4G9FE

Crystal structure of c12c tcr-hlab2705-kk10-l6m
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
250
structure length
250
Chain Sequence
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASREGLGGTEAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADASGLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title A Molecular Basis for the Control of Preimmune Escape Variants by HIV-Specific CD8(+) T Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9fE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9fE02
4QNPF 3L3GA 5TE4H 3QYCA 4DQOL 2YD3A 1SBSL 4N5ED 3BT2H 5GJTH 4JANB 1MI5E 3CFBB 2X4NA 3GI9L 1XGUB 2EDHA 2H6PA 5TDOA 2RGSA 2VDPL 3BIBX 2H3NA 2C1OA 2C3HA 1K8DA 2VITB 4ZPTA 3QFJE 5ACMA 4GG8A 1KG0B 2DQFA 3WLWD 4LBEB 3TP4A 3RVTC 4PGZA 1H15B 4LLVB 5E6IB 1PQZA 5F7UA 4L5FH 1YEFH 1YPZB 4BZYA 1D6VH 3O6FA 4Y1AD 3VFTB 1TQBB 2Z31B 1IBGL 3CFDA 3IU4L 1I1CA 1FLTX 5J0BA 2MJWA 2F53A 2AGJL 1KJ2A 4XP6H 4YDJB 4R97B 3MGTB 1IRAY 5JHDD 1IM9A 4NBZB 1MH5A 4V1DD 1IC7L 1KCSH 4YBHA 2CUHA 4I48A 3EYVA 1T20B 3BP4B 3HE7A 3C5ZD 4NPYB 2DWEB 5ITBL 4MWFA 1WCBA 4YHIB 4U1MA 3UTSE 4N9GB 2OR8A 3OAZH 4Y8AA 4KHXH 2VZUA 5GS1B 4NSKB 4MQ7A 4PV8A 5HHMD 3O8XC 2VUYA 4PB0H 1JPTH 1M71B 4Z95H 4NQSB 4FQCH 5EZLA 1M7XA 4ZAKB 1VGEL 1ZMYA 1LD9A 5T5FL 1JGVL 4JG1H 2GW5A 3EDFA 1SJHA 2Y5TA 4DKDC 3BGAA 4FQXB 1JGEB 2E7HA 5IWLA 1FNSH 2FBJL 1MWAH 1T5XA 1UH2A 1OGAB 1I1RA 4YHKH 4Z0BH 2NNAB 4KK5C 3SJVB 2Q86A 4OJFH 3V6ZB 1JWMA 1GH7A 4FQ2H 4TSAL 4D94A 5F9DC 4IHOA 4YDIL 1Q1JL 3WXWL 1G9NC 1P69B 5J56B 3ULVL 4I9WE 4LLAA 1XT5A 3QHTC 4OCWL 3UPAA 3TO4C 5EU6D 1BQUA 1FVCB 2FWOB 2IG2H 2X10A 1B4JL 1DVFB 4P3CL 1UXWB 5TDNB 3I2CL 4PJFE 3ZTJG 3VGHA 1KLUB 4WU5B 5ISZD 1IAIL 4LHUA 4ZFFA 2Q87A 2NY7H 1A6AA 1VPOL 5I15H 4OB5L 3V6OC 4QRPD 2BNQA 4HJJH 2RCSH 4YHZH 4WHYH 4G6KL 3SDYH 1ZHLA 2FZ3A 3D87B 3V7AE 1W0WA 1OOAA 2P5EA 4PRNB 4Z0XB 5DD0H 3D5OF 3LQAC 3BEWA 4D8PA 4WJ5B 1EUUA 5IW1B 4U1HA 3ZO0A 2VDQL 4LLYA 1KOAA 3WE6A 1XGTB 3TYGH 3HMXL 3IXAB 5GGUB 2L4OA 1OAQH 4R2GC 2MPAL 4D0CA 2WINB 4M7JH 4OF0A 3FQTB 3S98A 3KDMA 1HKLH 4XRCB 3GMLB 1F4HA 2X42A 3FQXA 3QWOA 2QV2A 4Y4HB 4M00A 2QBWA 1RZJC 4EI5B 5JUEH 2PCPA 3O6FD 5I8OL 4BQBA 5JQ6L 2BZDA 1IAOB 2E9BA 4N0UB 2MWCA 2E7LA 1V5JA 1J1PH 5CCKH 3RFZC 4JFFA 2F53D 4L8SC 4G80B 4F33B 4P9ML 3P4LA 5IK3B 1HCFX 3SGKA 5CEXA 1IM9D 4OFPA 1WT5C 2EECA 5IG7A 1CLCA 4XXDA 2YUXA 2GKIA 5IT2L 5DEGA 3HE7D 4OCLC 3MCLH 1G6RA 1ZGLA 2VDKL 1ULVA 4WTWA 3VWKB 3FB6A 4AENA 3PWVA 2P45B 4Y2OA 1R3JA 1HHKB 3GBNL 4FG6C 1GGYA 1X7QA 3VH8G 1EIBA 1YPZE 4JFYB 4XMPL 1X3DA 1U3HA 3FT4B 3IAPA 2HRPL 4NO3B 5D70H 2MTPA 1BPVA 2GSIA 3JV4A 2X70A 2YUVA 2HH0H 5HHNB 4YFEA 3ZT6A 4GAGH 2FDBP 3SDDA 3UAJC 4FFZH 3U46A 1TJIH 3DUUB 3KNBA 4BSWB 2AJVH 2VO5A 1CDUA 2WK2A 4KTDH 1CDYA 4LP5A 4WY7L 3MRFB 2VUOA 4NNYB 4GKOA 1LE9A 1A9EA 1A9BB 2JB6A 4P46A 2DTSA 1NBQA 2FATH 4JO4H 4GW1B 3RKDD 1TVDA 4YK4B 1LEKA 8FABA 1UA6H 3TZVC 1I9EA 2QQQA 1FLRH 2H8PB 5B8CA 3PHSA 5K9KB 3CCHA 4JKMA 4ELKB 2ZWLT 3FRPG 4F7PB 3JV0A 4LHUD 2W38A 1CD1A 3HUJA 3O11B 1HYSC 4M5ZL 5D1QC 2AW2A 4DUVA 2BNQD 4K7FA 3PXHA 1Q0XL 5KS9A 4YXHH 1RHFA 1N2RA 1P5UA 1RUKL 2P5ED 4HF5L 1DBJL 3SJVE 2W0FA 3RRQA 1E4JA 2AKRA 5C6TL 3SDCB 4IRSB 1PG7W 4OCMC 4NKDA 4XMKL 2NYYC 3UTQB 1MRDL 4M7ZB 5JDSB 1NC4A 1ACYL 2FSEB 2OXHA 2JCCA 2C5DC 5DJ6A 3SKOB 4I13B 1CLZL 3FN3A 4A2LA 4ZO6A 2HAZA 3NH7H 5JTWA 5MEOA 3Q6GH 1KENH 1QLRB 3MRIA 4XC1L 2DLHA 1BQHG 4FFYL 3QR2A 1HDMA 2ATKB 2EICA 3FAWA 3CDGA 3MRMA 4MD4B 2BXYA 5D7IA 1XF3B 3EYUH 3VMNA 4H0GA 5GGQH 1AGDA 2ORBL 3NPZB 5DRZA 4AM0A 1G7JB 4PTUB 4HZLB 2RAMA 1AXIB 1F8TL 4OCRL 1NBYA 5TFSH 1X5YA 1UYWH 2MKWA 2ICEA 3GSQB 4S1DC 2BRRL 3U36B 4XCFH 2DLIA 3B8YA 5CLTA 1W2KT 1D5ZB 2BVQB 5HHPB 1CGUA 1MNUL 1WEJH 2FEEI 4X5WA 4WI6A 5DJDA 4RA0C 4WW2F 4NZRH 5HHVH 1T83A 2BCKA 25C8H 4L9LB 3K2MC 4ORZC 4UI2A 5EOCJ 5IJVB 4HWBA 5BXFB 5EOQL 1ND0A 1U3HD 1DN0B 1XIWA 4TUOA 2CKBL 1AHWB 4N0UE 1U3ZA 5JORB 2D4FA 1TNNA 1BD2A 2VIRB 1HXYA 2FLRT 1ZTXH 4P2OB 4R90H 3SDDD 1YYLH 5BZDB 1FN4A 4KMQA 1GGBL 2D7MA 4XCYA 1MVFA 2C4XA 5EO0B 1PEZA 2K3TA 3KPNB 4NQED 5I71B 1SM3H 1OVZA 1P7QB 4PP1C 4E9LA 2VLLA 2YC1A 5A2JH 3JXAA 1HQRB 2PW1B 3NPSC 5JO5B 3TM6A 2VDRL 1A1NB 3OR6A 1KELH 1S3KH 4HULB 3DMMA 4ZOBA 3S36X 4WV1C 3LMJL 5CJ8A 5JXED 1YMHB 1NPUA 4ONFL 5EDXA 4PUBL 3GM8A 4ONHB 5F96L 5BV7C 4GW4B 4K94L 4C83A 3SE4A 4NCC1 5JOPD 1I1AA 4QO1A 2V9TA 4MS8C 1HH9A 2BK8A 3O2DA 3VH8B 5ESVB 1G0XA 3MJGX 5ETUA 3T0EC 3X13B 2Q8AH 4YHPB 3GMNB 5KZCB 5L0QC 4NNPH 1U8HB 1PW3A 2WUCL 4JN2A 4N0YH 4WHYG 4G7VH 3THML 2Z91B 1F02I 1PX4A 2C4FU 4JFXA 3OXSB 3LS4H 5IMOA 2R39A 3VXPA 4H8WH 1FNEB 1A0QH 1MI5A 4G9DA 3IDNA 1D6EA 1P4IL 5ALCH 1L4IA 3BWAA 1FL6B 43CAB 5DUBA 4U3CA 4PJ8B 3LH2L 1AXSA 1B4RA 3QFJA 3Q6FA 3ZE0F 1TCMA 2DIJA 5CEZL 4LEXH 4UU9B 3HS0A 1JPGA 3SO5A 4TOYL 2QSQA 1BVKA 3N0PB 4MAYA 1UC6A 4PRBB 5EC1B 5EBWA 3UC0L 1ZLWK 4DAGL 1HHHB 1W8NA 2OTWA 1EJOH 4I3SH 1DEEA 1NFKA 4UTAL 2KZ1B 3LQZB 1TZGL 2VSCA 5BRZE 4EQ3A 3CVHA 4TSCL 1MHEA 3VD3A 2VAAB 4GKZB 1A21A 1S9XA 3CXDL 1U8IA 3QWRD 3QH3B 3FKUS 3KPMA 4RWYH 4XNZB 4YE4L 4NT6B 5CZVL 4PBWD 1YJDL 3U2SB 1XIWD 5E7FA 5IGXH 2EO1A 2A74B 5INDB 1BD2D 3OWEA 5TQ0L 5ENWA 5C2UB 3GMRB 4G43A 3T77B 5SX4I 4AEEA 3RQ3A 1J12A 5C0AD 1BQHB 3F7YA 4HMCA 5DJZB 1V3MA 5J9PB 1WBZB 2ADJA 4GQPH 5B22A 2E5EA 2YN5A 5AAMA 2NTFB 3DVNB 1Z9SA 1FBIL 2JLLA 5I8CB 3ZDYF 3DMMD 3QQ4B 3DUSA 2JTDA 2J12B 2N7BA 4PB9H 4KQ3L 1FFQA 3DIFA 3KPLB 2IALA 2RJMA 4HIHA 4W6YB 4F37F 1DUZB 3M8OL 3QUZB 5E8EA 3HC4L 4RQQA 4AIXA 1CGSH 2FJGA 3CMOL 1I3UA 5EUKB 1D9KA 2WUBH 1I1AD 1UB5A 4IS6A 1G7LA 4PJFA 3TFKD 1FH5H 2FO4A 2D0FA 1W8OA 5DA4A 1YEHH 3ARQA 1T03H 1T0NB 2BVUA 2AJYH 1QNZH 1K8IA 4O58L 5EIQA 5LCVL 3BH8A 4OI8A 2I26N 4N8VG 4TNVF 2HA1A 3IAQA 3SCMC 3MRQB 5DQDH 2AJZA 1X5FA 3VFRA 1UM4L 2AXGA 4OZFA 3G5XB 4RISH 1MI5D 2ARJA 3SKMB 1MWAB 1JE6A 4M8QA 4Z7VB 3K3QA 1YZZA 4PG2A 1RZ7H 2BXZA 3QFJD 3IJSA 2DYPB 4LLWA 4NZUL 3ESUF 5C9JA 2F74B 1QTYT 1BFVH 4LSPH 3QQ9D 4B50A 1QYGH 4DN3H 4Z77A 4MAYD 1CDGA 5HDBE 1E4WL 3UEZA 5I1KL 1NCNA 3MJ7A 1G7QA 3O2WH 3UROR 3ARGA 4OGXL 2HKFH 1SJEB 3DI3B 3HE6A 3DSNA 4LFHD 1A7RL 4FS0A 4WEMB 2PNDA 3MNWB 5ICZB 4JANA 4Y8DC 1FVDB 5HYEA 3UTSD 4J3UA 1E6JH 5E2JA 4K7PY 1AY1H 4JZJB 4TPRL 4YXKH 5ITFB 1X6NA 5DFWH 1HIMH 4IBLT 2UZIL 2VITA 1KG0A 4LBEA 2V2TB 3BQUA 2E9WA 1ZANL 1H15A 3K1DA 2CUIA 4LLVA 1QR4A 5E6IA 1EK3A 1YPZA 2H32H 2VXQH 2CJUH 3GMPA 2CQVA 4WRLA 5EUOB 3VFTA 1ZHBB 3LN5B 5FECA 3FOMA 2YZ1A 4YDJA 2JJUA 3MGTA 4M02A 3EDDA 1G9EA 5E8PB 1WLHA 3T3MF 4KKBC 1Q9LB 3QSKB 4OQTL 2B7DT 4XNYL 1C5BH 3CK0L 4LVNB 1QBML 4HD9A 1T20A 3BP4A 4NPYA 2DWEA 3CAFA 1C1EH 4EN3C 2NY0D 3B9AA 2KQMA 1JF1B 4XCCL 3UDWA 1FG9C 4YHIA 4N9GA 4JY5H 3BP6B 4I9WD 4OLVH 1H5BB 1QLFB 5GS1A 4FTVB 4NSKA 2B5IC 3BKYL 3NCCB 1RMFH 1M71A 5MP6L 4NQSA 4N0RA 1KTKE 2OZ4L 4LPVA 4K3EL 4ZAKA 2FGWH 4HG4K 1LO0H 1OCWL 2XA8L 4FQXA 4XZUB 1JGEA 1T0PB 2IANB 3CVIL 3IVKB 1OGAA 4M48L 2NNAA 2B39A 3SJVA 2DQIH 4WU7B 1FG2A 4LQ1A 3V6ZA 3C60D 3CNKA 3I9GL 3KAAA 1HHJB 1ES0A 1LEGA 3ARUA 2X4TB 5GRUL 1U6AH 2F58L 3QRGL 2CGRL 1T7YA 1F90L 5D7LB 3U9PH 1S5IH 1KLGB 2ZOLB 2XRAL 4YH6A 1T1WB 3TO2B 1A47A 1FVCA 2FWOA 4UAOC 5FDWB 4Y5YC 3VD7A 1DVFA 3WJLC 1A8JH 1BWMA 4M1DL 5TDNA 1LO3H 3IDMB 1KLUA 1UWGL 4WU5A 1JNLL 5F1KC 3AS0A 2GIYA 1A3RL 2A77L 2IPUG 3DX7B 3ARGD 3RDTC 4WI7A 1JHKL 3HE6D 1TETL 4M6OL 5HYSG 1ZT1B 2WMPA 1WBXB 4YDLB 5ECJE 1LDPL 4Z0XA 4BFGA 5K9JL 4WJ5A 5IW1A 3TN0D 5SV4A 2MHAB 5IHUH 3R0NA 2ZUSA 1XGTA 3TT3L 4N8VB 4Z7VE 4OCYL 3IXAA 5GGUA 2YK1L 4JM2F 4C4KO 4L8DB 2WINA 3FQTA 3GNML 3UYPA 4XRCA 1RZFL 2C1PB 5EOCL 1MAKA 5E6ID 4LHQB 1F3RB 4Y4HA 3AY4A 4EDWH 1B2WL 4EI5A 2VC2H 5I30L 2Y4SA 5B38G 4X80H 5J11C 2Z31D 4N0UA 1IAOA 1RZ8A 4Z76B 4X9HA 2A6IB 4F33A 4IMKA 5IK3A 3DV4B 4L4VB 3PHQB 3IGAB 3UTTE 4EOWH 3TLRA 4MD5B 4HT1L 2I5YH 2ZG2A 2Q3ZA 1I1FB 3MOQA 2D7OA 3ZE2E 4P23C 1JTPA 3MV8E 3OG4B 3ZL4H 3S9DB 2WLZA 3U7WL 1BAFL 1QFHA 3CDFA 3VWKA 2MNUA 5I2IA 3W2DL 4JY4B 5IFAH 2EDXA 5DO2D 3REVB 3FT3B 1RU9H 1ZS8A 1PLGH 1HHKA 2G75B 3CMGA 5C07A 5EN2B 2P8PB 3QEQB 5JIHA 1T6VN 2A0LC 2W9DH 3RVUD 1FVEB 5MHSE 5A2IH 5JIPA 4JFYA 3FT4A 1OSZB 4ZAKD 5EUOE 3OKOB 3ZDXF 5HHNA 4K07A 2NTSP 1JGDB 4HC1A 2RIKA 1ZHNB 1GL4B 2ITDB 5DEFB 3DUUA 4BSWA 4NM4L 1OGAD 3VI3E 4QRSB 3LZFL 5KN5B 3RU8L 3SJVD 4RFNC 1J7VR 1N0XH 1CGYA 2VDML 4NNYA 2PR4H 4W6XB 1A9BA 2JKXA 3AFLA 1ZE3C 4QTIL 1I9IL 3KS0H 1QSFB 1MCBA 4GW1A 2W65B 4FTVE 4NFCA 3TCLB 5ABDE 2H8PA 5BS0E 2NXZB 1DVFD 1P4BL 3MLYL 1K6QH 4KKAD 3WDIA 5E2VH 3D1MC 5K9KA 1Z2KA 2XYCA 4ELKA 4F7PA 3O6LH 5E7BA 1QFWM 3ARFD 2VXVH 1NMCC 2F8VA 5SX5H 3O11A 4TNWF 1EFXA 3B5GA 4NQXA 5E08H 2AEWA 2DLEA 1R3LB 3LRGA 2YHGA 2OYPA 5GIRB 4M7LL 5D2NC 4GFTB 3MREB 2DD8H 3SDCA 4IRSA 3MYJB 5E56A 1YQVH 4WFEE 5JDSA 4S1QL 4FFWD 2FSEA 1TENA 5C7XH 5D7LE 3AREC 2OP4L 4NN6B 5DVMA 4L3CB 3QIBC 2JJWA 1A6VL 3ORJA 2H9GB 3IFLH 4OTXH 1ADQL 1F11B 4HJ0C 1QLRA 4YBQC 4Y5VC 4OM0H 3A6OA 5FEBA 4LSQL 2DBLL 2ATKA 3X17A 3OZ9H 4MD4A 2KBGA 4AIZB 3HC0B 4ZQKB 1XF3A 4Q9QL 4LDOB 4U33A 1N4XL 4X4ME 4JQIH 1G7JA 4UB0L 1IFHH 4I0PB 4PTUA 2QQLH 3G6JF 3FZUD 4HZLA 5EZJA 5DRXB 3WIIL 1AQDB 4HWUA 3UZVB 2CO7B 4PJHB 3VI4F 3IDXH 2DLFH 5A3ID 3GSQA 1XCTB 1FFOA 1A7PL 5HYSB 3VWKD 1NMAL 1CXLA 3OAZK 1D5ZA 1X5HA 5AUMB 2BVQA 4RCAA 5HHPA 3HPJB 2WIMA 1TJHL 3KYAA 3UX9B 4KRPC 1FSKC 2VN7A 5IJVA 5BXFA 5GRVL 1DN0A 5AYUH 5JORA 1I4FB 3FFCE 1MJ8H 2VIRA 2DWDA 4P2OA 4PJIB 4B0MM 1MFAH 5BZDA 5C9KA 4L4VE 4KROC 1F2QA 1C5CH 5DUPH 3OKMA 2ZUVA 5I16B 5B38B 4WHDA 3EJYD 5EO0A 1I3RB 3KPNA 2IFGA 1P7QA 5DDHB 3RL2B 4OZIF 4FZ8H 1HQRA 2ESVA 4MVBD 2PW1A 5JO5A 5F7LB 1R3HB 1S78C 4LCIL 4JRXB 1A1NA 2ADFH 3RI5K 3U4BL 3D9AH 3MRPB 3TNMB 5D7JB 3QEQE 2P5WB 4FFVD 4U4BA 1YMHA 1I85C 2HLAB 4ONHA 4YPGB 4GW4A 5I1CL 2CK0H 1MAMH 3RX7A 1GHFL 4OD3H 3VH8A 4M61B 1NGQL 3KLHC 1YNLL 4R7NB 3X13A 2PXYB 2NW3B 4YHLH 1JYXA 4YHPA 3GMNA 1WFTA 3O8XB 4IRSD 3SDCD 1MIEH 1U8HA 2DKUA 4Y2DD 1SY6L 2Z91A 3A6CH 3BOVA 4I3RL 4KKCC 4S11A 5BRZD 3RWGB 3ARBB 3OXSA 1ZVYA 5DJCB 1RSFA 1FNEA 2R29L 2VQ1A 3X14A 1I9JH 1TVHB 1EEYB 2KPNA 1YEEL 3GJEB 4EDXB 1FL6A 43CAA 3S37L 4PJ8A 1MFEH 5D6CB 4ZD3L 1GPOH 3LD8B 1WIPA 4U6XB 1FL5B 2HT3C 2APVA 2OMNA 4QXGH 3VA2C 1UENA 3AXLB 2O5YL 3QISA 5D1ZB 5I74B 4LDLB 4PRBA 2CDEB 2EDEA 3FRPA 1LDSA 1HHHA 2DTML 3T3PF 1LO5A 3KJ4B 3B43A 3VXME 1GOFA 2X4PB 1G9NL 1VEPA 4HKBB 2DMCA 4HXAL 3LQZA 3DTXA 5ID1B 5KSBF 4DKEH 5DZLA 5C6WH 3UO1L 2VRAA 1CL7I 3WFDH 1OTSC 3O4LB 2VAAA 4GKZA 1D7FA 4XAWH 2BP3A 2DQJL 2AQ3A 3DGCR 3QH3A 3R1GH 4DZ8B 4NT6A 3U2SA 5L8JB 3NCYP 2A74A 1S7SB 5INDA 1GGIL 3CD4A 1DLFH 4W6WB 2ICWJ 2UY7A 4P2OD 3P0YL 3GMRA 4JFQB 3T77A 1T1XB 1CR9L 5C09B 3B9KA 3LQAL 1BQHA 3NFPB 2WWMD 1K85A 5DJZA 1P7QD 4A2MA 3QEUB 5C0RL 1WBZA 5J9PA 3GI8H 3BZEA 2YKLL 2H32B 5IHZB 4U1JB 5J8OA 2N56A 2NTFA 4F15C 3DVNA 4ZO9A 4BUHA 5I8CA 3QQ4A 3GSWB 5GGVH 1RZJL 5KW9H 4LOUD 4MXVF 1UEYA 3KPLA 2J6EH 2A9MH 4NN7C 1OAXL 1HKFA 5I6XC 3QUZA 4CRPA 5KTEH 3TV3L 1I1YB 5EUKA 5DK3A 2NY5C 1ORSB 4YHMH 4J3XA 4WWKC 4QTHB 4A6YL 4PJIE 2ZPKH 1BF2A 4Z8FH 1JZ5A 2XWTA 1AC6A 2OR7A 3FFDB 3QXAB 1T0NA 5J06A 4XPBH 4ZOEA 3I50H 1MCIA 3REWB 3DX6B 1HOCB 1EFQA 3OGCB 2PTVA 3SGJC 2XN9B 4NJ9H 3G6DL 1JNHB 1H8NA 3MRQA 3BRDA 2BDNH 3WFCL 2DN7A 3S36H 3Q1SL 2EIDA 2XZQL 3G5XA 3SKMA 1MWAA 5B4MD 5GSVA 4Z7VA 4QNPE 1EEUA 4PJ8D 2P5WE 3MLRH 4QHMA 3PWJB 2DYPA 3P4MB 4KAQH 1YECL 2F74A 1JFQH 3PHOA 4HAFA 4HSQA 4DGYH 4JHAL 2VLJB 2CD0A 2D4DA 3MLXH 3R8BB 3MQIA 3VFMB 3EUUA 5DK2B 2NZ9D 2OL3H 4JO1H 1SJEA 1A02N 1JGUL 4HPOL 2EIEA 4XBGB 3WD5L 3DGGB 3ZKXB 2XFXB 2ZG1A 5K59F 3MNWA 5ICZA 1GSMA 2P24A 4YLQT 1FVDA 3LHPL 1MCOL 2R9HC 1NANI 2B2XH 4JZJA 3N1QC 4CMHB 1N7MH 5ITFA 3LS5L 5M94B 5ESAA 2Q6WB 3EO1A 2DIAA 4OV5B 2EZ0D 3HAEH 4HXBH 4AT6B 4CN6A 3MGAA 4W70A 3AS1A 4FQJH 1UFUA 4OLXL 5EU5B 5EUOA 5CKGA 4PJAB 1ZHBA 4M62H 3QUYC 1HK6A 3LN5A 1PYWB 4JVUA 1LWRA 5BW7C 3EYQD 4J2XA 4I18C 1G9MH 1NAKH 1TNMA 2Y07H 3VXOB 5E8PA 4K8RH 3OG6B 4QKXB 3HMWL 4NO0B 5ALBH 1KB9K 3BYYA 5D6DC 2XZZA 1OWRM 3O4LE 12E8H 4NZDA 5C0CB 1W0YT 2Y7QB 1JF1A 3O3EA 3MBEB 4KRMB 3BP6A 4ETYA 3QUZD 1VADB 1H5BA 1QLFA 4R9HA 3U1SH 5M95B 3B83A 4FTVA 3TH2T 5I8EB 3KLDA 1DUYB 4YAQB 2NXYB 1LO2H 5TH2B 5FO8A 1Q72H 3DVGB 4HKZB 5C09E 1U8OB 5B39G 2XQYG 2C9AA 3CZFB 1JPSH 2FB4H 4P5TB 2DAVA 2VXSL 1X5JA 4XZUA 2IANA 5AZEH 1UH3A 5DD5L 1CFVH 4XVSL 3IVKA 3UCRA 4PJXB 4MDIB 4K3JL 4KJPC 4WU7A 5A1AA 1K9TA 2CMRL 1HHJA 3O4OC 2PF6A 3B2VH 5I1EL 3RGHA 2X4TA 3N9GL 2IBGA 1NL0L 4JM4H 2BSTB 5D7LA 1JHTB 3LEVL 2DYPD 2AV1B 1KLGA 2ZOLA 4IRJB 1T1WA 3CFIC 4HKXB 5FDWA 1CVRA 5T1LB 3NGBC 2IPUK 4H26B 4KJQC 5T3XL 3IDMA 3L95B 3AM8C 1HSAB 5K9QI 3CC5B 1YDPB 4WW2B 4ZOAA 1KBGL 2G9HB 3Q3GA 2ZOKB 4WV1B 1KN2H 3DX7A 4I5BB 1VCAA 3E8UL 3ZYIA 3UTTD 1B3JA 1ZT1A 4X4MA 2KH2B 1WBXA 3WSQL 2XN9E 3MV8D 5FA4B 4F9LA 2R56H 1BZQK 1I7RB 2MHAA 1WWWX 5JXAL 4N8VA 2AABH 3NCYS 4KI5F 5BV7L 4L8DA 4G9FA 4KK8D 4ZFZB 1OY3B 1IGIH 2C1PA 1U8PB 2QADC 3EOTH 1F3DH 4N0FB 3O0RL 2EXYC 2P48B 3BPNC 4PLJC 3AB0B 5MHSD 2VLJE 5IMMB 1UACH 5GS0C 3CLEH 4Z76A 2A6IA 4KMLB 1C08B 3GB7B 3RBSA 2VOTA 4CVWA 4JFPB 4FNLH 3DV4A 4L4VA 3BZFB 3IGAA 2XPGB 4MD5A 1F13A 5FK9B 3U83A 1I1FA 3ZKSD 4HUUB 4XVTH 3PJSB 1JYVA 1UM5H 3BHBB 2YD2A 5JLZB 3WUWG 1MCFA 3WIHL 1EA9C 2CIKB 4ODSH 2VDOL 3H6JA 5HVHB 4JY4A 3REVA 4KH2A 4FTVD 2A6KB 3ARPA 3C2SA 2G75A 4K2UL 5BS0D 4OF5A 5EN2A 1KCRH 2P8PA 3QEQA 3HI6H 3ZYOA 1FVEA 5JW4N 3X3FH 1J0IA 1OSZA 3GSXB 3BFOA 4UNTA 4XCEB 5C0BB 4ZYKA 4PJAE 1N8ZA 2JB5L 4K55A 3EJZD 4X8JB 1JGDA 3F58L 3VGBA 1S5HB 3PP4L 3SKUD 2ITDA 2IAND 3VFGH 1DR9A 2AVGA 3L7FB 5F88B 4QRSA 4KKLD 5KN5A 5FFLA 1YC7A 2QHRH 3GKWL 1W72L 3RVVC 1CN4A 3RY6C 4PJGE 5C0CE 4NOFA 2UZYB 1MREH 4WFED 3KPOB 4LNVA 3AAZB 3QULB 1Y6MR 5D7LD 5F7EL 1QSFA 4M6ML 3B9VA 5CJQH 2W65A 4OFYA 3P9LB 4NHCH 4XPGH 1FE8H 3LDBB 1O7SA 4D9QE 3VWJB 2Q8BH 3H2WA 3V4PL 3EOBB 2R2HA 2AJSL 5F6IB 5CEYB 2W9EL 4ZS7H 3MRBB 5TGBB 3ULUC 5DD3H 4QYOB 3SO3B 5D1XC 3CLFL 4U05A 4R7DA 2VL5B 1R3LA 3HNSH 1K4CB 4U6YB 4PJXE 4LAQL 4B41A 3OAUL 3AGVA 5GIRA 3TVMC 5B39B 3QCVH 4QOKB 1IZKA 3MREA 5I75B 2FL5B 4QRRE 3B6SB 3MYJA 4UDTB 4U1IB 5I9QC 1HCVA 4IDJH 2CSPA 3LKSB 3RIAF 4L3CA 1DQLH 2OK0L 2H9GA 4R26H 1MELA 4KUCF 5TPWH 1JBJA 1F11A 3MLUH 4QWWC 2VQUA 3QPXH 5EOTB 3PQYB 3LY6A 2LTQC 5LGHL 1F3JB 3P30L 4HDIB 5DD6B 5IQ9B 1F00I 2NY2C 3GZKA 4XWOD 2EEBA 4BQ6A 3FFCD 3UYOD 2UV3A 3C09C 4ZTOL 3LOWA 3GEWB 5HBBA 4AIZA 3HC0A 4ZQKA 1NKOA 1WWAX 4L4VD 1YA5A 5FGCB 5IFJB 4M3KB 2F19H 4I1NB 2D03H 1INDL 4I0PA 3QDAA 1XR8B 4PLKD 5DRXA 1AQDA 4PJHA 1S9WB 1XCTA 3RZCC 3WCYA 4W4OA 5AWNH 5HYSA 4U7KA 1QRNB 5AUMA 4P3WA 2D7TH 3HPJA 4Q0XH 4BQCA 3QEQD 1CF8H 2X1QA 4LDEB 5TF0A 5IFHL 2H26B 1NC2B 4J8RB 4Y4KC 4JQXC 2MQ3A 4XVJH 2YPVL 4LL9A 1FFRA 1OSPL 1I4FA 1IEBB 3C87A 3C5SB 1DQJB 1MF2L 4AIOA 4M9OA 4PJIA 1F42A 1VENA 5IP4A 2N1KA 5I16A 5B38A 3QO0B 1I8MB 1S7RA 1IKFH 3V5DB 1I3RA 2MCPL 3A6BH 4U1GB 5FYJL 1PD6A 2H41A 5GZOD 3W11C 5DDHA 3RL2A 1IGJB 4EUPH 1XR9B 4O5LL 1IGFL 4DFIA 1R3HA 35C8H 4JRXA 4OFYD 1EXUB 3V0WH 4OLUH 4ALAH 1G7PB 2AJXH 3O9WC 5D7JA 5I8KH 3FB7B 2DQEL 2P5WA 1SMOA 2XZAH 1WISA 1INQB 1H8SA 4OGAC 4U0RC 4YPGA 5JQHC 1JN6B 2DQDL 3GBML 4J3SA 3OKLB 4M61A 2DM2A 4POUB 4OGYL 4R7NA 2PXYA 2NW3A 3VMPA 3ZTNL 2VN4A 3O8XA 1Q8MA 2ID5A 5JZ7C 4UV4H 3S5LG 4LKCB 5GJSH 3RWGA 3U9UB 3HNVL 2E6QA 3LIZH 4OCXL 1K3ZA 2XTJB 3ARBA 1P9MC 1QFUH 5DJCA 3L5IA 4DVRL 1XGRA 2LVCA 2A38A 2X1PA 1BEYL 4XC3L 2E27H 5TQ2L 1TVHA 4GXVL 3IFNH 1EEYA 5T1DL 2GJ6B 3STZB 5BO1L 4ZG1A 4RMWA 2HLFC 1DZBA 1OTTD 5D6CA 3N50A 1FL5A 1X5AA 1ED3B 1II4E 1YY8B 3PP3H 2VZTA 2VDLH 1B0GB 4RX4A 5DYOB 2R0KL 5D1ZA 3MPCA 1CS6A 4KXZI 2CDEA 5DHXB 4DGVH 1J0HA 1IGYB 2J3SA 4QOKE 4E41B 3ZE1F 4OD2B 3TPKA 2DJSA 4MXWH 4Y5YB 2X4PA 1MSPA 5IEHB 5CAYB 5ID1A 2DF3A 4UILH 2GI7A 1RZKC 4JLRB 1KPVB 4JHWL 1G1YA 4UNUA 3BE1L 5I19H 1MLBB 3O4LA 2D2OA 5CJXC 5DEZA 1FIEA 2WBJB 3GO1H 2OL3B 3P40A 2BVOB 3FHAA 1L9NA 3SGDI 3C08H 4L5FL 2WANA 4MCYA 5L6YL 4DZ8A 2OBGA 3QCUH 4NOBA 3PQYE 5CGYC 1S7SA 3NZHL 5KSUB 1DQML 5L2KE 5ESQB 4F57H 4P2CG 4FOMA 1T1XA 3FN0H 1U41A 5C09A 1LVEA 4YWGH 1OP9A 3WN5B 3NFPA 1X5ZA 3QB7C 3HAEB 4PJCF 5I1JH 3RVTD 4K71B 4GG6F 3QEUA 1MCLA 2DQHH 5IHZA 3S88L 3PDOA 2I60L 1NFDB 1QRNE 4FQLL 5ADOL 1C5DB 3QDJB 4R4FL 3GSWA 4NM8L 2HT2D 2EDFA 2X89A 4TTGA 4ZUTB 1UM6L 4E42B 2P5WD 5CHNB 5JA9A 1I1YA 2BVTA 3T65B 1B9ZA 2FIKB 1ORSA 4NQVA 1TQCB 5SX5K 4QTHA 4LLQA 5DWUL 5GGRB 2Z35A 3SDXF 5C0GB 3MJ6A 3RWEB 3C6SB 2D0GA 2Z8RA 2EXWC 1XGYH 3FFDA 3LRHA 3VD9A 3QXAA 2PXYD 1Z9LA 4IRZH 3TJHC 3E6HB 3O8XD 5ERWA 4TVPH 3REWA 3DX6A 1D5IH 4UV7L 1JF6A 1HOCA 5C71A 5MERB 1OT1A 3OGCA 3ARBD 2XN9A 3T2QA 3PXJA 3D6GA 1JNHA 2R0ZL 2ZCKH 4EQ2A 4LSVL 1F6FB 4NJAH 5DMYA 2FJFB 2IPTH 1CE6B 4O2EB 1KXVC 4KK5D 5CZKA 4RFNB 1CL7H 5I1DB 3PWJA 3P4MA 3SN6N 5IROC 4JB9H 2NZIA 1OPGL 5T3ZL 4YXLH 4Q74A 4JFDE 3FOLB 1WUNT 5D1ZD 5DJAB 3QAZB 1N26A 1ZLSL 2HTLC 1CI5A 5MEPA 5IESH 2VH5L 4F2MB 3GHEL 3TO4D 4JJ5B 5DK2A 1LK2B 3V52H 3QHZL 2QSTA 3F62A 2QQKH 3LKRB 1XCQA 2XTJE 2R2EB 4XBGA 4OUUB 4K3HA 3DGGA 4L3EB 5BJTA 2CUMA 2XFXA 1Z9MA 3O4LD 3QG7L 4JFEB 4OF7A 5C08B 2BHZA 3MC0A 4WEBH 5IQ7H 4U6VL 4GXUM 5GGTH 3RGVC 1F4XL 2CLZA 5FV2A 2Q6WA 5D2NB 4AK1A 1G7MA 4XWGH 4OV5A 3FO2B 5HVGB 4AT6A 4LAJH 2IH3A 3Q5YA 5IVZB 4P99A 5C09D 3EYSH 3GRWL 5EU5A 4PJAA 5JMRA 4E41E 2ZKHH 1PYWA 3FRUB 2D31B 4PV9B 1N3NB 4EVNB 5EPMB 4C56B 3RWFB 2WV3A 2X4QB 4YFDB 4NO0A 1AO7B 1VB9A 3SE3C 2J1KA 2WW8A 5C0CA 1LO4H 2Y7QA 2X89D 1ERNA 5DD1H 3MBEA 4H0HB 4YHNB 1CE1H 3BPOB 3PG2A 3FO0H 4K3GA 4WI4A 3SQOH 3EOAB 1VADA 2YXFA 4NNXB 4APQB 3X3GL 5I8EA 2K7PA 1YEJH 1DUYA 2HTKC 4YAQA 2E3VA 3LSOB 1QP1A 2R0LL 3L6FB 1AXTL 5CZXC 5TH2A 5IHBA 3DVGA 4HKZA 1JMZA 1U8OA 4M1CC 1KEGL 4YFLI 3CZFA 3HRZA 3RHWK 2APFA 1IAII 4P5TA 4KRPB 1IAMA 1YC8A 2JELH 5IB5A 3HZVB 5FGBA 1KC5L 3T2OA 1J05B 1QKZH 2FATL 1NAMH 4MDIA 1NFDE 2AXFB 2XN9D 2YMXH 1L7TL 1YY9D 3MROB 1NSNH 4F58L 3GM0A 4ZXBA 5KSAC 5E2UL 1UA6L 5HI3C 2GUOB 4F37K 2BSTA 5F7WC 1JHTA 3VFWA 3QUXC 3TWCH 2VWEC 2AV1A 4U1KB 4IRJA 2QJDA 1CVSC 1REIA 1YUHB 1OAUH 4HKXA 4DW2H 1DEDA 1NANH 1E4KC 4X5LA 5T1LA 2VLJD 4H26A 1UWXH 3RVWC 1OGTA 3K2UL 3L95A 5CJBA 3LKPA 2QQNH 4NFDA 1HH6A 3NACH 1HSAA 3QIWC 1MEXH 3CC5A 4QXTB 1YDPA 4WW2A 5HTSA 2V5MA 4JO2H 2ZOKA 2AXJA 1R6VA 4KUZH 3E6FB 1HILB 2ZSVB 4I5BA 1H3XA 3ULUH 4PJBE 1U2HA 4G8GB 2FIRT 4YX2H 1MIMH 5E2TH 5FA4A 5DI8B 4JZOB 3DRQB 4JAMB 1DBMH 1RFDH 3P4NB 4H5SB 1U91B 2AI0H 4OLZH 2R4SL 1P7KA 3VGEA 5D96C 1J87A 1FORH 5KANI 4ZFZA 5AZ2H 4OZIB 1U8PA 4N0FA 2NYYD 3MRHA 3B5TA 5GGQL 2BVYA 4Y88A 3BSZH 1CU4H 3SKJH 3I3EA 3WLBB 1C08A 1PSKL 4JFPA 4XI5D 1EO8L 2SEBB 3BZFA 2EYSB 2XPGA 5FUZH 4LRNL 4NO0D 2AEIT 2Y36H 3G08A 4GAJL 4ZUUB 3ZDXE 3O6KL 4HUUA 4L3EE 3JSSA 4DEPC 4JFEE 3BD5A 3BHBA 2X44D 3R06B 5C08E 4OD1L 5C0CD 2DQCL 1U8LB 4Y5XC 5F72S 3MBED 1NLDH 3ARDB 1BZ9A 5KJRL 3A0OA 3FT2B 4OZHF 3D85D 2EYTB 2AK4B 3CDYA 4HBCH 5D2NE 4K23H 2A6KA 2A1WL 1ZA3B 3QZWG 5D72H 3VXRA 4S1DD 5E94B 4EIZC 5GRJL 4D9QD 2NXYD 4MJ6A 1IM3B 3ARVA 5DVNA 2LU7A 3GSXA 4XCEA 5C0BA 1GXEA 1CG9A 5E5UB 3BEVB 5GSRB 1EERB 4X8JA 5C2BL 4ZTPL 5HY9A 1ZOXA 3VW3L 3SOBL 4PP2B 1S5HA 4UQ3B 4QHLB 1YEIL 3L7FA 5F88A 5JR1L 2EH8L 3KLAB 4Q58C 1VFMA 1CLYH 1AO7E 2X40A 3IKKA 1I9RL 3O3UN 4LSTH 4YBLC 4EXPX 4QRRD 4TULH 1A6WL 2QR0A 5SWZB 4M6NL 4P4KB 2CRZA 3VGAB 1T1ZB 3KPOA 3CDCA 6FABH 3WJJA 3EIFA 3AAZA 3QULA 4HPYL 1AE6L 1U0QA 4XX1G 2H1PL 5GHWL 2GTZB 3P9LA 4IRJD 1UZ8B 1XH3B 5E8DH 3KR3L 2ZUQB 5KSBB 2FX8H 4EUPB 2EH7H 3CFCL 5T1LD 2HWZL 3VWJA 4CNIB 3EOBA 3MJ9H 5CJ5A 1BBDH 4XBEL 4UBDD 3HC3H 3MA9H 3BD3A 5CEYA 3MRBA 4TRPH 5TGBA 4UIKL 4ZFGL 4NQCB 2H2SD 2UWEF 1WK0A 3KYKH 3RAJL 4QYOA 5FHBH 2V2XB 3HZYB 2VL5A 4U6YA 1AGFB 2R8SH 5B39A 4YFLF 4QOKA 4DKFL 4WWKB 3TBYB 2J4WL 1CZ8L 2FL5A 2KQNA 2NLJB 3B6SA 4UDTA 4U1IA 4JPVH 4YDKL 2NY5L 5J1AB 3LKSA 1A14H 1E4XL 3CXHJ 3VI4E 4HK3N 1I7ZB 1MFBH 3M07A 4NKIL 3NCEB 5IVNA 3CH8A 1F58H 3SBWC 5EOTA 1MUJB 2FH8A 3FB5B 3PQYA 1H3PH 1F3JA 1OF2B 4HDIA 5DD6A 5IQ9A 3ULVC 1G7IB 3Q5OA 2IWGA 4JGJA 1WFOA 4NKQB 5JW3L 2BSRB 5EZOL 4LPCA 1WICA 3WFBL 5IFJA 4G8GE 1KB5L 3TNNA 3ZZ1A 1XR8A 4N9OB 1NGXB 5L2JB 2W91A 3IS0X 3JVGC 2B1HH 3T4AB 3OAYH 4P5KB 1S9WA 4NC2B 3MR9B 1WZ1L 3PUCA 1MLCB 5FYLL 5GPRA 5I1HL 3VGFA 1FFNB 5AG8A 1RVFL 3IB4A 5JIIA 3C6LC 4YC2C 3BUYB 3QIUA 2H26A 1NC2A 4J8RA 3MLSL 4M7KH 1J1OL 4BZ2H 4M9PA 1ZK9A 3C5SA 1DQJA 3RWHB 5E2WL 2YPLB 5DMIL 1D5XB 2L7JA 1WBYB 1EHAA 3QO0A 1I8MA 3MRJB 2FD6H 4DJMA 3V5DA 4PJ9B 1CTNA 5F9WC 4PREB 4NRXB 3DVIA 5DLML 4RZCB 1QHOA 1IGJA 1XR9A 3G04B 3CU1A 4HWNA 4Q6IC 4WGVB 1INEL 2AK4E 5F9OL 4GMSH 4I18B 3UTOA 1MCPL 3FB7A 5T5NG 4F7CB 3VWJD 3ARRA 4F8TA 2EC8A 3QEGL 5IMKB 1INQA 3S6CA 5IJKC 1J11A 2NY4C 1HZHH 3RX8A 4HIIB 1JN6A 1I3GH 4LCWE 3QZWB 2FX7L 1S7UB 2J6EA 4U1NB 4CN4A 3OKLA 5JPNB 4LP4A 1WVZA 4QOKD 5DUML 3TA3B 4OAWB 1RURH 1QFWL 4RFOL 3BZDA 4KKNA 4OZGB 1NMBH 5SWZE 3UJIH 1NCDH 4JGMA 1QOKA 4LKCA 3U9UA 3T3PE 4QXUH 3P0VH 1C7SA 1WQVT 3FONB 4MMZC 3WEXB 1H3TA 5KVDL 5DR5H 2HP4A 1BBJB 4XP4L 4PRAB 3BVNB 4HCRA 4CJ0A 3WYRA 5J89A 2FYYB 5KSBE 3OBAA 4HGKC 4X4XB 2GJJA 3STZA 2GJ6A 4ODXB 1QYGL 3JWOL 1S7QA 3PQYD 4BZ1H 2VLKB 5GGSB 4LMQI 3IKCB 5L2KD 1ED3A 1YY8A 4NQCE 1EGJH 1B0GA 3OB0H 3IRPX 5DYOA 4Y1AB 4PJ7B 3C2AL 4L8BB 4MJ2A 1RUPH 4ENEC 1IGYA 4E41A 4OD2A 4Y5YA 2YWYA 4P9HH 4AH2B 5DF0A 5IEHA 1JRHL 4KMTH 1NFIB 1KPVA 1NCWL 1QRND 5HDOA 3C5ZB 4UTBL 5BOPA 2WBJA 4OIBA 3NBNA 2OL3A 4R0LB 4X83A 5CUSL 2BVOA 1SEBB 4H20L 4BJLA 2Y6SD 1NC2D 4LHUG 2NW2B 4CVUA 4JFZH 1FDLL 1A6UL 2B4CH 4I2XA 4MXQD 4L8CB 3BKML 5KSUA 4BK5A 5LGKA 4MXVE 1ZGLP 5ESQA 3QCTH 2J8UF 4J4PC 4LGPB 5LQBH 1JNJA 4M1GH 4Y4FA 3VDCA 1KIRB 2VLRB 3WN5A 3HAEA 4KHTL 2VXUL 1CFTB 4OSUL 2QADB 4P59L 1KACB 5SWQA 3MV7A 1RUML 2F5AH 4K9EC 3V6BR 4HUNB 4FRWA 5EA0L 3BMVA 1NLBL 4QF1B 4Q9RH 1C5DA 5KVEL 3QDJA 1BECA 3BGFB 1U2CA 3ES6B 3NAAH 1VFOA 3AMLA 5CWSB 3RPKA 4ZUTA 4E42A 5GS0L 5CHNA 3F5WB 2G60H 4X7TB 3LKQB 2R4RH 4HUXA 3T65A 2FIKA 4LU5L 4DTGH 1FGVH 3PGDB 2NY3C 2FEDD 5GGRA 1JPFB 5C0GA 4GBXB 4JFDD 2YPLE 3RWEA 3C6SA 4HQQL 3SE9L 4X4YB 4JPWH 1CK0H 3MZGB 3E6HA 3O6ML 1NCCL 1JV5B 2V9QA 5FHAH 3KJ6H 1A7QL 5MERA 3BKJL 4DGIL 3B2UD 2HFEB 4KXZH 2XTJD 3MRKB 3WBDA 1S5IL 4MNGA 5JHLL 15C8L 3FO1B 2FJFA 1V3KA 3OMZA 2F9BT 3S3JA 1CE6A 1CXIA 4O2EA 5EO1B 5I1DA 1QLEL 5LBSL 3RTQC 1F4YH 5HDBF 3ILQC 3VXQA 4DN4L 2AEPH 5LWYH 3SGDH 2ARWA 2FX9H 4G3YH 3FOLA 5DJAA 3BDYL 3DV6B 4F2MA 5HI5D 3H42H 5J3HD 4JJ5A 2F5BL 4E41D 1F6AA 4K94C 2XG5A 3C9NB 3ECBA 4MA7L 4FP8L 4OM1L 2FBOJ 4KPHH 1RUQL 2ZCLH 4OZGE 1MFCH 4Q9CA 4NRYB 1UCBH 5D2LF 4TSBH 5E70A 3SPVB 1J1XH 3LKRA 2IAMC 1RULH 4L4TE 2R2EA 3EFFA 4RDQF 4OUUA 4L3EA 3OKEB 4QHNB 1HI6B 4JFEA 3WHE1 3S35H 5C08A 1IQDB 4TVPE 1O5DT 1TDQA 1HINH 2P7TA 5D1XB 2O5XL 5CS7A 1FGNH 3V0AC 4X80L 2VLKE 4FXLA 3HPLB 3UYRH 4JDTH 3FO2A 3K46A 4LVHB 4MZ2A 4JHBA 5IVZA 1EV2E 3DPBA 4PJ7E 2JJTA 3GMQB 4JKWA 1CGTA 3P77B 2ILLA 2A9NL 3H7BB 4HS8H 8CGTA 3FRUA 3S4SB 2D31A 3K81A 4X6DE 2V6HA 4N5EC 4UOJA 4CADB 5EPMA 4EVNA 1P6FA 4C56A 3RWFA 2X4QA 4HH8A 4Z7WF 3P11H 4XCNB 1AO7A 4XNXH 2AJUL 2WP3T 4XNUL 3MODL 3QDJD 2R69L 3TJEL 2Y23A 1BWWA 3CGTA 4GOSA 2UVFA 4D9LH 4K8RD 5I1IL 4YHNA 3X12B 3KLSA 2HJLB 1IEAB 1FQ9C 2BFVH 3EOAA 4P23D 4NNXA 4X0KB 4APQA 4DQOH 1BIHA 1SBSH 3LSOA 3GI9H 3L6FA 1TZHB 1YEKL 2VDPH 5CILL 4RGMC 2VLRE 1AQKL 4KK9D 2WNGA 1GIGL 3HG1A 5BOZG 1H3GA 4N1EA 3HZVA 3N85L 4HS3B 1J05A 1X5GA 1ZLUH 2A83A 3EHBC 3EDJA 3MROA 1IBGH 3MUZ1 3IU4H 3QDGE 3WNKA 4NRZB 3GSNA 2AGJH 5J57B 1OW0A 3MBXL 1PKQA 2Y9RT 4JG0L 4P2YA 5DJXB 4XAKE 1JVKA 1IC7H 4V2BA 4U1KA 1ITCA 1YUHA 5ITBH 2V17L 2CR3A 3PP3K 4KI5E 3IAGC 5IB2B 5LVEA 1SJVA 1VFBB 1GCFA 4QXTA 1MRCH 3WKML 3O9WB 5GRWA 4IIQB 4PD4K 1BGXL 5DXWA 3E6FA 3LKNB 1HILA 4Z7VF 4G8GA 3T2PA 4RGOL 4U0RB 4L3ED 1DBAL 1ZAGA 2XZCL 1VGEH 4WFGE 5DI8A 4JFED 5F44A 3VXSB 1ZXQA 2XV6B 5C08D 5T5FH 1JGVH 4JZOA 3DRQA 1QVOB 3SDAC 4OBSA 3PDGA 3P4NA 4H5SA 1U91A 4N5UA 3N1GC 3P9MB 3FMGL 2V5SA 1WWBX 4OM0L 4R3SB 1MCJA 3VFOB 3CSPA 4RFEB 4OZIA 4TSAH 4PIRF 4OCSL 4L9DA 4YDIH 1Q1JH 3WXWH 1OAYL 3ZE2F 3ULVH 2V5YA 3STLB 1RZGB 3QIBD 4OCWH 3GGWA 3WLBA 5FA3B 2D3VA 1B4JH 4P3CH 2JF1A 2SEBA 3I2CH 4YBQD 5CBEB 4EXKA 1H3UA 3C5JB 3RJQB 4ZUUA 4W4NA 3G5ZB 1AO7D 5FM4A 2XWJB 2YSSB 1T2QL 1QR1B 1IAIH 4XGZB 3R06A 3V95A 4AG4L 1VPOH 1U8LA 2J88L 4OB5H 3ULUE 4WCYL 1VEOA 3KPPB 1UCTA 3ARDA 3DUHA 4G6KH 4KY1L 3FT2A 4P48A 2RFXB 2EYTA 2AK4A 1AFVL 3O6FC 3O3AA 1MHHB 2JJVA 1ZA3A 4NO2B 4RGNC 2BY0A 3H3PL 1VACB 2ATPA 2VDQH 5E94A 1J8HB 1IM3A 1AR1D 4GRMB 3HMXH 3VI3F 4G6AC 3STBA 1E0OB 5DJ8B 2MPAH 3BEVA 5GSRA 5FYKL 4KRPD 1RZIB 1LQSR 1RZKL 4PP2A 3HE7C 1P2CB 4UQ3A 1Z5LB 4QHLA 4LFHG 7FABL 3KLAA 3LB6C 3FTGB 5I8OH 5JQ6H 4NP4L 3MRDB 3FQRB 4P9MH 2ZJSL 5SWZA 4P4KA 5FM8A 3QG6B 1T1ZA 1QFPA 4PS4L 1JIBA 2VXTL 2GTZA 1D3CA 5IT2H 3T2NL 1UZ8A 1XH3A 5IIEB 4M93C 2EDBA 2W60B 5KSBA 1IC4L 4LQFL 4MCZB 1FZJB 4EUPA 4CNIA 2OI9C 2VDKH 5IWLC 4OFIA 2RB8A 5SWSE 2YBRB 1NCBL 3WV0A 3WS6A 5L8LB 1KFAL 4PGDA 5E8NB 4GKSB 3GBNH 4NQCA 4R8WL 1VKXB 1BJ1H 2PO6A 3VRJA 2V2XA 3HZYA 4G8GD 1AGFA 1EHLL 4XMPH 2HRPH 1NQBA 1IGCL 3RUGF 3TBYA 5HVFB 4MA1B 4F9PA 2NLJA 4UQ2B 5FKPB 3KLHD 1BM3L 1RI8A 4PJCB 4MD0B 1GZPA 4GG6B 1I7ZA 4WY7H 2EYRB 2ICES 3F6IA 4PJEE 3VRIB 4KKCD 2DMKA 2CDGB 4JO3L 3FB5A 5DC9B 4IJ3C 3BRGC 3BGMB 1OF2A 3BAEL 1G7IA 2VE6B 4ZFOB 1RHHB 2CIIA 3G5YB 2BSRA 4JPIB 3DRTB 2XY2A 3MV9B 1FYHB 1R5VB 4OZFG 1JZ4A 3S37X 1NGXA 3VXSE 5L2JA 3SDXB 5GS2H 3P73B 3T4AA 4M5ZH 4P5KA 1UJ3B 4XHQA 5ID0A 1Q0XH 2DDQL 3MR9A 3KYOB 1MLCA 4HF5H 1RUKH 2AK4D 2HN7B 1DBJH 1FFNA 4I77L 4BFIB 2E7LC 5C6TH 2ADIB 3BUYA 5AD0B 4XMKH 3SGKC 1MRDH 1ACYH 2MCG1 4PRHA 5K93A 3CPLB 4LCWD 1LGVA 3RWHA 1CLZH 2YPLA 5C8JA 3HLAB 1D5XA 1FIGH 5A2KH 4RRPG 1WBYA 3JTTB 1MCQA 4XC1H 1MOEA 1UKQA 3MRJA 4O00A 5EWIL 1CFNB 4FFYH 4PJ9A 2P47B 2EE6A 4PREA 1NBZB 5GGVL 2WAHA 4LIQL 4NRXA 1BVLB 5SWZD 4RZCA 2CH8A 2DL2A 4QRQB 3OQ3B 5E24E 4ISVB 2ORBH 4FMKA 3EGSB 1NUDA 1U3HC 3BZ4B 4WWID 4PRPE 4CAGA 5CJOL 1GGTA 4YHML 2P8MB 1F8TH 4OCRH 1KF9B 1WFNA 3BO8B 3KPQB 3INUL 2G5RA 4F7CA 5IOPB 1MCEA 1UWXK 2BRRH 3SDDC 2YR3A 5IMKA 2OR9L 4HIIA 1MNUH 2QSVA 3HKFA 3QZWA 4NQCD 1S7UA 4HCRL 2B20A 3IU3B 4P46C 5JPNA 5EOQH 4NJ9L 5IVOA 2CKBH 4ERSL 3O45B 3DROB 3TA3A 4OAWA 4H1LH 4WWKD 5D8JL 3S36L 1XF5B 1G6VK 5B8CC 2CPCA 5FF6B 5E5MB 1GGBH 3ZE1E 3FONA 3WEXA 1BBJA 3UTSB 2E6PA 4PRAA 3BVNA 2FYYA 4AEIL 2RQ8A 4X4XA 3CX5J 4ESKA 1MHPL 4ODXA 2BOBB 4OI9A 4D3CL 4Z6AT 4V2CB 2VDRH 32C2B 1PZUB 5FXCH 1BQLH 1EO7A 1U9KA 1EJ6A 4LF3B 3LMJH 4Y1AA 4PJ7A 3RNKB 3MOAL 3QUXB 4L8BA 4ONFH 5I1GL 4PUBH 5F96H 1WZMA 4K94H 1F4AA 1CBVL 1NEZB 4S1SL 5D93C 1OB1B 4AH2A 4P5MB 3LV3B 5IR1B 1Q9KB 4WI2A 4ZOCA 2Y72A 4PTTB 5CSZB 4YHYC 1NFIA 5BZWB 2IADB 3C5ZA 3J8F7 3RIAK 4GG6E 2NY0B 3O2VL 3UJTL 1V3LA 6CGTA 4NIKB 1JK8B 4R0LA 4C54A 4RSVA 1KCUL 4OZ4B 1SEBA 2WUCH 4MA8L 3THMH 1T0MB 2G2RB 1DSFL 1IAIM 2NW2A 1S7XB 4L8CA 3MUJA 4O02L 2UUDH 2VQTA 4I8DA 3WFEL 2YPLD 2NCMA 1P4IH 5GGTA 3MV9E 4YUEL 3OPZL 1KIRA 2VLRA 3LH2H 4KVCL 1KN4L 1SEQL 4PJ9D 4JQVA 1CFTA 5CEZH 2G5BB 3TCXA 3FJTA 2VL4A 4LSUL 4TOYH 1T83C 3HTLX 4QF1A 3UC0H 4DAGH 1XIWC 2HJKB 3A67L 1NDGB 5IBUG 3ES6A 4X6CF 5CWSA 4UTAH 1TZGH 1KYOJ 1Q72L 1KPUB 1UWEL 3F5WA 1MFDL 4DEPB 3ZHKA 3LKQA 4TSCH 3BH9B 1S9YB 3U30B 3WHE0 3PGDA 4W81A 1A2YB 1JPFA 3L5WB 4GBXA 2D7NA 1T66D 3CXDH 3OV6A 2WIIB 4LIQE 4U6TA 2V7HB 1TTGA 4YE4H 5CZVH 1YJDH 4X4YA 3TBSB 3PF2A 1L0YA 5EZIL 3TA3D 4QRPA 5TQ0H 3DMMC 1JV5A 1MQKL 5C0EB 2QSCL 2WQRA 5JW4Q 4K7PL 2HFEA 5EBLB 2HMID 4L4TD 4GRLC 2DI9A 3MRKA 3ET9F 4L1HA 2EKSA 3U7AA 5F7MC 3TN0B 1K3IA 4TVPD 2EIBA 3FO1A 3SE4C 1Y6NR 1TJGL 5T1MB 1S8DB 4L1DA 4HWEL 5EO1A 5A2LH 3TFKC 4C58B 3PABB 2VLKD 1FBIH 3MOBL 3RY6A 1KN2L 5J12B 4KQ3H 4LKXB 4OZHB 5EU7C 4MA3A 4GKNB 3DV6A 5ANME 2YD6A 5F8QC 3M8OH 3HC4H 3CMOH 1AKJB 4EZMA 4X9IA 1Z0MA 3C9NA 2AP2A 5CD3B 3OAYK 4KJQD 2NX5E 4NRYA 3SPVA 2ENSA 2VZ3A 1IKNA 1EZVX 2FECL 4HIEB 4JPKL 4EBQL 3OKEA 4QHNA 4OT1L 1IQDA 2B1AL 4HMDA 3OHXB 4O58H 5LCVH 5FCUL 3S97C 3QQ9C 3NMEA 3DO3A 4MAYC 5CMAB 3HPLA 1CLOL 1UM4H 3IDYB 1NJ9B 1G1CA 3GMQA 3TIEB 1OARL 5I73C 3D2UB 2VLRD 2VWEE 3P77A 3H7BA 4NZUH 2QADD 3S4SA 3TH4T 3L3DA 4LCCB 2EXYD 4U0QB 4X6BB 3M1BB 4CADA 4Q2ZB 3NFNB 1I8LA 2VDNL 4HK0B 4XCNA 1WIOA 1BP3B 4MB4A 3TF7C 3U7YL 3QDGD 2UWEB 1E4WH 5KBNC 5I1KH 2GSGB 3N1MC 2KUTA 2A6DB 4OGXH 5ADPL 3UBXI 3X12A 3DYPA 4XAKD 2HJLA 1IEAA 4X0KA 1T7VA 2ADGB 3V5HB 4LRIA 3ALPA 1A7RH 5EFIB 2P8LB 4PR5B 2ERJC 4KI5D 3GSNL 1OAKL 4GBXD 1FZMB 1TZHA 3MNVB 4TPRH 3ARFB 1P84K 4FQHB 2UZIH 3C6LB 2CRYA 1ZANH 3D0VA 4HS3A 4ZODA 3QWQB 1R5IB 4H1LG 4QCIB 4FQQB 4NRZA 2HT4C 3W9EA 1D9KC 1GYAA 1IAKB 5FYJU 1ACZA 5DJXA 3EAKA 4OQTH 4XNYH 1QBMH 1DANU 5IBUB 3SEPA 5E1AB 3MACL 4ODTL 1OAZL 3ILPA 1TCRB 4XCCH 4F7EB 2XXMB 3OB0K 2XKUA 1NGYB 5IB2A 1R0AL 4WI5A 1VFBA 4PJ5B 4IIQA 3BKYH 4LCYB 3LKNA 1BJ8A 4YNYB 3EDKA 5ACZB 3MJ9A 4IM8A 1YNKL 5MP6H 3JWDH 1C7TA 2OZ4H 4PG2C 3LEYL 4K3EH 5AYQA 3VXSA 1N6QL 1NEUA 1QVOA 1BF8A 3ULUD 1OCWH 2XA8H 5D1XD 3L1OL 4GAYB 4U31A 4MJ4A 3U0WL 3U6RB 4HK3J 4M48H 3P9MA 4BFEA 4R3SA 3VFOA 1UZ6E 4PG9B 3DECA 3I9GH 1IEHA 1MVUB 1AR2A 5GRUH 4OZHE 3BESR 3K74B 3ARGC 3QRGH 1IMHC 2CGRH 1F90H 3HE6C 1EDQA 3B9EA 1RZGA 3STLA 1I7TA 3RVXC 4XVUD 2XRAH 3EFDL 1YYML 2W92A 4M1DH 5CBEA 2GITB 3C5JA 5IM7B 4NQEA 4XXCA 3G5ZA 5FO9B 5L8KB 2XWJA 2YSSA 1UWGH 1JNLH 4XGZA 3HFML 4F8QA 5BCAA 4WI9A 4LPTA 5E4EB 2GCYB 1A3RH 5DSCB 2A77H 2M26A 3QNYA 3BQUC 4RDQG 4DWHA 3KPPA 2X2YA 1JHKH 5E6IC 1TETH 3CSYB 4M6OH 1I7UB 4PJAF 1QSZA 3WL9B 3TC9A 1LDPH 1MHHA 3C8DA 1AGEB 5K9JH 5F9JA 4OI7A 4NO2A 3U4EB 1VACA 5E03A 5JXEA 1J8HA 2W0LA 4R97C 1QZ1A 1QQDB 4GRMA 3TT3H 3L5XL 4JREC 1ZV5A 2GY5A 2YK1H 1RUAL 3IF1B 5SWSD 5FO7B 5DJ8A 5HDQL 4TTDC 4KUCD 3GNMH 4PJGF 5KG9B 1RZFH 4LCUB 3I84A 5EOCH 4C57C 4FABL 1RIUL 5BVPL 1P2CA 5C0JB 1Z5LA 3UDWC 1B2WH 1Y0LB 3ULVE 2XA3A 5I30H 4LPXA 3FTGA 2FGZA 3QUML 3MRDA 2UWEE 4Y2DB 5GS1C 5DO2C 2P46B 5BRZB 3FQRA 3QG6A 5CSGA 1K5NB 3RVUC 4QRTB 4HT1H 3ZYJA 4AEHL 4ZAKC 5IBLD 5I0DA 5IIEA 4JN1L 1KIPB 2W60A 1PZ5B 4HWZB 1FZJA 3T0WA 3U7WH 1BAFH 4FQXC 1OM3L 2ZNWA 4BKLB 4PJXF 3E2HB 3LKOA 2YBRA 2X4SB 4LVOB 3W2DH 5IW6B 2ICWI 4K9EL 3O9WD 1DBKL 5E8NA 4GKSA 1VKXA 4LLDB 4YQXL 3FCTB 5GJSL 3G9VA 1NGPL 4OGAD 3BKCL 3VXSD 2DLGA 2J8UB 1DCLA 2E27L 1MRFL 4UQ2A 1DVFC 5FKPA 1N59B 4NM4H 4KKAC 4PJCA 5EULV 2CKBB 4MD0A 3LZFH 4H1LB 4GG6A 4NN5B 3RU8H 2WBKA 1HHIB 2EYRA 5BVJB 2VDMH 1ZT7B 3VFSB 3QWRA 5JZ7D 1DL7L 3VD4A 2CDGA 2KZWA 3W81A 4QTIH 5IB3B 3BGMA 1JZ8A 1I9IH 2IFFL 3NIGE 2VE6A 4ZFOA 1RHHA 5MENB 3NCFB 1OT2A 4PJ5E 4JPIA 1PGRB 3DRTA 1P4BH 1CDBA 4ZSOB 3MLYH 1J86A 1MJUL 3MV9A 5C0AA 1R5VA 4UIMB 3RTQB 4FFWC 1LK3L 3EJJX 1BX2B 3SDXA 5HYQB 3P73A 4N1HB 1EGJA 4N8CL 5JPMB 3GO1L 1UJ3A 3T8XB 4MNQB 4Y4HC 2J8HA 3AY4C 4EI5C 1UT9A 2HN7A 4PRPD 4M7LH 4BFIA 3KHQA 2ADIA 4M3JA 5AD0A 1J8HD 4RMUA 4IMKC 3VJ6A 4S1QH 3GHBL 4YO0B 2OP4H 3UTZB 3KGRA 3BP5B 3CPLA 1A6VH 3H9HB 1IQWL 1DQQB 1ADQH 3JTTA 1ZLUK 5LGJB 4XPFL 5EC2B 3QNZB 3IETB 3VWKC 1CFNA 2D9CA 3PL6B 4LSQH 2DBLH 1NBZA 3U4AA 3SKNB 1Z9OA 4Q9QH 4QRQA 4ISVA 5GGVY 5J7CC 1N4XH 3EGSA 2AK1L 4RAVA 3BZ4A 4UB0H 3OXRB 3ZYZA 3JUYA 3WIIH 3QHFL 2CDFB 2P8MA 3MMEB 3BO8A 5D2LB 3KPQA 3CJJA 5IOPA 5T1KB 2DM4A 3H3BC 2XT1B 1A7PH 1NMAH 4G6ML 5BMFL 5IKCB 2KKQA 2PTTB 3EJYC 5GISL 5D7SL 4XPHL 1TJHH 3ZHLA 1N64L 3HHRB 3IU3A 1XMWA 4HUVB 3VFPB 1IZJA 5IHLB 2X9XA 1XF5A 4HFUL 3ARYA 1AI1L 4YK4C 1EVTC 2M1KA 1J5OL 5FF6A 4MGXA 4OLWL 3TJHD 3UTSA 3MFFB 3KYMB 2DL9A 4Z7WB 2BOBA 4FQIL 3WO4B 32C2A 1DQTA 4EIGB 4LCIH 4NWTL 4HJGB 5FUCC 3U4BH 2Q7YB 1V05A 4L29B 1T3FB 2FCBA 3GMMA 4LF3A 3SDCC 4IRSC 3MV9D 3RNKA 3RHWF 5KSVB 1A4KB 1LHZA 4M7ZC 4EI6B 5I66B 1HEZB 5IVXF 3MRLB 2J8UE 3RWDB 3VA6A 4CU7A 1NEZA 1XAUA 3OKKB 2HJFB 5I1CH 1OB1A 4P5MA 3LV3A 4GUPB 5IR1A 1GHFH 1Q9KA 4PTTA 5CSZA 2HTLD 4LLUA 5BZWA 1NGQH 2IADA 1YNLH 4KZDL 1WZKA 1KJ3L 5DVLA 3RZWA 2R2CA 4GQ9L 3O81A 4U49A 4OZ4A 3WNMA 1FC1A 1T0MA 1SY6H 3VE0B 1ZSDB 3CFKB 4I3RH 2G2RA 1A3LL 1S7XA 4GLRI 5MENE 5KVFL 3SDAB 3DHMA 2KL6A 1WITA 2R29H 4KQ4L 1DQDL 1OLZA 4NCDA 4ZSOE 3RY5A 1YEEH 4GMTL 2ZG3A 5DT1H 3S37H 3NFSL 2WWKO 3L9RB 2RR3A 4G8EB 4ZD3H 2YWZA 1WTLA 1T7XA 5HYIA 2OCFD 3X11B 2EDKA 5DRNA 1VSCA 3IJYB 5DHVA 4JVWA 5M7QA 5J1SC 4MNQE 2O5YH 2APXA 3C60A 1DTUA 4DFHA 1DBBL 5GGRY 2B0SL 2CLRB 2DTMH 2YRPA 2YUZA 4HGMA 1NDGA 5L88L 1WF5A 1T5WB 3TBTA 1G9NH 2AAVA 4HXAH 4P2OC 3UO1H 4ODUB 4HV8A 3BH9A 4GG8B 2WWMC 5I71C 2FHBA 1A2YA 1RIHL 3L5WA 4HIXL 1JUFB 1ZEAL 2DQJH 4D0BB 2WIIA 2X1OA 2V7HA 5DMGC 4UT9L 1SBBA 4RIRB 3TBSA 1GGIH 3L5HA 4RGNB 2HTKD 4BSVB 3BIKB 3UTTB 5CZXD 4WDIB 3P0YH 4LOUC 3LPGA 3MV8B 4M1CD 2UYLB 5EBLA 1Q9WB 4RRPA 1CR9H 3LQAH 3EZJB 3TN0A 3CFBA 3NCMA 5CEZE 1KJ2L 1XGUA 2COQA 5C0RH 5D2LE 1F5WA 3ZMRA 1RJYB 2YKLH 4MAUL 3AU1B 3PABA 5H94B 3V0VB 1HXMB 2V5TA 2YS4A 4XB7A 1I3VA 1RZJH 4I0CC 1KXQE 4LKXA 4OZHA 2Z31A 4Z5RB 4GKNA 3QUXD 3GK8L 4YX2L 1OAXH 1UEMA 3QI9B 3TV3H 2QLVB 1LD9B 1FYTB 5CD3A 2C3WA 3RY4A 4A6YH 2HYMA 4OLZL 5B4MC 4GS7B 4HIEA 4LMQE 3ROLB 4PJ8C 4F7MB 3HI5L 5F6HJ 3OHXA 1JWMB 4Z7WE 1WJ3A 1H9VA 5I0ZA 3LRSB 3PWPB 3Q0HA 3VFNB 3IYLW 2APTA 5BS0B 3G6DH 1KCLA 3BISA 5CMAA 3WFCH 2BMKB 2EC9T 3Q1SH 2ZZUT 2XZQH 1N6UA 1X5IA 3HZKB 4TQEL 1NJ9A 4HUWB 2Y06L 4WUUB 3TIEA 4U1SB 4BK4A 2X4UB 1YECH 4ZFFB 2O5ZL 4LCCA 4X6BA 3M1BA 4HBQA 1AGBB 4Q2ZA 2ZNXA 4JJHA 4JHAH 1B6DA 3T09A 2GTWB 4HK0A 4WUKL 1TZIB 4XNZC 1RK1B 2UWEA 4YIQB 3MLZL 1JCKA 2GSGA 4JRWA 1XGPB 2EZ0C 2A6DA 3WE6B 1U8QB 4CVXB 3MLTB 3RUGB 1JGUH 4HPOH 4KVNL 5J13B 2ADGA 3B9KC 3V5HA 3WD5H 1UXWA 2AV7B 1CCZA 3ZKMD 2P8LA 4PR5A 4G8IB 4B7IA 5ILTL 2OJEB 3EYQC 3LHPH 1MCOH 1FZMA 5T33L 3K1KC 3MNVA 1NFDF 3ARFA 3LS5H 2PCPB 1H0DB 2OJZL 5L7XL 3F7PC 4XP1L 2J5LB 1NUNB 4TUKL 4IOFD 3KPTA 4PRNA 4C59B 4QRUB 1ETZB 1R5IA 5B3JF 3NABL 1A6ZB 4OLXH 2C26A 1FZKB 2CK2A 3QUZC 3QXWA 4FQQA 4J3WA 4JKPL 1IAKA 1FPTL 3ISWA 2OQJB 3HMWH 4X7FC 3GMLA 4AQ1B 1G6RL 1F4WL 5E1AA 1B6UA 1L7IL 1TCRA 4F7EA 4PJBF 5H35B 1X7QB 5HHQB 1F45A 1NGYA 3FFCB 3OJDB 5HYJB 4LGRB 2HFGL 4G80A 4WW1B 4KK6D 4ODVL 4KC3B 1AKJD 3MV01 1YN7B 4JE4B 2GSIB 4RGNE 2X70B 4PJ5A 5MI0B 4LCYA 4YNYA 5ACZA 5DFVC 3NIDF 4HLZH 5C0ND 2OSLB 2OLDA 4M8VA 4L3AA 3WXVL 5L9DL 1U3YA 1FO0H 2NY6B 2VXSH 2ZUTA 1X5LA 4GAYA 2JB6B 5DD5H 2IH1B 3NCJL 4XVSH 3D39B 1QACA 4K3JH 3F7VB 4QHKJ 4OGZA 3GIZL 4PG9A 4LK4A 2CMRH 1I8KB 2UUDK 4BA8A 5B8CB 4UZGA 1MVUA 1MJ7L 4G5ZL 4NO3A 3N9GH 2XQBL 1NL0H 3D2UD 1ITBB 3LEVH 1M4KA 2HG5B 5IBTL 2IGFL 1CD1B 1EX0A 1FYTE 2BC4B 3HUJB 3PV6B 1KCVH 2WSKA 2GITA 3MRFA 5T3XH 5BQ7B 3ULVD 1ROWA 5IF0B 5IM7A 4JZJC 5FO9A 1O7VA 5EORL 2IEPA 5FUOL 4KK8C 1KBGH 1HYRC 2GCYA 5DSCA 2V9RA 1SQ2N 5B21A 3E8UH 3CSYA 1I7UA 1NC4B 5I76B 4P3DB 3PWPE 3WL9A 3WSQH 4XMLL 5CD5C 5E6ZA 1AGEA 5D93B 3VG0L 1NBVL 3U4EA 1IT9L 4XH2B 3LCYA 5JXAH 5MEOB 1QQDA 4WUUE 4DVBB 5BV7H 2EDOA 3IF1A 1QBLL 3IFPB 5FO7A 5DFTA 4FQ1L 4X9GA 3VMOA 4LVNC 1HDMB 3C6LD 4FA8A 5KG9A 1IC5L 1G0YR 4G7YL 3MRMB 4LCUA 4LNRB 4M6AA 5D7IB 3O0RH 5C0JA 3KVQA 2YXMA 4LSRH 1Y0LA 1AGDB 3VXMB 4QHUB 5DC0A 3IXTB 1H5BC 4Y2DA 3UTQA 1WFUA 1NBYB 5BRZA 1U58B 4X6EB 1K5NA 1J8KA 3PE9A 3SKOA 1MCNA 4QRTA 4R96B 3RUGE 2HKHL 5AG9A 1KIPA 3EJZC 2BOCB 1PZ5A 4HWZA 1C8PA 3WIHH 4R4ND 4BKLA 2VDOH 1XF2B 3VCLB 3NN8B 5AAWA 1OTUD 2X4SA 4NKOB 4KKLC 5IW6A 5FKAB 4PJ5D 4JFFE 4K2UH 4UDUB 1V7ML 1S9VB 4HWBL 2A6JB 5D71L 3FCTA 4MZ3A 3I6KB 3GSUB 3ME0A 3MRGB 3OL2A 1A7OL 2JB5H 2J8UA 3U36A 1A1OB 2YA1A 3F58H 3PP4H 2YC1B 4RAHA 1N59A 2EEAA 4DUWA 2CKBA 2OX5A 1FZOB 2CKNA 4H1LA 1ZVHA 5BVJA 1ZT7A 3GKWH 1W72H 4L9LA 3VFSA 3QNXB 4AL8L 5A40E 2I9LB 3DARA 3TH3T 3IS1X 1Z0NA 2NR6C 1AHWA 4NCC2 4GRLB 5IB3A 1CD9B 5HYJE 5F7EH 4M6MH 4JR9L 4NGHL 4YDLC 4X6CB 1EO5A 4F9LC 2R23B 4ZSOA 4TUJB 1QA9B 1E28B 1S7VB 3V4PH 4UIMA 4G6JL 1NCUA 2AJSH 1BX2A 5HYQA 2V2WB 4CUCA 4RMRA 2W9EH 5JPMA 3S8WA 3T8XA 3O2DL 4JRYB 3CLFH 3D39E 4JFXB 4LAQH 3OAUH 5GS2D 1V7NL 3MXWL 4UT6L 4XP5L 4QEGA 4XWOC 3T4YB 3CFEB 3QPQD 2VZSA 3NTCH 2D7QA 2AEQL 5C3TA 2HFTA 4YO0A 3Q6FB 3UTZA 3H9SB 5DMJB 3BP5A 4PLKC 2OK0H 2EDNA 1WV7T 3H9HA 3HUJE 4KDTA 5ESVA 1JPGB 3UJJL 1D5BB 4W68A 4CDHA 5LGJA 5LGHH 3P30H 5EC2A 3QNZA 2VKWA 3PL6A 4G6FB 1IGML 4J6RL 4U3XA 4J4PD 3EOYG 1DEEB 1YEGL 4XPAL 3SKNA 2AXHA 3RNQB 2AERT 1KJMB 3V2AR 3K8LA 3RP1A 1L6XA 1INDH 3OXRA 1UKSA 2CDFA 5C70A 3MMEA 3QXTA 4K3DL 5D2LA 1RIVL 2MFNA 2VSDA 5T1KA 3CVHL 1CYGA 1RJLB 2WWKT 1MCKA 4X7SL 4UU9A 3O41B 1XFPA 5IKCA 2PTTA 4HG4J 1GZQB 5EIIB 5ENWB 5D7IE 5EC1A 2Q3AA 5IFHH 5J6GB 5GZOC 3TO4B 3L3HB 4HUVA 3VFPA 3OGOE 2YPVH 4LSSL 3F7YB 4GH7B 1OSPH 5CIPH 1BOGB 3I6GB 1MF2H 1T89A 4HLZG 2Y25A 2NXZC 2OXGA 1JRHI 3BWUC 2R1YB 5E4IA 3MFFA 5DQ9B 2MCPH 3DUSB 3KYMA 5FYJH 4H88L 4Z7WA 4M5YL 4LSDA 4O5LH 5D5MB 1IGFH 1E6OL 2YRLA 3W82A 5MEND 4OKDA 2X4OB 2FJGB 4HJGA 1N5YH 2Q7YA 4GSDL 4L29A 4AZ8A 1T3FA 1A6PA 4R2GB 2EDLA 4RWHA 5KSVA 1MAJA 2DQEH 1A4KA 2X41A 3RTQD 4EI6A 4GT7A 5I66A 1HEZA 3ZLQC 3MRLA 4NN6C 3RWDA 3LN9A 3OKKA 2HJFA 2OS7A 1K8IB 2DQDH 4GUPA 3NA4A 3GBMH 4ELMF 4MNQD 1NCAL 3VU2A 1JNNL 4L8SB 1G0DA 3V6FB 4OGYH 4H8WC 3ZTNH 4A6YB 1DUZA 1MPAH 1OP3H 1GC1L 3VE0A 1ZSDA 3CFKA 3HNVH 1R3IL 4OCXH 1KUMA 4DVRH 1CFBA 4I0PC 4X6CE 1BEYH 3SDAA 4XC3H 5TQ2H 4GXVH 5T1DH 5BO1H 4W4OC 2DQTL 4Z77B 4G8EA 1PJ9A 3PL6D 2VZVA 3X11A 1H8OA 5DMKB 5EU7E 1DFBL 4JRYE 5JOFB 2R0KH 3D48R 5TE6L 4Y89A 5CEZD 2CLRA 2EE3A 3V7MA 1T5WA 4S1RL 5T1KD 1HWGB 1A7NL 3WIFB 4ODUA 1A5FL 2FHFA 1BVZA 2Q76B 4JHWH 3BE1H 3E0GA 3H9SE 4X9BA 1VERA 2GHWB 4O2CB 3BQUB 1JUFA 2QHLA 4D0BA 5F1IB 5L6YH 3GMPB 4PGCB 3TZVB 4RIRA 3HRPA 3NZHH 1SJXA 3ULSB 4M4PA 3MSPA 2XG4A 3S34L 4BSVA 1DQMH 3BIKA 5FECB 3UTTA 3FOMB 5FYKU 4WDIA 4NZTL 5DGQA 2HT2C 5GZND 5D7JC 2ARJQ 4JREB 4D0DB 3MV8A 2UYLA 1Q9WA 3RL1B 5D1QB 4LASL 1PG7L 5IEKB 3NA9L 2BRQA 1RJYA 3EHBD 2X5PA 2V2TA 3S88H 3T0AA 2I60H 3AU1A 3WS3B 3BXNB 1MRCL 5H94A 3V0VA 4FQLH 1HXMA 5ADOH 5HD8C 4R4FH 5GRZA 4X7CC 2PXYC 5EU4B 4NM8H 4O9HL 3BDBA 4OZGF 1BZ7B 1SYVB 4JY6B 4Z5RA 5CKAA 1UM6H 4OQTA 4KZEL 4GLRH 3QI9A 3ARBC 4JDVB 4JKKA 1EMTL 1FYTA 2OTPA 2PYEB 3PWNB 5DVOA 1Q9LA 1B0RB 5DWUH 4ZNCD 2EDQA 4RA3A 3UPCA 3DX9B 3HNTL 3ZKND 3L3KB 2P44B 3ROLA 4PJGB 3V6OE 4F7MA 1FG2B 3H9ZA 4MNHB 3LD8C 3BN9D 1P6AB 1ES0B 4UV7H 1LEGB 4PJ7F 3D85B 1Q94B 2DQUL 1AJ7L 5D5ME 5I74C 3LRSA 3PWPA 5D1ZC 2OZ4A 3DBXB 3VFNA 3ZKQD 5BS0A 1FO0B 2R0ZH 4CU8A 3SDAD 2BMKA 2YN3A 3ETBF 4LSVH 4X6DF 2QL1A 3HZKA 3KJ4C 1JPST 4HUWA 3ZDZE 4WUUA 4Z7NF 4KDVA 4ZDHB 4U1SA 3JWOC 2X4UA 2LABA 3MX0A 5HHXL 1Q0YL 2CLVB 1OPGH 2IJ0C 5T3ZH 3UBXB 1AGBA 2GTWA 4M43L 1TZIA 1ZLSH 1KSRA 4QRRB 2VH5H 1RK1A 3GHEH 2IBZY 4YIQA 5D9SB 1XGPA 3QHZH 1U8QA 1XF1A 1XF4B 5FV1L 4CVXA 3MLTA 1RQ5A 3N1FC 3RUGA 3TO2A 5TF1L 2AV7A 4S0SD 5F93C 3QG7H 3F12B 4G8IA 3NPSB 3DHJA 1KEML 2JJSA 2OJEA 2JE8A 3NZ8B 4U6VH 5C0IB 5DQJB 3EO9L 1F4XH 1QEWB 3MLWL 5GRVK 1H0DA 1EEZB 4RMVA 2VISB 1RZ8B 3I02B 4RGND 4BH7B 3P9WB 1JP5A 5BV7B 4QRUA 4G6AD 2FO1A 1ETZA 1A6ZA 2C4FT 3GRWH 1FZKA 3Q2CA 3I85A 3BJ91 4YHOL 3T0EB 2OQJA 3LB6D 1JGLL 5L0QB 5I2IB 1MCDA 3G6AB 3I3DA 2EE9A 1ZS8B 1CICC 1EBPA 5C07B 1AD0B 3B8SA 5H35A 4UT7L 4KV5E 5HHQA 3S3PA 3AROA 3FFCA 3OJDA 5HYJA 4WW1A 3QI9D 3X3GH 1YY9C 1NH6A 1YN7A 4OLYL 1FYTD 1WCQA 4KTEL 5A2FA 3PHQA 2Y5EA 2C7UB 1RAMA 2R0LH 1AXTH 2OSLA 1KT2B 3S7GA 4MB5A 1KEGH 4FZEL 3FB8B 4HC1L 7CGTA 3DETD 1KC5H 4U3HA 3JV5A 3DSFL 3SGEI 1MHCB 3FT3A 2IH1A 3PWPD 3D39A 1L7TH 3F7VA 3T1FB 4LGSB 4YGVB 1QPPA 4F58H 1I8KA 3RA7L 5E2UH 1DJSA 4O4YL 4WUUD 3MLVL 3U82B 3OKOA 1Z6JT 2HG5A 1W72B 1ZHNA 5DEFA 3ZKXC 4ETQB 2BC4A 3PV6A 3ULUF 4S10A 1EFXB 2PYEE 3QQNA 4NQXB 5BQ7A 3V4UL 5IF0A 3K2UH 4CMHC 5D7KE 1OGAE 1NUGA 2VTFA 4Z7UF 4POZD 4WHTB 4ZPVB 5CSBA 2ZCHL 3ZSTA 2J8OA 4ODHL 4QXWA 5I76A 4P3DA 3TCLA 2IQ9L 3GSVB 3OSKA 4XH2A 3CH1B 1FIGL 2R4SH 4DVBA 4QT5B 4XI5C 4NUGL 3SE8L 1FRGL 3IFPA 1XZ0A 4R4BB 5I18L 4JFFD 1J9CT 4LNRA 2Z92B 4OF3A 3GIVB 5CINL 1NDMB 2QEJA 3MBEC 3VXMA 4QHUA 2MOVA 3MXVL 1FAIL 2GAZB 3IXTA 5EZJB 1HE7A 1U58A 1ADQA 4X6EA 1Z3GL 1PSKH 5T3XE 1GOGA 1EO8H 2NXYC 4LARL 1FFOB 4R96A 5IVXB 4LRNH 4GAJH 2ICWB 3O6KH 3AC0A 1BIIB 1GAFL 4OD1H 4P5TC 2DQCH 2BOCA 3SCMB 3TT1L 5FGBC 3HAEG 3FAXA 1XF2A 5HYJD 1N0LA 3VCLA 1KPRB 3NN8A 5KJRH 5L2KB 1L0XA 4NKOA 4UINL 1RK0B 5FKAA 5E99L 2A1WH 4UDUA 4ZXBC 1S9VA 3BW9B 5FIEA 2DWDB 2A6JA 4KWUA 5GRJH 3I6KA 3GSUA 1CDHA 3MRGA 3OKMB 3M17B 2XNAB 2NY6D 1A1OA 4IRJC 5C2BH 4ZTPH 3VDAA 4PJEF 3V4VL 3WMSA 3VW3H 1GGCL 3SOBH 1M7DB 2BERA 3F7QA 4P46D 3T0EE 1YEIH 2ESVB 3D39D 5JR1H 2EH8H 1FZOA 2DMBA 5CIPB 1BQLL 4WW2C 1I9RH 3QNXA 1CGVA 1OL0A 4UBDC 5F1SA 5GXBB 5HPOA 5C07E 1A6WH 2I9LA 4RMTA 1T22B 4ONGL 4M6NH 3QJFB 3MTRA 3T04D 2H2SC 4GRLA 4HPYH 1AE6H 1JHLL 2H1PH 5GHWH 4XP9L 3RKPA 1DDHB 4X6CA 1Y6KR 2FH6A 3KR3H 2R23A 5E8OB 5EIVA 5HI4C 4TUJA 1QA9A 4GO6B 1E28A 3CFCH 2HWZH 1S7VA 4JVPA 2QTEA 4GAFB 3ARSA 4AMKL 2DQGL 2E7CA 3FHQA 4XBEH 1G84A 2V2WA 5A43C 1YN6B 1U8JB 4NWUL 4UIKH 4ZFGH 4UOW1 2AS5M 3RAJH 4LLMB 4JRYA 1NC4D 3AB0C 4N0CD 4JHZA 5TE7L 1R5WB 3MRPA 3TNMA 3BX7C 2IC2A 4DKFH 3T4YA 2J4WH 1T21B 1CZ8H 3CFEA 2VQ1B 3X14B 2HLAA 4OIIL 4PYHA 5E0QA 4YDKH 2NY5H 4EN3B 4OUOA 1E4XH 3H9SA 3SY0B 4JFDB 4NKIH 1SY6A 1T04B 2B8OT 4XPTL 1D5BA 5E5RB 1KB9J 2B5IB 3VXMD 3BPCB 5FUCE 2C3VB 5HVHC 3QEHB 3VD5A 1LO5B 5JW3H 5I1LB 3EO0B 3F8UB 5EZOH 3WFBH 4Z7OF 3DTXB 3RNQA 2XI9A 1KJMA 1KB5H 3S35X 5D4QA 3GJEA 4EDXA 2BY3A 5LXGH 3I6LE 1EUTA 4PLNC 2XICA 1RJLA 1ZLVH 4KJWC 4U6XA 5E9DB 3O41A 4F80A 1WZ1H 1YMMB 5FYLH 1K2DB 3AXLA 1UB6B 1GZQA