5CP7B

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
DVQLRESGPDLVTPSQSLSLTCTVTGYSITSGYSWHWNRQFPGNKLEWMGYIHYSGSTNYNPSLRGRISITRDTSKNQFFLQLNSVTTEDTATYYCARYGGYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
total genus 42
structure length 214
sequence length 214
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B01
4MJ2A 3BP4A 5JORB 3QIBB 2X9XA 2P42B 3VRLF 4ZUVB 3BH8B 1CFSB 3FOMB 4U6XB 5BVJA 5LCVL 2FZ3A 3KNBB 4Y19A 1I1AA 5CZVL 2FSEB 4EKXA 1I3GH 3OR7A 3H3PH 1REIA 4GBXC 2DQTH 2AXGA 1GHFH 1R5VA 3I75A 4P99A 3VD4A 4MXVF 2X6MA 4PGEA 1YEIL 5EO1A 4LSRL 3CXHJ 3WSQL 3K46A 1OTUD 3OGCB 1EMTL 2ZCKH 3ZDXE 1LGVA 5BQ7B 3L3IB 1Y0LB 2Y5EA 5JIHA 1HHHB 4X6DF 4P2RD 2JELH 3CMOL 3KPTA 4OB5H 3BIAX 4K71B 2AI0L 4QHUA 1J0JA 4J3SA 4MJ6A 3FL7A 4KHXH 3KPSA 1Q0XH 4RMRA 1Q0YL 3TP4A 4OV5A 2XQBL 5F3HB 4G9FD 3LKSA 3HA0A 2FX9H 3UJIH 2LAAA 1G7LB 4ENEC 4MAUH 4OM0L 4XVJL 4APQB 4MHHI 5GS2D 3O2DL 5FUOL 2I9LA 2HAZA 2PO6D 2R2HA 4KKNA 3QI9D 2UV3A 2JJTC 3KDMB 3V52L 1MWAH 4MGXA 2OK0H 4K23H 1MFCL 4K3EL 4MLSA 1LP9A 3NCJH 4MA7H 1F4YH 5BW7A 1FNSL 3SDDD 4BSVA 4JB9H 3L7FA 2ZKHH 3MUHL 4HKJA 4KDVA 4K71C 5ALCH 3X3FL 5AAWA 4QWWD 1OGAA 4WGVB 1MLCB 2WIIB 4FFVD 4WTZA 2RJMA 5IBTL 1CWVA 4JG0L 5DUMH 4U1LA 5T1KA 3BDBA 4Z76A 2CK0H 4PJFB 5J6HA 3I3BA 2L7JA 3AS2A 3C6LA 1OAYH 4F8QA 1XEDA 5IMKA 1SHMA 3CFBB 4LF3B 1NCBH 4JFHD 3WUWG 4PBXA 4OLXH 3G5VB 1HEZB 3IU3B 3WNMA 2VTFA 3L5HA 1L7TH 4XP6L 1BWMA 4J3XA 2WV3A 2V2WB 5IF0B 3SCMA 4OLYL 3EZJB 3ARBA 2R29H 3LKOA 4PJDB 1XGRA 1DVFC 2NY6B 2NTFB 4P3DA 2EDQA 4HPYL 2E7LC 1RZKL 1VFAA 4JRXB 4X7SL 8FABB 1S7QB 3PV6A 1N8ZB 4IRZH 2DBLL 1M7DA 4LVEA 3T3PF 2D9CA 2YBRA 4QRTB 5DJYB 3TV3L 3CMGA 1WWCA 5CMAB 3QR2A 4MMXC 5JXEC 3SDDC 2VXSH 3HUJF 1KCVH 1J8HB 5LXGL 2D03L 3P4NB 4PLNC 3TO2B 3UC0H 1INDL 2WUBL 5FGCB 1E6JH 3HE7A 3OKKB 4UUJB 3STLA 1RZFL 2XZQH 4ORZC 4IJ3C 4XP1H 1YUHA 4D94A 4ODXA 2FD6L 4LAQH 5DDHB 1YPZF 3RGVB 5KSVA 2XZCL 4DQOH 5GJSL 3PWUB 4GMTL 4Z5RB 4MSWA 3WFBH 1YEJH 1G1YA 5DYOB 4X0KA 4UNUA 4GMTH 4PJHF 5EO0A 4HV8A 5EZLA 4ZPVB 1QSED 2KZ1B 1FV1B 1OP3H 3TBYA 5CGYC 2PYED 4TVPD 4HWZA 1MCWW 4JHWH 1T1XA 1OSPL 1U8JB 5TF1H 4HWBL 1CXFA 1HILB 4XX1G 2FHBA 3WN5C 5IVXA 1EJ6A 3SDDB 1A6VL 1T5WA 2K3TA 1OM3H 1GGCL 4O51B 4QHMB 1FFNA 4PRIB 1XIWC 4QRTA 4EI5B 1U3HB 4U2ZA 5JIPA 1JPSH 4HZLB 2NLJA 1S3KL 5IGXH 5FEBA 1EEQA 2WP3T 3E6FA 1OP3K 1G6RL 4HKBB 3NCCB 4JGUA 3NMEA 3N1MC 4ODHL 5ANMB 1FJ1B 4UQ3A 4CRPA 1EHLH 1NGPH 3OX8B 3ARBC 5JLZA 3O2VL 3VD5A 1R3LA 1FP5A 3D85B 4Y4FA 4BZ1L 4DUVA 4XC1H 3D3VB 4NT6A 5BOPA 3GMMA 2VLRA 5DJ0B 3VFTA 2DQIH 2B5IB 4LHUB 3SEPA 2FECI 3FT2A 2A1WH 2EXWD 3MBXL 4L4TE 4G6KH 1TVHA 3CCHA 3ULUC 5T1LA 1RURH 3RZCC 1VEMA 1NEUA 4UT9L 3JV0A 3HE6A 4UTAL 4M7LL 4Y4FD 2AAVA 1XGQA 2AQ2A 2GSGB 2DLTA 3B2VH 3MGTB 4MDIA 4KZDL 1CR9H 15C8H 1IFHH 1P53A 5D2NE 4JRYA 2RGSA 3BHBA 2VDRH 4P5MA 4U1GC 3B3IA 4HHAB 2BJML 4M62L 2NXZD 4Q6YA 1JWMB 5FYJL 2EDNA 3TC9A 2YEZA 3UPCA 4ZXBD 1OQXA 2Y23A 1WBYA 1HN1A 2PO6B 1I7TA 1IC4L 5GQBA 4OCWL 3R06B 3GUTA 4QY8A 4HS6B 5HHOD 1HSBB 1RQ5A 3VXTB 4JO2L 1U8QB 4Z7UE 3ES6A 3JWOH 4GSDL 1U8KB 3T65B 1I1YA 4GH7B 3BXNB 4MCYB 4Z6AT 1NAMA 1YEIH 3THMH 1ACYL 5DMGD 3AU1A 4BUHA 2Y5TA 2NY7L 5JZ7D 4KHTH 4AMKL 4XZUB 1J9CT 2OS7A 2QQNL 3WNLA 4ORGB 5KVDL 4D0BB 4Z7OE 1MHPL 3AC0A 3BW9B 2HKHL 2V9TA 3HE6D 4I18A 3QRGL 1OAXL 1E4KC 4NYLA 1JFQL 3RPKA 4PJGA 1AGEB 3UJTL 3DTXA 1FQ9C 1J8KA 4UU9A 2PCPA 4JFZL 2HFFB 3CU1A 4Y2DB 5IM7A 5IB5A 1KCSH 2Y5TB 4OGYH 4I77H 3RL2A 2A77H 5DRZB 2X42A 4PD4K 2C9AA 5ACZB 2X2YA 2YWYA 1RZGB 1EFQA 4AQOA 1UG9A 5DWUH 3GSVB 2CH8A 1U8QA 1UZ6F 5TE7H 1BD2B 3GKZA 1EIBA 4NN7B 5HDQH 3ESUF 1WFOA 5SWZE 2H2SC 5I1GL 2E6PA 1EEUA 2YR3A 1FVCA 1MVUA 2ZOLB 3BKJL 3SPVB 3O45B 3VFGL 5IMOB 1UA6H 5DURB 2ICWB 3U36A 2Q7YB 4EEEA 4Z7WB 4JRXE 2VC2L 3LKNB 1M71B 2BSRA 1UVQB 1R24A 3VG9B 4NJ9L 4R97C 5KN5B 3T8XB 2VO5A 2F58L 5DEZA 3ALPA 5DMKB 4CVWA 3VXNA 1BM3L 2APFA 1IBGL 4DKDC 3QQ9D 2YOCA 1KJMA 3OKNB 5LG1A 5IB1B 1D9KB 2VSDA 3FAWA 1JHLH 3BO8B 2VZVA 3NFNA 1OAKH 2PYEB 3QDMA 4B5EA 2CDFA 3QAZC 4HFWB 2IEPA 4I2XA 4PJBF 4WO4A 2XZCH 4U7KA 1YEKH 2XG5A 5DK0B 1EEZB 3ELAT 2ESVA 2HA1A 3RKDC 3AUVA 4HC1H 5JDSA 5ACZA 1E4WH 4QXTA 1X5YA 1R3JA 4U33A 4POUB 1AXTH 3DRTA 2HT2D 3U46B 5I73B 4FABL 2J1KA 5DK2B 3C2SA 2AEPH 3RBSA 2BVOB 3ZHDA 1CL7I 1A5FH 3LZFL 2VXSL 2C1PB 2EYRB 2X4QB 3KYOA 3MMEB 3HNVH 3RFZC 5ETUA 2A9MH 1TTGA 3FKUS 4JE4B 2AVGA 3S37X 2VKXA 3Q1SH 3HNSH 3BZDA 5FA3B 3BEVB 3BGMA 4S2SB 5C92A 4XXDA 4BM7A 4X4ZA 2D7TH 3W39B 5CCKH 4M03A 5SV3A 3KPPB 3WS6A 1S7UB 4POZC 1LK2B 5DFTA 4WHTA 3JWNC 1NH6A 3P73A 5TE6L 4LIQE 4XPHH 3P0VH 4PRBA 3GBNL 3ROLA 1I3RA 3T2PA 5BQ7A 4HK3N 2VZUA 3FQTB 4NM8L 5K93A 3GI9H 5D72H 3RA7L 4GXUM 4P4KC 5BS0B 3P73B 3RWIA 3FB7B 1EVUA 1BD2E 4GKZB 1IGMH 4OGYL 4ZAKA 1LDSA 3BMWA 4K8RL 4R2GC 5F88A 4F3FA 2X7LB 1UC6A 5E4EB 7CGTA 3IFPA 2HG5A 5KSBA 1P4BH 1QBLH 3QUMA 4PJAF 1J1OH 1MJUH 3DV4B 3VW3H 4GRMB 1SJHB 2DMCA 4R2GB 4DVBA 3GGWA 5DUBB 1CICA 5DMJB 3WFZA 1DLFH 5EG6C 5JW3L 3HG1D 2AEIT 4RMWA 1GC1L 4I48B 5IR1A 3V4PH 4KRPD 4ORGA 4J23A 2XPGA 4DZBA 4MB5A 1K3ZA 4DVRL 1LILA 2CXKA 2Z9TA 2ZUSA 2C4FT 3FQUA 5EU6B 3QI9B 4MNQE 4JY6B 4B41A 4ODTH 4RX4D 4N8CH 1RUML 4P57B 5C0FA 1L0XA 2HH0L 2AI0H 4TTGA 2OL3B 2W0KA 3CZFA 4NQCA 3TO4C 3BKYH 3BUYB 4J3TA 1RZJH 2JJSC 1R3HB 4Z7NF 4P4KA 3E2HC 4RFEA 5I8EB 4A6YA 4M3JA 1X5GA 3TJHD 5ADOL 2NXYB 1MHCB 3NH7L 5H94A 1VB9A 4V1DD 5DJ8A 2FEDD 3L6FA 2Z31A 3O3DB 3ARBD 5C0CE 1FAIL 2XXCB 1H3PH 2Y7QA 4AIXA 3TBVA 2ZSVA 4LCUA 4HLJA 1WZKA 4MHHG 2Q7YA 3S9DB 1T1ZB 3C60C 4QOKB 4V2BA 1Q9WA 2R1XA 1NGXB 4GUPA 2HLAB 2X70A 5AWNL 5HGDA 3HE6B 5FA3A 1FFRA 3HZYA 2BNRD 4G7YH 3IVKA 4FN0A 5E9DA 4OSUL 3VW3L 1MJUL 1TENA 3GMRB 1FE8H 4AT6B 2FJHA 3FB8A 2XG4A 5J89A 1YJDC 3GSRB 5DRWA 4X6BB 5HJ3A 3QWRD 1PYWA 5DRXB 2QR0B 5CINH 2ICWJ 5CZXD 5JXAH 5DC4B 2OTUA 3VFSB 1CI5A 1LWRA 4P2OB 1PEZA 2X4OB 4JFOB 4KQ3L 5F7DB 3M1BA 2ARJA 3I85A 2AKRA 1JF1B 2FIKA 2O26U 4OKVA 4DCQA 4IRJD 2OLDA 4YDKL 3FRUA 3SDCB 2E7BA 3ZDZF 1WWAX 2ITDB 4N1HB 4HWUA 4XPHL 4NUJA 4D0BA 5F3HA 3DMMA 1RD6A 3AXLB 3SGDH 4OTXL 3BZ4A 3VI3F 4GS7C 2W0FA 4KWUA 1IGJA 5HI4D 4KJWC 5A16B 1OWWA 4OIAA 4NWUH 1DSFL 1NAMB 3ARDA 4H88L 5J56B 4CW1B 3JTTA 3IDGB 3MLWL 3X3GL 3P0YL 4KK8D 5LAXB 3LDBC 1T6VN 2BRRL 1AHWC 3QYCA 1V7ML 1T5XB 4LHUG 1U8NB 3PWPD 2WBJD 4FQ2H 4KJQC 4RMSA 4Q6IC 4DK6A 3TCXA 4HGWB 4JR9H 5D2NB 4BA8A 1A7NH 3RY6A 4YZFF 2IBZX 4ODWA 5MEOA 4DEPC 2FDBP 4J1UA 5ECJE 1D5BA 3K2MC 1A7OL 5E8OA 3QDAA 4MD4B 1U3JA 3RVWD 3IYLW 4EBQH 5DHYB 1K2DB 1A6UL 2X4UA 4JLRA 1OAKL 3GFUA 3KPLB 1CXIA 5TDPB 4XBPA 2CUMA 3IJHB 4DGYH 2DQGH 2XQYK 4N8PA 1HSAB 1WBZA 1FL5B 3TBWB 4AEEA 3EHBD 4PFEA 2JF1A 3KVQA 3O8XA 3RZCD 3U0WH 4L4VE 3IETA 1TCRB 3U0PA 3B9KA 1W2KT 5E08H 1CU4H 3WO3B 2FJGB 3TV3H 4S1RH 3SDAB 1QRNE 1SM3H 3FFCA 5HYQB 4AK1A 3IAPA 4WWKC 1C5DB 3ZYJA 1I1FB 3SQBA 3BRFA 1CF8H 3ARGA 1OF2B 4HPYH 4OZHB 3SQOL 1FYTB 3D85A 4Y4FB 2BY0A 25C8H 1G9NL 1ZLWK 5JW5B 3LKRB 4HDIA 4NQXA 4PJ7B 4KPHH 3Q0HA 4YGVA 5KANG 1UXWB 3ULVF 1CFBA 1IAKB 1AKJB 3L5XH 1TJHH 2ZG2A 4KTDL 4MXQC 4OLEA 1PZUB 1P6AB 1QLRB 3UTTB 4N0UA 4EUPB 4X8XA 1DDHB 5F44A 4ZYKB 1S7VA 4G43B 1X6LA 2Y36H 4CAGA 1HQRB 2BNQA 3MRCB 3T1FB 3N0PB 2A74B 4N8VG 3BHBB 1FBIH 1QSFD 2AQ3A 3HCVB 3ARGB 1TPXC 4LDOB 3RGVD 4TSBL 5HYSB 1MI5A 3WEXA 5ETUB 5C08E 2GSGA 1JGDA 3P4MA 3W5MA 1FNLA 1E0OB 3MR9A 4MJIA 5JW4N 1BQHG 3O6MH 4Y5VA 2HLFC 2XWBB 3KDMA 4F7EA 3IXTA 1BFSA 3SO3C 4YHYC 4XNMA 3HCVA 4OLWH 3AMKA 3IVKB 4Z77B 3NGBC 4PJIF 4XPTH 4KKCC 1JGEA 4ZPTA 1UJ3C 2R4RL 3IDYC 4G43A 4R0LC 2ZP0T 4J2XA 5GRVL 3D39B 3TBTA 1KACB 4JO2H 3QPQD 3V9FA 3ZE1F 4F3FB 1D5MB 4CU6A 4JPVH 3WKMH 5JXED 4OCWH 3BPLB 1ZLUK 1IGFH 4XZUA 4XPGH 3UTSE 3HNTL 3VFWA 1PLGH 3BXNA 2LVEA 4DK3A 5IW1B 4DUXA 3FMGL 3NABL 3CMOH 2AJZA 5C8JA 4RAVA 2HT4D 4V1DA 4NQCE 5JQHC 4KTEL 1BIHA 2AK4B 3RU8H 5KS9F 3VWKA 4OZIE 1KIRA 5A2JH 2BVYA 3FB5B 5L8KB 4D0DB 3AB0B 3PWLA 4LCWA 5DSCB 4LVOB 2DM4A 1VEOA 4DZBB 1OD9A 3V7MA 1Q9LB 4OKDA 3RNKB 1N5AA 4ZODA 5SWSE 3SJVE 3RWGB 1I8KA 4YDJA 2R2BB 4Y0GA 4FQ1L 3X12A 1MVFA 3DECA 1IEHA 3MV11 4IRSC 4POYA 1BREA 2KL6A 5DO2C 2FX7H 2WWKT 1DBML 3BWUC 3T0DA 3WLBA 2IWGA 4OIIH 1VFBA 2CDGA 4PRPE 1MLBA 1B0GA 1RZKC 4LARL 1BZ7A 5IB2A 4OLUH 4JQIL 1NMBL 3RWDB 1CQKA 1KIPA 1JF6A 2H6PA 5IGXL 4WW1B 2WLYA 4G9FB 3GJEB 1MPAH 3MLVH 5IB3B 1CG9B 1C5BL 2P8PA 2UWEB 4JM2C 1SBSL 4W4OC 3LKNA 1Q9WB 3EJJX 3FQWB 5IFJA 2B8OT 4HXBL 2KH2B 2YWZA 3G5ZA 4HK3J 1JNNH 4XNQB 4X98A 4JJHA 1N6VA 4FQQB 4XT1C 3MNZA 1ZHLB 4QRUB 4YFLF 1DQLL 1BBJB 4KROB 3QHZH 2VYRE 4MB3A 3LKRA 2PW1B 3KLAA 3ARED 5I1EL 5IB4B 1HXMB 1JRHL 2VXQL 3BGAA 1PGRB 2V5TA 3QJFA 2VN4A 3VFSA 1NCCL 4PYGA 3SE4C 3MV8D 3HRZB 3GMNB 4LLWA 5F6IC 3CFEA 5B8CC 1AXSA 1IAOA 5C0EB 2FJHB 3HI1A 4MNQB 3F7YA 4P9HL 4D0CB 4ZXBB 2CO7B 3HFMH 5DD0L 4WDIB 3MRFA 5MEPB 3OR7B 1YYLL 1FG9C 2OQJA 4KY1L 1HDMA 3QDMB 5FOBB 4GAYA 4PJBE 1CDIA 5LQBL 5F9WC 4YEFA 4OBSA 1KJMB 4TPRH 3RDTA 3BH8A 4LHJB 3S5LA 4LQFH 5E08L 2VH5L 1E27B 4JVPA 5IOPA 3PWLB 4HK0A 1MUJB 2NY2D 5I1IL 3U2SB 3PWPB 5E8PB 2VQ1B 2HTKD 4JQXC 32C2A 3JZ7A 5HYFA 1WZLA 4KI5F 2VQUA 4AJ0A 2ZCLL 1OT1A 2IH1B 4QEGA 1DEEB 3E3QE 1AE6L 1AQKL 2K7PA 3LRSA 4FRWA 3F7VB 4OLXL 3H9SB 1E28B 4DEPB 4HFUL 1QQDB 1LNUB 4GFTB 2AABL 4WFEE 3G08B 5E5MB 5LAXA 1QO3B 3G04B 4H8WH 5KOVC 1CLYH 2NY5L 4PJ8D 4NNXA 1Z3GL 2OL3H 4MJIE 4QYOA 4HMEA 5ICYB 5IOPB 1F2QA 2H8PB 3ARRA 4HHAA 3SOBL 3QRFM 1NC4A 1QBAA 3LMJL 5BZWB 3RX8A 1NCAH 4JDZA 5EC1A 1B6DA 2Y1VA 3EBAA 1AQDA 1A6TA 5D7JC 4LKCA 4JR9L 2H3NA 3D25B 5FM5M 3D87B 2AXJA 2BRRH 2F5BL 2VLMD 4YHOL 3DXAD 2VLLA 1CBVH 5K59E 1K5NB 3QCUL 3MRGA 3QXAB 4FXKA 3MLWH 3QXUA 2FSEA 4JFFB 2FYYB 2FHFA 5HYEA 1GIGH 5JHLH 1NLDH 1VESA 2X1WL 4QLRA 1BJ1J 2CMRL 3WHE1 4UV7L 4OF0A 3W9DA 3MLUH 4UTBH 3PF2A 2RQ8A 2OSLB 4GKZA 1J87A 3C9NA 2BNRB 3QXTA 3GRWA 5HHOE 4X6BA 2QKIA 4N0RA 3UZQA 2P43B 3MRHA 4QRRE 4L8SB 3H6JA 3OR6B 4FQLL 5J12C 5D7IF 1J7VR 2EYTA 2VIRB 1IQWL 3DHMA 3HUJB 3HZYB 3OX8A 2PYEA 4ALAH 1BGXH 4MA1B 4ZYKA 5TQ2H 3MRBA 1BMGA 1CDGA 4NHUB 2DB8A 3P9WB 4LSRH 3E0GA 4LNVA 3NZHH 2Q87A 4GKNB 1MIML 4JREC 5D70H 1MAML 3CLFH 1F3RB 3BESR 3RUGA 3VDAA 2WK2A 2Z4QB 1GHFL 4JKMA 4X6DB 5I66A 3FB6B 4PB9H 4F58H 1KT2A 3N1GC 3C2AL 3NCYP 1MCIA 2F19L 4XMLL 2J5LC 7FABH 2VSCA 2H1PH 1Q38A 3OTTA 1MY5A 2DDQH 1M05A 3DIFB 3P9LB 1HXYB 2BOCA 2QTEA 3A0OA 1I7UA 1K4DB 1RV6X 3U4EA 4LPWA 1BD2A 3RKDD 5F6HJ 3W82A 4QXTB 5DR5H 2Y6SD 1MCNA 2NYYC 1FZOA 2MPAH 1A14H 5DMGC 4P2QE 1UM5H 1W0VB 1KLGA 1VFUA 3NFNB 2BXYA 3QDJE 4AL8L 2DOCA 3QUKB 4DKFH 5IEKB 3KJ6L 4MAYA 3WUWB 2CIKA 5D8JH 4PRDA 3O4LA 3HZKB 1CFVL 4OGAD 5DMKA 5M94B 4I3RH 5C9JB 3CDGB 3DYMA 2R23A 5CGYD 2GCYB 3MRRB 4KROD 4YK4B 4JFDA 1N3NB 1YEDB 1FL3A 3EYFB 1CXKA 1J8HA 2GY5A 5E2TH 3LKSB 5DMIH 4FQIL 3WFEH 4K3JH 4U1KA 1U92B 5DS8A 1KOAA 3OB0H 3P4OB 1QR1B 3EGSA 5CD5D 2BERA 2CLVB 3MV9E 1NJ9B 1JGUH 4PTTA 2VR5A 4GRWB 4K3DH 1RUPH 3UDWA 3GJFK 4PV8A 4ZFZA 3TBSA 5E9DE 4XVTL 4XNYL 1MRFL 3MNVB 4WHYH 3OJVC 3VXRE 4HS3A 4LIQH 3S37L 2HFFA 1Z3GH 4PJGF 4MNGA 4QTIH 1XMWA 1RIUL 4NM8H 4X5WB 1WT5A 2ZOKA 3SN6N 1BECA 1FVEB 4JJ5A 5FIEA 1WFTA 2AABH 2NY2B 4I18B 5IK3A 5KSUB 3SKNB 5E00B 4P0DA 4K94C 4YE4H 5TE6H 3EOBA 4P2RA 1LEGA 4PJ8A 3JV6A 1MEXL 4X6CA 4LVHC 1EZVY 1ZTXL 2V7HA 4YHIA 3VXUE 4NP4H 4B50A 3CLEL 5HGDB 3U0TB 4R4FH 5IWLC 4GS7B 4PJDF 4JQXA 1F00I 3AAZA 2AEPL 1ZWIA 3QPQC 1CTNA 2Y07L 2VR9A 5EOTA 1DE4A 3I2CH 4FNLH 5FO9B 4HUVA 5GRUL 1LEGB 2Q3ZA 5CLTA 5FK9B 4ZUWB 1NAKL 2R1WA 4PGBA 3A6OA 5C0BA 5B38B 2B4CC 1ZLVH 5JA8B 1MSPA 4K7FA 3TH3T 4KK5C 2P8LB 3I84A 5B8CA 1NKRA 3ZKNC 5ICZB 4H25A 3MGTA 4MDIB 4JO3H 3IB4A 3GKWL 4X7TA 1EHAA 3L95A 43C9A 4H20H 3UPAA 3QEGL 3U9PH 2L4OA 4JPIB 1KLFA 3KXFB 1S78C 3O6LL 4PRHE 3FOLB 4P59L 5SWSB 3SJVB 4UT6H 3T0WA 4LSQH 5FYKH 3WE6A 3OV6A 4M6NH 4XWOC 4PB0H 1KN4L 1K8DA 3SKJH 3TH4T 4O58L 4G6AD 5GSRA 1LP9B 3ARFB 2QSTA 3BKJH 1WZ1H 3CK0L 1RUQH 3QUYC 5I1GH 1QRNA 3MLTA 1AI1L 1NC2D 3RVTD 1Q72L 1KTRL 4NDMB 5DWUL 5EH1A 3WXVL 3D6GA 4LP5A 3U4AA 1DEEA 3BE1H 4KMLB 4PJ9A 1U8IA 3UTTD 4OLUL 4J1UB 1YDPB 1XZ0B 3QWQB 5EOCL 4M8QA 5EZIH 1ZANL 3MXVL 5A2IH 1S5IH 3LEXB 2R0LH 1DBMH 5JHDE 2R1YA 3CDGA 5AD0B 4LFHD 4S1QL 1D5MA 3VCLA 1ZMYA 3KWWB 1YN7B 3QWRA 1YPZE 1OAQL 4RNRA 3ZE2F 4NKQB 4N8VB 3AMLA 1GYAA 5A16A 4D8PB 1JK8A 5EO1B 4KK6D 3R06A 3C6LD 3O3AB 3GUTB 4M43L 3UTZB 3K0WA 4J7RA 5EWIH 1YQVL 1NUGA 4BH8A 2BHUA 5ANME 4QOKD 1N7ML 3T3PE 1PKOA 3OKOA 2JCCF 3EYQD 4OF8A 3KYMB 4X0KB 5HHVH 3QP3A 3VMPA 5B39G 1ZSDA 4PJBB 1NGYA 2C1OB 5E00A 4X99B 3FO1B 2OR7A 4JHAL 3MODH 2PW2B 3ARFC 3AS1A 5EPMA 4WTWA 4HXAH 4ZAKD 4BH7B 3FO0L 1UADC 1QFPA 2VABA 1I3UA 4YWGH 3HNTH 5CS7A 1RUAH 5IVNA 3BN9C 1UWXK 2MQ3A 5E2WH 4XPGL 3L3DB 1HINH 3LV3A 3PQYE 3K1DA 4PRHB 4OCNC 4P3CL 5C09D 1UENA 3V6FA 2APTA 1Q8MA 5EU4A 1CG9A 5IB1A 2R4RH 3G6JE 3O4OC 1YY9C 2FX8H 2IGFH 3CDFA 3MLYL 1QLEL 4L8SA 5D6DC 3AM8C 3QQ9C 5CHNB 4XPTL 2ZSVB 4LCUB 3O11A 1NGWA 4EZMA 5F7FA 1ETZA 3HTLX 5HHQA 2EICA 5CJXC 3HC3L 2GY7B 4L1DA 4BQ8A 5J9PB 3UBXI 1UQSA 2YZ1A 1XFPA 4G6KL 1A6ZB 5T33L 5CEZE 3STZA 4QHNB 3LN5A 1BOGA 3N1PC 3SDCD 1M6OA 1YPZA 1G9NC 2B39A 3FQRA 4GW5A 1V8HA 5HGGS 2RCSL 2K7QA 4U1LB 4AIOA 3M07A 3KPSD 2Y6SC 3QIWD 3FRPA 1N6QL 1IC7L 5JW4R 1ZT1B 3L5IA 4JZNB 5D7JB 5JQ6H 2ENSA 4FA8A 2HP4A 5DEFB 4MA3A 5KG9A 1LHZA 5E0QA 5GRXG 4YHKL 3OXSB 1G9NH 2OZ4L 4G3YH 4LLYB 3TYGH 3QUYD 1CFQA 2CUIA 3K81A 4JDVA 5J13C 1D3CA 3L3JA 3VG9C 5AG8A 3QO0A 4ZO8A 3LS4L 4Z0XB 4DVBB 5SV4A 2X4TA 3ROOB 2IH1A 3RWJB 1OP9A 2E27L 1FNHA 4FQCH 1A6AB 4PP1D 5DHVA 4Q9BA 3VXPB 1KIQA 1EH9A 5IMLA 1VACB 4Y1AD 5J9PA 4ZAKB 1QNZL 3U0WL 1AJ7H 2XZZA 3OKDA 4PRNA 2R2CA 2GSIB 5ALBL 4OQTH 3WJJA 2VL5B 4HIXL 3EDJA 1YJDL 4X6CE 3LSOA 1JWSB 2DQHH 4M6OL 1M4KA 3QUKA 1NEZG 5AZ2L 4O00A 5IIEB 3OGCA 1YEJL 2NY3C 5GJSH 5JMRA 4G5ZL 4L8BB 3SO5A 3WD5L 5KVEL 3MLTB 3GSQB 4XP1L 1R5VB 3B9DA 1BAFH 5ADPL 1MREL 2DL2A 5D2LB 5GGRB 2R4SH 4NN6C 1SY6L 4B53A 1RIVL 2VWEE 1T3FB 1IEBB 1KCVL 4F57H 5F9JA 3VXUD 3RGHA 4TULH 1QD0A 5EORH 1PSKL 5FCSH 35C8H 1YNLH 3KHQA 3H9SE 4I13B 4FQXC 2JB6A 1FVEA 4JJ5B 1ZVYA 3N06B 5A1AA 4AZ8A 4TUOA 5I8KL 3L3HB 4HWEL 2XKUA 5EUKA 4FQXB 4WU5B 1KPRA 3DVGA 3G5ZB 5TDNA 5EULV 1WWWX 8CGTA 3RDTD 3QDGD 3TT3H 2A0LD 3MO1A 2EEAA 2FB4L 1CICC 1N0LA 2R9HC 4QNPE 3L6FB 4GG6A 1UXSA 3BZEB 1KFAL 4HDIB 4NQXB 4PJ7A 4U6YB 5CIPB 4PJCE 3WUZA 3QCTL 5DQJA 3OKNA 3OAUL 4HKXA 1EGJH 3DPBA 2E9BA 3GHEH 1NGWB 4G80A 2EDTA 1WEJL 3GEWB 2R2EB 4UQ2B 5C0IB 2OJEA 4YAQB 1HNGA 4AY0A 5EIQA 4M48H 3HI6L 1DBKH 4R96A 4RFNC 3VGAB 1KB5B 3H7BB 4P57A 3X3FH 5GRWA 4ISVA 4HKBA 1FNSH 1FL3B 3H2WA 1P2CB 3C5SA 4ELKA 3RAJH 3O9WC 1TJGL 4XBGA 3K4DA 1IAII 3T04D 2EDHA 3MUY1 3TVMC 4D9RD 2BDNL 3HUJE 2YD2A 5GSRB 1LK3H 5HGAB 3T4YA 3UJIL 3PXHA 4XPAL 1T0MB 3MLRH 2UY6A 5FKAA 1ZT4A 4PGCA 1HH9B 3WO4B 1X9QA 2BOBA 4Z7VF 5F9WB 2H26A 4KC3B 2VDLL 3HG1B 4ODWB 5CJQL 1TETH 4R8WL 4U1IA 1BVLA 3QEQD 4L3EB 4IIQB 3O2DA 3QXDB 4LCWE 5HI4C 1GPOL 2AK4A 4WIQA 5C6TH 2DKUA 2QSQA 1AR1C 5I2IB 1OTUC 3SKOA 1SEBB 2X4RA 2D9QB 2ZCKL 5FAAA 3PJSB 4CMHC 4YDVA 4AEHH 3MRKB 5IBLD 3VCLB 2FCBA 3ARSA 1NSNL 2D7NA 2B2XH 2EYSB 2OBGA 5DEGB 1T04A 4CMMA 1QVOB 3VRJA 1JNHB 3RUGE 1Z5LA 4DVRH 4UOJA 1KJ2L 4M5ZL 3O0RH 3T65A 1HK6A 1Q94A 1S8DB 4KZEH 3WJLA 1I8IA 2I5YL 5DHVB 3ALWA 3KPNB 5AUMB 4XXDB 4UZGA 3TWCL 3TLRA 1PG7L 4YH6A 5E7FA 3QEHA 3MBEC 4O02H 1EXUA 4LASH 5DJXA 2V2TB 2FGZA 5F1IA 2B1AH 5ILTL 4XNXH 1R3IL 5TDOB 1ADQA 3MJ7A 1RFDH 5D96B 4C55A 3TVMB 2WWMC 5HJ3B 4G42A 3QULA 2JCCA 4CVUA 2WQRA 3SHSA 1FH5H 4OI9A 4R6UA 5BRZD 4CNIA 1IAIH 2FGWH 3BMVA 1TVBB 2ICWI 2FATH 5L8LB 3D5OF 1YC8A 5E5UB 4CL7A 4TUOB 3O2WL 4BYHA 2WM0A 2X9WA 2X1OA 5F7YC 4F9LC 2WBJA 5D9SA 4WTXA 5TJWK 3E8UH 4FQHB 5A2FA 1KCRL 2FO1A 2VLKD 5A3IC 5CBAB 1CLOL 4OUUA 2XICA 1L7IH 1J1PH 1MHCA 4JG1H 5BMFL 4JN2A 3T3MF 4YHPA 4G80B 3HKFA 4QRPB 5L7XH 4WW1A 1G84A 3WIHL 3AB0C 3MV9A 3MRBB 1LO2L 5EU4B 5DJ6B 1N26A 1PY9A 3DETC 5I18L 3DNKA 3T0BA 3ARFD 1J0ZA 3MOBL 3U0PB 3VXMD 4ODUB 2AJZB 1J0HA 4LCYA 1ND0A 1CDYA 4LAJH 3BSZL 3IFLL 4IRJB 4QTHA 1IT9L 1J1XH 5KZCB 4TUKH 5DF0A 1PBYA 4PJGE 4WFED 4ONGL 4FP8L 1MRDL 2HFTA 2OSLA 5MP6L 1JHLL 4Y2DC 3T0EC 3NIGE 3O3BB 2WUCH 3PJSA 2O5XH 2AK1H 3QG7H 1LO4L 3MYJB 4NM4L 2NZ9D 5FM8A 1A3RL 3W81A 4PJAB 1ZGLA 1I1RA 1UJ3A 2CXGA 4ETQB 1NBVL 5JO5A 1BIIA 3QZWB 3AREA 1D9KC 2BXZA 5M7QA 3A67H 6CGTA 4L3CA 2EZ0C 1T0MA 4YHLH 5F71A 3WEXB 4W4OA 2P8LA 3SCMD 5B8CB 2MCG1 4M00A 3IDXH 2P7TB 1D5IH 2XFXB 3G6JB 4U1HB 5L88L 3C6SB 3IU4H 5LKNA 1UWGL 1VSCA 4C56A 4XBGB 2GTZB 1QQDA 5K59F 1FNGB 5MERB 3EW3B 1XCTB 2AJSH 1KCSL 4XAKE 2GK0A 2ZUQB 1IEAB 3IF1A 3SDCA 4NNPL 1BQLL 4P2CG 1ED3A 1FZMA 4Y2DD 1BWWA 1UH4A 4OCXL 1IJ9A 1JGEB 2GAZA 3CH1A 1FNEA 1OAXH 3DO3A 4JPKH 4N1EA 2G2RA 4P2OA 5LGJA 3S36X 3QDGA 2ESVE 4P5TD 4ELMA 4M1DH 2KQNA 4JFFD 3LPGA 5DLMH 5K9QG 2FHCA 2VZSA 4J12A 4KHTL 2JB5H 4AMKH 3IFNH 4K7PX 4PREA 3CX5J 1CLZH 3DX7B 2CRYA 3SE3C 4WO4B 5IFAH 1KPRB 2FLRT 1AXSB 5AYQA 5L88H 1M6OB 2Z91A 4LQ1A 3D39E 4BH7A 4HIIA 3WIIL 3HN3A 1T66C 5J11B 2R56L 1PQZB 3B2UC 4CDHA 4YHYB 1G9MH 3BKML 4U1JA 1U3ZA 3ARGD 2AP2A 5D71L 4ONHB 4QYOB 5CAYB 1FJ1A 4UQ3B 5I0DA 4D0DA 1ZHKA 4R9HA 1QBMH 2JK5A 4MYWB 3EYQC 1K9TA 2XT1B 4HS8H 3G5XB 4HPOH 2W9DH 2NR6C 1JL8A 5EOQL 4LEXH 2C5DC 1T4KB 4UT7L 5C07A 4LEOA 1P4IL 5T1DH 5DD5L 3RI5F 3AFLA 1TCRA 1MJ7H 4LNRA 4X9IA 4D9LL 1A1MB 2V9QA 4M7KL 4NRZA 3FT4A 4XHJD 4JFQA 4O51A 4QHMA 3WLWC 5C0RH 5C0DA 1UM6H 4WWKA 1KENH 1RJYB 3PP4L 3P11H 4Z8FL 5T1KD 2R0WH 3KPRA 3SGEI 3PQYA 2JCCE 2DICA 2BNRA 3GMOA 4QRQA 2A1WL 2YPLD 2EKJA 3N85L 2X89D 3T77A 4X8JB 1U93A 5JPNA 1LE5A 2GEEA 2WINA 3B5HA 1K8IB 4YDVB 3V4VH 2W9EL 1U8PB 3KJ4B 1XIWA 4U1MA 3BGFC 3UAJD 5F7EL 4GQ9H 5EBMB 4YXKL 4NYLB 3EOYG 5D1XA 4FZ8H 4NQVB 2OQJB 4KKBD 3O2VH 4NRXB 4P2OD 2YK1H 4OCSH 2IPKB 3CC5A 2ZUYA 1FC1A 5D7LB 5HDBE 5JO5B 4CUCA 2YC1A 4Y89A 1IRAY 3DX8B 4JHZA 3C5ZA 5KG9B 4OZGE 4PGCB 1WIPA 1Z9OA 3GDBA 4OFYA 1JN6A 4LLAA 5CJOH 2XACC 2GUOB 1W72L 1AR1D 1LO3H 5EUOB 1GGIL 3O2WH 3ROLB 5T3XH 1IE5A 3FQRB 4GW5B 5FHAL 4G6JH 1F8TH 1ZS8A 1S7VB 3EGSB 4RFOH 3P4OA 4BELD 4E0RB 4X7TB 5C08D 1A6VH 5C8JB 4GW4B 4XNQA 3MBEB 4M8QB 3ZKMD 1X5KA 1B4RA 4G8GB 4P2RE 4P23D 5CLWA 3STZB 1G6VK 3EYFA 4HW6A 5EC2B 4Q6IA 4I4WB 2EDOA 1P5UA 3S88H 1YN6B 1F4AA 1QSEB 4RGNE 3ULSB 1XT5A 3K4AA 1ZLSH 4OI8A 1ROWA 4X4XA 4EI6A 3WUWA 5LWYH 4HKXB 4LF3A 1PG7H 1J8HD 3GI8H 3NCMA 3LN4A 2CLZB 1CCZA 2ZJSL 1XGTB 1YMMB 3CFCH 2IQ9L 5JDSB 1UWXH 3MRFB 1OW0A 1D9KD 3LV3B 2X1XR 3OB8A 4XMKL 5HDBF 5INDA 2ID5A 3UC0L 4DAGH 4O2CA 3QEQA 1BFVH 4FFYH 3RP1A 1FL5A 4CBPA 3DYPA 4PS4H 4KRPB 4PJ8B 4MXWL 5JUEL 1V05A 3FHAA 4MJ4A 3WDIA 2DM7A 3HAEH 1TVBA 4OD3H 5GRJL 3C08L 1HIML 4C56E 2DLHA 4Q9QL 1Z0NA 2DLFH 4LCWB 5DSCA 5KN5A 4LLQA 4PJDE 5F9JB 5DJ8B 3OKOB 1UVQA 4JPWL 1XR8A 4RQQA 5FOJA 1VGEL 1HKLH 4ZFFB 3RUGB 1NANI 4KRMB 3U6RA 4JCLA 3FJTA 3BPOC 1WV7T 3T0VA 5C0AD 4I0KA 4CN1A 1R5WB 3TN0A 4MNQD 4ZMAT 3TIDB 1UKTA 3H9ZA 3BD3A 3KG5A 4YHIB 2D31A 2DYPD 1HH6A 1NL0H 4OLVL 3SCMC 2VLKE 1BVKB 2CK0L 1JPGA 3B5GA 3FO2A 4NN5B 4AENB 4D3CH 5J3HD 2W38A 3DO7B 3EYVB 3EJYD 1WFNA 1C08A 4PY8J 2YKLL 1ORQB 3BH9B 1ZLUH 4F9LA 5DD1L 3PL6A 3PWJA 1G6RA 1CS6A 1FDLL 2VDKH 3OQ3B 1RULL 5FO8A 3DUUA 4RWYH 3H9HA 1FGNH 2CJUL 2M8XA 1ZGLM 1S7SA 3HMXL 3FONB 5JHDA 4TVPH 1MY7A 1CICB 4I0PB 1K5NA 2P5WA 5DD3L 3QUXD 3EOAB 3KNBA 2AKRB 2FIKB 4JDTL 4IIQC 2I25N 3QXDA 5KTEL 3BPCB 3BP5B 4PRDB 5EFIB 5E9DD 4R4NC 3IDNA 3PWVB 3T77B 3U30C 4X83A 3V6BR 3SGJC 5CILH 2ARWA 3HS0A 2DQEH 1ADQL 1KEML 4EI5D 3EYUH 2QHRH 3QJFB 5E8OB 5DD6B 1NCNA 3IKKA 2XTLA 2DLGA 4XP9H 5F97E 4HWEH 5IV2B 2BY3A 1NJ9A 3BRGC 4ZQKA 1MIEH 3SE8L 3CXDL 2CLVA 1YA5A 2HLAA 1CXHA 2X70B 4DKAA 4WCYL 4KK8C 1HXYA 2O5YH 3BAEH 3KPPA 5IHUL 5J6GB 32C2B 4NPYA 2DN7A 5CEXA 5IF0A 1RIVH 3TJEL 2BNRE 2YEZB 4UDTA 4C83B 3D3VD 4S1DD 5I66B 1KELH 1G7IB 5B38G 3LH2H 1QSZA 4NQTA 4OLZH 2IANE 4NO2A 3WD5H 1URLA 5LCVH 1J86A 4I5BA 4LU5L 2J88H 5D5MF 3RIAK 1MCEA 1KJ3H 2IADA 4F2MB 3DVNB 3MA7A 1AGBA 1DBJL 4X9BA 1MJJA 3O8XB 1VA9A 3I9GH 2NX5A 2RHEA 1CE6A 4Y19D 2EKSA 4RAUB 4QXGH 1VKXA 1NC2A 2PXYA 4JRWA 3LN4B 5IB5B 4YHML 4QRSB 2Z8WC 5I1KH 3FN0L 3RWGA 4G6JL 5DMYA 1LD9A 4ODVL 1YMHB 5CJBA 1YN6A 2AJUH 3ZTNL 2XY2A 1IEBA 4Z7QF 3L7EB 1A0QL 2BK8A 3MXWH 1MRCL 5FYLD 3T0EE 3O4LD 5T3ZL 1IM9A 5J12B 3UTZA 4H0IA 3U36B 4KGLA 4NZUL 5KSAC 3FB7A 5GIRB 1OGAD 3KPSB 3PNWA 5HHPB 1PFCA 1J5OH 4Y5YA 3QFDB 4U1GB 1P84J 1MNUL 1OP5H 2VISA 3HMXA 4BFBD 4OT1H 1A1NB 3BJ91 3GRWL 3NFSL 4Y1AB 1T2QL 3P9MA 5HVGB 3MNWB 1I9IL 3ULUD 3K8KA 4Z7WE 3BQUD 3B8SA 5F1NA 2I60H 4NQSB 1B0GB 1MLBB 2R0ZL 4LCCC 3IETB 1FSKB 2NY5C 4IRSB 4JFED 4ZUUB 3U83A 2BSSB 5C0RL 4R4BA 3FFCE 3FQUB 5EU6A 4I0PA 1ITBB 1AGCA 4JQVC 3TVMD 3R8QA 4Z77A 5DD5H 1A64A 4U1MB 3C8KA 1G0DA 2CSPA 3CDYA 3VGFA 4ZOCA 5SWZA 2C26A 2E6JA 3ARFA 1E4XH 2C1PA 2X4QA 4XCFL 2Z92A 4IMKC 1PEWA 2VLJB 3PHQB 5DVLA 3NGBB 1F90H 4HJGB 3HZMB 3L5WA 4IRSA 1JI1A 1L9MA 3BD5A 3BEWB 3MYZA 4JPIA 3X11B 3GB7B 3KLHC 3FT2B 1KTDB 4TTDC 5J57B 4KQ4L 4WWKD 2MKLC 1C1EL 1Z9LA 1U2CA 2X4PB 4OAWB 1C5CL 4F37K 2VDNL 4JO4H 3JBG7 1U36A 4XX1E 1RUKH 5HI3D 1BPVA 4DKEH 2LABA 4PJ5E 1C7TA 4KTYA 3BYYA 2W65B 3VWKC 1DQDH 5HHME 5ISZA 4PY8I 1AR2A 2IAND 2W60B 1WZMA 4Q74A 3RHWK 5E2JA 1EJOH 3DRQA 1JUFA 4WEBL 4NSKA 3KLDA 1UB6B 4KDTC 1HHIA 4LSUL 3CVHL 4NQDA 1VENA 4YXLH 4ZS7H 2HMIC 4NRYB 3ZSSA 5FDWB 1HI6A 3O41B 1JIBA 2UY7A 1MF2L 3CAFA 1MFDL 5ESAA 3DI2B 5C3LD 4KXZH 1XGTA 4EI5C 4BZ2H 2AJSL 1AFVH 4OJFL 2P5WD 3D0VA 9CGTA 4OCMC 4CADA 2VITB 4WY7L 3O6FA 3OKEA 5L0QB 4NC2B 1RSFA 3D0LA 5CJ8A 3KLAB 5IB4A 1YEHH 4O2FA 1D5IL 4M93B 4LOUC 4P2OC 5C08A 1D9KA 1B2WL 5CJXA 2NW3B 3H9HB 2F15A 3PGFL 1IAKA 1VADB 3TT1L 4RISL 1A7RL 2O5ZL 4HZLA 4M9OA 2H8PA 3W0WD 1HZHH 4NN7C 2Z8SA 3MLZH 2O5XL 5EUOA 5I74C 3A6BH 1CE1H 1ZEAH 2FIRT 2ICWA 3TIDA 1UGNA 3BPNB 4KMQA 3VRIA 3SDDA 1MWAB 1W8NA 1B6UA 1J0YA 1MQ8A 5TF0A 3MFFA 1GAFL 2WIMA 4DOHE 3OPZH 4U1IB 4DGVL 1CGSL 2UZYB 1IT9H 4MA3B 4K2UL 4J6RL 3I02A 2Z93A 3QNXB 2IFFL 3D48R 4PG9A 4OKVB 5I30H 4R90H 4XB8A 5C0BD 4BFIB 4P5MB 3TESA 3ISWA 2L7UA 4XTRD 5FF6B 3WIHH 2KUTA 5FUCE 3CLEH 3NBNA 2VOTA 3PQYB 3ZE2E 3C8DA 1QG3A 3CNKA 3MOAL 4HMDA 4PG9B 4GAGL 4KU1A 3DSNA 3VXSE 3EIFA 4M93C 1CD8A 4XNMB 1BHGA 5CWSA 4I3SH 1W8OA 1UACL 2A6DA 2B1HH 1FYTE 4NBYB 1E4XL 3KXFE 4LHUA 3W0WE 1XIWD 4KVNL 3HRZA 4O4YH 2ZWLT 4Y4FC 1TCMA 5F7MC 4NCC1 4K94L 1NCWH 4ACPA 2I9LB 2R2HB 1QZ1A 4WEUD 5EA0L 2J8UF 3FHQA 4KK6C 5FYKE 1XF2B 1PW3A 4BFEA 5J0BA 2NY1C 3EDDA 3QPXL 1UWEH 3LS5L 4RCAA 3BIKB 4L8DA 1FL6B 2GITB 2RAMA 3OMZA 3VFNA 1JNLL 4P4KB 4RFEB 1WAAE 1SYSA 3ZHKA 1T7ZA 1KJ2A 4U0RB 1RMFH 3Q6FB 5IP4A 4FQJH 3I6LE 2VB5A 5F7LB 2GTZA 2QSCL 4K55A 5EUOE 4NNYB 3NFSH 3L7EA 4O2FB 1YEFH 2YRPA 5EPMB 4OZFH 3KLSA 4HT1L 1MFEH 3OR6A 1TQBB 3MCG1 4CNIB 1P5VA 3UTTE 1WCBA 4X9FA 5GS1A 3QXVA 4N90D 1U95B 4FQIH 5E1AA 1SEQL 1SVZA 2V5MA 2PCPB 5LGJB 3GJFA 1WBXA 2MWCA 3R0NA 3OJ2C 5C0CD 4BJLA 4MB4A 5CIPH 4FZEH 3HAEB 2ZZUT 1MHEB 1P7QB 2Z8RA 1RVFH 2WAHA 2ATPA 4RGOL 4DKFL 3LKQB 3CPLB 1RZJC 1N5AB 2AJVL 5FYKD 2FH8A 4OZGA 4POZD 3KPRB 3TZVA 1QFUH 1B4JH 3SGDI 3CDCA 5JW5A 4U1NA 3V4UH 3MRKA 1FHGA 3QAZB 5H37H 4LCYB 1KJ3L 2KQMA 4UOW0 5SWQA 3WFDH 3C60A 5IQ7H 3O45A 2DDQL 3I6KA 4JM2F 1IGCH 2H1PL 4HUWA 5DA4A 4JAMA 5GZOD 3QZWA 3ZLQC 3ILQD 3G5XA 3MLZL 1AY1L 3IDGA 4JY5H 5A2KH 2YPKB 3OL2A 1GGUA 5DEFA 2HT3D 1YEEH 2ZNXA 1YEDA 4LPVA 3VE0B 2CR3A 2K9UA 4N0CC 2YPVL 1KPUB 5KJRL 3C87A 4PJ5A 4U1JB 2R69H 4AEIL 3L3KA 4PJHA 1VADA 4C4KT 1UH3A 4OM1H 5DVOA 4KUCD 2CIKB 1ZA3B 5GZNC 5JOEA 2F53D 1A2YB 4YHZH 3PP3K 1IQWH 4ALAL 3C6LB 3GHEL 4LSTH 3D85D 1YEGH 5E4EC 3RWHA 3WL9B 4DCQB 1MH5A 4MDJA 1Q1JH 1XGUB 1LO5A 1P2CA 2SEBB 4QHNA 4Y5XB 5ICXA 1NFIB 2CDEB 4NO0A 1ZGLP 4KROC 1FIGL 4OQ1A 1K8IA 1R5IB 1H8OA 1DTUA 1TVHB 3CCHB 1U3HD 5IW6A 3MFFB 3TVMA 2YUVA 3N1FC 4PJXF 3RVWC 3MRMB 5GXBB 1MF2H 3SBWA 4CKVX 2VXVH 4ZTOL 4ZNEA 4UQ2A 3CX5K 4KKLC 4LDLB 4CW1A 3QCUH 5IROA 1YNLL 3T1FA 5C2BL 3BP6A 2PW1A 3HPJA 4M1GL 4XCCH 4Y4KC 4QRRB 2AGJL 4NSKB 3ZTJG 5KJRH 4NPYB 3DRQB 4RWYL 3BZ4B 1EFXA 4OCYH 2H32A 4L4TA 2HN7A 3NFPB 4TQEL 3WDHA 1WBYB 4MNHA 2J2ZA 3AS0A 4MA1C 5FGBA 4HJ0C 2DQFA 4PJCB 2YA0A 3ZT5A 1F58L 4OFVA 4PR5B 1MHHB 3ZZ1A 3F6LA 2X4RB 1C5DA 1Z9MA 1N6UA 3FTGA 4JFDE 5GS0L 3SGKA 4GKSB 3VXQA 5DJCA 4PGEB 4GBXA 1T1XB 4XPFH 4WHDA 1QFUL 2AJXL 2XV6B 5F96H 1QNZH 3WLBB 2NXYD 2V17H 4RGOH 3REVA 1MFNA 5ITBH 1WLHA 2DWDB 4HIHA 4JFXA 1QFWH 3WHXA 3HR5B 3DVNA 4AG4L 4PV8B 1HIMH 3ZDYF 1F4XH 4P2QD 2EC8A 3L3GB 4WV1B 3VGDA 4X7FC 2V2XB 1HHJB 1I7ZB 4U6HB 3IFOB 4IHOA 5GGTH 3C8KB 4LMQE 4H0HB 3BDYL 2R0ZH 3TO4B 3DX9A 3HG1E 5GGUB 3F62A 3CSYA 5JQ6L 1CZ8L 1A8JH 1VFOA 2IPUK 4W68A 1IGIH 5DI8B 2VAAA 3H7BA 2VQTA 5KS9A 1F3JB 4LPTA 2EDWA 1S7QA 1N59B 2HVJA 1WFUA 4NKMA 1F42A 1U8NA 3P9MB 3MBED 4JM2A 1T20B 3WS3A 1C7SA 4U1HA 1RAMA 5TE4H 3U7YH 1J5OL 3MLSL 3GSNL 4U6YA 1KEGH 2GUOA 4UIMB 1QUNA 4Y8DC 1OLLA 3NZ8B 2E7HA 3Q48A 3RL1A 3BPNC 3S3PA 2NX5E 2YD3A 1RZIA 5F9OH 3AREB 1I8MB 2ADGA 2AEQH 4UINL 1BZ9B 4M3KB 3R1GL 3ZTNH 1NBYA 1NCWL 2VDPL 4H8WC 2J6EL 4CU8A 1K3IA 2NPLX 3FFDA 1G9MC 5IHZA 2MMXA 3ECBA 1ORSA 3MGAA 1G7HA 4L29B 4ONOA 1LO3L 3RVVD 5JMOC 5DQ9B 4ZUUA 5F7DA 2B1HL 3BQUC 5K9JL 1LDPH 4UB0H 2V17L 1KG0B 1ZHNA 4I18C 4Y5VB 1BP3B 1FNFA 1J11A 3DXAE 5CZXC 1OWRM 2I07A 1BLNB 2NY1B 3NCEB 4Y4HB 3VFTB 4GMSL 3QWOB 4YK4C 4YWGL 2DAVA 2YK1L 4OCSL 4ZUTB 5FYLH 5DVNA 5HYSA 4PBWD 3GMRA 1A1NA 3GSOB 2Q86B 3FO0H 5B4MD 5BV7C 1ZOXA 2HFGH 5EOCJ 2F74B 5GPRA 4YXKH 3VFVB 5L2JB 3TZVC 4H1LG 4FQ1H 5BXFB 2IADB 3PIQB 4F2MA 2OI9C 1S5HB 5EC2A 1XGYL 4U05A 3BO8A 3QHTC 1GGBL 4PRHA 3S4SG 5L2KD 3QIWA 1VFAB 3JWDL 1ZKAA 5CBEA 3HC4H 4XCEB 2PO6A 2UVFA 3MREB 4A6YL 5IROC 3D18A 2HJLA 2G60H 5EBWA 1Z9SA 2IH3B 4M43H 4ONHA 4PJHE 3CVIH 3C6SA 3BP6B 5C9KA 1L0QA 3LAFA 2X4PA 4OAWA 4ZOBA 1P69B 3MLPA 3SKNA 3I6GB 3HE7D 5IHLB 2BRQA 3UTPD 1G7HB 3R8BB 3C5ZC 2AEWA 4FTVE 4Z9KB 1FO0L 5IVXB 5A43C 4X5WA 4XHQA 2IAMD 4WJ5B 1H15B 5C0AB 5JTWA 4PUBL 1UJ3B 3IDYB 4E42A 1T03L 2JCCB 4ZPVA 2F53A 3BKMH 5I6XC 3RL2B 4O5LH 3B4NA 1X5HA 1RY7B 2P49B 3NA9H 5GZND 5F7NC 1FFQA 4KJYB 3FQNA 3KPQB 1KSRA 1MJ8H 3IDJA 1RHHA 4TRPH 5DHYA 3EHBC 2MQCA 3C5SB 4ELKB 1NANH 3IAQA 5FCUH 4Q97A 1XZ0A 4Q2ZB 1EO8L 3AM8A 4MQ7B 1A6ZA 4PB0L 1K6QH 4CJ1A 1S7TB 1MQKH 4R2GD 43CAB 5DVKA 1KB5A 3NIDF 4E0RA 3NN8A 2VDOH 2R8SH 4XVSL 5E8DH 1IGCL 5TGBA 3A6CL 1W72A 4NOFA 5GGSA 5JPMB 5IQ7L 3O3EB 4LCCB 2Y36L 1NAMH 2NZ9C 4AEFA 3TF7C 1BQLH 2YN5A 3BOVA 4J4PC 2YXMA 3UYRL 4PRBB 1RIHL 1ZT1A 2GW5A 3ARQA 5HHPA 2F53B 5CUSL 3EYSL 1FCGA 2EDLA 1T6WA 3O81A 2X9YA 3TNNB 3KPMA 3MUGA 3PWVA 3SKMA 5F1KC 5C7XH 5F72S 3RBGA 3ULVH 1FZJA 1P7HL 3HZVB 1CF8L 2XNAA 1G7MB 5F1SA 1SMOA 4DN4H 2YD9A 3S36L 3QDGE 2YHGA 3QFJB 5JUEH 2PYFA 5CSZB 3B2UD 5F7WC 1BX2B 1VPOH 1BFVL 3BWAB 1ZHBB 1G6RB 4IEFB 1MEXH 3IKCB 5E1HB 2IQ9H 1YNTA 1FNAA 2XN9D 5D2LF 4MVBC 5C0AE 5INDB 4KUZL 1U0QA 4YBQC 1IC5L 1FNEB 2NXYC 4YE4L 1Z2KA 3V6OE 2EDKA 1WT5C 3V5KB 1KTLA 3PV7A 3MJ6A 3UTSD 2P8PB 5MP6H 4EN3C 4OF7A 4E41E 4P3DB 1K4CA 4O2EB 3MRHB 1R0AL 5HYJA 3S88L 3AVEA 1RMFL 1EPFA 2MTPA 3C5JB 4C56D 2VLRD 1AC6A 5FKPA 5C70A 2VNCA 1IQDA 5KW9L 3BI9X 3LRGA 4QRPD 1U91A 5IWLA 4UDTB 4LLUA 3IRZA 4DZ8A 1ZSDB 4PJBA 4PJ9B 4OT1L 1NGQH 4FXKB 3QXAA 2XIDA 3JTSB 4L3CB 5JA9A 3SDYL 1KJVB 1KGCE 3ILQC 3GB7A 4OZFG 2JB6B 5IFHL 1GGIH 4M61A 1QRNB 4S1SL 1I8KB 4H1LA 4PLKC 2ICEB 1FAKT 5T5NF 3S6CA 4KDTA 5E2TL 5DVMA 1W0YT 3G6DL 1KLUB 1WBZB 1D5ZA 1A0QH 3EOTH 3I6LD 3MOAH 1T20A 1KIRB 5FYKU 3DYOA 5I15L 1F11B 2DI7A 4MZ3A 3K8LA 5E95B 2A6KB 4Z7UA 3DTXB 3GIVB 4Y16C 4N5EC 3QEHB 1HWHB 3QUZB 2GK2A 1IAIL 1PD6A 2W9EH 3QEUB 5AZEL 1LP9E 3QUMB 4QXGL 1DVFB 1HYSD 4XCNA 3MX0A 1UQSB 1DP0A 3I9GL 5CINL 1KXVC 5EZJA 5DR5L 2GCYA 4KAQL 2Q8AL 4KK9D 3GK8H 3PL6B 3PWJB 4Q9RL 1WC7B 1MCJA 4BQ6A 2MHAA 3LKQA 4NQDE 1HHHA 1JPGB 5T1LD 4AENA 3OAZK 4DTGL 2D3VA 1NCTA 4GG8B 2W9DL 3O0RL 2Q8BH 1FZOB 3ZDYE 3RIAF 2QADB 5LBSH 5DT1L 1T7VA 3TT1H 2R39A 2ED7A 3BAEL 1FGVH 5IVXE 5F3BA 3CFEB 4M4RA 3MCLH 4GLRH 1B2WH 2B20A 2X1QA 3BEVA 4M5YL 3S36H 3SBWC 5TQ0L 4U6XA 4XNZB 1YECH 2ARJB 3UPRA 1NBQA 1NEZB 2G5RA 2BHZA 3QULB 1EAJA 5IBLC 1MFAL 4I0CC 2EYRA 3KYOB 1KB9J 3FB6A 4QHLB 2X10A 4QRQB 4WY7H 5C7XL 1OAUH 3ILPB 5DFWH 3C5JA 4KRNA 1KEMH 2DJUA 4N9GA 1BOGB 4YPGB 3MRLB 4CN6A 1SYSB 2QL1A 4I0PD 2WIIA 2FBOJ 4ISVB 1RIHH 1IMHC 3QIWB 3WFCL 5HBBA 1JZ6A 2CMRH 4UMGA 1JGVL 4A2LA 3V5KA 4MD0B 1CK0L 3PV6B 3F7RA 4ELMB 2OJEB 3F12A 1NQBA 1HOCA 4WEBH 2CKNA 3ZDZE 1A3QA 4NO2B 3IKCA 5DJZA 2P5EB 4JN2B 4F80A 1QSEA 5I8CB 5D7IB 1GXEA 2GAZB 1P4BL 1U42A 1PVHA 4ZS6D 3TCLA 5KSAD 5FCUL 1JMZA 2ATKA 3BP7B 4OZHE 1W0WA 4NZTH 4NC1C 4X7DC 1OB1A 2BSTB 1UEYA 3P77B 4ZNEE 3RWJA 1KN2H 4M02A 4JFYA 3T4AA 3L3HA 2DM2A 5DHVH 3IDJB 1FC2D 3IJHA 3F65A 4YBLC 4Z7OF 4OZ4B 1ZE3C 1YECL 4L8CA 1I1AC 2BNUA 2FEEI 1U9KA 3WIHA 2BP3A 4M5YH 5K9KB 1A02N 2YPLB 1ZT4B 3J7HA 1KLUA 2IBGA 1S7XB 1CGYA 4WI5A 1T03H 1FFPA 1ACZA 5IMMB 1RK1A 4HD9A 1A3RH 2NNAA 1QO3A 3G04A 2VH5H 1H3UA 4XCFH 2DLFL 2XZAH 4APQA 4CN4A 3HNSL 1V7NH 2DIBA 1NLBH 4RAVB 2Z31C 2RIKA 1XGPA 3RRQA 4TN9A 5BS0D 4V1DE 5DI8A 4KVCL 5C09B 3T0AA 4RNRB 1PX4A 1F6FB 4NKOB 3HNVL 2WBKA 3C09C 1CFTA 3QO1A 4X8JA 5FO8B 1T83C 5BV7B 2BSED 1TMCB 2P44B 1MCBA 4DGIH 1SYVB 3E3QC 3MNWA 4UILL 4C56B 3JWDH 1YEKL 2QQLH 5F7HA 4GXVL 1HHJA 4GKNA 4G6AC 1QFHA 1X7QA 5AZEH 5D7SL 5SX4H 4MXVE 5DJ2A 4GW1A 4LRIC 1LO2H 3INUL 2VWEC 1TTFA 1U58B 2MFNA 3WS6C 1W0VA 4NDMA 3RKPA 4TOYH 5B3JE 4X6CB 4ELMF 4D9RE 2YA1A 1L7IL 4ETQA 3FZUD 3G6DH 1CLOH 1BLNA 4UB0L 3GMNA 1A3LL 1Y6NR 1FG2B 2AXFB 2HFEB 3FB8B 2E27H 4S1SH 2D0GA 1UA6L 2A6JA 2XTJE 1QA9A 3MUZ1 4P46A 5TE7L 4G3YL 4YHMH 5J6HB 4CGTA 1A3LH 1QLRA 4GT7A 2AV1B 3UTTA 1KCUH 5CBEB 3HLAA 5DA0B 1BZ9A 3I3EA 1NMCC 4LSSH 4MAYD 1X4ZA 5D4QA 1MLCA 1A4JA 1V3JA 3RTQB 2WWKO 3O3AA 1IC7H 3DVIA 2CRIA 3GSNH 4GG8A 3ZYZA 1H3GA 2RB8A 3PDOA 4WI2A 4Y4KB 2XWJA 3NPSC 4Y16B 2HWZL 2CLZA 1IGTA 4DWHA 3GHBL 2D7MA 1I1FA 1HOCB 1TVDA 4K7PL 1DUYA 4XRCA 1B3JA 1YC7A 3HR6A 3DLQR 4PLJD 4Y4KA 3IAGC 4PJEE 2OCFD 4M5ZH 1VACA 4KXZI 1A4JB 5F89A 1Q94B 1S8DA 2NY3B 4PRAB 1IILE 4LL9A 1C8PA 4N9GB 5GHWL 3MRRA 4EUPG 3IS0X 2XPGB 1T04B 2O5YL 5KAQF 1U3HA 1NLBL 5SWZB 2DLEA 2V2XA 4JVWA 3TEUA 1PAMA 2HTLD 4JDZB 5EC1B 3F7PC 1HQ4A 2V5YA 1K2DA 3CFDB 3VG0L 2HRLA 4TNVK 3GGWB 1M7XA 3SKOB 1MCOH 1S7XA 2YA2A 4MD4A 3BUTA 2MCPH 4BZYA 5CEZL 2QV2A 1ADQH 3UTQA 5MEQA 4HEME 5D5ME 2BNUB 1ZT7A 4OZ4A 2QSVA 5C1MB 4L8CB 3CC5B 5DJXB 2V2TA 3WKML 2XYCA 4M62H 4D8PA 3ARPA 3TBSB 5KTEH 3D3VE 4UIKH 2EIZB 3RJQB 5IIEA 1CR9L 5E8DL 3MZTA 4JRXD 5B39A 3QUML 1FLTX 3CFKB 5ID0A 3DUUB 3QDME 4MQXD 4ZS6C 1UZ6E 5IT2L 1ORQA 1BOYA 3S35H 4RZCA 4M4PA 1D6EA 2VR4A 4NKOA 1AP2B 2YKLH 3RPIB 1VGKA 4JFEA 4YC2B 4LDEB 4MMZC 5FOBA 1XF3A 2GIYA 4UIKL 2Y25A 2DLIA 1EGJL 2XOTA 2EXWC 5C0IA 3G6AB 3MROA 2FR4A 3WFCH 2P24A 4L5FH 2OTUB 1KFAH 2H6PB 1NGPL 1FZKA 3BWAA 1LP9F 3V6OC 2VXTL 2MCPL 2ITCA 4OFYD 4AT6A 4KK5D 1BBDL 1DQJA 2EDYA 4X6FB 4X7CC 3QUYA 3VG0H 1G7MA 1Q72H 3CVHB 4L9DA 1HCFX 4U6TA 5TQ0H 4LOUD 4MXWH 4LKCB 3MJ8A 4ZXBC 1I8MA 4PJ8C 1OM3L 2GITA 5DT1H 3LN9A 4RGNC 4QKXB 2F53E 4U2YA 4OCRH 4HWBH 1XF1A 2ADJA 4JY5L 4QF1A 3ZYIA 3RWCA 1KC5L 5FB8B 4NM4H 5D7IA 4M7ZB 1CIDA 2IPTH 3PQYD 1LVEA 2CR6A 2G2RB 3MV7D 2R1YB 4L8BA 3S35X 4XAWH 3PP3H 5DS8B 1MI5E 4R4ND 5EZJB 1ZLSL 2BC4A 1QR1A 4YC2C 2GFBA 4Q9RH 3PDOB 2A6DB 3UP1A 1RJCA 3KPNA 5EN2B 2HWZH 4DQOL 4GMSH 2F9BT 2PNDA 3GSOA 4JM4H 2GK0B 3CSPA 1NFIA 2CGRL 4FMKA 4XI5D 3DVGB 5DRZA 3CXHK 1CD1A 1BQSA 2WUBH 3WN5A 4P48A 1T2XA 5K9JH 5IHBA 1WTGT 3IFOA 3BIBX 3HRPA 4WFFD 1G7QB 3K8MA 3QFJA 4FQ2L 2QADC 3RZCA 1FFNB 5F6HI 1A21A 4MCZB 4N0YH 4PJ5B 4QT5B 3ULUH 3KYMA 1RZKH 2VLKA 4TTDD 3HMWL 1HYRC 2N56A 2EDFA 3MRDB 2FNBA 5FGSA 5IVZA 3W0WB 2CQVA 4WUKH 5C0JB 4TSCH 5BVPH 1QKZH 3F7YB 4NQDD 3UXFA 3O3UN 2YZ8A 1FV1A 2X5PA 5D1ZA 4XP6H 5TE4L 3U7YL 4HBQA 2OYPA 3GM8A 4TOYL 3SDYH 2LVCA 5CGTA 3EYOB 3I50H 3NACL 4HT1H 1O7SA 3OXRB 3O3EA 4LCCA 3V6OA 3ZE1E 2F54A 1QACA 5B22A 4PTTB 4RSVA 2D31B 4M7ZC 5F7EH 2R1WB 4PGBB 5C0BB 3GMOB 5C2UB 4BSWB 1F4HA 4KMTL 2NY1D 3S37H 3LQMA 4LLMA 4UILH 4Q0XL 3AAZB 3ZKMC 3PP4H 1QEWA 2IG2L 2F8OA 5L6YH 2VE6B 4K07A 4ODUA 4YGVB 3WFHB 4NQEA 5TFSL 1EX0A 3QCVL 2FWOA 4HIEB 1DN0B 4YFDB 4LLQB 1RHHB 2ZNWA 3BJLA 2EE6A 4K94H 3DETD 1NGZB 1U6AL 2GKIA 5DJAB 1P4IH 4U3CA 5T1DL 4YAQA 3M1BB 5B4MC 3O2DH 5EU3A 2BCKB 2FLBT 4H1LH 2NY0C 2VXUH 3RWDA 3OWEA 5ACMA 4I3SL 1TTUA 3U1SL 1KIUA 5F96L 1HINL 1ZV5A 1MI5B 2XKNA 1R5IA 1DZBA 2J4WL 1RUAL 4IBLT 4K8RC 1QRND 4Y5XA 3RVXD 4ZD3L 2YPLE 3B9EA 3VFPA 2Z0BA 4CVXA 4F7CA 3CFJB 4NOBA 4I5BB 1GZPB 4NT6B 3ULVL 1XR9A 4FFWC 3QA3A 1I1AD 4WTZG 4EN3D 4R90L 5ESQB 2N7AA 4C58B 4BFIA 1KT2B 4HKJB 4NZTL 5FO7A 4ZFZB 3E2HB 2UYLA 4ZFOA 1YY8A 4MXQD 5EWIL 4H5SA 4MVBD 1H3XA 2EDRA 2NR6D 1FYTD 4MX7A 3V7AG 5DZNA 3I3DA 4MZ2A 4M1GH 2LU7A 4XCCL 1V3MA 3ARDC 1PZ5A 4ODBD 5CZVH 12E8H 1JK8B 1ZEAL 1ZS8B 5MEND 5C0CB 3HPJB 4XMLH 4AH2A 3GNMH 1DUZB 3GSXA 1IGYA 5EU5A 2WBJC 2A38A 2C3XA 3LVEA 2COQA 4OCXH 3V6ZB 5DZOA 4JGJA 5J3HC 5DD6A 1YN7A 5C0NC 2O5ZH 2IJ0C 3N1QC 1CXEA 3TBWA 5CD3B 2QQKH 2GSIA 1YMMD 5EZIL 2XA8L 1DQQA 3NZHL 4NN5C 4JY4B 1MJ8L 2P45B 5IR1B 3DURA 1F5WA 3ALXA 3RX7A 3OAZH 1UWGH 3VXPA 3OXRA 4QOKE 5E99H 3C8HA 5BCAA 1XGPB 3QH3A 4P9MH 1T0NB 1RUQL 3IGAB 4WUUB 3D25A 5D6CA 4UBDC 1WJ3A 2R2BA 2ZUVA 4AEIH 4PJIB 3A67L 1KB5L 3SKJL 2FB4H 1RK1B 4G6ML 5LBSL 4JCMA 1N4XL 3B83A 1P6FA 1MCHA 1RPQA 4HUXB 4YDLB 3BT2L 3FQTA 1NLDL 4QT5A 1KYOK 3NCBB 1JI2A 2P5ED 5JHDD 5JNYA 3FT4B 1LO4H 4S10A 1OARH 2ICEA 3TGXA 3KWWA 1KUMA 3SE9L 2WNGA 4YX2H 2ESVD 2Z4QA 3NN8B 4X98B 5MI0B 1A5FL 3BN3B 4PJEF 2QBWA 4IRJA 4QTHB 4F7MB 5BJTB 2NW3A 4DKEL 3DXAB 1ND0B 5GJTL 1NAKH 3VXRB 2RR3A 3QDJD 4L9LC 1IKFL 5B38A 5MHSE 3TPUA 2JE8A 2AJVH 2Y07H 4D2NA 4H8WL 2RFXA 5HHMD 1HWGB 2NY4C 3MV9B 4PJEB 2DTML 4NGHH 3RNQB 3TZVD 3OKEB 1JZ3A 3VGBA 2PR4L 4FZEL 3K2UL 2M2DA 2Z91B 1IBGH 1FO0A 1IKNC 3D39A 3RIFK 2GJ6B 3RGVC 3BZEA 1AD9B 3EOTL 4JG1L 3X13B 1AJ7L 5T1KB 4ZTPL 1U3HC 3WE6B 4LCIL 2ERJB 3VD7A 4PGDB 4C59B 4F7EB 3VU2A 5E6ZA 1HI6B 3O41A 1LO5B 4WNQB 4WFFE 2AV1A 4BSVB 1NGXA 1BJ1H 5IFHH 1WIUA 4NJAH 2VLRB 1CD9B 5DJ0A 1JJUA 5LQBH 4QO1A 1QHPA 5IJVB 3ULVC 3KPOA 1NGQL 3DV6A 4P5TA 1Q9LA 2DQJH 1FVDB 3EFDH 3U48A 4JM2D 4FQJL 5K9QI 4P9HH 1A9EA 2HJLB 4LLVB 1FZKB 4ZO6A 5J1SC 1RFDL 2UVEA 4RRPG 5HGBA 1K4CB 4O2EA 4CVZB 3TNNA 3LS5H 3G08A 1MCDA 1GGYA 2ILLA 2B1AL 5ILTH 2DQJL 3DGCR 5BXFA 1QPXA 1I1CA 3BPLC 4Y1AA 3OG4B 1NC4D 3LHPL 1RZGA 3LSOB 3M17B 1TZIB 3VI3E 1ZAGA 1JNHA 1MI5D 4NBXB 1IGJB 5E4IA 1JNNL 5K9OB 1HILA 4AM0B 4U1KB 4IS6B 3B9KB 1ONQA 1MRCH 2OMNA 2B2XL 4LHUD 1ACYH 3UZVB 3ULUL 5BRZE 5MI0C 5J7CC 4PGJA 5HY9B 4K9EL 2DTMH 1IKNA 4QGYA 3KYNA 4P3CH 3OAYK 1ONQB 1G0XA 4JY4A 4HS3B 1FFPB 4G8IA 2VDLH 1K8DB 1A9BA 4JM4L 1A14L 5I1DB 5J11C 3VMOA 2GJ6E 1F02I 1WK0A 4R7NA 4DGVH 4B7IA 3EO9H 3O9WA 1A7QL 2IAMB 4OQTA 4HUNB 2B7DT 3NAAL 2BFVL 1UT9A 3D2UB 5HDLA 3KAAA 1YPZB 5GIRA 1X5AA 5DFVD 4E41B 1EAPB 1F4WL 3QDMD 1C16B 1KC5H 2Y7QB 3OAYH 4K7FB 2JIXB 4UT9H 2A9NH 4APQC 5D2LE 4NKIL 4JFPB 1EO8H 3VXSA 1MAMH 4OZIB 4X6EA 1M7IA 4KJYA 1DE4B 3FAXA 4IHOB 3MRQA 4OI7A 3QA3B 4RFNB 2QEJA 2WBJB 2DQIL 3NPZB 3BRDA 4NBZB 2ADIB 4P9ML 1YEHL 4NQCB 3T2QA 2AJ3A 4FQXD 3D2UA 2H2PD 1HHKA 1QYGL 2GJZB 3NABH 1UZ8B 5IW6B 1IM3A 3BZFA 4W81A 1C12A 3SE4A 2H32H 1S5IL 3PXJA 4PGDA 3RTQA 4RMUA 1M1SA 5ID1A 5SWZD 3CIQA 1IAOB 3OB0K 4MDJB 2HJFA 2JJUA 3TT3L 3UTPE 3JUYA 3P0GB 3RVUC 3MLUL 3MV8B 4IOSD 4KRLB 3D69A 4PUBH 1BX2A 3P4MB 4JKPL 1QYGH 3OKMA 5GS0D 4YDJB 3G6AA 2FR4B 1I9RH 3FO1A 3ULSA 4PJGB 1OSZB 3B9KC 4FTVB 1EGJA 4OLWL 1FG2A 2AXFA 5D1QA 2IMNA 1AO7A 3S3JA 4R4BB 4KKBC 4G6FB 1AHWB 1EEYA 3VWKD 2LE9A 2A9NL 1WGOA 5ISZB 4JKLA 5DD1H 2VJXA 4UT6L 4L4VA 2EECA 4I9WE 3QUZC 3VFOA 4JZJB 4QRRA 1INEH 2GJ6D 2NW2B 3ZKXB 4C54A 2JJVA 1GGBH 1I1YB 5IKCA 5IV2A 4KQ4H 5F70A 3TIEB 3NTCH 4XHJC 5E5MA 4RGMB 4R97B 5FYLL 3V4UL 4JZJA 2J5LB 4PRIE 4OQTL 1RJLB 2VKWA 3KR3H 2J4WH 3TFKD 1VGEH 4N9OB 3W9DB 4DFIA 1EUUA 5I1IH 3S96B 2H26B 5D6CB 3SKUD 3MRDA 5IVZB 3W0WA 2D03H 25C8L 5EZLB 1I4FB 3PHQA 3ARTA 1LE9A 4K9EH 4N0UE 5KSBF 3LQZA 4WW2A 2M26A 2MKWA 2E7LA 4OD3L 2DD8H 4JRYE 2ARJQ 3OKLB 1J05A 5E94A 1J12A 5DK3A 1P7KB 4CADB 1B0WA 4I48A 4PJHB 1YYLH 4DAGL 4YHKH 4HAFA 2QLVB 3DMMC 1LE9B 4P2QA 5L6YL 3H9SD 5FYJD 3GMQB 1I8LC 3M17A 1KCKA 2ZSWB 3S96A 3E1F1 1S9VA 3U7WH 1TFHA 5DUPL 2X05A 5E8NA 1H15A 5C0AA 4LHQB 3RWIB 4O9HH 4ERSH 4Y19E 3IDMA 2VXQH 1A6UH 4ERSL 1MNUH 1GRWA 1RIUH 3LD8C 4UDUA 4PJEA 3RNQA 3S7GA 1J8HE 4EVNA 4L8DB 5FGRA 4HMCA 5T33H 3ARGC 5F8QC 4U7SA 4LSSL 3ZYOA 4KI5C 5EBGA 1FYTA 4XVTH 4WHTB 4APQD 3QPXH 4JB9L 1RI8A 5IJVA 3SPVA 4XTRC 1JGUL 1EV2E 3ZE0E 5LVEA 4QXWA 3P0YH 4MD0A 5HSFA 2OX5A 3MLYH 3MQIA 4HJJH 2DD8L 4ZQKB 4KVNH 4WNQA 3BVNA 1AD0B 1YMHA 4Y1AE 5CWSB 3IDIA 5C0GB 1NMAH 5CJOL 1U8HA 1I9JH 1QSFE 4PRPA 1RJZA 2HKFH 4JFDD 2FX9L 3MMEA 4PJFF 3DWTA 4KH2A 4LCIH 1O5DT 3KR3L 4PG2A 4QHLA 1JGDB 2YD8A 2R15A 2OM5A 5CSZA 5EU3B 1KNOB 1MJJB 1C12B 2BZDA 3LEVL 5IQ9B 2G75B 3NTCL 4WI3A 4GRWE 2J88L 4JFFA 1HQRA 2BNQB 4NGHL 3RWHB 3WL9A 2JJTA 3FFDB 1UFUA 3MRIB 5IHZB 5D7SH 1DANT 1SJXA 4PV9B 1EMTH 3RPIA 4YQXL 3SDAD 1IKFH 1JCKA 5J8OA 4KRPC 1LE5B 2AQ1A 2YD1A 2H32B 4L4TB 5GJTH 3P11L 5FECA 2JJWA 2G5BB 4OFIA 1UM6L 5HHNB 2DQTL 4BK4A 4PBVC 2D7QA 4PIRF 4NNXB 1KPVB 1Y0LA 4PJFE 2F54E 1V7NL 2YBRB 3GSXB 1DUZA 2ZPKL 4HULB 1T5WB 2VAJA 4HUWB 1N8ZA 5JDJA 3SDAA 3BT2H 1RZ8B 5GZOC 3F7VA 4JKPH 5SX5H 4L3EA 1QBML 2JLLA 2VZTA 4MD5B 4G6MH 3EYUL 3QB7C 3CLFL 2VXTH 3SCMB 2PETA 5IMMA 4IDLA 5FA4B 4H5SB 4L5FL 1I1AB 4NZJA 4G8IB 3DARA 1CLCA 1LD9B 4QRSA 4GRLB 4YHZL 3MV01 4NZDA 2HH0H 2V5SA 1JMXA 5EZOH 5ABDE 4WV1A 3BP4B 3RNKA 2AJYL 4J4PA 1ZLWH 5JORA 2KBGA 3WN5B 3BQUA 2BVTA 4PP1C 3GSRA 4O2CB 5MENE 5C71A 1ZVSA 4UOW1 2HG5B 5KSBB 2QQKL 2HJKA 2UZXB 2DTSA 1JTPA 4E42B 2W91A 4ZDHA 3VWJA 2ATKB 1MFDH 5EN2A 5D1XD 2PXYD 4PGZA 2IANA 4QHKI 1GC1C 3O6LH 2YXFA 5L8JB 2R1XB 4ZS7L 3QUMH 1AIFB 3VGEA 3U9PL 1YZZA 4LSUH 4QRPA 4HUKB 12E8L 4OLVH 3EJZD 2F5BH 1GCFA 3NAAH 2IMMA 3PDGA 3RZWA 2BY1A 4JO3L 3ES6B 2QADD 4Y4HC 1JGVH 2RFXB 1OL0A 1JTOA 5CIPA 3QIWC 1DN2A 5HDOA 1RZ7H 3GJFH 3SOBH 4HUVB 2BY2A 2JJSA 1NBZB 2YRLA 4A6YB 3EZ8A 3UMTA 3VH8G 1AKJA 1U8MB 3I2CL 3IDMB 1P7QA 3RHWF 3FQWA 1MCOL 5F9AC 2X44D 3S5LG 3IU4L 4BSWA 3U0TA 3UJJL 2EZ0D 4Q9QH 4F15C 1T83A 2CPCA 5KOMC 1BZQK 4AQ1B 2MJWA 5GHWH 1CU4L 3V95A 5A40E 4FFYL 1T7YA 4C4KO 3NIFE 1NBVH 1OLZA 1CIUA 4XB7A 3GM0A 1BIIB 3UYPA 3IDNB 2VXUL 3KYNB 1GGTA 2R9HD 4Y5XC 4DTGH 2DQGL 4PJ5D 3RY5A 3MRJA 3LHPH 3QUXC 1AD9A 1J0KA 4RAHA 1MFEL 1JUFB 3BPOB 1NFKA 5FV2A 3QI9C 3QQ4A 3QCVH 4YIQA 3LZFH 5FF6A 4IOIA 4WI7A 3WNOA 3ULVE 2ADGB 3ZKSD 4Z0BH 4WO4C 1T21B 2A6IA 4RA0C 5BS0A 5FUZH 3TPUB 1RJYA 3QDHA 5EBLA 3I02B 4PY7A 1BQHB 3MOBH 2YPKA 4J3UA 3RVUD 1A7NL 5J6GA 4CMHB 3GSNA 3V5DA 5EA0H 3GRWH 1MCRA 4QRPE 3AGVA 4AH2B 1UKQA 3QNYA 4U0RC 4NKMB 3PHOA 3NACH 3RTQD 3L3JB 2D0FA 2LFGA 2VDMH 4V1DB 2VERN 1U92A 2HTLC 3LRSB 5I16B 5EB9A 2HJKB 3CSBA 1JPFB 1QKZL 4HK0B 4HG4J 3HC0A 1N2RA 3S8WA 2CKBB 4ZTPH 3HMWH 3MOQA 5C9JA 3FCTA 1T1YB 1B0RB 3X17A 2ATPB 5HDQL 2AV7B 3QQ4B 1AGEA 1CGTA 4PRID 1JTTA 1PX3A 3MV8A 2FJFB 1SJHA 3DV4A 2DQDH 3HR5A 3V4VL 4AL8H 1OB1B 2BSTA 1D5BB 2QQLL 4GLRI 3VH8B 5GSVA 5KW9H 5JXAL 3DURB 1II4E 2CGRH 2FL5B 4DGIL 3N50A 5EIVA 2P47B 1AGDB 4GOSA 3VGAC 3GBLA 1OGAE 4LLWB 1J10A 5CD3A 4KKLD 4RA3A 4OSUH 4O02L 3WNNA 3SE9H 4GG6F 1MAKA 1QFOA 1SY6A 1CE1L 1X5FA 5GGVL 1CN4A 4LNRB 4KDWA 4HUUA 2XZAL 4Y5YB 4FS0A 5DGRA 2NW2A 1PJ9A 1U8OB 3LDBB 4J4PD 1DDHA 3VXRA 1JYVA 4M9PA 1N4XH 5TDNB 3OF6D 2C4XA 5IJKC 4LLMB 1QLFA 4NC0B 2PN5A 2A73B 1G9ML 1MFBL 4HBCL 2R56H 3EOBB 5GGTA 1A1OA 3CXDH 4JRYB 4YJZL 1T89C 1KNOA 4FXGB 2HT4C 2QJDA 1AIFA 1FORL 3QG6B 3REWA 3U79A 1BBDH 2HT3C 1KN2L 4EJ1C 4R8WH 2QHRL 3CFJA 3X11A 3RY4A 2XA8H 3EYSH 3SKMB 3I75B 3BP5A 3BPCA 5EFIA 2IALB 4QXUH 5DQ9A 3DSFL 5ICXB 4WV1C 4XPAH 3U30B 4LCWD 4S1DC 3ZT6A 3L7FB 1UZ8A 3P3YA 2V5RA 4RMVA 4JDTH 1QPPA 3EO1A 3X12B 4YXLL 4QOKA 1GC1H 3D9AL 3QIUB 1X5LA 2BVPB 2W92A 4Z95H 1X7QB 4TVPL 3H8NA 3V0VA 1J05B 3QIBA 5E94B 5GS1C 1G7IA 5K9OA 1RULH 5CP3A 4HIJA 1FZMB 1JVKA 1OY3B 3P4NA 3TN0D 2IQAA 2VUYA 4P46D 3V6ZA 1IGML 3UBXG 3BISA 3QEQE 5F7KC 4LKXA 1C5CH 1V3LA 3WJJC 2H2SD 1JZ5A 4XGZB 4XC1L 4JFEE 3STBA 3KGRA 2D4DA 2YD5A 1XGRB 4X5XB 4GBXD 1KCLA 5B21A 4YHLL 4OFDA 3L5WB 1O0VA 4PY7B 1QSFB 5DHXB 3L5XL 5FKAB 1X44A 4K7PY 5CEZH 4JRYD 4OZGB 5D1ZB 2W0FB 3MO1B 2Q8BL 4XH2B 1CDJA 2D7TL 3SQOH 1L6ZA 4F7PB 2ZPKH 2AK1L 2CKBH 35C8L 4TPRL 3QNZB 5D1QB 1ZXQA 2WUCL 2WZPD 2DWDA 1PSKH 1BD2D 3REVB 3O4LE 2A9ML 3BW9A 1JV5A 4Z5RA 3FONA 5JHDB 3PDDA 4TNVF 5TFSH 3CZJA 1MRDH 2IFGA 3QIUC 2QHLA 4URTB 1RJLA 2IG2H 1DQMH 5D1XC 5FKPB 1BAFL 4UI2A 5I9QB 1UJTA 5KAQG 1J0IA 1KF9B 4KI1A 4F8TA 4XCEA 3ZDXF 5F6IB 1YY9D 2HVKA 3TO4D 1T2QH 4GRWH 4NRZB 4RGNB 5DJAA 4K7PH 1HH6B 3GHBH 5AZ2H 1BJMA 1BFOB 1WTLA 2EYTB 2VIRA 5L7XL 5ESVA 5FYLE 4PJ9C 1AP2A 1T4KA 1Y18B 3KJ4C 3L3DA 4QGTA 3PG2A 4PD4J 2HTKC 1A7OH 4Z18A 1ZA6B 4NJ9H 3VXNB 4EXKA 2QQQA 4RMTA 5D6DA 3OKDB 4X6EB 3JV6B 4TSCL 5BVPL 1KCUL 2Z31B 5LXGH 2UYLB 2VUOA 1KCRH 2VC2H 1JWMA 1NMAL 1OTSD 4RDQF 4J8RA 3CFKA 3VRLE 5ID0B 2AK4D 4MA8L 2AJUL 5H2BB 2V7NB 3W9EB 4MS8C 3QFJE 2FATL 2J7LA 4J3WA