5CP7B

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
DVQLRESGPDLVTPSQSLSLTCTVTGYSITSGYSWHWNRQFPGNKLEWMGYIHYSGSTNYNPSLRGRISITRDTSKNQFFLQLNSVTTEDTATYYCARYGGYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
total genus 42
structure length 214
sequence length 214
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B01
1S5HB 2YRZA 4LFHG 3RVWD 5GGRY 1UQSB 4M3JA 4D3CL 2NR6C 1KIPA 4G9DA 1N64H 5FUZH 2QLVB 3D0LA 3AGVA 2DJ4A 2CK0L 4E41D 3UJTL 1AGBA 3BKYL 2FR4A 4TNWF 3PIQB 1S7QA 3FT4B 5LBSH 2F53A 3RHWF 1QR1B 1KFAL 2B4CL 4TRPH 4CMMA 1MI5D 2V17H 4M5YL 2X4RA 5E08L 5ESQB 3ROOB 4HIHA 3ARBD 3B9AA 2ARJQ 4D8PA 2FO4B 1XGRA 1LQSR 4PRHA 1QPPA 1U8QA 4UOJA 5E9DD 4F37F 1X5YA 2H9GA 8CGTA 1XCTB 2B5IC 4Z95H 2H32B 1FCGA 3TO4C 3QUMH 2DQEL 4U1MB 5I1IH 5I1AA 3CSBA 4Y2DC 1LE9B 3NCJH 5F1OB 3O4LB 1S9YB 2J88L 4P5KA 2P5EE 2DWDA 4HFUL 1YY8B 4BH7A 1GAFL 3P9LA 1G9NL 1H3VA 1LO5A 2IBZX 1ONQA 3OKNB 4PJ5E 1ZLVH 1CICD 3LS4L 5IROC 2ZNXA 2AV1B 4R97C 2J6EL 1XIWD 1LILA 3DRTA 3UPCA 1JGLH 4PJ9B 4PYGA 1ZLSH 4YXLL 5JHDB 3O8XA 5IHBA 4XH2A 5L6YL 12E8L 5HGHA 1JHLL 4U31A 32C2B 5F70A 3RL1B 1CDHA 1PYWA 4JPWH 3OKOB 4CBPA 2CMRH 2OSLA 1TENA 1PZUB 2VJXA 5KSVB 1E6JL 3BISA 2PR4H 2NYYC 1ZA3A 4OGYH 4N9GA 2X4QA 3ZKNC 1CBVH 1T0NB 2V5SA 3EO0A 4XVTH 3KPNA 5T1MB 2D7PA 4D0CA 3GJFB 4J8RB 4L3ED 1U42A 3V4VL 3STZA 3LRSB 2ZUQB 1OL0A 1P84K 2R29H 1ZTXL 5A16A 4NFCA 1U8JA 5JR1H 1CD9B 4X6CB 4DFHA 2YWZA 4NM8H 5JW4N 2FL5B 2QADB 1I3GL 3NFSH 5BZWA 4XB8A 4MWFA 1MHCB 1A6AB 5E2WL 3W81A 4LLMB 5E5MB 1P7QD 4KRNA 1AO7B 5I8CA 4YNYB 3WLWC 1SYSA 2NZ9D 3RIAF 4MA1B 1DQQB 2C1PB 5FHAH 4OSUL 1H3GA 3DNKA 2LVEA 1FJ1A 1IKNC 3HE6C 2X44D 5DVOA 1MOEA 1K3IA 3IDYC 5MERB 1U8PB 4FQXB 4KI5F 3HZVA 2HFGL 2X4NB 5JMOC 3P11L 4WEBL 4NRYA 3MJ6A 5E1HB 3O0RH 1E4WH 1N7MH 1CLYL 1DFBH 2KPNA 3QHFH 3C8KB 4KHXL 4PY8I 1BIIA 2ICWB 5MEOB 2VQ1B 1AXSB 1CLCA 4LEOA 4J4PA 5DUPH 4XPAL 4G5ZH 4PJDF 4GXUN 3HZKA 5EIVA 3MLVL 2P42B 3H3BC 4NNYB 2VLRD 4X9HA 3H9SA 3DV6B 2VLKE 5CINH 1C5CL 5E6ID 3JTSB 4GKNA 4F58L 4R90H 2UYLA 3TN0C 5DHVB 3H7LA 3R8BB 5I1GH 1MCIA 3CFEA 3QFJA 4CN4A 5GRZA 2VSCA 4HXBH 4Q0XL 2QQNH 5FHBL 5IB3A 4JFQA 1RVFL 3HRZB 1AKJA 5I75B 5BV7L 4EXPX 3UTQB 5I1KL 4IS6A 1S5HA 3KPSE 3KYKH 5D7KD 3D85A 4G7YL 5HHMD 2BOBB 2VQTA 5F3HB 1HXMB 3FONB 4JKWA 1WFOA 4ZUVB 4OF5A 1KTRL 2R1WA 4ZFOL 3OR6B 2VXQL 3BUYA 1BREA 1G7JA 3FT4A 1YQ2A 3RNKB 4HIJB 3G5YB 1WFNA 4WJ5B 1QR4A 5E2VL 2NR6D 4L9LB 3X11B 2X2YA 3OJ2C 4BELD 4P4RB 1XF4B 3FHQA 2NY7H 4K3JH 2FO4A 1NMBH 5CKAA 4HSQA 1JZ8A 4PRDB 2FSEB 3IF1A 1A9EB 3GSRA 2YEZA 1LK3L 1ZOXA 4KUZH 1PVHA 2K7QA 4WNQA 4GKZB 4U2ZA 1SM3H 5HVWA 3JV4A 1L0QA 4DKFL 4P46B 4U1MA 1RD6A 3KLSA 4HBCL 3PWJA 5CZXD 2BVPA 4OCYH 1JCKA 3AVEA 2EE3A 4YH6A 1LE9A 5T3XH 2JB5L 5JPMA 5FGSA 1S9YA 1U8LB 3QB7C 1NAMH 2XN9D 2DQDL 2ZSWB 3MV9B 3T1WA 2OLDA 4FZ8L 1KEGL 4LSVH 4LU5H 3TO4D 4L8BB 5IB2A 4U2YA 2WP3O 3MYJB 4XHJC 4G8GD 1TMCB 5IBLC 1N0LA 3AS3A 4PJAE 4XXDB 5CP7B 5LJYH 2R4RL 1K4CA 1CICA 1GGBH 4X6DF 4P9ML 1Q1JH 4PJ9A 4X7SH 3MRGB 4YUEL 2GJ6D 1DBML 2ZKHH 4X9GA 3G08A 3S35L 3TBVB 1CD1B 1NGPH 2XWTB 1FG2A 4UUJB 4Z7VB 1S8DA 4M8QA 3G5ZB 1AD9B 4DGYH 1YC8A 4GRWE 4E42A 3FN0L 4ZNEA 2ARJB 1AFVL 5ANMB 3FOLA 2XKNA 3IDNA 4L4VA 1ZS8B 2XWBB 5E8PB 4PJHE 4L3EA 3U79A 5KOMC 3TBYA 3IU4H 2CXGA 1FNEB 4XP6H 4JO3H 2ADGB 3N85H 3RY6A 4E0RB 4X6CA 1FLRH 3D3VB 2ID5A 2FL5A 3KYAA 4M6OH 1JPGB 4XCEB 3BPNC 1UXSA 5IEHB 1HQ4B 1H3UA 2NXZC 2VDRL 3IXTB 1MCQA 3UCRA 3RGVD 3QNZA 5ESAB 1EEZA 3FMGH 1CD8A 2DLIA 2B4CC 1QLEL 4YNYA 4ETYA 2AQ1A 1YECL 2Y5EA 4XBGA 5I2IB 1DQQA 4EVNA 5JZ7C 3EHBC 3R0NA 1UACH 2F8VA 4WFFE 3OKKA 2OP4L 3B2VH 4U1KB 2EYTB 3T1FA 5IIEB 1EGJA 2H45A 5F7EL 2YPLE 1BBJB 5IBUB 3A6BL 4JPVH 1UB6A 1QO3B 4KDVA 2DS4A 3HKFA 4CAGA 4TVPL 5BQ7B 3TF7C 1N26A 2ICWA 5DMKB 4A6YL 2CO7B 4HJGB 5E6YA 3KJ6H 3HE6D 4JKLA 1QNZH 1ZT1B 1F3JA 1A1MB 1C16B 1MIML 2EE2A 4QRPD 4M7LT 4RFOL 4U7SA 5EOTB 4U6VL 4NKIL 2YKLL 1G9NC 1M7DB 4F9LA 5SWQA 1MCPH 1NGYA 3QUXC 2BVQB 4WWKD 3THML 3VXTB 1JHKL 3MUY1 1VFAB 5GGSY 1CGWA 1PG7L 3JTSA 3HC3L 2AEPL 1UB5A 1XGTA 1U3ZA 1VPOH 5E6IA 5KS9B 2VE6B 3QIUC 1EHLL 4RGOL 2JF1A 3MXWH 3AB0C 4HDIA 3ZTNL 2NW2A 1ORQA 1FAIL 4XPTL 1IC5L 5E95B 5D2LE 5MEQA 1Z9MA 4Z7QE 5FIEA 3MRPB 2BXYA 1FDLL 4M7KH 1DL7H 5IR1B 4IRJB 2HT4C 4I5BB 5CSZA 2I26N 1A5FL 3KWWB 1WK0A 5F96H 4XP4L 3OR6A 3WFBH 3G5YA 5KJRH 5HVFB 4QF1A 1VEOA 2WWKT 5MEPB 1I1AB 3D25B 4CNIB 2H8PA 4P4RA 1ADQL 3VFOA 1MY7A 2XQYK 5M95B 4ZDHA 3S3PA 5EU4B 2PW2B 3UJTH 2FSEA 3BKYH 1IZJA 1W8OA 3NIGF 3QCUL 2UWEA 4OFKA 4EDXA 1EUTA 2B4CH 4LSPL 4M48L 1EPFA 4OZGE 1JWMA 4U0QB 1A8JH 2HJFB 1O5DT 3QDMB 1YYLL 1YN6B 2VISA 2PTTB 3MFGB 2Y7QA 1OOAA 2R39A 3I84A 4WW1A 3MYJA 3QI9A 3OGOE 5T33L 1UC6A 2EDFA 3SDCC 2R0WL 2EYRB 2Q86A 4P5TD 4MHHI 4KKAC 2C7UA 4XXDA 1FQ9C 2J88H 5CP7A 4UDUB 1I8IA 4S11A 3PGCB 5FGCB 5DFVC 5J3HC 3VRIA 1OSPH 4HFUH 2DQUH 3O6KL 3BZEB 3RI5F 3DX6A 3L3JB 5IUSA 3M17B 4JQVA 4TULH 2PYFA 2X4OB 5ISZA 1X7QB 3R06A 2GJ6A 3REWA 2IAMB 3BXNB 1BD2D 3K4ZA 3QEQE 3TBVA 3DI2B 4IM8A 4JQXA 5D70H 3VGHA 1Q38A 2J6EH 2XWTA 1BEYH 5SWZE 3VFMB 2DLGA 3CXDH 4XX1G 5GRUL 2B1AL 3B5GA 2FB4L 1I1YB 4MQXD 3MCLL 4PRPA 4U1GC 3F62A 1CGUA 3OJMB 3HMWL 1A1OA 5DFTA 2CR3A 5EU7C 1IEBB 1KEML 1ZHLB 2KUTA 5BV7C 5DD3L 2O5XH 1JNNL 3TIDB 2XWBA 2BY2A 3R1GL 2WBJC 3DYOA 3VFVB 4R6UA 2IANE 4DGIH 4ALAL 5FF6B 3L6FB 3C5ZB 5KAQF 2QHRL 4XCEA 3K4AA 3ARXA 4QRQB 3IXTA 1WJ3A 3V4VH 4BJLA 3GHBH 2HLAA 4PB0H 3SJVD 1AXIB 3V4UL 4M00A 4KY1H 1VADA 4YHYB 2Q1EA 5A2IH 3LY6A 3CVHL 1NC2A 3QUYC 1N0XH 3MLRL 1D3CA 5IMKB 1A21A 4PJCF 3GZKA 2CDEB 5IB4B 4HH8A 4U1KA 1NCTA 4LGSB 5DEFB 2Y23A 5IIEA 4JM2C 3D2UD 4J7RA 3ARDC 3V6OC 5B3JE 1N4XL 3CJJA 4RBPH 4U3CA 4XWOD 5AYUH 3WNPA 3IU3B 1T0MB 4EI5B 3ZT5A 3FJTA 2V5YA 4XNZC 4QHNB 4HH9B 1ZT1A 3K7UA 2YPKA 3AMLA 3IAGC 1EFXB 2C3GA 4KHTH 4GKSA 3PDOA 1X5XA 3DSFH 5IGXL 1DSFH 3D39D 1KJ3H 4YQXL 2YBRA 2EDHA 3ZKSD 3MRLA 1QSEB 4XPAH 1WGOA 5L9DH 1I3VA 3FB7A 2Q6WA 2G5BB 1N6VA 3MLVH 4JVUA 4NQVA 4KAQH 5T3XE 5IHZA 1FNAA 1G7MA 3FO9A 2LU7A 3HUJA 3HAEB 4I9WD 1GIGH 3SE3A 4AYFA 3AY4C 3PABA 4GKOA 3MRPA 5DURB 3MNVA 3QA3B 5HPMB 1P4BH 2R56L 3QIUD 4PLKD 2C3HA 1Z3GL 3FHAA 1KPUB 3REVA 5C8JB 1IGYB 4YZFE 3KJ4C 4P2QD 3KWWA 4Z5RA 5BV7H 1JGVL 4YPGA 2YPVL 1GGTA 2IWGA 5F3BA 3MV8E 5DD1L 3ULSA 5I1KH 3S96B 5FO9B 3HZMA 3ZE0E 1EHNA 4EOWH 1JPTH 1OD9A 5DXWA 5MEPA 1H3PH 4RMVA 3B9KB 2HT4D 3DUSB 4NC0B 1IZKA 5IBTL 5EU4A 3BH8B 1NBZA 4JG1H 5DC4B 3MODH 3LEXB 4QRSB 2E7MA 5IQ7H 4L29A 2VLME 5ESVB 5ICXB 3ARGB 2PUQT 5EU5B 4KVNL 3QQ9C 4TN9A 1ZANH 1ZT7A 3DUUA 3HI1A 2WW8A 4JCLA 2DKMA 4IDJL 2GFBA 4JFPB 4OCRH 4ZOCA 2Y72A 5I19L 5EUKA 4U0RC 4WU5B 5FA4A 3RGHA 4UAOC 2K7PA 1U93B 4DEPB 3GIVB 3SKJL 2X4UB 4R4FL 3MREA 1JJUA 1JZ3A 3ARVA 3U9UB 4QHLB 2XYCA 3AU1B 3UBXG 2JB5H 1LWRA 3L7FA 5DJAA 4UDUA 3PGCA 3Q3GB 3GSQB 2XZQL 4XX1E 4HF5L 3WDHA 4P57B 1SYVB 3V95A 1VKXB 4GSDH 3U7AA 2QKIB 4D9QD 2XZCH 3T2PA 3RTQB 2OJZH 3IDJB 4KUCD 2ITDA 3MO1A 4AEHH 2IAMA 4O2FB 5TH2B 5INDA 2MMXA 4K55A 3ME0A 4GS7C 4YFDB 5AZEH 4GXVL 4Q7DA 1A2YB 5J3HD 1NCCH 2VAAA 1X5KA 4PJGB 2P24A 3WD5L 2C3VB 3V6FB 1DBMH 1CFQB 4PJ7A 5GGTA 1IE5A 3HI6H 5C0CB 1TITA 3GJEA 3TIDA 1WZMA 1AXTH 2GTZA 4M4PA 2A83B 2IJ0C 3D87B 4ZSOA 2YXFA 4Q9CA 5EBGA 4PJEE 1U8HB 3PNWA 3L6FA 4ODTL 3BEVA 2I9LB 2KQNA 5BRZE 5D1QC 1UZ8A 2BHYA 3O3EA 1QBML 4AH2B 1MAMH 1EFQA 4JKKA 1QP1A 1FIEA 3DX8A 5F9WB 1VACA 3QO0B 2HKHL 3T4YA 5KW9H 5H94A 4UT7H 1HWGB 2CDEA 1WZ1L 4W68A 5D71L 4G8IB 4QGYA 4CU6A 4ONHB 1XF1A 1YEFL 5DEFA 1O7VA 5F7DB 1F4WL 2CGRL 5DJ0B 3UXFA 5D5MB 3D2UA 2B0SH 5KG9A 5J1AA 3ARYA 2A74B 3O9WA 4HH9A 1T7VA 2OP4H 5HYIA 1YUHB 4QRRB 3ESUF 1CDCA 1S7WA 5C2BL 1EFXA 4TSBH 4JEGB 4CGTA 4HC1A 1U8IB 4OKVA 1TLKA 4UDTB 1Z0NA 2JJTA 4Y4FD 3TPKA 3FFDB 4DVRH 5FKPA 5HI3D 2UY7A 3D39A 4YC2C 2VDPL 2R2BA 4OD2A 5F1SA 1KCSH 3K1KC 4MB4A 2G5BA 4QTIL 1DE4B 4RFOH 3IJYA 2Q3ZA 5DJ6A 5DGQA 1WLHA 3MLZL 4NN7C 5HVHB 2HJKB 1A7PL 1PQZB 3BMVA 1JZ5A 1GPOH 5D7IB 1U92B 3HAEA 1W0YT 4JM4L 2AEPH 1I9RH 1VB9A 3CFKB 3MOQA 4H0HB 3DBXB 5I9QB 2VDQH 4PJ8D 5MHSE 3G5XA 2DQCL 1WC7B 3FT2B 4MAYA 1G0DA 4JFDB 1NPUA 3ZTNH 1N6QH 1FAIH 3MLTB 4I0PC 4HUVB 3V6ZA 5HJ3B 4P2QA 2GTWA 5ITFB 4HUXB 4N1CA 3AS2A 2ESVB 3MYZA 1F90H 4JVPA 3WL9A 1IILE 3B9KA 4JY5H 3JTTA 4P5MB 2NY1B 3EYVA 4D94A 1J8HD 4P49A 1OAZL 3QZWA 3WXWL 1X5HA 3NMEA 3LEXA 4XMPL 3L3KB 1DBBL 1V5JA 3T77B 3SKOB 4XTRC 5ESVA 3I75B 2FHBA 4QXGH 1A6VL 4FTVE 3MUHL 2GEEA 1MCOL 5E6ZA 2ZP0T 2AJXL 2GHWB 4PGCB 4OZFG 3WMSA 3TCLA 4AM0A 1EJOH 5IF0B 1JWUA 3L3HA 3LH2H 4LOUD 2X4UA 5DQ9A 4ORGA 3QQ9D 3RVUD 4M48H 5T1KD 2EDYA 4H26A 3U9UA 4C56E 4PJXE 4XNYH 4P0DA 5DLMH 1YEKL 1Q0YL 4PJBB 1FH5H 2H6PB 4PB9H 5IVXA 2VL5A 4LL9A 2RQ8A 1YMMD 3GSQA 4P9HH 1OAUH 1HE7A 3RUGA 3O2VL 3VG9B 4M7JL 4XAWH 4RMTA 5CGYC 4YHKH 3LKPB 2QKIA 4MA3B 3RTQA 3NCEB 2CDFB 3FQWB 2VDNL 1ED3B 5TH2A 4O2FA 3L5WA 1X5LA 5GZNC 3PHQB 4TVPD 5SV3A 1OAQL 5E2UL 3QYCA 2E3VA 4X7DC 4K71B 5I30H 2GI7A 4WEMB 3WIFA 4IOSD 4NDMB 4Y5VA 3VXOB 5LGHL 4BM7A 4NZTL 5K59E 1IAIL 4WV1B 3N1QC 4MD0A 5JTWA 1YMHB 4BQ9A 1H15B 4D0BB 4J2XA 5I1LA 4PJAF 2WUCH 4X83A 4KZEH 2J8UE 5GRUH 1QOKA 1MJUH 2FB4H 43CAB 1IBGH 3MBEA 5J89A 3A6CL 1IT9H 2GSGB 4P2RE 2DQTL 4NNXB 4KWUA 3NA9H 3QUKA 3OXRA 5DD3H 1JNNH 4GW5B 4S1RL 5CILL 5IB1B 3EYSH 1J05B 1F4XH 1S7TB 4N0RA 2EC9U 2ZNWA 3QO0A 1CDIA 3SGDI 2WMPA 1EO5A 2QHRH 5D1QD 4E5XB 4ONHA 4LVNB 2BNRE 2WUBH 3B2UC 4GRWF 4I4WB 3VGFA 4PJ9C 4JFFD 5DFWH 2EECA 3FO1A 3CIQA 5TJWK 4AQOA 2AXHA 3RZWA 1AGFB 35C8H 2HFFB 5EU7E 4KMTH 5D5MA 4ZAKA 3PWVB 1MF2L 2DYPB 3NZHL 3O6LH 4AK1A 1HDMB 1MWAB 3KPRE 2H1PL 5ETUB 5DUBA 1YUHA 4YDKH 4ZUTB 1HIMH 1T83C 1IAKB 4HQQL 2FJFB 1U8IA 3FB5B 4UT6H 3MV7A 1RHFA 3NH7H 5A2JH 2DLEA 4MD4B 2DQGL 3FFDA 4Y4FA 2HRPH 3I2CH 1UVQA 3TWCL 1U9KA 2DTSA 4G3YH 4ZFGL 2ZUQC 1FL6B 3D69B 3RRQA 3IJSA 2XY2A 4F57H 3RY6C 1W0VB 1NFIB 1U8MA 2EDQA 3DXAD 4LLYB 4LQFL 2A1WL 4XAKD 2AJYH 3SKMB 2QADC 4CMHB 4J12A 4H25B 4LLVA 4S0TD 1RZGA 1H3WM 4PRID 3V6OE 2ITCA 4LVEA 4WHTA 5T1LB 2P46B 3BSZL 1FBIL 4OZ4B 2YRLA 3VXUD 1YEHL 1E28A 1B88A 3WNLA 1KB5B 4PJ8A 5L88L 5H35B 3MLTA 1MFDL 2ICCA 5HJ3A 3U7YH 4G7VL 4H1LA 1QHOA 1RZ7H 5HHOA 1EO8H 1Q8MA 5ALCH 3VFUB 1A7QL 2R69L 1KXVC 5ILTH 4I0PD 4MX7B 5BO1H 1J8HA 3L3KA 5F97E 3ZO0A 2BVYA 2OQJA 3NCFB 1CS6A 1QG3A 3A0OA 4BKLB 1RUQL 2RIKA 4F9LC 3AXLA 2QBWA 4Z7QF 1T1XB 4NO3B 3MLXL 3LPWA 4DTGH 1BM3L 2IC2A 1I7RB 3P9MA 4K8RL 1ZGLM 2PKDA 5IOPB 3SPVB 3GMRA 4NBYB 4QY8B 4CDHA 1L7IH 3MRHB 4U1JB 2P47B 5FV1L 2LU4A 4ZXBB 4IDJH 1U58A 5I75C 1OAXH 7FABL 2ZUVA 1OARL 3VXMB 1F6AA 4WFGD 2I9TA 1INEH 3QEUB 4X5XB 3S4SA 1I3RA 3SKJH 4CW1B 1CK0L 4K3GA 5EWIL 5AEAA 1U3JA 1WV7T 5BZDB 4DQOL 4U1HB 3TPUA 4HEME 2GSIA 1T04B 3H8NA 3DURB 3GRWL 1D9KB 1B0RB 2IADB 1TTUA 4OD1L 4JZOB 2DQIL 4U49A 1TVBA 1NFDE 4L9LC 3VXOA 5ADOL 5E24E 1I1RA 3MOBL 4PLJD 2G60H 3LS5H 1YPZB 1JF1A 2VXTL 4WV1A 1YMME 2Y5TA 3S37L 2EDOA 3CFBB 5BVPL 4O5LH 4UIKH 1H15A 4GXVH 4X4MA 1YJDL 3MCG1 5BVJA 3P3YA 2NLJB 2BSSA 2DICA 4P46C 3HC4H 1P7KB 2DRUA 2QJDA 2DBLL 4MNQB 4PGDB 4TVPE 4TUKL 2EDXA 5DI8B 2GSGA 1DUZB 4XNQA 1TVDA 2EXYC 5TFSL 5FYJL 4F7PA 1QYGH 1EGJH 5IB1A 4CVXA 1A47A 4LHUB 1E4XH 2Z93A 2EDEA 2FX7L 2NW3B 5D7JB 4F7CB 4AEIL 3QI9C 3DV4A 4KJPD 3VDAA 5ID0A 2ZCLH 2NY3D 1RAMA 1MCJA 2Q76A 4RRPA 2F53E 3QG7H 4U6YA 3VE0A 4AIZB 2OTUB 5ACLA 4TSCL 3B9VA 2NY2D 2RBLA 2XTJD 3LIZL 2FD6H 3FFCA 3RKPA 1QSFE 2JK5B 3O81A 1WAAA 2APXA 4X8XA 1Q9LB 1AGFA 3UTZA 4JFFA 2W9EL 2L7JA 1J8KA 5IW1B 2CIKB 1IM9B 2HKHH 5IVZB 1FYTA 3N1MC 5SX4I 2DYPA 1BJ1H 1GH7A 1HDMA 4K7PX 5CHNA 1WZ1H 1WBZB 4JQXC 4M1GL 5BS0B 2Z92B 4R4BA 4BZ2L 1PW3A 5DHVH 1HYRC 2MPAH 3WN5B 1OAYL 5EBLB 5IB5B 2EXWC 1YZZA 1EAPA 4IMKA 3U0TB 3DHJA 4S10A 1KLUB 2DD8L 2AK4E 1FL6A 3RBSA 1XGQB 1QKZL 2LTQB 3SBWA 2A6JB 1W0VA 3FOMB 4ODHL 4OF3A 2JELH 4PJIA 4EDWH 1T80A 4BQBA 2DM2A 3ROLB 2IFGA 2GK0B 2Y6SD 3MFFA 3FO0H 4JRYB 3T08A 2DM7A 1KB9J 4ZUWA 1WFUA 4LQ1A 2G9HB 1ZGLP 1GHFL 4OZ4A 4ODXA 3MLZH 4I18B 2VWEC 4KXZI 5JW3L 5TE7L 4PTUB 4NSKB 1MVUA 2ARWA 4HK0B 4XWGL 1CDGA 2Q8AL 3BQUA 3GSWB 4YO0B 1AO7D 2LVCA 3BP4B 4LSUL 5FM5O 3QG6A 3S34L 1XR8B 1KN2H 3H0TA 4X99B 2DQCH 1LK2B 3ZHDA 3LKNB 4KKCD 5D1ZB 5DMJB 4MX7A 4YXKH 3NPZB 2O5YL 4FQXD 2A77L 1QQDA 3WSQL 3ULVL 1F4HA 4WI9A 4BKLA 4UU9B 2FLRT 2F74A 3BP5A 3OF6A 5TQ2H 4HX1B 4NO3A 3WXWH 4YFLI 1LEIB 3CSYA 4WGWB 3CUPA 4YZFF 3QXAB 4QY8A 4LHQB 4KTYA 4RGMB 4QCIB 1CWVA 3GBML 4U1JA 2VLLB 3MJ7B 3FB8A 4JY4A 1P5UA 1NC4B 4Q9QL 1J9CT 1N3NB 3OL2A 4FS0A 3HUJF 3VFRA 3VWJD 2ADFH 1LO4H 3MGOB 1QVOA 1S5IL 4Z7WF 5HGGS 3TFKD 4CW1A 4RGND 1DQTA 3WBDA 2MWCA 5HYSB 4DWHA 3TH2T 5BZDA 5CGTA 2OCFD 2OJEA 3VXRB 4OB5H 1T04A 4HWBL 4MXVF 1B0RA 5D2NB 4RAVA 2WQRA 5C0NC 4JPKH 4RISH 1KPVB 4GAFB 4M7JH 4OCWH 1X5IA 5KSBA 1I1AC 3H9SE 2X1XR 2VDNH 4G6AC 1WZKA 3SGJA 2DDQL 4DOHB 3AS1A 2O93L 5I17B 2OX5A 4M9PA 2ZOKB 3W9DB 5C3TA 5C0FA 1H0DB 3CDGB 3RFZC 1BQLL 1KJVA 2ATKA 1QBLH 3PHSA 4NZTH 4LMQI 1IM3B 4UNTA 3RY5A 1DUZA 4P2YA 3TVMD 4G6ML 3FKUS 4KK8C 1KJ2B 3FN9A 4HCRL 3HI5L 5L7XH 3P0YH 4MMZC 5SWSB 2NW3A 4O2CB 4EN3D 2X5PA 4F7CA 2XA8H 1K6QL 4JPIA 1I4FA 2D0HA 2VXSH 1CLOL 5D96B 5JW5B 5T3ZD 4M1DH 2W0FA 3ZYIA 1JGUL 4OIIH 2OTUA 3MV9D 4XP1H 3V6BR 3G5VB 1MAJA 1MFAH 3ZE2F 3C2AH 2IQAB 2W65A 1NCAH 4O2EA 4R0LA 2JK5A 3QDGA 1TJHL 1Q9LA 5LAXB 1XGPB 4HV8B 2QSQA 1I8KA 1IM9A 4FABH 2IAMC 2FCBA 1KCUH 3DRQB 1OVZA 1XGYH 2AVGA 4QWWD 1WEJL 1KJMB 4PJEF 4KTEL 5BS0A 3SQOH 2H3NB 2JJWA 4JFZL 4K8RC 5B4MC 2FH6A 3WN5A 4M61A 3O4LE 1FZJA 1NCWH 5C0AB 4KKNA 4WO4B 3U0TA 4ZODA 3EFDL 3BT2H 5GISL 2CKBB 2H1PH 2A9ML 4RFNB 4TPRH 3DLQR 2FHCA 4NQEA 1XGQA 4M7ZB 2X1WL 3BEWB 3FOMA 5F7YC 3QCVL 4Z78B 1IKFH 5I1HL 1A1NB 4YLQT 5DRNB 3C5ZC 1C1EL 4L1DA 5FYLH 3T4AB 2J2ZA 5C07D 4OGXL 4PRAA 1AGEA 2GK0A 4KQ4L 5JHDE 4JRYA 2MQ3A 2YD4A 1ZLUK 1J86A 2G9HA 1U95A 2DI8A 4YHYC 4PREA 1LGVA 3D3VD 2EH7L 4I18A 5F7LB 2BSTA 4MD5A 3CFDA 2EZ0C 2V2WB 4F7EA 5JHLL 1YEGH 3GSWA 3HC0A 1YJDC 1G7PB 5MP6H 4GJTB 5BXFB 3SDXA 3D0VB 1NAKH 1FBIH 1XR8A 2XKSA 3PP4H 5C7XL 4L4VE 3P73B 4Y16D 3E6HA 1T5XA 1K8DA 4EI5C 1SVZA 1D5MA 5HI5C 1SJXA 1FE8L 3FQUB 3HLAA 4X6CE 2C3XA 3QJFA 4KDTC 4LEXL 3RWIB 4MXQD 4U1NB 4UILL 1SJEB 1MRCH 1QD0A 4KK5C 4HX1A 2JJTC 5ICYA 3PQYD 5GGQL 1DQML 1A7QH 4HFWA 2PYEA 2D7MA 1UA6L 3UTSB 4K2UH 4M1CC 3WFCH 4QCIA 4JQIH 1JNLL 3MJ7A 1RUQH 3ZDYF 3EJZD 3L5XL 2WK2A 2Z91A 1F58H 2C26A 1RIHH 1TJIH 2ADJA 1XZ0B 4Y19B 3MGOA 1KENL 1RK0B 3V0WL 4JRXB 2DMCA 3PUCA 8FABA 4UT9H 4IDLA 5GGTH 3W5NA 3VXRA 3F12A 4XNMB 2OM5A 4QOKD 1NH6A 5DJZA 1KPVA 4OLVL 5JIPA 3LQMA 4HWZB 3B9KC 4IRJD 4ISVA 4PD4K 5IVOA 2X05A 4I1NB 3BD5A 5BMFH 1M71A 2EDWA 3AFLA 3GRWH 2Z31B 5F93C 5C0ND 4U1LA 1Y6NR 1EDQA 4OD1H 2HKFL 3ARGC 2J1KA 3INUH 1BBDL 1SEQH 3UTTA 3LRGA 4I8DA 2W07A 3UJIH 1IM3A 1MWAL 2ZUSA 1UWGL 3S37H 4PJ5B 1F3DH 1KJ2A 5HPOA 1YJDH 3TVMA 2IMMA 3WNMA 1LEKA 1CGSL 4DEPC 4OI8A 4R8WL 2BRRH 5SWSA 3U30B 4O2CA 4TNWK 2I07B 2DTML 3CLEL 1P69B 3X3GH 4P4KB 4XCYB 3DUHA 4P59H 1WWAX 2XQBL 3RHWK 4EN3A 2DBLH 4TUKH 3P0GB 3GSNA 1JNJA 1C08B 1MCWM 3W0WA 1MHHB 4ZTOH 3FZUD 1U8NA 5DYOA 1OPGH 3MSPA 1RZ8B 3IFPA 5INCA 4HC1H 3BKJH 2FX7H 4XI5C 4F37K 1KTDA 1VENA 3RTQC 3LEVH 4KUCF 4JHWL 3DRQA 3TJEH 2UWEE 1B0GB 2X10A 4MJIB 5FYKD 5L0QB 4TSCH 4HUMB 4GG6B 3X14A 3LIZH 1W8NA 2AGJL 4HEPG 2NMSA 4MCZA 5B3NA 1GZPA 2F54B 2IGFL 4GAJL 3MLSL 1KB5L 2W9EH 4WO4A 4QNPE 3HAEH 1A14L 2E7CA 3C09C 2CKBA 2FATL 4K8RD 2E7BA 1HHIA 3B83A 2DWEA 4M93B 1MFCH 3V2AR 4NN6B 3OAUL 4NRZB 3WCYA 1OAYH 4JZJB 1NLBH 4BH8A 3P4OB 4Z78A 4PFEA 2OR9H 1WIOA 1CI5A 3EO9L 4XCFL 3DMMB 1T7WA 5C07A 4OCXL 4WI5A 3LQAL 2J4WH 1FPTL 3VG0L 3QQ4B 4ELMF 4UINL 5F9WC 2CLZB 5I8EA 1N5AA 3TCXA 4OLEA 3EW3B 5L2KB 3ARUA 2VDML 5JLZB 3NAAH 5I0ZA 3W5MA 1ZWIB 4Z7VE 3T0WA 3UZEA 3O45B 4Z6AT 1G7PA 3L1OL 4K3EL 4PRPE 4E9LA 4QRUB 5AZ2H 4YHLL 5EFIB 5ANME 4JJ5B 3TYGL 2IEPA 3PWLB 5DJ2A 1NUDA 5I8OL 4JY6A 4JAMB 2JCCF 5E99H 4Y1AB 2Q8AH 3FQUA 1JUFA 5E0QA 4D9RD 9CGTA 4XGZB 5DQDL 3RWIA 4Z7UA 4WDIB 1NEUA 2FJGB 2X9WA 3U1SL 2YUZA 1SJEA 4FFVD 1SJHB 3NCYP 4GUPB 2SEBB 3JBG7 2BNUB 3QCTL 4AEEA 3RIAK 3BE1H 1HINL 4OLZL 4WHCA 2XNAA 3GMLB 5FYJD 4ZPVB 1R5IB 3WSQH 2J5LB 1BZ7A 1NL0L 3CMOL 4R2GB 5CUSL 4PTTA 1KN4L 2WINA 2XY1A 3H42H 4L4JA 3ARED 4MAUH 5HVHC 1WCBB 3V9FA 2NY5L 3MRKB 4YEFA 4Z77B 2EC9T 2W0LA 3OJDB 2JIXD 3ZTJH 4GMSH 3GBLA 5DK0A 3FRUA 3HTLX 4R96B 4BK4A 4BFIB 4NQSA 5I9QC 5JDSB 4NGHL 3FQXA 4XT1C 5GS1A 1CT8B 4JO1H 4L5FH 4L4TD 4YXHL 3ZKMD 1HYSD 3W39B 3K46A 3WE6B 2OTWB 2VDOH 4QOKA 3QQ3A 1LO2H 4LSSL 1Z9LA 4UV4L 5TE6H 1MFEL 2QQKH 3WDJA 2BX5A 3I6LD 3GM8A 2J7LA 4HWZA 1IGTB 1WBYB 2JJSA 2NY1C 3NACL 2OZ4L 4HIXH 4P23B 3LKOB 1BFOB 4HS8L 1T7XA 1VEMA 2VKXA 4LKXA 4G8EB 5GQBA 1NLDL 4FFWC 3V0VB 2N1KA 2F19L 1EEYA 2JB6A 4F7TA 3PWPD 3S88H 3JWOC 4DCQA 4QGTA 1NUGA 5HY9A 2CRYA 5ITBH 3O11B 5B38B 1LE5B 1UH2A 3C08L 3L3OB 3O3AA 5F89A 1FN4A 1CZ8H 4F9PC 1GOHA 4KVCL 5IG7A 4PV8B 4RSVA 2OXHA 3LV3B 5E94B 3UZVB 3HA0A 5FYLE 1U6AL 1YEEL 1C08A 2RFXA 5D1XB 1YEIL 1CGXA 5E8NA 4HCRH 4FQ2L 5I1CL 3RY4A 4LARL 1M1SA 5TPWH 3QXUA 2E9JA 3VG9C 3D18B 4I2XA 3MPCA 1FFPB 2WIIB 3G6DL 4L8SA 1B0GA 4MA8H 1M7IB 1T1WB 4N5EC 5F7KC 1NGQH 3RVVC 4K71C 4MVBC 1FO0B 3QDME 1A3RL 2AJ3A 4HWUA 3NZ8B 3ULVD 2KBGA 2OI9C 4U6TA 3GNML 4JDVA 3QZWG 4WV1C 1RMFL 3VD7A 4Q9RH 2G75A 4CVZA 4J6RL 4KTEH 1AC6A 3CAFA 3LSOB 3ES6B 3CZJA 4LKCB 5A2LH 3T0DA 3N9GH 5F1IB 4H0IA 1FG9C 1OSZB 3N1GC 2EDDA 1R5WB 4NUGL 4OCSH 5FGCE 4V1DD 3EFDH 1KUMA 5C0CD 4N0UA 1AHWB 4H1LH 3I3EA 2YUWA 4QXTB 3QR2A 4R7DB 4LPYA 4HPOH 1MHEB 5I15H 4O4YH 3QQ4A 3B4NA 4XC3L 4KJYB 3HS0B 2CLVB 3E3QC 3UBXI 3F7YA 3QWOB 4PJFA 3BZFA 5L2KA 3SY0A 4GRLB 3ZSTA 2Q7YA 2EKSB 4LVNC 3R4DA 3VWKD 2FIKB 3O45A 5E4IA 1WAAF 1KC5L 3IDGB 4PJ7E 2AXFB 4G80B 5DTFB 2VMFA 3JWOH 3O2DA 4Q6IB 2OMNA 1R3IL 3LOWA 1EO7A 4IIQB 3STBA 4XNXH 3K0WA 4LP5A 5EZLB 4JAMA 4W4NA 5DC9B 4KV5E 5F1NB 1EXUB 4DAGH 3BRDA 4ZSOE 3NFNB 3MV01 1WUNT 4OQ1A 4WW2F 1TJGL 3RZCB 4RX4D 2BVUA 3QUMB 3CFIC 2FJGA 1XCQB 1SJHA 5C7XH 4IMKC 3QHTC 4GUPA 1C5DB 3WIIL 4TTDD 2CRZA 3CVIL 4HMDA 5FDYA 3HPJB 2A6KA 1FFQA 1R5IA 2YD6A 4ZPVA 1NMAH 1S7XA 3ARRA 1BVLB 3VD9A 4Z0BH 3SBWC 3QDJD 3P4MB 3C9NA 2EDBA 5FOJA 2YMXH 2XG5A 3AREA 4CMHC 4HG4J 2ZJSL 3DVNA 5HGBA 1A3LL 1A6TA 1JNLH 4LNRB 4PBWD 2PO6D 2V7NA 3Q1SH 4LSQH 1TCMA 1KNOA 3WE6A 3I02A 3QNYA 4L4TA 5CEZH 5FO7B 2V9QA 1UG9A 1Q9KB 3QHZL 3U36A 1G7HB 1HZHL 3CK0H 4IMLA 3OXSA 1PSKH 1ZA6B 1Y18A 1ORSA 1T22A 1XF5A 4U3HA 3SKUD 1IGTA 1WBYA 3H9YA 4JFEA 3VXQB 4OZGB 4P23A 4HJJH 1QSEE 5EN2A 5C08B 3CZFA 3MRFA 4B50A 1MCDA 5M7QA 3DX7A 2ESVD 4O51B 4UMGA 4OLVH 2HN7A 2GITA 3T3PE 2AQ2A 4N8CL 2X4SA 3QEGH 3NIFF 2GUOB 1GOGA 3EFFB 4F33B 3PWPA 5CZKA 3SO5A 3C6LB 3O11A 4WWID 5B38A 1DBJL 1NBYA 1LE5A 3L3OA 5A40E 1UM6L 1RUAL 4WUKL 3LV3A 3O6FD 1YNKH 1ZSDB 5CS7A 4ZXBC 1RHHA 1XGUA 3WKML 2AI0L 5IVNA 4FNLL 3S8WA 4NM4L 3T0EA 3TO2B 5C0BB 1UM5H 1CLZH 2MNUA 3V5HA 1NJ9B 4GMTH 2LABA 1CGSH 4MJ6B 3ILQD 2F5BL 1V3KA 2MCPH 5SWZB 1FFPA 2WIIA 4Y2DB 2EIZB 3P0VL 4Y4HB 4WFHE 2ZG2A 3GMNA 1T1WA 3C5JA 4XVJH 1D9KC 2WWKO 4RBPK 1V3MA 4H1LG 4BSJA 1CXHA 2XQYG 4OJFL 3VH8G 1KIUA 3CPLB 2ATPB 1B2WH 1UJ3A 2R0LL 4PRBB 1UYWL 1AIFB 4BFEA 5IM7B 1GGIH 3BVNB 2IQ9L 1HILB 1M4KA 3EDFA 5A3ID 2NY5C 5CLTA 3RA7L 3ES6A 4IRZL 1SY6L 4KRPD 1ZVSB 3R0MA 3VA2C 2IGFH 4Q2ZB 4GAJH 5CBEA 5IVXE 5FYKU 3V7AE 3RI5K 1J0ZA 1KLGA 3SGEH 4JKPL 1FNHA 5D7LA 2BVEA 1N2RB 3RJQB 2NPLX 3DVGB 4HHAA 3T8XA 1KELH 1BAFH 1DEEB 2P4AB 5DF0A 4K3DL 3VFPA 1XR9B 2NNAA 3IXAB 2CLVA 4LSRL 3GI8L 4OIAA 3QWOA 1DLFL 2VERN 4PJGE 2DL2A 3O3DB 4XBPA 4OF8A 2EKSA 4OZHB 3S4SG 2CIIA 3KYNB 4HZLA 1EVUA 1IVLA 4R0LC 4PG9A 3VWKA 3SCMD 3MJ9A 1YC7A 1FPTH 2FGWL 4L9DA 4Q6IA 2A38A 3GSOB 5C0CE 3KDMA 4KK9C 2ICWJ 1GL4B 4YX2H 3WS3A 1Q0XL 2IFFH 3NFNA 5FKAB 1FIGL 2V9TA 4M62L 5A1AA 4G42B 1D5XB 3WN5C 1FORL 4H88H 5FK9A 5ADPL 4RX4A 5IHUH 1GC1L 4C4KT 2R15A 1XCQA 4HXAH 3TYGH 4F3FA 1Z9OA 3LKQB 4PBVC 5E1AA 3B9EA 2VLJA 3PL6D 5FO8A 1JGEA 1CG9B 5JIHA 3HMXL 1NAMB 2PF6A 5LGJA 1A7OL 3S35X 3VFNA 1G7LB 3RQ3A 5KVFL 1DQJB 2LTQC 2HMID 1BECA 5ERWB 4Y0GA 4JO4L 3U1SH 4LPUA 1A6ZA 3FQRA 5EO1B 3QDJA 1KACB 3UC0H 5L2JA 3ULUC 4JHZA 3VI3F 3CC5B 2BJMH 4LCYB 4NKMB 2LQRA 1BGXL 5IMOA 1N5YL 5D5ME 4PJDB 4C57C 1X5JA 2EE6A 4OLWH 3BIAX 4OT1L 4RRPG 1FV1A 4I18C 1KG0B 2RCSL 4YEEA 2VABA 1ZHNB 4QRRE 2NY5H 5FYJU 2R23B 1RJLB 2QSCH 4HT1H 3V4PL 1A7NL 3IRPX 1SEBB 3OZ9L 5AAWA 2DQHH 2ED9A 5DJCA 4M6MH 5T1LD 5GSVA 5IKCA 3VGGA 3EYUH 3ZE1E 1MIEH 4KTDL 1BWWA 2QR0B 1EA9C 5C08A 2D0GA 5D1ZC 5FUCC 1SJVA 2G2RB 2QTEA 1AD0A 4PGJA 4RZCA 3KAAA 3KR3H 1BFSA 3QT2A 4IRSB 1MLBA 3LZFL 1MFEH 1OGAB 1U3HD 5D7IE 1Q94B 2FLBT 5DVKA 3RDTD 4WCYL 4OAWA 2GUOA 1K4DB 1MREL 3C6LA 3LMJL 4NQXB 1R5VA 3SE8H 4RGMC 1XF3B 5F44A 1I9JL 5SX5K 2EH8L 4BZ1L 1BHGA 4JFDE 4AG4L 1ZSDA 3MRQA 1HH6A 5EU6D 3O6FA 5E00B 1NCNA 4OLYL 5I18H 2ESVE 3PP3K 1NDGA 3WFEH 4RMWA 1L6ZA 3HG1B 3Q6FB 2NY4B 2GY5A 3MC0A 4GLRH 4Z7OE 4ZD3H 1PG7X 3FRPA 4XPHH 3JVGA 1K8IA 3PGFH 1T21B 5TDOB 1JZ6A 3GSUB 3EYFA 4ZUUB 5I1DA 1K5NB 4HBQA 3DJ9A 5D2NC 1RURH 1WZLA 3VXMD 3F8UB 4Z76A 4DN3L 1OWWA 2ATPA 2L4OA 5EO9B 4ZS6D 1MQKL 2X42A 4JDTL 2X4PB 4PGBB 3WS6C 1HXYA 3ULUH 1D9KD 1MFBL 1YY9D 2AW2A 4LCCA 2HH0L 5KN5B 2BCKB 3MRDB 4CVUA 5BRZB 6FABH 2A6IB 3I3BA 4N0FB 4X6EA 2V7HB 4PJBE 3BJLA 3NABL 5FXCH 1P5VA 2HVJB 1ES0B 1RMFH 4OI9A 5I76B 4LBEA 4OLXL 2P5WB 4IOIB 3PJSB 4J6RH 3DVGA 4R9HA 1HQRB 5CEXB 1DEEA 3QIWA 4K9EL 1U8KA 4W4OA 1XR9A 1MCNA 5F9OH 3SE4C 2LAGB 1LP9F 2R8SH 2O26U 1OLZA 5D96C 4ZUSA 3BDBA 1R3HA 1BZ9A 1IGJB 1IAIM 1RIUH 4PGEB 3GB7B 2X4TB 2FHFA 3KYNA 3IKCA 1IQWL 3C60D 2OK0L 5D7JD 4RQQB 5GSRA 4JE4B 3SCMA 1KCRH 5CEZE 2ZWLT 3SE9L 2YD8A 2ZOLA 3OR7A 1XFPA 1D5BB 1KGCE 3U4BL 4G42A 1BOGB 1D5XA 3H3PL 4IHOA 4XPGH 4YHOH 5DDHB 2MFNA 5FV2A 1YEDA 4KJQC 4LVHB 2P1YA 4WO4C 3TT1L 1R3IH 5GRJL 2C4XA 2BHUA 4U6XB 3KYMA 4HIEA 2DF3A 4MLIA 3PL6A 4DN4L 1G7LA 4RFNC 4OBSA 3E3QE 1IAMA 1WIPA 4M7ZC 4ZO7A 1VGKA 1LNUB 1FZMB 5ERWA 3VFTA 1HI6A 5ICZB 5EO1A 4Y7MA 1P2CA 3WV0A 3U2SB 4X6BB 3FT3A 4TOYH 3FFCE 3HFML 1L0XA 4JFHE 2K9UA 1QFUL 3KLHD 5ID1B 2IG2H 5J9PA 2EDRA 1IEAA 3DTXB 4PJDA 5J4MA 4ELKB 3BN9C 2FZ3B 1A9BB 1F4YH 1OF2A 3BH9B 1JP5A 1AE6L 3FO2A 2HT3D 1JGDB 3NN8B 5KVGH 1NCDL 4MNGA 1HHJB 1QFOA 1RFDH 1GCFA 4N8PA 4FQIL 3BYTA 4J3UA 2BNQB 1XAUA 4ODBD 3MUZ1 4OM0L 1MCKA 5DD0L 2XXCB 1R24B 3AM8A 1RUML 1AY1H 1KJ2H 3Q48A 3TNMA 4JHAL 3UBXB 2H2SD 1INDL 1LD9A 1NBVL 4XMLH 1DDHB 1YNTA 1CL7H 3MQIA 2AEIT 5E8DL 4PJIE 3SDAD 5IWLA 1FL3B 2YRPA 1FNSH 1OGAA 5B39A 4D0DB 3S5LA 3GSNH 1QFWI 1U36A 2BSED 5J6HB 1U3HA 3RDTA 4C56B 3C8DA 4PJXB 1FO0L 4B0MM 1ND0B 1RJYB 3QUZD 2VXUH 3QWRD 2UY6A 3C87A 1XF3A 3RWCA 1PZ5A 4F2MB 4S2SB 3BZ4B 2P49B 5EU6A 2BSRB 3HG1A 5TF1H 2B1HL 5EOQH 3TYFB 1QSZA 5KS9F 3CXHK 4LCIL 5C0EB 2BP3A 2VZUA 1CFTB 3W9EA 2FWOA 1NC4D 2P8LA 3U4EB 2V9RA 4TYUA 5I66B 4QTHA 1GC1C 1T21A 3QRGL 2CKBH 2AI0H 2AKRA 4LCWA 5IW6A 3TT3L 3F5WB 4NC1C 2WQ8A 1FVDA 3T09A 1N64L 5FUZL 3SDCB 4GBXB 4MDIA 1S7UA 3DARA 3ISWA 4Y5YB 5EO9A 1CDYA 4C59B 2J8UB 3KXFD 5LBSL 2Z31C 2MKLC 1P84J 4P2RB 3MRDA 1TFHA 4TRPL 1G84A 2V17L 1WISA 1NUFA 2A6IA 4KU1A 4X6DA 5B8CA 2DMBA 3BHBB 1Z5LB 2VH5L 2F58H 3VXME 4XP9H 5C86A 4NQDB 3DYMA 3DX9A 5GS2H 2VTFA 4IRZH 3QUML 4POZC 3S36H 3U30C 2BNRB 5I1IL 4P4KC 3GDBA 3KPOB 3NCJL 5EBMA 1CFSB 1F5WA 2AABH 5DHYB 4PGEA 1Y6MR 3GB7A 1CQKA 2X4TA 2E6JA 5KSBE 2ORBH 3KPRB 3O41B 2WBJB 5JW4M 1YPZE 2BERA 1FFNA 3BKMH 5KSAD 1MCCA 5DRWA 2ADIA 4L8SC 1MH5B 3CDFA 2DI9A 2QSTA 2DIBA 3RPIB 5L0QC 5J7CC 4HKZA 1T89A 1E4XI 4WRLA 4JKMA 1ZLSL 4MNQE 3RWDA 3D48R 1BOGA 4HS6A 3EJJX 2ICWI 2FIRT 4M8VA 4GAYB 2E7LA 4JPWL 3BRGC 4PLNC 2DQJL 3QDHA 2CMRL 4U6XA 2VUOA 2J3SA 2CRIA 3WNNA 5MEND 1FIGH 1ZK9A 2PR4L 4XVUC 4JM2B 4G9FA 2W60A 4OGYL 3WUWA 1CDJA 4M93C 2GT9B 2FNBA 4NN6C 1CBVL 4JZJC 4QRTB 5ADPH 4XVTL 2BXZA 3MTRA 4WFED 2IPKA 2VZ3A 1U91A 5ICZA 1JV5A 3IT8D 4GXUM 3GMPB 4XNZB 2BZDA 4WUUD 1MVFA 1ZAGA 3DMMC 1FVCA 4OQTA 2R29L 3DETC 2RGSA 3DTXA 1MEXH 4KV5F 2EEBA 2FZ3A 1A6UH 2VIRB 1HNGA 2Y9RT 1KPRB 3SDYH 4NM8L 5BW7C 5BS0E 3V0AC 3IJHB 3G04A 1II4E 5FA3B 4OZFB 1HHGA 3QNXA 1HHJA 1P9MC 1BGXH 2X41A 3IETA 2BNQA 1GYAA 5E8OA 4OT1H 4U1SB 4J23A 2RCSH 5D6DA 5JXEA 1EHAA 1M6OA 2M26A 3K81A 4LF3A 2NTSP 1D6VH 4NQEE 4DGVH 2LU3A 3ZDZE 5DJDA 4ENED 2HTKD 4LP4A 4OFPA 3O0RL 1E4WL 1N7ML 1MRDH 1DFBL 3QHFL 3ULUE 3U0PB 4K9EC 5J6HA 3GSXB 4JRYE 4WIQA 5FOBB 1DN2A 2A0LC 5DUPL 4G5ZL 1INQB 3RVXD 5KSUA 3ECBA 5J11B 1IQDB 2XPGA 2J5LC 4GRMB 3UJJH 4Z9KB 4R2GC 4XXCC 2OS7A 4XVSH 1H8NA 1WFTA 1WWBX 2FGZA 3CFCL 4HZAA 4ESKA 2OMBA 3AROA 1FVEA 4HKBA 5CINL 1OB1B 2BSRA 2I24N 5FYKH 3LMJH 3FB6A 3T2QA 4M7LL 3UTSD 4R90L 3OGCA 2ZG3A 1T4KA 5I1GL 2NX5B 3EO1A 4KROB 4BZ1H 2EH8H 4HXBL 1S7VB 4AG4H 3U4EA 5FUCE 1UM4H 2IBBA 3BPCA 3T3PF 1B3JA 4Y4KD 1MRFH 4L1HA 3ZLQC 4NKOA 3IDIB 2Z8RA 3KYKL 3WFHA 5GJSH 5HGDB 1VFUA 2PW1A 4RAUB 5GGUA 4APQD 1I7UB 1F4AA 3MLWH 4OLUH 4HMEA 1G7IA 1QA9B 3OSKA 4P23C 3G6AA 4P3WA 3TZVB 4QXUL 4DK6A 3FCTB 3JV6A 2IPTH 2VDKH 3KXFA 3TA3B 3HE7B 1KIPB 4G9DB 2O5ZL 3D0LB 3OBAA 2NY7L 2ZUXA 4K3JL 3OKDB 1AGBB 3HZYA 2FR4B 1S7QB 2F53B 5GRVK 5C0DA 3DPBA 3HNVL 1BVKA 2HH0H 4KUZL 4NQDA 1VSCA 2P5ED 4CMMB 1SM3L 2YN3A 2X4RB 3O2DH 3VXRE 3BIKA 3IFNH 4OCYL 1EZVX 3KPOA 4XCCH 5T3XL 4D8PB 4KC3B 1XGRB 5FDWA 1S7RA 1NAML 5GS3A 2PXYA 4PJ5D 4PRHB 1U8QB 5I16A 5CMAA 1BIHA 4UB0H 2PTVA 4LSVL 4LU5L 1R3JA 2CKNA 3O41A 1JNHA 1RK1A 2ZPKH 2H2PC 1J1XL 1TZHA 4DOHE 1OY3B 3O2WH 1T20A 3Q6GH 2DWDB 5KSAA 3ARFD 1CE6B 1GGBL 1Q1JL 4BH7B 4X7SL 3BP6A 1RZJC 3O4OB 3P9LB 4FP8H 2OK0H 1LO5B 2ZKHL 3DHMA 1UENA 4H5SA 5B22A 1ONQB 3RWFA 3ULVF 1I7TB 3NFPA 5I8KH 3VW3H 1IGMH 1AI1H 1L4IA 5HD8C 4PJCA 5SWSE 1FAKT 1NGPL 3TJHD 5CJOL 3O8XB 5MENA 4XH2B 3KYOA 1CD0A 5HGHB 4DGYL 3Q2CA 4P2CG 3ZMRA 5ELIA 5C09A 2VAJA 2RJMA 3GMQA 1AHWC 4FQJH 1T3FA 3IU4L 4WUUA 4M6NH 4XP6L 4KRLB 3F6LA 4JO3L 1ZA3B 1FZOB 4N9GB 2X4QB 1KPRA 3EO0B 1I7ZA 2OXGA 1E4KA 5GGVH 4M6OL 3IJHA 4KXZH 2XOTA 3RWGA 4GRLC 2NY6B 4HJ0C 3STZB 4X5WA 4OZIF 2VDLL 5C0AE 1PD6A 3G6JF 4WFEE 5DS8B 5A16B 5HYJB 2D9CA 3RNQA 3V7MA 4Q6IC 4CDGC 3CMGA 1BJ8A 1UACL 5BZWB 5EOCL 4MWFB 3B2VL 2MHAA 1QRNB 4P2OA 5F6HI 3LN5A 3KPQB 4JPVL 3RZCC 2BY3A 4DZ8A 5I8CB 5JORA 1R3LB 2HFEA 1SYSB 2KH2B 1IMHC 5GRWA 4NKQB 2FO1A 4LASH 4OM0H 3BWUC 4LPWA 3KPMB 4JFYA 2KKQA 1FJ1B 1QNZL 4NQCA 2CDGB 3KLAB 5EUOA 2YA2A 4Y1AD 3MBXH 5D9SA 4G6KH 2BC4A 4GRMA 4LFHD 4NRYB 2EDNA 1MCPL 1KT2B 1BIIB 3A67L 1WICA 1C5BL 5E2JA 3CGTA 4LEOB 2EIDA 2A0LD 3SGKC 2Q87A 3VXSB 3ZE1F 4YHPA 1RZJH 4L3AA 5LCVH 3QIBD 1VPOL 5DD5H 3HZKB 2Q3AA 2Q7NA 3GO1H 4XPBL 2NX5A 1I1CA 1OT1A 3KPSD 3RX8A 4K7PY 5EA0L 3HB3D 4X0KB 4A2LA 5BOPA 3M45A 2AK1H 5D7IF 3H9SB 3WJJA 4DJMA 5GZOC 1D7FA 4S1DD 4Y89A 3OG4B 4NHCH 1DVFA 2UYLB 2B1HH 1UKSA 4CADA 1NGWB 4M7KL 1DL7L 3QFJB 3CFEB 1I7UA 5IB3B 4JFQB 1ZLUH 1AKJB 4APQA 4UQ3A 3NIDE 3TZVA 3FCTA 3WFBL 5EZJA 4IS6B 5KJRL 3TA3A 3HE7A 3D85B 3MLYH 4EUPA 3TP4A 4LRNH 2ZSVA 3OKDA 4Y19E 2R1WB 1CGVA 3LPGA 3H9HB 3BUYB 1G7JB 1G9MH 3C6LC 4JRXE 5DZNA 5D93B 4NO2A 3IVKA 3MJ9H 2I5YH 1FYHB 2CXKA 2EEAA 4TSAH 4AL8H 1ZHKA 2ZZUT 5GJTH 1GGCH 1YEJL 4YDVA 3IDUA 15C8H 3EZ8A 4JCMA 3IF1B 4NC1E 5GS0H 2VH5H 1FNLA 3D6GA 3GSRB 5EPMB 2YEZB 5ABDE 5E9DB 4WNQB 1K9TA 1UXWA 3JV4B 3PV6A 3PWJB 1DEDA 2BVPB 4ZFZB 3MACL 4KFZC 5JPMB 1HKLH 4PJBF 4Y4HC 5D1XD 1CE6A 4Z18A 4PR5B 4XRCA 2WWMC 1OSPL 2DQUL 1AH1A 4TULL 3ARFA 5IB2B 1JWSA 3B6SA 3FAXA 2H2PD 3MA7A 3KNBA 1IFHL 1I7TA 4BYHA 3ALXA 2AP2A 3LN4A 4MJ5B 5D70L 2X89A 1CYGA 1K4CB 1CICB 1BEYL 1KV3A 1MFNA 3CXDL 5D6CA 4HGKC 4Z7NE 4ZYKA 3G08B 4HGWA 3L7EA 4U1IA 4LGRB 3RVTC 4I3SH 4OGAC 2DQJH 5B38G 4AJ0A 1U2CA 2O5XL 4DVBA 1FG2B 4I2XE 3RWJA 1S8DB 3K4DA 3QIWC 4DGIL 1FZOA 4M8QB 4W4OC 4KK6C 4WHYH 5E7FA 4MJIE 4PY7B 1PJ9A 1RUPH 4E42B 4GG6E 1FNFA 3FOLB 2XKNB 3IDNB 4L4VB 3GHBL 1DQDH 2NZIA 1QEWA 4PB0L 4WFFD 2F54E 1EEQA 4L3EB 3TBYB 4KY1L 2ENSA 5DS8A 5HYJA 2YPLD 3VD3A 1N0XL 1DQLH 1TPXB 1EERB 4GRLD 1UXSB 3RL2A 2D31A 4KJWD 1QRNA 4RDQG 4WU7A 3QNZB 1JMZA 3KPQA 1EEZB 3V52H 1XH3A 1R3LA 2E5EA 3HR5B 4XBGB 3BX7C 5AYUL 3EOAA 3UPRB 4EVNB 3KPMA 4N0UE 5C9JA 4P3CL 2CDGA 3OKKB 3KLAA 2UVFA 4HPYL 3T1FB 1LVEA 4HMCA 4KHTL 5FUOH 1UB6B 3DSFL 4GO6B 5L2KE 2VLKA 4G6JH 3MRNA 1M05B 1DSFL 1KT2A 3ZYZA 1P7HL 3GUTA 1KJ3L 4JDZB 3I50H 2FEDD 3VXSA 1F3JB 2FBJH 5L9DL 3RU8H 2UZXB 3QIBA 3UTOA 4KAQL 5SWQB 3MGAA 1NGYB 3CFCH 4X0KA 1J88A 2DQFB 3KPSA 1FNGA 4Y1AE 5F7HA 1GIGL 5ENWA 1K2DA 5E8EA 1R0AL 1UB5B 1XGTB 4YHMH 4M7LH 4G43A 5E6IB 1P4BL 4NPYB 3S97C 2CJUH 1DBKL 1NGWA 5DRXB 5CEYA 1MJ8H 4CKVX 4HDIB 2Y36L 1BF2A 2NW2B 2DMKA 1ORQB 1JZ4A 3BAEH 1G9EA 1I75A 4DZBB 3QXWA 1G1CA 2HT2C 4FFYH 4EOWL 1JPTL 2VR4A 5I74B 5MEQB 1AP2A 3SDDD 5HHVH 1H3PL 2YXMA 4IRSC 1CXIA 1F6FB 5HHMB 5CSZB 3TGXA 1BOYA 4JG1L 3MODL 3EKCA 4E41A 3H9HA 5IQ7L 4QXUH 1FGVH 5KANG 5J6GB 3FTGA 3N1PC 4O02H 1MUJB 4F7MA 4QF1B 3CDCA 4PP2A 3ARTA 1ZANL 2H8PB 2O5ZH 1MI5A 1UCBH 2YZ1A 3VFOB 2DM3A 4OCRL 4ZDHB 1TZGH 3ARBA 3MRBA 2NXYB 4XC1L 4OCNC 4BSVB 5EPMA 1OHQA 2UWEB 3HNVH 5E9DA 4EDXB 4OD3H 2NY4C 4PJAA 4JFEE 2Y06H 2M8XA 1CTNA 1JWMB 1TQCB 3KHQA 1FZKA 4ZFZA 3S6CA 2VISB 3BPLB 3IRZA 4HIIA 3PHOA 4MNHB 2Y7QB 4PR5A 3QEQD 1T03H 4GSDL 4WW1B 3QI9B 2XZCL 2OJZL 1F45A 5SWZD 1U2HA 1MCLA 4Y2DD 4WHYG 4AEHL 1J1XH 1J1OL 2Q86B 2IALA 4Y4HD 1KYOK 4POYA 5AZEL 2C7UB 4MJ5A 5AAMA 2VITA 1I8IB 1NCCL 3U6RA 5JW4Q 3VRIB 1ZGLB 4BQ8A 3PWNB 1I9EA 3GM0A 5I1JH 1CVRA 1XIWA 2H26A 3DX6B 1MCFA 4RIRA 2PYFB 1TETL 3VFGH 5ISZB 5B8CC 3R06B 2GJ6B 3REWB 5L8KB 3T0EE 4PJHA 1F00I 2IAND 1YPZF 1EHXA 3HI6L 3W2DH 1H3XA 3SHSA 2AEWA 4FMKA 1P1ZB 1AXTL 4BUGA 5IFJA 2F8XC 5CJOH 1PX4A 1U8OA 2DLFL 1CCZA 5CJXA 4JLRB 4UZGA 4PY7A 4PRPB 1A1OB 4XNUL 3TH4T 1RJCA 1OAKH 2D2OA 1X4YA 1IC1A 2HJLB 1MAML 4OF7A 3VGDA 2A9NH 5AWNL 2NYYD 3FRPG 2OL3B 3KPLA 4KK6D 3ZKND 2FX9H 1C12A 2R0KH 1W0WB 5KW9L 4UT7L 1E27B 5EIIB 3UZQA 3ZHKA 3WO4B 4TUJA 1F8TL 2RAMA 1DZBA 3QO1B 3T3MF 4M43H 1T89C 2HLAB 2XZAH 2ENYA 2HRLA 1VADB 2VDLH 3QPQC 3W82A 4NUJA 1TIUA 3RGVB 3HR5A 1P7QA 1NC2B 4ZS7H 1EH9A 2B0SL 3MNWB 3UPRA 2P8MA 4LVHC 1HCFX 1NANH 2WLYA 1BFTA 4UI2A 5EOCH 1F02I 5JPNA 4P3DA 2AJVH 4TSBL 3ZHLA 3WLWD 1M05A 1Y6KR 1PLGH 4FRWA 4LMQE 5C70A 4DVRL 5F72S 1OCWL 4R26L 5T3XD 4JDZA 1B4JL 3VJ6B 1NSNH 1KCSL 2YPKB 4GKSB 3PDOB 2FYYA 3MRCB 4OUOA 4N0YH 1X44A 4QHMA 5D2LA 3OTTA 2DQFA 1GPOL 2BY1A 3A67H 3U7WH 2YBRB 1C5BH 2VLRA 4WWKB 1CTOA 1T1YA 3VRJA 1I9RL 3MRLB 4YGAB 3FB7B 2Q6WB 3MV8D 4NPYA 1DR9A 5DRXA 1I8MA 4XPBH 2VDQL 3DECA 4NQVB 3FL7A 5IHZB 4L8CA 2VLJE 4CJ0A 5EA0H 5LXGH 4K23L 5K9KA 1N6QL 3UDWC 5D6DC 1G7MB 2XFXA 3FO9B 2WV3A 5FM5M 3F7QA 5JXEC 3HUJB 4DZBA 3TN0D 3PABB 5DJXA 4OF6A 1F90L 3GFUA 3MNVB 2VLMD 5JOFA 4JY5L 2IF7A 1WCQA 4P99A 3SDDA 5EULV 4NWUL 3REVB 4BZYA 2YR3A 3LVEA 3T65A 4Z5RB 4YPGB 4FFZL 5D7SH 4HKJA 5F3BB 5IV2B 3WLBA 3ULSB 5J6GA 2R1XB 3HZMB 1RJZA 1MUJA 5IK3A 4AT6A 1WT5A 4IRSD 3OAYK 1S9WA 4QXGL 4YK4B 5DJYA 1T1ZA 2OBGA 2QL1A 1CXKA 4HAFA 1NBZB 2FDBP 3TNNA 1R3KA 4BSVA 1EJOL 2V5TA 3LH2L 1W72A 3UAJC 4L29B 4RFEB 1L7TH 1QRKA 3HPLA 1ZT7B 3DUUB 3HI1B 4XNYL 5DLML 5C08E 1CFNA 3HHRB 2R2HB 1HOCB 1FH5L 1YEJH 2GFBB 4PB9L 1X4XA 5EUKB 5EU3B 4MNHA 2V2XA 5FA4B 4RA0C 5FGBC 4P9HL 2E9IA 1OAUL 4XB7A 5HGAB 2XN9A 4XAWL 1JHTA 3E6FA 4YHKL 3QEQA 4M5ZH 3MREB 4KKLC 3RKDC 3TO4A 4GBXC 2GAZA 4WI6A 4Y5YC 4G8GA 3EYOA 3FQNA 3WIHA 3MACH 1DUYA 3L7FB 4LLDA 5DJAB 2VZSA 2IH3B 4KKBC 4P5TB 5I30L 2PETA 4OQTH 1ZGLA 3PWNA 5T5NF 4XHJD 3AAZA 5B39G 3S5LG 2QQQA 4LCUA 5IBLD 1IFHH 4ACPA 4NZRH 2ITDB 3MO1B 4K7PL 5INDB 1S9XB 5HHQA 4AMKH 5C0BE 2BDNH 3TLRA 1RULH 1UH4A 1BD2B 2IANA 4JR9H 5BJTA 1V7NH 1P1ZA 2VAAB 4N5UA 1F2QA 1HEZB 2P24B 2WUCL 5BRZD 4KZEL 4D9LH 1YDPA 1MJUL 4JLRA 1IBGL 4YE4H 4PJ7B 1IT9L 1LO0H 5TGBA 3LCYA 2PXYC 3NA9L 3NVQA 1CR9H 3GJEB 2HJLA 5AG9A 5DMYA 2GTZB 3EYSL 4L3CA 1FRGH 1F4XL 1G6RA 4ODWA 4ZSOB 2OL3A 4UNVA 3G9AB 3GKWH 1W0WA 3PNWB 3SGEI 5EIIA 1E27A 3BEVB 1AGCB 1KTLA 1Q9OA 1OTSC 3RP1A 3QO1A 1UZ8B 2WUBL 3CU1A 3O3EB 5K9OA 4FQQB 2ZUUA 1ITCA 2HG5A 7CGTA 1ZLWK 1OM3H 3L9RA 3DX8B 5C0IB 2DOCA 3RGVA 35C8L 4GG8A 4KMTL 1VACB 3T4YB 1DP0A 3MNWA 3O6LL 5H94B 4MCYA 3I9GL 2NXZD 4YDKL 5F9JA 1HIML 3TV3H 2IPUK 1IGCH 4HWEH 5IJVA 3QPQD 1ZE3C 4UT6L 4HUWA 4J3WA 3NH7L 4UQ2A 3D2UB 5JZ7D 5KG9B 3EHBD 4OZHE 5J1AB 5H37H 4KMQA 2HRPL 3I2CL 1OP3K 3O9WB 3VJ6A 4G3YL 4P3CH 4AY0A 4HPYH 1IKNA 1FCCA 5CD3A 3GI9H 3VA6A 3HE6A 4PUBH 1S7WB 5F7NC 4F57L 3MRCA 4OKVB 4QRPA 5IP4A 2V5RA 2AJZA 3EBAA 2AJYL 1IC7H 5FKPB 5MHSD 5DJ8A 3D39B 4WWKA 2R2BB 4OD2B 2Z35A 4W6WB 1T6VN 5JOPE 3IJYB 1D5IH 5DJ6B 3CD4A 3MA9H 1P4LA 3QUXD 5AYQA 5DQJA 1QFWL 3K2UH 3MCKA 1HWHB 3U7YL 3OKEA 4P2OC 3STLB 1R0AH 3NGBB 5JMRA 4Z7WA 1RZ7L 5IMMA 1DBKH 1EO8L 5HDBE 4MDJA 5ALCL 1D6EA 4C55A 4XCNB 1GOFA 3G5XB 2W91A 5CJBA 4MAYB 5ILTL 2Y36H 1TNMA 4FTVD 5EUOF 1CIDA 1IL1A 1MNUH 5IV2A 3V6ZB 3IKKA 5BO1L 2CSPA 4P2QB 2GTWB 4PJDE 4OV5A 4NT6A 2R1XA 3CNKA 3WUWG 5J11C 4FXLA 3TBWB 3WL9B 5IT2H 5HHNA 4S1QH 3JTTB 3OX8A 4LDOB 3EYVB 1ETZB 4DTGL 3VGAB 3QZWB 4C56D 1ZEAH 4GQ9H 3L3IA 4RFEA 3U82B 3NIDF 1L7IL 2XG4A 2XWJA 4BFGA 3KG5A 2XIDA 4KROC 4LPVA 1P4IH 4OF0A 2R2HA 1HOCA 1OAXL 5EU3A 4XC1H 3WJJC 3TCLB 4AENA 4AM0B 3UAJD 3UO1L 4F80A 1JWUB 3L3HB 2D7TL 1INEL 4X4XA 1OGAE 5HGAA 4ZO9A 4HK3N 5DQ9B 1DVFC 3JWNC 4ORGB 4RMUA 4LLAA 4H26B 2F5AH 1JPFA 2Z0BA 3O3BA 4JG0H 5D8JH 1CFVL 2D03H 1BX2A 5IVXB 2VL5B 1EUUA 2IH3A 2N56A 3RIFF 4P5TA 2X40A 3TZVC 1B9ZA 1DBAH 1IGIH 3RUGB 3GGWB 4GLRI 4JO2H 4U05A 4S1SL 3TA3C 1OQXA 3HE7C 1V3JA 1TCRA 2PCPB 5ACZA 3SDCD 2G60L 3LS5L 5DEZA 2P45B 1J1OH 3L5WB 1S9XA 4KKAD 4O5LL 2Z8SA 5CAYB 3HG1E 4OZFH 5I0DA 4UIKL 3BKCH 4HUUA 1BD2A 5DFVD 4X6FA 4P2RD 4PJEA 1HEZA 4JZNB 3WIFB 4NNPH 1GVIA 1QLRA 4Y5VB 3HC4L 4CJ1A 5TE4H 1TETH 1PFCA 5F6IB 4U6HA 2E6QA 3QP3A 4LCWE 4ZMAT 4UV7H 3W11C 4MD0B 5H2BA 4HS3A 1AGDA 3C09B 2X7LA 4UTBH 1QYGL 1EGJL 5I1LB 5C6TL 2QEJA 1E4XL 2BNRD 2I27N 4ONFH 43C9B 2DLFH 2C9AA 2ZCLL 1PBYA 4ZQKA 3F7RA 4ZFFA 3ZL4H 5FCUH 3U0WH 3MBEB 3QG7L 3LDBC 4ZTPL 1AGCA 4Z7NF 5H37G 5J1TC 4XNUH 3DWTA 5SX5H 1YYMH 3QUKB 2YK1H 3VMOA 3PWUA 3OXRB 1OQOA 1U3YA 1NGXB 2FD6L 4FQQA 4QYOB 3UTPE 3J8F7 3KPRD 3VFSA 5HSFA 5AWNH 3O4OC 2WBJD 3WKNA 4YHZH 3SJVA 5C0IA 1Q72L 3PP3H 4ELMB 2P5WE 1BWMA 1Q9WB 4NP4H 5CJ5A 4X7CC 1F8TH 4FOMA 4LLUB 1MJ7H 2MPAL 3FO1B 6CGTA 3O8XC 1DLHA 1J0KA 2OR7A 3QUYD 3ELAT 4W70A 4ZAKB 5FM8A 1WQVT 4ODVH 3B43A 5DUBB 3DO7A 3M1BA 2JCCB 3CCHA 4P9HC 4JM2D 4LNVA 5TQ0L 3ARDD 4R7NA 1NKRA 3K8LA 4DUXA 3MV7B 5EORH 2JELL 5GRVL 4EDWL 1IGFH 4EI6A 1OCWH 4R26H 1RIVH 4Y4FB 1UVQB 3FO0L 1B4JH 4PP1C 5JQ6H 2NY6C 5IW3A 5GHWH 4EUPH 5F9DC 3IJSB 3BD4A 1ULVA 1D5ZB 4ZO8A 3L3DA 2P7TA 1PX3A 1U8MB 5KAQG 3U9PH 2BVOB 3P30H 4LLVB 3EDEA 1NEZA 1RZGB 4BK5A 2YD2A 3STLA 4YJZL 1JK8A 2ITCB 4C4KO 1FC1A 2AAVA 3GJFK 3BPOB 4WHTB 2GCYA 3A6OA 4XCNA 1KN2L 5GRYA 2DBJA 3QIUA 1E28B 4K23H 4PJ8B 2R1YA 1E0OB 4YXKL 5EC1A 1MY5A 3P2TA 4H1LB 3CFJA 4KH2A 3VCLA 3QXDB 4LLWA 2W0KA 4NWTH 3TBWA 2KZ1B 3VH8B 3QJHA 5HHOB 4JREB 4OUUA 3ETBF 2WIMA 5TQ2L 1ETZA 4NWUH 2XT1B 4YBHA 1DJSA 5CBAA 3NCBB 4FFZH 4J4PC 1J8HB 1CL7I 1K85A 2OQJB 2BNQE 2E7HA 5JOEA 2APTA 3NPSB 3PXJA 1J0JA 3AXLB 3DIFB 3BRFA 3P9MB 2ADFL 3WNKA 1LO4L 3VXPB 3GMRB 1QTYT 3JXAA 4XP5L 1A22B 5EBWA 4ZOAA 2EDKA 5C0GA 3TBTB 1OGTA 5A2FA 5C0RH 3QFDA 5T1KB 2DKSA 4OB5L 1U58B 5IHLB 4C54A 3MRJA 5F71A 4JPKL 4HD9A 4LSTH 2VO5A 4RISL 1F6AB 2I9TB 3GGWA 1JL8A 5E2TH 5ALBL 3S4SB 1I3RB 3I6KA 4OCWL 2PCPA 2BFVH 1RZFH 3RVWC 5I71C 3TPUB 3GEWB 3H6JA 2GSIB 3NIGE 1UGNA 3NTCH 3LRHA 5D93C 3X12A 5AUMB 4NJAL 1TVBB 1EMTH 4JZNA 4Q58C 3GHEH 2OI9B 4FQCH 1QBLL 5F88A 1DCLA 1JF1B 4K7PH 2IMNA 2GY7B 4K7FA 2Y5TB 2W9DH 3MLUH 4W6YB 2Y07H 2F53D 4I48A 4NO0D 5L7XL 3P0YL 2Q20A 5BVJB 4R4NC 2XA3A 4BSWA 3NCMA 2BSSB 2XA8L 43C9A 4OKDA 3RWHA 2VXSL 1QSFD 1IAOB 4M1DL 4OIIL 4XNQB 4XP1L 1MFAL 4XZUA 1A4JA 3C2AL 4F7PB 4CVXB 2UZIH 1NGXA 4QYOA 5DWUH 1NCAL 4YFLF 5CFHA 2MQCA 2Z93B 3SO3C 3DV4B 5ID0B 1HSAB 4KPHL 4ELMA 4FABL 1KCUL 2Q76B 1XGYL 4WI3A 1Q9WA 4U6YB 4NQDE 3VE0B 5AD0A 4LLUA 4KZDL 3SQOL 5JXAH 1CICC 5CCKH 4ZFOA 2JJVA 4GT7A 3FFCB 4EUPG 4X7TA 3UTZB 1NCWL 2AK4D 4JFFB 4PJHF 4ZPTB 5IQ9A 1A7RH 3F58H 1FYTB 5DEGA 3BT2L 3KPPB 5CHNB 1J18A 3LPFA 4LDLB 3I9GH 4R4BB 2JCCA 1A4KA 4TPRL 1NDMA 3O8XD 4WW2B 2V5MA 1F11A 4PS4H 2UVEA 5JNYA 5CJXC 4V2CB 1IKFL 2MJWA 1EAPB 1LO3L 3ARDA 3V6OA 1H5BB 4JFXB 5FYLL 4K94L 3IGAA 1A0QH 1UKQA 3QH3B 4PD4J 1KBGH 5DMIL 1D5ZA 2R4SL 4QO1A 4EQ3A 4PJIB 4PJCE 4YAQB 3N06B 2RR3A 1TPXC 1F42A 1VGEH 2BVOA 3DXAB 2NY6D 5I73B 2Q8BH 3MFFB 1JE6A 1YEGL 3BGMA 4ZUWB 2B2XH 3U83A 1JTTA 4NJ9H 5MP6L 1J11A 1ZKAA 1NAKL 4ODXB 3PP4L 4EBQH 1JZ7A 4OFDA 1QFWH 2VQUA 5FCSH 3VXUB 3E8UH 1MVUB 3OQ3B 3BQUB 3QXDA 4ZNCD 1FC2D 1KIQA 3VH8A 3QG6B 1MRCL 2VC2H 2V2TA 1G1YA 3H0TB 5CKGA 2Z8WC 4N8VB 3MR9B 1SVCP 2QHLA 4YR6A 3ZKXC 4K2UL 1PEWA 1QQDB 1WWWX 3WFCL 4JQIL 1BVZA 4YGVB 2D9QB 5D2LF 4EQ2A 2F74B 3BP5B 3TESA 3ARSA 3DIFA 5EZIH 1F58L 1RIHL 5GGRB 1TJIL 4J4PD 3CSYB 3CUPB 3VXPA 4GRWH 4XTRD 3E0GA 5E6IC 1MPAH 3TBTA 3C5SB 2C4FU 3FB8B 4JY4B 2YOCA 4UT9L 5GGTL 4NQCE 5T1KA 3KS0H 3BGFB 3VFRB 1ACYH 3H9SD 1GXEA 3UO1H 1QVOB 2D7TH 5I74C 3I6GA 3HNSL 1YMMA 1G0XA 4LAQL 1F2XK 3SOBL 1HHKA 5KBNC 4K3HA 4L8DB 2FEEI 2OJEB 1CFVH 1TXKA 3MUGB 4NN5B 4OZGF 4EZMA 5BMFL 2AS5M 1NCBH 3RX7A 4RAVB 4WY7H 3BW9A 2NX5E 5AUMA 4A6YA 3D85D 5CGYD 4S1SH 1WT5C 3INUL 5KTEH 1SEQL 5KSBB 1GJIA 3EGSA 4X98A 3UJIL 4NQUA 5GZND 3ORJA 4WI7A 2NXYC 5TDNA 1V05A 3UYRH 2BRRL 4UTAH 5C0FB 5HYQA 1BJMA 3X3GL 4NO0A 4CL7A 4P59L 4YHIA 1KJVB 2ATKB 1TQCC 1IAOA 3CX2A 1SMOA 3QULB 1QSFA 5CZXC 3BPLC 4ZTOL 1BMGA 3GMMA 3KGRA 1OPGL 4R4ND 2ED8A 5C6TH 5HHPA 1WITA 2ICEB 4HC1L 3BKJL 4DW2L 2DB8A 1VFBA 1Z2KA 4NHUA 3LEVL 1HSAA 4JPIB 1I4FB 4XMKH 3ZSSA 2ZCHH 2GJJA 3TJEL 3AUVA 2XV6B 4ZTPH 3O4LD 2W0FB 3X3FH 2NY3B 3OKMA 3UP1A 1SMAA 1S9VA 1WBXB 4FQ1L 5D1QA 2R2CA 2W65B 4O2EB 4R0LB 5DT1H 3QDGB 4JQVC 2NY2B 2XTJB 3P77A 1Q72H 4PRHE 1I8KB 4ZPTA 1T6WA 2AK4A 3KPPA 4POUB 5IMLA 1HHHA 2D0FA 3B2UD 1O0VA 1ADQA 1FGNH 2B39A 1BQHA 1SBSH 4PJ9D 4X4YA 2GJZA 5JHDD 2CUIA 1MFCL 4WW2A 1NLBL 4M61B 1Z6JT 1FZJB 3GSVA 4KQ3H 3GIZH 5KVEL 1H5BA 2OR9L 4JFXA 2P8PB 4KRMB 3EIFA 3IFOA 5DSCA 1UWXK 3QH3A 2J4WL 4NQEB 2YC1A 5TQ0H 2IH1A 4GQPH 4YAQA 1YNLH 5K93A 3NAAL 3WO4C 3ILPB 5B3JF 4UBDC 5K9JL 3DXAA 4PRAB 4L4VD 1AGEB 3ARQA 1VCAA 4OZHF 2HVKA 3EDKA 4OCLC 1U95B 1BZQK 1S7SB 4U7KA 4PREB 2RHEA 4PRIA 5AZ2L 4LDEB 4ONGH 3RGVC 4J3VA 2BSTB 4MD5B 2QADD 3IFLH 4X4ZA 4YFEA 3VXUA 3CFDB 4HKXB 1VESA 1W72H 5E99L 4DKEH 1T2QH 4F7EB 3DYPA 3DROA 3HC0B 2NCMA 3SDXB 3F7VA 4N8VA 3E6HB 1T5XB 3MR9A 1K8DB 5CLWA 1D5MB 1HH9A 3BE1L 3LN9A 4QHUB 5HYJE 4I0PA 5HHXH 3HLAB 5EOCJ 4JB9H 4WTXA 3PDGA 3QJFB 4RAHA 4Y88A 4YGVA 1J87A 1JF5A 1RV6X 3H42L 3VXNA 2EDTA 4MAUL 4PRNB 3WIHH 2I60H 5ICYB 1QRNE 5GGRA 5HDBF 4HFWB 2GIYA 2PYEB 4WWKC 4YBLB 4NRXA 3MGTB 4GMSL 1JRHH 3UEZA 3C5SA 1AJ7H 1BFVH 3ZE0F 4NYLA 4JO1L 4L5FL 1FLTX 2DLHA 2Z91B 1JPSH 2ADJB 3CVHA 1T2XA 4KI1A 4ODSL 2VDOL 3VWJB 3SE3C 1LO2L 5TE6L 4XP5H 2QQKL 5J13C 1UJTA 8FABB 4N90E 4RGNB 4L8DA 4HIXL 3VXSE 3MUGA 4H8WC 3F12B 3MXVL 4GW1A 2EEDA 3L95B 4K94C 5DJZB 5IJKA 1H8OA 2YA1A 1G6RH 2OL3H 3EOTH 1MCHA 5ALBH 25C8L 4YK4C 4ISVB 1B0WA 1UQSA 3OKYA 3S88L 3BO8B 1KXQE 1MHPH 1V7ML 4RA3A 1M71B 2R0ZH 5ITBL 4U1LB 2YD3A 1KCVH 3PIQA 3QFJE 4Q74A 2DM4A 1CZ8L 5SV4A 4NJAH 2GW5A 3IDXH 5E5RB 1QR1A 3UTTB 1X6NA 5ESQA 3ROOA 3WXVH 3QULA 2NXYD 5GIRB 3TVMB 2AJSH 1LEKB 5TPWL 2X9XA 2ICEA 5D72L 1XCTA 1JF6A 4P46D 1BQSA 1CGTA 2H32A 3O3UN 4E41E 4EN3B 1VFMA 3GSNB 4MA8L 2APBA 3W0WB 1LP9B 1NGQL 2EXYD 4LLQB 1U8NB 4P5TC 3O4LA 5DYOB 1WBXA 5INCB 3IFPB 1MI5E 1OTTC 3QI9D 1YY8A 5JO5B 1KTDB 4KPHH 1AR2A 1HCVA 3OKNA 4Q9RL 5E9DE 5KANI 3PDDA 2HWZH 4KZDH 2AV1A 3X14B 3ALWA 3N9GL 2EDLA 4MCZB 1EAJA 1GZPB 5ISZD 3QPXH 5JHDA 1MLCB 1AQKH 4OCSL 2X09A 4MQXC 2P8PA 32C2A 3RL1A 5T1DL 5FM4A 5L8JB 3OKOA 2NY0B 1HHIB 4MZ2A 4HPOL 5I15L 4O4YL 3M8OL 2DWEB 1T83A 4X7EC 5KSVA 4BH8B 4EXKA 2EXWD 4H8WH 4PRPD 1LO3H 1T0NA 4K94H 3ILPA 4O9HH 5T1MA 3GJFA 3T2NH 4J8RA 5DGRA 5C07B 2WLZA 4EJ1C 3S3JA 1S7SA 3LRSA 5DMIH 2R4SH 3JWOL 5I8EB 1BLNB 1J10A 1N5AB 4Y5XB 2ZUYA 3LKRB 4XNXL 4UBDD 4HKXA 3LHPH 5F7UA 4DAGL 1TQBB 1MHCA 1A6AA 2NTFB 4LLMA 5E5MA 3V5KB 1EZVY 2FX8L 4IEFB 5GPRA 1NC2D 5GGSB 1AO7A 4ZNEE 4XPFH 5DJ2B 4TTGA 1E6OH 4L3EE 2C1PA 4JY6B 5JA8B 3O9WC 4XWOC 4Y16B 4QHUA 1JUFB 1NMAL 2AJUL 5MERA 5C6WH 1U8PA 1UADC 4FQXA 4Z7UB 4Z0BL 1GGYA 2X4NA 3U48A 4PRNA 4NZUL 2YMXL 1JPST 3C8KA 3KVQA 1N59B 5MEOA 2VQ1A 3PQYB 4FQLH 1AXSA 3MGTA 2XNAB 3OKLB 4K07A 1BZ7B 4PTTB 2WINB 2WM0A 3Q1SL 4LSQL 3T0AA 4RCAA 4NNYA 1CU4H 5CEZL 3V8CA 3VWJA 1FSKB 3DV6A 2CQVA 3CK0L 5DK0B 5H8DA 3NGBC 1PSKL 4Z8FH 3FRUB 3GBNH 4NQSB 5DHVA 3FQXB 3H9ZA 4PLKC 5GS1B 4X80H 4MAYC 1CE1H 4HJJL 3L95A 3HRZA 4QOKB 3QQ3B 5DVNA 5I1EH 3UTQA 3PF2A 2A6DB 3HNSH 4LSDA 1CVSC 4LAQH 3SOBH 3QEGL 1NFKA 2BOBA 3BO8A 2VLRE 5F3HA 1HXMA 1QHPA 3CLFL 3FONA 3VGAC 4ZUVA 3GK8H 3LEYH 5FYLD 4PJXF 4NIKB 2BK8A 4Z0XB 4LKXB 3RNKA 4HIJA 4PIRF 4WJ5A 1I1AD 1EEYB 2JB6B 3ZKQD 4L9LA 1YNKL 3X11A 4F7TB 4G6AD 4D3CH 4DCQB 1XF4A 2CK0H 2X1OA 1SBBA 1MCBA 5HY9B 4PRDA 1UM5L 1CLZL 5GIRA 3O3AB 4GMTL 1A9EA 1FN4B 5D7KE 5F89B 5HHME 1KFAH 4WTZA 5IG7B 2MCPL 3QDMD 4GKZA 4M5YH 4P46A 4FHBD 5E08H 4WEUD 4CUCA 2RFXB 1YQVL