4G9FE

Crystal structure of c12c tcr-hlab2705-kk10-l6m
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
250
structure length
250
Chain Sequence
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASREGLGGTEAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADASGLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title A Molecular Basis for the Control of Preimmune Escape Variants by HIV-Specific CD8(+) T Cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9fE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9fE02
2EECA 2J8HA 5GSRB 5E1AB 1U8OA 2JCCE 2P5EA 4XXDB 5D6CB 2QSQA 4IOIA 3HZMA 4P59H 3E3QC 4LPUA 4WU5B 1KPRB 4QOKB 5HI4D 3WFHA 4KWUA 1IAOA 5JXED 1OW0C 1A4KB 4H20H 1AP2A 5TE7L 4AMKH 3VJ6B 2QSVA 1QFUH 4CNIA 2QR0A 2HTKD 25C8H 2UUDH 5IM7A 2VDML 4ODHL 5GS0D 3DYMA 2MHAB 3OJDA 3D2UB 2PXYC 4G42B 4HIEB 3QEUA 3AREC 4F15B 2XPGA 4QOKD 4D0BA 4GBXA 1OWWA 2JB6A 4Z95H 5E08H 1MREH 3W9DA 1INDL 1CG9B 5LAXB 1U8IA 3BIKB 2C3VA 3GSNA 1D5BA 1EGJH 1IGJA 4OZIA 1N2RB 4DZ8B 2R8SH 2J8UE 1UM4H 4NKMB 4CADB 4MWFB 1GC1C 3U48A 3KPQB 2WINA 2YD5A 3MBXL 5KW9H 1A4JA 4RAUB 5FB8A 2I24N 1DQQB 4LGRB 3L3HB 1U8PB 1QVOB 4CL7A 3D2UD 3BOVA 3I02A 1CK0L 5DA0B 3RWEB 2YRZA 3FT3A 3WJJA 1AI1L 2ADJA 2AW2A 4NNPL 4RAHA 5EZJB 4FA8A 5EH1A 1Q1JL 4GUPB 1F90H 3TIEB 1KTKE 3BEVA 4PRAA 5EU6B 3KS0H 4I0PA 5AZ2H 2JB5L 1C12A 5A43C 5FO8B 1KXTB 3TNNB 2OTWB 3FOLA 3TBWB 2AP2A 3GO1L 3K4ZA 3O2VL 1DQJB 3QULB 3SGEI 2AEQH 1F3JB 1OT2A 1I9RL 4HHAA 2CKBB 5ITFB 1HI6B 1ETZB 3MLTA 4OZFB 1OGAB 5EU6D 5B38B 3VGAC 3C8DA 1QBMH 5FA3B 3GHBH 5I73B 5FIEA 2DF3A 2QJDA 4PGDA 5GGTH 3SKNB 1QBLL 4MQ7A 3SCMB 4KZEH 4DZBA 1UENA 4NOFA 4KVCH 1IT9L 5F3BB 2BY1A 4YK4C 5C9JA 1BQHG 1QQDB 2XXCB 4OF8A 2VL5B 1UXWB 5I1AA 3LN4B 3MGAA 4KI5D 1MRCL 4PJIB 2OX5A 3N06B 4PJ9C 1OGAD 3QJFA 4OCSH 1MUJA 5C7XH 1ZT1A 4X6CF 43CAA 1C5CL 3SDAA 3SCMD 1IEBB 4MA1B 1MFBL 4PFEA 1OSPH 2UYLB 1HILB 3IDIA 2ZUQC 4TUOA 2IH3A 3O9WA 2F8XC 4LLMB 5TF1H 1ES0B 4TSAL 5C09B 4JPIB 5H94B 1K9TA 2HKFH 4LAQL 3LKQA 1RZGB 3BIAX 1OAKH 5CP7A 5GRVK 4BZ1H 3EYVA 4PP2A 3ARUA 4CVWA 1DEEA 5EU4B 4PJDB 4AL8H 5DDHB 3EDJA 1JFQL 3RUGE 1OWRM 2DQEL 5HY9A 1FV1A 4XNQB 4YXKH 2Q87A 4OZHB 4JVPA 5C09D 5BV7L 1RHHA 4FQQB 4XVUC 4A6YL 5IMKB 4E5XB 3VXNB 4ONOA 4HAFA 4OUUA 2PYEA 1G6RA 5EIIA 4JFZH 3MCLH 4IM8A 3JWDH 5E5UB 1F8TL 3LD8C 2CRYA 4MS8C 1EO8L 3U7YH 1UEMA 4QWWC 1G7PB 1QRKA 1NBYB 2AJZA 2G9HA 3MA9H 2ESVA 3NCJH 2HJLA 1U3JA 4DVBB 5HHQA 1D5MB 4GBXC 4JZJC 2G60L 1FL6A 2Y1VA 1F3RB 3GSRA 4JANB 3WLBB 2OR7A 1I8MB 4M6ML 3P11L 4LQFH 4NZUL 3T2NH 1X5IA 2BMKA 4B41A 3MV9B 2OL3A 4RWHA 2UWEF 3G9VA 2EDNA 2Y7QA 1BM3H 2BVQA 3WFZA 4MXQD 4LCYB 1YEHH 1U6AH 1W0WB 3PP3H 3VXPA 4L8CB 3MOAH 4RGOL 3UROR 2X4RB 3ARXA 1HHIB 5K59F 3S96B 4I3SH 4LHQB 5FO9B 1VGEL 3BP7B 4I0PC 2RFXA 4MD4B 4OB5L 1A6AB 4MXVF 4Q9RH 2APTA 3MV9D 1F13A 2P8MA 2PO6B 5FUOH 1NCWL 4HJ0D 1X4ZA 1NDGA 4HPOH 1NFDE 4AZ8A 2XACC 1KIQB 1IM9B 1CN4A 3M07A 1BJMA 3RY6A 1MNUL 3L5IA 3DV6B 3VWKC 3UPAA 4P2RA 3NACH 4UQ3B 4DQOL 3WL9A 4HWZA 3MX0A 3UJJH 3LRHA 3QEHB 5FGBA 4ENED 1I9IH 1T0NA 3BP5A 1QFPA 4LCUB 2ITDB 3PJSA 1EZVX 1OOAA 2PO6D 3VRLF 4LK4A 3WXVL 4M1CC 4RAVA 2H6PB 4TPRH 2GQHA 1S3KH 2YK1L 3NGBC 1IM9D 6FABH 1NCUA 3BUTA 5ALCH 3BO8A 4NBYB 2DI7A 1MJ8H 1MCSA 4NJAH 5T3ZH 2NCMA 3EJJX 1TVHA 1HNGA 3UYRH 2WBJA 5I1IL 4NM4L 2GITA 2W60B 3MRCB 2J6EA 1LDPL 2B4CH 1BECA 3O8XB 4J4PD 4NWTH 3KDMA 1ZEAH 4PJXE 4QRPE 3WIIH 5DGRA 3TP4A 4FQ1H 4NO0B 1CQYA 1JHTA 3D0VB 3HC3H 1JZ5A 4OIIL 4X6EB 4JDTH 1OAXL 3I9GH 4HKZB 4V1DD 2ATKA 4BZYA 1MQKH 3CMOL 4FFYL 4RGNC 1R5WB 1B6DA 1XFPA 3BISA 3DROB 4K71B 4GSDL 4K7PX 1KIPB 1BAFH 3C5ZA 2WBWB 4P99A 3MV8E 5IEKB 2XWJB 3O8XD 1MI5E 5DRZA 4HS8L 2VNCA 5MEQA 1AD0A 4PBVC 4PRHE 3NABL 3NMEA 4P4KB 4NO0D 3QDJB 5INDA 2NY2C 4UINH 1QFHA 1KC5L 5HYJE 1N59B 1YNTB 4XP4L 3ZTJG 5DFWH 3R4DA 2XOTA 3ULVD 4YDJA 2XZAL 1JJUA 5DO2D 4CVZA 1K8DA 4AEEA 5D7JA 3CSGA 2FR4A 1A6VL 3FZUC 1I8LA 5F7EL 5IFAL 4MXWH 4X7EC 4YBQC 5FM5M 3LQAL 4P4KD 2KZ1B 3AC0A 3QDJD 2VLRB 4LASL 4XAWH 1MEXL 1JGEB 2F53B 4OZ4B 1BVZA 3IDYB 1IC5H 2CLRA 3M8OH 4PJAA 2X6MA 5C1MB 5B8CA 4Y16A 3S88L 1MFCL 5J06A 1U8MB 1KEMH 4APQB 3U1SH 1A3LH 1CLOH 2JTDA 1T6VN 3UTSE 4PB0L 3ALXA 3RBGA 5TDNB 5JA9A 4U6TA 4MJ4A 2F53D 1MCHA 2H1PL 4HUUA 4MCYA 3MRDA 1DBML 3VD3A 2QADB 1VFMA 3KPOB 1EGJA 4MVBD 2B5IB 5E0QA 1NLBL 4K94H 2GCYA 4APQD 3MR9A 4JKPH 5E8OA 3RZCA 1NGXB 3A6BH 4EIZC 1AGEA 1RVFH 3RY6C 1Z3GH 1RJLA 4LARH 4Q6IB 3ZSTA 2E5EA 2W0KA 5GGQH 3MNZB 2DN7A 3GHEL 4MLIA 1BD2E 1T2QH 2Z9TA 3DYOA 3MLRL 2EE2A 4M3KB 4TNWK 4JZNB 3QG7H 5FGBC 3OJMB 3FKUS 4M43L 1KNOB 4XPFL 2QADD 5EUKB 4WUUB 2GUOA 3VFNB 2A1WH 4M9OA 4HLZH 4GFTB 2IH1A 1R3JA 5DD1H 4P2OA 1EBPA 5DWUH 1FDLL 1ACYL 2HT3D 5CEXA 2X4OA 4CN4A 4PJBF 1KCRH 2HRLA 1T22A 2FO4B 4RFOH 4WDIA 3FONA 4M7LH 5IB5A 4BH7B 1J7VR 3NN8A 5I30H 5CJ5A 2F74B 1S5HB 2HT4C 5C71A 2VDQL 2FJHB 3FFCA 1BBDL 4WUUD 2DKUA 3GNMH 1EEYA 4OV5A 3HC4H 2FEDC 1RUMH 1G7HB 2DICA 4GOSA 3QDGB 1CXHA 3WS3B 1QEWB 3EOYG 4Z7QF 3QUYA 5GGTA 4F9PA 1L9MA 4RA0C 2BX5A 1CFBA 5EA0L 3FO9A 2VDMH 1QLRB 5AUMB 3KWWA 1CL7I 2P48B 3KPSA 5JZ7D 2AV1B 4D9RE 4YIQA 5MERA 5ID1A 3RP1A 4FQIH 2FB4L 3DJ9A 3L3OB 2J5LB 2VQTA 1MFDH 1HDMB 3QDGD 3V5KA 3L3KA 2I5YL 1BLNB 2EDRA 5BZDB 5EO1B 1NJ9A 5I66A 3QUXA 3BWUC 4NNYA 5KSAB 4IRSA 3E8UH 4NRZB 4DFIA 4NQVB 1CF8L 3C6LA 1XCQB 2ZWLT 1CK0H 1NMCC 4ZFFB 3DGGA 3OKYA 1GVIA 1HHJA 2Q20A 3CVIL 4S1DC 4NKIL 5EUOA 1IMHC 3O3AB 1FNLA 4KUZL 1RUPH 4ALAL 4X5LA 1EVUA 1CD9B 4F9LA 2VB5A 4NQEE 5CJXA 4JQXA 4ZO8A 1NH6A 3G08B 4GH7B 5JPNB 3BGMA 7CGTA 4P3WA 3GO1H 3MRHB 5B8CC 1CFQA 3RVTC 4RDQF 5AZEL 1EUTA 5F1IA 2ED9A 5IVOA 4AEFA 1I9RH 3BKCH 4JFOB 3BGAA 3TPUA 4ZYKB 3LS4L 3GM8A 1FIEA 4KRNA 1JNNL 3QO1B 4R0LC 3FRPG 2COQA 1KENH 1J86A 3FQWA 3IF1A 3NZHL 1FPTH 4RISL 1QBLH 1QACA 4JFDB 4P3CH 1KLGA 4PLJD 3GBNH 1IT9H 4P2QA 4UT6L 3SKOA 1ZT4A 7FABH 4YDVB 1F45A 3G5ZB 5T5NF 4PR5A 1FAIL 4LSQL 1IQDB 1YEIH 2VISB 1MRCH 4NC0B 3V0WH 4XAKE 1TCRB 3GMPB 3TN0B 3RZCC 5DQDH 2B1HL 3VXME 4HIJA 2NR6C 3P40A 2FH6A 1YQVH 1C5CH 5BS0A 4NN7B 1MFBH 4JFDD 4OGXH 4QXUH 5K9OA 3CVHB 5E5MB 1O7SA 2FX7L 3ET9F 3PWJA 5IOPA 1A9BA 2KQMA 4TSAH 3WFBH 3WMSA 3OKOA 4LAQH 3TN0D 4R8WH 1P84J 3NCYP 1RD6A 4JG0L 3HG1B 3PXHA 4WI2A 3NFSH 4AENA 1ZTXL 4OLZH 3BDXA 4LNVA 3RVWD 2IANE 1UH2A 2H2SC 5IP4A 2EICA 1D6VH 1Z6JT 1JFQH 1OSZA 1IARB 3EOTL 1HIML 1NAMA 5IIEA 1K6QL 3FMGL 5C07E 5BV7H 1RZKH 3B6SA 1TZHB 1HHKB 2BFVL 1T1ZA 3K80A 4NUGH 4OF5A 5CUSL 5F9WB 4A6YH 4EOWH 1X5GA 2APBA 3HG1D 1F8TH 3H9HB 3QUYC 1T5WB 4F9PC 5L6YL 1YDPA 5EBMB 1OP3K 4NKDB 4LSDA 3L7FB 2R56H 3I75A 1BZ9A 3GBLA 3QFJA 2I27N 4KTEL 4H26A 1K2DB 1P4LA 3QNZB 3LMJL 3P11H 2E9WA 3RGVC 3VG9B 3L9RB 1J0KA 2GSIA 3H3BC 4IRSC 4H1LH 2EXYD 2JCCA 3D85B 5IVNA 3C6LC 4XCNA 2RCSL 1CBVH 1ZVYA 5L9DH 4RGOH 1GGTA 2I9LA 3MMEB 5C0AE 4Y2DA 3AM8A 4KKBD 2DJUA 3QEQD 1I7TB 4OB5H 2VLMD 2NW3A 2A73B 3D85D 3IDJB 4OLUL 4X0KB 4F9LC 2ZPKH 3MRLB 2PTVA 4EDXB 2R0WH 2PXYB 1JPSL 4FMKA 5EZOL 1OTSC 3SDXA 1ZA3B 4I48B 3NVQA 2UZIH 4D3CL 2Q1EA 3AREB 1MNUH 1WZKA 3PWNA 5FHBL 3JWDC 4U1IB 5FGRA 3QIWB 1NCNA 1QHPA 1PDKA 3PL6A 5IQ7H 5CGTA 3GGWB 5J6GB 3AROA 4TOYH 1AXTH 4ONHA 3MBEA 4OCYL 5FM4A 3RWGB 4M7KL 2W59A 1GHFL 3ZT6A 4J1UB 4CMMB 4G7YL 1Z5LA 1UJ3A 3VXQA 5EU3B 2PXYD 2XZCL 5HVFB 3QRFM 1AXSA 4NUJB 2EIDA 4NQXB 3HZKA 2E27L 3ARED 3PQYB 4UT9L 2IGFH 3QIWD 1MJJB 3QJHB 2CDFB 3B2VH 1JGDA 5JORA 1RUQL 3IETA 1LEIB 4KMLB 2FJGB 1A22B 4MQXC 4NM4H 3CMGA 4X6FB 3L3DB 5C8JA 5D5MF 4MJIA 5DQJA 4UDUB 1DBBL 4UU9B 3PQYD 4X5WB 1GXEA 5DVNA 4QRSB 2EEAA 3TBYB 4FOMA 4UTAH 3CH8A 5FYJD 4JZOB 4LVOB 4YJZL 1IQWH 1OAXH 5IMLA 3V4UL 5IJKA 3CMOH 4FFYH 1VACB 5HYQB 3VGAB 5A2KH 3BD4A 5F1KC 3KYNB 4H0IA 4Z7WB 3IJYB 3VU2A 1KCSL 5F88A 4ZOCA 4EN3A 4HJGA 4HS8H 1UCBH 3BP6B 1G7MB 1I3UA 3MLVL 4X6CE 4N0FB 2QKIA 2DWEA 1IKNC 3VI3F 3M17B 4BSVA 2O61A 5E2UL 4AIXA 2NYYC 4WGVB 1H5BB 1I9JL 4XP4H 2CUMA 3QAZC 1T7XA 1A6WL 3MUHL 3HPLB 1T7YA 4L1DA 4PJ9B 3T0EC 5ICYB 15C8L 2DTSA 2EYTA 4CVUA 2AXJA 5GGRA 5E8EA 2MNUA 4Z18A 1ZGLA 1M1SA 5ESQB 1A6VH 3FQUB 4L3CA 1RIHH 3QCTL 4CVXB 4YBLC 1JYVA 1U2CA 3BI9X 5IFAH 1K4CB 1U8NA 3F58L 3LQAH 3LPFA 4G3YL 1EZVY 4MA8L 2ZOLA 1LK2B 4LASH 1VERA 2VLLB 2VR9A 4GG8A 1DLHB 3TYGL 3V6FB 4EQ2A 4PJ9D 4F7MA 3ROOA 3B43A 3S88H 1K3IA 3PDOB 1NCCL 3RUGA 4KVNL 2CLVB 1MFCH 4R7DA 5HI5D 3LH2L 3P9LA 4J3WA 1F4WL 1U8OB 2P5EB 2Q6WA 4IOIB 4OLWH 3HZMB 3RI5F 1TVDA 3R1GL 4PB0H 2R0ZL 1IAOB 1GZPA 5D2NC 1I3RA 4MQSB 4Y2DC 1AP2B 3ES6A 2N4IA 1U8KA 2W0FA 1DBMH 3HRPA 4CNIB 1M05A 2QR0B 5IM7B 1JNLH 3LD8B 3LKOA 5JOPE 3V52H 3GKWL 1NLBH 3MO1A 2P5ED 2XICA 3DYPA 3IFLL 3OJDB 4J6RH 5F89A 1XEDA 3VG0H 3QEUB 3AVEA 5TQ2L 2XPGB 1T7VA 3PUCA 4OKVA 4D0BB 4GBXB 4JZJB 2JB6B 4ODTL 4NPYA 4XVUD 5IK3A 3W9DB 3PL6C 1U8IB 5GIRA 3GHEH 4HMDA 2C3VB 3GSNB 1D5BB 2UWEE 3BPLB 2YC1A 3MLRH 1IGJB 4OZIB 1R6VA 3AGVA 3MBEC 5L8KB 2WINB 3U0WL 4MS8D 5K59E 1YY8A 3VXUB 5FB8B 1BBJA 3E6HA 1UJ3C 1DR9A 2G2RA 1FDLH 1ACYH 3I02B 4AG4L 5KSVA 4JKWA 3FT3B 4MXVE 3CX5J 4GBXD 4O51A 2ADJB 1CXKA 4GRLC 3CPLA 3J8F7 2VDQH 3BEVB 4R97C 2QHRH 3O6LL 4WW2F 3NPSB 4F8TA 4PRAB 2IBBA 1IL1A 2BNQE 4I0PB 4LLUA 3S97C 2DQUH 2JF1A 3VXUD 1C12B 3ZDYF 1NFDA 3C8HA 1NC4A 1IJ9A 3FOLB 5I15L 5FYKU 4MMZC 4XMLH 1FNAA 4X4XA 1U58A 2XQYG 3Q5YA 4Z78A 5TE6L 5JLZA 2HT2C 5EA0H 3VRLE 4HHAB 4X6DA 2FEEI 4I1NB 1NAKL 1E4JA 2AJ3A 3LEYH 3MRMA 5H35A 1O7VA 3SDYL 4I0PD 4K94C 2FB4H 3TFKD 3VMOA 4WUKL 4PGDB 4MQ7B 1CFSA 2I5YH 3WFCL 4DZBB 3GFUA 3W11C 3WNKA 2IBZX 4R4BA 5C9JB 3NGBB 1ODAA 5I1AB 2Y06H 4ZTOH 1YY9C 3ZT7A 1J0IA 1TETL 3QJFB 3FOMB 1JV5A 5DHXB 1MUJB 1TZIA 5KJRL 3CVIH 43CAB 4IRJC 3SDAB 1ACZA 5HYSG 5TGBA 3E0GA 4DKEL 3V4VH 2BY0A 2Z8WC 4QRPA 4U1KA 3IDIB 4M1CD 3DGCR 4TUOB 1KELL 2IH3B 4G9FE 3O9WB 2EDDA 3BDYL 2GSGA 2CKNA 3BQUA 4GQPH 3LKQB 5KS9E 1HINL 3ARQA 2A9NL 5CP7B 3WKNA 5E7FA 4A6YA 4JFQA 3EYVB 2W9DL 5AZEH 4PP2B 4EVNA 2CIIA 3SDAD 3GSWB 1DEEB 5CSBA 5D70H 4LCWE 4DOHE 5HY9B 4PRHA 1FV1B 5IGXL 4XPTL 3O9WD 4KK9C 1AFVL 2LVCA 4ODXA 5HYJA 1RHHB 3WKML 3SOBH 3V0AC 2NY2B 2R4RL 4OUUB 2PYEB 1G6RB 4HLJA 4PRIA 1P7HL 4UT6H 4QY8A 1U42A 2EIBA 1HEZA 2YSSA 3PXJA 4DCQA 3CLFH 1I8KA 5EWIL 1YPZF 5GGVL 5DUPH 2ZKHH 4XPAL 1IBGL 2AJZB 2G9HB 2E9BA 3ARDC 3QB7C 2ESVB 3NCMA 4H1LA 2HJLB 3TM6A 5HHQB 4S1RL 4LL9A 1FL6B 3FN3A 5ERWA 4I4WA 2NY2D 3GSRB 2VAJA 5F72S 1KIUA 2PYED 4P9MH 5IW1A 3F62A 4NBXB 4UAOC 3ZYOA 2FX7H 4F58H 2BMKB 4MB4A 1JWSA 5CLWA 2OL3B 1KCVL 2Z4QA 3HZYA 4IS6A 1NL0L 2ESVD 3UTSA 4JG0H 4U1MA 3FZUD 2O26U 3OX8A 2Y7QB 2BVQB 1N5YL 4YBQD 5HHMB 3VXPB 3ALWA 4HUVA 3TPKA 2E7MA 4X4YA 5KVEL 2K7PA 1MLBA 1AGFA 4P5KA 3U6RA 1HIMH 3UTTE 1EO7A 3VD4A 1K6QH 2RFXB 3FMGH 1A3RL 3FQTA 4N1CA 3S4SG 4Q9QL 5LXGL 2X1OA 4QXWA 5CUSH 3QXWA 2P8MB 2GTWA 4ELME 4RZCA 4U3XA 1NDGB 1NMAH 1CVRA 4ODWA 3H2WA 4PTTA 1DANT 1ZGLP 1AO7E 5L6YH 5J1SC 1BF8A 5HHMD 3DMMC 4CDGC 5E8DL 4P2RB 5CGYC 3WL9B 4PJBE 4HWZB 2DIJA 3TGXA 1PAMA 2CXGA 1B3JA 5HGHA 1T0NB 1ZANL 3BP5B 2GJJA 4KJYB 4ELKA 3PJSB 3LMJH 3R8QA 5F9JA 5GRVL 3D25B 3OXSA 1PGRB 4RAVB 2D2OA 3SDDA 1DQLL 2BOBA 1WSST 5I1KL 2L0DA 3C2SA 3BO8B 4P2RD 1KJ3L 3EOAA 2DMKA 1JMZA 1FAKT 2RCSH 4GKOA 3NCEB 3SKJL 1OP5K 4Z7QE 3P0GB 5BVPH 2WBJB 1D5IH 4DN4H 2GITB 2P5WE 2WQRA 1QFWI 2ZUYA 5KTEL 1EO5A 1XAUA 3HI6L 5EFIA 3VE0A 5DUBA 5AD0A 5E9DD 4EXPX 3M45A 2X42A 3KDMB 3G5XA 3NAAL 4XGZA 4IDJL 3BQUC 1JHTB 1UG9A 4PGCA 2HT4D 5CSGA 1RZKC 1LO3L 1JPSH 2ATKB 5EZOH 3VGHA 5JIIA 2WBJD 2M8XA 4FQCL 2EDKA 4JVWA 5FHBH 2QQKH 3C5ZB 4ESKA 3MLSH 3P0YL 1UZ8A 2FEDD 2EZ0D 5DRZB 4M61A 5IROC 1BVLA 1S7QA 4HUWA 4R4FL 5MEQB 1AD0B 5EC1A 4XI5D 4LPVA 5GZNC 4M7KH 5INDB 1GHFH 1T1WA 1B4JL 1U8HA 2FDBP 4G7YH 5B4MC 3T65A 3BN3B 5JTWA 2GJZA 1RJYA 1QSEA 5T3XL 3UBXA 4YDJB 4N0UB 4KTDL 2E27H 3GKZA 4UT9H 3C5ZD 1H9VA 4CVZB 4J3OC 1JHKL 4QLRA 4XPBL 3T2QA 5D7JB 2FR4B 1RUQH 2FX8H 3OV6A 3S98A 1F11A 1NPUA 1VHPA 4L3EE 4DAGL 1TTGA 2NXYB 2A6IB 3LAFA 3VGDA 2CLRB 1F58L 4FG6D 4PJAB 5B8CB 2F19H 4Y16B 5DMIL 4I8DA 1EAPA 1RI8A 5D7JD 2X4NA 3JWOL 1J0JA 4S1DD 1JTPA 3GB7A 2VXTL 3V4UH 4WRLA 3FN0H 3ARRA 1S7SA 3RA7L 1KIRB 4XTRC 3L7EB 1IZJA 3N1GC 5IQ9A 3UJTH 5I75B 4LPTA 1JPGA 2R2CA 3HA0A 1BFTA 4LQ1A 4HUUB 1J1PL 2EYSA 4MCYB 1E4XL 3MLVH 3MRDB 4Y16D 3RVTD 5E2UH 5KZCB 3O3EA 2ADFH 4N5UA 3VXMA 1I9JH 2GCYB 3V2AR 3MR9B 2NTFA 4JB9L 3DUHA 5E8OB 1A6WH 3RZCB 4R2GC 1AGEB 5DR5L 1RJLB 4XNZC 1T0MA 1NFKA 2MFNA 1V3KA 4FNLL 4C55A 4UOW0 1J05B 5KAQG 2NXZC 4NNXA 3QCTH 4POZC 2M1KA 5CJOH 4ZFZA 2R0LL 4NCC1 3F58H 2GUOB 2B1AL 5KZCD 1PG7L 1BX2A 4Z9KB 4G3YH 5F9DC 4MA8H 3WHXA 1IGMH 2IH1B 1R3JB 4P2OB 5MI0C 5L88H 1TDQA 2IANA 1GYAA 5CEXB 2YKLL 2CMRL 3TYGH 5J1AB 5E6YA 3RZCD 2X4OB 4KZDL 1IGYA 1T22B 5D9SA 1NCCH 4KVNH 5IB5B 2N1KA 3NN8B 3SPVA 4PJGA 3QBTB 3LH2H 4M7JL 5C07A 3U4BH 2C3WA 1HQ4A 3FFCB 1U41A 1IC4H 2R0ZH 1PG7W 1MHCA 5F71A 1EEYB 4OV5B 12E8L 5HHNA 4WEUD 1LHZA 4QHLA 2N56A 4P2OD 3CFBA 3TT1L 1W8NA 2EH8L 2V5SA 3U9PL 1PD6A 4LSVH 1J8HD 3QUYB 2DMCA 1J1OL 2AK4E 3O4LE 2H2SD 4WVRA 1ZGLM 3FO9B 3GKWH 3KWWB 3EUUA 3ECBA 3KPSB 4WCYL 4YIQB 5MERB 1SEBA 4HZAA 4KDTC 3U7AA 4WHYH 5LGKA 3QO0A 3S3JA 4BYHA 5D1ZA 1P9MA 4OBRA 2EEBA 1I1YA 4ODTH 3NH7H 2BDNH 1UWXH 2IPKA 5E94A 3V5KB 3L3KB 3D39E 1NJ9B 2XTLA 5T3XE 3QUXB 5I66B 2D7OA 4NNYB 4IRSB 3QUYD 1IGIL 3K8MA 3DUUA 3U0WH 3QUZA 4GAGL 1C5BH 5I8OH 3N9GL 1H0DA 1T1YA 3KPSD 3C6LB 4LLVB 4M03A 4NO5A 3LQAC 4BFEA 2C3GA 4AG4H 5FF6A 1AHWA 1KPVA 2YPLD 2ICES 3UTPE 3DGGB 1SJEA 1HHJB 4BQCA 3RWCA 5C0AA 1SHMA 1G7IA 3HLAA 1BZ7A 3OKMA 4ODSH 5EUOB 5A2JH 3RGVD 2P43B 3QUXD 3U9UA 4ZNEE 4XC3H 3ILQD 4PLKC 4WI3A 5BRZE 4IRSD 4FN0A 1KB9K 2HFEA 4OQ1A 4N0YH 5FM8A 2ZSVA 3C6LD 1JZ6A 5I15H 3BGMB 1KTDA 3V4PH 1YYLL 1CFQB 4JFHD 3AS0A 1CLYL 3I6LE 1Q8MA 4PJ5D 1FYTE 2FZ3A 4M9PA 1MJ7L 5F1IB 5TE6H 4DEPC 3TPUB 1SVCP 1NAKH 3MV01 4F2MA 2J4WL 4YBHA 1NKRA 3SDYH 3FQWB 1SBBA 4LKXA 3TNMA 3IF1B 1JE6A 4HX1A 2PCPA 4WUKH 2KL6A 2AJVL 4YNYA 1QSFA 3TF7C 4H0HB 4P2QB 3SKOB 4DN3L 1ZT4B 1OTSD 3MNWA 2AGJL 4PR5B 5D5ME 3SGDI 2I07A 1PX3A 1YZZA 3CXDL 1KV3A 2N7BA 1TETH 4HIJB 4QNPF 5KJRH 5DI8B 1A7OH 5BS0B 2FX9H 4JO2L 5HHPA 5K9OB 1E6JH 1ZLVK 2A77L 3DVFA 2ENSA 4P2QD 4UV4L 3VFPA 3PWJB 3TWCH 1NCTA 1R24A 5IOPB 4GG6F 4TNVK 1A9BB 3BDYH 4LGSB 3OKOB 3PWLA 4FABH 1HINH 1L7TL 4S10A 1G9NH 4BK4A 3VI3E 2UY6A 4GRWH 3FO0L 4O02L 4MQXD 2F5BH 2X9YA 4X6CA 4GAYA 1OSZB 2XQYK 5IGXH 1NAMB 5IIEB 2WWKT 3N1MC 5C6WH 1FVCA 4XPTH 4G6FD 3B5HA 4OQTL 3WKMH 5CHNA 3B6SB 1T1ZB 4LF3A 3EIFA 1C8PA 2R4RH 3E2HB 5D7IA 4CN6A 4W68A 1WIUA 3QAZB 5DT1L 1OCWL 43C9A 1YDPB 2Z35A 5EWIH 3HB3D 2YHGA 4L4VE 5GGVH 2YD7A 1IBGH 3CK0H 5D2LF 1MWAL 3I75B 3SKMA 1MFEL 1BZQK 5J56B 3QFJB 4H26B 3KYKL 1P4LB 4HBCL 1UCTA 2NYYD 2DIBA 1QSZA 4JN2A 4MD0A 2VZSA 3T0VA 4JKLA 2GSIB 2OP4H 2IBZY 4FXKA 3BGFC 3HUJF 4HFWA 1N0XL 1S8DA 3QUZC 2JCCB 1KCVH 4X7SL 1AHWC 4XCNB 1F2QA 3QNXA 5GRZA 3QFJD 5JIKA 4YC2C 5JPMA 3MQIA 4Q6YA 5T3ZD 1H8NA 4RSVA 3LPWA 2I9LB 5KVEH 1X6LA 4Y2DB 1FQ9C 5DS8A 5E8PA 4Q9QH 5LXGH 2NW3B 1E4KC 2VABA 4Y4FA 4ZFOL 5I1CH 3OZ9L 3QHZH 3VDCA 1HHGA 2CRIA 3ZYIA 4G6AC 4MDJA 3SDXB 1OPGL 2FD6L 3WO4C 5J8OA 3WDHA 2UWEA 3MPCA 5ESVA 3PWNB 4PD4K 3SE9L 3PL6B 4Y2DD 5ANME 1A6PA 4GO6B 5FEBA 1RZIA 3OKLA 4ERSL 4UOW1 3KXFB 2C3XA 4ONHB 3MBEB 3P3YA 5ISZE 1JF1A 3KYAA 4LDOB 4QKXB 1DBJH 4YHOH 2XN9E 5HGDA 5DVMA 1Z5LB 1UJ3B 4KRPC 3VXQB 4GQ9H 4ZD3H 2YD8A 1AXSB 5F7YC 1DQLH 3HZKB 4PJ7F 1LO4L 3P2TA 4JEGB 5E6IA 3D1MC 1D9KA 1WT5C 2OSLA 2R0KL 3PL6D 3UJIL 4S2SA 2BNQA 1JGDB 3SKJH 3KXFD 4JDVA 4HD9A 3IETB 1LD9A 3MBED 2H32H 2GW5A 4Y5XA 4UQ2A 1P5UA 5C8JB 3VXSE 1IGCL 1XGRA 4MJIB 5DQJB 1WWAX 5EG6C 5TF0A 1A7PL 4DW2L 4HGWA 4KY1L 5F6IC 2F58H 1A1OA 1LO2L 4V2CB 2EO9A 1JZ4A 4HKBA 1XGQA 4ETQA 3V79C 1IGFL 3HN3A 1J1XH 1FLRL 5IMLB 4JAMA 2XT1B 5IB4A 4RNRA 3MJGX 1QPPA 4FQCH 4WO4C 4XCFL 5KG9A 3RQ3A 2KZWA 3P0YH 4MJID 1KXVC 2YRPA 4U1JB 3STBA 4I3GA 5F88B 1FBIL 1N5AA 4YHNA 4HJGB 4EN3B 4R4FH 3BP4A 3MRQA 2QKIB 3BJLA 2DWEB 3SO5A 1AKJD 4BSVB 2O61B 2HT2D 4C56E 3LKPA 3IAQA 4KTDH 4E42A 2WBKA 2EYTB 2X09A 4OFIA 3K2UH 4JM4L 4ODUB 5GGRB 1JHKH 4IRJB 1ZGLB 4XPBH 4UILH 2HWZL 2F15A 4G9FA 4L3CB 3WBDA 4XXCC 2FBJL 1T5XA 4JVUA 1KUMA 4AH2A 2YD3A 1U8NB 2XWTA 3EFDL 4WFEE 5KS9A 2ZOLB 4LLWA 4PG2C 4NKOB 1YY9D 4GG8B 3VXOA 3CDCA 4F7MB 4R90L 1F58H 3ROOB 1A8JH 4Y88A 4BFGA 3RUGB 5DMIH 4IRJD 4R7DB 2XI9A 3UBXG 3P9LB 3QQNA 4F7PA 2D03L 2Q6WB 2VXTH 4LCIL 4OF3A 3T09A 1T21A 1ZWIA 1CE1H 5CZXC 1ZT7A 4PRNA 4KJPC 1YPZE 3T0AA 3PGCB 4PRPE 3ZTNH 3W39A 5L2KE 1K5NA 1GZPB 4FQJL 4JFYA 1I3RB 3RU8L 1KLUB 3HE7A 3ZHLA 3ES6B 4LFHG 5F8RC 1E4XH 1U8KB 4L8SC 2W0FB 1M05B 4AYFA 1MFAH 4UDTA 3LKOB 1E28A 1A7RL 5BZWA 4N9GA 4PGEA 3MO1B 3RVXD 2VZUA 5F89B 2D7TL 4TSBL 3LS5L 3KLAA 4L4JA 5DR5H 4OKVB 4KK9D 1OGTA 3DOSA 4NPYB 1IILE 2Y07L 5IK3B 1DLFH 3FT2A 5GIRB 5TQ0L 4FNLH 5FK9B 2VN7A 2CJUL 2YC1B 1I85C 4R4NC 2P45B 1WFUA 4JKMA 4PRDA 2R2EA 1TQCC 1RZFH 2B1AH 3ULUC 3H42L 1PG7H 1YY8B 5JIPA 1BBJB 1A7QL 3E6HB 2FRGP 1OM3L 2G2RB 4PGJA 4M4RA 3UCRA 2YKLH 2CMRH 2A6DA 1VFBA 5KSVB 1L0XA 2VQ1A 1GZQA 3BKYL 4O51B 1D9KC 3C60C 1GGIL 4JFFE 3UTTA 3CPLB 4M7JH 4KGJA 5D96B 4JY5L 3FB6A 4PJ8A 4TSCH 1HYSC 4LCCC 4LLUB 1IL1B 5C70A 4Z7VA 2V2XA 4ELMA 1NFDB 4PB9H 1NC4B 4HK0A 2V9RA 4Y19E 1WBXA 1AO7A 5T5FH 3RPIA 5I8CA 5L2JA 2EH8H 3U9PH 3L95A 4X4XB 3A67L 3W82A 1U58B 3WJLC 2FBOJ 1NCDL 2R1WA 3FCTA 4X6DB 3HI5H 5DSCA 4M1GL 3MRMB 2AJ3B 4RFNC 3RTQC 4I18C 5H35B 3RY5A 3BJ91 2C4FU 3B9KC 4NZJA 1Y6MR 1E4WL 2AV7A 2X4UA 1KSRA 2NY5L 1NC4D 1CFSB 3PIQA 4HGMA 3KGRA 4N0CC 4ZPVA 8FABB 2VTFA 2HKHL 4HEME 4R4BB 1IGIH 3V5HA 3S36X 4GAGH 3N9GH 1DQTA 1GRWA 1XF5A 5CGYD 1XF1A 2YZ8A 2OJZL 4N90E 1JV5B 1V5JA 1RQ5A 1TZIB 2P5WA 2EDHA 1ZE3C 3ZKMC 3FO1A 4JFPA 5TGBB 3DI3B 5E4EC 2DD8L 5CLTA 4M62H 4QRPB 3TYFA 4U1KB 3G04A 2X4PA 1Z9MA 2VMFA 2HFGL 5C2BL 1NCAL 3X11A 5SX4I 4CDHA 2GSGB 3BQUB 5DD3L 2OS7A 4KI5F 4JHAL 3RIFK 1NGYA 4OM0L 1YYLH 4UNTA 5BV7B 1JYWA 4A6YB 2YUXA 4JFQB 1CLYH 1GIGL 3ARZA 5DC0A 3V0VA 4EVNB 2CIIB 3OMZA 5DD5H 3GIZL 4MZ2A 4DGYH 4K3HA 4QRPD 4PRHB 2J4WH 4NYLA 3VGFA 4ODXB 5HYJB 3K2MC 1T2XA 5JW5A 2ENYA 4KAQH 3BQUD 2AJVH 3OB8A 3HE7C 4P23A 1DJSA 2ZNXA 4PRIB 4PJIF 1QYGL 1WGOA 3GIVA 2DQDH 1M6OA 4IRZL 4R3SA 4DN3H 5CZKA 4L8DA 2EE9A 2YSSB 1HEZB 4M3JA 2AGJH 2X5PA 4DCQB 1I8KB 3CXDH 4PRHD 1KOAA 4H1LB 3QPXH 5HYJD 2J3SA 2NW2A 3QA3A 5GZND 4I4WB 4JO2H 5D7LA 3WXWL 1FJ1A 4PRID 4JPVL 5IW1B 5B4MD 4QRQA 2ZOKA 3F7VA 2A77H 4C58B 4TNVF 4OIAA 4OV6F 5D8JH 2ED8A 1XGYL 1MCWM 2AQ2A 5EN2A 3EDEA 1JWSB 1WQVT 5B3JE 3DWTA 4BZ2L 3HPJA 2Z4QB 3HZYB 4IS6B 2B0SL 1K3ZA 2VZOA 3GSVA 4U1MB 1UH4A 4IOSD 3OX8B 5HDQL 1Q9LA 2CO6B 4XMKH 4O02H 1MCCA 4P0DA 4OZHF 4U31A 2LVEA 1LK3L 4X4YB 1MLBB 1AGFB 1MHPL 4P5KB 3U6RB 5JUEH 5FXCH 3WUWB 3FQTB 3DPBA 4NQDD 3S5LG 3QIUA 2GTWB 5K9JH 4RZCB 4U0RB 4ODWB 5BW7A 4KDWA 4PTTB 3JV6A 3A6CL 3HTLX 4PTUA 3OJVC 4WFGE 2A38A 2VDNL 2EE6A 4WNQA 5C0NC 2DL9A 2ZG2A 4HJJH 1YC7A 2DKMA 4FQLL 1MWAH 2FATL 5C0RL 3EDFA 3U30C 3O2DL 3KYKH 5HGHB 4UIMA 5FECA 3DECA 4ELKB 4HBCH 1QRNE 5F9JB 3R0MA 1BREA 1ZSDA 5MI0B 2AJUL 3OXSB 2H32A 1WTLA 3SDDB 3RX5A 3VFTA 1DCLA 3BX7C 1ITBB 1KJ2L 1N0XH 3CJJA 5I71C 4ZUWA 1UB6A 5H8DA 4X7SH 3EOAB 5KVDL 3JWNC 4POZD 3TVMC 4N68A 3EW3B 3QQ9C 5C6TH 4MCZA 4HWEH 2GT9A 3IS0X 2ZZUT 3PHQA 1G9NC 2FYYA 5DJCA 3BYYA 5BQ7A 5EFIB 3VE0B 2XA8L 5DUBB 3O4LA 3SDDD 1HSBA 3WD5L 3D3VE 4D0CB 1ZHNA 1D7FA 2Y25A 1ERNA 4M5YL 2VUYA 4NC1E 1A7BA 4XGZB 4G80A 4K55A 3RBSA 4LSPL 1AC0A 3ZYZA 4PGCB 1GSMA 1VEPA 3SGJA 4MJ5A 2IJ0C 5JW4R 1HQRA 2FD6H 4N8VA 3L5XL 1YEGL 4D94A 3D39A 1CQKA 2OTUA 1UZ8B 3SE9H 2NX5D 3C2AL 3U0PA 1J87A 5CZVL 4M61B 2X4SA 1S7QB 4HUWB 3CZFA 5EC1B 2W9EH 3KHQA 3KPPA 1CGSL 1PSKL 4CUCA 3VXRA 2R1XA 5ITBH 1T1WB 1U8HB 2VR5A 4PY7A 1Y18A 3KVQA 3T65B 2W91A 2GJZB 1RJYB 1QSEB 4HWBL 1U3YA 3UBXB 4F7TA 1KT2A 3LN9A 1LO4H 4J8RA 5GJSL 4HC1L 4ZNEA 2R0KH 3MUY1 4ZOAA 4LSRL 5SWZE 3UJIH 3ZE1F 5GSVA 2LFGA 3VRIA 2Z8SA 4HUMB 3BRGC 3PABA 1F11B 4OJFL 4NHCH 2DQIL 2VH5L 3VGGA 1YQ2A 1YEKL 5INCA 1LGVA 3QZWG 4BSWA 1QSED 1A7PH 5C0EA 1FYTA 3CU7A 1OP3H 3F5WA 3ULVF 1LO2H 1QP1A 2E7HA 4OTXH 2CH8A 1EAPB 3FQNA 4DEPB 2X4NB 1N8ZA 2DLTA 1IGFH 2OLDA 1FLRH 1YUHA 3GB7B 4MDIA 1XGPA 4RCAA 2FHFA 1KF9B 4PLKD 1S7SB 5I19H 3KPMA 4XCFH 3VWJA 3H7LA 1BGXL 5IQ9B 3ZSSA 2BNRE 1JPGB 2D7PA 2R39A 1FBIH 2EYSB 3MCKB 3JV0A 4G8FA 4QNPE 3O3EB 4XWGL 3VXMB 3MZTA 3V5DA 3MLXL 1IFHL 2NTFB 1E6OH 4GG6E 2V2WA 4RGMC 2HWZH 3W0WA 3BD5A 5HI4C 3IS1X 1YYMH 4NNXB 5JXEC 4EI5A 3UZVB 4ZFZB 5JQ6H 2FBJH 2R15A 1TTFA 4K9EL 4K3JH 5J89A 5DURD 1V3JA 1FGNL 3OWEA 4XAKD 1BX2B 3WHXB 3LDBC 3VXMD 2AJYH 2GI7A 1HSAA 3GRWL 5HJ3A 4F37K 1SY6L 2IANB 2YPKA 4X7DC 2X7LA 1IGYB 4R90H 1X4XA 3V6BR 5IB3A 5D9SB 1A1NA 3SPVB 2YUVA 3RKPA 2VXVL 3BRFA 3K3QA 4PJGB 2EC9U 2X1XR 5MEOA 4OCNC 3T0BA 2EYRA 2D03H 4QEGA 5C07B 3QHFL 5CD3A 1HQ4B 2Z92A 4LCIH 1IEAA 5BXFA 1JN6A 1BFVL 1MHCB 5HHNB 4QHLB 3CFBB 5D2LE 2IAND 4AEHL 5MEPA 5E6ZA 4O2CA 1CD8A 5DA4A 5DXWA 4L4VA 3BW9A 1PBYA 1WC7A 4L4TE 4F15C 1BIHA 1NEZB 3ECBB 3SGJC 3LZFL 5C07D 2DS4A 3PHSA 4E41E 2D7TH 4TSBH 5EBGA 3VFRB 2D4DA 1SEBB 3HUJE 1CLCA 5FYKH 1UM6H 3QO0B 5D1ZB 3I6GA 4U1HA 3MLUH 1A5FL 3LPGA 1I1YB 2ZCLH 2Y07H 5D7KD 2IPKB 5E94B 4KKAD 5TQ0H 4KRLB 3CD4A 2VDPH 3FO2A 2B2XH 4U4BA 2P7TA 3MGOA 5CKAA 3IDMA 3DUUB 2G75A 3QUZB 1QLFA 4UNVA 1OM3H 1H0DB 1T1YB 5IWLC 4NO5B 5C08E 3BD3A 5FF6B 1AHWB 1KPVB 2DDQL 4KMTL 2AKRA 3BKYH 1SJEB 5FKPA 3MOBL 4YC2B 2W1NA 1MELA 4XC1L 5C0AB 5JQHC 5C0CE 1GGIH 1GGBL 1G7IB 2Q8AH 3HLAB 1BZ7B 3OKMB 3BKJL 4LSTH 2IFFH 4JY5H 3U9UB 2JLLA 3BN9C 2KQNA 3OR6A 3Q6GH 3BFOA 5DJAA 4QXTB 2HFEB 2HMIC 2OK0L 1GJIA 3QUZD 1NANH 1JVKA 3SE8H 3L3IA 1IAIH 2ZSVB 4ZOEA 4RMRA 3WLWD 1UWEL 5MHSE 4E0RA 1DBAH 1KTDB 4U7MA 3H3PL 4LHUD 3A67H 3WO4B 5C0AD 2FZ3B 5ANMA 3SE3C 3T77A 1NCDH 5I73C 4Q0XH 5ISZA 4F2MB 3EYSL 4PJ7E 3I6KA 5DF0A 1OAUL 1LEGA 1XF3A 3VWJC 4FFZL 5IG7A 4LKXB 3TNMB 4ZUUA 1I1FA 3O6KL 2PCPB 5GS0L 1N4XL 5D71H 4FFVD 4YLQT 1TMCB 4YNYB 3QIBA 1QSFB 4KRPB 2BRRL 4LEOA 3OAUL 2NY0C 3MNWB 1WK0A 4HIHA 3JUYA 1M7DA 3GUTA 5SWQA 4H0GA 4MA1C 1HH6A 3VXSA 3VH8G 4XCEA 5HHPB 4X9FA 2DD8H 1QSFD 4HG4J 5M7QA 3TBVA 2MQCA 4KRPD 4L5FL 4KPHL 3VFPB 3B5TA 1R24B 1WZ1H 2HFGH 5ICXA 3RX7A 3TZVA 4Y1AE 5F6IB 1NCAH 4YDIL 2F8OA 3PWLB 4H8WL 3RIFF 3ZTJH 3ESVF 2AABH 4NT6A 1I1AA 1FN4A 3VFGL 1IVLA 1JGUL 1GIGH 4R7NA 3U46A 1MH5A 3P4LA 1CFVL 2IAMA 3GIZH 1UA6L 2E7LC 4X6CB 4GAYB 1ZV5A 2C1OA 4IHOA 1LNUA 4YZFF 1FVCB 3GMQB 3ALPA 4C56A 5J11B 2Q3ZA 2VXSL 2XG4A 4LPWA 1MPAL 4LF3B 1MWAA 4XP6L 5JHLH 2GY5A 3EZ8A 5D7IB 4U6VL 4I2XA 1QYGH 4CRPA 3CU1A 2X2YA 1K85A 4OLVL 4IRZH 4WEBL 2R29L 4WI6A 43C9B 4JPKL 4G5ZL 4WO4D 1U92A 5F21B 2Z35B 1QA9A 2HYMA 4WWID 3RL1A 4MXQC 2BOCA 1J11A 3IDUA 5EPMB 1DL7L 3SKMB 3MRFA 3MGTA 2CXKA 1H8OA 4KI1A 3DO7A 2CRZA 3OXRB 4PP1C 4RRPG 3WXWH 4JN2B 4MD0B 4POUB 3WDJA 1SYVA 1FO0L 4FXKB 4KJWD 1KPUA 1S8DB 1XGYH 3OTTA 4AIZB 1EK3A 2NY7L 4BZ2H 5C0BE 2X70A 5FUZL 2R2BA 3QNXB 4NZRH 4OAWA 4PRPA 1H3WM 5L2KA 4ZFOA 5JPMB 4G8EA 3ILPA 3KPLA 4RDQG 2IQAA 4NQTA 1KBGL 1MHPH 4HPYL 5DS8B 5E8PB 4OKDA 4Y4FB 2VABB 1IC1A 5HHXL 2ADGB 2IPTL 4D8PA 5ACLA 3GSQA 1LO5A 1T6WA 1UC6A 1HHGB 1Y6KR 4MDJB 3NCCB 4XBGA 1AJ7L 2UWEB 5ESVB 5CD5D 5J7CC 5T5NG 5E2WL 4LEXL 2PNDA 2NZIA 1H3PH 1BIIA 4HXBH 1RZIB 3HNTL 3OKLB 5C0RH 5JOPD 1LQSR 4FXGA 4GMSL 3O2DH 1GPOH 2CIKA 2DIAA 1JF1B 4QOKE 1TQCB 4Y4FD 1X5FA 5ENWA 2IMNA 1I7ZA 3QIBC 1NBZA 3CSPA 1ZVHA 5HGDB 4KFZC 3LCYA 2AJUH 2R23A 3ZE2F 5HD8C 2AI0L 4UB0L 4UNUA 3D9AL 1R5VA 1KJ2H 4UIKL 1OP9A 1B2WH 1EEZA 1P7KA 4I0CC 5E6IB 3H6JA 1D9KB 2OSLB 3C60B 1W72L 4S2SB 2BNQB 3L5JA 4JDVB 4R4ND 1BQHA 1ZLUH 1LD9B 1JI1A 2GY7B 4HS3A 4Y5XB 1N3NA 4Y19A 5C92A 4UQ2B 2AS5M 1X44A 2EDTA 2H2PC 2DLFH 4ZOBA 1P53A 1XGRB 3W2DH 4FQ2H 4J7RA 4HGWB 4EUPG 3CFEA 3C09B 1A1OB 1KTLA 1B6UA 1D9KD 3C60D 3FT4A 4HKBB 1XGQB 4ETQB 2BNQD 1I1AC 1MCOL 3QWOA 4JHWL 5DO2C 5IMMA 5F7FA 4JAMB 4L9LA 4RFNB 5IB4B 4RNRB 3BT2H 2WUCH 2RBLA 4ZXBC 1HYSD 1YEGH 5KG9B 2IAMC 4Y8DC 1WWBX 3S6CA 2ZG1A 2C7UA 3C2AH 3QRGH 4P4KC 4WI8A 5CZVH 1N5AB 2DJ4A 3TO4A 4YHNB 4Y89A 5I8EA 3FJTA 3BP4B 5EU6E 5EIVA 4KROC 1CGSH 2CD0A 1T20A 3CX5K 4MA3B 4UT7H 5IF0A 4HWBH 1UT9A 3RTQD 1I1CA 1UYWL 2WWMC 4E42B 2EKJA 1FFRA 1SBSH 4KI5E 4LSRH 1OVZA 5E4EB 4G9FB 4R9HA 4N0CD 4ZTPH 3T0XA 2FGWL 1OGAE 1T5XB 4AH2B 3IDYC 2XWTB 4YXLL 4FQPA 1AD9A 2QQLL 2DQIH 4YQXH 1SEQL 5KS9B 4LLWB 2X44D 5FUCE 2W65A 2VJXA 1YEKH 1TTUA 1DBKL 3VXOB 4QTHA 2JELL 1V7MH 4APQC 3D6GA 5BOZG 4OI8A 3ZKMD 2AEPH 4PJIE 5EORH 3NOIA 1WUNT 4Z0BL 4F7PB 4FHBD 3DBXA 1EA9C 2FWOB 1T21B 1ZWIB 2P49B 2WQ8A 4PRNB 3MLYL 4WHDA 3W39B 1K5NB 1BGXH 1CD0A 4JFYB 3UO1L 1IZKA 2QADC 3I3BA 1CE6A 3HE7B 2ICEA 2IMMA 5GGSA 1NBQA 3F65A 2DQHL 2HT3C 3GDBA 3BEWA 5C09E 4UDTB 5A3ID 1E28B 4XWGH 5BZWB 4N9GB 1OP5H 1FC2D 4Q6IC 4YHKH 3QXTA 4PGEB 1IFHH 3MLXH 3KLAB 1UB5B 2VC2L 3B3IB 4LNRA 3WIHL 4NKQB 3S3SA 1OGTB 3SQOL 2ITCA 2H8PA 3HE7D 3AB0B 1A14L 4HUKB 3RWDA 3N0PB 3ULVL 4A2LA 4PRDB 3LKRA 2R2EB 3O41A 1FGNH 2A9ML 3CXHJ 5E7BA 1EBAA 3GRWH 3HFML 1SY6H 4HKJA 4MA7H 3O3DA 2A6DB 1VFBB 2VQ1B 3MUJA 1GZQB 3BHBA 2ZJSL 3DSFL 5JZ7C 2J88H 1LDSA 2VXVH 4H88H 4PJEF 4Y7MA 4BA8A 1HXYA 3QHFH 3U79A 3FB6B 4PJ8B 4U6XA 5DK0A 3AS3A 5FGSA 1BFVH 4Z7VB 1CDUA 2V2XB 4HH9A 4ELMB 2FECI 4RQQA 1S5IH 1U95A 4HK0B 2NMSA 1WBXB 3EJZC 1RIVL 1XCTA 3RPIB 5L2JB 4D9LH 1R3IH 3L95B 2P24A 1NGWA 3O2WL 4WV1A 3V7MA 3F7YA 2R1WB 3FCTB 5HDBF 5K33A 3UZQA 5DSCB 5FKAA 2FL5A 4LGPB 1ULVA 4OZIF 4PJ8D 5F7LB 5C2UB 1QRNA 1OTUD 3U30B 2AV7B 2D7NA 2X4UB 2Q8BH 5KSAC 3LIZH 2OI9B 1X5JA 3IVKA 3PIQB 5E56A 1ORQA 4ZPVB 1V7NH 1ZA6A 4Q9BA 3CFCH 3IAGC 1CICA 1FZJA 3V5HB 3MJ7A 4Z76A 1XF5B 1YNLL 1JWUA 4P9HL 2DDQH 1HNFA 4KMTH 2P5WB 3QDME 1GCFA 3MOBH 4XC1H 2BJML 1GGBH 4JFPB 3D3VA 3QWRA 5IW6A 3TYFB 5JO5A 5B39G 5CINL 1MAKA 2JJTC 3G04B 2X4PB 2EC8A 4GRWB 1YEEL 1RZJC 3DHJA 2OK0H 5KN5A 5FCUL 4C4KO 2WUBL 3X11B 5I0DA 5TE4H 1KFAL 3TCLB 1NGYB 1WEJH 1OHQA 2P5WD 3H3PH 1M4KA 1F6AA 4FZEL 3V0VB 4HXAL 4WTWA 1E0OB 2YEZA 3RAJL 2DBLL 4WI9A 3VFMA 3FFDA 3EYSH 1MRDL 5HSFA 1LE5A 1OAUH 4V1DE 3RKDC 2Y36H 1N7ML 4FFZH 4NYLB 1S7RA 3MSPA 3O6KH 1JYNA 1OD9A 4P23B 4OM1H 1GAFL 4GXVL 1KCUL 3GIVB 1ONQA 4R3SB 4OFVA 4L8DB 4DUVA 3TBTA 5SWZA 1JCKA 3HAEH 5IB2A 2D0FA 4NFCA 5GS1C 1ED3A 1JPTH 4U2ZA 2I60H 4K3DH 4D0DA 3ULVE 4BFIA 1PQZA 1DSFH 2NW2B 3QA3B 3MJ6A 1CZ8L 3FN9A 3MV11 5D7LB 4P23D 1FJ1B 4RWYH 1NCBH 3FHQA 4QRQB 2ZOKB 3F7VB 5F3HA 1FRGL 4KPHH 3LB6D 5E03A 3QDJE 4WWKA 5EN2B 5IBTL 3AY4A 3HPJB 2OJEA 3GSVB 4JRYA 3LEXA 1FNGA 1JL8A 5DMGC 1JGUH 1Q9LB 5KVGH 2BNRA 1JBJA 2R1YA 4TUJA 5ADPL 5D7LD 5FOBA 3P77A 1A0QL 5F9WC 3U83A 5H37G 3G5YA 2IWGA 2DAVA 3U4EB 3L1OL 2DQCH 1UWGH 2VDLH 4GG6A 3QIUB 1P4BH 5BVJA 3O2DA 3I50H 4RA3A 2R29H 4PTUB 2MPAL 4G5ZH 2M2DA 3BMWA 1C08A 4WNQB 1A6UH 3MODL 2EDXA 4QT5A 2RQ8A 4F57H 2PTTA 2OBGA 4QRRE 1QLEL 1KJ2A 4TTDC 4YFLI 3D18A 4UIMB 5FECB 3PWVA 2EDWA 3LDBB 1T83A 1ZSDB 2H32B 2WIMA 4O58L 1FO0H 3IRPX 3VFTB 4MX7A 3OKNA 1OLZA 1CR9L 4TRPH 5FDWA 4ZUWB 1UB6B 2NY7H 4ODVL 5ETUB 2EEDA 2VZ3A 2R4SL 1ZK9A 2EDFA 4C59B 5D2LA 5IFHH 4MCZB 2GT9B 3PHQB 4K23H 1BMGA 3PV6A 3VDAA 2FYYB 2XQBL 5DJCB 1KBGH 3MROA 1IC7L 3O6FA 5BQ7B 5HBBA 2BNUA 4I3RL 3LV3A 4NC1C 2DQJL 4U1SA 3O4LB 3W5NA 1HSBB 1X5KA 3BZ4A 4L4TA 4NRYA 4LSSL 3BRDA 4PJHF 1ZHNB 1R0AL 1II4E 1XH3A 1NFIA 3EO9L 4E41A 3ZLQC 4G80B 4Q2ZA 4YR6B 3HUJA 1Z9OA 1BEYH 3QIWC 1RK0A 4MJ5B 1B0RA 5I1LA 3V8CA 1NGPH 4BQ9A 1HQRB 2ARJA 4N8VB 3NFPA 1ZLVH 1AJ7H 3D39B 3L6FA 4IIQA 5E2WH 2OTUB 5B22A 4HWBA 4I0KA 3U0PB 5HGAA 2VUOA 2X4SB 3O4LD 2V5MA 1FE8L 2C4FT 2V2TA 3KPPB 4QCIA 4W4NA 4PG9A 3VXRB 2DI9A 5F7UA 2R1XB 5C08A 2O5XL 1WAAA 1Y18B 4PY7B 3SBWC 1LE9A 4G43A 3FRPA 5GGUA 4OI9A 1BP3B 4UB0H 4JR9H 4F7TB 1KT2B 3D9AH 5C0CA 1RUAL 4UIKH 4J8RB 3D39D 4JM2A 4RMUA 5DD0H 1BQLL 2D4FA 1KJMA 5ILTH 4YUEL 1W72H 3LKSA 2DB8A 4P5MA 1J5OL 3VRIB 3PABB 3VXRD 3TV3H 3UTPD 3L3GA 5INCB 5F6HI 3K1KC 4BSWB 2VDKH 2XNAA 2APFA 5C0EB 1FYTB 4PPTA 3GJEA 4LVOC 5HVWA 3F5WB 5IB1A 4WWKC 3RJDA 2KDGA 1JRHH 4BSJA 4ZS6C 3FQNB 3E6FA 2Y72A 4PJ7A 1N8ZB 5CEYA 1MCOH 4JHWH 1UZ6F 2A83A 4MDIB 1XGPB 1MFNA 3LRGA 3BN9D 3LKNA 2HMID 3KPMB 3VWJB 4YWGL 1H5BC 3I6LD 2X89D 1FYTD 4YHMH 4N1HB 4G8FB 5J3HC 3CFDA 2MTPA 1NUFA 3VRJA 1OQXA 2NY0B 4OZGA 4MNQE 1QNZL 4XPGL 3V5DB 3BPNC 4NSKA 1L0QA 1PYWA 4OLXL 5TFSL 2BZDA 5KSBA 2BVPA 1G84A 3GSXA 3FRUA 2V2WB 3GZKA 1HXMA 5HI5C 4NP4L 3VWJD 3DNKA 3Q1SL 4FZ8L 3GRWA 1EAJA 5HPOA 3NIGF 1SY6A 3AUVA 1JWMA 1BJ1J 3W0WB 3KYMA 3MYZA 2AK1L 1HKLL 4Y1AA 2V5TA 4EI5B 3KNBA 2LU3A 5E8NA 1IAKA 4X99A 5C86A 5F7HA 4PJAF 3ESUF 2NY0D 4Z6AT 1QPXA 1SEQH 4LMQI 1N64L 1HSAB 4JFDE 4FFWC 5HJ3B 2CUHA 3U36A 3GJFK 2YPKB 4JPWL 5F97E 1FFNA 4YZFE 2BSRB 2LTQB 2AAVA 1KEGL 5IB3B 1A1NB 1GC1L 5LQBL 1EVTC 4KK8C 3SO3B 1AY1L 3V9FA 1NEUA 4TUKH 3W0WD 5MEOB 2EYRB 3WNNA 4EI5D 3ZDZF 5CD3B 2Z92B 1KACB 1IEAB 1EUUA 5BXFB 5F7KC 1JN6B 2JJUA 2ZCKL 4K8RH 2X10A 4PV9A 3UO1H 4Z7UE 1XF2A 4DUWA 1PEWA 5K9KA 4O2CB 4GLRH 4LP4A 4P5TA 1RZ8A 4L4VB 4XH2A 3BW9B 4LDLB 5EOCH 4YEFA 5I1GH 5EULV 1MIML 1WC7B 1UKTA 1X4YA 3WSQL 4XNUH 1SM3L 1C5DA 2F5AH 2J1KA 4ORZC 2A6KA 3BPLC 4M8QA 1HK6A 3SQOH 3I6GB 3HE6A 4U1HB 4MNHA 3L3JA 2J7LA 3KAAA 2Q76A 1DQML 3MACL 3CDFA 3WNLA 3FO2B 3N85L 4L4VD 2P7TB 3MGOB 5C0BA 2JJVA 3IDMB 1YC8A 5IHLB 4HF5H 4K7PL 2G75B 3WJJC 1QLFB 3HFMH 2AKRB 3B9VA 3V6OE 2QSTA 3DSFH 5FKPB 4JM2C 1TJIL 3NPSC 3GMNA 4PP1D 3TFKC 5F96H 3TH3T 1F00I 5IVXE 3OR6B 5DJAB 1EHLH 3SE4A 1FVEA 4L8BA 3L3IB 1S9YB 2X41A 1NAMH 1RIVH 2OQJA 4E0RB 4AT6B 3ETBF 2RAMA 4PUBL 4OF6A 2E7BA 3QEQE 3O2WH 5IHUL 5ANMB 3T77B 3TIDA 2PKDA 3ZE2E 1BF2A 3F7PC 5ISZB 3EOBA 4QOKA 5IBUG 4NQUA 3I6KB 1JIBA 1LEGB 1XF3B 2W0PA 3U0TA 5J12C 5IG7B 3HAEA 3E3QE 4ZUUB 1I1FB 4M7LT 1LWRA 5LG1A 4W70A 4OD1L 1X7QA 3QIBB 4KXZH 5T1LA 4EDWH 5L8LB 4FQXA 1KJVA 4PREA 1IAIM 3VFVA 1PLGL 4LEOB 1TNNA 5DRNA 4HIHB 1M7DB 3GUTB 5IJVA 3SDAC 1HYRC 1YNLH 2JJWA 4P9HH 5EUOF 3C8KA 3BZEA 3HZVA 1HH6B 4G6JL 3UTQA 3VXSB 3K81A 1XIWA 4XCEB 4PLOB 3RDTA 1N2RA 2BJMH 3O9WC 3OPZH 4KQ3H 3QIBD 1CDJA 3T3MF 4LVNC 5CINH 5HD8D 1YEEH 1JTTA 5ICXB 2O93L 1QVOA 5FCUH 2WUBH 1T80A 1Z2KA 3GSNL 3EKCA 5HI3C 1ZMYA 3QCUL 1I1AB 1FN4B 3VXSD 3WEXA 1RU9L 4R7NB 2VRAA 3U46B 4HSQA 4ZXBB 3HS0B 1MH5B 2IAMB 2DBLH 2H2PD 3HNVL 3MRRA 4XP5H 2C1OB 4W81A 1MRDH 1LNUB 1EEUA 1MVFA 3VGEA 1TZGL 4FTVE 4C56B 4KROB 1S7VA 3HC0A 4ZFGL 1MWAB 2UZXB 3W9EA 2XY1A 4KHTL 4TVPL 4PS4H 4I2XB 4GXVH 1CU4H 1I1AD 4O2FA 4KK6D 1G7LA 2VZ1A 2ICWA 3JVGA 3QXDA 2JKXA 5F6HJ 4ZXBD 1U92B 2IAMD 1QA9B 3RL1B 2H26A 1X6NA 2Z31A 3SGKA 1OGAA 2BOCB 1FO0A 5LKNA 3IFOA 2ZUXA 3MRFB 3MGTB 2MKWA 5JHDE 3D0LA 1A02N 4LIQL 4C56D 4KROD 3REVA 3KLHC 3DO7B 1CZ8H 2PR4L 1MY7A 1QQDA 3S37H 4Z7NF 1SYVB 1UXWA 3CH1A 4PJIA 1KPUB 2WWMD 3OR7A 4I13B 4NQSA 2LV4A 1LILA 2NY3B 2ARWA 5IBTH 2X70B 3RI5K 1GGCH 5I1JL 3B2UC 2VLRD 1CWVA 2R2BB 2YA2A 4OAWB 4WFED 4PRPB 5L2KB 4ZFOB 5CBEA 4G8EB 3ILPB 3KPLB 1U93A 4IEFB 2IQAB 3CFIC 5TH2A 4GT7A 2EC9T 1DVFA 1EHAA 5A2FA 1ES0A 4S1QL 3AU1A 4PJCE 1GH7A 1RPQA 4KU1A 3L1OH 2NY3D 35C8L 5I18H 5DRWA 4MMXC 4D8PB 1LO5B 2CLZA 1TIUA 1B0WA 3AXLA 4PRPD 5L2KD 4KMQA 2MPAH 4OCWL 1B90A 4KKNA 2EDEA 4XBGB 4M1DL 3RWIA 5LGHL 1MCPL 3MODH 1KN2L 4J3UA 1BIIB 2LABA 3PWPE 4Y8AA 2HG5B 1EFXA 3KLSA 3C08H 4FXGB 2CIKB 3TJHC 2GJ6E 3X3GL 1N26A 4PJEE 5ENWB 1W72A 3RL2A 1I7ZB 3FB8A 1D5ZA 1FG9C 2JCCF 1NBZB 4PIRF 5CIPH 3UP1A 2R23B 3CX2A 3I2CL 3E1F1 4R26L 3R0NA 1JF5A 1EEZB 1CR9H 3NBNA 3ZHDA 1FORL 1P7QA 2WBJC 3B4NA 3PP4L 3P0VL 3QCVL 1LP9B 2Q3AA 1BQHB 2R4SH 1XIWC 2EZ0C 4Z7OF 5ACMA 1JMXA 2B7DT 3O3UN 4HS3B 4JANA 5HHOA 5TE7H 3WLBA 1N3NB 4Y19B 3DURA 5HDBE 2QV2A 4XI5C 2XQBH 3ZMRA 1LO0L 4OZIE 4I3RH 5GHWL 4NHUA 1UGNA 3BE1L 5GRWA 4ODHH 4LSSH 3CFEB 2YXFA 3SDXF 4XBPA 5HYSA 1CL7L 3IJHA 1KTLB 1DDHA 3VXUE 3FT4B 5J13B 3C5ZC 5IMMB 3QWOB 5FO7A 5BO1L 3RWJA 2DM2A 1INDH 4DKAA 1NDMA 4Y19D 4YHPA 2OL3L 4BQ6A 1BVKA 4RBPK 3BP7A 2C7UB 4PBXA 4X9HA 1K8IB 4TVPE 4MD4A 3MBXH 3EJZD 1TJGL 4FRWA 5I8EB 1HKFA 2H9GA 1FE8H 4N0RA 3QUKA 1MCDA 1NSNL 4W6YB 1RJCA 5JNYA 2ZUTA 4FG6C 2ADIA 1AE6L 3CDYA 1QKZL 5IR1A 1T20B 3S7GA 1AI1H 2IG2L 3QDMA 1DUZA 5IF0B 4NNPH 5D7JC 2HJFA 1Q1JH 4JCMA 2P8LA 1RUAH 4LIQE 2NTSP 1I8LC 3ARYA 1SYSA 3ZKXC 5KSAD 1T03L 1VADB 4YUEH 4BK5A 2IEPA 2E9JA 2JB5H 2VZVA 3CNKA 5JA8B 2ITDA 2NXYC 1R3HA 1J5OH 1T7WA 3QYCA 1MOEA 2UY7A 3IDXL 3FB5A 3O2VH 4N90D 3QFDA 4Y16C 2W65B 3TO2B 1INEL 1BPVA 4FP8L 4XNYL 3Q5TA 4QTHB 3SGEH 1L7IL 1CTNA 5EU7C 4XVTL 4V1DA 1CGYA 4X8JA 3DBXB 5I75C 2R2HA 5C3TA 2K7QA 3MXWL 2Y4SA 3O8XA 5LWYL 4YWGH 1DVFC 1JZ3A 1DEDA 1YEDA 3DX7A 1CE6B 2ICEB 3WIFA 3WIHA 5GGSB 3AAZA 4B50A 4WI7A 3BEWB 3QDHA 2WM0A 2J6EL 1QNZH 4XPGH 3F7RA 3IAPA 1MAML 5GS1B 1RJZA 3S4SA 1ZHBA 4HZLA 4C83B 1SJHB 2JJSA 4LNRB 4NP4H 3RKDD 1MCWW 4OIBA 2ITCB 4RGNE 2CSPA 3Q1SH 3P73A 4FZ8H 2H8PB 2LAAA 5FGCE 5FYKD 5L0QC 4MGXA 2AK1H 4AEIL 4P2OC 3RWDB 5J1TC 4S11A 3LKRB 5J6HA 3O41B 1JHLL 4PJFE 3T3PF 3RUGF 4B0MM 5DJZA 4HKJB 4JPWH 3O3DB 2F54E 1KG0A 1GC1H 2DQEH 4EJ1C 1CFNA 1EPFA 3X13A 4YFDB 4B5EA 5C0DA 5HDOA 1HXYB 5D72L 2ESVE 3MRPA 4U6XB 4JG1L 4HH9B 3K74B 5DRXA 4RQQB 2M26A 4X4ZA 5D7SL 1U95B 3P4NA 2PETA 3OKEA 1EO8H 1F2XK 3NTCL 4UI2A 4YHIA 5H2BA 3EYFB 2P24B 1HE7A 2RGSA 2X9WA 5DMGD 1NGWB 4WV1B 3N50A 4BUHA 4QRRA 3F7YB 3ARPA 4GAJL 3GEWB 2VWEC 4P59L 2G60H 2P44B 5FKAB 3ELAT 3DVGA 3VMNA 4NN5C 2GEEA 2NQCA 2AXGA 1QRNB 4M6MH 4H20L 4NZUH 5HHME 1FSKC 5AAWA 3QUXC 3ILQC 2OYPA 4AMKL 1DQMH 3IVKB 1QFUL 4WFGD 3MACH 1ORQB 2CUIA 4IJ3C 1T4KA 1ZA6B 3T4AA 4H5SA 2CK2A 1CICB 1FZJB 2WP3O 3MJ7B 3INUL 4OD3L 4Z76B 1CLZL 3SKUD 4QO1A 1OY3B 1ZLWK 1JWUB 1J0YA 4PJHE 1QRND 1MREL 4TTDD 1S9KC 3MFFA 5C0GA 1VGEH 2R8SL 2VLJB 5F44A 1ZAGA 3D3VB 5HTSA 4WEMB 5IW6B 5CJXC 5JO5B 4JQXC 4YFEA 3EGSA 4LVEA 1CICD 1WV7T 3RWHA 5KN5B 1NCWH 4BFBD 2FO4A 5CS7A 4X6DF 2FHBA 4DGVL 4K8RC 2J8UA 4PUBH 5E9DE 3H8NA 1F6AB 4DQOH 1F90L 2YEZB 5IHUH 2VLJD 3D3VD 3QWRD 3FFDB 3VFMB 5I16A 3MYJA 5ACZA 1LE5B 2DQFA 2HRPL 3WXVH 1S7RB 5LJYH 2YK1H 4S0TD 1GOHA 4M02A 5F7MC 1ONQB 3BAEL 3C6SA 3TBTB 1JRHI 5SWZB 4ZG1A 2V7HA 4S1SL 5IB2B 4QHUA 4P2CG 3LRSA 1ED3B 5I1IH 2VOTA 4LLQA 4D0DB 4G6JH 4XP1L 2WV3A 4KZEL 2O5ZL 5GGTL 3ZKQD 4BFIB 1PQZB 1LDPH 2VITA 4Y2OA 4ZDHA 3MFGB 1X5AA 1UZ6E 1TCMA 2XYCA 3GSUA 3UTOA 5JMOC 5F3HB 3HAEG 3GSOA 3S35L 5IFJA 4OIIH 1W2KT 5SWZD 1Q72L 4WWKB 2E8ZA 1EFQA 5HDLA 4OCSL 4ZSOE 2E8YA 2Z8RA 3HB3C 4GSDH 2OJEB 4JRYB 3LEXB 4N0UE 1FNGB 5ICZA 2BNRB 1RU9H 3NFNA 1G6VK 2R1YB 4TUJB 5FOBB 5DMKB 3D48R 3HNVH 3NABH 1FZOA 1HH9A 5TF1L 3E2HC 4LLDB 3G5YB 1M71A 1KC5H 1TZGH 4MNQA 4WWKD 4ZFGH 4BH8A 4GG6B 4ZS6D 2XZAH 1EV2E 4TVPH 5BVJB 3BPNB 4JRYD 1TQBC 4F7CA 4PJAE 2BNRD 4HBQA 2LQRA 4FXLA 4U0QB 1C08B 5CIPA 5F7EH 4YXKL 4QT5B 2PTTB 4Y4HA 4NJ9L 1KJ2B 4LIQH 1MEXH 5J3HD 3D18B 2ORBL 3PWVB 2PTUA 2QTEA 4JFZL 3JWDL 3ZDZE 2FSEA 3HRZB 2B4CC 1OARL 1GL4B 4MX7B 3OKNB 5KBNC 4JRXE 4UTBL 4QXGL 2VE6A 2KBGA 5I1JH 2DQTL 3WFHB 4IMLA 5D2LB 3AM8C 5ID0A 2H1PH 1SVZA 4LQFL 4M6NL 4OZFG 4Z7UA 3OJ2C 3MROB 3O6FB 3CUPA 4FFWD 2BNUB 4QYOA 1CGWA 3GI8L 3LV3B 3BH8A 4U1SB 4NRYB 4L4TB 3BZ4B 1K4DA 4Z77A 5E95B 1XH3B 1NFIB 2CO7B 35C8H 3FAWA 4L1HA 4E41B 5I6XC 4KK8D 2P47B 1R5IA 1CYGA 4Q2ZB 1BM3L 3HUJB 4K7PY 1YEHL 1U6AL 3THML 1PW3A 1B0RB 1YJDL 4LLYA 4P3DA 3MOAL 4XZUA 4AM0A 5I1LB 5FA4A 1J8HE 4M5ZL 3NFPB 4PV8A 4I3SL 3L6FB 4IIQB 2EIZA 4XNMA 5LGHH 1KN2H 4M43H 3O6FD 4XPFH 5CJ8A 4HS6A 5DQ9A 5HGAB 1FIGL 2DM3A 1A4JB 4L4TD 4RMVA 4NWUL 4WTZG 2V2TB 2EDJA 4QCIB 5A16A 4U49A 5FUOL 4PG9B 3ABZA 4E41D 5C08B 2QQQA 4HPOL 5KSUA 5T1KA 4J3VA 1UADC 3HMXL 3V6OA 1LE9B 4G43B 5GGUB 4JKKA 5C0CB 3KR3L 3O45A 5AG9A 1H3VA 4JM2B 1B88A 1FORH 2HA1A 1BBDH 1KJMB 1YN7A 3PP4H 3P0VH 5IVXA 3QCVH 3KPSE 3LKSB 3OAYK 1QBAA 2R69L 4P5MB 3UDWA 4JFXA 2YPLE 1BWMA 3QH3A 3CZJA 3F6LA 3MRNA 5DD6A 1XZ0A 3KJ6L 4TPRL 5M95B 3FL7A 3L3GB 1S3KL 3FQRA 2XNAB 3QEQA 6FABL 1FCGA 4OT1L 5GHWH 3BZFA 3GJEB 5K93A 1JZ8A 4Z0XA 5IB1B 3DI2B 5KVFL 4JM2D 2FEEL 4NJAL 5IJKC 3MLTB 5T3ZL 3E6FB 4IOFC 4PJ7B 3UYRL 2A83B 4U7SA 3LKNB 4EN3C 5MHSD 4PJ5E 5J12B 2Z91A 4BQ8A 5EUOE 1ZEAL 3K4DA 2CQVA 3T08A 3T1WA 4FQ1L 4NZDA 3VCLA 3CFDB 1X9QA 1UEYA 1CF8H 1NSNH 2ZP0T 2G5RA 4JDTL 3I9GL 1W8OA 4OZGB 3STLA 3IJSA 1AE6H 1AGDA 2PXYA 1QKZH 1ZT1B 3T3ME 4NSKB 2YMXL 1PYWB 5B21A 5KSBB 2BVPB 4U1GB 1FC1A 1BAFL 2GTZA 4X7FC 3FRUB 1INQA 4X7CC 1HXMB 4NKIH 4OGAD 4PJXA 4KV5F 4KUZH 3GMMA 2NPLX 4ALAH 1SMOA 1JWMB 3ARVA 3KYMB 4N5ED 4Y1AB 3KNBB 5E8NB 1IAKB 4LVNB 1JPST 4X99B 4J1UA 2V9TA 3KS0J 4GMTL 4CMMA 4OGZA 3VXTA 3IDXH 5D1QA 2HTLD 3MV8A 3RIAF 1INEH 3U36B 1FFNB 1MI5A 1L7IH 1YA5A 3RVXC 3LS4H 4G8GE 2RR3A 1JNNH 4KQ4L 4XVTH 2XKUA 5IHBA 1OB1A 3I85A 2VDOL 3C5SA 3NZHH 4Y1AD 4RISH 4FTVA 3WDIA 4XAWL 5EIIB 5F9AC 2O5YL 4UDUA 4PV9B 5AWNL 3M8OL 1XF2B 5HI3D 5K9KB 1FAIH 4LSQH 4P5TB 1TPXB 2AJSL 1RZ8B 4XH2B 4OCRL 1UVQA 5FDYA 1KXQE 2B1HH 2Z93A 3ZT5A 3G5VA 1CXLA 2X4TA 1A3LL 5E2TL 5JHDA 1VACA 2HVKA 4Z7NE 1C5DB 3DVIA 1MAMH 5C0FA 1KN4L 2A6KB 4M8QB 3HE6B 4HG4K 2C3HA 5DJXA 3L3JB 5I2IA 5JW4M 3BP6A 2Q76B 2MOVA 1NGZA 3T8XA 4P5TD 1MCJA 1IGTA 1UXSA 5DZLA 5C0BB 4K94L 1Z9LA 3QQ4A 1ZTXH 2RJMA 3A6BL 1UQSA 4PJGF 1EX0A 5GGQL 2QQNL 5D96C 4LP5A 3P9WB 3T0EE 4EIGB 3GMRA 3EOTH 3KLHD 1F4AA 4CVXA 3QG7L 4PD4J 4PJCA 3DSNA 3X12A 1K4CA 5D72H 2A1WL 2BFVH 1U9KA 5EDXA 2DRUA 5C0BD 4JG1H 3RRQA 1FVEB 5DWUL 2V5YA 2W07A 4L8BB 4M7ZC 2X40A 1MCKA 4HKXA 2OQJB 4RFOL 5DJ8A 1NUDA 3B2UD 3OKDA 1BD2A 4HK3N 1CDBA 3H0TA 3CSYA 3PWPA 3VGBA 4GAJH 4KTEH 3TIDB 2E7CA 5EOCJ 2GJ6A 3EOBB 3GNML 4PJEA 3DX6A 3HC4L 2XTJE 1RUML 3U0TB 2UVEA 3HAEB 1DANU 1AR1C 3LOWA 1X7QB 3I3DA 5D2NE 5T1LB 4Z7OE 4FQXB 4NBZB 1KJVB 4PREB 5I1HL 3VFVB 3QEGL 5CKGA 3INUH 4OD3H 1TVHB 5DRNB 3S37X 3TT3L 4KUCD 1CLZH 5IJVB 2Z0BA 4FQIL 3BZEB 3C8KB 3H9SE 3HZVB 4JZJA 3SDXE 4Y0GA 5HXMA 1MFDL 3UTQB 1QFWL 3TJHD 1XIWB 3RDTB 1G9ML 1I9EA 3E8UL 4OLUH 5T1LD 1P5VA 4FQXD 2YN3A 1ZHLA 3KXFE 1FLTX 3VXUA 3UAJD 5J9PA 3BSZL 5BV7C 1TENA 5D1QC 4AQ1B 4D3CH 5IESL 4X4ME 3HR6A 4WGWB 4NO2A 4DGVH 1MJUL 2ZUSA 3WEXB 1MCQA 1XIWD 1CDIA 1WZLA 2SEBA 1SQ2N 2VYRE 3RDTD 3T1FA 4F7EA 3OAZK 1RUPL 3MRRB 4ZS7L 4OCYH 3UPCA 4G7VL 1HHHA 4LKCA 2HRPH 3P4MA 1S7TA 2XZCH 1S7VB 3HC0B 4ETYA 1FGVL 4JFEE 4MJIE 3W9EB 4AIOA 3DRTA 4GKZA 4HQQL 4O2FB 1BFOA 1K8DB 1G7LB 2CRMA 2ICWB 4O2EA 3BAEH 3BKCL 3QXDB 3BVNA 4WI4A 3VWKA 4XB8A 2H26B 2BSED 2Z31B 4S1SH 4S0SD 3ZKXB 4NQEA 1NKOA 3V95A 1FO0B 2YBRA 3HR5A 1KENL 3IFOB 5CWSA 3P4OA 4JHZA 3ISWA 1YMHA 1FPTL 4R96A 4POYA 4OSUL 4XP1H 3D0LB 2O5ZH 5EB9A 3DTXA 4P3CL 1DBBH 3REVB 3GBNL 3K0WA 1C16A 7FABL 1ZXQA 5DGQA 3F8UB 3S35H 3CH1B 1RUKL 1YEIL 5IV2A 3OR7B 1Q72H 3V0WL 4NQSB 5ABDE 5DQDL 1KB5L 1JGLL 2Z31D 4Y5YA 2MCG1 3FOMA 2JK5A 2AEIT 1YQVL 5GRJL 1F4YL 2NXYD 5CBEB 1KCSH 2FJFA 4OGXL 4QXUL 5KANI 1U93B 3LY6A 9CGTA 3M1BA 2VLKE 5TH2B 1PKQE 3AMKA 1DVFB 3EO0A 3HHRB 4K7FA 5D7IF 5EBLA 5SX5K 3AU1B 3WFBL 4U0RC 5MENE 4R8WL 5DRWB 3NFSL 1FG2A 1WZMA 4XP9L 4OLZL 15C8H 2CLZB 4JCLA 1GGYA 3AXLB 3C9NA 5TDOA 3GSWA 1D6VL 4X83A 3T3PE 3VFSA 4YHZL 4ZUTA 1Q94A 1T66D 3RWIB 4MZ3A 1EEQA 1DVFD 1TLKA 1OQOA 4PJFA 4NJ9H 5L0QB 1RZKL 3KPTA 1EFXB 4NUGL 4EOWL 1NMBL 2ZSWA 4LRIA 2ORBH 3SDDC 2YN5A 4WHCA 1W72B 3RL2B 3FB8B 1D5ZB 2F54A 1WWCA 4WDIB 3FONB 2OR8A 1OARH 2YA1A 1F4WH 1WBZA 2PW2A 2R56L 4UTBH 1P7QB 3G6JF 1GGUA 3R1GH 4QXGH 2DQTH 3DRQA 1EFXD 4K2UL 3BMVA 4LSUL 3MV7E 5C9KA 2WSKA 1I3VA 5HHOB 5F1SA 4M6NH 2LAGB 3DURB 4WFHE 3MRGA 3EJYC 3GI8H 4NHUB 1U8QA 2ZG3A 8CGTA 4U7KA 3IFLH 4XBPB 5HYSB 3Q5OA 4X5XA 3FFCD 3IJHB 3FQXA 1DFBL 1DDHB 1P7QD 1CBVL 5ID1B 3RZWA 5TQ2H 3HI1A 4EI6A 4DWHA 5FO7B 3RWJB 3THMH 1YJDH 2NY6C 3TBSA 5L9DL 4NN5B 5HHOD 3TCXA 1NDMB 4M5ZH 2CDEA 3IXAA 4G9DA 1QR4A 4YHPB 1FSKB 1BVKB 5HVGB 3ULUF 1DTUA 2XFXA 4M6AA 3CXHK 1FIGH 4H25A 2H9GB 4NWUH 4IJ3B 2ZPKL 2V17L 2EO1A 3QUKB 3QXUA 4O5LL 3RNQA 1S7UA 5JNYB 2Y5EA 2R0WL 1NUNB 2ADIB 4PJHA 5IR1B 4DVRL 1ADQL 3HMXH 3QDMB 2UZIL 1DUZB 2HJFB 3KR3H 2P8LB 1SYSB 4LOUD 5IQ7L 3O6LH 4TOYL 4X6DE 1AXTL 4C4KT 2DLIA 2R69H 2GK0A 4KJYA 1S7WA 1R3HB 2XA3A 3D25A 4MNGE 2XRAL 5E2VL 3FB5B 3KJ6H 3QFDB 1CXEA 1HCFX 5E9DA 3QDMD 4OT1H 2IGFL 2WLYA 5DJ2A 5DZNA 1UKSA 5KVFH 5DFTA 4Y5YC 1DN2A 3B2VL 1L6XA 3ZHKA 4V1DB 3ZL4L 4X8JB 2BVTA 1EERB 2R2HB 3GMLA 3JZ7A 5CEZL 1MVUA 4FQHA 1KLGB 4YPGA 3WFCH 1YEDB 3DX7B 3WIFB 1M7XA 3WFDL 3NCFB 4K8RD 1VCAA 3AAZB 4UTAL 3F7QA 4K07A 3OGOE 1KGCE 3QDAA 1IQWL 5FV1L 5I1EL 5F70A 2YMXH 1RJZB 3S4SB 1ZHBB 4HZLB 2GFBA 4DKEH 4P4RA 3S5LA 4WW1A 3P73B 5GZOC 5EBWA 3LSOA 1KELH 1UCBL 2YRLA 1CDHA 5KS9F 5EO0A 1B0GA 4LRIC 5J6HB 4GMTH 3B5GA 1WFTA 4ZSOA 4AENB 1J0HA 2EDYA 2A9NH 4N0UA 4PRIE 2W9DH 3MNVA 5DJZB 5BS0D 2DM4A 1XR8A 1KG0B 5C0JA 3SJVE 2X05A 5ADOL 1WCBA 1CFNB 4KQ4H 1RIHL 3X13B 1AFVH 4NGHL 1U8JA 3UBXI 2VDOH 5C0DB 3JBG7 2IFGA 4KKAC 3MRPB 3F12A 1NLDL 2O5YH 2ID5A 5DRXB 4ZO9A 2A6IA 5AWNH 3P4NB 3S9DB 3OKEB 4YHIB 5H2BB 2AJSH 1W0VA 4XPAH 1TQBB 4NQDE 4OCRH 1BZ9B 4QRRB 4YO0A 1O5DT 5D1ZC 4OLWL 1P9MC 4GXUM 4AJ0A 5E2TH 4S1RH 4R0LA 1KIRA 3DVGB 3L7EA 4I9WE 1KN4H 1FH5L 2AXGB 4XRCA 1Q9WA 2P8PA 3T4YA 1VA9A 4RFEA 4BM7A 2NY1B 1T4KB 1JNLL 3T4AB 2FGZA 1LMKA 4H5SB 4JRXA 4X7TA 3WLWC 3V52L 3UTZA 1NL0H 3DV4A 2H41A 3IDNA 4J6RL 4QRRD 1YEJL 5IBLC 1N5YH 3KG5A 1REIA 3VG0L 2C4XA 3TH2T 2P42B 2E6JA 2QQNH 5AAMA 3MFFB 5C0GB 1J05A 4Z7VF 4ELMF 1A3RH 2Z8VC 4CGTA 2NY1D 1AC6A 5CBAA 3STZA 3EGSB 1I8IA 4FFVC 3RWHB 3CCHA 3B9AA 1T1XA 5J1AA 5I6XB 4Q7DA 4ODBD 1J8HA 2XZZA 2J8UB 5CP3H 2V5RA 5E8DH 5CEZE 3TLRA 1VEMA 2QHRL 3QZWA 3R06A 2AXHA 1L9NA 2IADA 4NQCE 1ZANH 5I16B 3MLPA<