5CP7B

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
DVQLRESGPDLVTPSQSLSLTCTVTGYSITSGYSWHWNRQFPGNKLEWMGYIHYSGSTNYNPSLRGRISITRDTSKNQFFLQLNSVTTEDTATYYCARYGGYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 214
sequence length 214
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B01
4Y4KA 5AYUL 1W72H 4MHHG 3HCVA 1GGUA 3EOBA 4XXDA 1U8JB 1CD1B 4XAKE 1M05A 1FDLH 2XXMB 4O2EA 2DM4A 4OFYA 3BD5A 4QGTA 4ZD3L 5F8RC 3ZTJG 5A43C 2IH1A 3VXPB 2Z0BA 4ZFFA 4JKLA 1ZHNA 5DK2A 4ZS6C 1WBXA 4D3CL 4DFIA 4CL7A 1QQDB 4L8CA 1XF5B 1P2CB 1SQ2N 1U8NA 4D9QE 2XFXA 4L3ED 3S3PA 1KYOJ 3ARDC 2JIXD 1QBAA 4N5ED 3KPMA 4NRXB 1UQSB 5D2LE 4P48A 1XF2A 3CMOH 2GITB 3I6GA 3ZLQC 1MF2L 4ZAKD 1JGUH 1U3HC 4UT9H 3FCTB 2IAND 3QUMA 1ZA6B 1ZKAA 3OB8A 4PB0H 3H7BA 4H1LA 5IB3B 4FTVA 2NNAA 1XR8A 2JCCE 5TGBA 3O11B 1RK0A 2NY5H 3A6OA 4G6AD 1VADA 3H9HB 3T4AB 5EUOB 2HJLA 3TBTB 4YXHL 1JN6A 5DQDL 4XMLL 3FT2A 3C5SB 1UWGH 1QACA 5ID1B 4LCUB 2CR6A 3EYQD 2C4FU 4I77L 3UTTE 2VZOA 3BZ4B 3JZ7A 3WIIH 2AABH 4HXBH 4XB7A 4EUPB 2BNUA 1D3CA 5ELIA 3UX9B 2ADFL 1A6UL 3VG0H 5IVOA 3VDCA 3PDOB 1YMMA 3LZFH 5EWIH 4EDXA 2VWEC 4JY6B 4K94L 4OT1H 3MCLH 4L8SA 1G7LB 1VA9A 2FEEI 5D8JH 3U4EA 1H15A 4JZJB 4DN4H 2OX5A 1F4WL 5JZ7D 1CFNA 3KYKH 4M1DH 1XGRA 1X4ZA 5JW4R 4YHMH 2I9LA 4P5TB 3ECBA 1U36A 1II4E 4JKWA 3ESUF 4NN6B 2Z93B 4EKXA 3RZCD 3LKNA 2X9WA 4OTXL 1RSFA 5M95B 1P5UA 3FAXA 3KPLA 1IEAA 3SDCB 3FB7A 4NO0B 2PO6A 3U0WH 3OXSB 5ADOH 5E8OA 1RU9L 1GSMA 4D0CA 4ETQB 4K94C 1AKJA 4NYLB 2QR0B 3R0MA 3MR9B 4MQSB 4U0RC 3HI1A 4ODSL 3KPSD 5E08L 4LK4A 1E4XI 4LAQL 4YWGH 1DEDA 2R2BA 5HHVH 2ZG1A 3KXFD 1RJLB 1EJOH 2CO7B 4RSVA 5FCSH 3U9UB 4XVSH 5EU6D 3FT3A 1S3KL 3D85D 5BV7L 2N56A 2Z91A 2PYEE 4XBPA 4JM4L 5GSVB 1BQSA 3G5YB 1MFCL 5D7JB 5IT2L 4PJXA 3IFPB 3CK0L 3RIAK 2W91A 4MDJB 5ITBH 3LS5L 1NAMA 4UOW0 2V7NB 3BKYH 4Q2ZA 5ESQA 4AG4H 4XHQA 2BHYA 4P2OA 1MIEH 4H88H 4PV9B 5DZOA 1WC7B 2H8PA 3S6CA 1YEGH 4HUMB 4ZFZB 2BNQA 1J0ZA 2V2WA 3EOTL 1P84K 3DURA 3DBXB 2BOCA 3LEXA 3UJIL 3MV9B 4OJFH 3E3QC 3JVGC 5C0CE 3CVHB 4NOFA 4YQXH 3L3DB 5GGVL 1ZXQA 3C60B 3QNXB 2FBOJ 1I4FA 1R5IB 5FGRA 3BZFA 4OZGF 5IP4A 4EOWH 1KPUA 1KT2A 2H45A 3BDBA 5IROA 5BV7C 4ZXBA 2AI0L 1LHZA 5FDWA 2BSTA 1TVDA 1QYGL 1HCFX 5K9QI 2W0FB 5LGJA 3RTQC 1KLUA 5FYKE 5CSGA 1DBKH 1ROWA 1CG9A 2CMRL 5IMKA 4GG6B 3STZB 4TVPE 4F9PA 3UTSA 3RWDA 4PJFE 5FV2A 3ZSSA 4P23A 4M6ML 4LFHD 3MRHA 2C3XA 4JPWH 1N59B 4R0LC 2H2SC 5DUMH 4LCCB 4OZGA 1Z9SA 5C0IA 2Y1VA 4MJID 5K93A 4JJHA 1MFDH 2NX5D 3QWRA 5C1MB 3B43A 3EW3B 1YN6A 4Z7VF 1KJ2B 4K3JL 1PJ9A 3VXOB 1UG9A 3QEHB 3LVEA 3LKSA 1KG0B 5BRZA 1FO0L 3WJJC 1AGBB 1EAPA 5IJVA 5IFJA 4KK9C 4KMQA 4PLNC 3QUYB 1NL0H 2HFFB 3V79C 3QG7L 1VGKB 1IAOA 5GQBA 2OI9C 1MIMH 3QDMA 5CIPB 4PLJD 1QVOA 5JXAH 4U3CA 1XH3A 4Z76A 1JHLH 2VDML 4HAGA 4GW1B 2C4XA 3RIFF 4JFFD 1CTNA 1DQDL 3FQWA 4U6TA 5IB5B 5C09D 4CRPA 3PL6C 5KAQG 4JRXE 1FSKC 2B4CC 2XG4A 1XF3A 1OF2B 2EZ0D 4PFEA 2E7LA 1JPGB 1RZJC 4KQ3L 3NCBB 1FLRH 1WBZB 3CFJA 1RZGB 4UBDD 5JW3L 5D5ME 4O5LH 5I1HL 3F7YA 5MERB 5ADPH 3MACH 4L9LA 4N1CA 4NHCH 3C9NB 5JW5A 4DUXA 5CEZL 5DUBB 4KHXL 5E5MB 5MEPA 1YEEL 4MNQD 1K6QH 2PW1B 5H94A 5SV4A 3S35X 4DZ8B 4KJYB 4X6EB 4BUGA 1EHLH 2P46B 1SMOA 4KKAD 4NJAH 3FAWA 3LRSA 4LHUG 3MV8B 3BUYA 3FO0L 3VFRB 1MNUL 2ED9A 4JQIL 1DBML 4RGMC 4OD1H 1KJ3L 5T5FL 2CDFB 3ULUL 3D9AH 4EBQL 2XPGA 3OXRA 1BOGA 1ED3A 1HINH 4K8RD 1X44A 1HH6B 3D39E 4U6XB 1JV5B 1S9KC 4JG0L 5IQ7L 3PP3K 2EIZA 6FABH 4RRPA 1KYOK 4GW5B 1FV1A 2MSPA 1J1PH 1SJEA 4RWHA 1SMAA 3V0AC 1QR1B 2BY1A 4F7TA 2X4RB 5DFVC 4PUBH 2M8XA 1OOAA 1T7WA 4TNWF 4B41A 3WLBB 5I66B 3DX9B 5DURB 5I71B 4NO5B 5I19L 3V5KA 3RGVB 3IKCB 3QQ9C 4HWBA 4F2MA 1MLBB 2ZCKH 4MX7B 4OF3A 3GJFH 3VGBA 2XA8L 4R2GD 5HI4D 3PHQA 5DK0A 4GRWH 4OQTA 5KSVA 1LMKA 4OCNC 1INQB 3ROLB 1NDGB 4NKIL 1U6AL 5EBWB 5FXCH 3T65B 4PJEF 3LKQB 1FL3B 4B0MM 3K8KA 2H9GA 4MCYA 4GMSL 5E03A 1JNHA 3UPAA 5JDJA 3B2UC 5DSCB 2VR4A 5E4EB 3FFDB 1MLCB 3GMLA 3DV4B 4LLDB 5KTEH 3I3EA 4S1DC 1S7QA 4M62L 3UPRA 1U58A 2IQ9H 3O2VL 1EHNA 3QDGD 1SVCP 4OLEA 5BO1L 3GUTB 2Q3AA 4X4XA 2ZUWA 2ZSVB 5DLML 2C1PB 2V2TA 1DSFH 4AY0A 4TTDC 1OL0A 3O6FB 1VFAB 3PP3H 1HH9A 4NSKB 2P5ED 5CSZA 5E7FA 1ZLSH 3RZWA 4FZ8L 4U1GB 5CJQL 1T66D 4MWFB 5HPMB 2CRZA 4F58L 2I26N 3SKUD 5DTFB 3OTTA 4G9DA 1L6XA 3MV11 1U8PB 4FQ1H 3F58H 1VSCA 3K4DA 1OWWA 2FIKB 2DKMA 1T89A 4BSVA 3GSNH 5FYJE 1ZT7A 3QEQB 4JHAL 1CFQA 1VKXB 3QFJB 4KJWD 1P7QD 2FEDD 4KVCH 1LO5A 2KDGA 1EGJA 3QDJE 3OKLB 3O0RL 1XF1A 2ZOKB 3ALXA 4FQXA 2X4PB 5EC2A 1GPOH 1ZHKA 1TVHB 4OGAC 2VLJD 4NQDB 4JY4B 1IGIL 4I18B 3REVB 1I8IB 2ZUUA 2P5WB 5D2LF 1IAKA 2V17H 4OCRL 2PYFA 3RA7H 3LOWA 4ODWB 4F7EB 5AZEH 4PJBB 4KGJA 1FJ1A 5JOEA 3SDDC 1CIDA 2YZ1A 4C56A 1WQVT 5LAXB 2VSCA 1B6DA 2VUOA 1KTLA 2JCCF 2Q3ZA 5HTSA 5T3ZL 1MI5B 5DVNA 4WWKA 5IM7B 2N4IA 3OKEB 1Y0LA 3WS3A 1JPSH 1LE5B 3LV3B 3KPOA 2V7HA 2ZG2A 5E24E 4IEFB 3BP7B 2I5YH 3EHBD 1A1OA 1HSAA 3LMJL 4ENEC 1VHPA 1ZGLA 2JCCA 5LGHL 4QRRB 4AYFA 3RL2A 3O4LD 5C0RL 3WHE1 3C09C 2AJUH 4P2QE 4JFXB 5INCA 1UM5H 3D48R 5E1AA 4APQA 3SE8H 5C0DA 5ICXA 1CL7I 3JV4B 1MVUB 3AU1B 4QHMB 3U36A 3ZSTA 1DLFL 2YBRA 5FO8B 1IQWL 4UILH 2FNBA 4QRUB 4P5MB 4P2RB 2ZUQB 5IW3A 4U6VL 5C07D 3C08H 5DMYA 3ETBF 1NBVL 4OM1L 1FVEA 3FL7A 5EULV 2ZKHL 5TJWK 1W8NA 1DQTA 4PRHE 3MYJA 4TSBH 5AZ2H 3BPNC 3H9SD 4POZD 5DMGD 5GHWL 4M7ZB 5I76B 1Q9OA 3BD4A 4LCWD 4NRYA 2J7LA 5DVKA 1N64L 3MJ8A 3I50H 2QL1A 5E0QA 4O2FA 1D7FA 1MHCB 1EEUA 1T1WB 1YEKL 2BMKA 3S5LB 4ONGL 3ZTNH 5I16A 3T3PE 3WO4C 1DLHA 1AQKL 3T0AA 1NGXA 5ICZB 3MV7B 2X42A 3KNBB 4Y16B 1MWAL 3MOBL 4GG8A 1GAFH 3S98A 5B38B 5MEOA 1OW0A 3RVWC 2PTTA 1IBGL 3VXRB 1KCSL 4Y4KB 1QSEE 2BY0A 4XXDB 1DBBL 3INUL 4ZPVB 1CLOH 2EDEA 3KYMA 1M05B 5IMMB 4X7CC 2DLHA 2FATH 4FXGA 4DKAA 4PJ9C 3WIHH 3BUTA 4R4ND 1ZV5A 3OAUH 3OAZK 4PRBB 1I3RA 4TUOA 3V8CA 1UJ3A 2FR4B 1UXSA 1ZHNB 1YUHB 1A4JA 1LO3H 4P59H 1GIGL 4R4FH 5JA9A 1Q9LB 3ULVE 1U8NB 4G8FA 5IOPB 4Y19B 4EUPG 5KVFH 2XFXB 1RUPL 3BXNA 5AD0A 3S36H 3HLAB 4JR9H 4M7LH 4NPYA 2NY3C 3KPMB 2PYEA 2Q6WB 3QHZH 1UA6L 1UZ8A 4HIXH 3C87A 1T0NB 4PJIA 1EEYB 3AAZA 3GM0A 4R6UA 1PFCA 2FHFA 4IRSB 2JKXA 3SBWA 3VGFA 4TSCL 1IL1B 1EMTH 3DYPA 4Y4HB 4NN5C 3TF7C 1BBDL 1W0VB 2UZIH 4RBPK 1YPZB 2DKSA 3OKNB 1VGEL 1GL4B 5IGXL 3WO3B 4YEEA 4NZTH 3MUZ1 5E2TH 4LIQE 1RUMH 2X1OA 2NY0B 2XQYG 1N6VA 2FYYA 2CKBL 4MLIA 3T4YB 5C0CA 1H3PH 4LSPL 4PJFF 4X80L 1KNOA 1JGDA 4R97C 3QR2A 4S1RH 5C0FB 3S35L 3E1F1 3JSSA 1G7IB 4LEOB 3PHOB 4NO2A 3ZKND 2I60L 3U1SH 4N90D 3UROR 4PJ7A 3NZ8B 1U8IB 5LG1A 5EA0H 3QO1B 4KZDH 4G6KH 3X14A 2J8UE 1D5ZA 1H15B 4CMMB 3CFBB 3CUPA 4PJFA 1CFNB 1WFTA 3MFFA 2Q7YA 2AQ2A 1UH3A 2AJYH 2YMXL 3GNML 4N5EC 1C5DA 3OAZH 4FP8L 4WHYH 3WFDL 4UQ2A 1HHGB 1UEMA 4EVNA 4WTZG 3LKNB 3L7FB 4TRPH 4IIQA 4M43H 1IAMA 4ZAKC 4GAJH 4IS6B 4AMKH 1NFDE 2ZOLA 3QPXH 1RVFL 3IU3B 2FCBA 3T2NH 3ARXA 3WNOA 5EPMA 2EO9A 4LCIH 5KS9E 4WHDA 1Z3GH 1Y6KR 5DJ0A 5D5MF 4G6AC 3U79A 4R8WL 2APVA 1WWAX 3TH2T 3EDEA 5EBMB 2AKRB 1AKJB 1HHIB 1X5GA 1F2XK 3DUUA 1VEPA 4KQ4L 1E27B 3HI1B 3MRLB 1I3GH 2JE8A 3DGGA 3EYQC 5A16B 2DRUA 4WUUE 5AYUH 1IGCL 1IGYB 1D9KA 4YH6A 4C58B 4M4PA 5ISZB 4LLUA 5T1LA 3VMPA 3W11D 2EDYA 3BW9A 3B8YA 1ZEAL 3OR7A 1J8HA 4FABH 2BXYA 2WQ8A 4B53A 4FNLL 3ES6B 1BJMA 5JXEA 4UNVA 3OQ3B 5JW4N 4XBPB 5D5MA 4L4JA 1GZPB 3OG4B 3QA3B 4D3CH 2PW2A 4FTVD 1X7QA 1EXUB 4KKLD 4LSSL 1R5VB 5JZ7C 3A6CL 4DK6A 1V7NL 5HGBA 4YDLC 5TFSL 3RWEA 1A64A 1NGYA 3HMWL 2GK0B 2BFVL 2V6HA 4CU8A 3MRMA 3RZCC 4CADB 1K5NA 4H0IA 2VERN 4ISVA 2YA1A 1MF2H 1CS6A 5IBLD 1QBLL 4WY7L 1YMMD 3B9KA 5C8JA 1I4FB 5HHQB 5CJBA 4H8WL 4FN0A 3PGDA 1HKLH 4UU9B 1MUJA 1NANH 2P44B 2BRQA 4ZXBB 3HZKB 3H3BC 4YXHH 5DQDH 5ENWB 4XMLH 5HGAB 3WL9B 1ZT1A 1ADQA 2IG2H 5E99L 3DI2B 1L0XA 4I77H 4L29B 3V5DB 1FN4A 5IMKB 1YN7A 4NKMA 3O3EA 3NA4A 1A6UH 4P23B 3QAZB 2W9DL 3MRHB 3EYVB 3NFNB 3E6HA 4OZGB 3VRIB 4K94H 1CI5A 4NKQB 5C0IB 1RUQL 4GRMA 5AEAA 2NY4D 4PGCB 1RZIB 1HHHB 3ZYZA 1IJ9A 4X98B 1F4WH 1SBSL 2B7DT 5DA4A 1QFWH 4NCC2 3LKSB 4Z7WB 4Q6YA 3B3IA 1CFSB 1RZFL 1GGBL 4KH2A 4MQXD 5CMAB 2EICA 4HCRH 3CX5K 3F7PC 4OTXH 3HB3D 3QRGL 4UINL 2Q7NA 25C8H 1UCBH 5ALBL 2VISB 1IC4L 1WITA 1TPXC 3O45A 4I2XE 2EYTA 5KW9L 1BM3L 3O2DL 3TYGL 2EXWD 4Z7VB 2R4RL 5DHVH 1I7UA 1IGFL 4YGVB 3BPLB 1XF3B 2XTJB 5F93C 1QFUH 3AVEA 4ODSH 5E08H 1KCRL 2QSTA 1IMHC 4LAQH 1T3FB 2MFNA 4NT6B 5IEHA 2BNQD 4OD3L 2FBJL 1S3KH 4QXTB 4XI5D 1HYRC 2W9EL 5BV7H 3QQ3B 5K9KA 4KGLA 4JM4H 2AXGB 2QLVB 1MFCH 5IT2H 4GUPB 4HQQL 3BUYB 3CK0H 2YUZA 4MAUH 3LS5H 4LMQE 3ZDXE 3VW3H 3GDBA 4TNVF 3MJ9A 5DEGB 2VDLL 3IU4H 4XTRD 1FHGA 4YJZL 2X09A 3SJVD 1A6TB 2VKXA 3RUGE 1YNKL 4MXVE 4JDZB 3EOTH 4PLKD 9CGTA 4RFNB 5DMKA 1UM6H 3CVHL 2BK8A 1NGZB 3UJIH 4PLJC 2R4SL 1EFXA 3RAJL 3UTSD 2VYRE 4PBXA 3QDJA 5GGVH 2LABA 1FV1B 4KV5E 4MZ3A 2XA3A 3GMRA 2B1HL 2AJXL 2FB4L 2YEZA 3JTSB 4DAGL 1OGTA 3FT4A 3ZTJH 1W0WA 3GKZA 1KJVA 2AI0H 2F53E 2EZ0C 4HLJA 1O5DT 2GTZB 3QWRD 2GJ6B 1QYGH 1DVFD 2R2EB 4UBDC 5FYLL 2VITA 3OJ2C 3K80A 1JYVA 1FNAA 4QGYA 3V5KB 4OLXL 5CHNA 5BRZD 3SKMB 1HNGA 2CMRH 3VWJB 1V7ML 3PWNB 2W59A 5DK0B 2X4TA 4M6MH 1RQ5A 2NTFB 3MGOA 4KKAC 2YPLE 1H8NA 2B4CH 4WIQA 1OP3K 4L4VD 2W65B 3QQ4B 1TTGA 1KJ2L 1WBYA 5M7QA 3WNPA 1T80A 4XRCA 4G6JL 5HDQL 2K7PA 3BT2L 1F3JA 2H9GB 1IKNC 1Q9WA 3JWNC 1X5YA 2ADIB 3ARUA 1FO0H 4K8RC 3UBXI 4DUVA 2CH8A 4MLSA 3QG7H 1ZOXA 2A6DA 2UY7A 2UWEE 1U58B 2OJZL 2VDMH 1DQDH 4PJ8A 1G7PA 4QNPE 4PJEB 2GSGA 2V2TB 1VENA 3UC0L 1M4KA 3FQXB 3UTQB 1EZVY 4GAFB 4NQSB 3T3PF 2YD4A 3FN0L 4F15C 3AB0B 4PTTB 1U95A 3I75A 4KQ3H 1UC6A 5CSZB 4LHQB 2ADJB 1BP3B 5JW3H 2BDNL 4Q6IC 1H8OA 5I1HH 3EO1A 4ZUUA 4HIJB 4JFQA 4R2GC 4LPWA 5HI4C 3K1DA 3SGDI 5CEZH 4Q9RL 4KHXH 1OSZB 5ANMB 2AERT 3L5WB 2EYSA 4I3GA 3FMGL 2YD1A 3DGCR 2EEAA 3Q1SL 1IARB 4HBQA 5E00A 4BSVB 3ARZA 5TPWL 1ZT7B 3FO0H 4I5BB 1MNUH 1Q1JL 5AAWA 3Q0HA 4JQIH 2G5BB 1A7RL 1DBMH 4JO3L 3GIVB 1KJ3H 2IAMD 5T5FH 3ULUH 4EBQH 3LQAL 3ULVF 5I8CA 4PGZA 1O7SA 2H26A 1OP3H 4GAYA 1FZMA 1QSEA 4HHAB 3OAYK 1ZHKB 4WFHE 4HV8B 4JG0H 4U6HA 2H32H 3QNZA 4QRPD 1SVZA 4U31A 1FNEB 3RWJB 1BF8A 1H5BA 3MNZB 1BBJA 2OSLA 1G0YR 2MTPA 2VH5L 2AV1B 1OAYL 2IMMA 1I1YB 3KWWA 2DQCL 4DQOL 1V3JA 3K2UL 5FA3B 1T0MA 4J3WA 4YDIL 3EYOA 1S9WA 4KJQD 3H9YA 1NFIB 1NMAL 1AD0B 3RIAF 1T66C 4HK0B 5I19H 3ZYJA 1Y0LB 3LEVL 5GGTL 5D2LB 3KPOB 3QFDB 1XCQA 2XA8H 1VFMA 5GGSA 2VC2L 3DX6B 3OGCA 2XZQL 3EDKA 4XP6L 2X4SA 4B7LA 4D0DA 4R90L 1WWCA 3O3DA 2DQDL 4NKIH 1RULL 1OP5K 1U6AH 1K4DA 5D96C 3S5LG 2JCCB 3IAQA 4KJWC 3P11L 2FEDC 3MRCA 4P4KA 1S9YA 4GRLA 2J8UF 4M3JA 4B50A 5B38G 3MRBB 5K9JL 4YPGB 4ZO8A 3T8XB 3U36B 5HYQA 3UTTB 2HN7B 2YBRB 5BMFL 2F5BL 1TZHA 4WJ5A 2HRPL 2JJTA 1UGNA 3EYFA 3LKOA 4M62H 2RHEA 3UYRL 5HHNB 2VE6B 3O2VH 3GBNH 1NFDF 4HAFA 3GO1L 3VI4E 1I8MB 5DLMH 2PF6A 5EBLA 2WUCL 3BEVA 3CFCL 4OZFA 1J05A 3NVQA 5TDPA 3U0PB 2DI9A 4D9RD 2CLVB 1TCRA 4FZ8H 4P5KB 3Q5TA 4WI4A 1U3YA 3LN9A 4XZUB 2EE9A 1EZVX 2KL6A 4F58H 2NY1B 4FQXD 4G8GD 5E2WL 1GH7A 3DX8B 1IM9A 2VWEE 2WBWB 3THML 3IFLL 3EHBC 2VQTA 2ZCLL 1PEZA 3ULSB 3F12A 3TH3T 3MBEA 5L9DH 5IHBA 4LVOB 2RFXA 5KS9A 4KAQL 1JGEB 4MMXC 3QXAB 3ESVF 4C56D 5IB1A 3VD3A 1G7MA 2F54E 4LCYB 4U1NA 4NP4L 3GK8H 1BLNA 3O0RH 3QP3A 2DQUL 1ZE3C 3LPFA 4WUUA 1L7IL 1UJ3B 3MO1A 4WWKD 5T3XL 3MRQB 1Z9OA 1A4JB 4PRAB 4MS8D 4RGOL 1LEGB 1QO3B 4G8FB 1DN2A 4NFDA 3X13A 5HYIA 4OCRH 1RZKL 4U1HA 3WFBL 3D69A 1G7HA 4BQ8A 3QIBB 1JHKL 2EO1A 5JNYB 5C0AB 4POZC 5DMGC 2WSKA 4HD9A 4RNRA 5T3ZH 3MODL 3DVNA 4XP9L 1I85A 3ILPB 3T1FA 2COQA 3HUJE 3F7VA 2HTKD 1UT9A 1F8TL 4HS6A 3TNNA 4D94A 1MCNA 5SWZA 2R29L 4PB9H 4PG9B 3F62A 5GRVK 3TZVB 1AGEA 3LMJH 5IB2B 2AJ3B 3L9RB 5BW7C 3MRFA 3KPPA 2P8MB 3Q5YA 5LGHH 3U6RB 1TMCB 5C0RH 4HMDA 2MNUA 4YHZH 3MREA 4R4NC 4JVPA 4NDMA 4XPFL 1C08A 3B9EA 4RAVB 4XNMB 1DLFH 2EC9T 3X14B 1G1CA 1PQZA 1D5ZB 1PX3A 3CC5B 1OHQA 1GRWA 2VN4A 5DJYB 1J1OL 4YNYB 1NBVH 4OM1H 4U7SA 2Y06L 5EU4B 2G60L 1R3LB 2ZKHH 3WEXA 2XN9A 3LKPA 1E0OB 4EVNB 5GHWH 3DXAE 1UB5B 5I9QC 2VABB 5FKPA 1N64H 1IE5A 1LEIB 4POUB 1HWHB 3IS0X 1YEKH 3TA3B 3VD7A 4ONGH 4NCC1 4P49A 1AQKH 3NH7L 3KPQA 1MWAH 3MOBH 5FHAL 4EN3D 3ET9F 3MCKB 4OZHE 3CCHB 1T5XA 3LIZL 3VFPA 1C8PA 4ZSOA 1IBGH 5F7EL 1I9EA 5GSRA 1KCSH 4HSQA 4Y5VB 1D9KB 3CAFA 1LILA 5E8EA 1DBBH 3INUH 4RGNB 4LLUB 1D5BB 4MNGB 1I7RA 2CPCA 2PYED 3N9GL 4JRXB 3ZKNC 4QHKI 3KPRB 5SWSE 1RUAH 2YPVL 3ZDXF 1YEDB 2DQFB 3NFPB 3WNLA 3BGAA 1I1RA 1S9XB 3VE0B 5GS1C 4QXGL 4Z77B 1GIGH 3RUGF 4PGDA 1X7QB 4MXVF 3QZWA 2ZUTA 3JV6A 1KBGL 3RI5K 3IDMA 3QJFA 3OKOA 5TDOB 1K4CB 5CEXB 1NC2B 5C0CD 3EYUL 1UA6H 1J12A 1GZQA 4KV5F 3ZHLA 5D71L 2EE6A 3DVIA 3L95A 5TDNA 3QDHA 4LRIC 4TSCH 4JRYB 5DWUL 3P4LA 2UUDK 4EI5A 1CGXA 3R0NA 1X5XA 2DICA 4LPXA 2VLRA 3B9KB 4X8JB 5LBSL 1A6AA 1VGEH 5IGXH 5FYKD 2R15A 3D39B 5IW1A 3QO0B 4WV1A 4PV8A 1JYNA 4ELKB 4A6YA 3V8OA 2VO5A 3E8UL 4JM2A 5DC0A 1U2HA 1NKOA 2CKBH 1CDCA 4LSPH 2ICWB 1ZT1B 1CLCA 4X80H 5JDSA 3G6AA 1JWSA 5DJZA 3V52H 3S35H 3W11C 3LH2H 4F8TA 2WIMA 2QQKL 2ATPA 4NKMB 2F53A 2I60H 4ODUA 1A0QL 4FQIH 3GHBH 5F9OL 1ITCA 5J1SC 4FQCL 1MOEA 1KB5B 4KKLC 3L3HB 2DLEA 1L9MA 4P3WA 2YPLA 3GNMH 4O2CA 5EC1A 3OMZA 4FP8H 2UWEF 4X7FC 3WFDH 1MCQA 4TN9A 1JRHL 5FKAB 5IB4A 2P24B 1OTUD 4QNPF 3OGOE 4X6BB 5T1LD 3M45A 3U7WL 1R3JA 3QIUB 5IBLC 5DJXB 1R3HB 1J8HD 2HJKA 4RCAA 2GJJA 1RVFH 3I85A 1CGSL 4IRJA 5F1NA 2EYTB 2MCG1 2A73B 4WFEE 1W72B 5DD5L 5B22A 2FHBA 3FN9A 4L8SC 5BQ7A 3IDNA 3MRRB 4K7PY 2I9TB 4KQ4H 5MP6L 4GS7B 2EH8L 5FM5O 5TF1L 2UUDH 1IGCH 4GKNA 4WEBL 5D9SA 4S1QH 8FABB 4WDIB 3TNMB 2NXYB 4YC2C 2I07A 1ZEAH 4OKVB 5I1LA 5IEHB 2WWKT 1NMBL 1RK1A 1D6VL 1F90L 4FNLH 4U1IA 1CE1L 3FO1B 2AW2A 2XTLA 3RJDA 1H3WM 1MHPL 1XGUA 1L0YA 2NY4C 4UZGA 1HSBA 4N0UB 3QEGL 1KULA 5JW4Q 5D7LB 4MNHA 4LSSH 5B8CB 3V5HB 1FVCB 3A6CH 5DJAA 1V7NH 5TFSH 4NM4L 3AREB 3HMWH 3MXWH 2BFVH 4OZIE 4MQXC 3C8KB 5DYOA 5J12C 4MHHI 3WDJA 3HB3C 4OFKA 5DMKB 3DO7A 2B5IC 2FGWH 2D0FA 4I0PA 3WSQL 1A2YA 3LS4L 1NGPH 3OPZL 3HE7A 1QBLH 1EFXB 3FHQA 4KTEL 4P0DA 3QDJB 3VFNB 3G5VA 5C9KA 3K7UA 3U0TA 1HXMB 3ARBA 4H8WH 5DR5H 2EXWC 2VNCA 1A9BA 1S8DB 2YEZB 4OSUL 5ICYB 1JWMA 3PE9A 3FT4B 5FO9A 4C4KT 2W0KA 2X89D 4BH7A 4QRSB 4DOHB 4Q9QL 4CVWA 3VGEA 5HHXL 1CZ8L 5E99H 4P2OC 4EUPH 4K9EC 3QRFM 3VFSA 4Y4FA 4AT6B 1IEBB 1CTOA 2X4TB 2W9DH 2AK4E 4XI5C 2QBWA 5EU5A 5T1DH 3WXWL 1RUQH 4LKCA 1T83A 1E6JL 5F9WB 1B0GA 5CEYA 4HWNA 1OP9A 4P2YA 5DFWH 2E7CA 5IROC 1MREL 1SBSH 1RD6A 4CJ1A 4JFDA 3TBSB 3BEWB 4XTRC 3OKYA 1Q9WB 1JMXA 1GGBH 1MH5B 5EZLA 4PLKC 1JTOA 2YKLH 3B6SB 3GMPB 3VI4F 3P0YL 4UINH 5GS0D 3ARDA 4F9PC 2HVJA 5ALBH 3TO4A 1IC4H 1W0YT 1Y18A 3SDYL 4P2QB 5DJ2A 5D1ZA 5KW9H 3O2DH 1BM3H 4YIQA 1DN0B 3OKMB 3TYGH 2LVEA 2PTUA 4XXCA 4F7MB 2R4RH 3IJYB 4M6OL 2GSGB 1GGCH 3WNKA 1IGFH 5DQ9A 4XCFH 4CVZA 3GHEL 3MRKB 4L4TE 1BD2B 1DVFC 1KCRH 3WDHA 2UYLA 3MSPA 3RWCA 2O5ZL 2QQNL 2X7LB 4PRHB 4K7PX 3UYOD 1Q0XL 4X8XA 5DURD 4LKXA 3RGVD 1JZ8A 4OD3H 1BIHA 2X40A 2W9EH 5FFLA 2Z31B 4OGYL 4NKOB 1LEKA 5LGKA 1CK0L 1HZHL 1P7KA 1U8KA 35C8L 1QPXA 5JHDE 2OJEA 2H2PD 3GEWB 5BXFB 2X5PA 3P4MA 4LDEB 2VDLH 1S78D 3MROB 2PCPA 3QT2A 5I8CB 5BJTA 2M1KA 2E7LC 2H26B 3BISA 1YYML 1YNKH 4GAYB 1QSEB 4PRIE 4ODVL 1WF5A 3D3VA 1BZQK 1ETZA 3MYZA 4L9LC 5EOTA 5EN2B 2R4SH 1T20A 3D2UD 4CU6A 2A9NL 1H5BB 4KZEL 2OSLB 3HC3L 1XZ0A 1L7TL 3PABB 4W70A 2B1HH 2AJXH 2FB4H 4DAGH 2ARJB 2CIKA 1T0MB 4Y5YA 3EOAA 3HUJF 1S9WB 2GQHA 4BUHA 5KVGH 4F7CB 3LDBC 4HWEL 5FYLH 4HWBL 3J8F7 3RDTA 4X4ME 5DF0A 3OL2A 3WIFA 4OLXH 3PWPE 2DD8L 4HS3A 4J3UA 1QZ1A 1V7MH 4EIZC 4X6DE 4HEPG 2CRYA 3VFVA 3BZDA 3UZVB 4DKDC 4D0DB 5K59E 1W8OA 2X4NB 1KJ2H 1P1ZA 2HA1A 3FN3A 1PKOA 3EZJB 4GQPH 3I02A 1C1EL 4PJ8D 1QRNA 4G6JH 2NY7L 5EFIB 2IAMC 5HDQH 4OCYH 1S9YB 3BT2H 5D1XB 2IJ0C 2M26A 2AEIT 2F8OA 4GBXA 5CWSA 1NMCC 1N5AB 5EUKB 1F00I 3V6FB 4D8PA 5CIPH 5J3HD 1YNTA 1BFSA 4KK6D 3P9MA 3MRJB 2N7BA 1B9ZA 2IALA 1DBAH 1KTKE 3U46A 5E8NA 2C1OA 3M8OL 2OJZH 1R5WA 1T04B 4P46B 4LLMB 4LDLB 1JPTL 3NOIA 3DWTA 1F2QA 5F7DB 3UC0H 3W0WD 4NC2B 1HQRA 2J8UB 3MZTA 4HIIA 3RNKA 2YZ8A 5EZOL 3FN0H 1ZHBA 4KJQC 4U1JB 1J05B 1DFBL 1LP9E 1KENL 3AY4A 1QHOA 1YEIL 1GGIL 1YECH 2J4WH 2QKIA 2XQBH 2Z92B 1G9ML 4OZHF 1TITA 4X0KA 4MQ7A 4YBHA 1A6VL 5MI0C 4Q9RH 4HKXB 3ARSA 4HGKC 3C8HA 3MNWB 2E6QA 1NFDB 3BWUC 1DANU 1SBBA 1PAMA 3UTPD 1QSFE 1M7DB 1F02I 3FMGH 4AIZB 1OLLA 3MBEB 3Q1SH 3U7YL 1BZ7A 5JPMB 5TPWH 5CKAA 4L3EE 4C83A 3P30H 4BQCA 2VDNH 2FGZA 1EGJL 1A7RH 3HZYA 5J56B 1TZIA 2LTQC 5CZKA 5CZVL 4JO3H 2Q76A 1EVUA 1G7MB 3LQAH 4QRRD 1BLNB 5FHBL 5BZWB 3TH4T 4OI9A 4HW6A 4R7NB 4RMTA 1U91A 4KXZH 3VA6A 4HS8H 2A0LD 4E0RA 2IANE 2FJHB 5FF6A 3WJJA 3ZDYE 4LP4A 2VXQL 4HBCL 3DMMA 3D69B 1UXWA 1R24B 1RY7B 4H25A 4E41D 4X5WA 4ZUVA 2VH5H 1EFQA 1OAYH 2EDOA 1T89C 2DQCH 3REWB 1Z9MA 4DQOH 3K2UH 1XT5A 3BAEL 3Q48A 4UQ3A 1I1AA 4YDIH 4YHOL 4RNRB 4KKBD 2IC2A 3L3JA 5LQBL 1KCVL 5F89B 1NMAH 3DIFB 4GRWB 1Q72H 2BSRB 4P4KD 3KS0H 4GRLD 2AXJA 3DRTA 4NQEA 5GGUB 2RJMA 3LEVH 1FH5L 5GGTH 4FQXC 3HA0A 1U93B 3F7VB 2VC2H 4WHCA 1XGQB 4LLQA 4OF5A 2G2RB 2D31A 4HS6B 2NXZB 2XZQH 3DX7A 4XP6H 3X3FL 3VA2C 3C5ZA 3VH8B 2XT1B 4AQOA 4K71C 2DQDH 3IDJB 3ZYOA 3P0VL 1NUGA 3P9LA 5CBAB 3P11H 1P5VA 2QADD 5E1HB 5F1OB 3MJ7A 3T1WA 3MREB 2BNRA 2ZPKL 1GYAA 3LSOA 4WWKC 5K9JH 1XGTA 4UMGA 2OL3A 3EGSB 3MRDB 2IFGA 5BMFH 4MS8C 4N0FA 2DIJA 2NPLX 5KSUB 4WUKL 4OCWL 2HRPH 5L2KA 4Z5RB 1I1CA 1S7SB 1IM9D 3UYRH 3W9EA 1YYLL 4G7VL 3CIQA 1NCTA 5DVMA 4E42B 3GO1H 4MD4A 3QUXB 3LB6D 4N5UA 5F96L 4FMFA 3KPSE 5BZDB 4KRPB 3IDGA 1A6PA 1FVDA 2WUCH 1QBBA 1CXIA 3CFCH 3EUUA 5FKPB 3IRPX 3KXFE 5D2NC 2GY7B 3VXTA 1JJUA 4MJ5A 5EU6E 1FL5B 2HTKC 4WUUD 5E2WH 1KSRA 4WRLA 4ZFOA 3U4BL 2YWYA 4DGIL 3THMH 4AM0B 3QYCA 3ARTA 4YR6A 3IFLH 2ZCLH 5JUEL 3VFPB 3KJ4C 4G6FB 4G6ML 5GSRB 4GAGL 1ZLVH 4I2XB 1BGXL 5IMLA 4KAQH 1ZS8A 2NR6D 3DV6B 4WEUD 3PWUA 4Y5XA 1R3IH 4M48L 4R7DB 4NP4H 1V5JA 5C6WH 2DQUH 1NLDL 3L3KA 5FECA 4YUEL 1L7IH 5T3XH 3PV7A 1IZKA 4LLWA 2E27L 5JQHC 3NCYP 3N85H 1NDMB 4OZIF 5KSBA 1B0RB 1DEEB 4RGOH 2HT4D 3DNKA 3PIQB 3L7EB 1RZKH 3CXDL 1OW0C 1SEBA 3QJFB 2WIIB 3OKOB 5SWZD 5FB8A 1TJHH 1JHKH 5IW6A 1UEYA 3TPKA 4NQCD 2CDEB 2DKUA 1GZQB 1K2DB 2VQ1B 1S7UB 4BK4A 4JQXA 3BIKB 4WHTA 3MODH 2VRAA 4XP9H 5E9DA 4EI5B 2X10A 5F7WC 3RUGB 2J2ZA 1WIOA 4XPAL 2MPAH 5I73C 4GH7B 5JPNA 4EDWH 4HFWA 1F8TH 4EN3C 4P2CG 4HIHB 3UO1L 2R29H 4MJIE 5EB9A 4YHPB 4K7PL 3JWDL 4M9PA 4PP2A 5JDSB 5I75B 2DIAA 1JWSB 4W4OA 4TQEL 2F74B 2XN9D 4EI6B 5IKCB 4ONHA 3GRWA 3U2SA 4JLRA 3AMLA 4NO3B 3VXQA 5FOBA 3SBWC 4JN1L 4XPFH 4TVPL 4P9HC 2UY6A 2YD6A 3G5XB 3PWLA 4ZNEA 4XX1G 3BZEA 5C09E 1J1OH 1JF1A 4QTHB 4OB5L 5IVZA 2YPLB 2Y06H 5EC1B 2G60H 4MDIB 4H5SA 1TJGL 1FZJB 2Q86B 1HQ4B 4CVUA 3KLHD 1ZA3B 5IESL 5DEFB 4PR5A 5DRZA 4NN6C 1VB9A 1SYSA 3IB4A 1RURH 4KK5D 1FNLA 2P8LB 2Z8SA 3HRPA 3VWKB 4HXAH 4LNRA 2R0ZL 3BFOA 2ENSA 4IRJB 4HUWA 4RAUA 4M00A 4MNQE 5F7UA 3GJEB 3NH7H 2HRLA 5HVFB 5J0BA 5FHAH 4MD5B 1EH9A 1NCUA 1I3VA 3LIZH 4XH2A 2EYRA 2UWEB 4OZ4A 4WNQB 5F7EH 5IHZA 1DUZA 1ORSA 5F97E 4CAGA 2FIRT 3TPUB 3GSVA 3RX7A 2DQHL 1MJJB 5I17A 4HGWB 4YX2L 1KN2L 3PGFL 4WCYH 3T77B 4N0YL 4IIQC 1RK1B 4L4TA 2YPVH 2IQAA 4U6YA 4U1IB 3K81A 3OX8B 1FE8H 4PYHA 1EEZA 4JEGB 1F6AA 1HSBB 4QXGH 2VLRD 4OV5A 1EHXA 4HUUB 4U1MA 4JO1L 3V6OC 2HLAB 4GXUN 4YK4C 1KBGH 3VJ6A 2JJWA 5T1MA 4JM2D 5C0EB 1EBPA 3B8SA 3AXLB 2GFBB 5F9DC 1OTUC 3O8XB 5JHDA 5D71H 2ITCB 4RFEA 5FIEA 4DN3L 4X5XA 1Q0YL 1KEGL 2F53D 5DWUH 5L0QC 1Z2KA 1Z0MA 5LBSH 3U0TB 3WFCH 3TIEA 1UWEL 3ZYIA 2LE9A 3OKDB 2WZPD 1JWMB 4U33A 3ARFB 1FG2B 4JFPA 1FFPA 3DO3A 4D0BA 2ZUSA 4X6DF 2C3GA 5ERWA 4R3SA 5ECJE 5KVMC 4Y4FB 1CDBA 3WKML 2QQKH 3B9DA 5K59F 2R23A 3HMXA 1A0QH 3L3IB 4WENB 3L1OL 5F9OH 1KB5L 3SQBA 3VXNA 4ZUTB 4JANA 4KWUA 4FQCH 2VIRB 4X6CF 1B0GB 1KIQA 3QDGE 4JN2A 1G0XA 5F3BB 2ESVA 1UVQA 2NW3B 3RX5A 1JRHH 2EKSB 4A2LA 1LK2A 1VEOA 2P5EE 4K07A 2YD9A 3FRUA 3ARDB 1SY6A 2B8OT 3GB7B 2LV4A 3HNSL 3L3GA 5HBBA 1Y18B 1CGSH 2WBJD 4UTBL 4MAYD 3S7GA 1LP9F 1QA9A 1T7VA 2WWMD 3IAPA 5ESVA 1FDLL 5DD5H 1U3HB 5I1GL 2YC1A 4PY7A 4QOKB 3SPVB 1KIUA 5MP6H 5EU3B 2EH8H 4R96A 2Z8WC 5TF1H 1G0DA 4H20L 4HPOH 4WEBH 3T0DA 4S2SA 1X4YA 3UAJD 2Z35A 1LO4L 1NMBH 1F90H 1WCBB 2VLJE 4I0PD 1N2RB 5IG7A 4MA1C 1DCLA 3HE7D 1MHPH 3UTZA 3ARVA 1CICA 2IPTL 5D7KD 3SHSA 2IGFL 3QEGH 1U8KB 2E8YA 1OVZA 1IT9L 1J0YA 2NLJB 3EDDA 1CLZL 4K9EH 4PREA 4NM4H 2C7UB 1QSFA 5E6ID 4I0CC 3WN5C 2DIBA 3QJHA 4PB0L 4GKSA 5BJTB 5FYJL 3ZDYF 4GLRI 3V4UL 1A14L 3VD4A 2D7PA 2KBGA 3CSYB 5GS0C 2Q1EA 2JIXA 3HR5A 3WSQH 3LS4H 3OPZH 5EOTB 4KTEH 3MLTB 5F1IB 2F54B 1WWWX 5IHLB 1M7IB 4MB4A 2G75A 4ZTOL 4ZAKA 1OWRM 2AABL 1NC4A 4HXBL 3T3MF 3RIFK 4N1HB 1CDIA 1CXEA 4QRQA 3VGHA 3FZUD 4ZQKA 1HI6B 3BMWA 4Q9QH 5FO7A 4M93C 3BH9B 5HYSG 4OT1L 3M1BA 4JFDD 4BZ1L 3O4LE 4HDIA 3STBA 1G9NC 2XWJB 4HS3B 3TCLA 4DN4L 4U0RB 3RP1A 4HT1L 5H37G 1FZOA 4EZMA 3VFVB 4HUVB 1CXFA 1Q94B 5DZLA 2RR3A 4BQ6A 2OYPA 3TO4D 3WXWH 1P1ZB 2VL5A 1E6JH 4WU5A 5F9JA 5C07E 3NABL 4FFZL 3TN0D 5D1ZD 3HUJB 4OUUB 5FK9A 5DRWB 2H2PC 2R9HD 1MREH 4Y1AE 2X4OA 3FQNB 1FZKB 4LVEA 3BRFA 1S78C 5IFAL 3H9SE 3BPCB 4LCWE 2H3NA 3U0WL 3ZO0A 1YMHA 1BFOA 2EDQA 2XI9A 5CWSB 3PQYB 3LAFA 2GCYA 5J89A 1YNTB 1HXYA 3P0YH 4XNZC 5DJCB 2O5XH 3PWVB 3U46B 4WU7A 4PG2A 3SDYH 5EO0A 1BPVA 1HN1A 4NUJB 2ERJC 1D5XB 4M6OH 1NBZA 1M1SA 4PJAA 1TVBA 4XAWL 1S7XA 4PJDF 3D25A 3H7LA 3GHEH 3MGTB 4HIIB 5DI8B 3NCEB 2QJDA 4PJCA 4RISL 4XP4L 5BV7B 2O5ZH 2R1WA 1PYWB 4XCNB 1Q0XH 2O61B 3NTCL 3KPSA 3WS6A 5C9JB 2DYPB 1AXTL 3DXAB 3RTQB 1KGCD 4NIKB 1JTTA 3D3VD 4PY8J 4J1UB 4PD4J 4OGYH 1RUKH 5EU6A 3TIDA 1BZ7B 1P4BL 1HZHH 4PJ8C 3CH1B 1MHEB 4ZUSB 4S1SL 2ZCHH 5HHOA 4R0LB 1D5MB 3GJFA 5JLZA 4WTWA 4D2NA 2Q76B 4OZHB 1XR9A 5EOCL 1R3KA 1YYMH 3X11A 1RZ8B 4PRDA 3VH8G 3RDTD 5J3HC 4ODVH 4KK6C 4I9WD 3ZKXC 2X70A 1A5FH 4PJ5E 5D7SL 1BQHB 1JIBA 2V2XB 3TJHD 3NCJL 5SWSB 2A9NH 3NCYS 1UXWB 3HC3H 4MCZB 4ZUVB 1L7TH 1NCNA 2A6JB 2P49B 4J6RL 4XVTL 3ULVL 1T1ZA 4NBYB 3T0WA 2P8PA 3NBNA 3UBXA 4O4YL 3AS0A 1QRND 1Q9KA 4X9BA 5DS8A 4HWEH 3PL6B 4HWBH 1HILA 1AI1L 2FZ3A 1FSKB 1EO7A 1GOGA 2HTLD 1OLZA 1G7QA 4GBXD 4POYA 3QWQB 1T4KA 4LLYB 4N90E 4OQTH 3FQRB 4N8VB 4HKJA 2EDLA 2CKNA 3RVTD 2YRZA 5C3LD 1FYHB 3DTXA 1C12A 1X5JA 2NY7H 1IAII 1K3ZA 2EH7H 4P57A 3MJ7B 4MJIA 2Y23A 1M71A 3GSRA 4DGVH 2A0LC 4IJ3C 3GSNA 4KY1L 1QEWA 2BHZA 4YFEA 3STLA 1NEZB 3VD5A 4N8CH 5CS7A 3FB6A 3GKWL 3HE6A 2E9IA 3M8OH 5A2LH 1NEUA 1K8IA 3S97C 2H6PB 1JPTH 1OAQL 2WMPA 4K7FA 4M7JL 4KKBC 5IQ9A 2WNGA 3PWJB 2R69L 3BQUA 5C09A 1DFBH 1KENH 2XZZA 4P4KC 2VXSL 4GRLC 1YEIH 1GGIH 1G9MH 3EO0B 5F1KC 3IS1X 3U83A 1A6VH 4PYGA 1A7OL 3MLWL 4HK3N 5DJDB 4ZS7L 5K9OA 1T7XA 2X41A 3L5XL 4TOYL 3LY6A 4YR6B 2MQCA 2JJTC 4FTVE 3DMMD 3E6FB 3WHE0 2CO6B 4MNQA 3C8DA 4QF1A 1JK8B 4QT5B 3W39A 1EGJH 2QADC 3PWUB 5CZVH 2YWZA 4PRPE 3MLZL 4PBVC 5M94B 5C0BD 5DK3A 1I1AD 2DWEA 4ESKA 3HG1B 5FHBH 3BJLA 2KZ1B 3GSWA 1U8MB 3L3KB 4LGSB 1C5CL 2C9AA 1KPVA 1P7HL 3C6LB 4NQED 4PUBL 5E2VL 1YMME 3HC0A 1IKNA 4ZPTA 2VXQH 4HBCH 2EIDA 4Q7DA 1E4KC 1M6OA 5DQJB 3G6DL 3MA9H 1MCIA 3LB6C 1YZZA 5CUSL 3C5ZD 3IETA 4XNQB 1CR9H 3BAEH 2BVQA 4Y2DA 3RWIB 4YHOH 2MWCA 4WI3A 4LAJH 5LQBH 3MRNA 3BIAX 2VLLA 2DTSA 4NZRL 5D93C 2ITDA 3L6FB 4OZIB 2BNRD 1FH5H 3OWEA 4GKZA 2A83B 4XC3H 3ZHDA 4AL8L 3X3FH 5I1IL 4Q6IA 5D1QB 1UCTA 1ZVSB 4M8QB 3VDAA 5L2KD 4AH2A 3ZE0E 4LBEA 2XYCA 4ZDHA 5JW4M 3MX0A 3P0VH 4JG1H 2NR6C 3WUZA 4OLYL 5E4IA 5GGVY 3U4AA 1BVZA 1J11A 2J3SA 1UACL 1OQXA 4XB8A 3WYRA 2ZPKH 3KPRD 4LLAA 4NZUH 5FGCB 5TH2B 3IF1B 4RIRA 5EU7E 1I85C 3IFOA 3HPLA 4LNVA 3FOLB 2GSIA 3QNYA 4OQ1A 3PWLB 1QPPA 4N8PA 4HFUL 1P69B 2CXKA 2HT4C 4OCWH 4WUKH 3G08B 3SY0A 4BSWA 2Y25A 1INEL 4J3XA 2AK4B 1NCBL 1YYLH 2MJWA 3ARWA 4G7VH 4LSRL 1Q8MA 1JGVL 4G80B 4HIEA 2WWKO 2XACC 4PJXE 3DSFL 5D7IE 1MPAL 1HDMB 4L9DA 1TFHA 5GRYA 3EBAA 1YQVL 4WTXA 3OJVC 3QIWA 3F58L 2A38A 3WMSA 3SDDB 5ACZB 5ACMA 4I4WB 4LNRB 1MAML 4G43A 3WD5L 3I6KA 1KCKA 3DLQR 4RAUB 4F33A 5IF0A 3BP5A 3HNTH 1KPRB 5EG6C 1PKQE 1IGJB 4V1DD 4ETYA 3U4BH 1I8KA 4DGIH 5IV2A 1BVKB 1FFNA 1KTDA 3S3JA 2DLFL 5JUEH 2AJZB 2EYRB 1MY7A 4OZ4B 3GGWB 3CZFB 4G6MH 4GAGH 1ORSB 3BPOC 2ORBL 1BGXH 4QHLB 3VRJB 3ZMRA 5C7XL 1PGRB 2EDKA 3TGXA 3W9DB 4G9FE 4M48H 3SJVE 2R0KL 5I74C 4G8EB 4WEMB 2IQAB 1MSPA 2DJSA 3KLSA 1NLDH 4PD4K 12E8L 2VTFA 3O41A 4YUEH 4HJGB 5F3HB 3MRGA 1P7QA 5E9DD 2E27H 1AE6H 4CUCA 3C09B 1YQ2A 1PW3A 3VFUB 5J1AA 3CXDH 3EFFA 3MA7A 2GT9A 1NLBL 5T1MB 2V5MA 4HC1A 5I8EA 2F58L 4ORGA 1HHJB 3KLHC 1ACZA 2IBZX 7CGTA 4MXQD 5BOPA 1P4LA 5KJRL 3NFSH 1FNHA 4KK5C 2RIKA 3BPNB 3RNQA 4LP5A 3T0EA 5D6CA 4XPAH 4PRIB 5HGGS 4L4VE 3UO1H 5C0GB 2VAAB 4D0BB 2AJUL 1UM5L 3JWDH 3WO4B 5I0DA 3KGRA 1E28B 5ERWB 5EO1B 1VACB 2XG5A 1N8ZA 2CRIA 2VLME 4TQEH 3U30C 4U1LB 1Q38A 1F3DH 5F71A 3FOMA 4D9LH 5FYKH 2DQIL 1AC6A 4JN1H 1YJDC 5ILTL 4BH8A 1PY4A 5GISL 3ELAT 4TVPH 2MQ0A 4Y8AA 3MNVA 2BX5A 4JANB 3PWPB 4WFFD 4P4RB 4PJ9B 3QI9B 4X6DB 4WV1C 5AYQA 5D7LD 2AEWA 4JM2C 4OB5H 4WFGD 1JRHI 3NMEA 2Z8VC 1U8HA 1TJGH 1B4JL 3T04D 1U2CA 5IESH 4RZCB 3BHBA 3IGAB 1RIVL 1VFBB 3NN8A 4OF7A 4Y1AA 2FWOB 2NY3B 3L3GB 4L4TD 3H9SA 4AK1A 2R0ZH 3BJ91 4RAHA 4CW1A 3WUWA 5CD3A 4X6CB 1S7TA 3BP6B 5F7KC 1TETL 4YDVA 2YC1B 3GSXA 4NN5B 2Y5EA 2W07A 4MJ4A 3QB7C 6CGTA 3OAUL 4UDTA 1I1FB 4UUJA 4Y7MA 4OBRA 4M02A 4ZNCD 2HH0L 1DQLL 1LO3L 1SJHA 2DQHH 2FO4B 4YX2H 1KN2H 3PGFH 3G04A 5JHDD 4R97B 5BW7A 1LP9B 4NNPL 4CBPA 4RMUA 1I9RL 1OB1B 1AHWB 2Y6SD 5CJXA 3N1GC 3OJDA 3F5WA 3J7HA 3OF6D 5HYJA 4QRPE 3RWHA 4DVRL 3R4DA 1MCWM 4BFIA 2AGJL 2IH3B 1N26A 4HKZB 5I1DA 4XPBL 1LGVA 3JV0A 4GKSB 3GMQB 2VSDA 3UEZA 2P7TA 5EIVA 4QRTB 4L3EB 1K8DA 2Q87A 2ADGA 1ZWIA 2FEEL 5DDHB 2GTWA 2JIXB 1KB9K 1MRFH 1Q0YH 3VCLB 1K9TA 1KEGH 1ODAA 5IR1B 2WBJC 4MAYC 2J1KA 2WWMC 4P3DB 1UWEH 1YA5A 3WBDA 1F97A 2FO1A 2YSSB 3P4NA 4ZO7A 2IANB 1S7VB 4PJ5A 4HPYL 3KJ6L 3EKCA 3MOQA 4ZOEA 4KMTL 2ESVD 1A6ZA 1KIPB 4JRWA 5I8KL 3M1BB 4CKVX 3UAJC 2EEBA 3TCLB 3WKMH 1A47A 4JVWA 1JZ3A 2AXFA 2CUMA 2X4UA 2R1YA 3TV3L 4I0PC 3HPJA 3HE7C 3IXTB 5D70L 1F11A 3L1OH 3RY6A 1KB5H 3AGVA 5JTWA 5DRXA 2VZUA 4JGUA 3FB5B 3BGMA 4ODXB 3TESA 2Z31D 4F9LC 2GKIA 1QLFB 2BVPB 5FK9B 5J9PB 1BWWA 2BC4A 4GW4A 4M3KB 5IMOA 1CDGA 5JORB 3KLAB 2P4AB 5CSBA 5E6IC 3T2NL 3QULB 1SYVB 1MHHA 4LHJB 1BX2B 3SDAA 1YMHB 5CP3H 2HJFB 5KN5B 1MCDA 4Z78B 3OV6A 5DD6A 3RL1B 2OP4L 5I2IA 4YDLB 1NBYA 3LN5B 3Q3GB 5CP7B 4PRNA 1CE6B 3HZVB 3IXAB 4GFTB 4DKFL 4HH9B 1GC1C 3QG6A 4G8GE 3RZCB 5EO0B 4UTBH 1IRAY 2FJGA 1TCMA 4PGEB 1NBZB 5DD1H 5I1GH 1TVBB 1CICD 1T83C 2IPKA 1G6RB 4LRIA 4FABL 3FZUC 1JWUB 4TPRL 1WIUA 1BQHG 3MMEA 4HLZH 5GIRB 4H20H 2X44D 4F3FA 1HCVA 1QSFD 1I7ZA 4C56E 3NGBC 4FQJL 3KPSB 1LO4H 5HGHA 3SGEH 3OHXB 4AIXA 2EKJA 5HY9B 3MRIB 3DRQB 3KXFB 5CBEA 1QFPA 1BVLB 3TO4C 5MENA 5KSAD 1D6EB 2IPTH 5E8PA 5EU6B 4PJDB 2IGFH 2VLKA 3F7RA 5D1ZC 3TN0C 1HHKB 4BZ2L 3MJ9H 4XXCC 2R9HC 3D85B 3V7AG 1IT9H 1NC4D 1MJ8L 2E6JA 1CLZH 3HZMB 5JOFA 5JLZB 1CF8L 1OM3L 2AAVA 4N8VG 1P9MA 5C08A 4JFYB 4J3TA 1R3KB 4QWWD 3H0TB 5FYJH 1LE9A 3VXSA 1HKLL 3V4UH 1A14H 1V3KA 3BMVA 5D2NE 5CGYD 4PRPA 4DTGH 5F8QC 2IG2L 4OD2B 1CVRA 4ZTOH 1CGWA 5D6DA 1FO0A 2XKNA 2XWBB 2P8PB 1TPXB 2AJVL 1FBIH 1V8HA 4U1KB 5ETUB 3UP1A 5AWNL 1NEZG 1OPGL 3BP4A 4JDTL 3O9WA 2YD3A 2JK5B 4BZ1H 3VGDA 2FZ3B 2PETA 1FCGA 4UAOC 3G6JA 2PXYD 5EZJB 1GHFL 3ZE0F 4QHUA 2FL5B 3QUKB 3IVKB 4HT1H 1LD9B 1QFWL 4UDUB 1B3JA 3O3AA 4JY5H 2P47B 4F7PA 4K23L 5DJ8B 4ZUWA 3FQTA 3EDFA 3GFUA 3QWOB 4HCRL 4X7TB 3NABH 4FFZH 25C8L 3SCMA 1UCBL 2UZYB 3LN4A 5I8OL 1OGAD 4Y5YC 3V6ZB 4PTUA 4FQPA 4MJIB 5IFAH 2VDOL 2NX5B 4XCEA 1ZSDB 2G9HB 1JI2A 3RDTC 2X6MA 1EHAA 1YDPA 4PJXF 3TJHC 5JA8B 1QFUL 3TBWA 3K4AA 5FOJA 5I1AA 5D7IF 3R06A 3FB6B 4LPUA 4FQQA 3OKKA 4R4BA 3B2VL 1HNFA 2GIYA 5BS0D 4KTDL 1JUFB 4XAWH 4JFEA 2WBKA 5EUOE 4JFFB 5C09B 2MHAA 4X6FA 1T1YB 5HHOD 5HJ3A 4RISH 4XP4H 4PJIE 2HTLC 4KROD 4MAUL 4GBXC 1FYTA 2CK2A 3NTCH 5D7IA 3TYFB 1R0AL 3VW3L 1AXTH 43C9B 4KHTL 2AV7B 3HAEB 3VXMA 1U8LA 3IU4L 4RQQA 2GHWB 3RVTC 5E70A 4NHUA 4ODHL 1P4BH 5EO9B 1H3GA 1QOKA 3TBVB 4MNQB 1A1NA 1UM6L 1G7JB 4S1SH 3IRZA 1UKSA 1PKQA 4IBLT 2HVKB 1A1MA 5EOCH 5C0ND 5LXGL 2Z4QA 2NTSP 2C5DC 3AY4C 3WHXB 1PZ5A 4LPVA 1NCCH 2R0WL 2IADB 2FRGP 4X5LA 5FGSA 5D7SH 3SE9L 2OR8A 3HC0B 4QYOA 4G9FA 3NCJH 4JDVB 3SJVA 1WZLA 4PJ7E 2BOBA 1AFVL 3KDMA 3CVIH 1CGYA 1DQML 4KUZH 4ZMAT 2W0PA 4J6RH 4XVTH 5CINL 5F7FA 3ULVH 4PGBB 2BCKB 4O4YH 3TVMA 4JFOB 4NKDA 3P73B 2Z8RA 2B4CL 4IOIA 1CD8A 4PPTA 4GO6B 1FNSL 1AI1H 2ITDB 1RZJL 5BCAA 2CR3A 5J1TC 1DVFA 2XNAA 3FB8B 2DN7A 3RU8H 3ARGA 3S88L 4Q6IB 2NY6D 3Q6FB 5F9AC 3DMMC 3HE6D 4R2GB 3CXHJ 4K2UL 3V6OE 4ZDHB 2IBGA 4LIQH 4NRZA 1TTFA 5CLWA 2EDBA 2GJZA 4J8RA 3GMOB 4L4VA 5B3JF 5J13C 3V0VB 1I1AC 2D7QA 3PJSA 3VRLE 1IAIM 2OL3L 3BQUD 3QXDA 4BKLB 3VMNA 4IM8A 1X9QA 1J8HE 2GSIB 5HVGB 5IVNA 4KY1H 2SEBB 3CSBA 2PKDA 3KPNB 3MV9E 1CFVL 1ZT4B 1Z5LB 3GKWH 4GT7A 4OIIL 3DVGB 4JE4B 3BKML 4X4YA 4HIEB 3C5ZC 5H37H 4DVBA 2FSEA 1OAQH 4M7JH 2CLRA 4NBXB 3QDGB 2BVOB 4WO4A 4L8DB 2R69H 4R26L 2VXSH 1BIIB 2JLLA 1S7WA 4G43B 3MFGB 5IF0B 4IRZL 1A7OH 2P5EB 4OIAA 3MLWH 4JZNA 1CT8A 4ZS7H 3TJEL 2HG5A 2ZNWA 3L5XH 1I8KB 4TOYH 1KTDB 4LHUA 5JOPE 4JJ5A 4GQ9H 3F8UB 4M6AA 5SX5K 1B88A 4CVXA 2HFEA 3PNWA 1OT2A 2EEDA 3PV6B 1XGYL 4MB3A 5ALCL 4JPKL 5L88L 1FLTX 3MLZH 4Y2DD 2VR5A 2DL2A 1C5CH 2AJSL 5F6HI 1B4RA 3NCCB 2A6KA 1T5WB 2IAMA 4MD0A 4CNIA 5E2VH 3AROA 3QUZD 5DJ6A 1T7ZA 1V3LA 2CSPA 5L2JA 3SKNB 4FZEL 5J6GA 4XCYA 3G6DH 2VLJB 3KLDA 5CUSH 2CIIA 1T2QH 3LQZB 3MLXL 4QRPA 4QY8A 4DZBA 2AK1L 4N1EA 1CL7L 1L9NA 1P4LB 3GSOA 4G7YL 3C2AL 4HKBA 4BFBD 4Y5XC 1IGML 2A74B 1CXHA 2GAZA 3EO9H 3WFEL 4NZRH 1IFHL 4M1GH 1A9EB 4HMEA 3QCVL 2DM3A 3QH3B 4AL8H 1B2WH 3BWAA 5I1IH 2WW8A 5FAAA 1EA9C 2J6EL 1IVLA 5H35A 3S4SB 2JJSC 4JFZL 3CH8A 5E94A 5I30L 4KUCD 4OLYH 3GRWL 4I13B 3WE6A 5DO2D 1UZ6E 5DC4B 2ZSWA 2Y5TB 1AD9A 5DD3L 2Y07L 3DROB 1UACH 3M07A 3GBNL 1MWAA 4H26A 3QIWD 4JQXC 5SX5H 4U1SB 5A2JH 5EIIB 4XNUL 3RWFA 4EQ3A 3O4LB 2NY2D 5HHMB 3UCRA 1A4KA 1XMWA 4HFUH 2NW2B 5MEQA 1INEH 1NCBH 4LSRH 1JGVH 1DDHA 4Z7NE 3DSFH 4YAQA 4ZYKA 1KIRB 2OTWB 1MPAH 4MXQC 5C07B 1RIUL 2CGRL 2NZIA 4W4OC 4XWGL 1YQVH 1GJIA 4ELMB 4LLVA 4NGHH 1XIWD 4F80A 3O8XD 1MRCL 3U9PH 1DQQA 5L9DL 3H9SB 1MAMH 4LCWB 4TUKL 3WD5H 1GCFA 4QXUL 4FFVD 5GGRB 4YPJA 2ARJQ 3TBYB 4BZYA 3GK8L 2DLFH 1FFRA 3LPWA 3HFML 5I1CL 3ARFD 5KG9B 4G8GA 4MA3B 1NJ9B 3KAAA 4GS7C 2ORBH 2RB8A 4Z0XB 3CLEL 4PJHB 1NGWB 2XICA 5C7XH 1SJHB 4I48B 3ORJA 1ACYL 2X2YA 3GSUB 2R0KH 4Q0XL 5INDA 5BVJB 3GMNB 1BJ1J 12E8H 4MMZC 1JNLL 1RHHA 1OAXL 1XCTB 1JFQL 2HLFD 3UZEA 1I9IL 3KYAA 3T0ED 3RWHB 4KU1A 2W1NA 2EIEA 3MLYL 4M7KL 5SX4H 5I1DB 4IMLB 1NLBH 4NOBA 3VFTA 1XGPA 2F58H 3CSGA 5IIEA 4RDQG 1K8DB 1WCQA 4UV4L 5F6HJ 4LRNL 1ZWIB 4PB9L 4DCQB 1RPQA 5KJRH 1DL7H 1KACB 5K33A 1CFTB 3BO8B 1TQCC 2NY5C 2OQJA 1J18A 3FONA 4JZOB 1E6OL 1LK3L 2ZWLT 3CDFA 5F7MC 3P4NB 4IDJL 4M9OA 4Y8DC 1CWVA 3GSQA 5D2NA 2BRRH 4YHZL 1DR9A 1BZ9A 1MJ7L 2ZZUT 3HS0A 4QOKD 4BM7A 4NNXB 4ALAL 1FFOA 1KJMB 2DJ4A 4G8IA 3QEQE 1FFQA 2LQRA 1DTUA 1T1XB 5GS2H 4U3HA 1QP1A 1WT5C 1ORQA 1S7RA 1RHFA 3IDIB 1PEWA 1H3XA 2DQIH 1A7QL 2R1YB 3T0BA 5ILTH 2Y6SC 4Y1AD 3SO3C 3VGAC 1CIUA 3CXHK 5GISH 2CK0L 4U0QB 1U8JA 4JAMB 4NQDE 3P77B 3BGMB 4MGXA 4NM8L 3CPLB 4YDJB 1ZLWK 5GZOD 1KEML 1X5FA 2BC4B 2XV6B 4MSWB 1DE4A 1WJ3A 3AMKA 2YPKB 4I3SL 3MZGB 2NMSA 3CFDB 5GS1B 1T22B 3W0WE 3VXPA 2Y7QB 1MCBA 1MCHA 1B4JH 4NWUL 1QQDA 1SY6L 1GOFA 1NBYB 1RIVH 3FO2B 3ROOB 4OCSL 4LGRB 3CFIC 5EUOF 4WGVB 1OARL 3HCVB 3EOBB 4NRXA 1UQSA 4KRMB 2GITA 3UTPE 1TETH 2XWTA 2IPKB 4O2EB 4PJIF 5HYJD 2LAGB 1RUAL 4OM0L 5GJSL 3RVVD 4XGZA 2E9WA 5GRVL 2N1KA 2IH1B 1ZA6A 4ZFFB 5IB3A 5DK2B 2B39A 2HH0H 4BA8A 4F3FB 2AXHA 4EN3A 1DQLH 1WBXB 4L8CB 1VPOL 3O11A 4QRRE 3H9HA 5DFTA 2A77L 5EUOA 3T4AA 5DZNA 3TBTA 2FLRT 2DS4A 1JPFA 3C5SA 2QEJA 5ID1A 4NNPH 4LCUA 1I9RH 2KZWA 4BQ9A 2IFFL 3BE1L 1XF2B 5KVDL 2Z31C 5DC9B 1J86A 3I6GB 4DVRH 4EUPA 4E41E 3PDOA 2AGJH 3BKCL 4XPBH 2VDQL 4PJ5D 3QUMB 4OKDA 4JY6A 3H7BB 4H1LB 4FTVB 3X12A 4PJ7F 2NNAB 1XR8B 5TGBB 1RK0B 4HJJL 1JL8A 1VADB 5IBUB 1ZLWH 2HJLB 4LFHG 5GGRY 1JN6B 3FT2B 2YR3A 2VB5A 4ONFL 4P5TA 5DT1L 5T1KD 3V52L 3LH2L 2Z93A 1CICC 1AIFA 2BNUB 1Y6MR 3MV7E 4ZO9A 5DD0L 1JZ5A 1HYSD 4HPYH 1YMMB 3LQMA 2FX8L 3KJ6H 4FQIL 1NCWL 3GHBL 3SDCA 4EDXB 3VXRE 4KMTH 4IMKA 5I8KH 2K3TA 3NIGE 3HI6L 4NO0A 2M2DA 4L8SB 3VXUD 3OXSA 3U4EB 3O2DA 3SDAD 4ETQA 1FL6A 4V2CB 4NYLA 2QR0A 1J7VR 3MR9A 1CGVA 2ID5A 3TV3H 2FX9L 1XGRB 2DYPD 3VG9B 2YUWA 4KRLB 2EDXA 2I9LB 5D70H 4YC2B 3ECBB 5KSAC 4NZDA 3VRLF 2WQRA 1S9VA 2RGSA 1WUNT 1RJLA 2DL9A 3U9UA 5E7BA 5IK3A 4OUOA 3KPLB 1IEAB 3HAEG 2NY4B 3FB7B 2DQJL 4QWWC 3WCYA 5GSVA 1JZ2A 2PO6B 4WTZA 3G5YA 4OGXL 5E8OB 3FJTA 5D7JA 1CD9B 4JGJA 3V6OA 32C2A 5KZCD 4D0CB 2OP4H 4MDJA 2NQCA 1IM3A 5CGYC 2DI8A 4P3CH 1C16A 1G84A 1U42A 2V7NA 3TBWB 1F58L 3FFCD 5I1AB 5JHLL 4DKFH 2R8SL 5J12B 1YPZE 4RBPH 4S1QL 2R2BB 4PV9A 3OZ9H 1WC7A 1G6RL 2B5IB 1WAAA 4ZFZA 5MEND 1MCRA 3DBXA 2VLKD 3FT3B 3BDYH 3MV9A 1PSKL 4TPRH 3CVHA 3MLSL 3L3DA 1TQBC 2Z91B 3C60A 1R5IA 3UZQA 1KV3A 2PXYC 4PJXB 3PL6D 5C08D 4N0CD 3VXSD 4FQJH 5D7IB 1NAMB 1U8QA 5MHSD 4Q2ZB 4R9HA 5ESQB 3MXWL 4P2OB 4UT7L 4MZ2A 5I18L 4PRPD 4FXKA 2H8PB 4PG2C 5FGBA 2BNQB 2KH2B 2V2WB 2XIDA 4GG6A 3STZA 3DURB 4BZ2H 1QFHA 2FGWL 2BOCB 3LEXB 5SWZE 1NGPL 3IT8D 1MJ8H 1CF8H 1I9JL 1OM3H 4NQCE 1N59A 1A1MB 2X9XA 4LCCA 4Z7OE 5DR5L 3AFLA 4LSUL 3BZFB 1PZ5B 2PNDA 3O9WD 1KPUB 1KT2B 2QV2A 5FDWB 2BSTB 1KJ2A 3WV0A 5BOZG 3VXOA 3WS6C 1J10A 3T2QA 3SJVB 3QEHA 1YEFL 5LGJB 4ZOCA 1KLUB 4TUJA 1KG0A 2FDBP 1CG9B 2APXA 3QUYA 2HFFA 3UTSB 3RWDB 3LHPL 2AJVH 5CIPA 3SCMD 3JTTA 5AWNH 2YD8A 1HWGB 5TQ2L 5B4MD 1OPGH 4JDTH 4GW1A 5T1DL 4URTB 2XN9E 5CEZD 4WI2A 5IB5A 2X89A 5ISZE 4KROC 2X1QA 1GHFH 4EJ1C 3L5HA 1YN6B 1QBML 1DVFB 2D0GA 1OF2A 1CQKA 4W6WB 1JPGA 1YEJL 1WBZA 1UZ6F 4K23H 5BRZB 2KPNA 1EAPB 5IJVB 5IFJB 2YKLL 5MERA 1PDKA 3ULUD 1TNNA 3C9NA 3GI8L 4NRZB 1IAOB 4XC1L 5DUBA 5E5MA 4NC1C 3QDMB 5I8OH 2PW1A 4L4VB 1QVOB 2VMFA 4ZSOE 4KJYA 4JFED 4X6EA 1XH3B 4Z76B 5C0NC 2VDOH 1JE6A 4OLZL 3FQWB 2BSED 5CJ8A 3MV8A 4ZG1A 2ICEA 3HG1D 1GGCL 2CLZA 4XCFL 3VFRA 4Z7NF 1FYTD 3WN5A 3TP4A 2CDFA 3C6LD 3CFJB 3VXMD 3IFNL 1HH6A 4P9ML 3B2VH 4YO0A 5TE6L 4X4YB 3F7YB 1JV5A 4DVBB 4L9LB 2D03H 3MLVL 4KTDH 5JW5B 5MEPB 1T21A 1QR4A 5H94B 4GW5A 3CFEA 3LRSB 4YHYC 5T5NF 1QR1A 4A2MA 2QQLL 1C7SA 4LSVL 3RPIA 2APWA 2X4RA 1BOYA 1R0AH 1N6UA 4OAWA 2APBA 4KHTH 3LDBB 4WW2C 4NNYA 2XPGB 4JB9L 5L7XL 2NY6C 2VLRE 3OXRB 5IVXE 1BOGB 4G9FD 4JJ5B 3WLBA 1ED3B 3F6LA 3DX9A 3HE6C 4NO5A 4ODHH 5IJKA 3V6BR 3RGVA 3IKCA 2XY2A 1MRDL 5A40E 2YRLA 3JWOL 1MLBA 5D1QD 4BYHA 4MX7A 1XFPA 2B1AL 2EIZB 5A1AA 5GGTA 2ZP0T 3IDXL 4YBQD 2ENYA 1UKTA 4Z7WE 5AAMA 3BQUC 1SJEB 3TVMD 5LXGH 1INQA 3ROLA 1EX0A 4KVNL 4F7TB 1JZ7A 5EBWA 2R0WH 3MUY1 3T65A 2A6KB 4K8RL 4TTGA 3S4SG 1MCOL 3LKQA 5E6ZA 3SE9H 5KVGL 5DJ6B 1FL3A 1ZGLP 3S8WA 3BYYA 1AFVH 1NMCB 4XCYB 1RMFL 3RKPA 1DQMH 3ARGD 5DSCA 4WWID 4F2MB 3FFDA 5CINH 1MLCA 3DV4A 4LLDA 2A9MH 3RBGA 3UPCA 3D2UA 3PHQB 4DZBB 3B9AA 4K3EL 2LU3A 1HOCA 3E0GA 3EJZD 3GSOB 5DHXB 3JWOC 5KSVB 3TWCL 5LJYH 1FNSH 4FA8A 3GUTA 4XVJH 1KN4L 5GS3A 1RZJH 3N1PC 2IF7A 1F5WA 4FMKA 4OCXL 3O6FA 4OCYL 2VLMD 1T03L 4MCYB 4YXKL 3S88H 2V5SA 5L6YL 1JNHB 4YXLL 4TSAL 5MI0B 4K2UH 4MWFA 5HPMA 3GMLB 5H35B 4OFPA 4J12A 5DTFA 3GM8A 5CILL 1DBAL 1U8PA 1S7QB 4Q74A 3UPRB 4Y2DC 2EDWA 2FIKA 4GXUM 4WO4D 4H26B 2CUHA 2OL3H 2HKFL 4NCDA 4X4XB 2OBGA 4YGAB 2LTQB 3QEQA 1VKXA 3ZT6A 4LF3A 3QUZC 4KJPD 1HH9B 1KLGA 1CFVH 1QFOA 5MEQB 2HFGH 1EV2E 4S0TD 3DOSA 2J4WL 2XQBL 1YECL 3OKLA 2ZOKA 4OIIH 3BKMH 4LHUD 2X4PA 4TYUA 1TVHA 2EECA 4NQDA 1F4HA 5T3ZD 4JY4A 4I3RH 4G9DB 4I18A 3REVA 1I8IA 5E8DL 2P5WA 1P84J 2P45B 3PG2A 1KUMA 3AM8C 1EVTC 4R26H 5I1KL 2MMXA 4F7EA 3W0WA 2K9UA 4PJBA 1LNUA 3MTRA 3P30L 1CFQB 1X6NA 2VDNL 2ILLA 4IRZH 5LAXA 3DI3B 3TJEH 4UTAL 1LO5B 1RFDH 2OS7A 4JO2L 4OV6F 1CXLA 5D7KE 5IM7A 3OKEA 3LRGA 4YFLI 4FQXB 4G8GB 5EC2B 1ZVYA 4HS8L 3P0GB 1XGYH 5ALCH 4JPKH 5DEZA 5DO2C 5L88H 2A2QT 1IAKB 3H3KA 4G3YL 2PYFB 3QIWC 4K71B 1FJ1B 1RHHB 2AJSH 2NY2C 4C56B 5DVLA 3VI3E 2Y36L 5DRNA 2C4FT 2D4FA 4QRRA 1KTLB 5SX4I 4BK5A 3QDAA 2PUQT 1Q72L 4HC1L 4FZEH 4WWKB 3QI9D 4JFXA 2DDQL 3WS3B 5B3NA 1OCWH 3JV4A 1MVUA 3AU1A 4QHMA 3MLXH 3K74B 2V7HB 2AK1H 4KI5D 4RMVA 1CL7H 2LVCA 2ATKA 4P5MA 4E41A 4I0KA 4JFDE 1XIWC 1URLA 4G7YH 4P2RA 3C2AH 1IGMH 1J9CT 1A1OB 1HSAB 3WFEH 1IFHH 3CU7A 1ZGLB 4FFVC 5HVHC 1KXQE 3QCVH 3NIGF 3RL2B 5I76A 3GSQB 3P2TA 1OAZH 5ANME 2BSSA 3ARFC 2E7BA 1MHCA 5INCB 1MVFA 1OAKL 4IDLA 2J6EH 5E1AB 4APQB 5C0DB 1T1WA 5ICXB 3S5LA 5J11C 4AJ0A 4ZOAA 5HHPA 4JFZH 5I30H 1N7ML 1Y6NR 3GRWH 5ICZA 3MV7A 3KNBA 4Y16A 5DD3H 3KJ4B 5B38A 2Y07H 3PF2A 1HIML 2QSCH 3VXRA 4NQTA 1FVEB 2Z9TA 1DJSA 1HKFA 1JYWA 4XNUH 3MYJB 2HLFC 3OAYH 1EO5A 4ZPVA 5IMMA 2JB5L 3T0EC 1Q9OB 3O4OB 4NRYB 5KS9F 2C26A 3BVNA 3MJ8B 3X17A 3GBML 1DE4B 4O2FB 1AH1A 1AO7D 4PRBA 2BMKB 1V05A 5I16B 2FR4A 1YUHA 1YPZF 1DLHB 1NGXB 1RIUH 2CGRH 5FA4A 1Q9LA 4XWGH 4O51A 1E4KA 4GG8B 5IOPA 1EUUA 5MEOB 4Y19A 2PTTB 4BSJA 1MRCH 3HLAA 5IEKA 3K8MA 3GIZL 4TUKH 2Q6WA 4QXUH 1KGCE 3KYMB 1T0NA 4H1LG 4U49A 1EEYA 3D3VE 4LSQL 1R3IL 2XWTB 4IRSA 1JVKA 4FXGB 1TTUA 2J5LC 5IBUG 5I1CH 1IL1A 3HFMH 4Y4HA 3ILQD 2VDPL 4XGZB 3D0LA 1W0VA 1I3RB 4TUOB 2UVFA 1YPZA 4J3VA 5I73B 1UXSB 3OKNA 1OP5H 3CLEH 1FAKT 3R8BB 4EN3B 3N85L 4JFHD 5ABDE 1A7PL 4PBWD 3Q5OA 1ACYH 4MA8L 4Q0XH 3BXNB 5AD0B 3A0OA 1JPFB 3T4YA 4YBLC 1TJHL 4I9WE 4NPYB 2PYEB 1JNLH 5F88A 1OAXH 5C0FA 1UZ8B 1JFQH 4PJIB 3KYNA 3BKJL 2BXZA 1G7IA 1I9IH 4LEOA 1FP5A 3AAZB 3PHOA 3SDXE 4Z7OF 5GZOC 1CD0A 4CDGC 1JP5A 3K1KC 3MLYH 1DZBA 4X7EC 4M7KH 2KQNA 2V5TA 3P4OA 3MJ6A 3NZ8A 4JO4L 4ONOA 2OZ4L 4W68A 1U8IA 3X12B 1BQUA 3QO1A 1BFTA 2MPAL 1QRNE 5CGTA 4EDWL 2OR9L 1FC2D 4UV4H 4LRNH 4CMMA 3CFBA 2D7NA 2FYYB 4U3XA 4EXPX 3DUSA 5C0CB 4NQCA 3QHFL 1KNOB 1JGDB 1OAUL 1E6OH 1LK3H 2CJUL 3T0XA 1HHGA 5CJXC 4OF6A 2DMKA 3L7FA 2FECI 4IDJH 1AIFB 4NO2B 1EPFA 4IS6A 3RVVC 1MJ7H 3VD9A 3IU3A 4PJ7B 4ALAH 4N68A 4N9GA 5IFHL 3HMXH 4LQ1A 4P99A 4JPVL 1FL6B 2E7HA 3CUPB 4PJFB 2AKRA 5EBMA 1HHIA 1ND0A 1CU4L 3KR3L 3MFFB 2VXUL 2Q7YB 1WEJL 1E27A 1A7QH 5J4MA 1G9EA 3MRLA 2X05A 1C5DB 5A16A 1IGYA 2CK0H 4UQ2B 3RGHA 5ISZA 1S9VB 2VKWA 1EJ6A 4NM8H 1YY8A 4IIQB 5EIQA 1KEMH 5IK3B 4EXKA 2ZOLB 1RURL 1N5YL 4I3SH 3ES6A 2CRMA 4HXAL 1RZ7H 5EPMB 2P48B 1GZPA 4JKPH 5C0AE 3QA3A 4NWUH 2ZUYA 5DJ0B 3RKDD 1SY6H 32C2B 3O2WL 1EXUA 4YK4B 1IM3B 4LASL 3O3BA 1R5VA 1YC8A 1C16B 3DUUB 5GRZA 4OCSH 1H3VA 2GK0A 3DGGB 1L4IA 5F6IC 3VMOA 4WW1A 1OARH 3DVFA 1HE7A 1TENA 4RMSA 5T1LB 3RY6C 4CADA 3BGFC 3BW9B 3S96A 1J0JA 3OR7B 1J8HB 3MJGX 4WCYL 1TLKA 1HYSC 5C92A 5L0QB 4OM0H 5GJSH 4ERSH 1FE8L 3SO5A 1I7TA 2GUOA 5D5MB 5HHQA 1WV7T 1I8LA 2VAJA 2AEQL 4UU9A 5IVXF 5C0BE 1VPOH 2PW2B 3SDAC 2YN5A 1H8SA 2YK1L 3W5MA 2OXGA 1U8QB 2A77H 3HZKA 5F44A 3NPSC 3R1GL 5HGBB 3RWEB 4DGYL 1NGYB 5ENWA 5HGAA 4JM2F 2JJUA 3WL9A 4NQEE 4FXKB 3MRMB 2IFFH 3BE1H 4L29A 4Z7WF 3V5DA 5KVDH 1K5NB 2F15A 4P5TD 1RV6X 4ISVB 4S0SD 1BQLH 2WANA 4I8DA 4LPTA 3CFKA 3QUML 3BKCH 1X5KA 2XZAL 3EYVA 2VDQH 3NFNA 3P40A 1NANI 5IVXA 2VXVL 2VJXA 5C8JB 3WFCL 3VRIA 1KXVC 4YDKL 3PGDB 3SDCD 4Q9BA 1MUJB 4PGCA 1RZIA 1HHHA 4HJJH 4NO0D 1XF4A 4LQFL 2EDFA 4UB0L 4X98A 4DKEL 3BIBX 2BNRE 4ONFH 3LPGA 1CN4A 3O6KL 4OLUL 4Z7WA 4TUJB 5DT1H 1CFSA 1NCAL 1OQOA 4Q58C 1FN4B 4W81A 5CMAA 3SOBL 4DJMA 4XP5H 1AY1L 1YN7B 3O3EB 5DD0H 5L2KE 4LSTL 2XRAL 2FX8H 4PP1D 1NCWH 2VISA 3E6HB 3JTTB 2EC9U 4GRMB 1U9KA 3HI6H 4O58L 4RGNE 1P9MC 4MNGE 4Z7VA 4N0CC 5GZND 3GJFK 1QFWI 3K3QA 4YGVA 3KPRE 4M5ZL 5D7JD 2H1PL 4Z95L 2FX9H 2WLYA 1KC5H 2AP2A 3B3IB 4BFGA 1T3FA 4NZJA 3MXVL 4IOSD 4Z9KB 4G5ZL 4NT6A 1F4XL 5D6DC 1FCCA 3SEPA 4MA1B 2O26U 2F5AH 4QXTA 4AEIH 3O45B 3LD8B 3MV9D 2DQJH 3QQ3A 4F37K 2AXGA 4OGXH 3TO2A 3C60D 3O9WC 4KDWA 4NN7C 4GUPA 2ICEB 1I7UB 2CLZB 3MLPA 3WN5B 1F58H 3EDJA 5DEGA 4C59B 4JRYE 1H9VA 5JHLH 4RRPG 2R8SH 4HPOL 1AXSA 4LVNC 1A6TA 5C6TL 4V1DE 1G6RH 4YO0B 5KSBE 4JDZA 2ZG3A 1CGTA 4J4PD 5FYLD 3T2PA 1NGZA 1PSKH 2WBJA 1T21B 4N0RA 4PIRF 4MAYA 3SCMC 4U05A 4ZODA 2O93L 3MLSH 5B4MC 5K9KB 3CFEB 3SE3C 5JOPD 1NAML 3FKUS 3OR6A 3RPIB 1J0HA 3JTSA 1DQJA 1WGOA 4OAWB 1A6WL 2GTZA 4HZLA 4K9EL 4M93B 2GJ6A 5F1SA 4NNYB 4KPHL 5E9DE 4QHKJ 4UT7H 1NGQL 2OTUA 2R2EA 5I18H 3SKMA 3ULUC 4DEPC 4AEHL 3VWJA 5EU7C 4M8VA 1DBJL 3PWNA 3CSPA 3QUYD 3VI3F 1I9JH 2NTFA 1YY9D 2ARWA 1FGVL 3CD4A 3QCUL 3GMRB 2W65A 3QQ4A 4GKOA 4X4ZA 4F9LA 4LSUH 1OGTB 1W0WB 1KJVB 5GRUL 5E6IA 4JQVA 4LU5H 1MCLA 3C6LC 3KYOA 1YEFH 2VITB 3D0VA 5E56A 2ADIA 1IILE 4ZTPL 5GXBB 3IDYC 5CHNB 2WM0A 1MQ8A 4QKXB 4XNZB 4ZNEE 5CD5D 3QISA 3ARYA 3D2UB 3LHPH 2O5YL 2D3VA 7FABL 1HOCB 2VXTH 3MGOB 5TQ2H 2ERJB 2CUIA 5KANG 2E5EA 1WBYB 4PJEA 4XX1E 4FS0A 3MV8D 1QBMH 4XRCB 3FQXA 3UTQA 4NQSA 5J7CC 2QSQA 2DLGA 3NAAL 4PTTA 1F3JB 1YEJH 1JPST 4WFFE 3QXTA 2ADJA 4Z18A 5H2BA 5D1QC 4N0UE 2BVUA 5F7LB 4HIJA 4LVHC 5D7LE 3GI8H 4WFGE 5CCKH 4XC1H 2O5XL 1OSZA 2A6DB 5ANMA 4YBQC 3CDCA 3SGDH 3L5WA 1AJ7H 3TVMC 3TN0A 1BAFL 2XOTA 4OLZH 4PJ8B 1G7PB 3A67L 4XMKL 2Q8AL 3EIFA 1JCKA 4I5BA 2G5BA 4LF3B 4XNXL 1KLGB 1U95B 3I75B 3GIVA 3WLWD 3W2DL 1MFEL 1KF9B 3IFNH 3ARGC 4P9MH 5TE6H 3ZKXB 2XZCH 3EO1B 4HHAA 4ZUUB 5LWYL 4JFQB 3IJHA