1QBMH

Fab e8b antibody, x-ray structure at 2.37 angstroms resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEKGLEWIGRIDPASGNTKYDPKFQDKATITADTSSNTAYLQLSSLTSEDTAVYYCAGYDYGNFDYWGQGTTLTVSSAETTPPSVYPLAPGTAALKSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E8B ANTIBODY
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 44
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1998-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qbmH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qbmH02
5BQ7B 5FUOL 1KIQA 2QQNL 3RL2B 1RZIB 2JF1A 3O2DL 2ICCA 4L8BA 4YHLL 3E2HB 1MCNA 1IAOB 2XV6B 4X80H 2NW2A 3KPSA 1N59B 5L6YL 1ADQH 3SGEI 4MWFA 5KS9B 3CDGB 4HD9A 4ZOEA 1S5IH 1SYSB 2DJSA 1JN6B 3ZHDA 3LVEA 1JRHL 1R5VA 1BQHB 4S11A 4ZDHA 1SYVB 3I6KB 5JLZB 2ESVA 1P7QD 1ZANH 3D39B 2BRRL 4IDLA 2VISB 1IAIL 3ILPA 1VEMA 5DJ8A 2HAZA 3PNWA 4DKFL 3ULUC 4LCCB 1JV5A 5F8RC 2NY5L 1BGXL 3SOBH 2IQAA 2X4SA 2OR8A 3IDXL 1E27B 1AKJD 3ARWA 3CD4A 2GSIB 2IPTL 1TFHA 3H3PL 5F97E 4OAWA 5EOCH 3SKMB 5D1QD 1S9YB 1B0GB 1Z9SA 2WBJC 3CDFA 3P4MB 2DDQH 5D96C 5DURD 4NQDD 1F45A 1RUAL 1FE8H 4JDZA 3FT3B 3NTCH 4OZIE 3QEHB 3WS6A 3MRPB 4LCYB 1BD2E 3MV8B 2ADFL 4RAVB 1RJLA 4EOWH 1HN1A 1XR8A 1TDQA 1KBGH 1S7UB 2Y06L 1AGEA 3ZMRA 1KYOK 1LGVA 1QFWI 4PYHA 3MR9B 5GJSH 2VXSH 1DBBL 1U93A 3CFIC 3NPZB 4TYUA 4DCQA 1IKFH 3DXAD 4D9QD 3KR3L 2BJML 4LQ1A 2XNAB 3CK0H 4WJ5A 5K9JH 1AO7B 3LRSB 2YD9A 3P0VH 2VQ1B 3I84A 5MP6H 3GKZA 3KYOB 5LWYH 1ED3B 4LLMB 4P4RA 4PTUB 2WBWB 4XBEH 3GNMH 4RX4D 3CZJA 2YS4A 3GHEH 5KTEL 1FRGH 3EYVB 1YY8A 5FA4A 4FN0A 3FRUB 3S5LG 2K7PA 3ARED 4HUUA 1JWUB 4YHPA 2E7CA 2F8VA 4LHJB 5KVEH 3BGMA 3QXDB 1QLEL 2FH8A 1FVDB 5JNYA 4LPYA 1OPGH 1KXVC 4Z7WF 2XWBB 4NCDA 4I3SH 1L7TH 3HE6D 4LLUA 4ZUWA 4X6DA 1QBML 5E70A 4HIEA 4U2ZA 3SE3A 4NQEA 2GJ6E 4HJ0D 3X12A 2EXYC 1FC1A 4GFTB 4OF3A 4XNUH 2NY1D 2VXVL 2X09A 3DV6B 1OSPH 3CFDB 1VFAB 1YYLH 4N8VB 3C6SA 4OZGA 3VRLE 5AAWA 5CSBA 3ZKMC 1TITA 2RFXB 4X8JA 3BW9B 5C3TA 2X44D 3LKPB 2APFA 3O6ML 3SKNA 4WVRA 1LO0H 2BNRD 1I3RB 1U8JA 3GBLA 2C3VA 3GKWL 1PLGH 3P0YH 4ODVH 2B8OT 4UDTA 4WW2C 5EUOB 3RGVD 1J7VR 2NLJB 3QA3B 1KENL 4NKMB 1YY9D 4NQDB 4TVPL 3TBYA 3WLBB 3B9KD 1U8HB 4KWUA 4R26H 5C0DB 3DJ9A 4P46B 3N0PB 4KMQA 4HUWB 3L3JB 2DWEB 4YK4B 4QRUA 4R7NA 5GS2D 1KULA 2H2SC 5IMOB 4PRIE 1TTGA 1UACH 4UI2A 3LN5A 2Z91A 4JFED 3MNVA 3VFSB 4OM0L 1NC4A 3MQIA 4FZ8L 1A2YA 3V4VL 1EEUA 5D7LA 1X44A 3VXUB 5HHQA 4HUXA 2AERT 2VDLL 4PJBA 5KG9B 3V4UL 1G9NL 4PRHD 1HYSC 3DARA 4G42B 3D85D 3FFCB 2X4QB 5BZWB 1VFBB 3IFNH 4ZFOB 4CVZB 5EU7C 2LU4A 5H37H 1HSBB 5T5FH 3VFPA 4N5EC 1JWSB 1MCBA 2IMNA 1SJHB 5IVXB 3U36A 5J57B 5EBLA 4EI5D 5ITBL 5D7KE 2QBWA 4G7VH 3QBTB 2WM0A 1K5NB 3LKSB 5HTSA 4UTBL 1AFVL 4I0KA 4XTRC 3EYQC 4B7LA 2XICA 5E8OA 4R4FL 1HI6B 1UM5H 5T5NG 2D9QB 3QO1B 4YFDB 4GQ9H 1JP5A 2XWJA 1K4DB 4OT1H 1V3JA 3U0TB 5IW6B 5F9JA 3OR7A 2J8UE 4P2QB 1EHXA 2NY1B 4HIHB 5ISZD 2XZZA 3TNNA 4M9OA 2IH1A 2P8MA 2UYLB 1D3CA 3GMOB 2DLIA 5C0AE 3SGDI 5TFSH 1NL0L 2D4DA 4UAOC 2JIXD 4LHUA 2X5PA 2OTPA 5DS8B 4M02A 3SDCB 4NM8L 1AQDA 1A22B 4WEUD 1LMKA 4KVNL 1YEKH 3IJYA 2P24B 3RGVB 4OF5A 2V6HA 3TBSA 3UTOA 3VXOB 3QWOB 5DHVA 1IKNA 4IDJH 3VFTB 2OR9H 3DRQB 5HI3D 3UP1A 1WWWX 4MNGA 1FL6B 3FT2A 4HX1B 3W81A 3BJ91 1N6QH 1P4IL 5LWYL 1WFUA 1IAKA 1DN0A 1W0VA 3GNML 2I60H 1UM6H 4JJ5B 4AT6B 1I7UA 1NC2D 3KXFA 5L7XL 5D2NC 4JKPH 3CMGA 1UWEH 4LLWB 3I75B 5I19H 4X6CE 1CLOL 4GJTB 3L9RB 1QZ1A 2VC2L 4WNQB 3CPLA 3PJSA 4JQXC 5HVFB 3QNZB 5IKCA 4HF5L 1RHHB 2JCCB 1DLHB 1GIGH 4HKJA 2D3VA 5J4MA 4RCAA 1WLHA 4NSKA 4DUVA 1IM3B 4LASH 2P5WB 1CG9A 3IJSA 2BC4A 1VGEH 1YPZF 1NUNB 3VI3E 1JPGB 1Q94A 1YC7A 2X4UA 4Y7MA 5IBTL 4CRPA 3B9AA 1QYGL 1T1WB 3NCCB 3U79A 4NRZA 5BV7B 3LV3B 3U6RA 3MRJA 5I9QB 5GZOD 3WFDH 3ULVC 4M1CD 3MJ8B 3AGVA 3GJFH 4HWZB 2B1AL 1ZXQA 1UZ6F 3S34L 2IC2A 1RZKH 3KJ4B 3ZKNC 2AGJH 2QHRH 1D5BB 3IDGB 3FMGH 1X5KA 15C8L 1KCSL 3RPKA 2EE9A 4C57C 3PWLA 3QNXB 4NFDA 1RMFH 2J6EH 2NY7H 2ED9A 3UJJL 1VADA 2XWTB 1YNTB 5GGUA 4F80A 3BDXA 1I85C 2LAGB 1MUJB 4KK8D 4MXVF 1HXMB 3VXPB 5LGJA 5L2JA 1Z9LA 1DQML 2IF7A 1JGVL 3DIFB 5FYLE 1L9NA 4E41B 1HDMB 2O5XH 4MAYA 1OVZA 2NY4D 1T0MA 4OCSL 1GZQB 1MRFH 2B4CC 5HHXL 3PXHA 4JM4L 4FFYL 5E1AB 3HZMA 4PGZA 4TN9A 5E6IB 3SDXF 1I7ZB 1A1MA 4D3CH 1WVZA 4QRQB 2X7LA 3IFNL 2QSQA 1MRCH 4K71B 4KDWA 2WWKO 4X6FA 3RZCB 4HG4K 4XVTH 3RVWD 2JJUA 3Q5YA 1A7OH 3I6LD 5ICXA 4FFWD 3OKEA 5FM5M 1EAJA 3BPCA 3HNTL 2KZ1B 3MRLA 3MLSL 1RIVH 1YEGH 1FZJB 5DHYB 1FV1A 4X9GA 5GGVH 1FBIL 1DUZA 3BGFB 1Y0LA 2C7UA 1U8NB 4PGEB 3U83A 2V17H 1KELH 4XB8A 5D71H 4D0CA 3FOMA 4ODXB 1BZ9B 2XTJD 3KDMA 5MEQB 5CP7A 2MNUA 1VGKA 5CGYC 1JGLH 2LABA 1B0RB 3O6FC 3Q6GL 4M7ZB 4I77H 2ITCA 4LAQL 5T1KB 3CX5K 3IDNB 4S1RH 5I75B 1J8KA 5C0IA 5KOVC 4N8CH 3TA3B 1ZVSA 3EJZD 3MRGB 4K94H 1MPAH 1ZHNB 1UB6A 1E4WL 2C4FT 4U6VL 3G6JE 5HJ3A 2VLJE 4AYFA 5JZ7C 1C12A 1KCUH 3BX7C 1F02I 3IYLW 3P9MA 2ATPB 2QADB 3PV6A 2A9ML 3ALXA 4OJFH 1CD8A 3VGBA 3W39B 3LDBB 1ADQA 1PQZA 1MHEA 4N0UA 2JJTC 5DJAB 3VG9C 4H25B 1XF5B 1TMCB 5EBMA 2BSRA 3PWPB 43CAA 3E3QE 2R0LL 1WAAE 1IZKA 3SQOL 3FTGB 3O9WD 1LILA 4LIQH 1BVZA 4O51A 5TQ0H 1ROWA 2XKUA 3MRDB 4GSDH 5CMAB 4AK1A 4HW6A 3FONB 3ZLQC 1UFUA 3S4SB 2QTEA 1LP9E 1ZLUH 1NSNL 4RGOH 2D7TL 4P5TB 4N0YL 3V52L 3GI8L 4APQA 3HMXH 2IPKB 4ZSOB 3BHBA 1DL7H 4OM1L 1LO4L 2R4RL 3ZZ1A 5LAXB 4RISH 2NY2C 3D3VA 4FQ2H 4XPAH 5IV2B 1FC2D 1FZKA 5C07D 1CTOA 2Q76A 3L3IB 5I1EH 5LGKA 1YEJH 3MA7B 1LNUB 5IBUG 5HDQH 4N90D 2FSEB 2E7HA 3BD4A 3NIFF 3KLHD 4LSSH 1IEBB 2J88L 3EW3B 3VXQB 3AMLA 5H35B 1UQSB 4C4KO 2WAHA 3HLAA 3OV6A 1O5DT 4CU6A 4PJAB 5GGRB 1MVUA 5D2LF 1MH5B 1UYWH 4GRLB 3HG1A 4GG6B 4PB0H 3L3HA 4I2XE 4BUGA 3F6LA 1IL1A 4NN5C 3WKMH 3MJ6A 1HQRB 5C0BE 2YPLE 5SWSB 2DYPD 3O4LA 4WWID 4WFEE 5GRVK 2H3NA 4UV4L 1X5ZA 5TDOA 1H3UA 1V7NH 3NACH 2Y72A 2PO6A 2WNGA 2NX5E 2QHRL 2R23B 4R4BB 3O41B 1G7QB 3PXJA 1YN6A 4CAGA 4IM8A 1UCBL 5B21A 1FNEA 1MHPH 4HGWA 1G7PB 1D7FA 2N1KA 4TRPH 1D5XA 2LVEA 4D9RE 1N64L 1N7ML 5EIIB 1INDL 2M1KA 3RA7H 5ABDE 4I48B 3HS0A 1KXQE 4LU5L 4F8QA 3KWWA 1BBDH 3VRJB 4EKXA 4QNPE 3X3FH 2D03H 3DSNA 1WQVT 4K2UH 3LIZH 1I8LC 2O5XL 5HD8C 1XF2B 1QEWB 1DFBH 2EDOA 4HXAH 5T1DH 3VRIA 1MCLA 4ODWB 4Z7OF 1FFOB 3U7AA 4Y1AB 3F7PC 1VKXA 4JCLA 3EYOA 1MRCL 3VU2A 4JJHA 4KXZH 4MXWH 3FQUB 1J8HA 5BV7L 3BISA 3BQUB 4Y5YC 2VZSA 3DRTA 4JM2F 1CGWA 1EZVY 4MSWA 5ENWB 3CX2A 3FB6A 4MDIB 1YMMB 1MY7A 2YN3A 3FQTB 1OM3H 4PJ8D 1RSFA 1D6VH 4X5WB 5D71L 1J1OL 5FB8B 3TT3L 5SWQB 1MJ7H 3LKNA 4POYA 1YJDC 1E28A 5J1SC 5EUKA 2RR3A 1CQYA 2OP4H 4J1UA 1T22B 3TH3T 3W9DB 1OAKH 3ROLA 4JE4B 4GKZA 3AREC 4GLRI 1I1AD 3G04A 3UJTL 4IRZH 5GS1B 4LCWB 4O02H 1JYXA 2AK4D 3B5HA 2JE8A 3HE6C 3T77A 1NUFA 4RGND 1IGYB 4Z7WA 3MBED 1BHGA 4XNMB 5JW4N 2EIZB 2VLLA 4UU9B 4YDKL 2HTKD 3SDYL 4HJ0C 3OHXB 4GW4A 5H94A 4LHUG 5I2IA 4PD4K 3G5YA 1BQUA 2HJFB 4QTHA 4WDIA 5ACLA 4P5KA 1KG0B 2R29H 3SN6N 2BVOB 4Q9RH 1RK1B 2W07A 3T0EE 3QT2A 4OLZH 4G8EA 4PJFB 1AC6A 4M8QB 2AQ3A 5EORH 3ZE1F 3DX8B 1J18A 2XPGB 2E9IA 4LCUB 4D9LH 2A6IB 5ERWA 5MERA 1PEZA 2GITB 3NA9H 2J1KA 1X5FA 3RWGB 1IVLA 3T1FA 4BH8A 1T04A 3UTSD 4XX1G 4TULL 2VXUH 5C0CD 4RDQF 1KCLA 1VPOH 1YC8A 4TTDD 5FGSA 3RJDA 1P4LA 5DJDA 2P5EB 35C8H 5TH2A 1D9KA 4PJ9B 2XQYK 4MZ2A 2MMXA 2GAZA 2OSLA 3FQXA 4J8RA 4XVSH 1IFHH 3QG7H 1HHGB 4JKLA 3SY0B 4M5YH 5F9AC 3GSNL 3TO2A 1YY9C 4NFCA 3B8YA 3QXAA 3L3OA 4NZRL 2YR3A 3PWVB 2CD0A 3HR5B 1QBBA 2AJXL 5J12B 5IB2A 2P47B 3UBXB 1FIEA 5J11B 3K8MA 1P7KA 4OKVB 5TE7H 2BSED 5I74B 5KAQF 5MEPB 3E6HA 4PP2B 3E3QC 1VFUA 2IANA 1KLUB 4WTZA 3N06B 1Q0XL 1G9EA 2YZ8A 1T7ZA 1YEEH 5D8JL 4LOUC 1A1OA 5IHZB 1EBPA 4KKLD 5ESVA 5IBLD 5JMRA 4YHKH 4H26B 1JGEB 5CBAA 4XCYA 3VWJA 4GBXD 3UDWA 4KQ4L 3V7MA 2ICEB 4MXQD 3WKML 4MD4B 1URLA 3WIHA 4Z18A 3DTXB 4EI5C 2YUWA 3BRGC 1MI5B 1SY6H 4U7MA 1ERNA 2R1WB 3EO1B 1A7NH 2XN9A 3DURA 4LEOB 2HH0H 5I18H 5ID0A 4RRPA 4F3FA 5DRZB 4NJAH 4WEBH 1Q9OB 3SDAB 1N0XH 3JUZA 4Z77B 1R5IA 4PY8I 3RWJB 2BSTB 1MWAL 4X9BA 1HKFA 1CXKA 1NFDE 3MBEB 1L9MA 3ZYZA 4CN1A 4EEEA 3WN5C 1QA9B 4S2SA 4XPFH 4WW2F 3Q3GA 1RK0B 1Z5LB 5M94B 3DUHA 5IW3A 4Q9BA 4HSQA 3IKKA 5EOQL 4JHWL 1L6ZA 2YPKB 4HS3B 1BBDL 4GAJH 4NM4L 1MREL 2ZJSL 2CPCA 4PUBL 3E1F1 4LGRB 4WHYG 3GMQB 2CDEB 2GK0A 4L3CB 4MQ7A 4H5SA 4N1CA 3HUJB 1E6JH 1ZHKB 3ZE2E 4U1NA 3UXFA 3MZTA 2R1YB 5BRZE 4MX7A 5T3XE 5F9DC 4NGHL 1FG9C 4H8WL 3ES6A 4FG6C 2FATL 5FYJD 5JPMB 3GJFA 5I1LB 1DDHB 4BZ1L 2GSGB 1PG7W 1MCKA 4NKIH 5D5ME 5HYJE 5HI3C 4JO3H 2HJKB 2CXGA 4PG2A 2R9HD 3DROA 3BSZH 5GGSY 3TV3H 3C60D 1BOGB 2J6EA 1MJ7L 5F3BB 4QF1B 4GMTH 2OI9B 3DLQR 5A2LH 2V2TB 1FVEB 1G0YR 4Q0XL 3FO9A 1R3KB 1OAKL 2O5ZH 1ORQA 3CVIL 3P30H 5DDHB 5E08L 1A7QL 2X4OB 1MHHB 4GRMB 2CSPA 3RX5A 1TETL 4IMKC 4KK6D 3WE6A 2F54E 1H3PL 1II4E 4J3XA 5HHMB 3VGDA 4G8FB 4P2YA 2FJGB 5INDA 1J0YA 3ARGD 5DEZA 5I1HL 5LXGH 4G8IB 3UPCA 2OJZH 4AIZB 4X6BB 1H8OA 5C8JA 1S9XB 3WJLC 4JZOB 5GRJH 5AAMA 3KYMB 4XP6H 4YPGA 3SDDB 3U2SB 3VFGL 3V0VA 2A6JA 5B4MC 1U8IA 3JWOL 4MA7H 1BM3H 1Q1JH 1RVFH 3GSXA 1YPZA 2VDML 5DRNA 1AHWB 1TZIA 5FDYA 3TCLA 4QOKE 5GZOC 2VKXA 3QCTH 4I18A 4M1CC 5E99L 4PS4H 2DIJA 3IDYC 1WCQA 3QIBB 2FDBP 4KTDH 4KUCD 5MENA 5J13B 4G8GE 3O6LH 4YE4L 3SE8L 2XQYG 4NNYB 4NZJA 4HDIA 4S10A 1IFHL 3MX0A 4L8SA 4MJ5B 5IGXH 5L2KA 3D9AH 5IMMB 4NO5B 3T3MF 5DTFB 3T0EC 3UROR 3GSWA 1F90L 3B6SA 4MNHA 4KI5E 5FECA 5EOTB 4NO0D 4FFVD 4PJ5D 4MCZB 4AENB 1PFCA 4NRXB 2EDNA 4PRNA 3VFUB 3MLTA 5JXAL 3WXVH 1XCQB 5IW1B 5TE7L 2CMRL 1KV3A 2Q7YB 4OZIB 4J3TA 1DE4A 2E6PA 2FR4A 2NY4C 1BD2B 3ULUL 2J4WH 4L29A 2BCKA 5KN5B 5GIRA 4YHZH 2GT9A 3O0RL 4M7JH 4P23C 4MA1C 1NCNA 3ET9F 4G5ZH 1UH2A 3PWNB 3RVWC 1UB5B 4UQ2B 3QJFB 3SJVD 4FFWC 3QUMB 3WO4C 2H41A 4YHIB 3MBXL 3VCLA 1JPSL 8CGTA 4R2GD 2I25N 3QUYD 4XPTL 3DBXB 2D7QA 1YEDB 2Y25A 3AM8C 3C08H 3VH8B 5AZ2H 4HIXH 4DK3A 3ULVF 1EFXB 4HBCH 4AEIL 5KVGL 4JPWH 3W2DL 4ZTOH 2XTJC 2DQUL 2X1XR 5FCUL 1B4JL 3MUGA 1K9TA 3S3PA 1RAMA 2FWOA 1Y6KR 3HMXA 4IJ3C 2X2YA 5JTWA 3KPPA 1BLNB 4XXCC 1UZ8B 3T08A 1C16A 3GSRA 2Y5TB 1KTDA 2HLFD 3CXHK 3FN3A 3EJZC 2FJHA 4HPOL 1N4XL 2VLME 3KPSD 4FOMA 5D93C 3FB5A 2EECA 4P9HL 1UWXK 5I0ZA 3PP4L 1NUDA 1NBYB 4U3HA 4YGVA 5FKPA 4R0LB 5DJYA 2W1NA 5JR1L 3V6OE 5LQBH 3B2VL 3EO0B 5E8PB 2ESVD 4HS8H 2M2DA 4EI6A 3ARQA 3PE9A 5F6IB 2DWDB 5IEHB 4GKSB 4LVHC 2NZ9D 1OD7A 5INCB 3GIVB 3TIDA 2F74B 1MCOL 3A0OA 2FGZA 5IMLA 1YNLL 5I1AA 3BH9A 5CSZB 4RA0C 1FFNB 1NQBA 4L5FH 5I16A 3O9WC 4NO0B 4HC1L 1U8MA 5GHWH 4NC1E 1JZ8A 4CU7A 2BVPB 3RUGE 2HFGH 1FO0H 1IGIH 4X98A 2X9YA 1JF5A 2Y5EA 1HOCA 4U1HA 1PX3A 5JHDE 4YFLI 5E8NA 1UJ3C 2B0SL 4PRIB 1T1ZB 5CIPH 4NRYA 1HQ4B 4TUKL 3MRQB 3VXTB 5FKAA 6FABL 1OAZH 2CK0L 3OKYA 2VITB 4KRLB 3BIKA 3BXNB 3IU3B 1OP5K 3KLHC 5T3ZH 2DQIL 2APTA 3ARRA 2EC9T 3ARZA 3P0GB 4G9FA 1QP1A 5H37G 3NIDE 4PV9B 1KT2A 5CEYB 3DVNA 3VG0L 4AMKL 5ID1B 5FIEA 4YDIL 1EBAA 5LCVH 5J6HA 1SEQH 1MFEH 1HEZB 2OR7A 4LSVH 1LHZA 3IXAA 5KVFH 5L0QC 5E00A 1MEXL 2NW3B 3LKOB 3TYFB 3UZEA 5JW3L 2XFXA 4QT5A 3BZFB 4XP5L 1I3GH 5GGQH 1NBVH 1CE1L 3LEYH 5F8QC 5ALBH 1IJ9A 3K4AA 4UUJA 4WU7A 2PUQT 4L1DA 4LVOC 2CKBL 4NQED 3D0LA 1A9BB 3D9AL 1KEGH 4EBQL 3J8F7 4ZXBB 4V2BA 1CGSL 4RFEB 3V6FB 4PJHE 3OTTA 4H0HB 2QSCH 2J8UB 4NQSB 4L8DA 1D6EA 1MF2H 4PJIA 2V2XA 3HPLB 3ULSA 3IVKB 4U0RB 4F57H 3KPQB 5C0AB 2GTZB 4R3SA 2QKIB 2SEBA 3STBA 2AJYL 1AQKH 4FXGB 5EN2A 5E4EB 3KYKH 3RY6A 2R15A 4GAYA 5E7FA 3T0BA 3FZUD 3V7AG 3ARFA 4U6XB 3E8UH 3MJ9H 4L9LA 5C09A 5J8OA 2NNAA 2R4SH 3HZKA 4I0PD 4G6FD 5DZLA 5C0EB 1S8DB 4BJLA 4C59B 4TVSa 1YECL 4B0MM 5FM8A 3EHBD 1M7DB 2APVA 5EU4B 5DMKA 4CNIB 3ARUA 4OCYH 1O0VA 2GI7A 1GPOH 4RRPG 4PJ8C 1OAXL 1KB9J 2VH5H 1MJ8H 4M48L 3VE0A 4ZTOL 2EDRA 1H8NA 2BY2A 4NT6A 3IFPA 4DW2L 1NC4D 3BKYH 1S7XA 4BQ9A 3TN0A 1CIUA 4YQXH 3WFBH 4WEMB 5D7LD 5DK0A 2B1HH 1L6XA 3KPRA 1S9VB 3KJ6L 1GH7A 2YK1H 4P3DA 4L3EE 4X6CB 1I1AC 1EH9A 2W91A 5EU6E 4Q74A 1VERA 1FVCA 4OCXL 3IETB 1Q0YH 5E03A 3SO5A 3H9YA 4OQ1A 4OGXH 1H3GA 4PJEB 3UTPE 4LNVA 1PYWA 1NLBL 3WEXB 1WGOA 3FHQA 4JZJC 1CGTA 1S7TA 4PJDE 1N3NB 5DWUL 1Z0NA 4PJCE 4HQQL 3S98A 4I13B 1HH6B 2AKRB 3BI9X 1T5XA 1XGRA 1I8MA 3L1OH 4HS8L 1TTFA 5KSAD 1JHTB 3WUWA 3AMKA 2DBJA 4Y2DA 2AEWA 1KLFA 1SY6A 3TPKA 1IAMA 2D7OA 3PDOB 1A3RH 2NZIA 4PTTA 32C2A 4JQVA 4NOBA 4U7SA 1Q8MA 3QHZL 2I07B 3TBWB 5AZEH 4G6MH 4JN1L 2PETA 4RWHA 5MEOB 4MNQE 5E2JA 4WFGE 3UJIH 4FZEH 3C5JA 2HKFH 4WWKD 2HFEA 4LKCB 2FECL 3QI9B 1FNSL 4Y5YB 5IB1A 3MRHB 4P2RE 3ULVL 1A3LL 3MA9H 5DMGD 5ICZB 4LHUD 5ESAA 4JFFE 3MNWA 1CDBA 4NYLB 3C8KA 4GRWE 4YXLH 4P3CH 2EDDA 2G9HB 1DBJH 1S9WA 2Q3AA 3N50A 2UY6A 2APBA 4I0PB 1NDGA 2VLRA 1TNNA 1BQSA 4YHNB 1WICA 3PHOB 4Y4KA 1CGYA 5CFHA 1L4IA 4E0RB 2BHYA 1TZHB 4OZHE 2C1PA 3DX7A 4JVWA 4JFQA 5FAAA 5C2UB 4LLYA 4LLDB 4KVCL 1CICA 5E2UL 4ZPVB 1T1YA 2X4RA 1E4KA 2MPAH 1FHGA 2FJFA 4LRIC 4NC1C 4C54A 5I15H 4KKLC 1I7RA 4MJIA 5IBLC 3HRZB 5J6GB 4GBXC 1S7QA 3QFJE 4MXQC 2V5RA 2PCPB 3KXFD 3KG5A 4HK3J 4WFHE 2B4CL 4HWNA 1ZA6A 4OGYH 5C0GA 4N68A 5IB3A 1EFQA 1DQLL 5EO0B 5KZCD 3SCMB 3OR6A 5CJQL 2DL9A 3CVHL 4K3DH 4Y5VB 4Z0XB 4HFWA 1U9KA 1FPTH 5IT2H 1F2XK 4CBPA 3PWJA 1WBZB 2UWEF 3FT4A 5EC2B 1CE6B 1XIWA 4ACPA 5GSVB 2H6PA 2AV7A 1YMHA 4B53A 5FHAH 3L5IA 1MAML 4M61A 5HGBB 1K2DA 3UYOD 3HI5L 5J1AB 4Z5RB 4UINL 1WFNA 4LLVA 4NCC2 1QNZL 2GQHA 3HAEB 3NAAH 4EIGB 3A6CL 4DVBA 2OTUA 3QIWA 2ZPKH 1RD6A 3RY5A 4LPWA 4K3GA 2DQJH 1MFDL 3CCHA 3I2CL 3K7UA 4JN2A 1INEH 3G6JB 5ANME 4KXZI 2VLJB 4JB9L 1RU9H 2AJUL 1EO5A 2FBJH 4KQ3L 4NHUA 2P42B 5IVZB 5KSBE 3BKCH 4LPUA 5I8KL 5DT1H 5C2BL 3KPMA 3X11B 1BJ1J 1RULH 1JGDB 3EYUH 2N7AA 3BDYH 4P0DA 4OCRL 5KJRH 3RHWF 3VXSA 1NGQH 4EVNA 1U2CA 4OLVH 3F7VA 1FP5A 2W65A 4WWKB 4HFUH 1E6OH 2HVJB 3MGOA 4C83B 5DD0L 1GC1C 3RWDB 2W0FB 4U1SB 4HUVB 5BMFH 3RDTB 1MCDA 2X4NA 4FQCH 3ECBB 5F7EL 1KF9B 2FHFA 3AVEA 5D9SB 3ARBA 3FO1A 5A3ID 4Z76A 1JYVA 4O2EA 2QV2A 4U0QB 4L4VA 1X7QA 4JPKL 4YWGH 1I7TA 1UCTA 3GSQB 3LY6A 4PJ7E 5D72L 5ACMA 1LP9B 3FO0L 3TJHD 2AK1L 3C60C 1KIUA 1JJUA 1MFCL 4MAYD 4CMHC 4Q2ZA 1A14H 4O58L 1MIEL 2IWGA 5LBSL 2YA1A 5DK2A 3RIFF 1MLBB 4H0IA 5CEZD 2OJEB 2ZZUT 2AJZB 5EIVA 4XP9H 4YHOL 2YD1A 1EO8L 3L3DB 4F7MA 5I1KL 2EYRB 2EDBA 1G7LA 1WCBB 3T2OA 3ARGC 4POZD 1FAIL 4Y5XC 4L8CB 2ICWA 1QRNA 4QYOA 1HILA 3BH8A 5IB5A 4NJ9H 1BFSA 1NKRA 1FYTA 3GI9H 5KZCB 3VFRA 3K74B 3U0PA 1XGPB 3QUZC 1KPUB 1AR1D 4I2XB 1ZTXH 4BSVA 1OW0A 5C0BB 3HZYB 1PDKA 2AJVH 2YPLB 3TH2T 3W0WE 2IPUK 3LKRA 1P9MC 3SHSA 3PDDA 3PIQB 2H8PA 4D0DA 5I1JL 2ORBL 5E9DA 3S37H 2NX5B 1T03H 3K2UH 1INQB 3REWA 2FHBA 4ELKB 2VIRA 2W9EL 2IG2H 2CLZB 1AD9B 3IDMB 5GRZA 5HHOA 1KB5H 4ERSL 4HKBB 4K3EL 4HIJB 2BXZA 4XHJD 1RZ7L 3QEUA 2E8ZA 4KJQC 5GJTH 5DJCB 1U58B 5B3JF 3QULB 2VKWA 3G5XB 1G7HB 3VMNA 3TJEL 1WBYA 2DQDH 4QTIL 3WIFB 1U3ZA 3OG4B 2H9GA 2VR5A 4FFVC 5E2TL 4PJGE 1IILE 2DM2A 2LFGA 4TOYH 3BKJL 4LKXB 3QDJA 4Q6IA 2L0DA 1HHKA 3HI1B 1DEDA 3VGHA 3HKFA 4X99A 1QLRB 4EN3A 3QB7C 3T4YA 1QSEA 3QCVH 2X9XA 3VXMA 1CT8B 3OF6A 3HNSL 1JHLH 4PY8J 3HMWH 4XAKD 1IM9A 3OL2A 1TVBB 1EGJH 5EOCJ 5CEXB 2DI8A 1F4HA 5DUBA 5FA3B 4S1SL 4CMMA 3MLYH 5DVOA 3MV9A 3DSFL 2R69L 1NH6A 4MD5A 3ZKQD 2OTWB 2P7TA 1NFIB 3ZT5A 1LE9A 1A1NB 2CDFA 5E24E 5T1LB 4APQD 3MUHL 3GBNH 4R2GC 4JG1L 2X9WA 4HPYL 3QUYC 1G6RB 3D3VD 4DZBA 1U8OA 2VLKA 4U3CA 4U6YB 1AXTL 2FX9H 3ZDYF 1Q9WA 2PKDA 5C6TL 1LK2A 1RIUH 1GGIL 4YLQT 3T2NL 3P4OA 5D7IF 4O2FA 5ITFB 5CIPA 1PG7H 4ODTH 4TTGA 1F11B 1FNGB 4TUJB 3RVUC 5TDNB 4HCRH 3HG1D 5FYLL 5DO2C 1HXYA 4GG8B 4DGIH 5IFHH 2HA1A 1T21A 1T4KA 4OGZA 3AXLA 1AP2A 3EOBB 3OJDA 1YA5A 3QH3B 1YJDL 4TUOA 2EC8A 3HRPA 5F7YC 3VXRE 1OL0A 2DLFL 5CILL 3O4LD 1FLRH 1XZ0A 5CBEA 2GFBB 3PQYA 3TIEB 2D0FA 5D1ZB 3EYUL 2YSSB 3T0EB 5IK3B 1S9KC 1IZJA 5FYKE 2PO6D 3ROOA 4DTGL 3MRNB 3IDJA 5K9OA 1BPVA 1N8ZA 2E9JA 1RFDL 5EC1A 4F9LA 5DD5L 3NGBB 1OCWL 1NGYB 3BUYB 1AD0B 2NZ9C 2Y6SD 4XC1H 4QWWD 4FQCL 3QZWB 3K4ZA 5EZLA 5BVPL 3MJGX 1I8KA 4I9WE 1MIMH 4OBRA 2CIKB 4QEGA 2GW5A 4TSCH 4NN7C 1MJUH 2NTSP 3U9PH 2FL5A 4CGTA 3C2SA 4P23B 4P59H 5E1HB 4XX1E 2GUOB 2DRUA 3S6CA 4GMSL 3FFDB 1G9MC 1CFTA 4KKCD 4FQIH 4RBPK 3WNLA 3U9UA 4OZ4A 3G08A 3VGFA 3VDBA 3WS6C 1EXUB 2BNUA 2IAMA 1X4YA 1QG3A 5BQ7A 4PLOB 3RL2A 2DTMH 1RZIA 3D18B 5ACZB 1J8HD 5HPOA 1JWMB 1IAOA 4XCFL 5TDPB 1GGYA 2ZUQB 1N59A 2BSSB 2FX8L 3TVMB 5KS9A 3CDGA 4R7DB 2HLAB 1JN6A 1FNFA 3R1GL 4NJ9L 3RZWA 2ZCHH 3MJ9A 3GSVB 1MLCA 4C56E 1XGYH 1BQHA 1OTSC 1YUHB 5TQ2L 3TBTB 1KIPB 1SYVA 3I6KA 5JLZA 3CJJA 5E8DL 3D39A 1CF8H 3HI6H 5EH1A 3WUWG 5ADPL 2VZ3A 2F8OA 3GMPB 4MJ6A 4N1EA 4CVWA 2VISA 4JFXB 5KVDL 5HYSB 1IGML 1U8KB 4LCCA 2J3SA 5D93B 1ACYH 2EDEA 4OFVA 4BQBA 4NNPL 3KS0J 1E27A 2CO7B 2D2OA 5D7JB 4XPBH 2GSIA 5E4IA 5EDXA 1QHPA 3SKMA 2LE9A 1JZ5A 1S9YA 1ZLVK 3P4MA 4ELMF 1NFDB 4HT1L 3RI5K 4RDQG 4LEXH 3FT3A 1OT2A 3SE3C 3V5HB 2V5SA 3O3AB 3QEHA 3MRPA 4A6YB 4LCYA 5IOPB 3MV8A 3G6DH 4RAVA 4M7KL 4R6UA 3T04D 4NQXB 3ARTA 5C0RH 1NGZB 2HWZH 3GRWL 5IHBA 1UA6H 2XZAL 4L4TE 2BVYA 3Q6FB 2BK8A 2ICWI 3FB7B 4M62H 5F21B 4KPHL 1NMBL 4LSRL 3MLUL 1JPTL 4I4WB 3NIGE 4ONHB 4HXBH 4JRXE 4KJWD 2XNAA 3VDAA 4K8RH 1AO7A 3FOLB 1NGPH 3LRSA 2VQ1A 4XP1H 1WT5C 3KYOA 1DBKH 1NEZG 1ED3A 3AROA 4LLMA 1WIUA 5AWNL 5BRZB 1KGCE 2DF3A 1D9KD 4PTUA 5E8EB 3FZUC 2Q8AH 3GFUA 3EYVA 5I76B 3FRUA 4LLQB 1MNUL 5F96L 1JWUA 2VXTL 5D5MB 5HYJB 4NIKB 3QXDA 3RTQB 1FVDA 3H8NA 1KXTB 1W2KT 5F1IB 1W8OA 2XWBA 5I30H 1ZGLB 1GJIA 4Y0GA 3MCLL 2VABB 4AG4L 4FTVE 2EXWD 2V9QA 2CR3A 3QO0B 5DK3A 2FRGP 1P4BL 4HIIB 4WUKH 4TVPE 3WNOA 3SBWA 2DLGA 2FEDD 3GO1L 3UAJD 3FQWB 4DKEL 4M1GL 1K8IB 3S3SA 3DV6A 3NCMA 1FN4B 3QWRA 3T0XA 3CFDA 1VFAA 4N8VA 4DGIL 1XFPA 2FGWL 1G7MB 2KBGA 1LDPH 4LVNC 2AEQH 1IC4H 3NN8B 4NWTH 2RFXA 2K9UA 3BW9A 3LKPA 2J5LC 4G80B 5TGBB 5DMIH 4G6KH 1TIUA 4NC0B 2XN9D 4XC3H 4RMUA 4AH2B 1I3RA 1FIGH 3BRDA 1RZJC 4RFOH 4XVJL 4CW1B 3ZDXF 5JXEA 5EUOA 1KCVH 2NLJA 3QA3A 4XMLL 2YOCA 3HC4H 1RZ8B 4NKMA 4NQDA 4LNRB 3BYYA 5DUML 3WLBA 1C5CH 4ORZC 1U8HA 4J4PA 2F53E 5C0DA 5D6CB 4P46A 1HZHH 3LQMA 4FMKA 4HUWA 3L3JA 2DWEA 3O2WL 4P59L 3VFSA 2NY0B 3BN9C 4KHXH 5EZIL 4IRJB 3T0AA 1S7VA 3VXUA 5I8OL 1NEUA 5KG9A 5DMGC 5IFJB 2W60B 4G42A 1DEEB 1OB1B 4HK3N 3FFCA 2X4QA 5BZWA 1VFBA 4ZFOA 2F19L 2YD8A 4CVZA 4U1MB 5JPNA 1HSBA 2RBLA 4DGYH 1EHLH 1JWSA 1SJHA 5IVXA 4O2CB 1IKNC 3CFEB 4ZPTA 5DD1L 4XBGB 2VDRH 2HVKB 1K5NA 3LKSA 3WO3B 2MWCA 3T2QA 1TZGL 5DF0A 1ZE3C 3HCVA 4WO4B 5ICYB 3U48A 1HI6A 1DQJA 4UILL 1TJIH 1DANT 1F4YH 2XG4A 3CU1A 3QO1A 3IFLL 4QXGL 1KUMA 1H5BC 2R2CA 5JIHA 2J2ZA 1F4WH 1K4DA 1PSKH 2I9LB 2MCPL 3U0TA 5IW6A 4XCNB 2HFFB 2QQKL 4P2QA 4HIHA 3RWFA 3MO1B 4Y16B 4NWUL 1D5IH 2H32B 3GMOA 2CDGB 4PRPE 2H45A 2MKLC 3H42H 3NABH 1KJ3H 2X1PA 3FO2B 1S3KL 3QIUB 4NQVB 2CO6B 1UG9A 5DS8A 3U7YH 1OGTB 3SDCA 3S5LB 4S1DD 4UT6L 4ZUSB 4DN3H 4KTEL 2E7BA 3N1GC 7CGTA 3HR6A 3MYJB 2P24A 2GCYB 2G5BB 3T3PE 1ZT1B 3RGVA 1OQOA 3VXOA 3QWOA 5C6PB 3VFTA 1DSFH 4YIQB 5CHNB 3T4AB 4JREB 1U95B 5HPMB 3DRQA 2GIYA 4V1DE 3TH4T 5D70L 2CIIB 1FL6A 5FUZH 4HX1A 5MEND 5D1XB 2E5EA 4XNQB 1EEZB 5ESQB 5HYEA 5JA9A 5DR5H 2G5RA 1NFKA 3DWTA 5L2KD 5GZND 4AT6A 4JG0H 1TJHH 3ZKSD 3WSQH 3ZKXC 4LLWA 3I75A 2EEDA 2YXFA 5JQHC 3L9RA 3NZ8B 5ILTL 4WNQA 3N9GH 4X4ZA 5A3IC 1SBSL 3QNZA 1OP3K 1W72H 2Q20A 1RHHA 2JCCA 3RUGB 3GIZH 1DLHA 1WTLA 2L7JA 3TJHC 1YEFH 1IM3A 4MAYC 4A6YL 3VD4A 2Z9TA 4HJJL 4LDOB 3BUTA 5JHDB 4XNXH 3RNKB 3X3GH 4NQTA 1JPGA 4KRPB 3S88L 4PR5B 4XPHL 1T1WA 3AS1A 3LV3A 4QHLB 1IE5A 3OAZK 1EMTL 4TSAL 4HWEL 5CS7A 3EDKA 5TF0A 1CWVA 4RWYL 2MQ0A 4POZC 5JHLL 1JGUL 5DUPH 3MJ8A 3CDCA 3P11H 1MOEA 1JL8A 3MLXH 3JWDC 4HWZA 4EJ1C 2F5AL 3QNYB 2R2HB 1BZ7B 1EGJA 4NZTH 5CP3A 1F4XH 5T3XL 1KACB 1D5BA 3D25B 3IDGA 4IIQB 5DA0B 3SPVB 2ATKB 4YO0B 3U7WL 1AR1C 5DQDL 3LD8B 4WI7A 3QNXA 3BVNB 4HUMB 1SVCP 3UZVB 1FZMA 2XWTA 1YNTA 1HKLL 4MB4A 5AYQA 3U1SH 1MUJA 1CL7H 5HI5D 1MCQA 1HXMA 3VXPA 4PLKC 2CUIA 4RBPH 3MSPA 4YHYC 3DIFA 4E41A 4X7EC 1HDMA 2E27L 4BH7B 2D7PA 2AXHA 3T0WA 3C5ZD 1GZQA 1REIA 5E1AA 4H88L 4XHJC 4DGVL 5E6IA 3O45B 2YMXL 4DOHE 4HCRA 5FM4A 4QRQA 4XI5D 4Q9CA 3LB6D 4XH2B 1S7WB 3RZCA 5DYOB 3PP3K 4L3AA 4N5UA 4KGLA 3BZDA 2OZ4L 5MI0C 1FZJA 5DHYA 4WI6A 4JY4B 1U8NA 4PGEA 1U8LB 2IANE 1PY9A 2O61A 1A7PL 5CD5D 1FSKC 4ODXA 1BZ9A 1XGQB 4Q7DA 4KJPC 5DRXB 1ZEAL 4JRYE 5MEQA 3OAYH 5CD3B 2R39A 1B0RA 2A77H 5I6XC 1BQLL 1XF4B 2BERA 1WEJH 5IUSA 5CSGA 5T1KA 3V7AE 1RY7B 1KJ2B 3IDNA 1NAMB 3IF1B 3AU1B 3MLWH 1OAQL 1JZ7A 3EFDH 3LEVL 2IQ9H 2ZUXA 1FGNL 4APQC 2AJSL 2Q8BL 3TA3A 2ERJC 3QG6B 1QR1B 3MRGA 3QUZB 2B5IC 2NY6D 1C1EL 1ZHNA 1HH9B 3UPRB 5D7SL 4Z7NF 3I9GH 4LP5A 2XIDA 3CSPA 3BJLA 4KUCF 1UC6A 4JR9L 2VB5A 2EDYA 4WV1B 5FYJH 2R1XB 3NCJL 4L3EB 4YZFF 4X5XB 4G9FD 1HINH 3UO1H 5EU6B 3FRPG 2ATPA 4K23H 43C9B 4M1DL 1OGAE 4OLYL 1NCAH 3W39A 4YEFA 2DMBA 3IFOB 3K8KA 2DI7A 5DJAA 2EH8H 4H25A 1XF5A 5GRUH 4UT7H 5HYQB 3D48R 2R8SL 4PJDB 1N5YH 5EB9A 2HKHH 3FTGA 4YR6B 2OL3B 5HXMA 4PJCB 1SBBA 4RAUB 4BKLA 1A4JB 1K6QH 4YBHA 1W0WB 3MRDA 5CMAA 3F7RA 4PV8B 2PO6C 4UQ3B 4XMPL 1CFVL 1YYMH 4JY5H 1UKTA 3S4SA 3K1DA 3QUKB 4P5TA 1RZGB 3C5ZB 1BIIB 1LEGB 2IPKA 4ZSOA 2CLRB 2A0LD 2Y6SC 3MRFA 5LAXA 3PL6C 3HC0B 4YBQD 4QWWC 2I27N 3MPCA 5SWZE 3OKOB 4MNQB 3L3IA 5IIEB 1R3LB 5FEBA 3MA7A 1LNUA 4ZD3L 2E9WA 3LPWA 2YA0A 4OZFH 3TP4A 2FSEA 2OK0L 4KU1A 3ZL4L 1S7SB 1IEBA 3VXQA 4J23A 5H35A 1UQSA 4KKCC 1UEMA 3HFMH 4JFFB 5C9JB 12E8L 4PJAA 5GGRA 1MH5A 1FCCA 4GRWB 4X0KB 1B6DA 4GRLA 5IMKB 3ARFD 3TF7C 4OF6A 4GG6A 5C09D 4XP4L 1WSST 2H1PH 4OLUH 1MFBL 1IT9L 3C6LB 5SWSA 1ZK9A 3LOWA 1KEMH 1AY1H 4HJGA 4OZHB 5AEAA 3DECA 1O7SA 1K3ZA 5F7KC 3L6FB 4MD0B 1AJ7L 4OCNC 4R4BA 3O41A 1G7QA 1Q38A 1KCRH 4NUGL 4LSQL 3N1FC 2AXGB 3QFJB 1UKQA 3TN0D 1G7PA 3KPRD 5KW9L 4XNYL 1QACA 2EH7H 3JV4B 3QEGH 2UZIH 5EIIA 5EWIH 3HB3D 5ETUB 3ZSTA 4MWFB 3NFSH 4I48A 3S96B 4WUUE 2DQGH 2FO1A 1EUUA 2XZQL 3VRJA 2W9DH 4JDVB 4KZDL 1R5VB 2WANA 3Q5OA 4DEPB 4OB5H 4POUB 3M1BB 5F7DA 3GDBA 5FYJU 1XF2A 1QEWA 1IBGH 4ODWA 1FFOA 3U4BL 4X7SH 1HIMH 1UZ6E 5C86A 4Y1AA 1JI1A 1J1XL 4UOW1 3SKJL 4PRDB 1RPQA 5C08E 5GISH 1MFAL 3FQUA 1T7YA 4JQIH 4G3YH 4ZO6A 1QLFB 4LL9A 3BQUA 1MCPH 2R2BB 1SVZA 4Y2DD 1NCBH 5ANMB 3TYGH 1QFHA 3WIIL 5CZXD 5KSBB 1GAFH 2BNQE 5ENWA 4MXVE 2FD6H 4JCMA 4YX2L 4J12A 4KJWC 4MDIA 1YMMA 3FQTA 1CFNB 3MXVL 4J6RL 4MHHI 1T2JA 2V9TA 4X5WA 3SGDH 3QDHA 3RIAF 3WV0A 5FB8A 2VUYA 4I0CC 1RJLB 5F7NC 5SX4H 5CZVH 1WUNT 2QQLL 5SWQA 1D9KC 1F8TH 4JFOB 5CCKH 4M6NH 4XWGH 5JORB 2BMKB 3MROB 4WCYH 3SDXE 3W9DA 1T22A 3V8CA 4HG4J 2OMBA 3QXWA 1F42A 1NCDL 1QFWL 1QSFE 1OTTD 1QRKA 3KPNB 2P46B 4HWBL 4PJEF 5GS1A 4LCWA 5FO9B 1CGVA 3LMJL 4PY7B 4LIQE 1DBMH 2AXFB 4LSTH 4PJ7B 1IGYA 2VLRD 4XNMA 2EIZA 2EXWC 4UU9A 4ZO8A 1BFVH 2QSTA 1GC1L 4Y4KD 3OHXA 4Y4HD 3CFBB 1QSZA 5J06A 4XXDB 3QDME 2HJFA 3UAJC 4X6DF 3NOIA 1KG0A 2BVOA 4Z7VF 1CICD 1RK1A 5F6HJ 4PJFA 1Y6NR 1U3HB 3CFKB 4MJID 4WFFD 4ZFFB 4M8QA 3ZTJG 3THML 3DX8A 3VWJC 4ODBD 2XPGA 2IFFL 4LCUA 5IBUB 1LO5B 1A6TA 2A6IA 2GITA 4G6AD 4Z9KB 3RWGA 3CAFA 2YRZA 2ZCKH 2X4TB 4RFNB 5F71A 3QWQB 2CUHA 4OZGF 1ES0B 4B7IA 5BZDB 5GXBB 2DQCL 4W6XB 2GKIA 4N9GB 4JRWA 1X5IA 3BAEH 2P5EA 4JPVL 4XCCL 4PJ9A 1SEBB 1RURL 5DJ6B 5A43C 1LEIB 1X5HA 4CDHA 1SM3H 2P4AB 1HHGA 3SY0A 3I6GB 3W0WB 4YBLC 4YHML 3BYTA 4IOIA 5CUSH 3U0WH 3BMWA 3H9HB 1T89A 3CFCL 1ZAGA 4HHAB 5FXCH 3PWVA 1S7RA 2VZTA 3HR5A 2XRAH 2YEZB 1QBLH 2PR4H 4F2MB 3UBXA 3QIWD 1IQDB 1GZPB 1CLZL 4P4KB 3AUVA 4OKVA 3SKOB 1RUMH 5MEPA 4V2CB 1KC5H 3L5XH 4PP2A 1NCTA 1KLUA 1JK8B 3KYNB 3OZ9L 2WZPD 4F58H 4PB9H 4MQTB 4U49A 2UUDH 5IHZA 4FP8H 3M8OL 2I9TB 4PJGB 4H26A 1JGEA 3Q2CA 2VTFA 4OLWH 4PJBF 2CGRH 2C3WA 1RUQH 2I24N 3SE4C 2DLTA 3LN5B 3UTTE 4MD4A 3JV6B 4O4YH 3DTXA 1L7IL 1BAFH 4ZQKA 1MI5A 2XG5A 2P49B 1T83A 4D0BA 2R1WA 1U36A 3EO1A 4EDWH 5B8CB 5IF0B 4LEOA 4OD2B 3H7BB 1UGNA 1RZKC 2VSDA 3ARBD 5DRZA 3QEQE 5SX5H 3VFWB 1Q9OA 3SDAA 2X1QA 1FORH 4PG2C 3NIFE 4Z77A 3RWJA 2BSTA 4HAFA 4IBLT 3MBEA 1EAPB 3IDIB 2R0KL 1A6UL 2E7MA 5DJXB 4JFZH 1T1XB 4YXKL 4PG9B 1QA9A 4ONFH 4Y4HB 5D2LE 1EK3A 1RK0A 1Z5LA 4JVUA 3BPLC 1JUFB 1KJMB 4I3RL 5I73C 2YPKA 1A6WH 1YNKL 1XCTB 1FL5A 1OAUL 5LGHL 4QLRA 4F15C 4OD3H 3IGAB 1V3MA 2XT1B 1ZWIB 3NH7H 3PP3H 4F33B 3GMQA 2CDEA 3D1MC 1Z3GH 1QRND 4ALAH 4L3CA 3HUJA 2F5BH 1FYTD 4OI9A 4S1DC 1AE6L 4JFDE 2R1YA 1MCIA 2OCFD 3F5WB 2BFVL 2HYMA 5FUCC 4ENED 4PGCB 5JPMA 4KUZL 3VXRB 5I1LA 5KANG 1DDHA 3S35H 4G6JL 2I5YH 2GSGA 3CDYA 2Z31B 4I18C 4GS7C 2HJKA 5E9DD 1CFSB 2NXZD 5HGAB 4Y19E 1BOGA 1VFOA 5F3BA 5CCKL 4Z7OE 2V2TA 3IJYB 5HHOD 1DQTA 1FVEA 3HZVB 4L8SC 1R3KA 2EKJA 5GZNC 1JPFB 5DFWH 4R97C 5DDHA 5AD0B 3VW3H 2EEAA 3SO3B 2X4OA 2WMPA 1MHHA 4GRMA 4HULB 5D6DA 1KLGB 1RUPH 3BDBA 1MRDH 4G8FA 4JZNA 4K94C 3GB7B 1LO3H 2KPNA 3HAEH 3WHXB 2FJGA 1H8SA 4MAUH 3QDJD 4G8IA 1DQDL 4AIZA 3DYPA 4X6BA 1UWGL 3R8BB 1S9XA 5ELIA 4JZOA 4LQFL 1H5BB 3KYMA 1N2RA 1BFOB 4OF8A 4EN3D 4AQ1B 1QSED 5DD6B 3VXMD 3OF6D 3SDDA 3CXDH 3U2SA 4Z7UB 5CGTA 1J1PL 5JW4M 1N26A 1J0KA 4LK4A 1IM9D 3R0NA 4LMQE 5FHBL 1T7XA 2FB4L 3MACL 2YPVL 4QRRE 3K81A 3QHFH 3UMTA 1AHWA 1NBZB 3MV9D 3CPLB 3QUXB 3ARDB 4X9HA 1PZ5B 5F7WC 1S78D 2C4FU 1G9ML 2QL1A 2HT4C 4MMZC 1KPRB 1LK3H 1SJXA 4BSWB 3QIBA 4C56B 4FQXD 3JBG7 3MZGB 4KJYB 2VZVA 2VLKD 4NNYA 5F9WC 2X4UB 4E5XA 4XNZB 1TXKA 1VFMA 4R8WH 4MJ5A 1F58L 3NBNA 4NRZB 1RJZB 5IMMA 5BS0E 3U6RB 4NO5A 3BFOA 5DTFA 3U0WL 1CS6A 4TQEL 1BWWA 2IALB 3OX8B 5M7QA 5EOTA 2XRAL 5HI5C 1Z9OA 4MCZA 4AENA 4NRXA 3QRGL 4XPGL 3VFUA 4DN4L 3GHBL 5IW1A 1TQBB 4C55A 2Q7YA 5T3ZD 4OZIA 2EO9A 3RNQB 1BD2A 2NYYD 2EE2A 4MDJB 3IAQA 2VQTA 4F58L 3BT2L 1CXIA 3PQYD 5KN5A 3QXVA 4Z8FL 3V0WH 4OD1H 3CUPA 1YEIL 3LB6C 5C0JB 1CU4H 4L4TB 1G7JB 4NBZB 2V9RA 3PWNA 1UB5A 1A6ZB 4UQ2A 3A6BH 3MGTB 2K1MA 3QJFA 5IQ7L 5MHSD 2DBLH 3QUMA 4MA8H 5EBGA 3LS5L 3L3GB 1AGDA 2F9BT 4JRXB 4YHIA 3V4PL 1X5XA 1BJMA 2KKQA 3GBMH 1HNFA 2GTWB 1T0MB 3DBXA 4X6EB 1IQWH 1YEDA 3VH8A 1EFXA 3DMMD 4JO1H 5CD5C 3CLFH 4GH7B 2E6JA 2VJXA 4HKZB 3LQAH 1UADC 3OGCB 4IHOB 4QO1A 1MVFA 2IMMA 5AYUH 1QVOB 1LO2L 1DVFB 2X40A 4YUEL 3PV7A 1F4AA 3NZHL 3VD7A 1CD1B 1VACB 3B4NA 4I8DA 1BLNA 2IAMD 1UZ8A 1FNAA 2Y5TA 2C7UB 4WI3A 3H7LA 4OZFA 4FTVB 1KN4H 2WUBH 4M7LL 3FOMB 3OSKA 4ZTPL 3UTQB 2NY6C 3W5NA 4PFEA 1RIHL 4QRSB 3RAJH 1HCVA 1NBYA 4WI4A 4J7RA 5A16B 4YNYB 4R0LA 2KQMA 1I85A 3O3DB 4FQXB 5GS0H 3BPNB 5E8PA 3C2AL 1MY5A 5DC0A 4GLRH 3D39D 3ALWA 5FDWB 1IGCL 2VDKL 2ZSVB 4DZ8B 1JPST 2DWDA 5IEHA 4GKSA 2O93L 2B2XH 1FL3B 5INCA 1RI8A 3GIVA 3TWCL 2F74A 4XMKH 1J5OH 1BWMA 4Z0BL 2DQHH 1GOFA 1OP9A 3O3UN 5CSZA 4G7YH 1FFNA 3WBDA 3BRFA 3IS1X 2W9LA 1MSPA 4QRPE 4NO0A 3ETBF 3VFOB 4NBYB 5CEZH 1G6RH 1O7VA 2BVPA 3L7EB 3VXSE 1JHKL 5F70A 1PZUB 2F53B 4JO4L 4TPRH 1EEYB 1NGXB 3MV8D 3VGAC 1F3JB 4IRSB 2I26N 4N0CD 5EBMB 5K9QI 4PRIA 1T1ZA 2A0LC 2IEPA 1MRDL 4YBQC 1RZJL 3W5MA 1HQ4A 1LO3L 3BE1H 2OXHA 3MRQA 3HC3L 3QDGE 5EU7E 3VXTA 4WY7L 3DO7A 3GMRB 4CJ0A 2BDNL 2VDNH 4L4VE 4DUXA 5F1KC 2VITA 4AL8H 3BXNA 3IU3A 4GKNB 3CMOL 4WHDA 2ZUSA 2DD8L 1AO7D 4PV9A 3LN4B 4FS0A 3RY6C 4LSPH 4FNLH 1PEWA 5CEYA 3V6ZB 5ID1A 1TCRB 4KHTL 1WZ1H 4M6OL 3ZHKA 4XAWH 3WJJA 3ARFC 4L9LC 2YD3A 2B5IB 3HPJB 2E6QA 3E0GA 1I9RL 4H20H 1AI1L 3EDFA 5IEKB 4M43H 4M93B 1OAYL 4HMDA 3LKOA 2NW3A 3QPXH 2NMSA 3TYFA 5TPWH 3BZFA 1KN2H 3LS4H 1JNNL 1CL7I 1XF3A 3HNVH 4KROB 4Z95H 4FQ1H 4ZXBA 2VAJA 2LAAA 2PN5A 5I71C 3TN0C 4H1LG 3F7YB 2J8UA 4NQSA 3F58L 2VDOL 1A8JH 3OXSB 3HB3C 4ETQB 1JZ2A 2J12B 5DQ9B 5C7XL 3QWRD 4M6MH 3HPLA 3IVKA 1AGFB 3WD5L 5TDOB 1CD9B 4PRPB 1T6WA 3KPQA 3EGSB 4JANB 4ORGB 5C0AA 4U05A 2QKIA 4I1NB 4RMVA 4NZUL 1T80A 4FXGA 1PX4A 4W4OA 3DX9B 4FQJH 2EYTB 5JUEH 1E4XH 4NKQB 1CBVH 3PL6B 3QCUH 4FFZH 4U6XA 1Y6MR 3O6KH 5JXED 2O5YH 3Q0HA 4XBPB 3MOBH 1R0AH 2Y7QB 4WU5A 1QD0A 3KWWB 3T3ME 5C0EA 4PRAB 1ETZB 4P2OB 3OJMB 4Y2DC 1CGUA 4J4PD 4V1DB 5CZXC 4P46D 1M7DA 4X7TB 4JQVC 5EU4A 2BHUA 4CNIA 1FH5L 5D2NE 3BEVB 3LCYA 1CLYH 4TNVF 1EJOH 4ZODA 3B9VA 4JO1L 2H26B 1GL4B 3S36L 3WNMA 3L5HA 4JY6B 4GAGL 4JGJA 3SE9L 1J10A 3ELAT 5KOMC 2RCSH 5CJOL 3VXUD 4BK4A 4CVXB 3TPUB 3G5ZB 1S9VA 1Q72L 5C71A 1KSRA 3VD5A 3MLZL 4X6CA 1OTTC 3FFCD 1GHFL 3VXNB 1IC7L 1H3WM 3IETA 3BEWB 3K3QA 4ZNEE 1KIRB 5K9QG 4KDTA 4UMGA 3VDCA 4PJEA 2JELL 1ORSB 1PJ9A 4K7PH 3MREB 3D69B 3WEXA 3JTTB 1CR9H 4NHCL 4JHZA 3UYRL 1FGVH 1RZFL 4Y4KC 3ULVE 1DUYB 3KPOB 1N3NA 4DQOL 3WFEL 1T2QL 2JLLA 3QAZB 1CICC 3G04B 1HH6A 4RZCA 1E4KC 5JOPE 4P2CG 1JHTA 3LZFL 4FABL 4Z7VA 1VEOA 5CINL 1JNLL 4GKOA 3T77B 1W8NA 3PDOA 5DD3H 1QFUL 2ZUWA 1EVTC 3T09A 5HY9B 2E9BA 4G6AC 5IHUL 2I07A 1NLDL 1WJ3A 4MLSA 3CXHJ 3TBWA 1ZGLM 4P2QD 4YDJB 4YDLB 3B3IB 1A9EA 5MEOA 4XVUD 1TVHB 3BKMH 3HE7B 2EDWA 4LKCA 3QI9A 2DM3A 4Y5YA 5JO5B 1A47A 3MLRH 3MRHA 1XIWC 1PVHA 5ICZA 2Z8WC 2GJJA 2YBRA 3SDCD 4PGJA 5L88H 4HZAA 3JWDL 4K3JL 2JB5H 1PAMA 1J0HA 3PGFL 5BO1H 4NYLA 3KLAB 1MCEA 1MAKA 3VWKB 5ALCH 2G9HA 3QIWC 3IRZA 4I0PA 5JIPA 1ACZA 3PWUB 4YC2C 5TH2B 4YHNA 2PYED 4TSBL 5J7CC 3PHOA 3TT1H 2OSLB 5GRYA 4ZFGH 1JMXA 4U1KB 4OCWH 3VA6A 2A9NH 4E0RA 3INUL 1TZHA 3O2VH 1ZLSH 3MXWH 4DOHB 1BBJB 2DQEH 5JIIA 4LLDA 3WLWD 1D5MB 4ZPVA 1A3QA 3WHE0 2IGFH 4DAGH 2E7LA 2ARJQ 4YDVB 3HRZA 1I4FB 5HI4D 5FFLA 5J6GA 3FAXA 1I1FB 3G6AB 2C1OB 3IU4H 5GGSB 1CFQB 4ZYKB 5FO8B 3JTSB 2PCPA 3MV7E 3KS0H 1EHNA 4R96B 5EO0A 5TPWL 3BP6B 3SCMA 4Y5VA 4URTB 4J3OC 4D3CL 1SJEB 4Z0XA 4JRYB 3LEXB 1ODAA 2EKSB 3GUTB 1WBZA 4X80L 1IRAY 5EC2A 1CE6A 1F3DJ 5GSVA 3NCYP 1EHAA 1ADQL 4F37F 1B9ZA 2P5WD 5HGBA 5J1AA 1S5IL 5CJ8A 3AAZB 4Z5RA 3HAEA 4JFYB 5EZJB 4LDLB 1C08B 1JFQH 1ZANL 4Y4FB 5DLMH 3WFCH 5KSAA 5CJ5A 4QRTB 3V5KB 4NP4H 2VLJA 1XGUB 4Y88A 1OARH 1T7VA 5IVZA 2NR6D 5F9OH 3VFMB 3SOBL 5J56B 2HRPH 2P48B 2VOTA 4YFLF 3X11A 2Z8VC 5E6YA 1JGDA 4UDUB 2NY3C 5C0NC 4DVRH 1OGAB 5C0FB 5EOCL 3Q1SH 5HHPB 5I1DB 1BZQK 4OUOA 4WWKA 3V5DB 2YD6A 2HVJA 2DDQL 4C83A 2ENSA 2YUZA 4ENEC 1FE8L 3NTCL 1OW0C 3RWDA 5SX4I 2VZ1A 2W0FA 2WQ8A 2DJUA 4U1SA 4UTAH 3GM0A 4HUVA 3SGJA 2P8LB 2VXQH 4I5BB 3RDTA 5E5MB 3DGGB 1WBXB 4HLZH 3ECBA 1TQCB 3NPSB 2IBZY 1HYRC 2E3VA 3MODH 1KBGL 4NQCE 5D9SA 3RUGF 4MB3A 3VH8G 4H5SB 2NXZC 3JV5A 3GSQA 5GJSL 1LP9A 1ZA3B 4E41D 2VXSL 5B39G 3RIAK 2PYEB 4EUPG 1IKFL 2H32H 3EOAB 4UIKH 5IR1A 3CK0L 5E6ID 5K9JL 5J89A 3WIHH 1CXHA 2EO1A 3P0VL 2ZCLH 1MLBA 5SWZB 5MP6L 2OJEA 3RZCD 2AJZA 3EO9H 4GXVH 3H9SD 4OZFG 1FDLH 4XBEL 5IESH 3L3DA 3GHEL 4DFHA 3MUZ1 2EYRA 1TNMA 3TO4B 1FRGL 1WCBA 1XH3B 1ZHLB 4Q6IC 3FJTA 3UYPA 4L8CA 1CR9L 1NMCB 4EXKA 5KVEL 4EN3C 4AEFA 1OPGL 2WIIB 3GMLB 5IJKA 4I3SL 1L7TL 1XGPA 2AQ1A 3BPLB 3F12B 1X5YA 3C5SB 4OQTH 1KPUA 4FXKB 3EOTH 4I2XA 4EDXB 2Q1EA 2VNCA 3M07A 5T1KD 2NXYB 3DUSB 2A1WH 3HZYA 3L5WB 5C0BA 2YPLA 3O3BB 4QXUH 5INDB 4LSUH 1MJJB 3OBAA 3EAKA 4XNUL 1ITCA 3PIQA 3O11B 3BWUC 2NX5A 4ODUB 1OSPL 1INQA 4NUJB 2G2RB 3TA3D 1ZOXA 2Y07H 4ELKA 1YYLL 4RMTA 2G75B 2DQTH 4JFHD 2CLZA 1AD9A 3IDMA 4K07A 4BA8A 3WHE1 3D87B 4HKBA 4HIJA 3FN0H 3FQNB 2XXCB 4KK5D 2CRZA 2E8YA 4NQDE 1U58A 5DJCA 1UKSA 1LO0L 3RU8H 1OQXA 3QULA 3G5XA 2GJZB 4WUUB 1J9CT 1PLGL 1T6VN 3PHQB 2QADD 4QHNB 3SQBA 3P0YL 4ODVL 3OWEA 25C8H 4LKXA 4MGXA 1F97A 1YDPB 1RHFA 5GS3A 3U46B 4U1GB 4HDIB 5ADOH 4R26L 3PWPD 1QLRA 3P40A 1N6UA 3BO8B 1VHPA 1Z2KA 4DFIA 2NYYC 1CT8A 3DXAE 4D9QE 1NAKH 5C08B 2BY1A 5E2VH 4X4ME 4S1QH 4NBXB 1UACL 3B6SB 1TVBA 5CEXA 1UH4A 2VZUA 5FA3A 2FEEI 4LRNH 1ZLWK 4P5TD 4FQLH 2OTWA 4R9HA 1NFIA 2BNQB 1A1NA 1QFWM 5T1LA 1T0PB 4JKKA 4UT9H 4ONGH 3MTRA 1CDHA 2EC9U 4U31A 1G6RA 1QFPA 2DOCA 2CJUH 5GIRB 2XACC 3H9SB 5T5FL 1CK0H 2GT9B 3FL7A 1JTTA 4ZNCD 3TZVB 2A83B 5BOPA 3SDXB 3B2UD 5IJVB 1DTUA 5ITFA 1QSFB 4G7VL 2AP2A 3QQ4A 1F11A 3CGTA 3F62A 3MRIB 1FNGA 4OSUH 4TUJA 4X4XB 5TDNA 2IAMC 1R24A 3WXWH 1OTUD 4GRLD 1M71B 4KGJA 5B38B 1UM5L 1Y18B 2BOCB 4GG8A 1CZ8H 3E2HC 3EOBA 3QH3A 5C92A 4K8RD 4BQ8A 4GQ9L 3GSNB 5SWSD 3QDMB 3ZYIA 4OT1L 2GFBA 4WW1B 1U0QA 3TIEA 5D1ZA 4L1HA 3T0EA 3BPOB 4KFZC 5IK3A 2DLHA 5BW7A 2UWEE 3GSUB 3MRNA 2BNRE 1AGCB 3T65B 2WSKA 5HDOA 5TFSL 2XA8H 1W0YT 4QCIB 1U6AH 1NGYA 3BUYA 1AD0A 4IS6B 4LCCC 1KJ2H 3P2TA 2YXMA 1NAMH 3QZWA 2R0ZH 4F7CA 1YQVH 1YEKL 2CIKA 4YGVB 4WGWB 1GGCH 5I1CH 4R90H 4ZG1A 1LDSA 5IWLA 2ZKHH 2GUOA 5BCAA 1BIHA 2G60H 4IDJL 1MCCA 1T5WA 3C09C 4ZS7H 5HHVH 4OLEA 3FFDA 2OR9L 4DWHA 4JFEE 2VDPH 3A6OA 3WIHL 4CKVX 1EXUA 1ZS8B 3RX8A 4Y1AD 1GXEA 4ZAKB 1LD9B 3FB8A 1N6QL 3D18A 5ACZA 3P3YA 4PRHE 5E2WH 4F9PC 1JWMA 2I60L 4HH9B 5TDPA 1UM6L 3BQUD 2Y36H 1MWAB 2WINB 2KDGA 5EO9B 3RVXD 3TVMA 4KZEH 4U1IB 4R7DA 4JKPL 2HLAA 3WFZA 1Q9LB 1UWEL 4P57A 1YMMD 1YZZA 1MELA 3VMPA 3GSVA 5I19L 1YUHA 5DA4A 3TBTA 3IXTB 4KKNA 1KIPA 3RVTD 2OL3H 3UZQA 5FO7B 1IGJB 3NCFB 4O5LH 4KAQH 3UTTB 1GIGL 3GMPA 3STLB 4JFXA 4LPXA 4CVUA 5EPMB 5HYSA 1U8KA 4LASL 4MA3B 4ODSH 3WS3B 1VGEL 1L0YA 5B22A 3X17A 5D7JA 5F72S 3QEQB 4KRMB 4LCWD 3MUJA 5EA0H 2YWZA 3H9ZA 4U3XA 2DLEA 1NFDA 1JTOA 5ISZE 3F65A 3H0TB 2WV3A 3WFDL 3V5HA 3O3AA 3BZEB 2DM4A 2V2WB 1PKQE 5D2LB 3IAPA 5IOPA 1CTNA 2HT2D 3ULUD 2VAAB 3IJHB 1NGZA 1WFTA 1RZKL 2AGJL 1QHOA 3FMGL 3Q6FA 2VDQH 3FB7A 2R0WH 1X5AA 2Z35B 3VFVB 3L3KB 2IADB 1RMFL 1BEYH 2J6EL 2NY7L 4I4WA 4ONHA 5H2BB 4PJIF 3MC0A 1QKZH 1C5DB 3O8XB 5F89B 4MVBD 4JFDB 5BRZA 2P5ED 4GW1B 4PJ9D 1D6EB 5E8EA 5D1QC 4KV5F 5JXEC 2BOBA 5I76A 4LLQA 1FFPB 1OY3B 3KHQA 5B3JE 1MRFL 4AEHH 5D5MA 5HYJA 4J4PC 3RTQA 4J3SA 2PXYB 5F1IA 2UY7A 1M7IB 4KY1H 2R56H 4P46C 1ZGLA 4P9MH 4XVTL 4YK4C 4OLXH 1EUTA 2VABA 4K9EC 4Y19B 1A7OL 1UXWB 1MQKH 3LPFA 3QO0A 8FABB 3P4LA 1FCGA 2JKXA 4HIIA 1RIVL 1YEGL 5GGVL 2CRMA 3RWIA 4ISVB 3FQWA 1A6VH 4R4ND 2V17L 2UZYB 1K8IA 2ZSWB 5EFIB 5TE4H 3NCYS 1CXFA 1IC5H 3HAEG 1FN4A 1KELL 3I02B 3RPIB 4UV7H 2B20A 4JM2B 1HSAB 2ADIB 2A6KB 4BUHA 1JGLL 1G7MA 2WUCH 3ILQD 2JK5B 4I77L 3NN8A 4G80A 5TGBA 1MI5D 1U2HA 1F2QA 4AH2A 1H3TA 2EXYD 4S1RL 5C70A 1P6FA 3AY4A 1A5FH 4CW1A 3ZDYE 4UB0H 4PBXA 4N8CL 4X7CC 4QXTB 3SDAD 3N85H 4QRRB 4K94L 5TF1H 3V95A 5D7IE 3OKLB 1MPAL 4LNRA 2XQBH 5F93C 1CDYA 7FABH 2L7UA 3KHOA 3ZKMD 2ARJB 5D6CA 5BJTB 1KCUL 3N1QC 5FGRA 2NY1C 1S7TB 2QSVA 4K7PY 5I1CL 4OJFL 5TE6H 4XVUC 4IRJA 2Q6WB 2WBJB 4OTXH 4XGZB 3LHPH 5J1TC 5BS0B 4XCEB 2ADJB 5D96B 1LEKB 1DQQB 1VCAA 3UEZA 5IFJA 2W60A 1DEEA 1OB1A 3SDCC 4LIQL 1J12A 3OJ2C 3EDDA 2Z92B 4U1MA 5TQ0L 3LN9A 4G9DB 2MQCA 3MRBB 4GSDL 4M5ZH 2Z8SA 1UM4H 3RGVC 3OPZH 4O2CA 3CFEA 4RGOL 1B0WA 1EV2E 5E95B 1F13A 3C9NB 3D2UB 3I6LE 4XBGA 4ZOAA 2F58H 1OLLA 2HVKA 3B9KC 1Q9KB 2JJSA 3HMXL 4OIIH 1DL7L 4AQOA 4RISL 4WO4A 3L7FB 3RBSA 4FQ2L 4XPAL 3WLWC 5I1EL 1YEJL 3I50H 3EYSH 3ZTNH 5F7UA 5HDQL 3DI2B 5HI4C 1JMZA 2XTJE 1JI2A 1R3IH 2MCG1 4LSSL 1J86A 1A6AB 5KSVB 4BZ2H 4Z78B 4HLJA 4XCNA 2HFFA 4FMFA 4OFYA 3MO1A 5HHMD 2BX5A 1UYWL 4Y16A 5IG7A 3DYMA 2VR9A 1A7RH 1WIOA 4XTRD 4AEEA 4LLYB 2H32A 3MV01 2CDGA 1SHMA 4PB0L 4UBDD 1GGBH 1NEZB 3EYFB 3FO2A 4RAHA 2DN7A 3QIUA 4NQVA 2V7NB 2DICA 1OGTA 3S5LA 2ZP0T 3SDDD 4ZUSA 1V7NL 3NACL 1QTYT 3UTZB 3MYJA 2GCYA 2G5BA 1NCCH 1JNHB 1ZT1A 1UVQB 3OR6B 4JGMA 4JO2H 5BV7C 1E4XI 2PYFB 4YIQA 5CHNA 4M8VA 1X4XA 3T4AA 3E6FB 1IARB 1BEYL 1U95A 5HPMA 4M4PA 1B2WH 1GGUA 1MHPL 2F15A 4TRPL 3GGWB 3CZFA 1XIWB 2CIIA 4OUUB 4OQTA 4PJXB 3V6OA 3QIBD 3RA7L 5D1XA 3RX7A 1DBAH 4ELME 4XNQA 5BOZG 4RMWA 1EEZA 5ESQA 3KJ4C 3LPGA 4NN6C 3X3FL 2D03L 1NDMB 4K2UL 4WW2B 4RNRB 1QPPA 3DVFA 3LIZL 5IFAH 3WNNA 3FAWA 4LARH 4XZUB 1DFBL 2CXKA 4HXAL 5T1DL 3CLEH 4OIBA 1R3HB 2L4OA 2C9AA 2XZCH 3MLVH 2X1OA 4QRPB 4HZLB 4FHBD 2FLBT 3NZ8A 3BGAA 4MXWL 3V79C 3K80A 4MQSB 3RUGA 4GO6B 4GW5B 5C07E 4Z7UF 4LGPB 1IMHC 1BD2D 2BVTA 3MGOB 1TJGH 5JHDA 2AABH 3RNKA 3A67H 4N90E 3GZKA 5E6IC 1OM3L 1DLFH 4PR5A 1NMAH 1D6VL 5HDBF 4WGVB 4K71C 3RZCC 1AGBB 1C5BH 3QDGB 3QXTA 3MOAH 4QHLA 1I9JH 3LH2H 4L4VB 2CKBB 5GGTH 4GXUM 3NCEB 2OP4L 2X70B 3G5VB 4YPJA 3QNYA 2R2HA 1BZ7A 4IRZL 1HHJB 1EFXD 3OAUH 4O02L 3D25A 2BY0A 4IIQA 3RRQA 5JQ6H 3SPVA 5FYKH 2ATKA 1YEHH 4N9OB 4YO0A 5FUOH 2QQNH 3O2DH 3BVNA 4M7ZC 4YHLH 2WQRA 5EZOH 1M05B 5JW4Q 2PW2B 2FO4B 4M9PA 5L6YH 2R29L 4D2NA 4Q9RL 2MKWA 5I75C 1CFBA 4OLZL 2NY3B 2P43B 1JRHH 3ZKND 3TA3C 3P77B 4BH7A 5K59F 1J11A 2GJ6D 5EORL 2A74B 3BD5A 2AI0H 1IAIM 2BRRH 4D9LL 5FV1L 2XXMB 4MYWB 3NA9L 3KNBB 2PF6A 3O45A 4UAOB 1IAIH 4KK5C 4DKFH 4KRNA 2VXUL 2NY5H 1S7WA 4FXLA 4XH2A 1BGXH 1VPOL 35C8L 3IDXH 3NIGF 2IPTH 3H3PH 1JYWA 3MNZB 4XVSL 2OBGA 3DETD 3QG7L 4M5YL 4JY4A 1U8LA 1I3UA 1XR9B 4KK8C 3DI3B 1QUNA 1XGQA 2ADFH 5DRXA 5CD3A 3M17B 1XF4A 2N56A 1OSZB 4RMSA 4MLIA 1KJ2A 1NAMA 3IF1A 4P5TC 3AU1A 4NZDA 1YEEL 1G1CA 3KR3H 2BJMH 5D2NB 4PRID 3T4YB 2DJ4A 4H0GA 4YHKL 3QG6A 5E56A 3U4EB 1QR1A 3QUZA 4U1JB 1HH9A 3UPRA 4MJ2A 2AK4E 4RIRB 4RGNE 3B2UC 4CMMB 4WV1A 5KTEH 2R1XA 4L3EA 1SY6L 2O26U 4X5XA 4MD5B 1A7NL 1CLCA 5EU6A 1A4KB 2HH0L 5I18L 43C9A 3DPBA 1K4CA 2PW1B 4NJAL 4WEBL 1QLEH 4OF7A 4U1LB 4WHTB 4KK9D 1N0XL 4GRLC 1X6LA 3IFOA 4C58B 1FO0B 5D7KD 4XHQA 1QBMH 4XPFL 4K8RC 5HYQA 1LK2B 4PJDA 3HTLX 3BP4B 4YR6A 2OL3A 1EDQA 4HK0B 3ARYA 4PJCA 5CAYB 4RAUA 1I1YB 1A4JA 4WHYH 1ZSDB 1W0WA 3IRPX 4PV8A 3IKCB 4UQ3A 3UTSE 2HJLB 5GGVY 2VXVH 1YQ2A 4GAJL 5C0CE 2GJ6B 3QUKA 2EDJA 3MCKB 4ZXBD 1RZGA 3C5ZA 4M00A 1BIIA 4NO2B 1LEGA 3OKDB 4WI5A 1IC1A 5JOEA 2CLRA 4PREB 1E6JL 3HC0A 3O6MH 1BREA 2VL5A 4M6AA 3OKOA 4MNQA 4LFHD 5IIEA 1R3LA 3H6JA 5C0AD 3GKWH 5I17B 3MFFB 4KI1A 3RP1A 3GJFK 1P2CB 1S7SA 2W92A 1KENH 4LCIH 1VENA 4NKIL 4TVPH 4JFFA 5C9JA 2BY3A 3ZE0F 4JO3L 3IAGC 2KUTA 4X0KA 5F3HA 3CVHB 2RIKA 3BSZL 5IMKA 1PD6A 3TV3L 4GMTL 5GRWA 3P4NB 3T0VA 3BQUC 5EO1B 1D5ZB 3C6LA 4RGMC 2O5ZL 4OM0H 1M6OA 3ZO0A 4OZHA 3RVXC 4FZ8H 3P30L 3TESA 3V4VH 4JAMB 2VDLH 3U9UB 3V4UH 4MD0A 3CNKA 1G9NH 3RVTC 3ESUF 5KS9F 5LXGL 4N0FB 3IS0X 2AXGA 3QFJA 2OJZL 3QJHB 3O6FB 2AEPH 5EZOL 3MV7B 1OOAA 2IH3B 5GRJL 3JV4A 2Z0BA 2Q3ZA 5HVGB 5ITBH 4XP6L 5ETUA 4HBQA 4E9LA 5E5UB 3S96A 4MA7L 1BM3L 1Q1JL 1RVFL 2LVCA 4OCMC 5GS1C 4JDVA 4UTBH 4BK5A 1AFVH 1MLCB 3M1BA 2AI0L 4R4FH 4K3HA 3QCTL 4MJ6B 3T3PF 1H0DB 4BQCA 4PIRF 4PS4L 2HT2C 2D4FA 3AS0A 4NPYB 4KTDL 4PRDA 3O6LL 4JKMA 2C3GA 2FIKB 2PTUA 5DJ2B 4PPTA 4Q6YA 1QO3B 1QLFA 4B41A 3MRCB 2R2BA 5ANMA 5IGXL 1BJ8A 1BX2B 4GUPB 1OWWA 3C09B 3DVGB 5HD8D 5KSBA 4OV6F 3U30C 1G7IB 3VG9B 1EA9C 4M03A 2UV3A 4LP4A 5FYJE 1NL0H 2A73B 1CFNA 3MRMB 1WZMA 4MVBC 1ONQB 4NM8H 4KVNH 4OGAD 1JCKA 4PJ9C 2VERN 4JFOA 3WXVL 3J7HA 5IM7A 1UH3A 5JORA 2BMKA 3MROA 3QI9D 4NKDB 4JHAH 1VDGA 4WTZG 4HLZG 2J4WL 1TENA 3IB4A 4NQCB 3KPNA 1J05B 4YHZL 1T89C 5FO9A 4F7PB 2ZUYA 4PY7A 4M7JL 1CIDA 5I8CB 2AXFA 2NY2B 1H3XA 4N1HB 2NTFB 4G5ZL 4PJ7A 5FYLD 5GRVL 4LF3B 5J12C 2X89A 5J11C 1P4IH 3QXUA 5I74C 1DANU 1P5VA 3CFBA 2FBOJ 3L95B 4LGSB 5GSRB 4XXDA 2EZ0D 4P9HC 3CU7A 5L7XH 4R4NC 3QYCA 3C08L 3EFFA 5AZ2L 4HIXL 5EIQA 4HBCL 1U3HA 3CFKA 3I3EA 4JPWL 4QHKJ 1ZLUK 1VB9A 4ZFFA 1CLOH 4PLJD 1I75A 3DO3A 2FLRT 3ILQC 2VC2H 4HF5H 1LO5A 4NN5B 1OT1A 1AIFB 1ITBB 4J3VA 2X4TA 3MOQA 1T83C 1ES0A 5BZDA 3SCMD 4N9GA 2FNBA 3KAAA 6CGTA 1SEBA 5DJ6A 4Z7NE 1LEIA 4P99A 5IBTH 3SDAC 3OKMB 1QYGH 3CSBA 4RGNC 1FFQA 5D4QA 3X13B 1P7QB 3I6GA 4ZUVB 3W0WA 4YZFE 1QPXA 3MBEC 4G43B 2FIRT 2HTKC 3H9HA 1YN7B 5EUOF 4HHAA 3OB8A 2DIAA 2YEZA 3RKPA 5LQBL 4F2MA 2B1AH 1WT5A 2N4IA 1IQDA 1AKJB 1HWHB 3MJ7B 4PGBB 1GZPA 2JB6B 4WI8A 4XB7A 4P4KA 2ZOLA 5DC9B 3SKOA 4OIAA 1F6AB 3S34H 5D1QB 4PJ5E 3N1PC 1JK8A 2VLJD 15C8H 1KCSH 3KYNA 4X83A 2Y23A 5DURB 4LCIL 3UJJH 3BP7B 1GOHA 4L5FL 2I9TA 4PJGA 5JDSB 4TTDC 5GHWL 5DJ0B 1DQMH 2HFGL 4QGTA 1FO0L 1JGVH 1IGIL 3JV6A 2WP3O 5JW4R 2J8OA 4OKDA 1A0QH 3SJVE 1S7VB 3DXAB 3RDTD 5B8CA 2BVUA 5IF0A 4OCSH 4OD2A 3H7BA 5IVXF 5HHXH 4JM4H 4LOUD 4FFYH 4BQ6A 3CFJB 3VFWA 2EE6A 1EAPA 5JPNB 3IDIA 5DFVD 2OI9C 5DJXA 1OAZL 1T1XA 2AEPL 4PG9A 2AQ2A 2D31B 4Y4HA 3MRKB 1P84K 5T3ZL 3HNTH 1T20B 5DC4B 4ODHH 3MLSH 4F8TA 4ZPTB 2Z8RA 3AREB 1FBIH 1JUFA 1KJMA 5D6DC 2HRLA 1XCTA 3PHSA 5LCVL 3HCVB 1SEQL 3HE6B 1MFEL 4IMLB 4UBDC 4LSVL 5L9DH 3IGAA 5KVFL 1DQJB 1ZWIA 4F33A 3Q6GH 4LAQH 3O4OC 4OFDA 3KPSE 2YD5A 4HGMA 3MYZA 1I3GL 5GGQL 1NBVL 3LEYL 3SDDC 2YC1B 3NFNA 5JIKA 5ALBL 3F5WA 5GGTA 3RWFB 4K9EH 4PGCA 1WWBX 5C0BD 1JNJA 4WIQA 1KEGL 3VXRA 2YPLD 1AHWC 2ESVE 2IBGA 2RAMA 4WFED 3B9EA 5HVWA 4P49A 2Z31A 1E4WH 4U6VH 2QSCL 4BFIA 1MF2L 4ESKA 4X9IA 1CFSA 2UWEB 2NX5D 3QIBC 5HGAA 4HEPG 1KJVB 2BNRB 2ZNXA 5J13C 3O2DA 4F57L 4FQQB 5A1AA 1XAUA 3O3EB 3R0MA 3K1KC 2A9MH 3HZVA 4FG6D 4JHAL 4NKOB 4D9RD 1JPFA 3T0DA 1AQKL 5AD0A 3KYKL 1U91B 2KH2B 2PTTB 3BMVA 3B9KB 5I8EA 1KLGA 3CC5B 3RVVD 2R0LH 3GB7A 3MCG1 1U92B 3E8UL 3MJ9L 3SQOH 3WHXA 3QFDB 2R4SL 4U6HB 3NFPB 4JFEB 3W9EB 3BN3B 2KZWA 5DFTA 4MJ4A 1H5BA 1BFOA 1NSNH 5GS0D 2D7TH 5DD6A 4N0YH 4Z7UA 5I66B 3V52H 2JCCF 4OCYL 3GI8H 1GPOL 2QEJA 4BFEA 4PRHB 2ARWA 4OM1H 1LO4H 2R4RH 2VH5L 1MJ8L 3H2WA 2R9HC 3D85B 1HCFX 3N1MC 3MGAA 2X4PB 2EYSB 1NBZA 3BKYL 1KB5B 3QUXA 3ARDA 4YQXL 3WFBL 2DI9A 2VE6B 1PZ5A 2B1HL 1UJTA 4PJEE 5T1LD 2YK1L 1KPRA 4EI5B 1F6LL 3FQRB 4BSWA 4C56A 2J88H 2VL4A 3F6IA 4KJYA 3QPQD 4KK6C 4NC2B 3KLSA 5B4MD 1Q0YL 1UWXH 4KKBD 5KSUA 4E42A 4OGXL 1RV6X 3MRRB 2MFNA 3V6BR 4DKDC 1RJZA 3WL9B 4X6DE 2RJMA 3JXAA 4Z7VE 3WN5B 2IALA 4HKXB 4NQEE 3OX8A 4NO3A 2QQQA 1AH1A 4UV4H 3VGEA 5ISZB 1T2XA 3L1OL 4P48A 4NN6B 4CADB 4JHBA 4QHMB 1PKQB 3RNQA 1ZKAA 1A3RL 4MDJA 4OZGE 3MFGB 1UCBH 1C8PA 5FOBB 5JA8B 4BZYA 3H3BC 5D1ZD 1FZMB 3REVB 3T0ED 2JIXB 5AZEL 1WTGT 1N64H 1N7MH 4R0LC 4G6ML 5DRWB 4UNTA 5C0JA 4L4TA 1G7JA 3CSYB 1INDH 3UJIL 1A6ZA 4FZEL 3EZ8A 2HKFL 3MGTA 3S7GA 2H2PD 4LU5H 1P69B 3L3GA 1TTUA 3DETC 4JRXA 5F6IC 5K9KB 3MA9L 4ZS6D 1A0QL 2GTWA 2IJ0C 4X4YB 4X6EA 2VR4A 1EX0A 2ZOKB 5B3NA 1NCWH 1OP5H 4YXLL 4NNXB 4HKZA 4P23D 1DBJL 4P3CL 4PBVC 3TNMB 1F3DH 3OGCA 4IHOA 1ZVYA 1QVOA 1CVSC 1DVFA