3OR7B

On the structural basis of modal gating behavior in k+channels - e71i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
molecule keywords antibody fab fragment heavy chain
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2010-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3or7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3or7B01
1KCVH 4NKOB 3U30C 1HYSD 3TNMA 4GRWF 1MCNA 2DICA 1TDQA 1KN4L 3WFDH 2Q6WA 3N9GL 1C12B 4AIZB 4GLRI 3RVVC 4JFEA 5EZOL 2C26A 4GG6A 4ERSH 3VI3F 4XWGL 1YN6A 1MFEL 1C5BL 2D7NA 3QDJD 5L2JB 1QA9B 1ND0B 5C0CB 3C5ZA 4JFYA 1CG9A 2NY3B 4OFYA 1MNUL 3ZYOA 3HG1A 4PRIE 2B20A 4KXZI 5D2NE 4QRRA 4OBRA 5TF1L 3WUWA 4L8CB 5DMKB 3P4OB 2QL1A 3QXDB 2R2HA 3JTTA 4P4KB 2W1NA 1FPTL 1SY6H 3L3KB 1H3XA 3HRZB 1X4XA 2APTA 2E5EA 4OD1L 5C07A 3D0LB 4XT1C 1KLFA 2NXYD 4NCDA 5ID1A 3G6AB 3FFCE 4JEGB 3TO4A 4OLVH 3BO8B 2W07A 5CJ8A 4YBQC 4X6CA 4EI5C 3G6DL 1G9MC 3BSZH 5C3LD 1INDH 4O2EA 3LB6C 2BSTB 4B53A 2NXZB 3MUGA 3RNQB 2HVKB 1JPTL 1S9XA 2R15A 1U3HA 4NM4L 5CSGA 1RUQL 2B1HL 4JY4B 1A3RH 4ODXB 2OK0H 1ITBB 1NCAH 4DGVH 2NLJA 3QUMB 4ZNEA 1VFUA 1UVQA 4L3CB 2GK0B 1HHKA 4XHJC 1ZHKB 2L4OA 2XNAB 5LQBH 1G6RH 3ZDZE 1MOEA 2YD3A 3WD5L 1H5BB 4WU7A 2FHCA 3HAEH 4AIZA 5IESL 2YOCA 3CVHH 5FYLE 2R69H 2CK0L 3L6FB 1WICA 4F7MB 4NUJA 4ZXBB 2IPUK 2NQCA 2V5TA 3AM8A 3HC3L 2EE2A 2ZUYA 3UROR 1MFAH 1T83C 5CBAA 2C3XA 4TUKL 3VRIB 4QRRB 3PABA 1UCBH 5DUPL 2VDKH 4APQB 3WEXA 1I7UB 3ALXA 3L5WA 2W60B 4I8DA 1A5FL 3UTSD 4TRPL 3EKCA 4QXTA 4PJFE 4TSAL 12E8H 1YEKH 3TJEH 4YDLB 4WGVB 4G5ZL 1S7TA 4PJGE 2R1XA 1MCBA 3HRPA 1Q9OB 2ATKA 4MJ5A 4PRNA 2IADA 4PG9A 4QXGL 5D5MF 1KPUA 5J56B 5E8PA 5TDNB 4PJAA 1OGAD 1T1YB 2OSLB 4K71B 1DQDH 4E41A 3NH7L 2XN9D 3FQNB 1CLZL 4BFEA 4NGHL 3TV3H 3WNNA 3K1KC 4YHOL 5IKCB 1PKOA 2F74A 4LIQE 1WBZB 3SKOA 3MV8D 1NAMH 2XWBA 2CUHA 4G6FD 5E1AB 3O6KH 4RWYH 4F3FB 3RDTA 3OG4B 1ZLVK 4UTBH 5CJQH 4RGND 2NLJB 3KVQA 1A1MA 3J7HA 4HUXB 4Y5VA 1UZ6F 3N1QC 3WLWD 3O3DB 4O9HH 1XCTB 1E4WL 1ZVYA 1L0QA 1RVFL 2ICWJ 5FYLL 2HRLA 2VDNH 3C6SB 5FGBC 4EUPB 3O2VH 2YA0A 2B39A 2V7NA 3L3DA 1FGNL 2P4AB 5TE6H 2BVPA 4X9HA 2D4FA 1LEKB 3ORJA 5C0NC 1UB5A 2PYFA 3VXRB 3HUJA 1VFBB 5B8CA 4IRJA 5C0EB 5IVZB 1DQQB 4B50A 1T6WA 2FIKB 1FC1A 4X6EA 2XTJB 4PP1D 1UJ3B 1QLEH 4BQCA 2A77L 4I1NB 4F7EA 1Q9OA 1TVDA 4MJ5B 5J4MA 3F7VB 5DZOA 4WCYH 5TDNA 1QACA 3EJJX 1NGYB 2AP2A 4RNRB 3RNKB 3SGDH 1T1YA 3IDUA 4ZQKA 3DRQB 5DO2D 5F7YC 3C6LB 4ZPTA 2CDFB 4P2RA 1JCKA 3QDMA 2VITA 4F33A 5IKCA 4OCNC 1BZ7A 5AEAA 3BESR 4KRMB 3V6OA 1EZVY 2HT2D 3SKOB 4AH2B 1R5VA 1HDMB 3IETA 2JK5A 2LU3A 2VYRE 2BNRD 3RU8H 1P69B 5KOVC 4E5XA 1WIUA 2DLHA 2A9NH 1AHWA 3CMOH 1S7RB 5I19H 1KIUA 3WS3B 3FFCD 4XX1E 1B6DA 4XCYA 5MHSE 1TIUA 4I18C 3V0VA 3EAKA 4H1LB 2GTWA 3R06B 4G8IB 4Z7WB 1CICB 1A6UH 2NY6C 3N1GC 3O3DA 1OSZB 4C58B 5B3NA 4EUPA 3NIGE 3CPLB 1OM3H 1PSKH 4NHUA 3QCVH 3M8OH 3U0TB 1EHNA 2NY1C 4H88L 3KNBB 4NYLA 4MWFA 1NCWH 4BQ9A 3W39B 5CD3B 5FO8B 3FOLB 4MB5A 1XIWC 3U0PB 3FL7A 1R3IH 3KHOA 1ROWA 4RBPH 1I7TB 4CNIB 3HUJB 1XAUA 1V8HA 3SKNA 3G9VA 3H8NA 4ZO7A 1CICD 2X4UB 2JLLA 3DETD 5DYOB 2AERT 4H8WC 3V5HB 5ALCH 1J5OL 2B2XH 1UJ3A 3FQWB 5ETUA 2VDPL 3HZKB 4PTTA 2EYTA 3H3PH 4I3SL 4YFEA 5DQJB 4YAQB 3EDDA 1S9WB 3RNKA 1NGYA 2H2SC 1IC5L 5KSUA 4ZFGL 4X80H 2VXVL 1HQRB 4HUUB 4ZPTB 1QSEB 2XY1A 5F6HI 4JVWA 3U0WH 5GRJL 3T4AA 3OKOA 1GL4B 4KTEL 4M1DH 5L8LB 4QF1A 1BZ7B 1QRKA 4BZ2H 2VJXA 2GJJA 3OBAA 5GJSH 1R5VB 4N8VA 3EDFA 4X4XB 1FFPA 4HT1H 3TVMB 1ZXQA 2GW5A 2XIDA 4MNGA 4HKJA 3QDHA 5JMRA 5CMAB 3DX7A 2ENSA 4OCRH 4NJAL 4KVCL 3ILQC 3PIQA 4JRYE 3WS3A 5ERWA 3LPGA 4QTHB 1NAMB 3ZKQD 1OGAE 1YEIH 1N6UA 4P57A 1U8LB 3UTSB 3AY4C 3DX8B 4Z7WA 1XF5A 1NUNB 3DSNA 2CKBA 4JDVA 1OSZA 4AIXA 5CZVL 2D03L 2I07B 5L6YH 3T0VA 3BZFB 2FX8L 4I0PA 2VDOL 4U1GB 4U1MB 4YXLL 4ZUSA 4OLEA 3S97C 1R6VA 5HVHC 2YHGA 4AZ8A 4TVPL 3GSNA 5EU7E 3VFRA 2OL3B 5CUSL 4FOMA 3KLAB 1BFVH 3MLRL 4I77L 1P2CB 1MHHA 4ZD3H 3PP3K 5IMLB 5F9WC 3TYFA 5DYOA 3QA3B 1IE5A 1OT2A 1OTTC 2HG5B 1RULL 3D9AL 3V5HA 2VLJD 5KVEH 2IBBA 4W6XB 2AEQL 2F5BH 3UJJL 1EUTA 4G9FD 3KXFD 3R1GL 1N0LA 3ILPA 4RDQF 5IQ9B 4Q0XL 1K5NB 3GRWL 4OCXH 4Z7UE 4OCLC 3MCKA 2WAHA 4WEMB 2UVFA 2OX5A 4OLZH 4AMKL 1AY1L 2AEPL 3QJFA 4G8EB 3MRJA 5I8KH 1S5HB 2AV1A 2BZDA 1F3DJ 5CJ5A 5JIHA 4N8PA 1U8JA 2O61A 5D2NC 2VLJE 2NXYB 1QVOA 3MFFB 3MV9D 3ARBB 3IVKB 3ARGB 5CBEB 4P57B 2A9ML 1U8LA 5T3ZE 1DSFH 4LKCB 2DJSA 5DJ8B 2CKBB 2I07A 1H0DB 3MJ7A 2AJUL 4HUVB 4PRPD 3BZFA 1EO7A 1O0VA 4R2GD 1A3RL 1SYSA 2FEEL 4P9HC 4N9OB 4LBEB 1JK8B 1S7UA 1F00I 5M7QA 3V6ZA 3QQ9C 5BV7L 3MXWL 1KJMB 3S3PA 3QDJA 1CFTB 2NY0D 3DGGA 3JWDH 4BK4A 1Y0LA 2W0KA 3HCVA 3G9AB 3I02B 1ORQA 3BP6B 3MLWL 4CVWA 3HPLB 3WN5C 5IFHL 4JO2L 4XCNB 4XTRD 3I3DA 2EYRB 3RQ3A 5FOBB 4M4PA 3KPPB 3OB8A 2E7HA 4PGZA 2I5YH 2YK1L 1DJSA 1FG2B 2YN5A 3EIFA 4X6DA 5CP3H 3VD7A 2AABH 5IQ9A 4M3KB 1R5IA 4GO6B 1YUHA 3FB7A 3GMQA 3HR5B 1RFDH 4FFVC 1Q38A 2GJ6E 5HYJD 3QJFB 2A73B 3I6KA 2C7UA 4KI5C 3WFDL 4D0BB 1I8MA 5HI5D 4FQLH 1IKFH 1GJIA 5C0BA 5C0GA 3HA0A 1SM3H 4HJGB 1OP3H 1J0JA 2UY6A 1KTLB 3ARGA 4Y4HA 3QIBD 4KKLD 4H5SB 4N1EA 3WKNA 2R1YA 3OAUH 4NHCH 3B9KB 3ARDC 4OZIA 5I8OL 1LO3L 5HHOE 3IYLW 3SKMB 5EBGA 1GHFH 1SYSB 3RHWF 1XGPA 3CC5B 4JQXA 3UCRA 3ULVF 5J89A 1ZT7A 2RBLA 5D6DC 2YRLA 4OV6F 1ZT4B 5F3BB 3RIFF 4U1SB 1DBKL 2QV2A 4WW2C 4Z8FL 5CP3A 1A8JH 5E8NB 4U1IA 1TCRA 3BGFB 4M48H 3QUZC 4HS3A 3SOBH 3HCVB 3SDXA 1S3KH 4PJEB 5D7SL 1NLDH 5J1TC 3LMJL 5DJ6B 4KZDH 1NH6A 1DTUA 1U8MB 3OWEA 5EC2B 5FUCC 2EZ0C 4PJ8B 3T1FA 1N5YH 5SWSB 3WXVH 1KB5A 3S35L 1WZ1H 4KTYA 2ZUXA 3CFCH 3QDJE 3PWVA 4WWKC 4Y1AD 3ARGD 2DQCH 4L8SB 3HE6B 1MREH 4GXVH 1BZQK 1PVHA 1H9VA 3IFNH 3GMQB 4MA1B 4DQOL 4M1CC 5F72S 4NZRH 4LRIC 3I6KB 4PJFF 4CKVX 4PJGF 4KKBC 5TF1H 4JY6B 3KPNA 3KPRE 4WV1B 5HDBF 5B38B 1QKZL 4GW5A 1P5VA 1ZS8B 1G0YR 3G6JB 3MLYL 3QEUB 4IMLA 4Y0GA 1LNUB 3X13B 5H35B 5DJYB 4DGVL 4OZIB 3H9SD 4M7JL 4MSWA 5ILTH 4JLRA 1CGXA 1QFPA 5J0BA 3MO1A 4LK4A 5FYJD 2BK8A 4QT5A 4J7RA 2AI0H 3MRIB 2FJHA 1ZT4A 2GSGB 2X9WA 3WL9A 1QBAA 3IAQA 5HJ3A 2EH7H 1AXSB 3CCHA 1NMCC 1U95A 3OTTA 1S9YB 3DHMA 4HX1A 4J12A 4MS8C 2G5BB 1DDHA 4TN9A 1YPZB 2OI9C 3T04D 2VZ1A 2NY1D 3KYKH 3EYVA 4Y16D 4ZSOB 4Q9BA 5LAXA 3O3EA 3SY0A 5IEHA 3DVNA 2L0DA 4Y5XC 5C0AE 4HUNB 1J7VR 4JREC 4F8QA 2FX7H 4Y2DB 12E8L 5D4QA 2UY7A 2VDOH 2I9LB 3O0RH 3VGEA 1NGQL 5AAWA 3IGAA 2P5WA 2ZG3A 2MFNA 1N5YL 4NRYA 1F4WL 3EOYG 2EEDA 4KK6D 1BVKB 4FZ8H 4PJDF 2JCCA 4OLYL 4X5LA 2Y07L 5C7XL 1JGLL 1NUFA 3OGOE 1KLUB 4FFWC 1J8HE 2BOCA 4PJFA 1HWHB 1QQDA 3QIWB 4WJ5B 1R3IL 2VLMD 3MLUH 3MZGB 3NIDE 4EUPG 3ROLB 3ZO0A 1BGXH 5IBUG 2DTSA 5IT2H 4NO0B 1OF2A 3OF6A 5IBLC 1EAPB 2XKNB 4G8GD 4PJIE 3PWPB 2XN9E 2NY5L 3K3QA 1HN1A 4MSWB 1CFNA 4MXWL 3O45A 5I71C 3HMXL 4O51B 4QT5B 5DDHB 5FA4A 1XF1A 3MRIA 1BREA 1CLZH 5H37G 3VE0A 3GHEL 1S9KC 5C1MB 2VKXA 3NPSB 1H3PL 1AC6A 1AHWC 1S9YA 2XTJE 5FK9A 3KPQB 3MOBL 5DD6B 3KS0H 1QFUH 5FAAA 4O02H 2WQRA 2P8PB 2YD1A 1B3JA 1M05A 3MRHA 4I0PD 4QCIA 5EZLA 5EG6C 1CK0L 3ZZ1A 5FYKL 5IB4A 5C0JA 5J9PA 3DMMD 4OM1L 4YHIA 1DVFD 4IRJC 5HHVL 4MVBD 5H8DA 4NFCA 1AE6H 4Y2DA 3VXTA 3SJVA 5SWZA 2XZZA 4JKPH 3N85H 1RULH 4ELMA 1DQMH 1DQJA 1GOFA 5CP7A 4X4MA 1UB6B 4P3CL 2KUTA 5C2BH 1OT1A 1W72H 1NEUA 3KYAA 3ETBF 4PJFB 2XZCH 4WJ5A 4X0KA 3UTTB 2DM2A 3ROLA 3BDXA 1RD6A 5E2TL 4LSUH 5KANI 1FAKT 1XF4A 1PEWA 4AT6B 1MCFA 2XXMB 4M6MH 2IANA 5J11B 1OF2B 4QNPF 3O45B 4NQDE 2X1PA 3OXRA 3MRMA 1RV6X 1KCVL 5AWNL 5CJQL 5LBSL 1FYTA 1U8QB 1YJDL 1PQZA 2BC4B 1JRHI 5FM4A 4AL8L 2VXQL 4ZOCA 3WLBA 2XWJA 1S9VB 3ZTJG 1CLCA 3CSYB 1GGYA 3BD3A 3BDBA 4PLOB 2P7TA 5LXGL 3HG1E 3HMXH 1ZEAL 4NZTL 1RZJH 3WNLA 1GZQA 4UNUA 1M05B 3PDGA 3U46A 4M93C 4OFVA 1JGUH 1WFUA 2A6IB 4XPBL 1SVZA 4I18A 3FO1B 1MIMH 2MHAA 4U6VL 3NTCH 5F97E 3HC0B 2J8HA 1BWWA 4NWTL 3EYOA 4KK5D 1K4CA 4N0YH 3O2WL 1ZVSA 1LO2L 2YZ8A 3VXTB 4UBDD 3FFCA 3RPIA 4NDMA 4QNPE 6CGTA 1JZ6A 1G7IB 1F4XL 2ZOLB 4ENEC 5TQ0L 4P5TA 4X5WA 1E4WH 4FFVD 4HBCH 1BBDL 3J8F7 2HP4A 4N0CC 1KELL 3KPSD 3VMOA 1PJ9A 3JWOC 3D9AH 5GSVA 3FT2B 3JWDC 4K23H 3T2NH 5I1KH 2XN9B 1KYOJ 4X0KB 3H42H 3P73A 5CGYC 4U6HA 5C0AD 4LP4A 2ZUUA 1OGAB 4MQ7B 4L9LC 3QHFH 4DUVA 4MD4A 4GSDL 4M43L 4XC3L 3GM0A 2BMKB 3LKSB 4KV5E 4YIQA 4YHOH 1JPGA 3B5GA 1PD6A 2MNUA 4LSTL 4KRPC 5DHVH 5HDLA 3ZE1F 1EUUA 2I26N 3ELAT 4D0CB 2ICEB 3NZ8B 1LVEA 4IEFB 1E27B 1S9VA 1DCLA 4XNQA 4XH2A 4LHUA 1A02N 4ZAKB 2W9DL 4H8WL 4LOUC 3EOAB 4MJID 5B22A 4NT6A 2HJKA 3HKFA 1DN0A 3ARSA 4DGYH 3V5KA 1IGFL 1GGCH 1TJIH 4Z7WE 3T0EA 4P9HL 3FO1A 5I1EH 1IKFL 2H3NB 3W82A 3B43A 4HS6A 4HMDA 4KHXL 1DQTA 3GSQB 2AQ3A 3MRNA 4A6YL 1K4CB 1NGXA 5BXFA 4MCYB 3OAYH 4K8RC 3CFJB 4HWBH 3TJHD 4WW1B 2J1KA 4JZNA 2VL5A 5HHPA 3BOVA 4YDKL 4P5TB 1U8HA 5E03A 3PHQB 3OAZK 4EN3A 2JELL 5DTFB 5INCA 1IFHH 2VLRB 3VA6A 4F2MB 1MFEH 5DRNB 5BRZA 2ARJB 3UZEA 2FIRT 1RZ8A 2IQAA 1IGFH 3VFNA 1YZZA 1JBJA 4WI8A 3MXWH 5C0FA 4YGVB 3ARFA 1EV2E 1OOAA 1N64H 3OZ9H 2RB8A 2NXZC 2BMKA 3LKSA 5I9QB 4JFFB 5FOJA 5DD0L 3WN5A 4LDLB 4F37F 4LSSL 4LGRB 4I77H 2ICEA 3NZ8A 2YZ1A 1CE6B 3MLYH 1XF2B 2FD6H 3CDYA 1FRGL 3FCTB 3Q6FA 4G6JL 4M1DL 4TPRL 3VRJA 2XRAL 3GSXA 2GYSA 1KIRB 3QEQB 3LQZB 4NHCL 4RRPA 3V5KB 3S6CA 1ERNA 3D0VB 4XNZB 4BZ1L 4F37K 5F89A 4JY5H 3O3UN 4JO2H 3NAAL 2ESVD 1FCGA 3UO1L 3CFJA 5E4EB 2DI7A 3V7AG 2M26A 2Q7NA 4G43A 1I75A 4YDLC 1QFHA 1KGCD 1QP1A 5ENWA 2VLRA 4XGZB 3MOBH 3S88H 5BRZB 4HUWA 4MCZA 1RZ8B 2IQAB 3QXAA 2CXKA 4K71C 2XQYK 2PUQT 1G0XA 4KMLB 2F15A 3DTXA 4R7NB 4W4OA 1LP9E 3MBEC 2UZYB 2OZ4L 4M5YH 4NKDB 2ERJB 3I6GA 3TZVD 5KN5A 2D4DA 2Z35A 5C07D 4HGWB 1KFAL 4PJCE 1SEBA 5F9OH 3FO0L 3GSVA 4R26L 5C0DB 1OLLA 2Z92A 5CGMA 1RIVL 5I18L 3LDBB 2X40A 1MY7A 4PJEE 5GRXG 1INEH 1G7QA 3FCTA 1U6AL 3GMNA 4H88H 2CKNA 3FN0L 3RKDD 1UZ8A 2NX5D 5IW6B 2HVJA 5SWSE 3GGWA 3SDXF 4UDUA 3GI9L 4HQQH 3BWAA 5TDOB 3GKZA 4IDJH 4BFIB 3GMOA 3D85D 5F89B 2NR6C 4M8VA 4NP4L 1AD0A 4LVHB 4U33A 2CR6A 3SCMA 1EHAA 1TFHA 4ODBD 4HIHB 5JOPE 2H32A 5CEZD 4I3SH 1U8OA 2A74B 4JM2D 2ADFL 3DXAD 2IGFH 5ESVA 3TFKD 3MPCA 1AC0A 2RHEA 5FGSA 3VH8B 4G9DB 5GRUH 4M6NL 2WINB 3MV11 4MCZB 1YEDA 1ZLUK 1CF8H 2IH3A 1CYGA 3LQAH 5FF6B 2LE9A 1KJVA 3DTXB 1D9KA 4ZUWB 3VGAB 4HPOL 3G6JE 1ED3A 3BIAX 1FAIL 4N8VG 4DW2L 3UBXB 4DZBA 1T03L 2FBJH 4EI6A 4S0SD 3I6GB 4S2SA 4H8WH 2ZSVA 2X1WL 4PGEB 2D7TL 4Z95H 1QBLH 35C8L 1NCWL 1CXLA 4PJDE 3KJ6H 1RUPL 5IQ7H 3HUJF 5B39A 5CZKA 2Z8SA 3U7YL 2BNRE 3JV5A 1NBZB 4PJ9B 2X42A 1D3CA 3DSFL 1OAKH 3RWHB 4V1DD 2C5DC 3K4AA 1H15B 1G7QB 1QHPA 4XCFL 1B2WH 4D9QE 3GMNB 1ZAGA 3MLTA 4U6XA 2EDEA 4KXZH 2VTFA 3HZYB 1UZ8B 4X9BA 2X44D 4UDTA 4PJHB 4ZSOE 1KJ2H 3MA7A 1WZLA 4KJQD 3WIHL 2VQUA 5I8EB 3BWAB 5TDOA 5K9JL 2NY1B 4BFIA 4DW2H 4Z7NF 1WISA 3LRSA 3KPLB 1SJHA 4KAQL 4M3JA 5IB3A 3WO3B 1XIWB 2NW3B 4EQ3A 1MLBA 3BKMH 1G6VK 3RIFK 1PG7X 5I1HH 3O9WB 3FMGH 5GHWL 2DQFA 2WBJD 5IP4A 3L1OL 5C09D 3SCMB 4IMKA 4CJ0A 4OKDA 2Z31B 3P0YL 4HAFA 2DQDL 2J2ZA 1FZKB 3DV4A 4QRPE 5FUOL 4JO4L 4G8GB 5I1AB 3H9SB 2GTZA 2E7LA 5C0RH 2EKSB 4L29A 4JPIB 1KN2H 2GITB 4YZFF 2E27L 1RZJL 4EI6B 1HOCB 2CR3A 4YPGA 4QOKA 3WIFB 4C83A 1DBML 3F6LA 5L9DL 3QQNA 5IT2L 4WY7H 2X4TA 2X4PB 1MRDL 4AQOA 5I75B 1XH3B 4KJQC 1FL3B 2AJXL 3VFSB 3RWHA 4LNRA 4LDEB 1T1ZA 4PJCF 4TSBL 5DMGD 1T89A 3DURA 3LN5B 4OLYH 3P77B 2IBZX 3IDNA 5F7EH 3RL2B 4UDTB 3T65A 2WLZA 4K3DL 3MA7B 5EB9A 4KK6C 4GMTL 4PJ8D 3ARYA 3WE6B 2H45A 5IB3B 2QSCL 4K3HA 2NY4C 4GBXD 2BVUA 3JUYA 3O9WA 4P3CH 5JXEC 1JYNA 5CJOH 1F3DH 5ICYB 4K9EL 4KK9D 3VXOA 1F2XK 5E00A 2DDQH 2YUWA 3QNXB 1J10A 1HHJB 2WMPA 2Z31A 1RJZB 5LGHL 4PJ5D 2R2BA 4KJPC 1FNEA 1BPVA 4ELMF 1IGTA 2AJZA 2FEDC 4I0KA 3V4UL 3ZHKA 4P9MH 2J6EL 3G5VB 2CRMA 3KR3H 2X2YA 5E6IC 3VW3L 4FQPA 3R0MA 3AVEA 5HTSA 3Q6GH 1URLA 1U8KA 4HIJA 4WUUA 5KVGH 4BZ1H 2E8YA 2WUCH 3BEVB 1OQXA 5SWZE 4R3SA 4C83B 5CINH 5HHQA 2C3WA 4OZFH 1FG9C 2XZAL 4XRCB 1KEML 3QNZB 4R90H 2F54A 4AENB 5HYJB 2C4FU 1FIEA 2BY2A 3CXHJ 2IPTL 5I16B 4LLUB 2LAAA 1VGEL 1M7IA 2Z91A 5KSBF 1FL3A 5CSZA 1CXIA 1P7QD 5IFJB 3BUYA 2Y5EA 3K2UL 2BNQE 4PV9B 4R4BA 1KJ3L 1EJOH 1KNOA 1NDGA 2W0PA 1PDKA 1NCNA 2PTVA 1C08A 4DGYL 3LEXA 3BE1H 1MJUH 4XXCC 3S9DB 3MZTA 4F58L 3JZ7A 3U36A 5T3ZH 5ANMA 4YXKH 3PGCB 4XAKE 2NY3D 5C0CD 3GJEA 3U82B 4UV4H 1JWMA 4QHNA 1P7KA 4ISVB 2NY0B 3MRFB 5AZ2H 5ICYA 3TN0C 1XCQB 3DLQR 1DSFL 3WFZA 3A6CL 2ENYA 5HI3C 5I1JH 4AIOA 25C8L 1A4JB 4O2CB 3AROA 1INQB 1MWAL 1OTSC 1K8DA 4OD1H 3QDME 1TMCB 3QO1B 2W0FB 5AYQA 3V6OE 1EGJL 4QGYA 4WUUB 4PB0L 1G6RB 3FQUA 1B6UA 4JPVL 3F8UB 2NR6D 1A5FH 2R9HD 5IFHH 4PRHA 5E70A 3RGVC 4OGXL 3MV8E 3AREC 3G5YA 1L7IL 2FL5B 4L9LA 2YD2A 3U79A 2YSSA 3B6SA 1G7PA 2Z91B 3UC0L 4PLKD 4HKZA 4XP9L 1JF1B 3CX5J 1DQLH 1IMHC 4ZOEA 1MH5B 4XPGL 2DL2A 1A7QH 2FB4L 3KXFB 3QXTA 4G9FB 1EXUB 3BPNB 1I1CA 3NZHH 4PJ5B 2VISB 3U9PL 3NA9H 3QULB 3SKJH 2UZXB 5ACMA 1EBAA 1MQ8A 2GT9B 3SQOL 1TLKA 3QUZB 3E6HA 4DKFL 5L2JA 5CIPH 5DWUL 3IFLL 2VC2L 4MDJA 1YNKL 2B4CC 4G9FE 4LIQH 1Y6NR 2H26A 4BELD 3W0WD 5EUKB 4B5EA 2HFFA 3DX6A 3G6DH 4L8CA 1SMAA 4LHUG 3S96B 1QBML 3QI9D 2VXSH 4GJTB 3KPOA 2NY2D 1GGUA 5HVWA 1VADB 4LARL 3NN8B 1JZ8A 1XGYH 4L8SC 3BGMA 3QO1A 1KN4H 1MWAB 3FRUB 1JHLL 1D5ZB 3ZDYF 1FH5H 2IFFL 1G6RA 3FQUB 3KAAA 1J0IA 4NN5C 5HDBE 4G42A 1NLDL 1IRAY 3MNVB 4ODHH 1XR8B 4YC2B 5GPRA 3CH1B 2XA8L 3TVMD 1T20B 1G7JA 3PQYD 3U1SH 3NIFF 3WSQL 5MHSD 4PG2A 4KRPD 1PKQB 1EEUA 4P5MA 3S8WA 5I73C 2QKIB 3ZDXF 4UOW1 1JF1A 4JB9H 1QSED 4UQ2B 3QFJA 5IHUH 1NFDE 4M7LH 2XV6B 1BMGA 2OJZH 4JVPA 3B5HA 4H20H 1UVQB 3LRHA 1XMWA 3FT4A 1TZGH 4XP4H 1FNLA 1I1AD 2CMRL 1HZHH 3OJVC 1UWXK 4JGMA 5DRWA 4UOW0 4N1CA 4NQSB 3AXLB 1NUDA 5HGDB 5LWYL 5D2LE 1JF5A 5AUMB 1U3ZA 4CRPA 2M1KA 1ULVA 4GRWE 5BW7A 3PNWB 5KZCD 1KPRA 2BNQD 3TJHC 3STZB 3JWOL 2A1WH 3UTSE 1X5HA 5JLZA 4LFHD 3PABB 4XNYH 3ZE0E 4OGYH 4APQA 4JKPL 1YQVH 4UNTA 5IB5B 3SGDI 1EEYB 4OLZL 5EBWB 1VADA 4PGDA 4BSVA 1BJMA 1NJ9A 1T4KB 3SGJA 3K1DA 3GJFK 1D5XA 5T1MA 3I3BA 4O00A 4Y4KD 3FONA 4M7KH 1QSFE 1ZK9A 3CFKB 3K81A 3HNTL 1CGSH 1HH9B 1UEMA 2IH1A 3T77B 3CH1A 2MKWA 2A6JB 2Q8AL 1G7JB 3MRRB 2AK1L 4EN3C 4Y2OA 3RFZC 4Q9RL 1LDSA 3I50H 2Y6SD 1A21A 3MMEA 1QFUL 4F3FA 1RPQA 5C08B 1S7SB 5D5MA 3RDTB 1AKJA 4G8GE 3D3VB 4Y4FC 1WCBB 2GAZA 3Q5OA 1KJ2L 3S37X 3KS0J 2OR8A 2N7BA 1YC8A 4WU5A 5IMOA 1OCWH 1FIGL 4KKAD 4FQ2L 2JJUA 4ZOBA 2B1HH 2EXYC 4IHOA 5C70A 1DQDL 3IS0X 5LG1A 5F7EL 4HXAH 2PN5A 2WBJA 3ZLQC 4I0PC 4GMSL 4MD5A 4R2GC 2XQYG 2CMRH 3T08A 3STZA 1J0HA 3V6FB 1Q0YH 4EKXA 4LCWB 1YMHA 4NKMA 1RIVH 1T03H 4AG4H 3VXRA 1WBYB 2QLVB 5A3ID 1Q9WB 2ZUQB 4IRJB 5C0EA 2ZPKH 1FGVH 4YK4C 5EBWA 1NGWA 1KLGA 4ODVL 4Q58C 4ZDHA 3T09A 4S10A 4V1DA 3RA7H 1R3HB 3QFDB 1RHHB 5I66A 1A6WH 1R3JA 4PJDB 3MQIA 4RGNC 3CFKA 4Q9QL 4JFZH 4OT1H 1JUFB 2BNRB 1HH9A 4CU6A 3SE4C 1KPVB 3C6LA 3DRTA 4L3EA 1ZHLB 1D9KC 1NFDB 4P2RB 5E2UL 5T1LA 2P5EB 2R8SL 4U0RC 5BO1L 4GAJH 5BVJA 2NTFA 4HFWB 3MMEB 1MCQA 3IETB 5E8OA 3WFHB 2OK0L 1I7ZA 1AKJB 4X9GA 4HQQL 3GI9H 3FMGL 5GZNC 1TNMA 4UQ3B 4LHQB 2BSRA 4HUMB 4KTDL 1YNKH 3EW3B 1M7XA 1HZHL 4P2RE 4R0LC 3QUXB 5GS1B 1XGQA 3BSZL 5DR5L 3L5XL 5LKNA 1T2JA 4XNMA 3CVHL 4BKLB 1KJ3H 5CWSA 2ED8A 5KS9E 3LV3A 1JMZA 1FV1B 3W0WA 3HLAA 1RFDL 4PBVC 3I9GH 3U0TA 1IQDB 4DFIA 1MCOL 3KNBA 4NYLB 4MWFB 5CD3A 5D7IB 3SDYL 1ACYL 3PJSB 1RZIA 3W39A 3WIIL 2FD6L 3TH4T 3V6FA 3U0PA 5H94B 5L0QC 4ZUTA 3W5MA 1BVLB 2HKFH 2Y72A 2F8XC 2IAMA 1BD2D 4IOIB 3EUUA 4DUXA 3IF1A 1NGWB 5SX4I 3O2DA 4LSPL 1RIUH 3T2QA 1D6EA 4LQFH 3A6CH 3AGVA 3HZKA 4PTTB 2G60L 1J5OH 2UUDK 3HZMB 4YAQA 5I66B 3TESA 4JZJC 1C5DB 2E8ZA 6FABH 5FFLA 2FHFA 1IL1B 4TUOA 3DRTB 4G6FB 3BP7B 3KPSE 4LAJH 4LVNC 2CLRB 2VXUL 4QRPD 5T1LB 3RVWC 5L2KA 4M48L 2YPLB 4NWTH 3BP5B 5EBLA 1EGJH 2E7BA 2AABL 2F53A 4N8VB 1AR1D 1K9TA 3DVGA 2H6PA 1L4IA 1XFPA 4N5UA 1A9BA 2OLDA 5DZLA 1AR2A 5JPMA 1EJOL 3DX7B 4L5FL 2MMXA 1EERB 3B9AA 3OR6A 2BSRB 4QWWC 4G6ML 3VD4A 4POYA 2VLRD 3UTPE 4HCRH 5K9QI 4WUUE 2YD4A 4JHWL 3DX8A 5FKPB 1XF5B 3UTTE 3S7GA 4KV5F 3D39D 4LP5A 1MCWM 2BY0A 1JTOA 5D7IF 4JAMA 4OJFH 2HTKC 1J1XL 4J1UA 4FRWA 5IF0A 2Z0BA 1H3WM 4OTXL 1NCCL 3PJSA 4NN7B 1GPOL 3PGDA 4JKMA 5GGRB 5T1KB 4WI6A 2H2PD 1TJGL 3TN0D 1TPXC 2ATPB 2VQTA 5LGJA 1CT8B 5TPWL 3UTQA 2IAMB 4BSJA 3WJLC 3KXFE 1AQKL 1EGJA 1OD9A 2DLEA 2VLRE 3IF1B 4K7PH 2DIBA 1JNLL 1BLNB 5DWUH 5I1CL 3GIZH 3WDHA 3MROB 3H7LA 4N9GB 3RL1B 5DURB 1PG7L 5GRYA 4XWOD 3UTOA 3OJDB 1MVUA 3ILPB 4KUZL 1BQHB 3MRDA 3EO9H 2ZKHL 2YWZA 3E6FA 4NO3B 4RFNC 4CN4A 3BP5A 5EBLB 1TJGH 4URTB 3ARED 4MGXA 1QFOA 3G04A 1KULA 4PY8J 1A9BB 1S5HA 4DZ8B 3MUJA 4NQDB 4KWUA 4UBDC 3KR3L 2YD6A 2ZG1A 5I9QC 4PRID 4L8DA 5B3JE 5A3IC 3C60D 4RAVA 2Q3AA 1XGRB 1IM9A 1EO8H 1F6LL 4OZGA 5FKPA 3B2UD 3VFPB 1JPFB 5DJZB 3RTQC 3HB3D 1WWCA 1J05A 2XICA 3VXME 3NCFB 4QRUA 2DQIH 1R3LB 5A1AA 1S7UB 1C7TA 4YPJA 1J11A 2PO6C 5F21B 1RAMA 4Z76A 1WAAE 3U4BL 2W59A 3MRQB 1T0MA 2DWEB 4M6OL 4OCYL 2X70A 3RZCC 4DOHE 3TBVB 5LGJB 1Y0LB 4GBXA 1DQML 3I02A 1BIIA 4LEXH 4JANA 5JHDB 3VWJD 4OGAD 3QUYC 2EYRA 3BN3B 3QHZH 4ZFZA 1VFAB 5MEPB 3LD8B 1NBYA 2NY7H 4MX7B 2G9HA 3NFNA 4WWKD 3VU2A 2CIKB 1HCVA 3RGHA 1ZT1A 1MVUB 2CGRL 3IDMA 1P7QB 4XB8A 2VRAA 4OLUH 1ZHNB 1T0NB 2E7MA 1NCDL 4X98A 3I75B 4FZEL 1NC2B 4M7ZB 4FQQB 4HH9A 4LLVB 1ZE3C 2X9XA 4R4NC 4EEEA 1CD1A 4DVBA 2A73A 2DI8A 1OAUH 4WI2A 5K9KB 2A9MH 2LTQC 4JFDA 3HC4L 1EEZB 1QD0A 4HKBA 3UBXG 1BFVL 4EDXB 4MMZC 3MRGA 3WYRA 2WLYA 1CXEA 1JV5A 3K8LA 3KLDA 2GQHA 4Y4HB 1FN4A 1L7TH 2XACC 4M6AA 4UT7L 3VCLA 3AU1B 5CZXC 5DSCB 4QY8A 3WMSA 2R4RL 3Q3GA 4XBPA 3TO4C 3EFDH 2EDWA 2AI0L 4P4KC 1E6OL 2FWOA 3BIKB 1U42A 4OZHF 2ADIA 5CIPA 1R3LA 1MI5D 1NFDF 5D1QA 5IMKB 2AS5M 4J8RB 4U1SA 1ZANL 3M8OL 4M7LL 2CDGA 3FQRB 5KTEL 3QUKA 4LCIH 5D7KE 2OQJB 3OGCA 4U1IB 3TBVA 4JO3L 4JRXE 1LD9B 4RRPG 5FCSH 1IT9H 3HI5H 1WWAX 1F58H 2UWEE 2V7HB 4LVHC 4OB5H 4JG1H 4ZFZB 15C8H 3GHBL 3IB4A 4JO4H 3DUHA 1SY6L 1FLTX 3HNSL 3NFNB 1KB5B 5ID0B 2L7UA 3C2SA 4FFWD 4I5BB 1N7MH 2A1WL 1FGVL 1ZHNA 5JW5A 2FJGA 1I1FA 8CGTA 4X98B 1U92A 2HTKD 3I75A 3PWLA 2A2QT 4FQQA 4HH9B 3OKYA 1IEBA 3IXAB 2BHZA 3VGAC 5F88A 3QEGL 3QO0A 4KZDL 1EEZA 4G6KH 4JY6A 3KPNB 4BJLA 4FTVA 4EVNB 1JGEA 5F9DC 4B0MM 1NL0H 1J1XH 3S37L 4BUGA 5B38A 1EHXA 1D9KD 1JV5B 3TT1H 2CRIA 3ILQD 5FM5M 3CDGA 3H9HB 1BFSA 1IAOA 1ZA6A 5EORH 4HJ0C 1J8HB 4PY8I 4U2YA 1WJ3A 1P4LA 3P4NB 1VA9A 5LVEA 3K8MA 1HINH 4P3DB 3SE8L 1MFBH 4UB0H 3MLVL 4IRSD 3DXAA 2FJHB 3T0EE 2IG2L 3I84A 2JB5L 2RFXA 4JFZL 4OT1L 2CK2A 4R4FL 3ALPA 2EDXA 5GRVL 3DMMA 1Z0NA 5C09B 3SCMD 1KENL 3GMLB 3OGCB 1UM6H 2BRRH 4JFQA 4AEFA 4Z7WF 4GG6F 3KJ6L 1IGMH 1BAFL 4NQVB 1JHLH 3D85A 1YPZA 3SDDD 1F3RB 4XBEL 4XPHL 3EYVB 1G7HB 5IW1A 4GRMA 2Y9RT 5D2LA 3ZSTA 2WBKA 7FABH 3HI1A 4KRLB 3SY0B 2Z31C 2NX5A 4TQEH 4L4TD 1AGFB 5ID0A 3OKMA 4BZ2L 2J88H 3PF2A 1DP0A 5BRZE 1YYLH 4UUJB 2VZVA 1GXEA 4Z0BH 3WV0A 5FYKE 2ICWA 2DL9A 1ORSA 3PWLB 2GK2A 5K9OA 1RY7B 2P5WB 1J8HD 5BCAA 1LILA 1IEBB 5EU5B 3OMZA 2DYPA 4EOWL 1M7DB 4YEEA 5T33L 3QO0B 2J5LB 1PFCA 1WWWX 2XI9A 3VG9B 5FO7A 4UMGA 4L9DA 1XF3B 4NO5A 1YEEH 3S36H 2ARWA 1M71A 3UZVB 1UZ6E 4WDIA 4LLYB 3QUYA 3VD3A 4FA8A 3JTSA 2QQLL 2IALA 3MNZA 4H1LG 5DDHA 2MQCA 2AJUH 3DXAB 1UJ3C 5EO1B 3OKDA 2YWYA 4J6RL 2DM4A 3L5IA 5SWSD 1TETL 2ZCLH 3EFFB 4NO2A 2K3TA 1U91A 1CXFA 2P42B 3GMLA 5L9DH 2MCPH 2XWTB 3HAEG 1UH2A 3ULUL 3C87A 5JORA 5FHBL 1YYML 4XP5L 1XGUB 1DANT 3OKMB 4M00A 1OTUC 3SJVB 4UINH 4K2UH 3W0WE 4XMPL 5SWZB 3FO9B 1AQKH 1DBJH 1BBDH 5DMKA 3D25A 1CLYL 1ORSB 5GGSY 4XVUD 5K9OB 1LDPL 3MV7D 2ADGB 1CICC 5CKAA 4Y88A 1EMTL 2NNAB 3UPCA 1M7DA 3QIBB 1EBPA 4H26B 3D0LA 1NCCH 3WKML 5E94A 3ISWA 3EO9L 2K7QA 2PYEB 4ZS7L 3ARFD 3QH3B 4NQDD 2Q20A 1M71B 2YRZA 4JY5L 4P59H 1RUMH 1T21B 3THML 5EIIB 1FE8L 3KYKL 1YDPB 5HHNB 4NZTH 2OP4L 4JFPB 5D1ZA 2QEJA 3W2DH 4KKAC 4EZMA 1CDIA 3EYSH 3TBSA 3ULSA 3M17B 1H8SA 1RJLB 2O5XL 1U3HB 1SEQH 1FYTB 5EO1A 2JJSC 2BC4A 1GHFL 3RI5K 5EU3A 5EPMA 1V7ML 4M5ZH 1V05A 2AXHA 4Y19E 5CINL 5D8JH 4IM8A 4YDIH 4ZS6D 3EGSB 5TQ2H 4Z7QE 5FV2A 4DN3H 2W91A 4RISL 3OHXB 3LS4L 3O6FD 4I18B 1RUAL 1Q9KA 3EO1A 3NABL 4PRDA 3TN0B 2MHAB 3GJFA 5DD3L 2WP3T 4D9LH 1UM4L 5DLMH 3EYOB 1NAML 3MCG1 5F7WC 1B0RA 3O6MH 3S5LG 3FN9A 4NQEB 2DJUA 2DM3A 1M6OB 5J6HA 4NNYA 2ZKHH 3ZKSD 5IESH 4YHMH 3C8KA 4ZD3L 3WEXB 1HK6A 3L5WB 5EUOB 2W60A 2EDKA 5DJ0A 2EIZA 5FUZH 1EHLL 4OGYL 3QIBA 5TGBA 2C9AA 5BV7B 2VL4A 1RU9H 2VXUH 2IADB 4PG9B 3LPFA 5E94B 4U1GC 2P24B 3RY6C 2BDNL 4PJAB 3QH3A 5DJAB 2Z8VC 3BZ4B 1NFIB 3AREB 4U6TA 1N3NB 3ESVF 1FVEB 3FQNA 5D7LA 3NVQA 4QRSA 3EYUL 1YDPA 4KJPD 5HHNA 2F74B 5ACZB 1KBGH 2QQLH 4A6YB 5E1AA 1FO0A 3KPSA 4YIQB 5K9JH 2MPAL 1TZGL 2DMBA 3ME0A 4XP4L 1RJLA 4L4VE 2DQGH 3GJFH 4PJ7F 1GGBL 5CJXA 5CD5D 3LEVL 3LHPL 2R29H 1F90L 4LSTH 5HGBA 2RJMA 1T3FA 5DD5L 1KB9K 2EIBA 5E9DA 4HUXA 1E27A 2WK2A 3IS1X 4XH2B 2OP4H 5E8DH 5MENE 2E9WA 2HFGH 4QEGA 4Q97A 3PHOA 3U2SA 5I6XC 2VQ1B 3A6OA 1CXHA 4JN2B 4NT6B 1XCTA 1WT5C 2G2RA 4IIQC 3BI9X 5DJ2A 4RX4A 3UJIL 4NZDA 1A3LL 3CU7A 2HLFC 4NBZB 4DCQA 3WJJA 1KBGL 4FQ1H 1UG9A 4DEPB 5JW4R 1B0RB 1RK1A 3PP4H 2B8OT 2PO6A 4K7PX 4M61B 4NNYB 3JWDL 5C8JB 3C8KB 5HVHB 2DKUA 2VL5B 5HHPB 2FIKA 4C56E 1JPST 5HXMA 1IC4L 1NMBL 5E5RB 3ULUC 2X5PA 4X6CE 4JRYB 3MV9A 2R0LL 4CJ1A 1HH6A 2ARJA 4FMKA 4K8RD 2ZZUT 4L8BA 5DJAA 3CVHB 1N0XL 1FYHB 1N3NA 3O3AA 2CDFA 2QSVA 4XVSH 3IKKA 3QDMB 2NZ9D 1X5ZA 1F58L 4YHYC 2NCMA 3BPOC 4ONGL 4AH2A 4A6YA 3KPSB 4LSRH 4CVZA 3WN5B 3P0YH 4FQHA 4F57L 5DRZB 3B9VA 2RAMA 5BS0E 5J1AA 4Y8DC 3SDCC 1T3FB 5IMMA 3T0WA 4YHKH 1L9MA 4XP1H 1NEZG 4P49A 1E4KC 3RVXD 2B1AH 3ARQA 4I48A 4RGOH 1A64A 1JL8A 5A16B 5H2BA 4DOHB 3PHOB 5IG7A 5IGXH 3Q6FB 2GTWB 3BE1L 3R06A 1EJ6A 3V8CA 3GBML 5D2NB 3VRJB 2BY3A 1H3PH 1T7VA 3NIDF 3MLZH 5CLWA 1IVLA 4LGPB 4JFOB 3ARGC 2C3VA 1I8LA 4NHUB 4H25B 4R7DB 1RIHH 1FVCB 1IAKB 4KKBD 3VXMD 3VXMA 4JE4B 1TQCC 3B5TA 4ZUVA 1FSKC 3O81A 3K8KA 4M1CD 5MENA 1WAAA 2ADFH 3AS1A 4J3XA 1J1OH 1EEQA 1L9NA 1N8ZB 4NRXB 4YO0B 3RX7A 4WW2A 3U6RB 1MUJA 3RIAK 1FFOA 3HMWH 4LPCA 4UOJA 2XZQL 2FR4A 4U1LB 1HH6B 1YYLL 3WXVL 5KVDL 1JYWA 1N26A 4UV7L 4RDQG 1N59A 1IGCL 1RURL 4KI5E 5C08D 2D9CA 5I1LA 4WO4A 4NWUH 4QF1B 3N9GH 1Q1JL 4HXAL 5BZWB 3BWUC 3QAZB 1BQLH 4OF5A 2FH8A 4M03A 3BAEL 1ZVHA 5IB2B 5KSBE 1EFXA 5BOZG 5DRZA 4HGWA 4MNGB 5F9JA 3IRPX 1SEBB 1JI2A 5ALBH 1F6AB 4XVTH 1PKQE 2CKBH 2GKIA 5C0DA 5IMMB 3PIQB 4JFDE 4HGMA 1F11B 4JHAL 5A16A 1IGIL 5IG7B 3I9GL 1C5CL 2DOCA 2VB5A 1B4RA 1YY8B 4PGBA 1JN6B 2GHWB 5D2NA 4QRRE 4XC3H 4JKKA 1IC7H 3NCEB 3IDXH 4DGIH 1VERA 3GGWB 3I50L 4UDUB 5J6GB 4I0PB 1CIDA 2QQNL 1I3UA 3B9KC 4ZUSB 3SDDC 2ZP0T 2GUOA 4NPYB 4PJHE 5I15H 3VXMB 2YEZB 4K7PY 1MI5E 1OTUD 3VFRB 1OAQL 1AD0B 1JGVH 1MCJA 2X9YA 4AY0A 3RBGA 5D7JB 5CD5C 1MQKL 2AK4A 2D7OA 3GO1H 4YK4B 5IMLA 5JNYB 4MNQB 2R2CA 4WW2B 3U6RA 3QA3A 2APFA 2PR4H 1MLCA 1S5IH 4NQXA 3TBYB 1U8IA 3PGFL 2F8OA 2DQJH 1CZ8L 2WINA 5E9DD 2ARJQ 1K3ZA 4P99A 2H41A 4RGNB 3D3VD 5D6DA 5IFAL 1T7YA 3CUPB 5GS2D 1D9KB 4ZNEE 4XCFH 5DJCA 1G7MA 4XI5C 4WO4B 5I30L 2HFGL 4JQIL 2OMBA 3C8DA 4ONHA 5DGQA 3AMLA 5IB2A 3VXSE 1CI5A 1MQKH 1U0QA 2OI9B 1QLRB 4Y1AE 4YH6A 5BMFL 35C8H 2NY7L 5F7KC 1RUQH 1T2QH 3EZJB 4J6RH 1FQ9C 1Z5LB 1QVOB 5TE4L 5AD0B 4DAGH 2EECA 3VXUB 3FB8A 3TBWB 3IVKA 1H15A 4XMLL 2UYLA 4R0LB 4KJWD 1HSAA 4HK0A 3GUTA 3E0GA 4Y2DC 3V5DA 4PGBB 5DJ8A 2BVQA 4PD4K 1ZLUH 3QI9B 2Q1EA 1H0DA 1SEQL 3P2TA 4XAKD 5I8EA 1GRWA 3F7QA 3QIUB 1EH9A 4PRAB 4AEEA 1FFNB 3LRSB 3V6ZB 3MREA 3BKCH 1OP3K 4FMFA 1MLBB 1MHEB 3F58H 3BX7C 5BS0D 1SVCP 3PWJA 1FL5B 3V7MA 4X7FC 1OWWA 1HKFA 3O6FA 3RWIA 4Y16C 2EDNA 3HPLA 5DK2B 3VI4F 3MLSL 4LSDA 4D3CH 3OB0K 4CUCA 5IJKA 3MOAH 5HGHA 5D96C 1IGJA 4MZ3A 2JF1A 3D18B 5DEZA 4JJHA 5DGRA 4JPKL 1K8IA 3R1GH 1UM5H 1ZGLA 5C9KA 3KPRB 2JIXD 1VHPA 1B9ZA 3UPRA 2XXCB 1R5IB 2WSKA 5HPOA 1UT9A 3QEHB 1G7MB 5TQ2L 4GRLC 1FO0L 3HR5A 4YPGB 3WIFA 4ONHB 3DI3B 2JE8A 3FO0H 3AS0A 1B88A 5HPMA 3P0VH 2E3VA 3VWKB 1XH3A 4TYUA 4WFEE 1DEDA 3BQUC 4FXLA 1MELA 4M62H 1A7RL 4YX2H 1Z9LA 2OTWA 3V5DB 1OQOA 3LS5H 2R1YB 3RL2A 3ZT7A 2APXA 3IAPA 4OFIA 2HN7A 2CXGA 4LCYB 4HC1H 4PRBA 4WFGE 4XP9H 4K9EC 3FO2A 4QHUB 2VMFA 4YUEH 1XGPB 3CC5A 5TE4H 4X7SH 1DQLL 3GMRA 5GGVL 1PG7W 3MREB 4TRPH 4S0TD 4YNYB 5F3BA 3WFCL 4PS4L 5JR1H 5FO9A 5A40E 3Q6GL 1UQSB 1UWGL 4S1QH 4HT1L 4Z7NE 3VXOB 3BYYA 5F1NB 1FNSL 3O6FB 4MB4A 4HS3B 1OLZA 4UIKH 4JB9L 3UO1H 3HNVL 1E6JL 4N5EC 4YQXH 2J4WH 1P4BH 4PTUA 1IGTB 1D7FA 1AD9B 5I74B 3T1FB 3OJ2C 1U3JA 5SWSA 4D0DB 3E2HC 5I8KL 4XCEB 1J9CT 2Q8BH 2APVA 1U3HD 3L3GB 1UFUA 3H3BC 5HYEA 2JB6B 2FATL 2O5YH 4K3EL 5EOCL 3UMTA 1MCLA 5TFSL 3S5LA 4P9HH 3BPCB 1OVZA 5HHXL 2EO9A 4X9FA 1UCTA 1MEXL 3M1BA 1W0WA 1C5BH 4XZUB 1CLYH 5HPMB 3DBXA 5AWNH 3D2UD 3MRBA 4LSQH 3QCUL 1KC5H 1MJ8L 2YXMA 1LWRA 3MBED 3VJ6A 5I18H 2OJEA 4HDIB 5DJYA 3ZKXB 3UBXI 4D8PA 2HN7B 4X6FB 4MS8D 1MCDA 4LCYA 4PRBB 2EYSA 4PJBA 4TNWK 5CJOL 1FLRL 4N5ED 4YDJB 2BY1A 4QHUA 4O2FA 2FATH 4PPTA 2DN7A 4MAYA 4G80B 1X5GA 3U36B 5E7BA 5I0DA 1S7VA 3BW9B 2GSGA 1ZGLM 1J86A 1NDMA 2DQTL 2IF7A 5FO9B 4S11A 2MTPA 3CCHB 4GMTH 1UQSA 3CDFA 5CS7A 4JFED 5I1GL 3LEYH 3I2CH 1DDHB 1ZSDB 2G75A 3HS0A 4AEHL 3WHXA 3GSWA 3EYUH 5HYQA 2E7LC 1AI1H 4O2CA 4ZSOA 5I1EL 3O3EB 4HUKB 4IIQA 3MGOB 1CGTA 5IEHB 4TUJA 2X4RA 4UINL 5GRUL 4IRSA 2R4SL 3GKWL 5TJWK 3IFOB 1H3VA 2XPGB 2BCKA 2N7AA 1N2RA 3F62A 3V4UH 1QLFB 3QG7H 5DVMA 1T83A 5C0BE 5E4IA 5KVEL 3EBAA 1I1RA 3S5LB 1HHIA 4LEXL 3EHBC 4PRHB 5TH2B 1BVKA 1FC2D 3KLHD 2ID5A 2JCCB 3G5YB 3L95A 1E4JA 4EXKA 1MSPA 2FL5A 1KLUA 2RR3A 3DBXB 4X8JA 5FDWA 1FL6B 1S5IL 4Y4HC 2EIDA 3NFPB 4FQJH 3H7BA 4YBLB 1KEMH 5HHVH 2JIXA 4NO0A 2CDEB 2HTLD 3PWPA 4KY1H 2D03H 4YFLI 1UJTA 2EDDA 4NM8H 4O2FB 5JHLL 3MLUL 2OMNA 1P53A 4C4KT 4MAYB 4LSQL 5D1XB 2YUZA 3QULA 3BW9A 2AJXH 1OM3L 2C1PB 5JZ7C 4HIXH 5C2BL 5BMFH 3HUJE 4WI7A 1OCWL 5BS0A 5BJTB 4MDJB 1K6QH 3AM8C 3W2DL 2PNDA 3MRHB 2CIIA 2H26B 3A67H 1S7QB 3BUTA 2YD9A 3UYRL 5J9PB 3C5SA 4YHIB 5KS9B 1WAAF 4LSVL 5DC9B 3DV6B 2X4RB 3UX9B 4NO2B 2D7TH 3MBXH 2WUCL 4POUB 3U4EB 2BCKB 3FFDA 1XGYL 4P2QA 2F9BT 3BD5A 2M8XA 4CBPA 5J1SC 5IM7B 5FB8B 3QQ9D 4AL8H 4G42B 4NZUL 1RZGA 1BOGA 4ODVH 2H8PB 1UCBL 5DUPH 2VDNL 4S1DC 1XR8A 1TXKA 3PP4L 3UTZA 4QLRA 1F45A 1RHFA 5KVMC 5DMIL 3EDKA 3MV7E 1NKOA 4P5TC 4X8JB 4P2RD 1YEFH 5K9QG 3LQAC 5CEZE 3ARWA 4UQ2A 3BXNB 1K3IA 2CDEA 4N0UA 3UP1A 4KVNL 1FRGH 3GMMA 2FX9H 1GH7A 5AG8A 2VLKD 5D1XA 1OAYL 4GAGH 1VGEH 1CFVL 5L6YL 3ECBB 1WIPA 4DK3A 1J8KA 2DTML 5B38G 3MGTA 2DJ4A 2CRZA 2DLFH 3PNWA 4WTZA 4OF3A 3SBWA 1KPRB 5I1KL 3N1MC 4XC1L 2I60L 4OIIL 5FIEA 3RY5A 5BJTA 4KVCH 3U46B 2CIIB 1T22B 2QR0A 5EC1B 4NWUL 4KGJA 1QSZA 3QQ4A 3O8XD 5IB5A 1I9JH 4OM0H 3DV6A 1LEGB 2CUMA 4ODUB 5D93B 4LCWE 3L9RA 3ARPA 4ODSH 4OGZA 4KMQA 3FFCB 3FFDB 4IJ3B 5IEKB 1UM6L 1D5XB 2ICCA 4QHLB 4QRQB 4JFEE 1K85A 4OIBA 4UTAL 2H8PA 5C9JA 3C9NB 4J3SA 3ZDYE 3T0AA 1FZOB 4PRIA 4M1GH 3UTPD 2NY5C 3FT2A 4RAUB 1U58B 4UT6L 2XN9A 1R5WA 3V6OC 2O26U 5B4MD 4ZFFA 2VXTL 5C08A 4P2QE 1OGAA 1A7QL 1S7SA 5D5MB 1VEPA 2AXJA 2WWMC 3DX9B 4W70A 5F1SA 1ETZA 4N0UB 4U6YB 3N1FC 2MWCA 3UXFA 1OTTD 5HYSG 1HKLL 4QXWA 4JRYD 1CL7L 5EU6E 1W0YT 5IMOB 3ULUD 1H3TA 4KQ4L 4YXHL 4NQCD 3U9UA 4Z7UF 4RQQA 2R56H 2R0WH 5B3JF 2B5IC 5DXWA 4Y4FD 3I6LE 5MEND 3DJ9A 4ETQB 4HULB 2AGJL 3QZWA 3SE9H 1Y6KR 2X1QA 4E42B 4MD5B 4ZTOH 4WI9A 5K33A 2WZPD 5L8JB 4U7KA 1MPAL 4XBGB 5GSRB 5JQ6H 2FJFB 3L3OB 4BM7A 5I8OH 1WBYA 4FZEH 4HS6B 4ZS7H 4KK5C 2J7LA 5I76B 4NM4H 2W65A 2X4SB 4ODUA 3JWOH 3B8YA 4U49A 3T0XA 5BXFB 1AGEB 4PJ9C 4JDZB 1E6JH 3DNKA 1AGCB 3Q2CA 4GH7B 4JHBA 3RWFB 1XR9B 4EI5B 1MAML 3PHQA 3SO5A 4LDOB 3QIBC 3MRKA 1EFXD 4KKLC 4TULL 5DTFA 3LMJH 2E6JA 3QBTB 2V2TB 5F7LB 4L3EB 1ZTXH 3RX8A 3CSPA 5IJVA 3NCBB 2FX7L 5IBTH 4PRIB 4O02L 4XP5H 4RAUA 5BVJB 1U58A 2NTFB 4KUZH 2VLLA 4RMQA 3VFUA 2DQEH 4WFFE 3IDXL 1I7ZB 3PV7A 3BKYL 1ETZB 3SCMC 3VGHA 1ACYH 3WIIH 3HE7D 3IJSB 5T5FH 1OGTA 3CZJA 2NYYD 3RX5A 1LK3H 3P4MA 4JFFA 1JZ4A 2LFGA 43CAB 4R8WL 5AZEL 2VNCA 1OB1B 1A2YA 3QUXA 3SGEI 4KK9C 3U9UB 4QXUH 2ED7A 4Q2ZB 4XNMB 1CE6A 4ZXBC 1AXTL 1FV1A 1XF2A 1AGDA 4PJXF 4ETQA 2GEEA 5GGSB 4NSKB 1IGYB 3TM6A 4UILL 3GSRA 3W9DA 3M45A 1T2QL 4NKIH 3QUML 2IAMD 2DRUA 5H94A 3QEQA 1DUZA 4XBGA 5GSRA 4LVOB 2DBJA 3HHRB 4RX4D 2FGZA 5ADOH 3V79C 3Q1SH 3RUGA 5T1KD 5I76A 4L4TE 4RFOL 4J2XA 5AZEH 3P0GB 4P2OB 2EDLA 3LEYL 4ZAKD 1GC1H 3GSOB 3RUGF 3SE4A 3OPZL 3P0VL 3VXNB 1P6FA 5C0RL 3OG6B 3RWFA 3NCYS 3CLEL 3MLRH 1C5DA 4YE4H 3O9WC 1BBJA 3MRKB 4UIMA 3EJYD 4ZPVA 4TUOB 2F5AH 2V2TA 3QDAA 4PBXA 1KCRL 4AQ1B 2VUYA 4XVJL 3BP7A 1ZEAH 3GKWH 1AJ7L 5A2KH 2N1KA 2B4CH 2VWEE 2WBJC 3CXDH 1R24B 3BHBB 3VFUB 1GOGA 4RGNE 2YXFA 3CZFA 3EYQC 2AV7B 4AEHH 4U1NB 2R39A 4WHTB 4PLNC 5KN5B 2QSTA 43CAA 1A3LH 2MQ0A 5C86A 3W11C 2PYEE 3LS5L 1A2YB 2VE6B 5DJXB 5E2TH 4JN1H 4HWEH 2DQTH 4N8CH 3NCJL 4XB7A 5DVNA 1MCCA 1QHOA 1F2QA 2VDRH 4JAMB 5CEXB 2QSCH 2BJML 3TYGL 5GGSA 4ZTOL 3O4LE 3KYMA 4MQXC 2QHLA 1CD0A 3GSRB 5I75C 4PJXA 1YY9D 2YRPA 5GGRA 1VENA 2DQUL 1JIBA 3H42L 1DUZB 4RZCB 4ELME 4GAFB 5I2IB 2QJDA 3S37H 3T1WA 5I17A 5DK0B 1MRFH 1I8KB 4DEPC 4FQIH 4Z0XB 4JZJA 4KK8D 4GKNA 1I3RB 4Z7OE 4P0DA 4Z5RB 3MROA 1AIFB 1MHPL 3GDBA 3MLXL 3EDJA 3CDCA 2A74A 2H1PL 3BRDA 1GIGL 1UYWH 3WFCH 3RVVD 1KCLA 1A1OA 4QWWD 4OI7A 1E4XL 4HG4J 3BFOA 3QDGD 1OAZL 3IAGC 3LKQA 5D1ZD 3SN6N 4OLWL 4I2XE 5DC4B 5D7LD 2X4QA 4D9RE 5FF6A 2YD8A 4XX1G 2UWEF 4NOBA 1KJVB 2OXHA 3QWOA 3CZFB 4NQDA 4YHYB 3H9YA 1WZKA 3BPOB 4KPHH 4V2BA 2AVGA 4LRNL 4U1NA 3V4PL 4ZG1A 4YGAB 1ZLSL 4WHTA 1B0GB 1RIHL 4GW4A 4MLIA 1ZGLP 3SEPA 4ZFOA 4CMMA 2EDHA 3P9MB 1LE9A 1XGRA 5B39B 5C92A 5IK3A 1UWGH 1OSPL 4S1QL 2VE6A 4YFDB 1NBZA 5IVXF 4PJ9A 2AXFA 4PR5A 4QTIH 5JW3L 1J05B 5EZIH 2QADD 5ISZB 3EOBA 4MD0A 3MLTB 2VZ3A 3KYMB 4Z76B 1RZFH 4LSUL 4PJXB 1KJ2B 1HHHB 3WJLA 4FABL 1SJEB 2R0KL 1KT2A 1DVFB 4MXVE 4RZCA 2DWEA 1EX0A 4GBXB 5JW4N 4LRNH 3V4PH 1BIIB 4WI4A 1TQCB 1B2WL 4JANB 1NGPL 2DKMA 3BVNA 3TBTB 3F65A 4K3EH 1G9NL 4JFXA 2DQFB 1I3RA 1W72L 1OAXH 5DQDH 4Z5RA 1VEOA 1NBYB 1CFSA 4Z18A 4AMKH 1L0YA 1FNAA 2F58L 1BQSA 3OR7B 4DTGH 2IBGA 3RZCD 3EYFB 3ZE1E 2YC1B 2R23B 1A6WL 4POZD 5EUOF 1HQ4A 1IARB 4U3XA 2CGRH 3N85L 3AS3A 2FGWL 3LKQB 1C1EH 3VMNA 5HHMB 1QBMH 4PJ7A 1YNLL 2X4QB 1A14L 2EH7L 4HIIA 4JPKH 1HXYA 1PY4A 5FYJU 4HPYH 3UTTD 2I9TA 2G60H 1D5MA 2HT2C 4QYOB 5CHNB 4EDXA 1HOCA 3A6BH 4QOKB 3V6BR 3PQYA 1B0GA 4GW4B 1KUMA 2CQVA 1LE9B 4FNLL 1FN4B 1HEZB 2WNGA 2X4TB 4R9HA 1TQBB 1UACH 1L7TL 5C07E 3INUL 1NLBH 1OAKL 3WHE0 4OB5L 4JJ5A 4Z7UA 3V8OA 5IVXA 2IG2H 1ZLSH 4C54A 3OL2A 2OR9L 5I1DB 4UU9A 1QSFD 3ZMRA 3TFKC 3TO2A 4NC2B 3FQRA 2YN3A 3A0OA 4YXHH 5F9WB 2DQEL 1PLGL 3CX2A 3OKEA 4YWGL 3WE6A 3SDDB 1BX2B 1XIWD 3MOQA 1QNZL 1HXMB 3CSGA 4LHJB 4OFKA 4ONOA 1QZ1A 4C56D 4CMHB 3JVGC 3JV4B 3LVEA 2R4RH 2VXSL 2UVEA 5E00B 3GNMH 5DS8B 3MRPB 3OKLA 5DFVD 5BO1H 1JRHL 4Y7MA 1B90A 3DECA 4XC1H 2YC1A 1CR9L 3IDIB 2Z93A 2YPKA 3WS6A 5F7UA 1I1FB 1U92B 3RWCB 1O5DT 1IKNC 1YEGL 4PJ7B 5EFIA 3VFGL 3GHEH 3GSUB 3MRLB 4KKCC 1L6ZA 3KPTA 5DEGA 5GGVY 2F58H 1HXYB 4K8RH 4MAUL 1IT9L 2NXYC 3HI5L 1MFBL 5I8CA 3RWJA 4TPRH 4ZO6A 3ARBC 5GS0L 4RFOH 1CGWA 1VKXB 4FTVD 1K4DA 3PQYB 1P84K 5HHQB 4LLDB 1A6PA 2DYPD 1HEZA 2ZCHL 4PRHD 1D6VH 3BP4A 1X9QA 4PJ7E 5T5NF 2EC8A 2Y06H 4GRWH 1JPTH 1NC2D 4YC2C 3F6IA 1WQVT 3BUYB 1O7VA 4FQIL 4TVPD 2HJFA 2ZSWB 1KXTB 2MJWA 4CGTA 2ZUWA 1CF8L 3LKPA 3PQYE 4DKEL 4OZHE 3LEXB 1I9IH 3TNMB 1V7NL 5E7FA 3X3GL 3KDMA 4OV5A 3ZYZA 2H9GA 3GJEB 1BM3H 5KS9F 1JWMB 1G7HA 3MODL 4QHNB 4GG6B 3MRFA 4GRMB 3IFNL 3QUZD 3FAXA 1KOAA 4MHHI 4MA8L 3MRPA 3BMWA 4X83A 4ETYA 1QTYT 3TT3L 2EC9T 2NX5B 5C0CA 1AGFA 3GIZL 1MI5B 3MCLH 2DQHL 2HRPL 3HI6L 2R0ZL 3HG1B 2YS4A 2YPKB 1WTGT 4MNHB 1INQA 2GJZA 4JM2F 1UM4H 1REIA 4TSAH 5EFIB 3RP1A 5EU5A 1LP9A 4GRLD 4M02A 4QOKE 4RIRA 4HD9A 2Q7YB 3C60B 3RIAF 5D2LF 4OD2A 4TTDD 1A9EA 1DL7L 4UILH 5FYJL 5HYJE 4F15C 4KKCD 3L7EB 5ID1B 1DR9A 1VKXA 4XP1L 1IEAA 1K4DB 4NO5B 1F4YL 4LLDA 2V2XB 3GI8L 4WTZG 3ULVE 5EU6B 1H8NA 1MJ7L 1G7LA 3FT3B 1JGDA 4I3GA 2MCPL 3B6SB 2O5XH 4WWID 3PE9A 3R8BB 3RNQA 5DK3A 1T89C 3MNWA 4MDIB 3E8UH 3DUSB 5IWLA 1JPSL 4A2MA 1RJCA 5KW9H 3F7YB 1MH5A 2C3HA 4YLQT 5DURD 3JSSA 4NOFA 2VN7A 1V3KA 3WNOA 5IW3A 1U91B 4PYGA 3TIEA 2GK0A 3RU8L 1OP5K 1Q0XH 1ZHKA 1NANI 3VWJB 4PJ5A 2Y23A 2IBZY 3KDMB 4BQBA 4S1SL 1LQSR 5EO9A 2H9GB 5GRVK 2MSPA 3QPQC 4K94H 1C16B 4I2XB 3X17A 1X5LA 1I4FA 5GJSL 4E0RA 4TTDC 1MCSA 1XGUA 5D1QD 2A83A 1V3MA 5ADPH 2IC2A 5CBAB 5T33H 2DM7A 1AQDB 3S96A 4PRPB 3E2HB 3FRPG 3O4LB 4R2GB 5DVOA 1QO3A 2HWZH 1EZVX 4CADB 1LP9B 1RZKL 3VFOA 1TZHA 2NNAA 2YK1H 1IM3B 3C60A 3HZVB 5JW4Q 3ARBD 1D5ZA 2X4NA 2R1XB 4OD2B 4HS8H 4M7LT 1UEYA 5JXED 2OSLA 4WEUD 2DLGA 3WO4C 5IV2B 4YFLF 3PWPE 1A6ZA 4XBEH 3MJ8B 5EZOH 4TUKH 4HJJL 4PJAE 2GFBA 1FFQA 2DKSA 5JOFB 2J8OA 3DVIA 1EVTC 1JMXA 3CVIL 3VDAA 3WLWC 4E41E 5JHLH 3M17A 2XFXA 5IOPB 4R4FH 4HHAB 3B4NA 3ZKXC 4WWKA 3ZDZF 4UTBL 5EPMB 2G5RA 3GSNL 3FRPA 3TIEB 3ZTNH 5FXCH 4M43H 3VWJA 5I0ZA 4EQ2A 2VLKE 3JUZA 4MQTB 5LXGH 5EO9B 4BQ6A 5HGDA 2Q6WB 3BPLB 1AFVH 2CO7B 3OHXA 4P5KB 3C6SA 3VGDA 3TN0A 1I4FB 2PXYD 1YN6B 3TH3T 3L3DB 2ADJA 3GEWB 2XA3A 4HXBL 5FKAA 1CTNA 4X7DC 3Q48A 1CG9B 2BFVH 3NPZB 5IIEB 2D7MA 1UB5B 2AQ1A 2ESVE 2PYFB 4O5LH 4PJEF 3P4OA 4H1LH 3T8XA 3O4LA 4LRIA 5IVZA 4OGXH 2O5ZL 1GGCL 1TJIL 1JZ7A 1QO3B 2X7LB 4J4PC 4CADA 5L0QB 5TE7L 1TZHB 3HRZA 3FB5B 2FH6A 3QIWC 1F3JB 1OY3B 4XVJH 1LEIA 1DBJL 5T1MB 1BECA 1SHMA 3HE7B 3UDWC 2YD7A 3G6AA 3I2CL 4PJIF 4TSCL 3TA3A 3BO8A 5FHAH 1HSBB 3TPUA 2IH1B 1JYXA 1NFIA 3AREA 4NP4H 3CMGA 2VITB 3MJ8A 4PJCA 2YPLD 5FHBH 4G6MH 3OB0H 5L2KD 1XGTB 4FG6D 5F8QC 3U9PH 4RAHA 1HDMA 2HVKA 1I3GL 2ZPKL 3X11B 4EDWL 1A0QL 4LASL 2WANA 4EI5D 4JY4A 5HGBB 2GAZB 4ODXA 1AHWB 3IRZA 1FDLH 3L1OH 3QUMA 4XVUC 4L3CA 4XCYB 1QRNE 1UXWA 3UAJC 4WU5B 3BRGC 4H1LA 4YUEL 2WWKO 4NQCE 4IHOB 2BRRL 1X4YA 4WU7B 4RFNB 4P5KA 4MLSA 4F9LC 1MRDH 1F4XH 4LF3A 4BH7B 2VH5L 2ZCHH 4NNPH 4G7VL 4DCQB 5FO8A 3O2DL 3HAEA 1ZHBA 5F1IB 3HFML 1F42A 5GRJH 1YQVL 1LO0L 2LVEA 5JQ6L 4NQCB 1DUYB 2IWGA 3TIDB 4QXTB 4ZDHB 3PL6C 1F3JA 1GYAA 3RTQB 3ZL4H 1UXSA 2KDGA 1R3HA 2C3GA 3MLWH 5E8PB 5GZOC 4UI2A 3NCMA 1T66D 1RQ5A 1HSBA 3TPUB 4HUUA 4QHKI 2J6EA 4E41B 4JGUA 4WHDA 1P84J 3LS4H 3MACL 4PG2C 4UAOB 5DHVB 5IHZA 2DTMH 1WBZA 3P30H 4XWOC 3MCLL 1XGTA 2XWBB 3O3BB 4CVZB 1S78D 1G0DA 4P4RB 2DQUH 2H32H 3X11A 1OSPH 3B83A 3TA3D 5J1AB 4UQ3A 1GSMA 2HLFD 2ITCA 4TVPH 3QCTL 3SE3C 4ACPA 1N6QL 5F7NC 2DQIL 3S36X 1ADQA 4XCCL 5H2BB 3TLRA 4CN1A 4JN1L 5GS1A 2R29L 2YUXA 4K3DH 3CIQA 3QR2A 1NCBH 5CWSB 5I19L 4NC0B 4M7ZC 1DLHA 3MJ9A 3HLAB 4U1MA 4OUOA 5CKGA 4HPOH 3EYQD 2FDBP 2AJYL 1E4XH 4HPYL 5FEBA 1BWMA 5KVGL 4IOFD 4P3WA 4M7KL 3CK0H 4Q0XH 4HMCA 1N8ZA 4NRXA 3W11D 1CK0H 4OZ4B 1DUYA 3TIDA 4IJ3C 1I1AB 4XPAH 5E2WH 3W9EA 2VC2H 1FFOB 1KTRL 4F7EB 1CBVH 1CQKA 1T5WB 2HRPH 4G6AD 4LCCA 4YHLL 2KZWA 5FHAL 4ZQKB 3ZSSA 1IL1A 3DYOA 4KGLA 1TZIB 1K5NA 4F33B 1IAIM 2R0LH 5L2KB 2YPLA 4KRPB 1JHKL 1FLRH 3O3BA 2VR4A 2AGJH 1N5AB 2VDML 3C6LD 2LABA 4P4RA 3MLXH 5CEYA 1F6AA 4Y4KB 5CZVH 5BV7H 1U8JB 2O61B 2ITCB 3OR6B 5BRZD 1SBSL 2IPUG 1BQHG 4PD4J 3ARBA 1JNHB 2XTJD 1U6AH 1JN6A 1WITA 1RURH 5JW3H 2BVOA 1KXQE 4ZS6C 3E8UL 4YHKL 4KUCD 4K7FA 2HT4C 1DBKH 3VXRE 1JK8A 3SE8H 3LN4B 3O4OB 4FFYH 3VFWB 5FA3A 1JHKH 2IPTH 1FNFA 1KYOK 2PXYA 1UGNA 4NBXB 4HF5L 3NIFE 3BYTA 5SX5K 2ATPA 3DOSA 2AK4B 2OM5A 3V7AE 1CLOH 5CSBA 1IZKA 4ALAL 4I9WE 1X44A 1BLNA 3S35X 1I1AA 1WZ1L 5IHBA 3W5NA 4LHUD 4Y5YB 4D94A 4GAYA 3LPWA 1WBXA 2DQCL 1QUNA 4Y5VC 3JBG7 2P43B 1MF2H 2BP3A 2X09A 4HSQA 3CUPA 2FGWH 5FDYA 3QFJD 1QSEA 3RVWD 3HI6H 2X10A 3MV8B 2GIYA 1J87A 1Y18A 1CXKA 5FGRA 3EOTH 4X4XA 1CDYA 1FFPB 4YEFA 3G04B 1QLRA 3E3QC 5C0AA 4DZ8A 4Q74A 5CMAA 1ZLWK 5C0GB 4Y4KA 5SX4H 1MAKA 2OS7A 4HV8B 1XT5A 3KYOA 3VXUA 4G7VH 1H3UA 4QTHA 1KTLA 4H5SA 4XVSL 3F7RA 3GUTB 2BJMH 1WFOA 3TYGH 5M95B 4D9LL 1NLBL 4XNZC 3V4VL 3B9KA 2VABB 3REWB 4APQD 3SDAD 2BVOB 3TPKA 1JPFA 5DJZA 3K4ZA 1MFCL 4LOUD 1BGXL 2AJSL 3QIUA 4PS4H 4QRUB 5JR1L 3RY6A 5INDA 5CJBA 4OTXH 3RRQA 2NW2A 1D6VL 1NPUA 3GRWH 2J5LC 3MSPA 1IAMA 5E4EC 2EDOA 2PXYB 3MRQA 2OL3A 5E8NA 3BKJH 1SM3L 1E4XI 3ZKMC 1AJ7H 2AJ3B 4M8QB 1P4IH 3D87B 4KH2A 4PJEA 3O6KL 5EOTB 3ZE0F 3WXWL 1A7OL 5DJ6A 5DK2A 3RAJL 2HG5A 4P2OC 1FBIL 2QQQA 5ECJE 4LFHG 3QYCA 1HCFX 2YPVL 5MEPA 4Y5YA 4HLZG 2VLME 3D18A 1WBXB 1RUKL 2EDQA 4MX7A 1TCMA 3MBEB 2WQ8A 1JFQH 3H3PL 1HHGA 2CLZA 2W38A 1FYTD 4YDKH 5B39G 2X1XR 5HHOD 2NXZD 3KYNA 3D2UB 3QEHA 1R0AL 1MCOH 1GAFL 2Z8WC 1NC2A 4AM0B 1RUAH 3MCKB 1Q94A 1FGNH 5HYFA 3ZKND 4W4OC 4S1SH 4N0FB 1FHGA 4HKBB 5KJRH 3QCUH 2CPCA 4WV1A 3L3JB 1T80A 3ULVD 4YDVB 1FZMB 4S1RH 2Z8RA 5EU4A 1HKLH 2OTWB 5J13C 3O11B 3VCLB 1EK3A 5DSCA 4QY8B 1QFWL 4Z8FH 3MJ7B 3U7WH 2IQ9L 4ZTPH 3BIKA 2HFEA 2ADIB 3BJ91 1R0AH 3QJHA 4ZYKB 4FFYL 3N0PB 5D1QB 5IMKA 3VXQA 2NW2B 3EJZC 4CU7A 5FV1L 3BN9C 3QDJB 1UC6A 1S78C 1CFTA 4K23L 1U95B 4PIRF 3T2NL 1QBLL 3SGKA 1NMAL 5F1NA 2Q86A 1LD9A 1YJDH 4WTXA 1CE1H 1ORQB 3PWNA 2B0SL 5JDSA 1YECH 4PJ5E 3MXVH 5JXAH 2BRQA 4FZ8L 4PTUB 4JQVC 1FORH 3LKRA 5JO5B 1N4XL 1DANU 4P9ML 3DYPA 3SDAB 4BSWA 3DVNB 4HKXB 3O41B 5F6IB 3P9LB 1HHGB 2CLZB 1EO5A 3MLSH 1HNFA 5D72L 5GGVH 2NY3C 2JB6A 3O8XC 4PB9H 3VWKD 3P4LA 2APWA 1RIUL 5E99L 4AM0A 3IJYA 4HK3J 3GM8A 1Q94B 2IMMA 4U1JA 2F54D 1NMAH 2F19H 2NZIA 1UA6H 1WEJL 4DKFH 1KCSH 4J3UA 4JCMA 4R97B 1AFVL 5C0BB 3LY6A 4YDVA 3VFVA 2CO6B 5HHOA 2O93L 2FZ3A 5EU4B 32C2A 3D5OF 3SHSA 2D0GA 2B7DT 1KXVC 1RI8A 1P9MA 4NN6C 1T1XA 4MA7H 2P5WD 4AG4L 5CILH 1CFNB 3SKMA 1X5AA 1KIQA 2YBRB 4O51A 4F7PB 1A7PH 2AQ2A 1S7VB 2Z31D 5F7DA 5BVPL 5JZ7D 4H0IA 1NDMB 5D6CA 2QTEA 3VXSA 4WRLA 3DETC 4EDWH 4FQXC 5EOCJ 3P40A 1I9EA 4Y16A 3OQ3B 1U3HC 2E9BA 3N1PC 3VG0H 2F5BL 3O9WD 4ONGH 1OAYH 4GAGL 1D5IH 2HLAA 4NQVA 2P8PA 1ZSDA 5JDSB 1U36A 4X4ZA 1J0KA 4HS8L 4HWBA 3QIUD 3ROOB 5HYQB 5EC2A 5IW1B 5HY9B 3F5WA 5D2LB 3HNSH 3HI1B 5FUZL 4CVUA 3L3IB 4TUJB 3O41A 1QSFA 3F58L 2V5RA 3P9LA 1MCWW 3PWVB 5EBMA 4L8SA 3O2DH 4Q9RH 1P4BL 5KVFL 4XPTL 1N2RB 4Q6IB 1QLFA 1MJJB 2IPKB 3KJ4C 4TOYL 1DQJB 3UYPA 4PJ9D 3IJYB 4A6YH 1TETH 2ZCLL 1N4XH 2DYPB 4DFHA 4KU1A 5HI4D 1Q0YL 1I7RA 4N1HB 5DR5H 3L95B 2Y6SC 5FO7B 4OD3L 4QOKD 3CGTA 2AXGB 5E8EB 4I3RL 1TJHL 3VFVB 5GRZA 4FQXD 3UTTA 2FZ3B 32C2B 1ZS8A 3LKNA 3G6JA 3QEUA 5DO2C 2VDMH 1T1XB 5MP6H 4JLRB 4YHZH 1BP3B 3MRMB 3MO1B 2CJUH 2EH8H 4LPVA 1V7NH 3BN9D 3BH8B 5E6ZA 3I6LD 3IXTB 4B7IA 2NYYC 1AP2B 2UWEA 5D6CB 3WL9B 2KZ1B 1EO8L 4GG8B 3D3VE 2YMXH 5L88L 5DD0H 1CD8A 2XZAH 2DQJL 4OD3H 2HMID 4FNLH 2G5BA 5GS0D 2D7QA 4MA3B 4JO1H 4CMHC 1RK0A 4LU5L 5JORB 4HW6A 1KELH 1YC7A 5LAXB 3ARXA 3C5SB 3VRLE 3L3IA 1BF8A 4JRXD 4JQIH 4G3YH 2EO1A 3SDCB 2M2DA 2R2EA 5EWIL 3ZL4L 4OZFA 4YWGH 3TCXA 2R69L 2HH0H 2ZUTA 4J3VA 1I9RH 4H26A 4XPAL 5E2WL 5ELIA 3NCCB 5F1OB 2AXGA 5E8EA 4OZGE 3ES6A 2VDRL 2Y4SA 3GO1L 3BXNA 4HWNA 3REVB 5F96H 5HHMD 4MD4B 1EAPA 2XKNA 5D1ZB 4JKWA 1ES0A 1KEGL 3QHZL 3GMMB 1GOHA 1V5JA 3ZHLA 3GBMH 3TBSB 3ULSB 3VRLF 1VGKB 1ZA3B 2Y07H 5C7XH 4HC1L 4K55A 5GS3A 1MRFL 2NY0C 3IXTA 1FJ1B 4KY1L 1KB5L 4GFTB 4U7MA 4ZAKA 1KFAH 1FCCA 3KPQA 5DD6A 3TC9A 5JHDD 3EGSA 5DJDB 2NY5H 2HJKB 4MXWH 3QQ3B 4OKVB 1DN0B 4LLAA 4QCIB 5EC1A 3EO1B 4PRDB 1ZLVH 3QEQD 1UA6L 1WEJH 2ZCKH 3MRNB 3C5JA 1A7NH 2GY7B 3DIFA 3WS6C 5J6HB 5A2FA 4JZNB 3IDYB 4ODSL 5IEKA 4HIEA 1NCDH 3O2VL 3OZ9L 4QRQA 2F8VA 4O5LL 4LCCC 1FNGB 3RWEA 1U8HB 1H3GA 1FSKB 4MVBC 3C60C 5C9JB 1NGQH 3FB6B 5TGBB 1S7XA 4ALAH 1KCKA 4WHCA 3TZVB 4JFFD 1FZOA 2NMSA 1CFQB 3GB7A 5ICXB 2Z4QB 2IGFL 1YECL 4RGMC 3VFNB 4J3OC 4XPFH 5J3HC 3UPAA 5IHLB 4NIKB 4RBPK 4YGVA 4QRSB 4U31A 3REVA 5IR1B 1E28B 4WTWA 4HFUL 4F9PA 3QXWA 1ES0B 1SJVA 4L1DA 2YPLE 5F8RC 4UIKL 3QCTH 3P11H 3QAZC 1PZ5B 3WLBB 2HTLC 3FN0H 1LO4H 5AAMA 4P2YA 1FO0H 4S1DD 1IAIL 3U2SB 2ESVA 3F12B 4JN2A 3L5HA 4F58H 3PDOB 1GZQB 5ESQA 3ARTA 4U1HB 1A6TB 3LQZA 3NGBB 4Z78B 1EDQA 3OKKA 3Q0HA 4NC1C 4HEME 4MJIB 3T3ME 2JELH 1ZVSB 4X6DE 3DIFB 4PGCB 1CE1L 1N7ML 2OTUB 4NDMB 3L3HB 4HIEB 2APBA 2PTUA 2ZOLA 2F5AL 1RUML 1FNGA 3RWEB 4W68A 4MNGE 4X5WB 3QDGE 2EDTA 4FTVE 1A7OH 3RAJH 5JIKA 3OV6A 4JRYA 1A7BA 2J88L 3BIBX 1X7QB 3QXAB 5IJKC 2OL3L 4PJHF 4U6HB 3CVHA 4C4KO 1JNJA 2CLVA 1YEHH 1YN7A 5TPWH 5F71A 5DI8B 5KSAC 4OZGF 5IR1A 1IEHA 4X99A 4NKDA 1PLGH 2C4FT 4TVPE 1U93B 3BT2H 4FQHB 3CJJA 1J1PL 4JM4L 3DHJA 3GSVB 4D0CA 3TCLA 4Q2ZA 5JIPA 1MFCH 2Z92B 5SWQA 4QXUL 4HFUH 3QHFL 1IGYA 3G08A 4LVEA 3D69B 4M9PA 2BHUA 3BQUA 5ESQB 2AEWA 4U1HA 1OARL 2BVEA 1KCSL 3FHAA 4N0UE 3T0ED 4R7DA 4KJWC 4ELKA 1FVCA 1IAKA 1Q1JH 1YEIL 2AKRA 1G9EA 4MJIA 5DUML 3QEGH 4PGCA 5KJRL 3EO0A 4L4JA 3UJTH 1IC1A 3L3HA 2H32B 2W92A 2YKLL 2BX5A 4P46B 4NBYB 3VGFA 2YD5A 5ESVB 4N68A 5DRXA 2IANE 3PXJA 4EN3B 1ZWIA 3ZT5A 1MUJB 5INCB 4YDIL 3DROA 1MFAL 3C09B 1A3QA 1X7QA 4KDVA 5BW7C 1J12A 4TNVK 5EU6D 3ULUE 2V9RA 3V4VH 1O7SA 2JB5H 2V9TA 3K46A 2YPVH 2PYED 5I1LB 3UBXA 2EEAA 3NBNA 4X99B 3MJGX 2P5ED 4JDTL 5CAYB 2ZSVB 2XG4A 4G3YL 1A4KB 3FQTB 3RJDA 5ABDE 3X3GH 4IBLT 3LIZL 4GRLB 3V0WL 4EUPH 5KTEH 1NBVH 1G84A 1B4JL 2WUBL 1K2DB 2P48B 1RUPH 4TSBH 2R56L 5I74C 4L3EE 1JNNH 2QADC 4GQ9L 5FCUH 1X5XA 4Q6YA 5I1HL 4RGOL 2XTLA 1TNNA 1KC5L 1IAIH 3T0EC 1GGIL 3ULVL 5GGRY 1WUNT 3IFPB 2FO4A 4G6KL 3O8XA 4PLKC 2ZUQC 3BQUB 1EIBA 3GSXB 1KIRA 5EIVA 4IRJD 3D0VA 4KMTH 2DMCA 5I30H 5I17B 2PW2B 5T1DL 3NFSH 3SGJC 2GUOB 1IGIH 4NPYA 2NW3A 2VZSA 1T7XA 2GSIB 4XTRC 4FXGB 3VI3E 5FUCE 2V2WA 4JQXC 3V0AC 3BD4A 1ACZA 5JNYA 2HYMA