4PYGA 3L5HA 2YUZA 4PJ8D 4Z7WF 5C9JB 3LQAH 3U30C 3OKYA 2ZP0T 4Z0XB 5HDBF 5GS2H 1QD0A 1P84J 1I7RB 2XQYK 3MREA 1IC7H 5BQ7B 3MV11 2FX7L 2HA1A 4GRLC 4I18B 1FH5H 4JFPA 4RAVA 1ZKAA 1SYVB 1U8KA 4P59H 1CQKA 4F7EA 3RZCD 3RGVC 3UPCA 1ZLUK 1OAKL 2EEBA 3P11H 2CRYA 4QWWD 2XZQH 1A7RH 4RIRA 5E2VL 4JRXB 1HYSD 3DTXB 4XCYB 5I15L 4P5TA 4DGIH 4HMEA 4B7LA 2MFNA 2X05A 4LLVB 4BA8A 2AAVA 1XR8B 2OL3B 2BVOA 4M1DL 2IC2A 4TPRL 4OI7A 1B2WL 3VI3F 3W39B 4S1RH 1AY1L 3RY5A 1DANT 3QUZB 3TIEB 5BJTB 3D18B 1MCJA 4DN3H 1IGIL 3WNKA 4X8XA 3VXME 4PRNA 2CGRH 3DURA 2YA2A 2VR9A 1ZA3B 4JG1L 3TEUA 5CMAA 4BFBD 2ATKA 2NR6C 2EYRB 4PJIA 2Y25A 1FFPB 2LTQC 1G7MA 1V3KA 1ZK9A 5FGCE 4XT1C 1FJ1A 3BXNB 3ZYJA 1RUAL 1YEIH 2BSED 2HFFA 2W38A 3M17A 4LIQE 5FM4A 2D7PA 3ARRA 3NFNB 2FDBP 1TXKA 1LP9E 2AEQH 4LGRB 4N8CL 3V2AR 1QRNB 5T1KB 1MQKL 3LMJH 1IZJA 4KU1A 4HLZH 2H3NB 3OKNA 3GSNL 2X4RA 1A7PH 1TVHA 3GSRB 5D71H 5EG6C 3UO1H 1GGBL 1AKJB 1UM5H 3U6RA 4PD4K 2FGZA 3TT3H 2BXZA 1QBLH 2OMBA 4R4FL 4JZOB 1HK6A 1U8PB 3C8KB 3CH8A 2GYSA 5L8KB 3KWWA 4LAQH 2DBLL 3H42L 5LAXB 5C70A 1BEYL 2VB5A 3TA3D 1G7JA 4HIJA 3QPXH 3MBXL 2YPLE 3LKSB 2GJ6B 2EH8L 4FTVA 1VERA 5JNYB 1C5CH 4NZRH 1T21A 5LGJA 5I17A 2CKBH 4G6AD 3JXAA 4G9FD 3SGKC 4CN4A 3OAZK 5GRJL 1I1FB 4R4BB 3OJ2C 5MI0B 3Q2CA 3SGKA 3SBWA 2YPLD 1NBYA 2OSLA 1YEDA 4QEGA 3GI8H 4XPTH 1Z5LB 2GSIA 5IM7A 2EDOA 5EZJA 4NZUH 3I3BA 3MRQA 1I3VA 3KXFD 1ND0A 2P5WA 2JIXD 3CVHA 4Q2ZB 5B4MD 2J6EH 1MH5A 2EXYC 1BECA 2VSCA 4YFLF 3SJVD 4HC1A 4ZPTA 4X98A 4ELMB 4OZHE 2QHRH 1U3HA 3RIFF 4WI3A 4MMZC 3FOMB 4MD5B 5EO1B 4BQ8A 2X09A 4KJWC 2Z0BA 1DFBH 1T5WB 2EKJA 1BLNA 4XPHH 5E56A 4V1DE 5ANME 1UJ3A 2LQRA 1EO7A 2G5BA 3SOBL 1CGSL 5D7JB 2EYTB 2FD6L 2XN9A 4D8PB 1IAKB 2AJSL 5H35A 3QFDB 4KAQH 2HVJA 3MRCA 4PRAA 5JHDD 1NCDL 4MJ5A 4JHAH 3IXTB 4AK1A 4LSDA 3H9YA 2QSQA 1JPTH 1BVKA 3QO1B 3HNSL 4FP8L 3RDTC 2HG5B 2VC2H 4ZUUA 2ZUWA 5IFJB 1BFVL 5L88H 5ACZA 3AUVA 3RDTA 3KPOA 3O3AA 4U1SA 5SV4A 2A77L 3EYUL 4ZG1A 5KG9A 5L2KD 3RRQA 4V2CB 5D5MF 5EU4B 3TZVB 4FXGB 4NO2A 5EA0H 3AVEA 3SE4C 1JWUB 4DOHB 3TBYB 2BNUB 5CWSA 3QJFA 4HIIA 1INQA 1JNLH 4DVBB 3KAAA 3QEQE 4HZLA 4L9LC 1NMBH 2ORBH 4GQ9H 5HHNA 4MQXD 3UTSE 3ULVD 3UYRH 4G8GE 4PG2C 1FZJA 3IU3A 2GSGA 2OR7A 2R23A 1A6UL 1OVZA 4X6CB 1V7ML 5EOQL 4WEBL 4XB7A 2NY3C 4RWYH 1A3LL 4PLOB 2AVGA 2F19L 3MROB 3DUUB 1HHGB 3BFOA 3G5YB 4G8GD 1PZ5B 43CAB 1RIHH 5HYSG 1XR9A 3U7YL 1CLZH 3CZJA 5FECA 5I1HL 4WCYL 5DR5H 1CGXA 3C9NB 5HYIA 3BPOC 1FC1A 5JPNA 3TYFA 4NP4H 2P8LA 4JFQA 1T2XA 5TDNB 3EIFA 3OKDB 5KZCB 4N5UA 1CE1H 1JWMB 2Q8AL 3TNMA 2Q7NA 2ITCA 5JDSB 1TENA 1T89C 2O5ZH 1YQVH 2D7TH 5ESQB 4L3EA 4U0QB 5KS9A 3QDGE 1X5YA 3L3HB 4GRWF 1Q9WB 1U8IB 1Y0LA 1T89A 3KHOA 1AQKH 2YD4A 5HSFA 1P5VA 1K6QL 4F15C 1J8KA 1HHIA 2R2CA 5GGVH 4LSTL 2ADJA 2JELL 2JJWA 5F9JA 5CEZH 4FQJL 3MRDA 1CICA 5I9QC 1DN2A 4L4TB 2EDBA 1DJSA 1BWMA 3U2SB 1MWAA 1DBAL 2FCBA 4KDWA 3VFPA 4YK4B 4NN5C 4PRPA 1AQDB 4NN7B 1TIUA 3MLUH 4O5LH 4F7PA 3F5WA 5DWUH 3V8OA 1ZGLM 1NLDH 4Y4FB 2HFTA 4EVNB 4RMTA 1W0WB 3DSNA 3GUTB 2FX9H 3KLDA 1JPGB 2DQGL 5MEQA 3NCBB 3KLHD 3OKMB 3BKYL 3ZTNL 3TO4A 2A83A 3HN3A 4L1HA 3G5ZA 4XMPL 1VDGA 4U31A 3IFNL 5AD0A 5AWNH 1DQTA 2HH0L 1XGRB 4XPBH 2NLJA 1IM9A 1FCGA 3O0RL 3IDXH 4RRPG 1A5FH 3UBXG 5E1AA 5E4EC 1GOGA 1EGJH 1M05B 2X4PB 1H5BB 1A47A 4XNQA 5T1LB 2Q87A 4C4KT 1D5MB 4U1HB 3ARFB 4HWBL 3TN0C 1O0VA 3RIAK 2YD1A 2VOTA 4OD1L 3QI9B 1CDCA 1VFOA 1T83C 4O02L 4E0RB 3TN0A 3PGCB 4PGCA 5DK2B 2VDLL 1YMME 4LMQI 4QNPE 2F54B 1T83A 5J56B 4UZGA 5C07E 1NCBH 1NGQL 1UVQA 2YUVA 3VFUB 4Q9RL 2J8UB 2FZ3B 3T2NL 5D7IF 1OSZB 2A74A 4EXKA 3KYKL 4YHKH 1KTLB 3P9LA 5DXWA 4M7JL 5ADOL 3LEYH 2E27L 1BZ7A 4NQVB 1UZ6E 2F15A 2XWTB 3ZYIA 5I8CA 1EVTC 1F4WH 4QRQA 1HOCA 1MHCB 2DIBA 5DJXB 2FX8H 5C7XL 1ZWIB 3P73B 2EDRA 4H88L 4NHUA 1CXFA 1NC2D 3MA9H 4FQXD 3W0WD 5E6ID 3L3JB 3ARGB 2IALA 4UOW0 5C3TA 1KJMA 4M6NH 5ADPL 5FUOH 3ZE1E 5IHLB 1IAIH 5BV7L 3T77A 3QFJD 2IQ9L 3OJMB 5A43C 4Z8FH 4X4XA 5F6HJ 1JRHH 3EOYG 3MNWB 5LBSL 1C08A 4MJ2A 4ODXB 4TSBL 3FTGB 2NZIA 4OQTH 3NFPB 2WINB 3IFOB 3A6BH 5C0IA 4HXBL 2IQAB 4S0TD 2QR0A 3AS0A 3HFMH 2VAJA 2AV1B 1I4FB 1I9IL 2QADB 4EKXA 4HIHA 2BVYA 2BVPB 1B4JH 4PJIF 4UAOC 3BP7B 1EVUA 5TF1L 4JO3H 2R4SL 4MAYB 2FX7H 1LEIB 1FPTL 5C0JA 3TBTA 2CDEA 5EORL 3KJ6H 4ZXBC 3BJLA 1LEGB 4Y19D 1WBXB 2C1OB 2UYLA 4QRPA 3B2UD 1TJIH 5C0BA 3TPKA 4MXQC 4YE4L 4CKVX 4KJPD 3PG2A 2RCSL 5LQBL 3EFDL 3BI9X 5D6CA 4LOUC 1FFNA 1I8IA 2X7LA 3UP1A 5KVGH 4JZJC 1UCBL 1T2JA 2CLVA 3E1F1 3OTTA 2R39A 2AGJH 5E99L 5DEGB 4GBXC 1Q9OB 4JZJA 4F80A 2GY5A 1HCFX 3VXUA 3VXQB 1B2WH 3LEXB 3PWPE 3UTTE 1G1YA 1GC1L 1V8HA 3IJYA 1K8DB 5EIVA 3UTOA 4JKPH 4JG0H 2BDNH 4JGUA 2EDEA 3O9WD 4RFOL 1X6NA 1TETL 1HQ4A 4KKLC 5EU6A 2YKLL 4GSDL 4M1GL 5DRXA 3UTTD 3HE7B 2R69L 4GXUM 3HPJA 4PLKD 4LHQB 1I7ZB 4YBLC 2GAZA 3SKOB 4XWGL 3QIWC 3SDCC 1UB5B 3IS1X 1RUAH 4C54A 3S36L 3MPCA 5FK9A 2IFFL 3SDCA 4U7SA 3LN5B 5DZNA 2F74A 4N8CH 2Z92A 1RFDH 3CUPA 1MQKH 4OB5L 1GGYA 4Y5YC 1JGVH 1KNOB 1FL3A 3U30B 2VDKL 2EICA 3QQ3A 3UZEA 2ZSVA 3C5SA 1TZIA 3MO1A 2Z31D 5F7LB 4L3AA 2WSKA 4HWEL 4GRLB 4M9PA 1GGBH 1HYRC 3C08L 4KK9D 4X5LA 1GPOH 4F7EB 4NC1C 1EO5A 3DROA 3CDCA 4WDIB 3I9GH 3RWDA 4AY0A 3E3QC 3FHQA 4WI5A 3VFVA 5HYSB 4RGOL 3RGVB 1J8HE 3SCMC 1BEYH 2NZ9D 3BDBA 3KPQA 3TCXA 4LCCC 4V2BA 3WLBB 1QLEL 3T2PA 3ARYA 4NKOA 5E6ZA 4KMLB 1N4XL 3N1QC 3B5HA 4P46D 3MRGA 4CGTA 4TVPH 4NKQB 4PRNB 3RWCB 3DURB 3UPAA 4F7TA 5GS1C 1QZ1A 5IMLA 1I85C 1QFWM 2ATKB 1XCQB 4GLRH 1S9WA 4N9GB 3SDXB 3V4PL 5EU7E 4NQCE 1G7MB 1Z3GH 2P48B 4J3OC 2VLKE 4L8CB 2QQNL 3WKML 2X4UA 4PJEA 2LTQB 2WBJD 4EOWH 3CPLA 3RTQC 4RCAA 4C4KO 1X7QB 4H1LA 1RZKC 1U9KA 4NQCD 3QO0A 4ORGB 3CVIL 1J1PL 3UJIL 3SOBH 1MHPH 3INUL 3V5DB 3BJ91 1EEZB 4UBDD 1ADQL 4ODTL 3L5WA 2D4DA 4ONHB 4CU6A 3V6ZA 5I8OH 4H8WL 4PJ5B 1YN7B 2YK1L 3AGVA 2QKIA 4PB0H 2OS7A 4M6ML 1MCDA 5IHBA 3J8F7 3GGWA 4G9DA 3H3PL 4NKDB 4FG6C 2EZ0C 3V5KB 1BHGA 2L0DA 4CNIA 5A2JH 5GJTL 4YQXH 12E8H 1TJHH 2A77H 3EYUH 4FTVB 2PKDA 3M1BA 5I17B 2VLRB 3C8HA 4Z78A 4PP2A 3QDME 4XVSL 5TJWK 2Q6WB 1HHHA 1IAOB 3QXVA 3RA7H 4XBGA 2O5XL 3EFFA 3B9AA 4XMKL 4GG6E 1B0GB 4LMQE 3H9ZA 4NGHL 3LOWA 3RWFB 4E5XB 2OSLB 1CK0H 5IM7B 1OQXA 2B7DT 1EMTH 2BFVH 2MJWA 3ZDYE 2ICWA 3MRQB 1FO0H 5FXCH 3S96A 2P5WB 2Q20A 1INDH 1JF1B 3EJZC 3ZSTA 5IEHA 3JZ7A 1T1XA 1W0VA 5DD5H 5FDYA 4JQIH 3Q6GL 2VDPL 4OFYD 4ZUWA 4ZS7H 5EOQH 5C0RH 4WEBH 2P8PB 4WUUE 3MV7E 1U95A 1DVFC 1KCSL 5EZIL 1HZHL 3OGOE 1I1AC 4M5ZL 1QEWA 4XP4L 1BLNB 1BVLB 4FQ2L 4OUUB 1KJVA 3K2UL 1DVFA 1ZT4B 5I1HH 4OD2A 4LCYA 2G5BB 4CJ0A 3DOSA 3GEWB 1YJDL 4YZFF 2IH1A 2WANA 2XN9B 4YGVB 5H35B 5CZXD 3S3SA 5D9SA 2ESVD 1QFHA 2OZ4L 2XXMB 3ULSA 4F7MB 5DD3L 2DOCA 2APXA 3RDTB 3KPOB 5GRYA 4U1SB 4CU7A 3O4OC 4X4MA 4M3KB 5FA4B 4G3YL 5HI5C 4I0PC 4NO2B 1F4XL 3KPRE 4WFHD 3L7EB 4HUXB 3T3MF 2JELH 5CWSB 5HDOA 1JP5A 5HHOA 3V6OE 1T7ZA 1INQB 5IW6B 2IBZY 2UY7A 5HHNB 1FIGL 2L7JA 4S1DD 1T0PB 1DBAH 2HFGH 1EUUA 4L5FH 4JKLA 2ZUVA 3B9KA 1KC5L 4IOFC 1FZJB 5C8JA 1RVFL 1D9KC 2GSGB 4L9LB 4LLYA 1LE5A 4QRRE 3GJFK 4WENB 3QHZL 3WHE0 3V52L 4X99A 3ETBF 5FCUL 4Z76A 3OJDA 5CHNA 3BPCA 2NY3B 3PWNB 1OGAE 1RZGB 3BKYH 1XR9B 3ZTNH 5J1AA 2NYYD 2E9IA 3FFCB 1NFDE 4GXUN 3NCJL 1X5AA 5C08E 1YYLL 2HH0H 4TNVF 3V5HA 3L5JA 3O0RH 1A6WH 3BUYA 5IK3A 1NLBL 3BPOB 3LKOB 1F4HA 3TNMB 4LLUA 4OIBA 4RQQA 4UQ2A 1ZGLB 2ITCB 3T0AA 3DV6B 3TP4A 1WUNT 3DUSB 4HWBH 1G9NC 1LD9A 4B53A 1T0MA 4YWGL 3HI5L 3QUMB 1MAJA 3VRLF 4APQD 4XP9L 4O02H 2VZOA 2UVEA 5EB9A 1Y0LB 1QFOA 2DQEH 4HK0A 5IB2B 3BT2H 4RAUA 1MLCA 1OAQH 1IFHL 1NGQH 3D2UA 3FT2B 1HHIB 1IGML 3QQNA 3DYPA 4MNQD 3VH8A 5I1KL 5L8LB 4KI5F 3QYCA 4F15B 3FQNA 3KYKH 2ZCHL 5F9JB 5JMRA 1J1OH 1RUKH 1ZHKA 3WIFA 5I1IH 2HT3C 4JO4L 2DI7A 4M7JH 4U1IA 5ADOH 4YXHL 3V7AE 4CL7A 1XGTB 4HCRA 5C0CE 4PRPB 1KCUH 1MSPA 5I9QB 2P8MA 1JL8A 5SX5H 1SY6L 4F7PB 5C7XH 1I3UA 2FWOB 2GFBB 2VZVA 4NN5B 1ONQB 4JDZA 1TZHA 3CFKA 5F3BB 3REVA 1R6VA 2Y6SD 5ADPH 4TULH 1LK3L 1PKQA 2A83B 2IQ9H 3LS4H 3G5ZB 4YLQT 5AD0B 1FLRL 3MRFA 4BQ6A 3A0OA 4TSBH 5LGHL 2GCYB 4C83A 5HHMD 5KJRL 5F7FA 4KJYB 4U1NB 5E1AB 2K7QA 3W9DA 1VEOA 3N06B 1HWHB 4JM4L 3WNOA 1KJ2H 5IOPB 3O2DA 3BZFA 5E4EB 1ZTXH 3FO9A 3GNML 4TNWF 5E1HB 4CVZA 1PY4A 4NT6A 3TN0B 4PGCB 1I7TA 4LCWE 4OLWL 2P5EA 1AGDA 1FPTH 4JAMA 4MS8D 3MLSL 4XVUD 3HZKA 4FQLL 5I1LA 4JPWH 2R15A 2OL3L 4RMRA 2P47B 3O8XD 4HLJA 4JO1L 4PR5A 3P9LB 1ZT7A 3PQYD 4YE4H 1LK2A 3GB7A 1CD1B 1IEAA 2RCSH 1K8IA 2ENSA 2HJFA 1P4IL 1F42A 5DJAB 3SE3C 1PG7X 1UCBH 1MJJA 5D1XC 3P0YH 4HBQA 4D0DB 1PDKA 3C60C 5FHBL 3D3VD 3UMTA 4ELKB 2IALB 2Z9TA 1KJMB 4LP5A 5D1XA 4PJHA 4I1NB 4CW1B 5I1AB 3C60A 4LHUA 1GC1H 2M8XA 1YNLH 4HT1L 5GS2D 3CH1B 1O7SA 4UT9L 2FO4B 3HNTL 1CDBA 1C08B 1A7QH 3FRPA 4L3CB 4FZ8L 4U1GC 1YPZB 3BISA 4EXPX 4ESKA 2YKLH 4M1GH 4MNGE 3RY6A 2QSCL 2R69H 1X5KA 1N64L 2QR0B 2A0LC 5I75C 1XGYH 4LF3B 3MJ6A 2DMBA 4JY6A 3D39E 4GAYB 5DD1H 4G43A 3S36H 4XCNB 5DUPL 5E8DL 5DJ0A 3TIDB 4HIHB 4JRYE 2IFFH 5DC4B 4F8TA 3K80A 4Y1AD 1YY9D 5I1JL 1FCCA 3MA7A 1F90H 4X9IA 2EIZB 2HWZL 2NW2A 3JSSA 3HG1A 1T20A 2VDKH 3HCVA 4UAOB 3TBTB 5SWQB 5DEFA 3SQBA 4JM2C 1IKNA 3AM8C 3C5JA 5IR1A 3RPIA 2UYLB 4HWEH 4PGDB 3UX9B 3BKCL 3LZFH 4ZXBB 1RIUH 2XPGB 4JM2A 4PFEA 1QP1A 4O2CA 5A3ID 3VXTA 1WCBA 5D6CB 3KPMA 1FFNB 1MVFA 3NTCL 5CJQL 4JY5H 3UTQB 4MCYB 5CSBA 3WBDA 3QH3B 1MAKA 1KB5H 3NABL 2BNRD 1WAAA 3PGFH 4J4PA 3SEPA 4HX1B 2CMRL 4JZJB 1UYWH 3MOAL 2XA3A 4GKSB 1QLEH 3OX8A 1QSEB 2WM0A 3X12A 4HDIA 4GBXB 1FSKC 2XT1B 2ZUUA 1N4XH 2OR8A 4PGEB 3OL2A 4RGMC 2VLMD 2VDQL 1DDHA 4X9HA 1SEBB 3U0TA 3M45A 4CRPA 3MACH 1HQ4B 3VMPA 1IGYB 5EU6B 1QFPA 5JXEC 1A0QL 2Q3ZA 4I3GA 1K3ZA 3EOBA 2Q8BH 3RX8A 4GAFB 2OMNA 4RX4D 3C6SA 3CFEA 3WKMH 4PLJC 4TUKL 2WWMD 4O58H 5BVPL 4UV4L 4YBLB 4LQFH 5FK9B 1TVBB 2LVCA 3JWNC 3QIWB 4R90L 1BIIB 3SDCB 4YGAB 1ACYH 2F74B 5KANG 2Z92B 4H0HB 4NFCA 1UQSA 4MA3A 5IMOA 3JVGC 5BS0E 1A14L 5DO2D 3QQ3B 2ZSVB 3C5SB 4Z18A 3PWUA 5I1CL 4P2QA 4Y5YB 2BERA 3JVGA 3KPNA 5IESL 3QWRD 2YBRA 2H8PB 4ODUA 3WEXA 5D1QC 5D2LB 1AI1H 3DROB 4DKFH 3RWDB 5FUZH 4P9HC 3S9DB 1IARB 2Y1VA 5T33L 4M6MH 1EZVY 3PHOA 4Y16C 5HHQB 1RURL 5CBAB 3KPQB 3HMWH 5JW4Q 3BMWA 5J11C 3NIDF 3SCMB 2E9BA 1TNNA 3KR3L 4N8VG 4POUB 4HBCL 3CX5K 4XVSH 1C5DA 1DQML 2H2PC 4Q7DA 4LCCB 2O5XH 3J7HA 3F8UB 1PGRB 4NGHH 1I8KA 1YA5A 4HHAA 5ERWA 3TYGH 2WMPA 3LCYA 4PTTB 3I6GA 2BP3A 1CL7I 3VFTA 1FGVL 1S9WB 3LH2H 3OB0H 4HS8L 5GS1B 1UA6L 4WI4A 3QNZA 1MI5A 4S11A 1XZ0B 4JREC 2GJZB 2PO6C 4PJEB 5A40E 1NGZA 3Q6GH 3QHTC 3TCLA 1FE8H 3H9SD 4Q58C 1MJ8H 1EJOH 5KN5A 4M7ZC 4P2RE 4WWKD 4XNUL 3X13B 1X3DA 2PO6A 4OCRL 4F58L 4ODSL 2J7LA 5EZIH 1HZHH 3GBLA 2GK2A 3RTQB 1YZZA 3QO0B 5KSBB 4JB9L 4FQ2H 1OAUH 3K2UH 1OP3H 1CL7L 1VGKA 5CJXA 1YJDH 4HUWB 2I60L 3CMGA 2Y5TB 2BNQB 5DVNA 2P1YA 4Y4HD 2APVA 5C71A 2OZ4H 2HJLA 1OW0