3OR7B

On the structural basis of modal gating behavior in k+channels - e71i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transport protein
molecule keywords antibody fab fragment heavy chain
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2010-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3or7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3or7B01
1I7RA 4HIXL 2NY1C 5D2NC 2YA1A 3VXQB 2JELH 2A6JA 3ARYA 4KJYB 4W70A 1S9WB 2GQHA 4ELMA 1MJ8L 3KLDA 3K0WA 5EZJB 3O11A 4I2XA 1G9NC 4GBXD 3I2CL 4AIZA 1TQCB 3HNTL 3MLPA 1JYWA 4L4VE 4ZOBA 3U6RA 2CRIA 5FYJD 4HXAH 1I8MA 4QRQA 2VXSL 3DX8A 4PJ9A 4XMLH 4YDIL 4RQQA 5E4EC 1NJ9B 4QTIH 4LEXH 4UBDC 1QLFB 1F6LL 2VDKH 2NZIA 1EAJA 4BKLB 2VKWA 1ZXQA 4KROB 4KQ4L 3VFWA 2B39A 2A0LD 4ORZC 4LVHB 3HNVH 2AP2A 2QBWA 3GHEL 1MWAB 4XCCL 3IDXH 3MR9A 1I8IB 4U1SB 3C6LD 1AGDA 2NX5A 5FB8A 5JIKA 1QP1A 3M8OH 3GUTA 4L9LB 3TZVC 3DXAA 1MHCB 4O5LL 1CFVL 3P9WB 1H15B 4DGIH 3N85L 2R4RH 5C0DA 1Z3GL 5C07D 1UA6L 4JQIL 1CS6A 4OT1H 43CAB 4GRMB 3O2WL 1O7SA 3LN5A 3KLHD 3S5LA 5D7IA 1UXWB 2QHRH 2L7JA 5EC2A 3WO4C 2FHCA 3OR6B 1T1YB 3IGAB 1MNUH 1AJ7H 1KJ2B 3DROA 3B5TA 5FYLE 4NNPL 4KVCH 2EZ0C 1IKNC 4OKDA 4I0CC 4FP8H 3VGEA 1C8PA 4I2XE 3H6JA 5F7EL 5GXBB 3DUHA 4W4OC 1WIOA 1GC1L 2XZAL 3FN9A 3VFNB 4YIQB 3PWNB 5DD6A 4X98A 4HF5L 3TH2T 5BJTA 1K8DB 1KG0A 4PJIA 3LMJH 1LO5B 4GAJH 1BQHG 3KPRE 5KTEL 1IEBB 1K8IB 4FXGB 2EE6A 1NCTA 3IDIA 5B8CA 1SEBA 4KKLC 1XH3A 4LGSB 1ND0A 4OF7A 3DECA 5SWQA 5I74C 2PYFA 1M7IA 2YXFA 4FTVD 2AI0L 3Q6FB 3NGBC 4X7TA 1PQZA 2RFXB 2YSSA 4NKIH 2Z35A 3QNXB 4M7KH 3EDEA 1CDHA 2YD6A 4JRXA 5JZ7D 5DJYA 3O8XB 1M1SA 4DOHE 2YC1B 5E08L 2GIYA 3BQUA 4HFUL 4K2UL 3C5ZC 4YHML 4UIKL 3D2UD 4CMHC 4OLWL 5A2KH 4PJHF 3BIKB 3T2NH 4R4BB 1KFAL 3SOBL 4YFLF 3WJLA 5C1MB 4MA7L 4BFIA 3SGKA 2I24N 1IAKA 3RDTD 1JUFB 3QA3B 3SKMB 1QYGL 2OJEA 2I9LB 1IL1A 2CO6B 5EG6C 3HMXL 1CXLA 1LVEA 2DBLL 1JRHI 1NCDL 4U49A 3V2AR 1LO0L 2DM3A 1OF2A 4Z7NE 4GBXB 5FO9A 2VLME 1JZ2A 4HV8A 5TE4L 3P4MA 1DE4B 1AXTL 3GSNH 2X4SB 1A7RH 2VDML 2EO9A 2WIIA 3G6JE 4X6DB 3QQNA 2DLEA 1IQDB 2X9XA 2A0LC 1RIVL 3CSBA 1KCVL 5DS8B 3MLWL 1CLOL 5J11B 4O4YH 1T80A 2HYMA 3EOTL 4ZFZA 1GZQB 4OCLC 5HHOA 1U3HB 2XTLA 3CVIL 4JFYB 3C6LC 3MXVL 1AQKH 1O7VA 1C7SA 4I9WD 1AO7A 1KCRH 2HG5B 3BUYA 4MZ3A 4PREA 5C8JB 4JR9L 4JKPL 4HLJA 3REVB 5DD5H 2FRGP 1RZJL 1I4FB 4HUUB 3KLHC 4JFFE 3X3GH 1EHLL 1R5IA 1J9CT 2FIKA 3ZKXB 2MJWA 1A6VH 4NQVA 3T0WA 1L4IA 1YN7B 1VGEH 1VFBB 2AEQL 4ORGA 2QQKH 1NGWA 2OQJB 1KIQA 3BUTA 4Z7VA 4ZTOL 1CGSH 4PJDB 3ARQA 1OGAB 4NZJA 4LCUA 3GSXB 4WO4B 3CFJA 1FAIL 4PGBB 3I9GL 2G2RB 3ARBD 4L3EA 4PRBA 2R1XB 2HTLD 4LPXA 5I18H 3CSYA 2WMPA 1JGVL 4A6YA 4OJFL 3ZDYE 1N64H 4IMKA 1LO3H 2QADD 5GS0D 1QHOA 2VIRA 2YBRB 5C7XH 4I48B 5D1XB 1NDGB 2WUCL 2R2BA 2GJ6B 4OLUL 4M3JA 2ADFL 5IR1A 3BRGC 4XPHH 3GKWH 4CMMA 1W0YT 2HVJA 4FRWA 1U93A 5EORH 5F8RC 5EZLB 5IJVB 1UVQA 3U7WH 2OTPA 1A6WH 1NGPH 2VLJE 2BSSA 2HAZA 1UB6A 3FO9B 3VGDA 5JZ7C 1K4DB 3ZTNH 4XBEL 3IJYA 3MODL 4JFEE 1MH5A 2YD1A 2CIIA 4S0TD 3V4UH 2PXYB 3S96B 5L0QB 5MP6L 4R7DB 3ROOA 5CBEA 3MO1A 4XH2A 2XKNB 5K9QI 1UXSA 5JW5A 2CSPA 3RDTC 3EO1A 2W9DH 4L3EE 3MREB 3QCUH 4I3RH 3JWOL 4MLIA 2FEEI 5ID0A 1WFNA 2FR4A 4RIRB 4TUJB 4Z8FL 2CK2A 4Z0XB 4Y1AD 4Z77B 3IRZA 2DJ4A 4UINL 3B4NA 4Q6IC 4NQEB 4PRPD 4NJAH 3GBNH 4OZHB 1DSFL 2QQQA 3SDXF 5C0GB 2KDGA 1G6RA 4U1GB 4NQCB 1EZVY 4KGJA 3MA9L 2ORBH 1YEJL 1IGFL 5DK0B 3QDJE 3TVMA 2F53B 1T22A 1CD1B 4NFBA 2DKMA 3QEHB 3U0TB 1I3UA 1XGPA 3OXRA 3QIWD 1IM3A 4N0UA 1F2QA 1J1OL 2IPTL 4FZEH 5ANMB 4YGVB 2AQ3A 1J8HD 4HAFA 3CC5B 4JAMB 3VA6A 2DDQL 4JRYE 4Y4HD 3S36H 4PRIB 2L7UA 1IEAA 3LPFA 2CIKB 4HUKB 5JDJA 3OKMB 1B6DA 3BYTA 4UNUA 4HHAB 5EPMA 2YUVA 4KH2A 1RURL 3NOIA 3BN3B 1MFCL 4HW6A 1HYSC 1Q0YH 5BXFB 1J7VR 5JIIA 5D7LA 4OQ1A 3S88H 4OLYH 1LK2A 4Q2ZA 4F37K 2XTJD 4KDTA 4ZXBA 2B0SH 3QHZH 3LEYH 3C8DA 3H9SE 3DHJA 1OAZH 3ARBC 1FC1A 1S9VB 3PP4H 2HTLC 4LHQB 2H26A 5EU6A 3KDMA 1MRDL 1WJ3A 5IHUH 1TITA 1TVBB 3VWJD 1NMAH 3RNKA 5D7KD 2QADC 1MY7A 2NY0D 1NBZB 5C2UB 1WZLA 3MRRA 4IJ3B 1IT9H 1HH9A 4KUZH 1PBYA 1E4WH 4WGVB 4ZFOB 4J1UB 3QO1B 3NH7L 2D7NA 3JTTB 3X17A 3OZ9H 1JHTB 3U9UB 2DS4A 4JO3H 4OM0H 2NTSP 1P6FA 5C6WH 1EA9C 2WLYA 2BP3A 4RMVA 1JPSH 1MREH 4NUGL 4F2MB 1UACL 1U3JA 4U3HA 4KHTH 1MIEH 5DVNA 2J7LA 5IWLC 3NACL 4HIHA 4ZS7L 4QOKE 3SE8L 1MJUL 4NQTA 1JPST 2X4TB 3LZFH 3OG6B 3FFCB 4OIBA 1GCFA 4QRUA 4K23H 2IANA 1TJIL 3QUXD 5GISH 4PJEF 3C8HA 4NO5A 1CYGA 1NFKA 3SQOL 2Y7QA 4KV5E 2JIXA 4QO1A 4XVTL 1P6AB 1RMFH 2AXGA 5GQBA 3C60B 3L6FB 2MQCA 1RI8A 1IQWL 1IVLA 2DLFH 1MJ7H 4XXDB 3V0VB 5BZDB 3ULUL 3MRBA 5I1JH 3ABZA 3RTQD 1KLUA 3HFML 4GKZA 4X9FA 4OTXL 2CMRL 3BPOC 4JFZL 4K7PH 2ZSVB 4MWFB 3MRGA 3MJ7A 1A3RL 4X6CA 2CQVA 4XNQA 4CDGC 4YXHL 2GTZB 3NABL 3QIWC 2DI8A 3VRJB 2AJSH 4LLDA 3J8F7 4DTGL 5KSBE 5T5FH 2BNUB 4O2EA 5GHWH 1FGVL 1UYWL 3FB6B 5JOPD 1AY1H 4H26A 3SDXA 4FQXB 3QH3B 1SEQH 2YR3A 4Y4HC 1BJ1J 3O0RH 2ZPKH 3RU8L 3VFTA 1HHJA 5GSVB 1QSEE 1NCCL 4MCZB 4XNZC 2DIJA 2ZCKH 1JPFB 3CLEH 4XB7A 3BKCH 2XTJC 2GSGA 3EJZD 1U41A 3MOAL 1FJ1B 1HXYA 4X7FC 5J0BA 2DQTH 2GT9A 5JQHC 2IAMD 2H1PL 4M48L 2YK1L 5FKAB 3VWJC 1A2YB 2VR5A 3D39B 4IS6A 5FGSA 1OPGH 1A14H 5CLWA 1SVZA 2NY0C 4KY1L 1KF9B 3ARED 1EGJA 4NYLB 5E99L 4OFDA 5CSGA 2HVKB 1AR2A 4ZUWB 3J7HA 5C3TA 5IOPA 2XPGB 5EBMA 2ITCB 3IFPB 3CPLA 5AUMB 4OGXH 3I6KB 3HI1A 5FCSH 2FJFB 3ROLB 3UBXI 4EN3A 1MJJB 5DMIH 5TDOB 3GSNB 2BSED 1T5WA 1U8PB 1UGNA 4ZYKB 4JY4B 12E8L 3JV4A 3N50A 5E6ZA 1ZLSL 3DX6A 4MD0A 1PY4A 4MJ2A 4HIXH 3P9LA 1EUTA 3A67L 5EZIH 1RUAL 4F80A 4JJ5A 4JY6B 1BWMA 4PV9A 2M26A 1YJDC 3MRQB 1I1AD 5FECB 4XTRD 1KCUL 1V3MA 2WSKA 2O93L 4RGOL 3N1PC 1A4KA 2P5EA 1VESA 2Z4QA 3O41B 1QBMH 3QUXC 5CJQL 2AERT 2VXSH 4YDIH 3D0LA 4X83A 3L3OA 3QEQA 5D2LF 1XGTA 1BEYL 4KJQD 3AMKA 1P5VA 1NMBH 4XAWL 3VW3L 3QWRA 4RNRA 3PDDA 4K94L 1WEJL 4LU5L 2FATL 4YH6A 3O6LL 1U8IA 1HIML 3PGDB 3RTQC 3BO8B 3L5WA 4OLXH 1VGKA 2DLGA 2X70A 3G5YA 4OCRL 5F6IC 1DBKH 1N5YL 1Z3GH 4PJEA 5EOTB 1VKXB 1UA6H 4Y4FA 1YPZF 1MFAH 5B38B 4YHZL 3O2WH 3QO0A 3NN8A 1G7JA 4U6YB 1CFTA 1JN6B 3V8CA 2K1MA 5SX4H 4JFHE 5IB5B 4NNPH 1ORSA 4G8FA 1WV7T 4K3DL 5J1AA 3LRGA 2E27H 4X7EC 2OZ4L 1JGDB 4PUBL 3ARGA 4I4WB 4X5WA 5C0BD 3EW3B 2F5AH 3MV8E 2XZAH 4DAGL 3KWWA 3VFVA 4G3YL 5KZCB 4BUGA 4PJBB 4FFZL 3QEQE 2P43B 3F62A 2KZ1B 3SJVD 5KVEL 5KTEH 3BPCB 5E6ID 3EJZC 2P5WD 2LVEA 1S7QA 1A9EB 3ME0A 3L3DB 1DLHB 1BIHA 2IAMC 3K8LA 5HHNA 1CFNB 1T1ZA 2VZ3A 1IGTB 1NGZA 2YD9A 4LLWB 4G9DB 2AI0H 4G5ZL 5F6HI 5DEFA 3AREC 1RULH 5HVHC 4KRLB 3S37H 2BNRD 1SJHA 4PRHB 3NVQA 4JO1L 1NLBL 2DQUL 5HGDB 1RJLA 5I1EH 3U48A 5E08H 1BOGA 1HEZA 4HFUH 2GK0B 4P4RB 5HGAA 4K2UH 4KU1A 4UIKH 3D85A 4MB4A 4HIIA 4Z78B 1F97A 1M7DA 4OLWH 2CUIA 4P2RA 1MQKL 3BZDA 3ARDB 3QDMD 3VFGL 3TFKD 4LBEB 3SOBH 1KFAH 4P46B 1MRFL 3PQYE 4MA7H 1I1AC 4XTRC 3QUYA 1QYGH 2J6EH 1WGOA 3DNKA 1W2KT 4GFTB 5T3XE 3HMXH 4ZUTB 3ZZ1A 4R2GB 1NCDH 4X7CC 3UTOA 1LO0H 2J8OA 1NFDF 5TE4H 1BBJB 2IWGA 1YA5A 1AXTH 3UBXB 4KJQC 1VEPA 1UWXK 4OCWH 1RIVH 5KSAD 4LNVA 3MLWH 3CFBB 3EOTH 1MSPA 1M6OA 3NIGE 1WAAA 4LKXB 3CVIH 1KPVB 5FGBC 5I9QB 2ADJB 1BWWA 2PO6A 3U4BL 4MA8L 5F9WB 4P9HC 5IHZB 1S7SB 3G04B 4GMSL 4JKPH 5HPOA 2EYRA 3FN0H 1N6QH 3JXAA 3H9YA 5JA8B 4O9HH 1X5KA 3W0WB 4PJFF 3EGSB 4WHCA 3I6GB 5GRJL 1AR1D 3GSUB 1UKSA 4MXWL 4W81A 4QY8A 4ZSOB 1WTGT 4UQ2A 4PG9B 2E7LC 3KPOB 2VXTL 3MUGA 5GGVY 1T89A 2X6MA 2VXUL 3MQIA 3VE0B 3T0EA 2GAZB 1CT8A 3PHQB 4ENED 1YUHA 1UH4A 2NW3A 5BRZB 1UZ8A 2AKRB 5IT2H 1CG9B 1T4KA 5DMKA 1AP2A 2YD2A 2OR9L 2R1WA 2AJZB 5FO8B 3HNSL 1FAIH 2LU3A 5ID1B 3DVGA 4QRRA 2IQ9L 2Q7YA 2OK0L 5JPNB 1JGVH 1ZS8B 2ID5A 4OJFH 5E6IC 5E6YA 4PJGB 5KVDH 2VLKE 2X10A 3QFJD 3FTGB 4U1IB 4V1DB 3VXRB 2WUCH 2VR9A 6FABL 4XPBH 3C5JB 1WAAE 2X44D 5D1QA 3DO7B 3QAZC 1FZJA 3T77B 3CFKB 1CICA 2VDRL 5FA4B 5FEBA 4PTTA 1P9MC 4OFYA 3DI3B 4X7SH 4DJMA 4KTEL 4QRPA 2K7PA 5SX4I 1T6WA 4J8RB 1BBDL 4XBEH 5IFAL 4J23A 3MODH 2Q87A 2BNRB 2Y25A 2NY7L 3IFOB 3STLB 3WHE0 4JVUA 4Y5XA 2CK0H 1OWRM 4MNQD 2MTPA 5IW1B 3S97C 3T0EE 4YO0A 2IALA 5D96C 1WZKA 5C08B 3TFKC 3QCVL 1MCWM 5IQ7L 2D7OA 5IVZA 3MOQA 3RWFB 5BS0A 1QRNA 1BFOA 1EBAA 2R0ZH 3P4NA 4RX4D 3OAZH 4UT7L 1XR8A 4OSUL 3FO0L 2EIZA 4S1QL 2DN7A 5ITBH 5JW3H 1HHHA 2FZ3A 3GSWA 2VC2L 4UOW0 3R1GH 5DRXA 4WI3A 1NC2A 1U8OA 5LCVL 3OKNA 4U1KA 2WBJD 5GRVK 4JM2B 3BH9A 5DHVH 5IW3A 3FL7A 1A6ZB 5EO0B 3WL9B 1EH9A 1FQ9C 2D4FA 3T0AA 2YWYA 3X12B 5D2NA 1ACZA 1YEEL 5KSAC 5C09B 3MLZH 3NCEB 4WV1B 1A7PL 5D93B 2Q86B 4R8WL 1MCQA 3VWKD 4QRPE 1LNUB 3MA9H 4DVBB 1YEJH 1FFNB 4WHYH 4JM4L 3JSSA 4KK6D 5C0AB 4IOFD 2FX7H 4MXVE 5F1KC 2Y06L 4CU6A 2PW2B 3WUWB 2CLRA 3E0GA 4U6HA 4MQ7B 1J1OH 2IPTH 5HHPA 1AR1C 1YYML 1JV5A 3ECBB 3P0YH 4PJAB 5H35A 1QO3B 5IGXL 5ELIA 3QFDB 5J1SC 2VNCA 1KXTB 3RWDB 1T5XB 1KV3A 2DDQH 5ESAB 2G5BB 2A74B 3E6FB 1DUZA 4ZO7A 5HTSA 4QXUH 3T65B 5GPRA 5GGTA 3TBSA 1RURH 1DUYB 1IGCH 4ENEC 5DWUH 1MFCH 3QQ4A 3CFIC 4R7NB 4WEBL 5ESQB 4NJ9H 1HHKB 2P1YA 5BO1L 1S9YA 5TQ2L 3QUZA 1N0LA 2GJZB 3EZ8A 4DZBA 4PJFA 2BVQA 1V7NH 3WNPA 3ILPA 1Y6NR 4OV5A 4I18B 3IDMA 4JRWA 5D2NE 3V79C 3TH3T 4M02A 1S5HA 2VAAA 3QNZA 3QQ3A 5D70H 3T2OA 4X99A 4HFWA 5I66B 4FXKA 1JP5A 4O2CB 3D3VA 1QZ1A 1MQ8A 3BZ4A 3Q3GB 5F9AC 3R0MA 2ZG1A 4G9FD 3NH7H 25C8H 4L1HA 1P84J 5EOCL 3U30B 2ZJSH 4YPGB 2EIDA 4AY0A 5D7SL 4X8XA 4YEFA 3BZFA 3DWTA 1FH5H 1U9KA 1UQSA 2NW2A 4NUGH 1UACH 5E8PB 4C56A 1W8OA 2XT1B 4JGJA 3HE6B 4GUPB 4HC1A 1P69B 1XF4B 1ZHLA 3NACH 1FL5A 2J8HA 4ZS7H 1MFDH 2VYRE 1MI5D 2XNAA 1FSKB 3JWNC 5IB3B 1MCEA 3CNKA 3DV4B 2VZ1A 4I8DA 2PYED 3SQOH 4LVEA 3VJ6B 1A6TA 3RL1B 4XVTH 4LNRA 4PBWD 4YFLI 1F6AA 2KKQA 3WUZA 1IQWH 4FQQB 1GC1C 3V52H 3FO1B 2WBJC 1LP9B 4JREB 4UTBL 3ULUH 1WF5A 2CKBH 2P7TB 1X6NA 3C08H 5GRUL 4MA3B 2E6QA 1I3VA 5HD8D 5IFHL 5F1NA 4OTXH 2M2DA 2CMRH 2QTEA 5IV2A 3O2DA 4WJ5A 4JFZH 2P4AB 3VWKC 3K7UA 3L95B 3RKDD 3IKCA 2BK8A 1RJCA 4DW2L 4KK6C 2FBJL 3EFDH 4IOFC 4P5KA 4KKBD 3MFFA 1A3RH 2X4NA 1RK0A 4YXHH 3WO3B 3NABH 3OKLA 3I3EA 1ZVHA 4C56E 1IE5A 4OUUB 3L3JB 4DTGH 3E8UL 4OGZA 4Z7NF 2BVUA 4XPAH 2V9QA 1UYWH 1WTLA 3VGBA 3VXUB 1J0ZA 4KTYA 3VH8G 4U31A 3BP4A 5FYLL 2NZ9D 4K3JH 1FV1B 3G6JF 2ARJB 5T1LB 4DUXA 1I3RA 4FS0A 1NCCH 1QVOA 5JNYB 3UDWC 2XWTA 4FQHA 1JWMA 4LDLB 1U8JA 5E7BA 3LD8C 3WEXB 4LCYA 4JPVL 4JG1L 3MRDA 1W72A 4H88L 2O5YL 3QI9D 3HE7B 2H1PH 4M48H 2YK1H 5IHBA 5ADOL 5HDQH 1YY9D 4KY1H 4L5FH 4ODWA 2Q3ZA 4NO2B 5E99H 2ILLA 4M5ZH 4EUPH 2FYYB 3C09B 4L8DA 1R24B 3HC3L 5FYJE 1F11A 3DYPA 1S8DA 1WZ1H 4JZJA 5ITFA 1C16B 3B6SB 4ODSL 1G7HB 5IVXE 5JDSA 3WFCL 3O9WB 4TNWK 1A0QL 3CCHB 4N9GB 4H8WH 12E8H 5LBSL 2ZUTA 5E5UB 5DUPL 5JORA 4M9OA 1ZLSH 1T20A 4JPKH 4X4XB 1S7VA 1FFOB 2G60L 2HH0H 3DGGB 4PYGA 1C12B 4Y4KA 2W9LA 5FYKU 3U46B 4LCCC 1KCUH 1OW0C 1RZJC 3ARFA 3TO4D 2EDLA 3HS0A 3IFLL 3OJ2C 5C07E 4WTZA 3SO3B 4XNMA 5I71C 4NKOA 5F9DC 1LD9A 2DQJH 2A6KB 4Z9KB 1M05B 1FVDB 5EN2A 1MRCH 4WW2C 4MNGB 3RX8A 3PF2A 4MMZC 4QGTA 4WFFD 2UZIL 1YC8A 4KUCD 1WWWX 4LU5H 2X1XR 5SWSD 5E56A 5F7DA 1CLZL 4B41A 5J9PA 2YRZA 1DVFD 4UTAH 3DIFA 5HD8C 1HHGA 1P2CB 2HT2D 4TUOA 3QDHA 1Q9OB 1D6EA 1CWVA 1RZKC 1N5YH 1IGJA 5LAXA 3SKNB 1UT9A 2XZZA 4ZOEA 3H9HB 3NFPA 1XGUA 3PWPD 3MJ8B 4YHZH 3GMMB 4KKBC 1UM4L 3LQZA 3GJEB 3MRPB 4ODHH 4PJHB 3F5WA 3GIVB 3NPSC 3CFDA 1J1XH 4LSTH 5F97E 2DWDA 4G8GA 3TPUB 2YPKA 1OSPL 1OQXA 4FTVE 4MAYB 5MEOA 3H7BB 5DQ9A 1EV2E 1BFSA 1GGCL 2VITA 3OGCA 4DAGH 4DWHA 4NGHL 5HVGB 4RSVA 2ICWI 3TJHD 2X1PA 2NCMA 4GJTB 4L4TD 4FFZH 3PDGA 1HH6B 4WHTA 1Q94A 5DA0B 2CUMA 5I73C 5J4MA 4X0KB 1BFVH 2FD6H 32C2B 3MLUL 2DQFA 5CSZA 4HH8A 4O58L 1X6LA 3L7FB 2AJ3A 3WFZA 1J0YA 3QI9C 1OP3H 2VAJA 5DJ0B 4XCEB 4UT9L 1UB5B 5IB2A 2OS7A 1T1XA 3BAEL 5I16A 1KN2H 2R39A 4G5ZH 1FYTB 1EHAA 2NY2D 3JWOC 1IZKA 4E0RB 1YY9C 4PFEA 5IMKB 1X4ZA 3TNMA 5LQBL 4V2BA 3MYZA 1J05B 1NLBH 2A6DA 1NCNA 4N8CH 1A1OA 5CEZD 2Z93B 3ARBA 2AQ1A 3QWOA 3KPPA 4OAWA 5DHVB 5BQ7B 4LHUG 5C0CB 2O5XL 1PX4A 1BF2A 2OL3H 1ZLUH 4HBCH 2BOCB 3VFGH 1U3YA 2NXZD 3TBVB 2JJSC 4HH9B 2C7UA 2ICEB 3VGFA 5EU4B 4Y8DC 5E5MA 5FUZL 1MCRA 2Q3AA 4I9WE 2NTFA 3TO4C 3TESA 2HRLA 3MJ6A 3UTSD 2V2WB 3I85A 3MGAA 1SMOA 1KELH 5CLTA 3RPIB 5HHQA 4M6OL 3D69A 3PP3K 1QEWA 1SYSB 3MV7D 3FB8A 3WFHB 1QSFD 4XWGL 3G5VB 1ZK9A 4CVUA 3C9NA 4Q97A 1IAOB 3CDCA 3FO2A 4AH2B 1N5AA 2AK1L 3N0PB 4L3CB 4G6ML 4RISL 2C3WA 5IWLA 4AM0A 2R8SH 1XF5A 4NNXA 2EXWD 3RX7A 1DVFC 1SY6A 3H8NA 4Q7DA 1YNLL 1N8ZB 1HI6A 2HT2C 3GJFH 2RAMA 3RWGA 4QTHB 1JNLL 1T0MB 4GMSH 2R0KH 2HRPL 2D7TL 3FMGL 4YC2C 1MF2H 3V5KB 4JCLA 5FO7A 4R4FL 5LGJA 2P8MA 4I3SL 1GPOH 3C8KB 3PNWB 5E8DL 1RZFL 4YC2B 3DVIA 4C59B 2X1OA 2FJGA 2VXTH 1BP3B 1NFIB 4K7FB 1PG7W 3UMTA 1TDQA 5EFIB 4IDJL 5LXGH 2CR3A 1FG2A 4J4PD 5KG9B 5ERWA 2KH2B 5C9JB 4YHOH 4RMQA 3BI9X 2EDXA 4U2ZA 2ICCA 4KXZH 3TJHC 2R2EB 1KPUA 1N4XH 3UJTH 2OK0H 1XGRB 4HJGA 4M00A 1OAKL 4TULL 5D1ZB 5E1AB 2YMXL 3DRTB 4AQ1B 3RVWD 3D87B 1P84K 1E0OB 5CP3A 1EFXD 1YN6A 4QGYA 1A5FH 3FQTB 4BQBA 3TNNB 3NAAL 5KSVB 3ES6A 3MYJB 3PDOA 2YWZA 3FOMA 5KSBF 4QHLB 3G5XA 4NBXB 6CGTA 2NY2C 3ZT7A 3VRIA 3PL6D 4U33A 3I84A 1HOCB 4IHOB 2Z91A 4AIXA 4KTEH 1YQVH 2ICWB 3L9RA 4KZDL 1BBDH 2NY4B 1R3LA 3OKKA 5EUOF 5FDWB 5IFAH 4NQDA 4Y1AE 1JFQL 5L6YH 1MCOL 3UYPA 2V2TB 4LCWB 4N0CD 4HPOL 3TJEL 3LS4H 2DQGL 2CKBB 4PRPE 3VWJA 1WCBB 5CBAB 4WTXA 5DFVD 4ONHA 2J5LB 4UUJB 2FEDD 3HI5H 3O3DA 5IQ7H 2NXZC 3HG1D 5FM8A 2HT3D 2X40A 5EULV 4MJIB 4NWUL 4UT7H 3VD7A 2YEZB 4OSUH 4PR5B 4YFDB 7CGTA 4Z7OF 2GITB 4P2OA 4NCDA 3ZDZF 3FCTA 2VC2H 2QSTA 2JK5A 4RFEB 3KR3L 3QZWG 3TN0D 1V05A 2IBZX 2H3NA 2AV7A 4ONFL 4XMKL 1FNGA 1GGIL 4JKKA 1JNHB 3SDYL 1J8HE 4LLAA 1X5IA 2RR3A 3MV7B 4TVSa 3BP7A 1UH3A 3ARZA 2DKUA 1A7PH 4BH7A 1KTDA 1Y6KR 4R8WH 2EXWC 3PWJA 4YHPA 1VERA 3A6OA 1A6AB 2XN9B 4Z7WE 1SJVA 4EBQL 1TCRA 2XTJE 1MHHA 3GKZA 3N1MC 5EIIB 4XB8A 3VXPA 4FQJH 4HWEL 2Y07H 3OB0H 1BD2B 4UV4H 1F4YL 1YEIH 1NUFA 5FCUL 1OAUH 4XP9L 1G7MB 3FT2B 5CUSL 3WKMH 4PJXB 1S9XA 3IDGB 1QHPA 4MGXA 5IESH 5CZXD 1Q1JL 2HFFB 5ENWA 5IGXH 3IVKB 2FJHA 2QKIB 4OGAD 3OHXB 2P47B 2WQ8A 4M7ZB 4PRNB 3RTQA 4LRNL 1DQLH 5KSUA 4J4PC 3WBDA 3ZMRA 3FT4A 1H3VA 4WEBH 5GRXG 3U2SA 4M7LL 4PJ7F 3KLAB 1SMAA 4QHMA 1UCBL 2W92A 3MRFB 3WDJA 3WFEH 4AJ0A 1FFRA 1HWGB 1K4CA 3JUYA 5DQDL 4Y16C 4D3CH 3RVWC 2BOBB 4IIQC 4F7PA 4M03A 4HUMB 4F7MB 3HCVB 1Z9LA 2X4PA 3FONB 1Q9WB 4KHXH 4F7CA 3MROB 2W0LA 5DO2D 1DBMH 3QR2A 3BN9D 1KB9K 3ZO0A 3PL6C 3S34L 5GGRB 2N56A 5FYKH 4K94C 1V7MH 5I8EA 3S8WA 1A9BA 2VZOA 1AHWC 5DGQA 5D7SH 4ZAKD 4E41B 3BW9A 1I9EA 3P0VL 4N0CC 2J88L 4Z5RA 2XY1A 1OLLA 2DD8L 5DFVC 4OZFA 3NCFB 4P23A 2FEDC 4Q6YA 3MXWL 3EO0B 1OAXL 4KXZI 3OPZH 2HT3C 2WK2A 4PP2A 2HJFA 1KUMA 4GW1B 3WS3A 5BZWB 5CEXA 5DEGB 3SDAD 2J8UB 4MDIA 5EUOA 5I1DA 4WUUD 4O00A 5IROC 4C54A 3TN0C 1YEKH 4Q0XL 3QBTB 1U8HA 3T08A 3LV3B 3BGFC 3K2UL 4UTBH 4LKCB 1VACA 2EDNA 5JOPE 5KW9L 3TC9A 3X3FH 3QISA 4POZD 4LSPL 4J6RL 1YNKL 3TN0B 5I75B 2DYPD 3LKSA 5E8OA 5IFHH 1OCWL 1RV6X 1EGJL 5IEKA 5JPMB 1J5OL 1BJ8A 1WT5C 3FFDA 4GW4B 1OL0A 4ESKA 3RZCB 4DW2H 5IK3A 1DBAH 3CGTA 2BVOA 1YMMD 1FZOB 1CQYA 1IM9D 4NN7B 1JE6A 2UYLB 5MENA 2A9ML 5L2KD 4R90L 4YX2H 4HJ0D 1KTLB 4M61A 1RZ7L 4R97C 1KT2A 3E2HB 3D48R 3FQWB 4LASL 3IDJA 2AJXL 3MRKA 3T3ME 4XMPL 2OM5A 2NY6B 4OGAC 5FYLH 2CXKA 4KTDL 4PY7B 1SBSH 4HS6B 3KPQA 4ZUVA 1ZVSA 5FGBA 1IKFL 3DYMA 5SWZA 5EA0H 1KIRA 4WWKD 2IPUG 5I15H 1ES0A 2HJLB 2UWEE 3MBEA 3NIGF 3ZHLA 4XBPA 1CFQA 1CBVH 3KPSA 3EZJB 3VXSA 2OXHA 3O2VH 3TGXA 2B1HH 4XGZA 1ZT4A 3ZHKA 1TZGL 2ITDB 2OL3B 4JHWL 3TA3B 3LKRA 5CHNA 2O5YH 1WITA 2E7LA 3QIUA 2N4IA 4OB5L 1I9IL 1PG7X 5JHDB 1Y18B 3CMOL 2I25N 4AG4L 1AE6L 3FB7B 1FPTL 3AXLA 4H1LG 3QDGB 5C0BA 4PTUB 1CXKA 5GRYA 2EH7L 4MD4B 1UJTA 5DO2C 3SCMB 3FB5A 1JBJA 5ISZB 3BN9C 3HC3H 3AFLA 4PJ7A 5FOBA 2VO5A 1D5BB 1N7ML 1SYVB 5HYSG 2YRLA 4ODSH 4IRJD 3P9MA 4QXGL 5IBLD 4HWBA 5DUBB 4KWUA 5I1AB 5H2BB 3HHRB 4YDVA 2VLRB 3N1QC 5JXAL 5MEQA 1CGYA 2X4UA 1S7WB 4D9QD 4YEEA 1D5MB 5LBSH 4ZAKC 3NFSL 4Y2DA 1FGNL 4OCXH 3ZYOA 1KCLA 2D31A 1I3GL 5HHVL 3W9EB 3M17A 1AKJD 5I8KH 5I17B 1IGYB 4FQ1L 5CP7B 3GJFB 5F3BB 2WP3T 1JNJA 3IFLH 3BWAB 5IVOA 3OQ3B 1EEYA 3KPSE 3AAZB 4LMQE 3HC0A 2DTSA 5HXMA 4JZOA 3SDAC 5JLZB 2IQAA 5FHAL 1JWSB 5HHMB 3NZHH 3HPLA 3PWLA 5L7XL 5INCA 1HILA 3JWDL 2FSEB 2MQ3A 4P5TD 2ZNXA 5D9SA 1KSRA 1OAYL 5D7JB 4POZC 5C0BE 1FO0H 4WEUD 2BNQA 3R8QA 5E5RB 3KHOA 5SX5H 3WIHA 2BC4A 4MA1C 4IEFB 1MEXL 1RZGB 2VLLA 1HKFA 4F7EA 4AEIL 3WSQL 3DVFA 2C3HA 3PXHA 5F1OB 4PJ8D 3SJVE 3MNZB 2P5WE 2AK4D 1G9EA 1BVLA 3MGOB 4OCYL 3E6HB 4WFGD 2R29L 1D5XA 1ZT7B 4HJ0C 2X7LA 3NCJL 2IF7A 3HUJB 1JHLL 5DRNA 3LEXB 5IFJB 1CTNA 1RJZB 3WIFB 3BISA 1DEEB 3SDDB 5IIEA 3HLAA 2SEBB 5HYQA 4XNYL 2W0FA 1KTKE 4NGHH 5TGBB 3BEWB 3WJJC 3F58L 2A38A 1NFDB 1U0QA 4K3GA 4WWKC 5AYUL 3HPJB 3O4LA 5DXWA 5EO1B 2WWKO 3TBYB 2EDEA 5C71A 1CXHA 5CCKL 3BEVA 4TOYL 1A4JB 4LPTA 3MLUH 3SGJA 2X5PA 4O58H 5FM5M 5KS9F 3QDME 4HQQH 5K9QG 2DL9A 3OJVC 4PJCA 4UT9H 5DJ8A 3GHBL 3BAEH 4IMLB 4ZDHA 2ADGA 2EDBA 3MRHB 4KKCD 3ELAT 2B5IC 4M8QA 3BGAA 5F21B 4NM4L 5LQBH 4E42B 4FQIH 5C0JA 1EAPB 4YPJA 3QRGH 1GGBL 1F2XK 4MD5B 4HDIA 4IRJC 1BFTA 5IBLC 3SE3A 4HGKC 4P2QB 4M43H 3DTXA 4KJPD 4EI5B 2H9GB 5J8OA 4HUXB 4HT1L 1X5JA 2JCCA 3D9AL 4Y19A 3T1WA 1H5BC 2Z31A 1CXIA 4RAUA 1MCIA 4U1MB 5FUZH 4JFDA 3UTQA 1ACYL 1EPFA 3G6DH 2EDTA 1HDMA 3KS0H 1OB1B 3MJ9A 1ZWIB 1R6VA 1AKJB 3O3AA 4OKVB 4M6OH 4S1RH 3KG5A 4K55A 3EDKA 1W0VA 4HK0B 2YPLA 5INDB 3NPZB 4XNXL 4WFED 1UKTA 4XWGH 1PLGL 4PJCE 1AH1A 2PF6A 5E2VL 4PGEB 1AD9B 1H0DB 5DJXA 2AK1H 2PCPA 2B20A 2B4CL 4G6MH 1LEIB 4DEPC 3GSOA 5TE6H 4PJ9D 2FX9H 4P5TC 5CSBA 3QNYB 5JTWA 4J12A 1FDLL 3VD9A 5ACLA 4HS3A 1UJ3B 1PKQB 2LABA 2IH1A 2EEBA 1A1MB 1YNLH 1P4IL 3FT3A 3TBWA 4AEFA 4C4KT 1NH6A 3GMPA 3UTTA 1I7ZB 4QWWD 5IQ9B 3KJ6L 2R2HA 3T1FB 4CRPA 3MLYL 3QYCA 1T0NA 4R4FH 4XX1E 4WW1A 1FFQA 3N1GC 4XHJD 4I13B 2NX5D 4I0PB 1RZFH 3SO5A 3MV9A 3P4OA 2R0LL 3DXAD 3QFJE 2FH8A 4PJ8B 1UFUA 1XF2B 1FORH 1FNEA 1G7LB 1RHHA 4MQSB 5JQ6L 3QUKB 4WTWA 4BK5A 4GG6E 4IDJH 1MHPL 4CW1B 1QA9B 4UNTA 4L8SC 4LDOB 5EDXA 2CRZA 2FECL 3IXAA 4ZUUB 5HYIA 1N59B 3OJDA 1ONQA 2IC2A 2F8OA 2VABB 3VXMA 2B2XH 1G0YR 2BVPA 2G75A 35C8L 1ERNA 3DO3A 2YMXH 3IXTA 1E28A 5E9DA 5E95B 4MNQE 2DAVA 2CRMA 2F54B 3U79A 1L0YA 1RZ8A 1KBGL 3NAAH 1B90A 4JLRA 1AQDA 1C08B 1XGQB 4R4ND 3P73A 2GCYB 4KKCC 3JVGC 5CGTA 4MX7A 2VLMD 1O5DT 1PD6A 2A83B 1JGLL 1L0XA 4NWTH 3WLBB 4L4VB 1VADA 1LEKA 3SY0B 1N6VA 4PJ5A 4U1NA 1CDCA 4HKJB 1MHEA 3TCLA 1KENH 2RJMA 4ZPTB 1JFQH 1N0XL 1J12A 4DZ8A 3SBWA 4KJPC 1NL0H 3GI9L 4DGVH 5C6PB 5KS9A 4HK3J 1IC5L 1DBBH 5T1KB 3TJEH 2DQGH 1OD9A 2EXYD 2MMXA 3OAZK 1DEDA 3LIZL 4JRXD 2R1YB 4MAUH 3G6AA 1F5WA 5J6HB 2IMMA 1DLFL 2EKSB 3BQUD 2CLZA 2H32A 1BIIA 3R8BB 2VQTA 1JGEB 2V9TA 4GT7A 3EKCA 2NNAB 1AGBB 4NWUH 1Q38A 5L8LB 3PIQA 2P8LA 4X9BA 4NHUB 4RMWA 5D8JL 1WBZB 4Y5YB 3BHBB 3EIFA 3I6LE 3KR3H 4DKDC 3RZWA 2X4OB 1T7ZA 4X6DF 2M8XA 4RGND 3CAFA 4J3XA 4RGMC 4ONFH 4XMKH 1I7RB 1GGIH 1IARB 5IVXF 4BSWB 3DUUB 4KJYA 1S9WA 4WWID 2CR6A 5EZJA 4R26L 5DMGD 4XBGB 2D7PA 4I2XB 1WFUA 3Q6GL 3JBG7 3RWCB 4EBQH 4QT5B 1L7TH 4DN3H 1NJ9A 4PJ9B 3OAYK 4JZNB 4QWWC 2PYEA 1QLFA 5I0DA 2NPLX 1F4YH 4P3CL 3KPRB 4Z76B 4JFXA 4XHJC 5HHOD 2E6PA 1NMCB 1MWAA 5GJTL 1AO7D 4EDXB 4XCFH 1YC7A 1I8IA 5EO9A 4R3SB 4HC1L 4L9LA 1MHCA 2F58L 4G9FE 3LKPA 4W6WB 5AG8A 43CAA 4GRMA 2OTWB 4N5EC 1UXWA 3UBXG 2XFXB 4HWZB 3NBNA 5CJOL 3MRNB 1T1YA 4LFHG 5DFWH 3FHQA 4DOHB 1UCBH 2WANA 3IGAA 1KJ2A 4JFOA 5MI0C 3CK0H 4XNUL 4ZD3L 5DQDH 1QUNA 3FQXB 1D6VH 1CFBA 1U6AL 1F8TL 2VDQH 3HAEG 3MLRL 4L3ED 2ENSA 4YIQA 3VFNA 1MI5E 3PWNA 2GKIA 4R4NC 1ZTXL 4CNIB 1ADQL 1PSKH 2DICA 3O2DL 4MJ5B 1LO5A 3RBGA 5BJTB 5B8CC 1G1YA 1OTUD 4U4BA 4P9ML 2PYEE 1K8IA 2UUDH 2XIDA 2IJ0C 4FXGA 4NP4L 1HHIB 1T3FB 5FYJL 2V2XB 1DDHA 1SEBB 3B9KD 4N90D 2J88H 3G6JB 3Q6FA 3V8OA 4Y5VB 1N3NB 2EXYC 1FO0B 3GRWH 5CZKA 5F9JB 2RFXA 3SKOB 1LQSR 1HINL 1CDYA 3QNXA 2YSSB 1P4BH 3BQUC 1I8KB 1ZA3B 3O8XA 3L5HA 2OI9C 2YC1A 4M6ML 1EDQA 1ORQA 2BXZA 3A0OA 5TQ0L 3KJ4B 2OSLA 3GSVB 4JFFB 1QNZL 1NGXA 2FL5B 3SGKC 1BF8A 3BIKA 4RGNC 3V0WH 4R4BA 2MSPA 3L3GB 1S7TB 4G6FD 5KW9H 3PE9A 5IMMB 5CFHA 4NSKB 2VZSA 1JUFA 3KPTA 2OJZL 3QA3A 3OSKA 3SKMA 5DMGC 1V8HA 2I9LA 1J5OH 2OJEB 3QXTA 5TDPA 1CGUA 5DI8B 1HE7A 2MCG1 3V4PL 1AXIB 1IGIH 1DE4A 2AEIT 2X4SA 5ICXB 3RGHA 3GK8H 1Z0MA 1IQDA 4AMKL 1BX2B 1EVUA 4R90H 2PTTB 5DS8A 3MLTB 3CSGA 4OQTA 3DMMB 3TVMD 1U3HA 3OKOB 1EERB 4JFYA 4KTDH 1OP5H 2FGWH 2HG5A 2ATPB 1D9KB 5C8JA 4F8TA 1GIGL 4PREB 3MMEB 3REVA 1TJGL 2VLJB 15C8L 1UZ6E 3LS5H 1I4FA 2AV1B 4HUUA 2IGFH 3S6CA 2GFBA 4JB9H 4HKBA 1TZGH 2FIKB 4JFEB 1FIGL 1KN4L 5IB4B 2UZXB 4YFEA 5E2TH 4LVOB 1YN7A 3TV3L 4YBLB 1VFBA 5D7LD 2VSCA 3SDCB 2OQJA 1VPOL 2JE8A 3KYOB 4ZXBD 4YK4C 5GS1B 1CGXA 4AG4H 1NGQL 1AE6H 5JHLL 3BXNB 4PJDA 1FPTH 4QKXB 1OGAA 3GSXA 2EH7H 5EU6D 5CILL 2ATKB 3MNWB 2G2RA 2R1XA 3WUWG 1OTUC 4L3EB 1R3IH 1UKQA 3BP6B 3IU3B 3LDBC 4JY5H 3OWEA 5F9OH 4L9DA 3CH1B 5I1KH 1KULA 3IJHB 4LIQE 2X9YA 2YBRA 3ZDXE 4I48A 4WFFE 5D1XA 1NDGA 1H8NA 3VI4E 3B9KC 5DJCA 2GJ6A 1FGNH 4K7PY 2R2BB 3S35H 2EC8A 2VDOL 4WDIB 5SWSE 4XCYA 5GGQL 3UZQA 2XWBB 4Z95L 2BXYA 1Y0LB 5EZLA 5IJVA 3ARVA 5F7NC 4FQ1H 4W6YB 3V7MA 1UVQB 4JQXA 3FO9A 2JJWA 4BSVB 1K4DA 2EEDA 4OCMC 3PWPE 1X5HA 3QDJB 5T3XH 4K8RL 5C9KA 5FGCE 2FWOB 4XVJL 2CIIB 2PXYA 5FHAH 3S96A 2CUHA 4R7DA 1MPAL 4LQFL 3SE4A 4L1DA 4BUHA 5DA4A 2IAND 1U8LB 1EXUB 4FNLL 4U7MA 4PJDE 4UAOB 4JRYB 1UXSB 3UTZB 2JIXD 2NR6D 5JW5B 2I5YL 1P7QB 4IM8A 3EO1B 4G6FB 1LGVA 4BQ6A 2BJML 4L4TE 4KMTL 4NZDA 4RIRA 3QCTL 1KJ3H 3WSQH 2ZUQC 3QT2A 4JHAH 5D71L 3SE9H 3NTCL 1CTOA 2DQEL 4Z0XA 4AEHL 4Z77A 5FGRA 5KVMC 3H9SB 5GZND 3VI3F 2DQHL 3HZVB 3BKJH 4OZHA 2DIAA 2R29H 3O3UN 5E2WL 3NCJH 1JL8A 4ZNCD 3DOSA 1JHLH 5C0GA 3B8YA 4PGDB 3CZFB 3TVMC 4NQCA 1E6OH 1OSZB 3GMNB 3QG7H 1DN0B 2EO1A 5GSRB 4APQD 1CIDA 5DK0A 2F53A 1TVHB 1CD1A 4NZTL 5IBTL 3STZB 3QEHA 3U0TA 4FQCL 2YUZA 5CEZE 4G8IA 1XFPA 4YHYB 5CCKH 3C5SB 4WUKL 5ANMA 3QHFH 4YGVA 1J11A 4JAMA 3CC5A 4PRIA 4HWUA 5C0ND 3ZYIA 1I85A 5CINH 2ZCHH 2CIKA 2ZZUT 2B8OT 4NHCL 5ACZB 1IFHL 3H42L 4HKXB 1RZIA 4KDTC 4G80A 5EPMB 3IDYB 4ZXBC 5BXFA 4NO0B 4QOKB 5GZOD 4NM4H 4J4PA 3UTSE 2XY2A 5DVOA 1BZ7A 3N9GL 1GGBH 4ACPA 4OLZL 1FP5A 1ZLUK 1S9VA 1R5WB 4HUVB 4L8CB 2E7BA 1QSFE 4F33A 1TVBA 2ERJC 2VDPL 3KDMB 5E94B 1CFSB 4JANB 3RNKB 4JVPA 3QIBB 4Y16A 1NBZA 3D9AH 2FO4B 3UXFA 1RUKL 2XACC 4ZO8A 3MRRB 2R2CA 2X05A 2R0WL 4RAHA 2CLVB 5HDLA 1YMHA 4EN3D 2F53E 1HH9B 4J1UA 3QO1A 4ZFOA 1F3DJ 2R23A 5DTFA 3JTTA 3V6OA 3U9UA 4BFGA 1YECL 1CDJA 1OHQA 3AM8A 1LE9B 4ONOA 2FNBA 4S11A 2EIBA 4U6VL 4F2MA 1AHWA 3RVXD 4XNXH 3ARPA 4BSJA 3UROR 1VFAB 3GJFK 3VG0H 1QTYT 5KSBB 3GMQB 2P5ED 4PY8I 3FRUB 4GQ9L 5AWNL 3PXJA 4HIHB 3ETBF 2X4TA 3FFCA 1LO4H 5GGVL 5BV7L 5JOFB 1REIA 3K8KA 1QSEB 3QWRD 4U05A 3C60A 2WBKA 1I9RH 1ZVYA 5IROA 3V0VA 5GZNC 5BZDA 1J10A 1T83A 5GS2H 4GO6B 4LSVL 4KFZC 2APFA 1EJOL 3LQAL 3RUGA 4YDKH 3NIDF 1A6UL 4RFNC 3P4LA 5JQ6H 2ZSVA 4MWFA 1A3LL 4PJBF 4HLZH 5I1GL 4APQC 2GY5A 1EHNA 2GTZA 2AABL 1TTUA 4ISVB 1R0AL 3ARGD 4IOSD 3PWUB 5F1SA 5GJSL 5F7MC 1FL3B 4IRSB 4LLDB 4RA0C 2BNUA 3K1DA 5JMOC 4JDZB 1DANU 2OP4L 3FB6A 3AS0A 1NCWL 4FQXA 3QH3A 2HKFL 2KL6A 4UOJA 5ESVB 5C0NC 1JF1A 4BELD 5D5ME 1GAFL 5K33A 1DBJL 3HG1E 4XVSL 5BVPH 3I75B 4X9HA 5GSVA 1YJDL 3VFTB 1DQQB 4MCZA 1QBLL 2YKLL 1V3JA 4HULB 1G9NH 4HZAA 4M62L 1T2QL 4BZ2L 1TIUA 3W9DB 2ZSWB 5GZOC 1JGLH 2HLAB 4NKMB 3DX7B 1FJ1A 2Q8BL 4H0GA 4Y7MA 1S7UA 2A73B 4LAQL 4KQ3H 4CKVX 1QR1A 5FKAA 1A2YA 3F7YB 3D39A 4FQLL 3RUGE 1XAUA 1L0QA 4R6UA 4OZIA 5L2JB 4ALAH 5T1DL 4NYLA 4PLNC 1DLFH 4GMTL 3GSRB 4ODUB 4XP6H 2HVKA 3ZE1F 3D85D 4EN3C 2XPGA 5CWSA 2DTML 2ITCA 1DQDL 3IFPA 5AUMA 3OX8B 3I6KA 4P2RD 2FJFA 3CPLB 3ROLA 1MJJA 5D8JH 5TDOA 3GSNA 3QJHB 1U8PA 3DVNB 4YHLL 4JY4A 4M6NH 4ZYKA 3QPXH 1CF8L 4MDJA 4BQ8A 3S3SA 5DJDB 3KS0J 3RVXC 4QF1B 3QUYD 3VDBA 1INDL 3AC0A 4JY6A 1IGML 4QXTA 4Z7UA 4UV7L 5FHBL 3T4AB 1T6VN 4F8QA 5D72L 4JKLA 4PV9B 3MRCB 1IBGH 3GI8H 1X4YA 2F19L 2W0PA 3EYSH 3MV8B 4JQVC 3O41A 1A4KB 4ERSH 3Q6GH 3LPGA 5HDBE 1U8QB 4DGYH 3S3PA 3D0LB 3MRIB 3L3OB 3QEQB 1PEZA 3SDAA 4YQXL 1EK3A 3O4OC 4X6FB 4JHBA 4P3CH 4AENB 1K5NB 3LN4B 4EOWL 1BECA 5ICYA 2XG4A 2V17H 4OZIE 3V6FB 2PO6D 4FABL 4ODVL 3PGDA 1XIWB 1QSZA 3AB0C 3BO8A 3VH8B 4WHYG 1WLHA 3O6FB 2YA2A 1JGUH 1VGKB 3MLXL 3RVVD 5EOTA 3IU4L 3GB7B 2F58H 1DQJB 5F7WC 5B38A 1MCPH 5T3ZD 4Y4FB 1SHMA 2QQNL 4U6YA 1JN6A 1JVKA 2N1KA 1OGTA 3ULVL 5CJOH 3T0ED 5B21A 4PJGF 2BHZA 5IB5A 5DZNA 3ARGC 2MCPL 3MACH 1IM9A 4ZD3H 4Z7UE 3VGAB 1NEZB 4WVRA 1DFBL 1JGDA 4JO2H 3B2UD 2FX8L 4I4WA 1MCBA 1F8TH 3RWIB 4DVRH 4LL9A 1RUMH 4YDJB 1LK3L 4QRRD 5B39G 1H3UA 3PQYB 3H7LA 1ADQH 4LPUA 4J3VA 4PJBA 3O2DH 5TF1H 4P4KB 4PB9L 4P9MH 1OWWA 3BPCA 2Q76B 4NP4H 1EO7A 5FYJH 2E7MA 3JWDC 1ZHKB 1A9EA 4WUUE 3D0VB 3L3DA 1S7QB 4M1CD 1TJHL 4GKSB 1WICA 1F4HA 3S4SG 4KDWA 4JPWH 3BT2L 5DJZB 1CFNA 1Q9KB 1KPRB 1IGTA 2MFNA 2I26N 5FUOH 5HHNB 4LLWA 3CX2A 4OFYD 4QRPD 1FE8L 1F4XH 2C1OB 3WDHA 1IC4L 1HINH 3QXVA 3F7PC 4QNPE 1SM3H 1TQBB 4PRHA 4RAVB 4D0DB 3RWHB 1SJHB 4NZUH 2XZCH 2LAAA 5IBUG 5TH2B 4M6MH 4V2CB 5KANG 3ZHDA 2GK0A 4OLVH 4P4RA 5HI4D 4TSCL 1YMME 1JWUB 2HTKD 1Q72L 1QNZH 5IMOB 5BS0D 5L2KE 1M7DB 4LSRL 3ARDA 4GRLB 4UI2A 1QRND 2WZPD 1QLEL 5I0ZA 3QUYC 4P46A 3OL2A 4KRPD 2BHYA 3TM6A 4MSWB 1ETZB 4WFHE 2OMBA 1CIUA 2WAHA 1ZANH 1NC2D 1FNSH 1O0VA 4ZNEA 4UOW1 2Q20A 2EIEA 3BOVA 4ZUTA 1FZKB 5JW4R 2Y36L 4X80L 1ZLWH 1WC7B 3DUSB 1GZPB 1PFCA 1BBJA 1J1PL 4DCQB 3GMOB 3LAFA 4HWBL 3UBXA 1JF6A 1EO8L 2DKSA 1JMXA 1CK0L 2CDFB 1F00I 1I7UB 3RAJH 3U1SH 4F3FB 5HVWA 3EOBB 5TE7H 2BSRB 3WXVL 2PO6C 3CFBA 2VLKB 4M93C 2P8PB 3UYRL 1KPVA 4XP5L 2ADJA 2BVYA 5IHZA 2GUOB 3CD4A 1S7SA 3QXWA 3G04A 1GIGH 3RVVC 15C8H 2BMKB 4K7PX 3W0WA 2QQLL 3EGSA 1T89C 3I6GA 3GSUA 2Y5TA 4ZSOA 5EU3B 5IG7A 43C9A 4PG9A 4D9QE 2F5BL 2C5DC 3KPOA 2BCKA 2IADB 3SKJL 3WXWH 2GAZA 3LKQB 5F3HB 2BFVH 3PHQA 3T0EB 1CT8B 3B2UC 3QUZD 5BRZA 2AKRA 3PHSA 2IBGA 1CG9A 1NGQH 2NW3B 5ALCL 1ULVA 1FRGL 5CGYD 4AQOA 3WIHL 1WFTA 4L8SA 3IB4A 1R3KB 5FO8A 4L8BB 1EBPA 4GG6F 3MCLH 1X5GA 5JPNA 3ZYZA 1ZS8A 1PG7L 2B4CC 1ZLVH 3U0WL 4PJGA 1CVRA 5DURD 2V5RA 4LHUB 4M1CC 3FTGA 4U1IA 5F89B 3VXRA 3D3VD 4YXLL 3C5JA 4WNQA 3DO7A 4Y89A 3KXFD 4YHKL 5D1QB 4NN5C 2AJVH 5GGQH 4JO4H 3REWB 3KNBB 3T77A 3CFKA 1AD0B 2APWA 4F15B 2DF3A 4X8JB 1CICB 5FA4A 2HJKB 7FABL 1A1NB 5DUMH 4H1LH 4NPYB 5J06A 3JZ7A 3UJJL 2Z8WC 3T3PE 4LLMB 5CD3B 4J8RA 4QRPB 4EIZC 4C56D 4LVNB 2C4FT 5HI4C 5FFLA 2VUYA 3IFOA 2AK4E 5T5NG 5DLML 4XVJH 1LP9F 4Y5XB 3L5XL 4N0RA 5IW1A 2HTKC 4WFGE 1B0GB 2DI7A 5C08A 2IALB 2BVTA 1ZMYA 3RWFA 4KRPC 4XP1L 1Q0XL 5LKNA 3LB6D 5FV2A 2KQMA 2BJMH 2EIZB 1NQBA 3ISWA 4ZPVB 1F58L 1HQRB 5D71H 4I5BB 1CD8A 2DQEH 5DRXB 4JM2A 1WFOA 1E4XL 1T1WB 4QHKJ 4NC1C 4WIQA 1A6ZA 4LEOB 2XI9A 2DQHH 4LCIL 4RMUA 2VSDA 4BFBD 3CU7A 2EEAA 1ZHBB 3PGCB 5E2WH 4WV1A 2NY1B 4OF6A 5GS0H 5D2NB 5DVLA 2W07A 3GFUA 2Q86A 3KPNB 3OKEB 4XC3L 3GDBA 1A02N 1MFBL 3UX9B 3Q48A 2HFGL 2ESVA 4R96B 5CZVL 4DVBA 5C0AA 4KMLB 3DI2B 2PN5A 4MJ4A 4YZFE 5IBTH 4FQCH 4XZUA 3ZT5A 5E4EB 1DANT 1YEDB 3NIFF 1NUNB 2PW2A 1Z9MA 3WUWA 3KYMB 5DRZB 2O5ZH 4MQ7A 1NBYB 3ECBA 3BPNC 4PJAA 4WUKH 4DN4L 3BJ91 3RWDA 4XC1L 4RZCB 2G5BA 1DJSA 1OD7A 3LSOB 3L3IA 1DUZB 3H42H 5GGRY 3T65A 1DUYA 3ZLQC 3QUZC 1OT1A 2YA0A 2A9NL 3DSFL 2ZCLL 3TZVB 1YY8B 4R7NA 4NBZB 5ESQA 1NBVL 3TLRA 1HHKA 5CGYC 1NSNH 2GJZA 4CU7A 3DRQA 5M94B 2D03H 1ZA6A 4FFYH 4KRMB 3WO4B 4ELME 4KPHH 2F74B 2WQRA 3CJJA 4XWOD 4WFEE 2VDPH 2BX5A 4OV5B 1XMWA 4XI5D 2MOVA 1NAMH 4DUVA 3W39B 4ZOAA 5DR5H 5I66A 2Q8AL 4QHNB 2ESVE 4IDLA 3SPVB 3Q3GA 1YYLH 3RI5F 3F12B 3V95A 2IFFL 4P57B 4WCYH 3S37X 1YECH 2ZUSA 4YPGA 3GM0A 1CLYL 3MRMA 5J12C 4JHZA 4AT6A 3QZWB 4U6VH 2P49B 4NC0B 4Y4KD 2NX5E 3P2TA 1J88A 5E8PA 2HA1A 3DXAE 3ARFD 3HE6A 2NXYC 2VH5L 1F4WL 5IEHB 4C56B 1RIUL 1H3PL 3HR5B 3P0GB 1XF4A 4WW2F 3VU2A 4FFVD 4PB0L 5I74B 4GQ9H 5AWNH 1FL5B 3VFPB 1KEMH 1ZGLP 5D7IE 2OCFD 5DSCB 3NGBB 5IB3A 3TPKA 3DV4A 5EUKB 3P3YA 1S5IL 3LB6C 2RBLA 4NFDA 4WEMB 2MPAL 3RL1A 1F02I 4PRAB 5EH1A 4LNRB 4NRZB 3C5ZB 4KK5C 3FO1A 4N8VG 4TUKL 4P5MA 1KXVC 4CMHB 1I1CA 2P7TA 4LSVH 1EHXA 4LPYA 2YD4A 4MA3A 3CXHJ 2PR4L 4KZEL 4GS7C 1TTFA 4PJIE 1A6UH 2RHEA 2D4DA 2F8VA 4XP4L 1PX3A 1U42A 1ZSDB 1WIPA 3L95A 1XZ0B 1EFQA 1RUQL 5FM4A 2ZKHL 5I1GH 2NY5L 3TP4A 4X4YB 1II4E 2RCSL 4HX1B 5E8EB 4I0KA 4G8GD 5BVJB 3NFNB 2FLBT 4OF3A 2AABH 3ORJA 5HY9B 1RK0B 4G42B 3WIIH 5IVXB 3L3JA 2VISB 5A2JH 5GJSH 2CPCA 2OP4H 3VXUA 3K4ZA 4F57L 1NCWH 4JRXE 3ZKND 2ARJA 4QRTB 1GAFH 5T1LA 1DBJH 2LTQC 3GNMH 4EDWH 5E00B 4K8RD 3QUML 2QR0A 1YJDH 3C6LB 4OIIL 5JNYA 2YKLH 1VCAA 1I3RB 3RIAK 4BZ2H 1T2QH 1D5ZB 4N1EA 1L9MA 5I19L 5C07B 1Z5LB 3MLVL 4LSSL 1JWMB 4HBQA 3WEXA 1U8JB 3BPLC 5T33L 4OM1L 3MRDB 4YR6B 3HE7A 4RGNE 4XWOC 3L7EB 4FQLH 3WKNA 4U1LB 2V7NB 4XI5C 1MWAL 1HYSD 1G6VK 2OTUA 4NO2A 2J6EA 4Q9BA 4JZJC 1GOFA 4GMTH 2NLJB 2FYYA 1BAFL 1F6FB 3Q1SH 3HMXA 1AGFB 3LH2H 1R24A 4K07A 4LARL 5EC1B 1N6UA 4QXWA 3B6SA 1DQDH 1RZKL 3TYGH 4JJHA 3O9WA 4R0LC 3CCHA 3MSPA 3SHSA 4W6XB 4WU7B 1CF8H 5HHOE 4I77L 4PG2A 2WWMD 4EI6B 1FAKT 3EBAA 4Y4KC 4CN6A 1HWHB 4O02H 3B9KA 1AO7E 1P53A 2CDGB 3ARFC 1INDH 3LKNB 3DGGA 1EEQA 1C12A 5FHBH 1J0JA 3U46A 5D72H 4FFVC 3IJSA 4NUJB 5ILTL 4FTVB 3VI4F 4KUCF 4DKEH 1S3KL 3OAUL 3HS0B 1J18A 2F19H 3D18B 4D9LL 1XGYL 4RBPH 3G9VA 4JDTH 5EBWA 2A6KA 1YDPA 2ZNWA 3VFUB 1M05A 4HS8L 1FVDA 1XCQB 5JOEA 1IRAY 2J12B 4MNGA 1CD0A 3MCKB 1UM6H 4EOWH 2YXMA 4Z7VE 3D2UB 4H0HB 4ODVH 2KQNA 1P2CA 1HHGB 4FZ8L 2Z92B 3AU1B 5KAQG 3RRQA 1MAML 3RDTB 3SKNA 3IU4H 3AMLA 3H9HA 4QCIB 5LAXB 3ZKSD 3SQBA 1T7YA 3NFPB 1OM3L 1WWBX 1XGUB 3U7AA 2YD5A 2QQNH 3GMMA 3VMPA 1I1FB 3GJEA 3WN5C 3MRPA 4PJHA 3IDNB 3GIVA 8FABB 5FUCC 2HMID 3CFDB 3TPUA 5HYJD 5JR1L 4Q6IB 1Q9LB 4N90E 1QBAA 4MAYA 5GRVL 2FX8H 4ZTPL 3ZKNC 5I8CA 4WI5A 4HIJA 2UUDK 4H1LB 1FL6A 4K8RC 1RUPL 1OT2A 2EH8L 4DQOH 5I6XC 4ONGH 3ET9F 1HH6A 2YPVH 5ACMA 4PB9H 4X7DC 4WHTB 5HYSB 4X0KA 2EDKA 4BZ1H 3CZJA 3ULUF 5EU5B 4GAYA 3EDJA 3BT2H 5DJ0A 1UB5A 4LIQL 2JB6B 4XPFH 2AEPH 4NIKB 4OQTL 5I16B 1FYTA 1YEFL 4E0RA 4D0BB 1FE8H 3HAEH 4TRPL 4GAGL 2ARJQ 1J05A 2WUBH 4NQDD 5C0RL 1G7IB 1WBXA 2DQCH 3VFSB 4P9HH 3B5HA 1G1CA 3A6CL 4HUWB 4TSCH 3BP5B 3ARBB 1D5IL 5DHVA 5BQ7A 3QWOB 4ZO9A 3W2DL 5C0CA 1JIBA 4QRSB 3EYUL 3ARRA 1C1EL 2WWMC 3C6SB 3SGDH 4FXLA 2BOCA 1RK1B 2BY3A 2QADB 3TBVA 4HH9A 2ICEA 4NM8L 4ZODA 3W82A 5EU4A 1VB9A 3ZYJA 3VXOB 1JK8A 4BQ9A 4P2OD 5E5MB 1NEUA 1JPTH 3WMSA 2HKHL 2YUWA 2V2WA 4AK1A 5HVFB 4N0UE 3F65A 2XA3A 4OD3H 4H20H 2J4WL 2JF1A 4IRZL 2K3TA 2VDLL 1HSAA 1ROWA 3X11B 2Y5EA 1MVUB 4YBQD 3QEGH 2ZOLB 4PJXF 2VN4A 1EO8H 4TVPD 1I8LA 1CK0H 1IAOA 4AH2A 3Q5YA 5HSFA 4L3CA 3EO9H 4DUWA 1N5AB 3WXVH 5D7LE 2BY0A 4MNHB 3B2VL 1L6ZA 5DYOB 3UYRH 2EDYA 4OD1L 1N8ZA 4QTHA 1AC0A 5EU6E 1GYAA 1T0MA 2O61B 5BOZG 3V5KA 3AVEA 2X4QB 3CVHH 2YHGA 1BLNB 3C8KA 3PNWA 4PBXA 1G9MH 2AGJL 5CEZL 1TPXC 1X5ZA 2F5BH 4GRWE 4Y1AB 1NAMB 5T5NF 3BKML 4YE4L 1NFIA 5TJWK 4BH8A 2HMIC 3SKJH 5IMLB 5EFIA 4PRPB 1TPXB 4TQEH 4OLEA 1SJEB 5KG9A 5C9JA 1TETL 4F7TB 1FG2B 4NZRL 1A47A 3BPOB 1RFDL 4OZ4B 2JB5L 5FK9A 1MCJA 4APQA 2XG5A 2R2EA 1CE6B 1WUNT 1D3CA 5AZ2H 1DCLA 3DGCR 1BGXL 3PWVB 3T0DA 1XGRA 1KPUB 1CD9B 3MRLB 1ZT1B 5D1ZA 5E1AA 1PG7H 3U0WH 3QIWB 5ADPL 1QLRB 1QQDA 3KYKH 3HRPA 3FQTA 3TNNA 5BV7C 5KSVA 3O81A 1FBIL 4YXLH 2IANE 4MB5A 3HZMB 5FA3B 1JTOA 3MYJA 1J8HB 2XWJB 4QHLA 4Y4HB 3AUVA 1GHFL 3EYFA 5BV7B 1K2DB 3G5XB 2VDNH 1HOCA 4IHOA 7FABH 4LSUL 3ZL4H 4LLVB 2Z91B 4XNZB 3UJJH 1BQUA 5D5MF 2Q6WB 3ZT6A 2ICWA 1RU9L 2Y1VA 4JDVB 2J8UF 3L9RB 1JRHL 4Z7WB 5FDWA 3QRFM 3LQAC 2XTJB 1RQ5A 1R3LB 2A1WL 2DMBA 3KPLB 3RGVC 5JW4N 5DRWB 4CVXB 5DLMH 4PV8B 4P23D 4FQPA 4LCWA 2CKBA 5CBAA 5KVGH 3VWJB 2GSIA 4UUJA 2XXMB 4ONHB 3HB3D 4GSDH 3BE1H 3TT1H 5CAYB 4XAKD 2H45A 3GO1L 3ULVD 2NY0B 3OJMB 4QEGA 1Q0XH 4XP1H 4X6CE 4P2OC 3CXHK 3I02B 4MJIA 3ULSB 3BZEB 2YEZA 1KC5L 3EFFB 4PR5A 4NT6B 3RA7H 2GITA 3BDBA 1EMTH 1OTSD 3V4VL 4RFEA 3SDXE 2B2XL 2JK5B 4HZLB 3BGMB 1E4XH 1FN4B 4YBQC 5DJAA 1KLFA 1JNHA 2H3NB 1TMCB 5DD1L 4MCYA 1MJ8H 4X6BB 5IUSA 2JELL 1RD6A 2QSQA 2W9EL 3I2CH 3KYAA 5K93A 4GW5B 3HNTH 4BH7B 3GGWB 4Q74A 1MFBH 5CZVH 4LRIA 1A6AA 4HXAL 2XN9A 4QHUB 4XMLL 2B1AL 4JQVA 5EIIA 5MEND 5B3NA 3QUXB 1TTGA 1BD2A 5D6CA 3VXPB 4KQ4H 2VDKL 3BRFA 3SGDI 1G7MA 3FT2A 3DPBA 5KOMC 4PJXA 3GHEH 3IDGA 2XOTA 4XCCH 4XT1C 2HFFA 2X09A 3OHXA 3IDXL 3NA4A 3DBXB 5ALBL 4O5LH 5SWZD 1CFVH 3BMWA 5T1MB 4PRNA 3M8OL 3N85H 3MBED 4EUPA 1ZE3C 5JXEA 3RTQB 3MX0A 4G6KL 5MEPB 4JQIH 4DGIL 3EOYG 3KPSD 5KSUB 2R4RL 3VXSD 5CKAA 2A9NH 4F9LC 2ZCLH 4ZOCA 1NBVH 2VE6B 5F6IB 4YHNB 3KLAA 2DL2A 3DX9B 2QHRL 3QIUD 3RIFF 3WYRA 3MRFA 2VJXA 1QKZL 1MNUL 1AJ7L 2N7BA 5BW7A 2BOBA 3V7AE 2CD0A 4KVCL 5F7EH 4F7PB 2VL5A 3WHXB 1I1YA 5J56B 1GC1H 4F7MA 4HGWB 3HCVA 1BVZA 2DLIA 4B53A 1Q9WA 2P5EE 1INEL 1MAKA 3MROA 2X4PB 1JHKL 4WI9A 4HF5H 5A16B 4POUB 2Q8AH 4NRXB 4OZGF 4ODXB 1DL7L 5J13C 5GGRA 1DP0A 3LMJL 3EDFA 2IFFH 3VXTB 4Y2DD 3W11D 5MHSE 3LOWA 1E6JL 4S2SA 1S7XB 1V3KA 5EU7C 8CGTA 3V5DB 2FEEL 3H9ZA 4E41A 5EIVA 4EXKA 3KYNA 5ICZB 4ZFFB 2XKUA 3LQMA 4P23C 3WNLA 2VH5H 4LK4A 5DHYA 2IAMB 1RIUH 3FQNB 3S98A 4PJEE 4PB0H 3HB3C 4OZFB 3D25B 3EO0A 4ZMAT 1U8MB 3ULVC 4M7KL 3AREB 3LEVL 5HVHB 5C0FB 1S5IH 1RIHL 4YHMH 4CVZB 5DEGA 4JFPB 1INQB 3WS3B 2XQBL 4QNPF 1U58B 2UWEB 2WNGA 1OTSC 3L3HB 2BNQD 4TUKH 3LV3A 4MZ2A 3F8UB 5DK3A 2DQIL 3T2NL 4LKCA 3TIDB 1BPVA 1FNAA 3HUJF 1UADC 3KAAA 5F1IB 3EUUA 4HK3N 2PR4H 2ZOKB 5JPMA 2R56L 2DBLH 1AI1L 5IJKA 1I1AB 1HN1A 4GW4A 5L9DL 1F3RB 3FFDB 3EDDA 1PW3A 3FQUB 1RUQH 4LP4A 3RZCA 1XCTB 2ZKHH 3EYQD 2RCSH 2VDMH 3GSQB 3NCBB 1A7RL 2UYLA 1KCVH 1FZMB 1CLOH 4UDUB 1I9JL 3FQWA 1KT2B 1WBYA 2OR8A 3MXVH 2ICES 1CLCA 3FAWA 4PY7A 5A3ID 4HS6A 1LEGB 1AQKL 3HAEB 4BM7A 5JW4Q 3T8XB 4JR9H 1UWXH 3MBEC 3O4LD 4ZUVB 1ZVSB 3QUMH 5HPMB 4NO3A 4OIIH 1RZJH 4G43B 3PUCA 5D2LA 1EHLH 5DD5L 3DLQR 1KIRB 1BQHA 4P2RE 1E4XI 2K7QA 4LLUB 3MLVH 4LSSH 2Q7NA 3KPSB 3QIUC 2ITDA 1U36A 5T33H 2OL3A 1ZT4B 1A6VL 4YDLC 2YD3A 2AEQH 2ZG3A 5JHDA 1Y18A 4PYHA 1AGEA 1VGEL 4ZTOH 4HCRL 1T21A 3FB7A 4P3DB 1F3JB 3QDGA 1CGSL 3HRZB 4PTUA 1YPZA 1JYNA 3D6GA 4JFQB 4MD4A 3SCMA 3I9GH 5C0BB 5LGKA 1MUJB 1GXEA 5ISZA 2VR4A 2C1PB 4ELKB 1D5BA 5E8NA 1SYVA 4JKWA 1RZKH 5KAQF 5I18L 5DUBA 4Y2DC 3W11C 5I1AA 4K71C 2Z8VC 4Y19D 5H2BA 2VLRA 4A2LA 2Z31D 4YGAB 1S7WA 1LO3L 4OLUH 3SJVB 5MEQB 5E6IB 2P5WB 3DETD 4JFDD 2ADFH 1HXMB 5JMRA 3T0XA 4OGYL 3W9EA 4U6TA 4CGTA 2D31B 4XPHL 3EJYD 3GKWL 1LILA 5EORL 5I17A 2D9CA 1J86A 1LDPL 2ZUYA 2D0GA 3MFGB 3GJFA 3QAZB 5F3BA 4NN6C 1NGPL 3BWAA 2C3VB 5D2LE 3OAUH 4X4MA 2YPLD 5HJ3A 5I1HL 3AAZA 5T3ZE 1EEYB 3HC0B 3CVHB 1EZVX 4XCNB 3O3EB 5JLZA 3VG9C 4RMRA 5MP6H 1JWSA 1CZ8L 4IOIB 4KK9D 3LRSB 3PWLB 3PABB 5INCB 2FSEA 2EYTB 5D7JA 3UTTD 5D96B 1YPZE 3QDMB 4U3CA 3TH4T 4QRRE 3JWOH 3QCUL 4NKDA 3Q5OA 2VLLB 3T2PA 4Z8FH 2H6PB 4F7EB 3MV9D 1OM3H 2B7DT 3MNZA 1EEZB 4N0YL 4UINH 3VD4A 1KB5A 3EYQC 3MGOA 5BCAA 3BYYA 4M1DL 4BFEA 1DSFH 3E6HA 1ZT7A 4NJAL 4YBHA 3PV7A 1SJXA 1OOAA 3WIFA 5KN5B 3MGTB 1DEEA 4GAFB 4XRCB 3SDDA 1KNOB 4ZTPH 5KSAB 5IIEB 5A3IC 3LRHA 1IGFH 3M07A 3VXMD 2ORBL 1K85A 5TGBA 3BEWA 1HNGA 1GRWA 1BJMA 1NFDA 1RUPH 2EH8H 4LLQB 3I6LD 4M5YL 5E9DD 3SGJC 3HPJA 5EO1A 3TBYA 3O45B 1F4AA 2CXGA 1A4JA 5JIPA 1BJ1H 1JTTA 1ZEAL 5BS0E 1XT5A 4UIMB 1QRNE 3UC0L 1Q8MA 4RDQG 4LIQH 3BKYL 4PJCB 4IMLA 4PGCA 3MRHA 3X13B 1G7QA 1Q0YL 1XF3B 4WHDA 4PJ5D 4E42A 4B7IA 4GAGH 3S88L 1EAPA 4OLYL 5C0RH 2KBGA 3SE3C 1P1ZB 3QHZL 3LEYL 3FRPG 4UQ3B 3BD3A 1OAZL 2R15A 1JZ7A 3LKOB 4MD5A 1MRDH 4NRYB 3HZKB 5HGBB 5DJ2B 4NC1E 4P2QA 4NCC2 3WNKA 5IHUL 4EI5A 2H9GA 5DK2A 2Z31C 4NNYB 1U8NA 4HUXA 1MCDA 3DETC 2WV3A 1VHPA 1CXFA 3QFJB 3CFEB 4ELMF 3GMRA 2VZTA 3EJYC 4U1MA 4RAUB 3KXFA 1IT9L 3OKDB 1ZLWK 3PJSB 4RFOL 1C5DB 4GG6B 1NDMB 1HDMB 2XA8L 4LQ1A 4OKVA 3O3AB 2VXQL 4HK0A 5INDA 1JPSL 1MREL 4KHTL 1MIEL 2FDBP 4KK9C 1J0KA 4PGEA 1AD9A 1H0DA 3SE8H 3PGFL 1MJUH 4MNQB 1LEIA 1UENA 5F8QC 3RY6C 5ETUB 3UCRA 3QNYA 1TJIH 3NZ8A 1UJ3A 1PKQA 4OD1H 1A1MA 1LMKA 4PJFE 4UDTB 5GISL 3SN6N 4KROD 5F71A 1I7ZA 5IQ9A 3T1FA 4JGMA 5EIQA 1ZOXA 2R2HB 2A6IB 5C3LD 4LGRB 1FG9C 3TIEA 2E9JA 3HZYB 4I0PA 2AGJH 5CEZH 2I07B 1RPQA 3D3VE 3JV5A 2WBJB 1U95B 3HFMH 4YE4H 3DV6B 1XF2A 1AGCB 1K9TA 1G7LA 3KXFE 2YN3A 3QUKA 2KPNA 1QOKA 3P77B 4CW1A 2IPUK 1QA9A 5F7HA 4U0RC 3OF6A 4K7PL 2ZWLT 2DM4A 1GGUA 1RFDH 4KJWD 4ZUUA 3M45A 4PJIF 1N59A 3VWKB 4BZYA 4XXCA 3T0BA 2MHAA 1ONQB 5IM7B 4LF3B 1BGXH 3S7GA 3TCXA 3VFRA 4X6EB 5AG9A 1FGVH 1PVHA 1KOAA 2P45B 2F54A 5T5FL 1E28B 5ADPH 4OBSA 1BHGA 5GHWL 4OCSL 1AY1L 1BQSA 3RPKA 1SEQL 3RU8H 5LWYL 2FO1A 3V5HB 1C08A 4KKAC 2ZPKL 4DFIA 4TTGA 1AQDB 3UTPD 2GCYA 4F9PA 4UILL 2HWZL 1GHFH 2I27N 1NC4A 3MUJA 2DQDL 2ZCKL 4LSUH 1S7RB 2A83A 1LWRA 3IS1X 3MOAH 3WLBA 4L4VA 3BKCL 3SBWC 3SY0A 1M7XA 1LEKB 4ETQB 5H8DA 4HKJA 1TZIA 1NEZG 3AY4C 4D8PB 4ZPTA 1MHEB 2DQTL 3LD8B 1WZMA 4IBLT 5IHLB 1ZGLM 4C57C 4KRNA 5T1KA 4H5SB 1OPGL 3RWJB 3VFMA 1W8NA 2FBOJ 1A14L 2R1YA 4P0DA 1MLBA 5J6HA 2WM0A 3O8XD 4WU5B 2NY5C 2EKSA 3G6AB 2E3VA 2CLZB 1JGEA 3MRJB 2NNAA 1AGBA 3TF7C 1KC5H 4NHUA 3EYVB 3CDYA 1WBZA 4G9FB 5J57B 4Y5YA 3KLSA 5DMIL 3V4VH 2F8XC 2MKWA 4R0LA 2X4OA 5J7CC 3A67H 1RUAH 1TCMA 4WI2A 2WIMA 1KB9J 2K9UA 3ZDYF 4BSWA 5EZIL 5DD1H 1TQCC 4OI7A 3DUUA 2W1NA 2W9EH 5FXCH 4XBGA 3UAJD 1ED3B 4RGOH 1TNNA 3QUMB 4MHHG 2UVEA 1XEDA 1T2JA 4LCCB 4P59L 5CJQH 1MI5B 3RWCA 1QBML 4G8EB 4NQXA 4QT5A 3UEZA 2B1AH 4KROC 4JZNA 1BEYH 4LVHC 4XAWH 1BVKB 5I71B 3VW3H 3MZTA 2PYEB 1NMBL 4K94H 1WEJH 3KPRA 4Z76A 5K9OB 1U3HD 3V9FA 2FATH 4WW2B 3O6LH 4JFXB 5I1CL 1HIMH 2ZP0T 4L9LC 5C6TL 1B0WA 3OGOE 4EDXA 3NA9L 1X7QB 4R3SA 2YN5A 5EO9B 5ALBH 5DJ6B 5C86A 4OCRH 4OLXL 5E0QA 4HIEB 4G6KH 4Z7VF 5H37H 1DBKL 1NGYB 2UV3A 4X9GA 5KANI 2OTWA 3LKPB 1MFAL 2XFXA 4KJWC 4N1HB 4HWZA 3OBAA 5F6HJ 1N26A 2JJTA 3MRNA 5EWIL 1QFHA 1Z9OA 1QKZH 3WN5A 4K3DH 4JFOB 3U0PB 3FQXA 2OZ4H 4PUBH 3NPSB 1OGAD 2E27L 4WO4D 2VERN 4D2NA 4G3YH 1INEH 2F5AL 1JHKH 4ODTL 1MCCA 4CNIA 4MJ5A 2AXFB 5GGUB 1DL7H 5I2IA 2CRYA 3U4AA 5DZOA 5KVEH 5D1XD 1HHIA 1T3FA 2GJ6D 4EVNB 2V2XA 1E6JH 3GEWB 5I73B 2DIBA 5CJXA 1DDHB 2IH3A 3CUPB 4M4RA 3WNOA 3G6JA 3D5OF 3H0TB 4Y5VA 1N3NA 3QI9B 1FO0A 3MTRA 2Y72A 1OY3B 5F9JA 3SKOA 3VDCA 3CMGA 3DURB 3O8XC 4CADA 1RULL 3IETB 4JO1H 3KPMB 3S37L 1R3JA 4EKXA 1AC6A 2DQUH 1I8KA 3LEVH 4MJ6B 4UU9B 4NQSA 4YUEL 1ZA3A 2PXYD 4KI5D 1RIHH 5I1EL 2D2OA 1ORQB 3BVNB 4G8GE 5IKCB 2XQBH 3GSVA 1MQKH 4JFFA 4LDEB 5FUCE 3NCCB 2OSLB 2FL5A 5IW6B 1NGXB 4PPTA 1MRFH 3L3GA 2DQIH 1PAMA 1S7TA 5IMMA 4NSKA 1Z6JT 2HFEB 3UAJC 2IPKB 2R56H 4GKNB 2CO7B 3T4YB 1VA9A 2J6EL 4GBXC 1AI1H 2MWCA 3H3PL 3S3JA 1QPXA 5L9DH 3TO4B 5DI8A 1PYWB 5TDPB 4NQED 4A6YL 3U7YL 2BERA 1PZUB 5ICXA 5J11C 2VQ1B 2RGSA 1BX2A 4NQCD 1U3HC 4KK8D 2PTTA 4M9PA 3QXDB 4TTDD 3MLTA 4OCWL 3PP3H 4ODBD 3TYFB 1I9JH 2GHWB 3DMMA 3OKOA 2F53D 3PV6A 4HLZG 3CX5K 3U4BH 1CR9L 5SWSB 4MA8H 3IYLW 2CGRL 2ATPA 1D9KA 3SEPA 3VCLB 5B39B 1DVFB 3MMEA 3QSKB 2VLJA 4B5EA 3ZKXC 2YZ1A 3FJTA 3FN0L 3RHWK 1FVEB 1N6QL 2AV1A 4FOMA 3TO2B 3QXAB 4HKZB 3MPCA 5GRJH 4MXWH 4PRID 3LVEA 4O9HL 4W4NA 4KV5F 3PWPB 2GFBB 1OTTD 1KGCD 4JFEA 4HKBB 1J0HA 2VXUH 5IB4A 3S4SB 5FGCB 1H3WM 2G9HB 3SDCA 3TT3L 5HYJA 3KYOA 4WO4C 4GQPH 4YJZL 3IFNL 4HCRH 5GS1A 5SV4A 4J2XA 1MLCB 4LSQL 1VFOA 3BXNA 2VB5A 4GRWF 2OR9H 5IT2L 2ED9A 3QG6A 3HNSH 4LPWA 1CDGA 1IILE 2ATKA 3MNWA 2J2ZA 1JTPA 2IQ9H 5IBUB 1BZ9B 2W65B 2ED8A 3BP6A 1QFOA 3IU3A 3WS6A 4Y16D 5D1XC 4QLRA 2Y23A 4L4TB 3BH8B 3CH1A 3SGEH 3DJ9A 3IJHA 4FHBD 4S1DD 6FABH 5KVDL 2GTWB 5DJCB 4WDIA 4OGYH 5DC9B 4XPBL 1G6RL 2CKNA 2XWBA 4RBPK 1Y0LA 4XCYB 1KJMA 2H8PB 4JQXC 4TNVK 5DD0L 2VDRH 5HBBA 5F88B 1LDPH 4Y8AA 5DDHB 3RNQB 1YNTB 3TBTB 1VFUA 3BDYL 2NY2B 4HUNB 4X7SL 4P2CG 4BSVA 5I1HH 5FKPA 2PXYC 3OXSB 3QDJA 2NY7H 4KI5C 4L3AA 5L0QC 2QHLA 2FWOA 3SE4C 5IF0B 1ZGLB 3RGVA 1W0WB 2CK0L 3JTSB 1CZ8H 3RKPA 1H3XA 3FFCD 3QCVH 5HYJE 5FOJA 2HP4A 1IAMA 1U8LA 1EXUA 2EDJA 1U92B 4JRYA 3UTZA 5I76A 3B3IB 3PG2A 5J1TC 4RDQF 2NXZB 3FO0H 2R0ZL 3C60D 2BRQA 4S1QH 4U1HB 1P7QA 4K9EC 5JW3L 5ITBL 5LCVH 3UTSB 1R3HB 3R1GL 4X6CF 4N0YH 3H9SA 3HZVA 2OX5A 4M1DH 1QSFB 1YEEH 2WINB 4U1GC 4XPTL 4KK8C 4TTDC 4NDMB 2X4RA 4OV6F 3MLZL 4PGDA 1B2WL 3CZFA 5KVFL 4YHIB 1RJYB 1U2HA 4NOBA 3EOAA 4NFCA 4I3GA 2VOTA 3BX7C 4JM4H 4I1NB 1OSZA 3GMNA 3IS0X 1DN0A 5GSRA 4OUOA 4NQDE 1JNNL 2FX7L 1TVHA 4U7SA 3STZA 4M5YH 2Y06H 4FQXD 4G8IB 4PRDB 1YYMH 1I85C 2NQCA 3C5SA 3G5ZB 1OTTC 3P0YL 2XQYK 5C0IB 1ZEAH 1GOGA 3VMOA 3UC0H 3E1F1 3HN3A 2D7MA 5ACZA 3BKYH 4HKXA 3KHQA 3GMLB 4QXUL 5E4IA 1RZIB 4NO0A 1IGCL 4QOKA 4G80B 5DWUL 3VXNB 5BO1H 4Z18A 5TQ2H 4NJ9L 4F9LA 1ZV5A 1X3DA 1BZ7B 3D39D 1R5WA 4HUVA 3WNMA 4L8CA 1Z9SA 2P48B 4L29B 3W5MA 1V7NL 2W38A 5E94A 4AIOA 4F33B 5AEAA 1CFSA 4TVPE 4XVUD 1H9VA 4JANA 3QIBA 4IJ3C 2DJSA 4S1DC 5GS0C 3B9EA 4Y16B 4IIQB 2FO4A 4X5LA 2D0HA 1EFXB 5D70L 3V6OC 2NYYD 5C92A 2CLVA 1DZBA 4JN2B 3AM8C 1YMHB 3R4DA 4RFOH 5EOCH 25C8L 2R23B 5DTFB 2YD7A 4EQ3A 5CIPH 3F7QA 1M71B 3PL6B 5DC0A 2XA8H 2ZJSL 1LE9A 2VXQH 3M1BB 1TZHB 3QXUA 1FH5L 1AHWB 1HSBA 1VFAA 5DQJB 1LE5B 5EBLB 5KSBA 3GMQA 3FRUA 3PGFH 4MS8D 1P4LB 1MFDL 4M7JL 5ABDE 2V5YA 3MLSL 5JOFA 1PZ5B 4OI9A 5D5MB 5KBNC 3HG1B 3CDGB 3C60C 3F7VB 5TPWL 1QSEA 3SGEI 4YWGL 3MUY1 4FN0A