5CP7B

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
b'DVQLRESGPDLVTPSQSLSLTCTVTGYSITSGYSWHWNRQFPGNKLEWMGYIHYSGSTNYNPSLRGRISITRDTSKNQFFLQLNSVTTEDTATYYCARYGGYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
molecule tags Immune system
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
total genus 42
structure length 214
sequence length 214
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7B01
2IPKA 1JPSL 4KGLA 5C0JA 3EDEA 5F88B 3O2VH 1AFVH 3MJGX 1S8DA 2R29L 2XXMB 5CJOL 2C3VA 4ZQKA 1AO7D 2OTPA 3KXFD 4KWUA 3GO1L 1KEGH 3HUJA 1A64A 1J18A 1QBAA 5IROA 4NZTH 3MV7B 5DSCA 2PYEE 2BMKB 4YBQC 2P46B 1X5ZA 3ZHDA 3LKQB 5FB8B 3RVTD 2ESVB 1Q9LA 3GMLB 3GSUB 4NZDA 3VFWA 4P5KB 5C6PB 5I8EA 1PQZB 2DQGH 2NR6D 3PWPB 5AZ2H 3E8UH 3ARSA 2DQJL 4W81A 5EZOH 2WBJC 4YE4H 4NQDA 3TYFB 4TVPH 4TSCL 2YSSA 1BIIB 3V5DA 3LY6A 2EYSB 4WHCA 3FN0H 2DQEH 5IB3B 2R0KH 5F71A 4XBEH 1BFSA 3QCVL 1ZHKA 3CMGA 4Y4FC 1DE4B 1JVKA 3ARGC 1VACB 3MJ7A 3R1GL 5I1JH 1OVZA 2AJVL 1EGJL 3VXUB 5EZOL 4CDHA 1KPVB 4XNMB 4G43B 4Y4KD 1A7NL 1OAZL 2V7NA 4E5XA 4HUMB 5ID0B 4Y2DD 3BYTA 1NUNB 5MERB 5T1MB 1AQDB 1JUFA 4Z7WF 4ZNEE 5JW4M 4LSVL 5JW4N 3SKMA 4KI5E 1IGCH 2BNQD 4NQVA 4Y5YB 5GPRA 4HUWB 4JM4H 4Y4KB 3OKEB 5E5UB 1KBGH 2HT2C 2ADFH 3IDIA 3KPOA 4LEOB 4N0CC 4DFHA 1MJ7H 3ME0A 5C0BB 3OKMB 2E7LC 4NKIH 2DBLH 4YDVB 2R4SL 4YEFA 4XPTH 3R06A 4I13B 3ARFC 2HKFL 4N0YH 1KCRH 4AJ0A 2QV2A 3SGDI 1CFQB 1OL0A 2CO6B 4Z7UE 4ZPVB 1Q9KB 4TTGA 4Y4HB 3TJEL 1V7NH 1DLHB 3IDYB 3FQNB 4AEIH 3PP3H 1A7RL 3JWDH 5I73B 1YEDA 3SJVE 4KUCF 4NQDE 2X4TA 1T5XB 3LN4A 3SJVD 3V4VL 1EZVY 4XP5L 4RFNC 5J12B 2YPKA 4FABH 2K7QA 5HYQA 4L4VD 4KZEL 3SE9H 1B88A 3L7EB 3C6SA 4R4FH 2YPVH 4Y0GA 3QAZC 5F44A 3NCFB 3AY4A 4N9GB 3RWFA 5C6WH 3SCMA 1WWCA 5CAYB 4O51B 3QDJE 2YK1H 1SHMA 3EO9L 1CLZL 4KXZH 5EU5B 2SEBA 2ATPA 4JFQB 3OTTA 3T0AA 4YHPA 1N0XH 2YMXH 4X6CF 3GMNA 4KUZH 3IXTA 1KXQE 1SMAA 2XPGA 4YX2H 2V2TA 4S1SL 5CIPA 3AXLA 2Z35B 4F9PC 1LK2A 4DN4L 3V6ZA 2X9XA 1I3RB 1T4KB 3VXMB 3IAGC 1Z0MA 2CDGB 3LKQA 4MAUL 3D0VA 5FB8A 3IFPA 5HHME 2YWYA 1IL1B 2ICES 5CEZL 3WHE1 1H3PL 3QXWA 2CIKA 1X5AA 2NY2C 3IDGB 3MRDB 4LSRH 4ZUTA 1S9YA 3U30C 5DD6A 5GRUH 4OD2B 3VFTA 5D9SA 4TNVF 2NY7L 4Y5VA 2F8OA 3MLTA 4RMTA 1ZGLP 4RMSA 3HE7D 4NZRL 1O7VA 4OUUA 5INCA 3PL6C 5LG1A 4APQB 3DURA 1RJYB 5C09A 4YK4B 2C3VB 4N0UB 5IVNA 1FBIH 3CIQA 5D6CB 2GT9B 1RFDL 1RIUL 2L0DA 4E41D 4RZCA 4KI5C 2EECA 5SWZE 4XPGL 2N1KA 2DLIA 1LD9A 2I9LA 4LSVH 1BFOB 2XG4A 3FOLB 3QQNA 3V6FA 4WRLA 1AGEB 4LKXA 4FS0A 1VFUA 2JELH 5HDQL 1RURH 2EYTA 5GRWA 5ACZB 3RY4A 3LZFH 3UYRL 4JPVL 4F7EA 5JO5A 1KBGL 4JKWA 3RU8H 3VD9A 1W8NA 3AREC 3FO0L 5EA0L 5HHPB 5CD3B 1JWUB 4JDVA 1JIBA 1NFDB 3U0PB 3QCUH 4EVNB 1DQJA 4P3CH 1NDGB 2HJFA 5FDWB 1KN2H 4XH2B 3C8DA 5DMGC 2DQGL 1IAKA 3TO4D 1KXTB 4JZJC 4UV4H 4W68A 1D6EB 3Q6FB 2D9QB 3MR9A 1EXUB 4LQFH 1G9ML 1IAII 1WBYB 5C2UB 1YEKH 3PL6D 1A47A 4GAGL 3BJLA 1XF5B 4PY8I 1SEBB 3MRKA 2NXZB 5K9KB 2DTSA 4R9HA 1XCQB 1NMAH 4QYOB 1MCOL 4G8GE 5CINL 5EUKA 1JN6A 3QDGB 4H1LA 5HGDB 5J9PB 1I1AD 5KG9B 2DMCA 4KK8D 5CJXC 1ONQA 3GSXB 3UEZA 2GW5A 1BJ1H 3GM0A 1TDQA 1WSST 2R29H 2QHLA 3DSNA 1ZTXH 4KRPC 5GS1C 1WISA 3O41A 3ZYOA 1DEDA 5TDPB 3U46B 4H8WC 1QFWL 4WWID 3V5HA 4BH8B 4NBYB 3VFRB 4OIIL 3IDUA 4LPUA 1CLYH 1JF1A 3HI1A 2Q8AH 4LVNC 5IT2L 2EE2A 5GS0L 2ILLA 4OZIE 3R4DA 1JMZA 2OJZL 3L95B 1QTYT 1TZIB 4RRPG 1VDGA 3FB7B 3PUCA 4KUZL 3G5XB 3AS0A 3DVGB 4ZPTB 4QRRE 1W72L 5J89A 4H8WH 1TXKA 2BNRB 3FN9A 2AK1L 2LVCA 3T0VA 2EEBA 4YWGH 4BQ8A 3PDOA 3O0RH 3DVNB 2ERJC 1U8IB 1U8KA 2CLVB 1JMXA 3RVUC 1L9MA 2AK1H 4G8GB 1YY8A 3GRWH 4HS6B 3X3FH 4KI1A 5IHUL 4U6VH 3ZT6A 3CFIC 4MJIA 3L9RA 1XGTA 5D1ZB 3DRTB 5D70H 1F45A 5T3XE 1RJLA 4XCCL 3QUMH 1L9NA 3B5GA 4L8SA 2CR6A 1TPXC 5LQBL 2H1PH 3QI9B 4Q2ZA 3RX5A 4L3EA 4XBGA 4PJ8D 5DR5L 4JQVA 2FX8H 4ZODA 5KSAA 2FD6L 4LSUH 1TQCB 4UOW0 4NKDA 3L3JB 1HINH 2VWEC 3PWPE 5EU6E 3FFDA 1XT5A 4Y16C 4LGRB 5D1ZA 5FYLD 8FABB 1QO3A 1RK0A 1QLEL 1J1PH 2ATKB 3G08B 5DS8B 4AIZA 5F21B 4JO4H 4K2UL 4LLDA 2NXYD 5E0QA 1BVZA 4WI4A 3VGGA 5DJCA 1NUDA 4LCUA 5D1QB 4L3ED 3SQBA 3RHWF 5F1SA 4NKDB 4XAWH 2DLTA 5CBEA 3UJJL 2BY0A 1T83A 2X9YA 3IJYA 3ARXA 4OBRA 4A2LA 3OAZK 5FUOL 1NC2B 2EYRA 2JE8A 3H3PH 4M1GH 4MD5B 1MVUB 1T3FA 3OJDA 4GMTL 3P4MB 1BECA 3WFHA 5JW5A 3EYOB 4WHTA 4TTDD 4WY7L 3ARUA 2W0FB 2YD5A 1I7ZA 3T65B 4KKBC 5DJ8B 2VIRA 1XGTB 5ELIA 3CFEA 4ODXA 3RIAF 2EDEA 2BSSA 1C5CL 5KANI 2NXYB 1SM3L 4N1HB 4UILH 3TBSA 3Q3GB 1L6ZA 3LD8C 3W82A 2K7PA 2VITB 3EJYC 1BM3H 3GNML 1JPGB 1F6LL 4ONHA 4NO2B 1LEIA 4PJFA 1BAFL 4MQXD 4IRJC 3FFDB 3FB5B 1VKXB 4KPHH 4PJCE 2R0LL 2BNQE 5EU4A 4DTGH 5E8DH 5F3BA 2BVOB 5TQ2L 1UZ8B 3DX9A 4PJ5E 5IWLC 4PGEA 3UAJC 2X4RB 6FABH 4JN2B 2LU7A 4OLXH 4NM8L 3TT3L 5I18H 2BVQB 2WWKO 3FHQA 5T33L 3GKWH 1MWAA 4LMQE 4PLNC 4TSCH 4IEFB 3OKYA 1KNOB 5IEHA 1XIWD 4Q0XH 3GGWB 4KDVA 3QSKB 3JV4A 3R0NA 3MUJA 1TVBA 4Q9QL 4QXUH 3MA9L 4JY5H 5A3ID 3QXUA 5HHQB 5KZCD 5LCVH 1MI5A 1G7QB 2OYPA 3CSYB 4WUUD 4ZAKD 2VXUL 2BFVH 4NC2B 5C0AE 4XPBL 1F11A 1QFWH 3PGFL 3RNQA 4HV8A 5D2NA 2R4RH 3FFCA 3TF7C 4D0BA 2FJHA 3U2SB 1RJCA 4X99A 4BK5A 3K4ZA 3L7FA 3L5XH 4LLQA 3T04D 1IGTA 2GQHA 4PJDF 1CK0H 3SDAD 2E9WA 4DWHA 4NHUA 1Q94A 1JGEA 2CMRL 2R1WB 4JY6A 1LDPH 4UI2A 4WWKA 4XMPH 4Y16D 5J6HB 3DBXA 3B43A 1MLCB 4H26A 3VFPA 1YMHA 3RKPA 4HUVA 2VQ1A 3ARFD 1D5BB 3QULB 4RGNC 2OX5A 1QSFE 2P4AB 3HMXA 1R3JB 5M94B 2ARJB 3DLQR 3IDNB 1ZOXA 5HPMB 3AS3A 1XGRB 2VDNH 4NHCL 5KOMC 1J8HB 2E9BA 1IGFL 5FYJE 3MRQB 3EOAB 5GJTL 4WNQA 1LDSA 4PRDA 1IM9A 4FFVC 4HCRH 1MRCH 4DVBA 3TV3L 5B3NA 1GAFL 4LCWA 4UNUA 4GKSB 1WBZA 3ES6A 2H45A 2DD8L 5EWIH 1S9XA 4OF7A 4OUOA 4YFLI 1YPZA 4G80B 2AQ2A 3KWWA 2XYCA 2W60A 1A4KB 2CIIA 4JDZA 4NC1C 3UYPA 1MCPL 4JHWH 2EDTA 5FXCH 3PP4L 1Q9OA 1F3JA 4LU5L 4ZOEA 5CSBA 2PW2B 4YAQA 3RVVD 2DD8H 2GK0A 4LSPH 1KCVH 1EUTA 4P0DA 1K85A 2CIKB 3OB0H 4K8RD 2BP3A 3DJ9A 1EHLH 5DD6B 3CLFL 3NZHH 1N64L 1J8HD 3BEVA 2IALB 4U1KA 5CHNB 2KPNA 3BJ91 3TC9A 3DSFL 3LKOA 1DQDH 4HCRL 3FT2B 4G9FB 4I48B 1F58H 1KGCD 2GJ6B 4YPGA 2CLZA 4YXKH 4HWNA 4CJ1A 2IFFH 2MOVA 1GPOH 3O3UN 4P2RB 5AYUL 1YEHL 3ZT7A 2OR9L 4JG1L 3B5TA 2B4CL 1CT8B 1FAIL 4ORGB 2NY6B 3VD5A 1RZIA 4TSAH 4QXGH 3LEXB 3IGAB 4S0TD 5F8QC 1AP2B 4Y4FD 4U0RB 1Q0YL 1A22B 5BMFL 3JUZA 2E27H 3SDDC 1HNGA 3GJEB 1YN7B 4NQXB 3V95A 4B5EA 3NCBB 1AXSB 4I0PB 4L4VA 2IQ9H 5HY9B 5F96L 3S34L 1CIUA 4MX7B 3ZTNH 5IK3A 4M5ZL 5T1MA 5DYOB 2MMXA 3C5SA 2Y25A 4W6YB 4LSSH 5JHDB 3VXPB 4RCAA 5I8OL 5LWYH 4GRLD 4UUJB 1EO8L 3IKCB 4PB0L 4AMKH 2H2PD 2V6HA 4KJPC 4HD9A 3WDIA 1EJOL 1MJ8L 1P84J 2GY5A 2R4RL 1CFNA 3WMSA 1CD9B 2YPVL 2R1XA 4P5MA 1ZT4B 5CIPB 1NGQH 3MYJA 5GS0C 2D31A 1LK3L 2GJ6D 2LU4A 1EVTC 4PYHA 4X7FC 2F19L 4G6JL 1J1OH 1G7HB 4ZPVA 3KPMB 1X5YA 5GSRA 4OF5A 4MZ3A 1G9NC 4HIHB 4MSWA 5I9QB 4JPWH 4HJJH 5FK9B 1H9VA 5MERA 2NZIA 1NBYB 3HE6B 4QRRD 2WBJD 3S96B 5DI8B 5I66B 4Q6IB 4LQ1A 4IJ3C 3ZKSD 3TN0D 1KG0B 3RI5K 1UKTA 4L4TA 5E1AA 1LE5B 2YD8A 1NGPH 4NQED 3OZ9H 1B9ZA 1KGCE 4XXDA 4GRWF 4HEPG 2ED9A 2YXFA 4MNQA 1HSAB 1IJ9A 3HC3L 3LRSB 3T3PE 5T5NG 2GI7A 2GJZB 4GRLC 4YHZL 1FDLH 2Q87A 3SY0B 4J4PD 5HPOA 2EZ0C 4OGAC 5L7XH 1T1YB 1UEMA 5EA0H 4DKFH 1N7MH 5IB3A 5IMLB 4XI5C 4LEXL 3DXAB 2DLFH 4O02L 3SQOL 3NACL 2OL3A 2GK0B 4UILL 2ZCKH 1ZVYA 3BRGC 4M6OH 2Z8SA 2BDNL 2R69H 3S5LB 1BQHA 2JJVA 3H0TA 3IETA 32C2B 5EZIL 4JFXB 2O93L 3HNVL 3ROOB 1YPZF 5DSCB 5IMOA 1NKRA 3UZVB 4P9HH 3GBMH 3KHQA 4LPXA 2AABL 3SGEI 3ARDD 4PP1C 1R3IL 4HZAA 5DFWH 2VISA 4IOFD 5JR1H 3PWLA 5H2BB 1EX0A 2UUDH 5ILTL 4F9LC 1OCWL 2ORBL 1D5ZA 2A1WH 3HS0A 1UM5L 2QSVA 4KAQH 5LAXA 4WDIA 3UTPD 2BVTA 4U7KA 3HPLA 5GISH 4PG9B 2QSCH 3RDTB 5HHQA 3JWOC 4HPYL 3ARRA 5MEPA 5I2IA 1Z3GL 4J8RB 1LO5A 5DJYA 1UC6A 1XGRA 5CD5D 4U6TA 4NKIL 3I75A 4BJLA 4LSUL 2VWEE 2R56H 2J6EA 4GO6B 3I50L 5JORA 3ULUD 4M5ZH 1PVHA 5C7XH 1J10A 4BYHA 4KJYB 3KYKH 4BKLA 4WI5A 4Z7VB 5EU6D 2P1YA 4AYFA 3PWJA 3GSRA 2P5ED 5KSAD 4X98A 3S4SA 2VABB 2UWEF 4IS6A 2W07A 1S9XB 4LASL 1MQ8A 3ZKMD 3GSQB 5I1CL 4PGEB 1MVUA 4KC3B 2DIAA 3RZWA 4U1LA 5EZJB 3RNKA 3E6HA 1OAYH 1MWAB 4GG6A 1NPUA 2EDFA 2ICWB 4PRPA 4C56A 3NABL 4F33A 3FCTA 5DQ9A 1CZ8L 4KJQC 2XN9E 4L9LA 5EBGA 2ZPKH 5A16B 3JWDL 2MCPH 3G08A 4AIZB 4ZFOA 4NO5A 1JGVH 2OTWA 4UTBL 4MAYB 3WNNA 4WFGE 4H8WL 5EBLA 4HJJL 4NKOB 1FCGA 4LASH 4TTDC 3T0EC 3HG1A 3WXVL 2RFXB 4G6KH 3BP5B 5EIIB 1RVFL 3IFNH 3PE9A 2DYPA 4JANA 4PUBL 2R0WL 3NA9L 4XVUC 4F7TB 1RJLB 2Q1EA 3BWAB 2ZZUT 1U8OA 3OHXA 4PJEE 4MD5A 3T0XA 3NCJH 3P4NA 4PRNB 5DJAA 1QBBA 1UM4L 3BPCB 3UTPE 1NL0L 4YXHL 2HJLB 1C16B 1QFOA 2DN7A 3O2DH 3U7YL 1M71B 4IRJD 4EI5C 3ALWA 4O2EA 1A1OA 2C26A 4MXVE 4U33A 2X1WL 4OLEA 2IBZY 1GGTA 5GGSA 4OJFL 4IHOA 1ZEAL 3BIKA 5EIQA 4LHUB 5HYIA 2HWZH 1WIPA 2R0KL 3JBG7 2VXTH 3V5KA 2VITA 4S0SD 4MXVF 5A3IC 3H7LA 5TDOA 1PX3A 5BQ7A 1A1OB 3IFLL 3CC5B 3W9EB 2AQ1A 4CNIA 1A5FL 4PJGF 4Z7VE 3QJFB 5B38G 1Q72H 4P9HL 3KPSB 3VXRB 5FYKH 4HKXA 3K1DA 4OCSL 3MNWA 3LQAH 5CGMA 4ZS6C 4L8CA 4ZFGL 3QNYB 1GZPB 4KROC 3RWCA 3MMEA 1Y6KR 2BVQA 5DZLA 5TE7H 5DJZB 4IDJL 4NZTL 3RZCA 3BP5A 5EIIA 4FNLL 2DAVA 5DD0L 1BOGB 2P45B 4CAGA 1MY7A 5GGRB 5ITFA 3VI3F 1ZAGA 4YHMH 3BP6B 5I1DA 1BZ9A 4M1CC 1X6LA 1OAQH 1OOAA 4OQTH 1UVQA 4HHAA 3O4OB 4E0RA 4YGVB 3C87A 3BRDA 1UH4A 1A7OL 2DKUA 3MGOA 5T1LB 2HLFD 1FBIL 3G9AB 3GI8L 1EFXA 3OX8A 4FQHA 4HWEH 1FYTD 3AGVA 1A5FH 4O2EB 5DS8A 1CBVL 5J11B 1D5ZB 1T2XA 5GGSB 2R1YB 3L3IA 5DHVA 3BGFB 1CDYA 1E28B 1LILA 4W6XB 3SO5A 4XXCA 3MRPA 4NN7B 3VFSB 4D0CB 3IVKA 3E6HB 1KYOJ 1OGTB 4KQ4H 3TV3H 5HHOE 4LCCB 1R3KB 4G8IB 3QFJD 4PJEA 3DRTA 1N8ZA 2NY1D 1DUYB 5GRUL 4FQ2H 4XPFH 3T0BA 5F7EL 3BKML 1TZIA 4DEPC 4YBHA 4QRRA 5IESL 5EBLB 4D9QD 3CVIH 2VQTA 5FGBA 3HB3C 3IAQA 3MLWH 2JJTC 4ZXBD 1OM3H 5L9DL 3RDTC 4WCYH 5FF6B 3MXWL 3WNPA 5FKAB 3EUUA 5J13B 4TUJB 4S1SH 3U9PL 1S7XA 3D3VB 3WUWA 2EEDA 4M93B 2Y9RT 1Q38A 1CTOA 4WCYL 3TPUA 4PG9A 1EEYB 1KULA 4XNUH 5HVFB 3UYOD 3PWUA 3UDWC 1RHHB 4X9BA 5HYSG 2VDRL 4QKXB 1KCLA 5F7EH 5CEYA 4PLJD 3OKNB 3L6FB 4GXUN 4Z18A 1HIMH 3GI9H 3U9PH 5A2LH 1GGUA 1Q0YH 2BFVL 2J88L 3CFJA 3HC0B 4ENED 1K5NA 1WVZA 3HZVA 5L9DH 5JORB 1U8MA 1HOCA 3VXSB 2UY6A 4GBXA 4JFPA 4QRQB 3HFML 1E4KC 1PBYA 3I02B 1OP3H 3AFLA 4PJ7F 3ZO0A 3EYVA 5E03A 3X13B 4Y4KC 5FYLL 5DVOA 5D6CA 5C8JB 1QR4A 5LAXB 5HHVH 1YY9D 1F13A 2W9EH 2NX5D 1JNLH 4RAVB 1U8HB 1C1EL 2EDRA 2ICWA 4C56B 3RUGF 1U93B 2GK2A 2CGRL 1CGUA 3IS0X 4QTHB 2DBLL 1RI8A 1C5BH 5IB4A 1LVEA 3KVQA 4GRLA 1DVFB 5T1DL 3KPQB 1MHCB 4OD2A 4J6RL 4UNTA 1ZGLB 1AQKL 4FNLH 1DEEB 3ARDA 3KLHC 5JOPE 3ALXA 3L3OB 1UM5H 3SKOB 1JWUA 1UT9A 4M7LL 3REWA 5KZCB 4J3WA 1OAQL 5I1EH 4KJPD 5E2UH 1EUUA 4U05A 2H6PB 1HDMB 3QFJE 4GRWB 5HDLA 4F7CA 4LRIA 4G9FE 4DK3A 5IB1B 4GT7A 4RMQA 5ICZB 3BAEL 3C09B 4D9QE 5AG8A 5E4IA 4Y4HA 3IFPB 2X10A 3EOBB 2CUMA 3WN5B 5LGHL 1MCJA 4UT7H 5H2BA 2GJZA 1SJHA 4H0IA 3UTOA 4MYWB 1JI1A 4Y89A 3MROB 5B4MD 1JRHI 1UWEL 3FAXA 1CDGA 1JZ3A 4HT1L 2VTFA 2Q7YA 3UJJH 4X6FA 3DX6B 5I19H 1S9WB 4P23C 2VZSA 2GAZA 1E4WH 4HDIB 3D6GA 1NCNA 2PNDA 5CKGA 1E27B 2BJML 2C1OB 3NCJL 1BWWA 2FYYA 1N59A 1JPFB 3IJSB 2DLGA 2A9NH 4WW2A 1NFIA 3FB6B 3W9DB 2W60B 3HE6A 5IJVB 1LMKA 3DUUA 5T3ZH 3LS5L 3MBXH 4CMMA 4RMVA 2FHBA 5E4EB 2DM7A 3X11B 1SY6H 1E6JH 4XP6L 4YDKL 4CBPA 2C1PA 5SWZB 1FZOA 1QD0A 2X4PA 5C6TH 5LXGL 3FAWA 3IU4L 1JRHH 1QYGL 1J0YA 4F2MB 1HYRC 1QA9A 3I6LD 4KUCD 3RL1A 5JDSA 4LRIC 5CILL 4CMMB 3RWIB 5F89A 3FN3A 5TGBA 3D0LB 1JL8A 2Q20A 4YZFE 5C0IA 5E8NA 3LPFA 4GW1B 1RU9L 4U6VL 2EH7H 1OHQA 1N0LA 5EU3A 1F8TH 3VFTB 2ID5A 2PXYB 3TJHD 2A73B 4OI7A 3FT4A 4IRSD 5K9OB 3MNVA 4JHBA 4KJQD 5IV2B 5HGHB 4ZXBC 3NVQA 3D0LA 1Z9MA 5H94A 4GAYB 1RURL 7CGTA 1OGAE 1RUMH 4HXAH 5DUBA 5B8CC 1NC4A 2DS4A 1PEZA 3RWGB 2F54A 1CDUA 2ED8A 5TPWH 5C3LD 3AXLB 2X4TB 3LN4B 3MJ6A 1A6VH 1GYAA 3V52H 1I75A 2BCKB 2V17L 4HV8B 5D2NB 4GRMB 4DUVA 2HVJA 5CHNA 4J23A 5DVMA 1J8HA 3PABB 4W4OC 1YNTB 1J0HA 3FT2A 4J3VA 3TO2B 4D3CL 4C83A 2D7MA 5HJ3B 4YDJB 1KF9B 3OKLB 4E42A 4R8WL 5IF0B 1KSRA 2Y7QA 3BMWA 5CUSH 1RUPH 1BF2A 3PJSA 3GIZL 3VFGH 4N9OB 5F6HJ 5KSVA 3QDJB 1FGNH 3NAAL 4JY6B 3RWDA 5DK3A 3GM8A 3Q2CA 3H3PL 4M1GL 3RVUD 1YN7A 4POUB 2F9BT 4F58L 4QRPA 4UNVA 5CKAA 1Q9LB 2AQ3A 4BQ9A 1AXSA 1NCDL 5FECB 1U93A 5A2KH 1T83C 3EYFA 1JZ2A 3CGTA 4PBXA 4PJDE 1YQVL 3MCLL 4Y5YC 1G9MH 5SWQB 1JYWA 1U3HD 3QB7C 1N6QH 3OKOA 4P3DB 4JFOA 4B7IA 4HG4J 3GMRB 4DN4H 3HMWL 5E94B 2IPKB 1JNNH 1MNUH 4FFYH 2HRPL 1I8IB 3JV6A 3RWJB 1DE4A 2KQMA 3ZTJH 2W92A 1QPPA 4JFFA 4NQEA 1A7QH 1CYGA 2IAMC 1BF8A 3H2WA 1DP0A 3HI6L 3I02A 1VFAA 3EO1A 3D85B 2VL5A 1VEMA 1MWAH 2HG5A 4RGNB 4XI5D 1FO0L 3N85H 4MD4A 4PS4L 3FQRB 5ACMA 3VJ6A 3QPQC 5HGGS 1CLZH 3WFCH 2YZ8A 1BGXL 43CAB 2XT1B 1D9KD 3BD4A 4I2XE 4LSTL 4XBEL 2Y06H 3QUXB 2ERJB 2ZCLH 4YC2B 5BO1L 3PWUB 1HKLH 4IRZH 4U1IA 1CF8L 5DVLA 4AEEA 2H32A 2DM3A 5M95B 1WCBA 4JZJA 3MV8B 5J6GA 4H20H 1PW3A 2O5XL 1PEWA 4ETQB 3DMMB 1MFEH 3CXHJ 5GGVL 2GUOB 4MJID 1QG3A 1G7JA 5C9JB 3JV0A 1G7QA 1ZLWK 2R9HD 5EO9B 3VWKC 3WLWC 2B0SH 4NO2A 3GB7A 1KCKA 4DCQA 1OP5K 1VKXA 5EC1A 4N5ED 5GS1A 3KJ6L 2ZUQC 4R0LB 5GS2D 1MCEA 5F9WB 3TWCL 4XMLH 2L4OA 5I8OH 4JKLA 4NQTA 1X4ZA 3M17A 5TQ2H 3RI5F 1MREL 4HWEL 1IC5L 1MRDH 2YBRA 3BH9B 3FB8B 1T1XB 1FNGA 3KYMB 1K8IA 3MNZB 1EGJA 4LDLB 1AGBB 1QRNA 3TWCH 3VFSA 4D0CA 5D8JH 3VRIA 4FN0A 1ORQB 1HHGA 5TE6L 5FGSA 1S3KL 1FIGL 3V0VB 2JF1A 1SJXA 3V6OC 1FH5L 2X2YA 3TNNA 4XBPA 2WBKA 3QIWA 3TFKC 2OR9H 1BZ9B 1XF3B 3RRQA 1AXIB 4NRZA 4DN3H 3ULVH 2VDQH 4JB9L 1JFQH 4HHAB 4XT1C 3QEUA 5C08A 3WKMH 1ORSB 4DGVH 4DTGL 3KPNB 2ZNXA 3WV0A 4EXPX 3V7AE 4Z7NE 2QADB 5IFAH 1S7SA 3PIQB 5HYJD 3B9KB 3BH8B 2J1KA 2OXHA 1NCUA 4NNPH 4E41E 4Z78B 4WW1A 3TP4A 1KNOA 5IEHB 3IFOB 4GFTB 3STBA 5FEBA 5AEAA 3TO4A 2PTTB 5ISZE 1HEZB 1A7RH 3RWCB 4M00A 2DL2A 1UWGL 4JGJA 2AV1A 2EC9T 2W9DH 4MCYA 1B0GB 3MGTB 1X5GA 4OIBA 1KIRB 1A9EB 2ZUWA 2IAMB 5HGBA 3ETBF 2O61A 4KMTH 1SYVB 3NIFE 3BDYH 5HHNB 2BERA 2Q3AA 2XZCL 3ARDC 4M7KH 1D5MA 3CFCL 4PP1D 3QHFH 5B8CA 3BO8B 5FF6A 5J1AA 5IW1B 2HFGL 4PG2A 1YMMB 4NJAH 2WIIA 4YBQD 12E8H 3PL6A 4GRWH 4WWKC 2Z8WC 4NJ9L 3TBVA 3GSNB 5JW4Q 4NWUL 3EYOA 3SDAA 1WT5A 4LGSB 3UTTE 1NCAL 5KSAB 1NGWA 3A6OA 2BVEA 2GSGB 1EEZA 3BXNA 3BUYB 4XMPL 2DYPB 4JANB 3VXQA 1RIVL 3T4AB 4JO1H 5E70A 5B22A 5DLMH 2MJWA 4K07A 5GZOD 2X89A 3IFOA 1T2QH 3C08H 1F5WA 2OQJB 4OLVL 1XGPA 4Q9RH 4PYGA 4F9LA 2R2HB 4I0PC 4XCCH 5EUKB 4JRXA 3FCTB 1ACZA 5MEPB 1S7WB 4OCSH 1CDCA 4ZFFA 4XX1G 4J1UA 3C8KB 2PETA 2XKUA 3PWPD 4DOHB 2NR6C 4K3DH 4DGVL 3H9SE 1A6WL 1FZMB 3LQZA 1F97A 1CFSB 5D2LF 2K1MA 2W59A 4L3EB 4POZC 1HHGB 3LD8B 5IESH 3VE0B 2E7LA 3DX7B 5FOBA 2ENSA 1OAUL 4K71B 2DYPD 2YUZA 2FH8A 3EBAA 1NDGA 5KJRH 3PWJB 1U42A 2VR9A 4AY0A 2VOTA 4P5TA 1YPZE 4HIEA 2IANA 1T5WB 1J5OH 3BWAA 1S3KH 1AGDA 5FHAL 4WUKH 3QIUB 1T22B 4BZ2H 5ESVA 3B8SA 4L8DB 4CMHB 4K3JL 2MWCA 3NGBB 4UDUB 3DGGA 1CBVH 1XCQA 4QYOA 1WF5A 3HZYB 4UQ2B 1ONQB 2R23B 3OF6A 4LVHC 2EEAA 1P2CA 4JFZL 3SDDD 4K3DL 1UADC 4AENA 4LPTA 3BW9B 1WJ3A 3HAEG 3AY4C 3NPSC 1KPRB 2NX5E 3LS5H 3MBXL 3T3PF 4XC1L 2JJTA 2WLYA 4XCFH 4OLXL 1WFNA 3ARBD 1MCIA 2QSTA 4JE4B 2HVKA 4JDVB 2A83A 2FIRT 1QBLL 5E95B 3CFKA 5DGQA 2ZJSH 4ERSH 5IMKB 5D1XB 5EU6A 1RHFA 3P73A 4C59B 3DV4A 2QKIB 4KK5C 5I66A 1MSPA 5HYSA 1I85C 5T1KD 2AI0L 1NEZB 2WZPD 1IGIL 4YBLB 2EIDA 3DRQB 5D1XD 2ZSWA 3BKYL 3C8HA 3KPNA 4E42B 3UJTL 5D5MF 3CFBB 4TUOB 3TH2T 5DZNA 2X1PA 4F8TA 2VLRE 1YNLH 1AC0A 1RSFA 2EYTB 2X4QB 4M7ZB 4KJWD 1PSKL 2IFFL 2JK5A 1IILE 1U3HA 1T1YA 3DO7B 3T77B 3D0VB 4S10A 2R2CA 1SEQL 1L7IH 2XWJA 4MS8D 5C0BE 1P4IH 5IQ7H 1FZOB 2NPLX 4OZFH 5F93C 5I74C 4MDJB 4ZYKA 1NQBA 2ZOLB 5E2TH 2ZUVA 1EHLL 4YHKH 1I8MB 1J1OL 2DIBA 1UCBL 3S96A 1KB9J 1XCTB 4P23B 3ARPA 3ZLQC 2DDQL 5CBAA 1I1YA 3AMLA 1C12A 1KG0A 1DSFH 1Z5LB 5JOFA 1M7XA 5IHLB 5CLWA 3EJZC 4LLYB 2FECL 1T7WA 4L3AA 4QRSA 2VMFA 2JKXA 3ULUF 3MLZH 1WLHA 1WUNT 4UIKH 3UBXG 2Y7QB 1OTUD 2CK2A 5FM4A 3CVHB 4MMZC 5C07E 1I3VA 5ILTH 3K7UA 2BNQA 1KLGB 2RR3A 2JTDA 5C0GB 3GMMB 3MJ9L 2FSEB 3IDYC 3U48A 3WJLC 2FX8L 1SEQH 5JXAH 1I4FB 1KV3A 3EO9H 1YEFH 1T7VA 4FQIL 2C1PB 5SWZA 3WFDH 4R0LC 1CT8A 4D8PA 1VGKA 3CLEH 4Z0BL 1IGML 2ESVE 3P9MA 4P3DA 3ULSB 4YXLL 1KJMB 1XR9A 3DTXB 1NBZB 5IP4A 3LPGA 1T03L 4OUUB 3VDCA 1LGVA 1UG9A 4KY1H 4N8CL 4R2GB 3VFWB 2NY1C 5HY9A 2NY1B 2JCCA 1NC4D 2IQAA 5H35B 1N3NA 5JHDD 3CUPA 4M93C 2H2SD 4I8DA 2BVUA 1CGXA 4X6BA 1VENA 1H5BC 4DZ8B 5B38A 2PO6D 1WT5C 4LL9A 1A14L 3ARVA 2A73A 2VZVA 8CGTA 4Z7WE 4RFEB 4I3RL 4Y88A 5DEGA 3T2PA 1CICA 1VACA 1VFBB 3T4YA 3FT3A 2I27N 3RVTC 4HK3N 4XNMA 1BPVA 1EERB 4L4JA 3GSNL 1W0YT 4L29B 2CXGA 4PJAF 2DQHL 5C0DA 5TJWK 3F7PC 3L3DB 4BZ1H 3VGAC 4PRBB 1GRWA 3EO0B 2C7UB 3OAYH 3WHXA 4XTRC 3ARBA 3TH3T 1ZA3B 1ZHNA 3SN6N 4EI5A 4JFQA 3ARQA 4QO1A 1CLOL 3ULVE 3MPCA 1YC7A 4BQCA 1CFTB 3RTQC 1WFTA 1H3TA 4ALAH 3HNTH 3O81A 2GSIA 5EPMB 4IDLA 1PKQA 3OKMA 1CD8A 1IEAB 4OGZA 1JHKH 1EBAA 2FB4H 4YDVA 4A2MA 2M26A 1CL7I 2AABH 1DBML 2AV7B 1FVDA 4OZHA 3S3SA 4OV6F 1F4XL 3N1GC 3DX6A 3EIFA 3HE6D 5CGTA 2Z0BA 5D1QC 2JIXB 2HFTA 3FQXB 5K9QG 3KLDA 1EO8H 5CSGA 1RIHL 4Y4HD 3CFKB 1P7HL 3VXUA 2FJGB 4M6OL 5D5MA 2VLKD 1IFHH 3QI9C 4LNRB 1N6UA 4OFVA 1MWAL 5CMAA 5AWNL 3ULVF 1BQHG 5EU7C 1RMFH 1SJVA 3KR3L 3MYJB 1BQLH 4NDMB 3VMPA 2X41A 5IFHL 1OSPL 4H0HB 5F6IB 3DIFA 4NQDD 4RIRB 1LP9E 1P5UA 4KROB 3X11A 1P7QB 2CRZA 1CE6A 4PJAE 4L8SC 1ERNA 3FT3B 1T2QL 4YDIL 3OR7B 1PQZA 3GO1H 5ANMA 3L5WB 3O3BA 1S7UA 2UVEA 1FO0B 4NQDB 4BFEA 1RIVH 3C5SB 1D7FA 3TGXA 2LTQB 2QADD 4HLZG 1EMTL 3EYUH 1D6VH 1MRFH 5EULV 5F7UA 2VXUH 3MLRH 5GZND 1R3KA 3REWB 4XPAL 5EORH 1CFVH 3C9NB 3DYPA 5GIRB 3NAAH 2V7NB 2ADJA 4HIXH 5F7NC 3FQUB 4LFHD 3LMJL 1AQDA 1OD9A 3FQTA 3FFCB 4WI9A 1TVHB 1QFUH 2UZIL 2ZUXA 3QBTB 5J8OA 2A9ML 2P42B 3G5VB 2Q76A 5ALBL 5IEKB 3FQWB 1FFQA 1TETH 1YNKL 5A43C 1AC6A 4HLJA 4OGXH 3OWEA 1WK0A 3RIFK 1AFVL 3MLSL 3CH8A 4DEPB 1OGAD 5DRWA 2F58L 4H26B 1IGYB 1JNLL 4Y7MA 3WEXA 3B3IA 2D0GA 1Q9OB 5FOJA 3QPXH 4XHJD 1GGIH 4HKZA 3CCHA 4ELKA 3HR5A 3VG9B 2A6DB 4HUKB 4PJ8A 1KENL 5D1XA 5EU6B 4JHAH 1BBJB 4HJGA 1DFBH 2P5EB 3GMQB 4NNPL 3SGJC 5E2VH 3U2SA 1NC2D 3E3QC 4TOYH 4NNXA 5EFIB 3L7FB 2NMSA 1JPGA 1X4XA 1Z9LA 3P77B 5I76B 5IWLA 4AEHH 3OV6A 1AIFA 2WK2A 4OQ1A 2PW1A 1CVRA 3SDXA 3NH7H 1GGIL 5A2FA 5I75B 4OLYH 1JRHL 4QLRA 3TNMA 4D9RE 1V05A 1U2HA 5IW6B 2XNAA 5LXGH 1QSEE 2APBA 3MRBB 3BPOB 1FIGH 3VFUB 4X0KB 3RDTD 4R90H 3BZEB 5I1CH 2R2HA 2X4SA 2A2QT 4QY8B 4NZJA 5B3JE 5D5ME 4OCXL 2FECI 5DJ8A 2IADA 3TJHC 2YKLL 2HFGH 3KPLA 4ODXB 2MFNA 3OKNA 3BOVA 1WZLA 2Y4SA 3TO4B 4RBPK 5C0EB 4JN1L 4L8CB 4N1EA 3MRNB 3HAEH 2D0FA 3PHQA 1FYTA 1MUJB 5C92A 3HMXH 1JK8B 1ZVSB 2AJSL 3CDGB 3RPIA 5EWIL 4QTIL 3QDGD 5JPMA 4PGBA 3SDCC 4KVNH 1VA9A 2FD6H 4XCYB 5DD3H 1S7XB 5DMGD 4NYLA 4P2QA 3PWVA 3H9SD 2GTZA 2X42A 5LQBH 2VH5H 2BOCA 5D6DC 5DQJA 3QNXB 1GL4B 3T8XA 4FQHB 1BVKA 3WXWH 3O3EA 4MNGE 1DQLL 1F6FB 3HZKB 1A6UH 1RK0B 4R7DB 5CJ8A 4JDTH 4KPHL 2BZDA 2OZ4A 1WZMA 3LKNA 4QXTB 1QVOB 5TQ0H 4FXKB 1BIHA 4HXBH 3C09C 4JY4A 3I2CH 1B0RA 5T3ZE 1KB5H 3MMEB 4U6HB 4PLKD 4LCCA 3DV6B 3H42H 4OB5H 5F70A 5BVPL 3WLWD 4FG6D 5MP6L 1G1CA 5KAQF 2Z93B 3FL7A 2BVOA 4D9RD 2OTWB 4C55A 5J11C 3C2AL 4NO0D 1YY8B 4WHYG 2P5EE 1BQSA 3KPPA 4G6ML 4IRJB 3VWJC 1EFXB 3OX8B 3ULUL 1VCAA 3HC3H 4I1NB 3RHWK 1JWSA 4DFIA 3MRHA 4L8BA 4ALAL 3T1WA 3QUYB 2EDLA 4NYLB 2OXGA 1N26A 5HHNA 3G04A 3RY6C 3QQ3B 4Q9QH 2ICEB 1PLGL 3P4NB 4ODVH 4M5YL 1VESA 2C9AA 3C6LB 2FLRT 2YS4A 5T3XH 5AZEL 2J88H 5HI3D 3JSSA 1U8NA 2VABA 5B4MC 4U1NB 4Z0XA 2ZUQB 2G60L 3PNWB 2OL3L 3E2HC 5F9JA 1U58B 3F7VB 5FCUL 4Z6AT 2QQKH 3G04B 4LOUD 1RULL 2CO7B 2O5XH 3WO4B 4UV4L 1V8HA 4CJ0A 4H25B 4ZS7H 5ITBL 1WICA 1Z9OA 3ZYIA 5I2IB 3NZ8A 4XNQA 3RGVB 2IFGA 4NUJA 5ISZD 1UA6L 4HKJA 3B4NA 3QUYD 3RPKA 5IUSA 3O45A 5EC1B 4DGIH 4EI5D 5CWSB 5FM5M 3OXSA 2YPLB 5ADPH 4OTXL 4ODWB 3NA4A 5EFIA 1NCCL 4FQXB 4FQXC 4K7FB 5L6YL 4NCC1 4M7JL 1SYSB 1FFPA 1MHHB 5DUPL 5AG9A 1PZUB 4P46D 2XQBH 4K8RC 4C56D 1FFOA 4JFYB 2X4OA 3QO1A 4HUNB 2CUIA 4Z78A 1XR8B 5EU7E 4B7LA 3JWOL 3Q48A 1ZWIA 1TPXB 5JXAL 5FO7A 4U3XA 2PO6A 1T03H 4IMKA 3QUXA 1NCBH 2WWMD 1FRGH 3QEQD 3O2DA 35C8H 4Z7NF 3OAZH 1JPTH 4GBXC 1UQSA 5J0BA 1YJDC 2WINA 2QBWA 1U95A 1QBMH 1G84A 3HB3D 1AR1D 2AP2A 5B39A 5JHLL 3GSWA 1J12A 1DTUA 3T2NH 4X6CE 4OFDA 1FLRL 1D6VL 2QLVB 1B0WA 3SJVB 2AJYH 4XP1L 2AJYL 3CH1A 5CMAB 3D2UA 5F72S 1P9MC 1U8OB 1SMOA 2FDBP 4K7PL 3F8UB 4PRIA 5E1AB 3WS3B 43CAA 1W2KT 1MOEA 2PCPB 1HZHH 2APXA 2DMBA 3BP7A 4KXZI 3U83A 4N9GA 5C07D 3BE1L 3PG2A 4ZUTB 2HLFC 2B1HH 2BOBB 1LEKA 2VZ3A 4NO5B 5CGYD 5IBTH 1MCFA 1AP2A 4K94L 5I1JL 4GRMA 1ZT1B 2AEPH 4XVJH 5IMLA 3I9GL 1BREA 4HGWA 1N5AB 4HX1B 4P2CG 5JA8B 1G7JB 2PKDA 3U82B 3FO1B 3QEHB 5IMMB 4NQEB 3JV5A 7FABH 5C09B 3VXUE 2ADJB 1OWRM 4LLVA 1NMBH 5DTFA 1I9IL 3VXUD 3FQTB 4TNWK 4X5LA 4O5LH 2XZQL 2Q8BH 3R06B 3BE1H 1AXTL 4FQLL 3MRIB 1MJUL 5IVXB 5H37G 2VLKA 4QOKB 3TM6A 4NP4H 4PJHB 1U3ZA 4Z76B 1UJ3B 2AJSH 4A6YA 4M61A 3QDMA 5FO8B 3U36B 5EOCJ 5GS0H 3KR3H 5IFHH 3TYGL 5JLZA 5FAAA 4G7YL 4MB3A 1IQWH 1QP1A 4M03A 5DRWB 3IGAA 3QIBD 2NY3D 3FO2B 3QFDB 5F7HA 4GW4A 3DPBA 2VZUA 2AJ3B 3J8F7 3KPMA 3KYOA 5C07B 4ODBD 1MCCA 2OL3B 3MV9E 3QHZL 4HIHA 5GZNC 1LP9F 4PIRF 3VGDA 5IOPA 5KJRL 1HHJB 3WFBL 3ZTNL 3I84A 4ODVL 1CICD 1KB9K 3ARBB 3FO2A 5E99L 2CRIA 4K71C 5GSVB 2AJ3A 1C08B 4LK4A 4X6EB 4UUJA 2XWBB 1I3GH 4FP8H 2WW8A 5DFVC 3GUTA 3DX8B 4RGOH 2NZ9D 1WEJL 2B4CC 4WEBH 5KSVB 3EFFB 2XA3A 5IVOA 3CXDL 3T0ED 4HSQA 3WNKA 3MUHL 4NPYA 1HZHL 5C0AA 1ZA6A 3QDJD 4LOUC 4NSKB 2Y06L 4WHDA 3TCXA 3ISWA 4WV1C 1WWWX 3CDYA 4P5TC 1VGEH 5BV7L 1T66D 5DMYA 1UJ3A 4U6XB 2WSKA 4U1HA 4FFVD 4X8XA 5DK2A 1N64H 4GKSA 3QZWG 5C70A 3MO1B 5C08E 2DQIH 5C8JA 4XCNA 5C0GA 3Q5YA 4R26L 4Y4FB 2OSLA 4WEMB 4RFEA 2IWGA 3HE7A 1MCSA 1VFBA 3T4YB 4F37F 5C07A 4F3FA 4WHYH 4UDTA 5F7YC 2F74B 2OR7A 3GHEH 2EE6A 2HRLA 4ZSOB 1BX2B 2P8LA 2XZAH 4D9LH 5IJVA 1KIQA 4GW5A 1SJEB 3QRFM 4MXQD 1QRNE 4LCWD 4X6CA 4XMKL 5FYKD 5GRZA 1MF2L 4YDKH 3VD4A 4F15C 4Y4KA 5KVDL 2BC4B 1DZBA 4ZQKB 3KYNA 5BVJB 5KTEH 3DETD 3OG6B 1G7LA 2FEDC 2PO6C 2D31B 3ARGB 2QTEA 3MV8D 4MAUH 4M9OA 2NY6D 3EAKA 2YPLE 4PJ9D 5GRVK 3WE6A 3AB0C 3DO3A 3T77A 4CN6A 4WIQA 3GHBH 2WQ8A 2NTFA 2YKLH 3EGSB 4MCZA 3GSVB 4AENB 3TZVC 3TZVB 4FFWC 5D93C 3BDBA 1VFOA 4HH8A 5BW7A 4LVNB 5HXMA 1TVBB 1ODAA 1HQRB 1IFHL 1XAUA 3HZVB 4JB9H 1GC1C 4LBEA 1E27A 4S11A 3ULUE 5FM8A 3SDCD 2NYYD 1GIGH 1P9MA 3CH1B 2WBWB 1EAPB 1WIOA 3V9FA 4Q97A 3CNKA 4NNYA 3NIGE 5TE6H 3KWWB 3ARTA 1ZHBB 4X99B 2E8YA 3HKFA 1MPAL 3P3YA 4LLQB 4FABL 3CDFA 2J4WH 4JHAL 3DXAD 3VG0H 4G6JH 4HZLA 5DVNA 2A0LD 4FQ2L 2R23A 1S7WA 4MWFA 1MLBB 5CCKH 4X5WB 3QIBA 4KK6D 3MRGA 5KS9A 1KJ2H 2RCSH 2YSSB 3V5DB 5DD3L 4B53A 2F53E 4M6MH 1ZT1A 2OMNA 1LEGB 4MJ6B 5I71C 1K5NB 5E24E 3O2DL 2B20A 1FSKC 3UZEA 3NGBC 4QTIH 3V4UL 2E7MA 1UYWL 5ETUB 3WUZA 3MRRB 4MA1C 1JZ8A 3M07A 4CW1B 4P5TD 3B6SB 1IQWL 5DO2C 4ODUB 2XFXA 5ALBH 2KBGA 1BAFH 1MHEB 4JEGB 3SO3C 1TLKA 1HI6A 5CEZE 4G6MH 4FXKA 4TVSa 4BFIB 3UZQA 2YOCA 5SX5H 5D7IB 5TQ0L 4ISVB 4WI6A 3GZKA 2C4FU 5GJSL 1HH9A 1B3JA 1IGTB 1RZ7H 5IJKC 3TPKA 2E5EA 5FGCB 2LQRA 1DQLH 1H3UA 5D1XC 3RUGE 4GG6F 4ENEC 1D5XB 3WUWB 5GS0D 1KJ3L 4WFEE 1EV2E 4C4KO 1MY5A 5ISZB 1YEHH 1X3DA 4G6FB 1BGXH 3O6FC 2NY2B 1EEUA 3FKUS 4PJ7E 4F7MB 3MZGB 1QRKA 5J06A 2OMBA 3RGVA 4TOYL 4N5EC 4P3CL 5EH1A 5DEFB 3QUZB 3KPRE 3S37H 4X8JA 1OT2A 5HYSB 3D3VD 1GIGL 3QIUA 1R5IB 4LSPL 5D7JA 3S36L 1QVOA 2H8PB 5T3ZD 3MLPA 1U8JB 4OI9A 1ADQH 3X3GH 1CXHA 3N1FC 4U6YB 3IT8D 3QI9D 4GG8B 1MHHA 4UT9L 1YECH 4J6RH 2QHRH 3SBWA 3HN3A 4PPTA 5D2LE 1U91A 2P48B 1MIML 4RNRB 4OM1L 4YQXL 2EIBA 1HK6A 5E4EC 1Z9SA 3TBWA 1VPOH 2N7AA 2VE6B 3SDDA 3N9GL 4NRZB 5DWUL 4R6UA 1H15A 1QSEB 1XZ0A 3T2QA 4NQUA 4JLRA 2QHRL 2GCYB 5DEZA 3HTLX 1BP3B 1EVUA 1XGUA 5JIHA 3L3JA 2BNRA 5FUOH 4KTDH 3QDGA 3C60B 1IC4L 2X1XR 1OF2B 4GBXD 3MCLH 1JPTL 4BQ6A 4XWOD 1F02I 4M1DL 3U4EB 2GTZB 1RZJC 4O9HH 5IGXH 5DRXA 2L7JA 4I4WB 5DJAB 1JF6A 3SDAB 4O58H 4P46A 4PGZA 3G6JF 3PV6A 2MCPL 2K9UA 4M7KL 2V2XA 3MGTA 1G7MB 4DN3L 2A6DA 2FHFA 5J12C 1J87A 3GIZH 3UBXB 1H3PH 4PTUA 3LHPH 1YJDL 3LEYL 1IAMA 1A6AA 1U3HC 3ARFB 4LDOB 1IQDB 1NJ9A 4L8SB 2EDXA 3L3IB 4MAYA 4ONGL 5DHVB 5E9DE 4R3SB 5GS3A 1CWVA 3QCTL 5KSBB 4HC1L 4JG0L 2AXHA 5B8CB 4M7JH 3PF2A 2MQCA 5DHXB 5E2VL 2IPUK 5D7LB 2XZZA 3S36X 1QOKA 4ZUVB 5BQ7B 4CRPA 4P57B 2FHCA 4PGBB 1M05A 5CFHA 1RUAH 1IC7H 1KENH 1KEMH 2Q3ZA 2PW1B 4RGOL 3NIFF 4DOHE 2WUBL 1S78D 3IF1A 4K8RL 5IT2H 6CGTA 4ZS7L 4XC3L 3SKUD 3ZE2E 1P1ZA 2XA8H 5FYJL 1HEZA 1VERA 4QCIA 5LCVL 1C16A 4GG6B 1CR9L 2Z4QA 3QFJA 1RULH 1QKZH 2GSGA 4MCYB 3EOTH 4QOKD 5D7KE 1T6WA 5ESAB 1WTLA 3CX5J 1BLNA 1BBJA 3UTSE 3VFNA 4EI6B 1QQDA 4MQ7B 3OSKA 3L3KB 4QHMA 4L9LC 4MJ6A 5KVGL 5E08H 2Y1VA 2A6IA 1CDHA 3ILQC 2RFXA 4UBDC 4Z7VF 5K9QI 2X5PA 4LIQH 4X9GA 1JF1B 3MRRA 1UXWA 4QF1B 3AUVA 2BY3A 1EFXD 1ZT7A 2FLBT 4S2SA 4MNHA 1R6VA 4XBPB 5EOCL 4KK8C 5B39G 4BFBD 3PWVB 1DSFL 1HILB 3KS0J 4LDEB 1R5WB 2FCBA 4X6DE 1A3LL 3SGKA 1AJ7H 1H3XA 4UT6L 4Z7OE 3O6KH 1SEBA 5JXED 2R4SH 2HJLA 1L6XA 1CL7L 4K3EL 4ZS6D 3QA3B 1IGJB 3GK8H 1FQ9C 4H1LB 4HZLB 1DANU 4HF5L 3D39B 1MLBA 1YEIH 3V79C 1YEIL 1H5BA 3R0MA 5FKPA 3S88H 1CE1H 2PTTA 3Q0HA 2NY4B 4Y5VB 4PJEF 4HFUH 1D9KA 2BHYA 4Y16B 4OCRH 3RWEB 3TA3B 1AD0B 3NFPB 2VLME 3HG1B 3P4OB 1DBMH 3SDXE 1PG7W 2HKHL 2VLMD 4EVNA 2E27L 2XOTA 5IVZA 4XP9L 1JHLL 3U7AA 1JHLH 1LNUA 4EOWH 3TESA 4PREB 5IB2A 1KELH 2NY5C 3ECBB 3G6JB 3PABA 4TULH 4IRZL 4O2FA 5C2BL 1LO3L 4N0FB 3G5VA 2VH5L 1ZEAH 5J9PA 3P9WB 5KG9A 1YDPB 4XP4L 1XF2B 2BXZA 3NIDE 3GJFK 3O9WA 4KRMB 1G7LB 4J4PA 1W72A 1S5HB 3L3GA 1J88A 3G5YB 2NY4D 3JTSA 4X4XB 5BZWB 1CR9H 4GLRI 1A7QL 4QRPD 4PJBF 5D96B 3KPRB 4AT6A 3O4LA 4HULB 4WO4C 4HQQH 2AJXL 2F74A 5T5FH 3MODL 4Y5XA 1ITBB 5D70L 4RFNB 2H32H 1HQRA 4YHKL 3QJHB 3DIFB 2HT3C 1UXSB 4XWGH 4YDLC 3TLRA 3JV6B 3LS4L 5DUMH 5I1IH 2XZQH 5GRJL 3AU1B 4Y1AB 3VH8A 4FFZH 1JGLL 3FQWA 3HAEA 1CE6B 1JGVL 4UTBH 2JB5H 5BV7H 4JPIB 1TNMA 2NY0B 1Q8MA 4JKPH 5CGYC 2H9GA 5DC4B 1XF1A 2HMIC 1G6RB 1H3WM 3WKNA 4MXQC 2OSLB 4JZOA 4PRHE 3BRFA 1D5IL 2ARJQ 1MCQA 5FECA 2VXQH 2A6KA 2UZXB 1W0VB 1T0NB 4PJIB 1FV1B 4K3GA 1QSFA 2VSCA 1DFBL 1KXVC 5AUMB 2F8XC 3S5LA 3MV8E 1FVDB 4X80H 2CIIB 1V7NL 4JDZB 5MEQB 2P49B 3RL1B 3MRIA 5IVXA 2DBJA 5HHMD 1WQVT 3VXNB 1NCCH 1FVEA 4N0YL 1UCBH 3MRMA 1DLHA 2CDFA 3O4OC 1QACA 1RZKL 4DKAA 4EUPG 2N56A 4IIQC 4LVHB 2BNUB 4NDMA 1YECL 1UA6H 3WHXB 2EYSA 1A1MA 2YPKB 1KCUH 1JE6A 3IDXH 1C8PA 2HFFB 1TETL 1YNKH 1PAMA 3VXPA 1QBML 2B0SL 1FNAA 1QFWI 4K9EH 1BZQK 3S35H 3IKCA 5DT1H 4LP5A 1F00I 5E8EA 1JJUA 1A2YB 4NN7C 1XFPA 2QEJA 5ADOH 1KIPB 4WW2B 4UQ3A 4X6BB 1MAMH 5DJ0A 4O51A 3MLRL 1ZLVH 1M6OB 2BMKA 1TVDA 4Y2DA 3HCVB 5C0FA 4K7PY 4HK3J 3TVMD 4R2GD 3QIWC 1UFUA 3NPSB 3DXAE 3OXRB 4NM8H 5I18L 4PV8A 3BAEH 4XPTL 3MACH 4GQPH 4PJ9C 4I77H 4YZFF 4O2CB 3O9WB 1UB5A 2Z31B 3BIAX 1SJHB 4ERSL 2ZUUA 3MTRA 1A6WH 3JTSB 3L3GB 3EO0A 4KI5D 3GI8H 1IBGH 4OF0A 3ZL4H 1HHIA 3GK8L 1ZA3A 3QIBC 2WP3T 4ODHL 3N06B 4MB4A 1N5YH 2AXJA 1ZHKB 1CFBA 3PQYA 3O9WD 3FQNA 1NSNL 4P2RA 4FFYL 1RFDH 15C8L 2GFBB 3LH2H 1MCHA 1DL7L 1T2JA 1VGEL 4OAWB 3IS1X 4F7CB 4FQJH 1U6AL 3QH3A 5B38B 2OK0L 3ECBA 3G6JA 4MA7H 3VA2C 1M1SA 1U92A 4FZ8L 4OD3H 5FHBL 3AM8C 3TVMA 4KDTA 1M7IB 5L8LB 4JG1H 3LQAL 4FA8A 1T0MB 1KLUB 5E08L 2HLAA 4DW2H 1OP9A 3V0WH 4AG4L 4OKVA 3DX8A 2DQJH 3ES6B 4YPJA 4P4KB 1G6RH 4BSVA 5D72L 4MJ4A 3MROA 3KPQA 5MEND 1AGCA 2FZ3B 1IE5A 3CFDB 4PRID 1H8NA 35C8L 5IBUG 2HTKC 3H9HB 3EJJX 3SE8L 3F5WB 3MJ7B 4FG6C 4HUXB 2NY3C 1P6FA 3WL9A 2CKBB 1LHZA 3OB8A 4RX4D 1L0YA 1A02N 4P49A 4X4ME 1U3JA 5BS0A 4WUUA 3X12B 5I1AB 4XNYH 3G9VA 1GHFH 1FGVH 1J8KA 2Q6WA 4PR5B 3M1BA 3BGMB 1WIUA 5FO8A 1Q94B 3D39A 3K8MA 4NP4L 4UMGA 2RJMA 1K9TA 3I2CL 2PXYC 4DAGL 2B5IC 1T3FB 3OJDB 4RMUA 3FMGL 3WS3A 4MA8L 5L8KB 5FYKU 4WWKD 4Y16A 3RWEA 5E8OA 3E6FB 5SWZD 2DQTL 5ITBH 4AK1A 2XWJB 1QLFA 2BY2A 3F6LA 3MV11 3JVGA 4ZFFB 4Z0BH 3MC0A 4APQC 2WP3O 4NUJB 1XH3A 3V4VH 5HPMA 4L8BB 3BIBX 2XXCB 4IMLA 4N90D 5C7XL 2FIKA 3IU4H 3GSOA 2XZCH 1NBQA 5J1SC 3KPSE 1OQOA 4NQSB 2XY2A 2X6MA 1H3VA 4P57A 3HLAB 4ZXBA 2VLLA 1KIRA 3L5JA 2F53B 3I3BA 2H2SC 1U9KA 5JXEC 4NJAL 5HHOA 3P9LB 3T09A 4IRSB 1MNUL 4OFYA 3LN5B 3F7VA 3OJVC 5J6HA 5ICYA 3M45A 1YA5A 1XIWA 2BSTA 4JHWL 4EUPH 3ULUH 2FR4B 4P2YA 3SCMC 3I3EA 4E41B 1YQVH 1RHHA 1HHHB 1YMMA 4MQSB 5HYFA 5FO9A 4J1UB 1CQKA 3WFEH 4PJ9B 4JRYB 5DJ6A 1KPRA 1U8KB 4OZGF 5DQJB 4RGND 4WGWB 5JZ7C 2PYFB 2WWMC 3LKPA 2BRQA 3KPPB 4JM2F 1DBJH 2A77L 3RIFF 1G7IB 5TH2A 4JFEB 4G42A 4OD3L 4HS3A 5FHBH 3BUYA 1UACL 1KJ3H 4BUGA 1LE9B 5GGRA 2M8XA 5FO9B 3VH8G 5FUCC 4P9MH 4JRYA 1ED3A 4O02H 3INUL 3DI2B 1T22A 3ET9F 3LPWA 2ZCLL 2ADIA 1B2WL 4KHTL 4AEFA 2XN9B 1BQLL 3H7BB 2RGSA 3KDMA 3HG1E 2DLHA 4WI3A 5ADPL 3QIUC 5JIPA 2JELL 1CFSA 1S7TB 4GKNB 3VFOB 3NN8B 1FC2D 4JFED 4LCUB 1JYNA 2FX9L 3MFFA 1C1EH 4MA3B 4ZUVA 5T1LD 5F1IB 2FB4L 1MI5D 4GLRH 2IEPA 4JPKL 1U41A 3VXOA 3BP6A 5F1KC 5C0NC 1DQTA 3VI3E 5C3TA 4M6AA 4K3JH 1YEGH 1DBAH 4KJWC 1MJUH 5E99H 2R2EB 2CKBH 4RDQF 2R9HC 3RY6A 3PDGA 3A6CL 1OSZB 4OM0L 5D72H 3ZSSA 3KLAB 4LSQL 5TFSL 3HI1B 2W0FA 1U8NB 5IHBA 3V0AC 1A21A 4F9PA 4KRPD 2D7OA 4HPOH 4F7TA 1M7DB 1GC1L 3OHXB 4PJGE 2WBJA 3MOBH 3X12A 5I1AA 4AEHL 1QFHA 4Z8FH 3EHBC 4NC1E 5J1AB 4PR5A 5F7KC 1ORSA 4U1JA 1LO4L 4ZXBB 1A14H 3QXTA 4MAYC 4FQ1L 5GHWL 3NBNA 4U2ZA 4LP4A 2NY4C 4Y5VC 1V7MH 1MAKA 4HBCL 3MRGB 5KS9B 4KTEL 1A6VL 2DOCA 5IW6A 4ONOA 1UM6H 1QSEA 3RNKB 5JTWA 4GKNA 2RBLA 1I1AA 3GIVA 4V1DB 5LGJA 3QUMB 2NCMA 3E3QE 2ZUTA 4JPVH 3WFCL 1QPXA 3FZUD 3H3BC 4U0QB 4K7PX 4TQEH 4PJ8B 2ZCHL 4PBVC 4F57L 3VFMA 2X1QA 4WI2A 1CICC 1DN2A 3L95A 4UT6H 5AYUH 4KKCD 1DDHA 4PP2A 4KVCL 2AW2A 2H8PA 3RZCC 4BFIA 4WUUB 1FL6B 1JGDA 1FYTE 4QRUA 1DUZB 1IKNC 2DKSA 5J4MA 4JAMA 1UACH 5CP7A 1MCDA 4XAKE 2G9HA 2YRZA 4LLUA 3VXRE 3MLZL 2AAVA 1OP5H 4NZRH 2FWOA 3MRBA 3QHFL 4V1DD 4U1LB 4ETYA 3HPLB 5EO1B 2I9LB 4XVTL 3UC0L 4PRPB 4F33B 2DWEA 2J8UE 2DQHH 4BZ1L 1R24B 3MBEB 5DJXB 4Z5RB 1NFKA 1WBXA 2H32B 4NKQB 5FGBC 3GMPA 1YZZA 4OQTL 5D4QA 4HW6A 3S5LG 5KOVC 2I9TB 3K2UL 4PLKC 1HINL 2BSRB 1RJZB 4JN1H 4R97B 3FB7A 3DNKA 3LKRA 3DVIA 4XVTH 2UWEE 2YUXA 5SWSD 3SQOH 4P4KC 4NQEE 5IMOB 3QIUD 2D03L 2EDWA 4TSBH 4OZIF 1Q0XL 4ZFOL 4CW1A 3RVWC 3O11A 2OCFD 2BC4A 4OCXH 1RQ5A 4PLJC 2DJ4A 3W2DL 2GFBA 4BH7A 2PF6A 4CN4A 1TITA 3TIEA 3TH4T 3UDWA 4WFHD 1JTOA 1A7NH 1OAZH 2CSPA 4WFHE 4ODSH 1TMCB 4UT7L 3VGHA 3WNOA 5K9KA 1GOHA 4PJCA 5IB5A 2F54D 3V6FB 5DQ9B 2CMRH 1RAMA 1HHJA 5EN2B 1YEFL 2R1XB 4P5MB 5F8RC 4A6YH 3S97C 1E6OL 4QGTA 4ZUUA 4NT6A 4MQTB 5DXWA 4OZIB 2EDHA 2YRPA 3DMMA 3GMRA 4POYA 2DLFL 3SKNA 5DMKA 5CD3A 2G5RA 2X44D 4J4PC 4YHPB 4KMLB 5DD1H 4YHIA 1WV7T 2FH6A 4LEOA 3SGDH 1ZLVK 5IF0A 3O6LH 4L4TD 3KAAA 4AZ8A 4PJIA 4AEIL 5BZDA 2NTSP 3PJSB 4K9EC 1LO4H 2K3TA 1GGBH 4Y2DB 2FX9H 4LLMB 2XTJB 2Q7YB 1DQQB 4QXUL 4YHNB 4ZD3L 3S4SG 4OM1H 4YQXH 5C0FB 3O2VL 4GQ9H 1TNNA 3PGDA 1LD9B 1INEH 3J7HA 5KVGH 1CFTA 3EGSA 2AKRA 4OSUL 2NW3A 4OGYH 4PJDA 2C3XA 3GSVA 3RA7H 2AK4B 5GGVY 1NMBL 3MREA 2EE3A 1NLDH 4BELD 2A9MH 2KZWA 4YLQT 4LKCB 4M5YH 5JMOC 5EBWB 4OM0H 1KB5L 3K8LA 3TT3H 2DWDA 3H9ZA 5MENA 3AU1A 1YEGL 4K94C 2DM4A 1T7ZA 4GRWE 5GGVH 1PY9A 1QLRB 2JLLA 1G9MC 4XNZB 4ZAKA 2ZNWA 2W0LA 3C9NA 1JWMA 1HN1A 3LAFA 3WDHA 1P4LA 4MX7A 1WZ1L 5I1EL 4JZNA 5KBNC 4PFEA 1JGUL 4NSKA 2AI0H 2B39A 1II4E 5DRNB 1M7IA 1AKJD 1CE1L 1AHWC 3SKNB 4HIJB 5HJ3A 3RU8L 3FRUA 5HI4D 5TDNA 4HC1H 1PDKA 2XWTA 4XRCA 1GGCL 4K23L 15C8H 1S8DB 2J3SA 2BSED 3KLHD 1GVIA 4IDJH 1PD6A 3ZMRA 3ULSA 1T5XA 4OZ4B 2OZ4L 4N0UE 3V6ZB 3QNZA 4QRTB 4YUEL 3G6DL 5TE4H 3GSWB 1QSZA 1RMFL 4UIKL 1FVEB 1G0DA 3VRLF 2VL4A 3CXHK 4P5KA 1NC4B 2FJGA 2QADC 4O9HL 5ACLA 2AK4A 2DDQH 2HN7B 3ARED 3VXTA 3ZZ1A 1KLGA 1S9KC 1ZA6B 1WCQA 3GMMA 1NCBL 2PO6B 4GW4B 1X5KA 2NNAB 1O7SA 5HHMB 5E2WH 4AT6B 4I5BB 4GW1A 5ICXB 2C1OA 2UYLA 2A6KB 3AB0B 2HTLD 2XTJC 1P84K 1AY1L 1GCFA 2VZTA 1FV1A 5CUSL 3ZSTA 4JO2H 4Z9KB 3CLFH 3NZHL 1PZ5B 3P9MB 4PJAB 2G2RB 5DT1L 1ZGLA 2G5BA 1LP9B 4D0BB 1J0KA 3QDHA 5DMKB 3EDKA 3I85A 4DVBB 1TZHA 1AHWA 3GSNH 1A7OH 1YDPA 2X4PB 4HG4K 4TUOA 3QP3A 3SGEH 4LLUB 4XPHH 4LLMA 5GHWH 4MNGB 2RB8A 2FWOB 2I60H 4L8DA 1RUQL 4G3YL 5DDHB 2PCPA 3SCMD 3KPRA 1ZK9A 5D1ZD 4M61B 5I16B 5I0ZA 4YAQB 3X17A 5IKCA 5D2NC 1MELA 3QUXD 2DQDH 4KKAC 3MOAL 2XV6B 2VLKE 2X09A 3N1MC 1Y0LA 2EH7L 1RK1A 3P0GB 1CU4L 4X9HA 5F88A 3L3HA 5K9JH 3FO1A 3QEHA 3BQUB 3BKMH 4TUJA 5L2JB 3O8XB 2H9GB 5IB2B 1JGLH 4Y19A 4U31A 1T04B 1MREH 5ICZA 3OG4B 4OCWH 4E0RB 3UO1L 2V9QA 4N0FA 4LPWA 1WWBX 4GAFB 3BPLC 4Y8AA 3LDBC 1TJHL 1PKOA 1XF4A 3QZWA 1NLBL 1HXMB 4JM2B 3G5ZA 2Z8RA 3I6KB 4MVBD 1H8SA 5ESAA 4PTUB 1X5LA 4XX1E 5GGSY 3QDMD 4UT9H 3DOSA 1QQDB 3CX5K 5E5MA 1MLCA 1DEEA 3LKRB 1S7VB 4EEEA 3C5ZD 4Z77A 4PJ5A 1OB1B 2A83B 2DQFA 2IAND 4RQQB 5CZXD 5IFAL 4PRAA 1VHPA 1ZTXL 2ZOLA 4OQTA 4NC0B 3VI4F 2Q8BL 4O5LL 2GY7B 3O3EB 2EDYA 5IJKA 4CU6A 2IH1B 3WIFA 3ZKXC 1MFBL 3RNQB 3V7AG 1A9BB 3OKDB 5I1HL 1R5WA 1JP5A 4NCC2 1CXLA 4ODWA 3K3QA 4JLRB 1P1ZB 4O4YH 4MD0A 1XGPB 3RQ3A 4U1JB 1CD0A 1T21A 2XKNB 2B2XL 2VZ1A 2PYEB 3RZCD 4X4MA 2IG2L 1DCLA 4JFHE 4YNYB 5L8JB 2LTQC 3NCYP 5HYJB 3B9KD 4OCRL 4BSJA 1WAAE 1OTTD 3TA3A 2R2EA 2J8OA 4ODHH 4CVWA 4PV9B 2P5WA 4F7PB 5D7JC 4OV5B 3RZCB 2ADIB 3F12A 1SVZA 1FO0H 3N85L 4U1SA 5C9KA 4ZUWA 3FB5A 3P9LA 1L7TH 3FRPG 1ACYL 4R7DA 3FTGA 3W5MA 4PJCF 2YPLA 5HVHC 3GFUA 3NN8A 1DN0A 5D7LA 1FN4B 4R7NB 2FNBA 1NUFA 3CZFA 3C60A 1QHPA 2JJSC 1A9EA 2XZAL 1S7QA 3NH7L 4PJXF 4D9LL 1T1ZB 2IMNA 2IGFH 5HGBB 3QIWB 2D7QA 1CG9B 4UIMA 3IFNL 3FTGB 2QR0B 2HH0H 1SVCP 1A8JH 2NY2D 5GGTH 4DVRH 4E9LA 3QNYA 3CDGA 1I9IH 4GG8A 1RUKL 4KK9C 5J3HD 2HFEA 3GSRB 4Y2OA 1S7SB 4JO4L 1NGZB 4ZO6A 1T7XA 4LSTH 1A6PA 5LWYL 3O2WH 1E4JA 3ZE0E 4ELMA 4L1DA 3QNXA 4UB0L 3VFUA 2ICEA 4UB0H 4J3SA 2X4SB 1I8LA 2WANA 3OQ3B 4MLIA 2DIJA 2UWEA 4JCLA 1R0AH 5C0BD 3WL9B 2OBGA 1RUKH 5CIPH 3AS1A 1NAKL 4LF3A 1GH7A 2GUOA 5D7SH 4XBGB 4GJTB 2R56L 4G7VL 2PUQT 4U6YA 5I1LA 4RQQA 1HH6B 2F58H 4KZDH 2HJFB 5IBLC 1HCVA 5L0QC 5IQ9B 1J0JA 2D0HA 1KT2B 1IAKB 4MMXC 4CU8A 3W0WE 3ZKMC 1CFVL 3GSQA 2MKWA 3O3DA 2Y36H 4LNVA 5ICYB 1OARL 3L1OL 1RU9H 3H9SB 1HXYB 5GISL 1T0MA 1XIWB 1WTGT 4FQCL 1V5JA 3MLXL 5F7DB 1LQSR 1HXMA 4NM4L 1BVKB 1R5VA 2P24B 1KELL 1AGEA 3A67L 2BDNH 2R69L 3BH9A 4XAKD 2Y5TA 4HIIA 4XB8A 3O8XC 2W65B 3MV9A 1XH3B 3MODH 1LO5B 4DQOL 5DA4A 3QWRA 4PRHD 3MJ8B 4ZFOB 2LE9A 3LQAC 3R8BB 4HH9A 5E94A 4HS8H 5KW9L 4PGJA 3MLYH 2PYFA 3PHSA 4RSVA 4ZG1A 3KHOA 3P0YL 4OLWH 5T3ZL 1AHWB 3B2VL 4K3HA 1PYWA 2W9DL 4MVBC 4DCQB 4RWYL 5GIRA 4EJ1C 4U0RC 4N0UA 2JB6A 2Y6SD 1X9QA 3DGCR 4BM7A 4CVUA 1ADQL 3VXME 3X3GL 1HI6B 3EYSH 3VGEA 4U3CA 3VXMD 4ZFGH 3FZUC 4KKNA 2BJMH 3L5HA 4JVPA 4QRPB 4CVXB 3M1BB 4KH2A 4WEBL 1MFBH 3QHTC 5HVWA 3LEVH 4F8QA 5LBSL 2YBRB 2YD6A 5IKCB 1QNZL 3L5WA 4P2OD 3REVB 3VXTB 2HJKA 1YYLL 5C0CE 5MHSD 2AK4E 2NLJB 1MFNA 2N7BA 4QHNA 5ID1A 4MNQE 5FA4A 1MFAL 1I8IA 4GS7C 4P2QE 3H9HA 4P2QD 2XTJE 4LNRA 4Y2DC 4LCCC 1UH3A 2EKSA 5IW3A 3QUYC 4ZTOH 3QNZB 1TVHA 5DZOA 2SEBB 3Q6FA 2PTVA 1UENA 3LRGA 4GQ9L 4CGTA 1LK3H 1NGQL 3JWDC 3VXSD 4YR6B 3H3KA 3JWNC 5AUMA 4P4KA 5E6YA 3WBDA 3RY5A 5F6HI 1QUNA 3HI5H 3CX2A 2CDGA 4G6KL 4YHOL 5MP6H 1FG9C 2VXQL 2X9WA 5E6ID 1I7RB 4OCWL 1T80A 3ROLB 3MUZ1 5D1QD 5D2LA 4PRPD 4Y1AD 5IVXF 5EBMA 4J3UA 2MPAL 2W0PA 1QFWM 2J4WL 1HNFA 1PG7L 1JV5B 1MPAH 4ACPA 2A0LC 4W70A 4IM8A 5INCB 3PP3K 3SE4A 4JDTL 1CFQA 2NXZD 3S3JA 1LE5A 4APQA 3OAUL 4G9FD 1RJYA 3QQ9D 4X6DA 1VADB 4MNQB 2LV4A 3QEQB 1BBDL 4M7LH 3ZDYE 1IT9H 3STLB 5KVEL 1T89A 1L4IA 2WWKT 3NPZB 5C0CB 1M6OA 1LDPL 1QFPA 4HBCH 3RWDB 3HCVA 3D85D 4PBWD 3VD3A 1MFCH 4XB7A 4M43L 4Y5YA 2NNAA 4QRPE 4I0PD 3WUWG 2DJUA 1G9NH 4I9WD 4M7ZC 4ESKA 2FGWH 43C9B 1G6RA 1TIUA 3UTSA 3LEXA 2Q7NA 2Z31D 3HMWH 4WW2C 4YHLL 5DGRA 2HFFA 4YIQA 4QRTA 4ZFZB 3DO7A 4QHLA 1I7RA 4ZDHB 2DLEA 4G8FA 1PSKH 2A1WL 4L29A 1QSFB 1A6TB 1WC7A 1I8KB 4H5SA 2D2OA 4I2XB 5JR1L 1LEKB 3LV3A 3V0WL 1QNZH 3TJEH 5K9OA 1C12B 3JWOH 3B5HA 3HUJE 4ZNEA 4QRSB 3MCKA 2V5TA 3C6SB 4OZFG 2XACC 4J7RA 2HKFH 5H35A 2AEQL 3HNVH 2ESVD 3IJSA 3QXVA 1RZ8B 5ID0A 4JZNB 1QZ1A 4RGMB 4IOSD 1CLCA 1FYHB 1W8OA 3UYRH 1UGNA 2J2ZA 1E4KA 3GMOA 3FMGH 1YEJH 2J8UA 2V5RA 4YO0B 3EOBA 3PGFH 5IB5B 4Z5RA 4JR9H 2DM2A 4Z7UF 4PJDB 5IHUH 1B6UA 1ZANL 2HJKB 1KEGL 3TYFA 2BOBA 4WO4D 3T0EB 2JK5B 4QHNB 2NY0C 4XMLL 4U1KB 4HC1A 5KSAC 1OAXH 4M6NH 5F1NA 1U8MB 4X4YA 3U9UA 2VDPH 4LPCA 1VEOA 4U7SA 4M6ML 4YHIB 5CJBA 2OP4H 2JCCB 3MRLB 1MAJA 1JPFA 4JQXC 3D69B 2VDLL 3CUPB 4E5XB 2FATL 5HDBE 2JCCE 4KI5F 3UTQA 1JUFB 4PP2B 4YJZL 3IDJA 4P59L 3SKMB 2QQNH 1Z5LA 3FFCD 3VA6A 4FQXA 5KVFL 3T0EE 4QCIB 4H20L 3QA3A 4PJCB 5C6TL 4XPAH 2MSPA 2CRYA 1O0VA 3O6LL 2G9HB 3VG9C 4M7LT 1CGSL 3TEUA 3KNBA 4OGYL 1EO7A 1FNEB 2EC8A 1TJIL 3VFPB 2FSEA 1HHKA 4I3GA 1VB9A 1KIUA 4RISL 2A6IB 3A6BH 1F3JB 2BVYA 3BKCH 1NGYA 2Y23A 5DHYA 3TBTB 3TYGH 1N59B 4PJEB 1MFCL 1UQSB 4FRWA 4XPHL 3GEWB 5GGUA 1J11A 4MXWL 4HIEB 3HUJB 5B21A 1DDHB 4P23A 3VGBA 3WJJC 1CN4A 3S98A 2YA2A 2IQ9L 4JO3H 4WI8A 1X6NA 1NBVH 1FL6A 2R8SL 3KPTA 2ITCA 4OCMC 3K46A 1NDMB 2AJZB 1CGYA 3U6RB 4P9ML 3D2UB 3HE6C 1CF8H 4KGJA 3EYVB 4JRYE 1ADQA 1NMCB 1HSBA 3B8YA 1X4YA 1S9VB 1F58L 1GPOL 3KYKL 3JV4B 2OQJA 4ELME 3QPXL 3BSZL 4NKMA 3P30L 1FGVL 4UOJA 5EIVA 1FJ1A 2VIRB 3CSYA 2Y5TB 4HIIB 4NRYA 3MJ9A 3VWJD 1F42A 1R3HA 1MQKH 3L6FA 1CLOH 5ITFB 4QHMB 3Q1SL 3QYCA 1RIUH 1N2RB 2YD3A 2YN3A 4OGXL 4IIQB 4Y4HC 2DF3A 5MEOA 4C58B 3DX7A 4PV9A 3RBGA 5TPWL 1J1PL 1E0OB 3Q1SH 3BGFC 3O9WC 4OF8A 4NRXB 3MYZA 2IG2H 4G8GD 3UTTD 5F3HA 5DD0H 2QSCL 3V5KB 4I3SH 2H1PL 4H25A 1IKFH 1GSMA 2VLRA 5EO0B 1D9KC 1S7QB 4FZ8H 2NY6C 1PJ9A 4J2XA 4N8VB 4TVPL 4QRRB 3SDDB 3GSNA 4ISVA 2C4XA 2IANE 2WMPA 1KFAH 1R0AL 1IKNA 5MHSE 3AS2A 2QQLL 1BOGA 1QYGH 4HJ0C 2GYSA 3VXQB 1OF2A 3ZL4L 1XMWA 3BDXA 4LCIL 1SY6L 3WYRA 2AXFB 3O41B 4KRPB 1F3DH 4G6FD 5T1LA 3LDBB 5BV7B 5AD0A 4RFOL 5IR1A 5HBBA 4MA3A 5FM5O 1G7IA 5TH2B 2EZ0D 1FL5A 2FRGP 1MHPL 5F1OB 3AMKA 1JTTA 3RAJH 5KANG 3KGRA 8FABA 3OF6D 4P2QB 2BSSB 5I1KH 3GJFB 1DBKH 1A9BA 2BRRL 3OKDA 4OIIH 1WBYA 4LLDB 3QXDB 4D2NA 3STZB 5F3HB 1BQUA 1G1YA 1AR1C 4FQLH 5E00A 4NM4H 3SDCB 1BZ7B 1M71A 3FOMB 1WAAA 3U6RA 3CMOH 1G6RL 1HHHA 1KN2L 3KYMA 2CQVA 1E6JL 4XP6H 4JPWL 4NOFA 3HRZB 1I85A 2DQDL 2H26B 5E5MB 4P4RA 1IAOA 1DLFH 4H1LH 4Z77B 4ZUSB 4JY4B 3QR2A 4NQCD 3HZMA 1OQXA 4LSSL 1ES0A 5E00B 3SDCA 6FABL 2ICCA 3BZ4A 4HEME 5E9DD 1GGBL 3TBTA 2AEWA 1KTDB 4J8RA 4HS3B 1R3HB 4EN3A 2R0LH 4X80L 4JR9L 2IH1A 3CVHL 1B2WH 2AGJL 3ARZA 1MJ8H 4L3EE 2CJUH 4Z7WA 1T04A 2IPUG 1INDL 1EXUA 1EHNA 1AXTH 1OSPH 3C08L 2VLJD 5GGTA 1N0XL 2YMXL 2ICWJ 4ZTPL 5HGDA 1BJMA 5JHDE 3T1FB 2AJZA 1ZSDB 3HR6A 5E8PA 1U91B 2YXMA 4BSVB 1FNGB 3P0YH 4OLWL 1OTSD 2FBOJ 1ZS8B 2FR4A 1XGQA 4X4YB 1UB6B 1P6AB 4JREB 1A6UL 5E7BA 1NFDA 1JBJA 5HI3C 5FYJD 1FJ1B 5F9AC 1P53A 5DHYB 3FRPA 4QHUA 2D3VA 2A74A 3B9KC 4OF3A 4KAQL 1BQHB 5FA3B 2IH3B 2KZ1B 1XF3A 3QH3B 3IXAA 1TTGA 2VDOL 5FHAH 1B6DA 1IKFL 3VWJA 5BS0B 1NCDH 4P2RE 4HLZH 4R0LA 3ZYJA 3ULVD 3BN9D 4KDTC 1EEQA 5EOTA 5K33A 2PYED 1P4BH 4CADB 3O8XA 4YX2L 4NBZB 4IS6B 4Y19B 3MRJA 3DUHA 5CZKA 3ARGA 1ACYH 1HWHB 3UO1H 1X7QB 3VWKB 4KROD 1K8DA 5HHVL 5FUZL 3PP4H 5IV2A 2JJUA 1CXIA 4GKOA 5DR5H 5DHVH 3RX7A 4ODTH 3WEXB 4HIJA 1IGFH 3VFRA 4PUBH 4LPVA 4PTTA 4U1IB 2P7TB 4XGZA 5ERWA 5SX5K 2D7PA 3RWHB 4LKXB 5DQDL 4ZSOA 2CD0A 4O00A 5I8KL 2AV7A 1IT9L 3LV3B 4HFWA 32C2A 4GXUM 4LIQE 5C08D 1E4XH 1SJEA 4NZUL 4DVRL 3RWIA 2NXYC 5GSRB 4Y1AE 5I71B 2B4CH 3U4AA 3QIWD 4BQBA 3RTQD 5L2JA 4M62L 3NABH 3L3DA 1NCAH 3FN0L 2XQBL 4EDWL 2C7UA 2ZCHH 4NZUH 1CK0L 4Z7UB 3BGAA 3E8UL 4L4TB 3SEPA 2XG5A 4XHQA 3WE6B 1QRND 3DMMC 1P5VA 2HH0L 3QO0A 4JJ5A 3VFVA 3JUYA 3ZHLA 5GGQL 4EUPB 4I2XA 5BOZG 1BX2A 4JM4L 2Q8AL 4L4TE 1MHPH 1C08A 4X6EA 2AEIT 1E4WL 4P2RD 3UROR 2ZUSA 3U9UB 3C5ZC 4JO2L 1I7UA 1F6AB 1CQYA 1TCRA 3RTQB 2Z91A 4MHHG 4W4NA 4YDLB 1VFAB 3EO1B 5C0DB 2CKBA 3LSOB 1QA9B 3AROA 3BN3B 1L7IL 2ADFL 4U4BA 2Z35A 4JQIH 4AM0B 5JDSB 1RPQA 3WJJA 2GT9A 3ORJA 2VDPL 5MENB 3A6CH 3GMOB 1N5AA 1I1CA 2GJ6A 3ESUF 2J8UB 3NOIA 2H3NB 3EYFB 1HSAA 2W0KA 4JREC 3LSOA 2X4NB 4HMDA 3FONB 4UU9B 2YC1A 4RA0C 5A2JH 1KLFA 1MEXH 1N5YL 4QNPE 4V2CB 4HUWA 3MV7E 3EYSL 4YK4C 4OLZH 2H3NA 3KJ4C 4L4VB 4X6DB 1AKJB 4UDTB 1DL7H 3V8CA 3QCTH 3UPCA 2ARWA 1F2QA 3RVWD 4KVNL 4LPYA 2UZYB 4C4KT 2HVJB 3QXAA 4XCFL 3D2UD 1BD2B 4KV5F 2AGJH 2PXYD 4TYUA 3UCRA 2DWEB 1F4YL 4HS8L 2J5LB 3FJTA 3EZJB 4FQQA 5EBMB 1UKSA 3IXTB 5DK2B 4R4BA 3KYAA 1R3JA 1MCPH 1LNUB 3UTSB 5KS9E 2YD2A 5IFJB 3BEVB 5IB1A 1MCKA 3LKOB 1UXSA 4BZ2L 2A77H 1DQQA 1MCWM 5CEZD 4YH6A 2VLKB 2VXVH 3RP1A 3DRQA 3OKEA 4X7SL 1OARH 3GMLA 4YHLH 3BSZH 1HIML 3GI9L 4M8QB 4OSUH 4GH7B 2NY7H 4BH7B 4NHUB 3STLA 3V6OA 5I0DA 2R0ZL 5ABDE 3QDAA 3QO1B 3VFGL 3MCG1 5C0CA 4GUPB 2VDNL 1MIMH 5FKPB 4OZFA 5HGAB 4G3YH 4LMQI 4OKDA 3ZDZF 2V9RA 3MUGA 3EJZD 4R97C 4L4VE 4PY7A 4HWBH 1ZLUH 3QUMA 3QO0B 1UZ6F 4TRPL 2R8SH 2CLRB 2NW2B 2VAJA 4WV1A 5EN2A 1CGTA 3MZTA 3BD5A 1G9EA 4ZUUB 4MLSA 1RZKC 4ODTL 5DO2D 1D5IH 4Z95L 2V9TA 4XVUD 4FQ1H 4HX1A 2P8PA 4JRWA 4Y1AA 1F6AA 3U0WL 3UBXI 3TFKD 5DC9B 4EN3D 2DI7A 1A3RL 5FCSH 1JFQL 2PR4L 1MIEH 1K3IA 3CVHA 1F8TL 4RBPH 3F7RA 5F9OH 2NXZC 3MV7A 4XPBH 4W6WB 1Z2KA 5GRJH 1YMHB 5T3XL 3IVKB 1IZJA 5L88H 1GXEA 5JUEH 3B2UC 1F3RB 5EO1A 3HI5L 3GIVB 4V1DA 5LGJB 4MA8H 4TUKL 5GGRY 3CVIL 2YEZB 5FV1L 3GMPB 1UWXH 3WFDL 4I0CC 3T3ME 1BIIA 2MPAH 3P2TA 1U95B 3O8XD