4RMQA

Crystal structure of the d59n beta-2 microglobulin mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKNWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title Decoding the Structural Bases of D76N 2-Microglobulin High Amyloidogenicity through Crystallography and Asn-Scan Mutagenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rmqA00
5DURD 2R1XB 5IB3A 1NDGB 5EOTA 5EA0H 3TA3C 3S5LA 1NGZA 5DVNA 2PXYB 5J1AB 2H6PB 1BIIB 2PTVA 3IDUA 3CVIH 2GITA 3MREB 3QHFH 4HXAL 2JB6B 4O5LH 1BX2B 1PZUB 2EXYC 3A0OA 2OK0H 4Z7OF 1GC1L 5T3ZL 3B5HA 5IMOB 5D2LF 1IQDA 2YN5A 4M03A 2C4FT 5I1DB 2EDHA 2B2XH 1H3PH 2QHRL 1UZ8A 2VISB 5D5MA 3TNNB 1FG2A 1A3LH 1NBYA 3BPNB 1P84K 5DEZA 4EI5D 5DURB 2YN3A 3BESR 4NWTH 1JP5A 5E1HB 4N90E 3C9NA 1KIRA 5IJVA 2BOBA 3BGMB 4DWHA 3P2TA 3QIWC 4YBQD 4JM2A 4YBLC 3E6HB 4LRIC 4NM4H 5D8JL 1UVQA 1U8PA 4WGWB 4LSQH 4X8XA 2HRPH 5IB2A 3OX8A 3MV8E 3K4AA 5CJQL 5D72H 3GI8L 5GGRB 5C09A 2EDDA 5F72S 4LSVL 1CDBA 2O5ZL 4UILL 5FHBL 1OPGH 4AM0B 2RFXB 5DZNA 4JQVA 1A6WL 4HUWB 5CJXC 4HKZA 5GS1A 3RUGF 3WEXB 4YFLI 4I48B 4P2QD 4EI5B 1JWSB 4LLQB 2AV7B 5A3IC 2J7LA 3MRGB 4Y0GA 5TGBA 4OSUL 3DVIA 5EU6E 3HFMH 3G04B 4FTVA 3HE6C 4BQ8A 3QSKB 2OQJA 4U6HB 1UCBL 3PQYA 2K9UA 3TT1H 2XQYG 3TV3L 2QSTA 2HKFH 3WO3B 4D9RD 3ZL4H 1PKQB 2IQ9L 4YHML 1BLNA 4X5WB 5IEKB 5H37H 2WK2A 1OAUL 4DFIA 4PJ5D 1OLLA 4PR5B 4OZGE 1H5BA 5DRZB 1HHKA 2FJFA 5DFVD 1NCCL 2HT3D 4WFEE 4WUUA 3WKMH 2BHZA 5ICXA 1H0DA 3D3VA 2DTSA 5DJZA 1LEKA 4ZD3L 5CJ5A 1OM3H 3MRIA 5A2JH 2GTZB 3MXWH 4FFWC 4TUOA 5IQ9A 3TJEL 4YHZH 4TULH 4O58H 3VD5A 2UZIH 2ZKHL 4P2QB 3VRIA 5EZLA 3V5HA 1K9TA 3T3PE 3FB7A 3MJ9L 1YEEL 2C7UB 1AD0B 3JWOL 3KWWB 5INDB 3F58L 2DQHL 2NY2C 4JY6A 5IJKC 4I2XE 4GW1A 3AXLA 4JHAL 4QRPE 1HH6B 4XNQA 1XGTA 2P8PB 3OKYA 2DN7A 2HJLA 4N9OB 4WW2F 4ZUUB 4BZ2L 3GJFA 1RIHH 5C2UB 1ETZA 4RCAA 4NRZA 4HH9A 3T2NH 2Y36L 4NUJB 3S88H 1ONQB 5F9WB 1A6UH 4PGJA 1ED3B 1IEHA 1MCOH 5CJ8A 1DBJL 3RFZC 1A9EA 3VI4F 1X5ZA 4Z95H 3D2UA 3MBEC 4TRPH 4KI5C 5GGVL 4X9GA 4PJFE 5CEYA 1NMCB 4ODUA 5DR5H 5JA8B 5DUBA 1XF3B 1FRGL 4AG4L 4X4ME 3AMKA 3IETA 3ZLQC 3BT2L 4CN6A 2DBLL 4X99A 2GEEA 1FVEA 3TVMC 1UB6A 1WFTA 1C16A 1G0YR 4HBQA 4MNGB 4BQBA 4NRXA 4RGOH 4X8JA 4P2OD 3WFHB 4DUXA 2E27H 4X4XB 1NLBH 3FQWB 1K2DA 3TIEA 2QV2A 1CTOA 2N7BA 1UC6A 3FO9B 2Q6WA 4H20L 2Q76B 4WEUD 4XMLL 2Y23A 1JUFB 3O3DB 3RVWC 4NZJA 1T5WB 1YEJL 5FOBA 1MCFA 1ZHLB 2A2QT 4H25B 1DLFH 3CCHA 5D93C 3U46B 3NZHL 1TETH 1G9MC 3MLUL 5D70L 1HKLL 1CDUA 32C2A 3LKQB 5IVZB 3BPLC 4X0KA 1FV1B 3GZKA 4J4PC 3IGAA 4CAGA 2NZ9C 1RMFL 2JJVA 4LGSB 3X11A 1NEZB 2YD3A 5TFSL 4V2CB 1FFPA 4P2OB 2P42B 3FTGA 1MCNA 3S35H 5FOJA 5GGQL 4JR9H 2PN5A 3KLHD 1JGEA 2HA1A 1NPUA 3NMEA 4TUKL 1NBQA 3BVNB 1C7SA 2OI9C 4LU5L 1ZTXL 3CFDA 5F1NB 1U3HD 1F8TH 2ENSA 2FLBT 1ACYL 3RY6C 1WIPA 2D31B 1JZ8A 3REVA 2G60L 4NO0A 2NY1C 3RUGB 4LSPL 2VDML 5IB1A 4LKXB 3PWPE 5ENWB 3OXRB 2AGJH 2OSLB 4OCLC 1QRND 3WHE0 2Y7QA 1O5DT 2VLLB 3SJVE 4NP4L 2Y5TA 5CD3A 3REWA 3KG5A 2Z31D 3IFLH 3IDGB 2F5AL 3QPXH 3DRTA 5JZ7D 1SYSA 5JLZB 5EOCH 1DQLL 1QSVA 5CSGA 4WW1A 1Q94A 3JTSB 5DLMH 3GSUA 3IFPA 2FIKA 4G6AD 1EEUA 1IVLA 1SBBA 1U3HB 3B9AA 4OZGF 4YHLL 4JFFD 2NW3B 3BH8A 1I1FB 4M7LT 3OB0H 3VFTA 1WIOA 3VXOA 3GSVA 4JFHD 4MNQE 1OARH 3CVHL 1KTKE 3EYQC 3S9DB 5FGRA 1FZKB 5D2NB 4UQ2B 2A6KA 4LCWD 3GKWL 1ZMYA 1IAMA 4KI5E 3AAZB 2ZUUA 4RGMB 3RWEB 3T3PF 3G9AB 3QUXD 2VNCA 5CZXC 2XTLA 1A5FL 1QRNB 4JQIH 4TTDC 1CS6A 1L0XA 3VXNA 3ZE2E 4HULB 1JPGB 3QJFA 5KSAC 5E95B 1G7QB 3X13B 4OIAA 1KJVA 3MNWA 3LN4A 4JPVL 3U9PH 3OQ3B 3VWJC 5IG7B 4JPKH 4L9LC 3LKPA 2XN9A 1P4LB 1YEDB 4GMTL 3S4SB 5IFAH 4JFFB 3SDDD 4GQ9L 4HS6B 3AS3A 5KW9H 5FHAH 3QCVH 1H8NA 3CXDL 3QZWA 4Y5VB 4JCLA 1N5AA 4YDJA 2FEEL 1SJXA 3HC3L 2ZPKH 2A77H 1I4FB 1U8IA 3BI9X 3QUKA 4NQCB 4PJFF 4I1NB 3HNTH 1JK8B 3PHOA 1K8DB 3MRRA 4K8RL 1HZHH 4RIRA 3BZ4A 4RWHA 3SKNB 3T0WA 1ZEAH 2MCPL 2RB8A 3SCMD 1OQOA 3TEUA 2YKLH 3ULUL 1J12A 4L4VB 1JFQL 3Q6FB 3RIAF 4NYLA 1I7UA 3BKML 1BMGA 1YYLL 3ALPA 2HFTA 4ZFOA 2F19L 5KVFH 3ARFD 4EIZC 1M7IB 1P2CB 1OSPH 1RURL 2BHYA 4S1DD 4E42B 4GG6A 4HZAA 5D7JD 5E4EC 3L3JB 4HQQH 4N90D 4L4TE 3T0EC 1JL8A 1AGBA 3AM8A 5DJ8B 2AJVL 2HFGH 3LS5L 4MCZA 5E8DL 5I8CA 1N5YH 5I1CH 1NC4A 1PW3A 1KCSH 1P9MA 1PG7L 1GZPA 1KPRA 1WJ3A 3MV8D 1HXYA 3IU3B 2ADFL 5KSBF 4QHLA 3LH2L 1HHHB 1FFNA 5I18H 4WUUD 1I1YB 1A6TB 3C08L 2HT4D 5DJDB 5FUZL 3SCMB 4U1LB 2QR0B 3ZMRA 3LB6D 3F7RA 4LAQL 3RWDA 2EDWA 3ZYOA 1NBVH 2GYSA 3RKDD 5HGBA 3ULSA 4Z76B 3MLRH 4ZSOE 1TVDA 3S35X 1VCAA 3ARFB 3LHPH 4HXBH 4PRHD 2J6EA 1MNUH 1DANT 1YEKL 5D7JB 4Y4KD 5E70A 1GPOL 1IL1B 4XC3L 1ZAGA 5B39G 4PB0H 4QT5B 2RGSA 1R5IB 3KGRA 5ECJE 4RQQB 3MV8B 25C8H 4N5UA 1F4YH 2DYPB 3TYGL 1LWRA 3G5VA 4K3DL 4LQ1A 3VCLA 4MD0A 5E4IA 5IUSA 2D4DA 1PEWA 1L6XA 3RL2B 4JPWL 2AJ3A 1CLOH 3EDFA 3SPVA 4MLSA 4IS6A 1UXSB 3VFRB 5FYKL 1OCWH 3QH3B 4HIEA 4APQA 4JG1L 4R4ND 1WTGT 5C3TA 5F6IB 1TVBB 1K8IA 5I15L 3G9VA 3P4OA 8FABA 3NBNA 5EU6B 2UY7A 4Y4KB 5DRWB 2DLHA 5I1LB 5GGUB 5HYEA 1Q1JL 5EH1A 2DQFA 3H3BC 1FL5B 4JRXD 2VE6B 5FYJD 3TBYA 5IV2A 3WN5B 3K8MA 4ZAKD 2X4TB 3DLQR 3TT3H 1QUNA 4ZQKA 4OFDA 5TQ0H 3BMVA 4OZGB 3QEGH 3SDCD 5C0AE 2BY0A 5TE4H 4XBGA 3IDXH 1F6AA 2XXMB 3X3FH 5FM5M 2VR5A 1UKTA 5TF1H 2EDTA 3UTZB 1INQB 3GNML 5EULV 3EJZD 4PS4L 2VQ1A 2NCMA 1M71B 1Z5LA 4KI5F 2G2RA 4X6FB 5CINH 3WO4C 4OFIA 3K7UA 4YXHH 4FN0A 5D9SA 4B50A 5I74C 2AV1A 5A40E 1ZLUH 1LO3L 1KNOA 5E94A 2BVEA 3ZE2F 4XPGH 5ALCL 4JRXB 3U9UA 1OB1B 4QRPB 5T1DH 2Q86A 1L9NA 4FQJH 4MAYA 4S10A 4YXLH 5C0EA 5SV3A 4LSUL 4HC1L 1CBVL 2PYFB 4ZAKB 4N8VA 5HHQB 4Q74A 1C08B 4KK5C 3SDCB 4YE4H 4GJTB 4MJIA 4WI8A 4DKEH 1KENH 1MAKA 3TA3B 1JPTL 3CC5B 4WHCA 1VGEH 2UY6A 3INUH 2Q87A 1BFOA 4GKNB 3BAEL 4QOKA 3HNVH 5J3HC 4WU7B 3RNQA 3UDWA 2VN4A 1RZGB 4M7ZB 4RFOH 5DT1L 2X4QB 3IFNH 3QJHB 2E9IA 1MRFL 2CLRA 4HCRL 3K4ZA 4GXUM 1QBML 4MB4A 1U8NB 3VG9C 2AW2A 1OTSC 4Y2DA 3WE6A 1MFCL 2J6EL 5GRJL 1MPAH 3OAYK 1A1MB 3ELAT 4DTGL 3I02A 4EN3C 5EUOE 1KYOK 4X6EB 3RGHA 1FO0H 4G9FA 3IJSB 4F7EA 1HSBA 4ENED 2V17H 4R9HA 5D1ZD 1QR4A 3VE0A 1PSKH 5ISZD 4YBLB 2CD0A 2D03L 4PJXB 3HPJB 1K4CA 4OI7A 1JGLH 4QRTB 1NMBL 4M7JH 4NZRH 2I9TA 3VMOA 5KSBB 1E4WH 1OAQH 3LN5A 3HZMA 3N85H 3HI6L 1E27A 5CZVH 5IWLA 4QXTA 4K9EH 4F80A 1EUUA 5BVJA 1QR1A 4JREB 5GRUH 5HHVL 1CLZL 2R2BB 2OS7A 4NQDA 2YMXH 1QD0A 4PJBE 2HLFD 4Q9BA 4DCQB 2VDKL 4JZNA 5E9DE 5EO9B 5FYKU 1OGAD 5AAWA 1U2CA 4LSDA 1KN2L 4M6OL 4TVPH 2DLGA 4KK8D 4WJ5B 1AXIB 4P5TA 4LFHD 4PJAE 5D1ZB 1XZ0A 3HI1B 4G9DB 3MNVB 5ISZB 2O5XH 5F7FA 4PUBH 4BQ6A 3W5MA 1AHWA 3AREC 4Q0XH 1GZQA 3GMLA 4DKFL 2BXZA 5JOPD 2XWTB 1P4BH 2LAAA 3OAUL 1LD9A 3UJTL 4FQ2L 3M07A 3QT2A 5F89B 1MI5A 3KXFE 5IVXA 2DJSA 1R24B 2R23B 4WGVB 2BRQA 5BXFB 2AI0L 2DIJA 4HXAH 4FXKB 1RZKC 1GC1H 5KOMC 5T3ZH 2ITDB 1OGAB 3WJJA 1IRAY 4B7LA 1R3JB 5CJOH 5HI5C 1OP9A 3BP7B 4Y2OA 4FMKA 3OR6A 2BMKB 4OIBA 5F3HA 2GQHA 1X6LA 2PUQT 4HGWA 4D0BB 3B3IA 4LCYA 4MNQB 2P5EA 2DQDH 3BUTA 1VESA 4KJYB 2DM4A 2JJWA 4HK3N 4NUGL 3IXTA 4NHCH 2H3NA 4Z0XB 3PWJB 5CJQH 5AD0A 1AO7A 3LEYH 2YPKA 1OD7A 1TJHL 3T2QA 3O8XA 3HR5B 5C0NC 1HK6A 4ERSL 1T66D 4UILH 2MQ3A 1YMHA 1EUTA 4KQ3L 1CTNA 3HCVA 3WNLA 1NBZA 1RULL 1S5IH 1A6WH 5JMRA 3TCLA 2GTWB 1NUDA 3MACL 2FGZA 3N50A 4JY5H 1R3LB 3BDYL 1V3JA 2FB4H 1A6ZB 1AC0A 4LVHC 4JFPA 4OSUH 2ADGB 2ZNXA 3I75A 1RUKL 2Y07H 3IU4H 4P46A 2EYTA 1WT5A 4JQXC 2D7MA 1UCBH 3TV3H 3WDIA 4X98B 5FECB 2IQ9H 1KXTB 2VIRB 5MEPB 3CFJB 3RVVD 4G6KL 2IPTL 3FB5A 3V6FA 1SM3L 4NOBA 1LEIA 2GUOA 3FT3A 3UPRA 1CXHA 5F71A 5DMGC 1JRHL 2N7AA 5CWSA 4LCUB 5LJYH 3ES6B 2WINB 2ADIA 2XZAL 3TJEH 2E7MA 4P57B 4JLRB 2CH8A 3RWJB 2ZKHH 2AJZA 1DBAL 3ZZ1A 3CXHK 3DNKA 4OM0H 4L4TB 3WFBL 5A16A 5EUOF 5HVFB 2OJZL 5C6TH 1YEEH 3VFOB 2ED9A 3JWOH 3F58H 2FDBP 3IAGC 2YHGA 3CFCL 4U6VH 4JZJB 4YXKH 1DUYB 2W9EL 5J1AA 4JHAH 4PJ7E 3SKJH 4MA3B 3TPKA 2OP4H 4PD4K 2X89D 5H37G 4MXQC 4Q58C 4XCFL 4RMRA 2OI9B 2A9ML 2YEZB 4PRDB 4ZFFB 1ZOXA 2JCCB 1RZJL 2NY0D 3SDYL 3DV4B 1DBJH 5EG6C 3QDGA 3RU8L 3TGXA 4NZDA 3VRLE 4PJBF 3ARGD 5I8EB 4BZ1L 1I7ZB 5F96L 3W11C 1MFBL 3MCG1 2ZCKH 4HWBA 3C5JA 1BF2A 1ZLSL 3QQ9C 4M48H 1FRGH 4AG4H 5BW7A 1FL6B 5BOZG 4Y7MA 2UZYB 3MLSL 4Y5XC 3OG6B 3SGDI 3BT2H 4PJAF 1HCFX 4CRPA 1QFHA 5E2VL 1W72H 5DD0L 4UT6L 1LO2L 4A2MA 1X5AA 4CDHA 2IMMA 4E5XA 2OTWB 3MRKA 5CD5D 3GUTA 2EC8A 3QR2A 4XPAL 5JOFB 4MVBD 5LVEA 4H20H 4XMLH 2NY0B 5DJ0B 1I9RL 2J8UB 2CR6A 3ARGB 4I48A 4R7DB 3ZYZA 2VN7A 1JWSA 3MLUH 4XNMA 2XIDA 3K2UL 3T0BA 1HKLH 3H6JA 4ZTOL 1P7QB 2ENYA 4G6FD 2DL9A 1Y6KR 3G04A 2LQRA 4NGHL 4GRLD 1Y6NR 1RZIA 5IHLB 2ERJB 4XGZB 2K1MA 1BJ1H 2G5RA 1MHPL 5KSAB 1PKQA 1D6EA 3NIGE 3ZT7A 1CXIA 5AG9A 4U1GB 4J8RB 4ZS6D 1EHNA 3VWJB 5C0AB 5D71L 5GGQH 1EZVX 1Q8MA 2I60L 3GBMH 4WI3A 3AS0A 1Q9WA 1BM3L 5C6WH 3N1MC 4WHTA 4KHXL 3H0TB 3ZYIA 5MENE 5ERWB 2EYSB 1F97A 5C0CE 2ZUYA 3UMTA 1WWAX 1U8JA 4V2BA 2FBJL 2XZCL 3L7EB 2YOCA 4MXWL 1KULA 1HOCA 3CZJA 5D7LD 3MA9L 3GMQA 3GSNB 5ESVB 5KS9A 4OCMC 3FQRA 3KS0J 1A14L 4N5ED 5TQ2L 3L7FB 3PG2A 4LSPH 4U1JB 2P8PA 5DDHB 3EYVA 4UAOC 4Z7UB 5ELIA 4KMLB 2BOCB 4LHUD 4MQ7B 2Q7YA 1KG0B 2CXGA 2MKLC 3QO1A 3K8LA 4YC2B 3PL6D 2R0KL 3LDBB 3LZFH 4L3EA 4PJIF 1GSMA 3BD3A 2DICA 1FVCB 1OAXL 2FSEA 5EU3A 4ZUWB 2DQUL 2Z92B 4LAJH 5J6GB 2O26U 5GGSA 1JN6A 1QSZA 5EU5B 2XPGA 1OP3K 4D9QE 5M95B 4IRZH 1K6QH 1BFVL 1IGTA 1Q72L 2AK4A 3CVHH 3L3IB 4H0HB 1URLA 1XF4A 4HZLB 5GSVB 1RU9L 1WZ1L 4QRSA 4TQEH 3GKWH 5FDWB 1V5JA 5ACZA 3V2AR 3RWGB 3JV6B 1DR9A 4HWBL 5LBSH 4BSJA 1MHCA 5EUOB 1EZVY 4GAGL 1RUML 1DQJB 3RA7L 5F9DC 3I6GB 3L1OL 4NWUL 1M7XA 3DOSA 5FKPB 1ZLVK 3T4AA 4BFBD 2WIMA 4PJ7F 3PL6B 3KPRA 4EZMA 3BIAX 1JUFA 4JKPL 1NCAL 1IE5A 3MOQA 4JPVH 5KVDH 2X4SA 3MV7D 3WHXA 5B8CA 1AXSB 4H1LA 4RMQA 3IJYB 3BQUC 4GMTH 4XPHH 5EZJB 4CMMB 1C8PA 4GQ9H 1PG7W 1XCTB 4OCYL 3CXDH 4DK3A 3OKDA 5D2LA 1FNSL 1XIWA 3HC3H 4PRPE 1AO7D 1MCKA 4IRJA 4UIMB 3BXNB 3VRLF 1BECA 1KCUL 4PJBB 1FNEA 4WDIA 1RUAL 4G6ML 2HG5B 5E9DB 1QKZH 4PTUB 5CHNB 3C8KA 3ZKMD 5I19H 3ULUH 5DFWH 1OD9A 3ILQC 1JFQH 5IKCB 3PHQB 3WNOA 3SE4C 4IIQC 4PJHE 4U4BA 3BKMH 3ULVL 2APVA 2VZ3A 2F19H 2J3SA 5DEGB 1FNGB 1GH7A 5ANMB 2MOVA 5TDOA 1M1SA 5HXMA 3O2DA 1T0PB 1X4YA 3DURB 1JNNL 3MV7B 4ODTL 1DSFL 1VSCA 3O6FC 4N68A 1IKNA 5MEOA 4HUMB 3ZT5A 3AB0B 1RAMA 4HV8A 5T3XL 3VXTB 1PG7H 2EDYA 1NLDH 2X10A 4YH6A 2YXMA 3EFFA 1KLGA 4LKXA 3PWNA 3C08H 2FO1A 1NC2D 1N8ZB 4MD4A 4U1SB 4PJDE 1CLCA 2VLLA 5HY9A 3GMOA 4Z18A 2P48B 4LAQH 4PJEE 1HN1A 5HJ3B 1J5OL 3IDGA 1BAFL 4I0PD 3NIGF 4KZEH 3I6KB 3ROLB 1CGVA 3GMMB 4KKCC 4WEMB 4U7SA 1WWCA 5DI8B 4F37F 4UZGA 4FQIH 4XC3H 5C0GB 35C8H 1BZ7B 3V5DA 3FFCD 1YEIL 1RV6X 3SO3B 1ZT4A 1J8HE 4JRWA 3TBTB 1L7TH 4F3FA 1FZKA 3ETBF 4UQ2A 2R1WA 1Y6MR 5DD3H 1B4JL 3CSYB 4HUXA 3B2VL 4K3DH 3L9RA 3VRJB 3BWAA 3IRPX 4Y5YA 1NC2B 3HB3D 4XNUL 3QIUD 4GS7B 3RPIB 2VDLH 1G7QA 5FYKH 4ORGB 4I0PB 4U49A 4JG1H 3VG9B 3QDJA 4C83B 1IGML 1AXTL 2FX8L 1JI2A 5I15H 4F15B 5I76A 4EDXA 5L2KE 4WW2A 3UZVB 1NGWA 5C07A 1DUZA 4LLVB 1Q1JH 3DMMA 2VLKE 1A0QH 4PRID 1AR1C 4Y5VA 2BVTA 5KSUA 2A0LD 4PJIB 1PZ5B 1UB5B 4K94L 5E2WL 4E9LA 3UPAA 2X4NA 4P59H 4NQCA 4PBVC 4U1KB 2QADD 2VJXA 3BP5B 3SKNA 1FE8L 3KYOB 1UKQA 3BIKA 1QFUL 4L4VA 2EEDA 4WHYH 1MUJB 2A73A 3SKMA 3RGVD 3CFEA 4KH2A 3O4OC 4G7YH 5I1HH 5JHDA 2R8SL 3I2CL 2BVYA 3QEQE 4KTEL 2WZPD 5EO0B 3O9WC 1SMAA 3IFOB 1YDPA 5EIQA 2F8OA 3ARDA 3KYMA 1LO3H 1LILA 4K55A 3VH8A 1J1XL 1G7JB 1UH4A 4PRIB 3CU1A 1ZS8A 4ZDHA 5T5FL 2BNQE 5C9JB 4PJ7B 2X05A 1BQHA 4A6YA 3VXSE 2Y25A 1YY8A 3EOBB 2DD8L 7FABL 5JPMB 1KTRL 1S7QB 4HC1H 1CBVH 5EUKA 4NN5C 5F7NC 1G7PA 3OKLA 1CFSB 5LGHH 2V7HB 2QADB 5CGTA 3EOAA 4FFVC 1FCGA 4OZFH 1I1YA 1A6TA 4KFZC 2V2XA 4M93C 3HNSH 2W0KA 4U1LA 2GJZB 1W0VA 2ORBH 4DW2L 4QXUH 2X09A 2F58L 2R9HC 1WICA 3RGVB 1CFQB 3BAEH 4ONGH 4JPIA 2OZ4H 1QSED 3KHQA 2H8PA 1XCQB 1QFWH 4Z5RB 3O3EA 1MCPL 3MYJB 2DQEH 5D1QD 3QUYA 1NUFA 3Q48A 3H8NA 1MRFH 2JJSC 4FG6C 1QSFD 4LP4A 4HCRH 4LDOB 4KZDL 3O4LD 1SVCP 4PJHF 1P5VA 2WBJA 3SO5A 1FN4A 3UBXB 3NCYS 1R5IA 2BSTA 3ARVA 1MJUH 3WDJA 5GRJH 1D5IL 5DWUL 5FA3A 2B20A 1X4XA 4N8CL 2DYPA 3GJEB 1WWWX 4FZEH 4L3ED 4YHKH 5E6IC 3V0WL 1MRDL 4H26B 4FA8A 3VFGH 4NHUA 4XTRD 3FQUB 4JVUA 1AGEB 3MMEB 3L3KB 5GS2D 4Y89A 3K1DA 4Q6IB 1S7UB 1NMBH 1TXKA 2BSSB 4MB5A 1M05A 1YQ2A 1UJ3C 5INCA 3KJ4C 1QSEB 4OV5A 4F37K 2R1YB 2WWMD 4LVNC 2R29L 3HI6H 1PAMA 5D1QB 5EU6A 1NL0L 1CIDA 4PJDF 1M7DA 1IFHL 2V5MA 1QSFB 2X70B 4KXZH 1LO4L 4PJEF 3C6LD 3O4LB 3IDIB 5HHVH 3QFJD 2GCYA 3LIZL 3IDMB 2I5YL 2VDKH 2CDFA 2VXQL 1JGDA 4LBEB 2FX9H 4NRYB 2BVQB 4OZGA 3HMWL 3V8CA 4M6OH 4X6DE 3UTOA 4PP1D 4YHYC 1T1YA 2AEQH 1I8LA 1F11B 5K9OB 2AJUL 3LPGA 4BH7A 4XNZC 2E9BA 4U0QB 4WO4C 3MRJA 2DS4A 2JIXB 3UO1H 4F9PC 1M71A 5EC1B 3GMRB 4BSWB 3OAUH 1MCCA 2FHBA 1EBAA 5DD1H 4IRJD 3B8YA 4FQ2H 3P4LA 1QNZL 3IJHA 4I2XA 1UWXK 3C6LB 4QEGA 3QFJB 4IOFD 2AI0H 4L4JA 1VEMA 2RQ8A 4FQCL 3HKFA 4I8DA 3L5WB 1MSPA 3KR3L 1ZV5A 4OT1H 5AYUL 3T4YA 4QRUA 5TDNB 3ET9F 3S8WA 2VRAA 3TA3A 4A6YL 1WBYB 4YWGL 4DEPB 3A6OA 3F6IA 1MRCL 4PJFA 2PW2A 1RZGA 2LU7A 5CAYB 4O9HH 1BEYL 4JO2L 4Y4HC 5L0QC 3D48R 3QDME 4KJWC 5E5RB 1CF8L 4NZTL 1CL7H 3C5SB 1GGTA 3UYRL 3QDHA 2XFXA 1ZANL 3BSZH 3STLA 1JYWA 3QFDA 1S9WB 1G7MA 1J0JA 3G08B 1G6VK 3RTQC 4IRSC 1A1MA 4MJ5A 1QQDB 2QQLL 4U3HA 1FSKB 1KBGL 5IB5B 1FYTE 1NGQH 1FBIL 4KQ3H 4ZFGL 5IEHA 1NDMB 4ETQB 4QCIB 3QIWA 1YUHB 3T8XB 4QF1B 1QO3B 3MACH 4LRIA 5ETUA 5JPNA 4I0KA 4S1QH 2X4RB 3IYLW 1SHMA 3TN0D 1MJJA 4PJGF 4QWWD 4LLAA 3DV6A 4NKIL 5CBEB 3MOBH 4YO0A 3QQ4B 5ESQB 4LPWA 2QSVA 5KN5B 3IKKA 4PYHA 4JRYD 5FGBC 5I8OL 5FA4B 1T4KB 1VKXB 2YR3A 3LEXB 3OF6D 4PRPB 2XNAB 2AK1L 3D5OF 3PGDA 5GZOC 1SVZA 2IPTH 4P4RA 5J12C 1TZGH 5CJXA 1XGQA 4F7CA 1YMMD 1MREL 4KK6D 3KPNA 1UEYA 2FD6L 4KRLB 1U3YA 1X3DA 2H32A 1HHIB 4X5XB 3EJJX 3DX8B 3MLPA 4DGIL 3HE6A 3MRNA 4YK4C 1LE5B 2XZAH 5E8NA 2F74B 3WIFB 2CGRL 1OTTD 1L0QA 2NY6C 3BFOA 1L4IA 1DBAH 3NCEB 4D2NA 3VXPB 1JMZA 3QUZB 4KXZI 4M62L 4UV4L 3S3SA 1DCLA 5C1MB 4HHAA 4JRYB 4HWEL 3CFCH 3QUMA 2W9EH 5I1AB 4NNPL 5EORH 3MLXL 3PWLA 1FAIL 1R24A 1KB5H 5F7HA 2ATPB 3GSQA 1GGBL 5BXFA 5DTFB 1YMMB 4POZD 3PWPA 2MQCA 1L9MA 4ZXBC 1B9ZA 1MIEH 3SJVA 3C09C 5JW4M 1RZJH 2HJFB 1R3JA 4OLUH 4PJEB 1ZVSA 2XTJC 4M9PA 5IJKA 3O41A 4KVCL 4BZ1H 3ARDD 2Z8SA 1FP5A 3CDCA 4C56E 1MFBH 4P2RD 2B0SH 4YHOL 3BPOC 4X6DF 4NKDB 3MLSH 5AEAA 1ZGLM 4D0BA 5H2BB 5F9OL 1WAAE 1CN4A 2W60B 4XCNA 3O45A 2ZG3A 4G8EB 5E2VH 3EZ8A 2GJ6E 5DD0H 4UT6H 2XKNB 4JJ5A 1ZKAA 3FAWA 4ELKA 2F8XC 3TF7C 4O4YH 2DQGL 1QZ1A 4OCSL 2UUDK 2X4OA 2D4FA 1ZXQA 3MBEA 2NYYC 4NQEE 2F54E 4GBXC 2D0GA 4RMTA 2VH5L 2AJXL 4HWZB 4L5FL 2XKUA 4IOIB 4Y19D 1I9RH 3JWOC 1NAMB 3FJTA 5ICYB 4LEXH 2IH1B 1D7FA 3UTSE 5E03A 4TVPE 5J06A 2XQBL 3TVMA 3B9KD 5ALBL 4BELD 5L2KB 1ZHKB 1KGCE 4P2RB 1KB9J 2WBJD 4OB5L 1CL7I 4NGHH 4K23H 3HC0A 3QISA 4L3CA 1MHPH 2CRMA 2IADA 4OQ1A 3C60D 1WV7T 3TYFB 2VIRA 2ICEB 2DWEA 1L7IL 3P3YA 3IXAB 3I9GL 5IOPA 1MFAL 1R3KA 3N1FC 3QI9B 5IMKB 3WHE1 1GGUA 5JO5A 2I60H 2X1QA 5E6ZA 4W6WB 2BVUA 3LY6A 4XWOC 1BM3H 5HHPA 3OAZH 3C6SB 1VERA 1A1OB 3L6FB 3IDNB 4Y19B 2COQA 15C8L 3BWUC 4J4PA 4OZHE 1LEGB 5LWYH 1X9QA 2N56A 4ZTPL 5FCSH 5DUPL 3RVUC 4JEGB 3WIIL 4L4TA 5FCUH 1EXUB 4JO1H 1H15A 5DHXB 5I9QC 4XX1G 2IPKB 3AUVA 3PHSA 3Q3GA 3T1FB 4IIQB 4BKLB 5HD8C 1DUYA 5TQ2H 1CGWA 4RAUA 3C60B 5CP7B 4CVZB 3TC9A 1FFRA 1NGPL 5EZOL 3W0WD 4XXDA 2H1PL 2NTFA 2PO6C 1ZGLA 1RIUL 3P30L 5FDYA 4PJGB 2AEPH 3QIBD 4KJPC 1JHTB 1N6QH 2YPLE 4C55A 2EIZB 3RY6A 1FIGL 5E2TL 1FPTL 2EO9A 5CGMA 3MLTB 4OBSA 1TIUA 4O2FA 4AH2B 1OAXH 1RJCA 3SBWC 1ZWIA 4G6JL 4ZSOA 4ZPVB 1TENA 2BSRB 3PV7A 3QG6B 3BRGC 4GLRH 4QXGL 2YA2A 1IJ9A 4X5LA 5BO1L 4R2GD 4X7EC 1NGXA 1BFVH 4FOMA 1IT9L 2DI8A 2P8MA 5HYJD 4J2XA 1AC6A 3RZCD 5L8KB 5IT2H 3GSOB 5HHXL 3BZDA 5HVGB 2XTJE 2VQTA 5DQJB 3W0WB 5BS0D 5J11C 1S5HB 1DBML 5FYJU 1JZ5A 5K9JL 4GAGH 1PX3A 4ISVA 5JR1L 4NWUH 1UADC 3MUGA 1J7VR 5DVKA 2EZ0C 3FT2B 4GW5A 4IEFB 4UIKH 1REIA 3RVTD 1NCAH 3IDJB 5IIEB 1R3IL 3BKYL 4PG2C 3TZVD 1FNFA 4FZ8H 4KROD 3GHBL 3FRUB 4OV6F 4WEBH 2IBZX 4M3KB 1BQSA 3SDXA 4DZ8B 1IAOA 5EC2B 4R90L 3OKKA 4R2GB 3D39E 1FL3B 3ARBC 1FNSH 2ESVE 5HYJB 3B5TA 1Q0YL 4XGZA 4E41D 3HMXH 1CFVL 3RZCB 1KCUH 1Q38A 1LGVA 1SJHB 5GS0D 5KSAA 4NJ9H 1N7ML 1RUAH 5HVWA 5BS0B 2XZQL 1U8LB 2VSCA 1KV3A 1ZSDB 4OF3A 5KANG 3VWJA 5C0AA 4L9LA 3W9EB 4KTYA 1N0XL 2WBKA 1GGIL 3W9DA 4M7KL 3ULVH 1BQLL 3H0TA 4EI6B 2YUXA 3VXUE 3DBXB 2P5WD 2X4UA 4YBHA 3TZVB 3QXDA 1JNNH 4KROB 4ODTH 2OMNA 3GRWL 2HVJB 2VLJE 1DSFH 1FVDB 3S36L 4TNWK 3L7EA 1G9ML 2AAVA 4Z7WE 5T3XH 1FDLL 5ESVA 3NAAL 5E2UL 1ZHNB 3NA4A 3QULB 1W0WB 2O93L 4PJ9C 3L7FA 5L88L 1ZA3A 3D69B 5DDHA 4FQQA 3EJYD 1A7RL 5C0JB 1OAZL 3GK8L 2PCPB 3HUJB 4MSWA 4TSCL 2XICA 4I3RH 3T0EA 1A7QL 4GKOA 2EYRB 5DD5L 1MHHA 1XEDA 1N59A 1DBBL 3ECBA 1A9BA 4ZOBA 5FO7B 1DN0A 5F9JB 2P5WB 4FXGB 4XH2A 2Y4SA 3MNZB 5J6GA 4PY7B 4TOYL 4LKCB 1EGJA 3ARSA 3WFEL 1YEIH 3ULUC 4BUHA 5CSBA 5GISL 4J12A 2CRIA 1P7KB 1FH5L 4OZHF 1C1EL 4MGXA 3B2VH 4DGVL 1QLRA 5JXEC 3RZWA 1D5MB 1QEWB 2X7LA 1S7XA 1JPFA 3D0VA 5EUOA 4RFEA 3VG0L 4V1DD 1DQJA 3MJ7B 2YRPA 2G75B 2ZJSL 2F15A 5ITBL 5JW5B 4JFQB 1Y0LB 2Y6SC 4E0RA 4Y8DC 4XVSH 4EUPB 5KJRH 1HI6A 4GLRI 1T1WA 1BD2A 1WVZA 3FFDB 5FM5O 3IJYA 3U4EB 4KQ4L 3ARUA 2BDNH 3P0VL 1RJZA 1XCTA 1C5CL 4F7MA 3MRFA 3CFKA 1IEAA 2YD4A 4FQXD 4HS8H 4ZO7A 3ARZA 4K94H 3TCXA 1PVHA 3NPSC 2M8XA 2G5BA 4PJBA 4XWGL 4YHNA 3SDAD 5B39A 1UJ3B 4HS3A 2V6HA 4ZYKA 2HMID 1HDMB 4ELME 1E0OB 5IKCA 1T7WA 3CH1A 3TVMD 4JFDD 4PJAA 3PV6A 2XWBA 4N0YL 1EVUA 1T89C 1AKJB 2FEDD 1LO0L 2H2PD 4KTEH 4LGPB 1U3JA 5MP6L 4B0MM 1WF5A 5C0IA 1IAKB 2FJHA 3FB6A 4Q6YA 5CSZB 5DJYA 2JLLA 3IT8D 5TH2B 1VPOH 3D0LA 2C4XA 4N0RA 1HNGA 3HS0B 3RVWD 3G5YB 3VXTA 3KXFA 7FABH 1D9KD 2DIBA 3FOMA 2ICWA 4FQXB 4P3DA 5HBBA 1D5ZA 2EDKA 3OKNB 4OZIA 1H3UA 5MI0C 2W0FA 1KT2B 3SDAB 2B1HL 1JVKA 2D7PA 1X5LA 3P9LA 5E8OA 2AEWA 4WHYG 4DW2H 4JAMB 5HJ3A 2WWKO 1PQZA 2NZ9D 4U6YB 3UX9B 3HE7C 4BH8A 1CFNA 2CK0L 3MLWL 4Y4FD 3O81A 5AUMB 3ROLA 3FZUD 4NO2A 1KLUA 4UUJA 2BNRA 1T22A 2EC9U 1MCPH 5H35B 5ID0B 5C0GA 3DX7B 3RDTC 1MVUB 1BVKA 5EZIL 1KIPB 4XVTH 2RJMA 3LKOB 2J4WL 1D9KB 4L8SC 3TPUA 5DWUH 1LP9B 4CU6A 4N8CH 1BJMA 4PRBA 2R2CA 1OAYL 3U4AA 3DTXA 4OZFG 1KJ2B 3SKUD 3V0WH 2B4CH 4JDVB 5EIIB 1XGRA 3GSWA 2CIKA 1L0YA 3V52H 3VXMD 4BA8A 1MLBA 4JB9L 4NQXB 1ITBB 5IMLA 3L3GA 4HH8A 2VXVH 4B5EA 3BN9D 4M5YL 4ORGA 3DUSA 1QTYT 2YRLA 4JY4B 2Z91B 3E3QE 4O2CA 5C08D 2LU4A 1F4WL 4PJ8D 1CDIA 3CIQA 3S37L 3RTQB 3PNWB 4IRSB 4JFYB 1NL0H 1IFHH 2OBGA 4EN3A 1A02N 1U93A 3OL2A 3HZYA 5SX5K 3QPQD 4HFUH 3LIZH 2PW1B 2MPAL 1UB5A 3EGSA 3LQMA 3X12B 2I5YH 5C8JA 2VXQH 4PREA 2BVPB 3BP5A 3HMWH 4MAUH 2YPLD 4TSBH 1WBZB 1RK1A 3VXMB 4U2ZA 1EAPB 5C7XH 1KTLB 2VZSA 1GOFA 2N4IA 3O3UN 4PTTB 1FG9C 4NKMB 4TYUA 5IP4A 5C08B 5EO0A 12E8H 5CZXD 5FV2A 3IFOA 4JG0L 4JANB 4DN4L 4J1UB 1QNZH 4UTBH 2IANE 4AMKL 3UP1A 4PJ7A 4AIOA 2UYLA 4N0UE 3PWVA 3EOBA 3GB7A 5CLWA 4YK4B 4OZ4B 2J8OA 3T65B 4FQCH 3R06B 3VJ6B 3LKSB 2MQ0A 3AREA 1AFVL 3RY5A 3KPQB 2YPLB 2ARWA 3EDKA 5AYUH 1INEL 2OLDA 4NDMB 3QWOB 4M1CD 2WIIA 3EO1A 2HFFB 5EBLB 1EMTL 3K8KA 5KBNC 1A7BA 3LRSB 3VDAA 4MWFB 2AXGB 3GI9H 4PBXA 4AIZB 1CFQA 1YEFH 3WL9A 1MRCH 5HGHB 3AU1B 1EEQA 1A7NH 1KPUB 1MAMH 3MYJA 3RWIB 4ELMF 1A6VL 4ZXBB 1CF8H 1U8KA 2F53A 5HDQL 2IH3B 3C2SA 4FQHB 4F33B 3C09B 5IGXH 1WIUA 2C3HA 3L3DA 4WUKL 4CVWA 1ZANH 5FO9B 3JV4B 1T80A 3MRLB 3HZVB 2APWA 1UM6H 4CVUA 3T0ED 3QG7L 4CUCA 1S9KC 1T7XA 3NFSL 2QQLH 3TBVB 1KBGH 3JSSA 2P45B 1AGDA 4MMXC 2ICCA 2X9WA 1QLEH 4XBPB 3PIQA 4JM4H 3H7LA 2GY5A 4YQXH 2MHAB 2F8VA 4LSRL 3IAQA 5DVOA 3EO0B 2GKIA 1G7IA 3CFIC 5ITFB 2ZSWA 4P99A 5DEFB 4NM8L 1J10A 4OF7A 1TQCC 4JKWA 3MLVL 1J88A 2X70A 2ESVB 2HVKB 3T04D 5BQ7A 1EAJA 2VYRE 4QRRD 5LCVH 1ORSB 2WQRA 4DFHA 2IAMD 3PF2A 2EH8L 3DX6A 4W70A 2DTML 4WHDA 3KNBB 3H7BA 5EBMA 1S7SA 5I1IH 2FD6H 3VFNA 4LBEA 43CAB 1JHLL 3KPPB 4G7VL 2BVQA 5J6HB 1OAKL 4OFPA 2HAZA 2RIKA 1WEJL 2DQCL 1A47A 3KVQA 4DGIH 4LP5A 2BVOA 3BOVA 1BD2D 1TFHA 5I1GL 1F11A 4JQXA 4NT6A 2OR9H 4ZUTB 3I6LE 5MENA 2CGRH 5H94B 2JIXA 5DO2C 3TNMA 2VLRA 3W81A 2AJSH 5C0CA 1RJLA 3F12A 3FO2A 4NOFA 2VLJB 5ID1B 1DQQB 4OIIH 4YDLB 1CE1L 4M62H 4UV4H 5C86A 4HWEH 5D1XD 1GGCL 2AXFB 3WXVL 2W07A 4HIXL 4YR6B 4DAGL 3MLXH 1FAIH 2XT1B 4QRRB 4RGND 2B7DT 2IAMB 1HEZA 2I9LB 3MROB 3LV3B 1B0GB 3U7WL 3LQZA 1CD9B 2ATKA 4I4WB 2FJGB 2ED8A 3QXAB 1QBLL 3V5KB 1NCNA 4DVRL 5FYJH 1GCFA 5TDNA 1E28B 1EEYB 5LGJA 1FLRL 2YZ8A 4KVCH 4LNVA 2A6JB 4OJFH 4YHOH 5BV7B 4IBLT 2XY2A 1ZGLP 1T03L 3A6BH 4L8BA 4RGNB 3PXJA 2CR3A 2SEBA 5IBLC 4OCSH 1PX4A 2A83B 3ARTA 1WFUA 4NN6C 3E8UL 4U6XA 4XP5L 5C0BE 4OFYD 3HG1E 1G9EA 4PGEB 5C0FA 3CDGA 2VH5H 2AJXH 2Y06L 4I3SH 1RD6A 1YY9C 3TO4D 3OHXB 1G6RB 3GMPB 4Y5XA 5GZND 1U91A 1YN7B 2HJKB 2BNRD 3TH3T 1S8DA 3T8XA 4Z78A 4KKLD 3GIVA 4S1SL 3QBTB 3S6CA 1F4XL 4G43A 2OJEA 1QP1A 2EDEA 5CBEA 4KHTH 1VFAA 1VACA 4OB5H 2ZUSA 1LDSA 4YGVA 1S7WB 1FQ9C 1VKXA 2MFNA 4NZUL 4PRPA 5SWZE 3VW3L 3H9ZA 2CLVB 1JGVL 1RZJC 3QO0B 1L7IH 2R2EB 1RVFL 2KKQA 3CZFB 4M43H 3WYRA 4XPTL 3BJLA 4YNYB 3EHBD 1CCZA 3IDYB 1I8KA 3DX8A 3TO4B 3O6MH 3ARBB 4PJHA 3LSOA 2NY3C 5KSVB 1Q9LB 1EERB 3GEWB 2F74A 4EN3D 1T2XA 5DUPH 2XACC 1J0ZA 3VXPA 1OVZA 1DVFC 2M26A 1ITCA 4H88L 4P23D 3AFLA 1NGPH 1Q9OA 1LE9A 5D4QA 2AJYH 1RIUH 4HIIB 1JNHA 5HHNB 4N0FA 3P30H 1WCBA 1H3PL 4HF5L 1A3LL 5DRNA 4PJDA 2C3VB 3E6FB 4WFGE 4YZFE 4PJEA 1NUNB 1DBKH 4NWTL 2OCFD 4RNRB 1DE4A 3N1PC 2VB5A 3RBSA 3B83A 1SMOA 2R4RL 2W0PA 5HYQA 3CXHJ 2BFVL 3VXRE 4XPBH 5BO1H 3KJ6H 1A1NB 4LSTL 4PV9B 4LSQL 2HRPL 1PD6A 1IT9H 5EU7C 5D72L 4GKSB 4G8EA 3VD3A 2IC2A 3P4NB 4OQTH 4P23B 1X5XA 3OKMB 5HHXH 4HPYH 4OGXL 1J8HA 1KCRH 1TNNA 4BFIB 1NSNH 1OPGL 5DHVB 4RZCB 1CICD 4XCEB 1LVEA 4NC0B 2OR8A 5JR1H 3L5HA 4CGTA 4R7NB 4HKXB 1QHPA 3BMWA 4XVUC 2CIIA 1YA5A 1I8IB 3I50H 1XR9B 2FL5B 5T5NF 3O2WH 2J12B 5ICYA 2GAZB 3HFML 2IH1A 4LOUC 1WZLA 1JCKA 1R3IH 3BKYH 2CO7B 4L8DA 4I3GA 5JQ6H 3BHBB 2HKFL 3M1BA 3LKNA 5L2KA 3ZL4L 1ZHKA 2GK2A 4H5SB 4R90H 5JIKA 2J88H 2VLKA 2H26A 1Q0YH 3S3PA 5HI5D 1OT1A 2EXWC 3TYFA 2PXYC 1N7MH 4IHOA 1R5WA 5CEZD 4NQTA 5DS8A 4BM7A 2CDGA 3EBAA 3IXAA 1CICB 4NNYA 1SJEB 4G8GE 4PY8I 2KBGA 3GMNA 1TVHB 3H9SE 3BQUA 4WV1B 1D6VH 4TULL 2UZIL 3LEVH 4AENA 3RP1A 4M7KH 2ZUTA 3J8F7 1S7VA 1CFBA 1F3DJ 3R8QA 3N1GC 1PYWB 3V7MA 3QEQA 3NPSB 1U36A 3GRWH 3OJDA 3BPNC 4Y16D 5EU4A 2H9GB 3DRQB 3I3BA 3S36H 4LRNH 4NFBA 1IMHC 1IAIH 4HIHB 2IPKA 2IANB 1V3MA 2IG2L 1T21B 2BNQA 1RIHL 3GHEH 4IIQA 4RMUA 3SE4A 4BKLA 3VXSA 1DQTA 6FABH 3S88L 5L88H 5CP7A 1A6UL 5E1AB 4K3EL 5CBAB 2X6MA 1T5XB 3C2AL 4OM1H 3O6KL 5JNYB 1OAZH 2FWOB 4TSCH 3X17A 2D7QA 2J8HA 4TRPL 1A7QH 3AY4C 2CK2A 3NVQA 5SWSD 1F4HA 3O6FA 1H3XA 1MCLA 2VLRD 5DR5L 1U9KA 2Q20A 4OD1H 3MLTA 4GUPB 1CZ8H 1YNKL 4GOSA 4PRAA 2D7TH 2BY3A 5KG9B 2CPCA 3LMJH 2AERT 4J3VA 4Y16B 4TOYH 5LAXA 4EI5C 4R8WH 2X1PA 4MX7B 3WFEH 1K3IA 1RK0A 1F5WA 1KTDB 1J0HA 1C1EH 4YBQC 1NUGA 5DZOA 3ULVC 1CVRA 2WLYA 3VG0H 5IK3B 1DLFL 4NCC1 1D3CA 1N0LA 5SWSB 5CIPB 2K3TA 5EU7E 4GW4A 4K3JL 4ZOAA 5EPMA 3FRPG 4HJ0D 2YUZA 4ONHB 3R0MA 5L9DL 4KQ4H 3P0VH 3WD5H 5HHMD 4HUNB 4JFED 4U1IA 4HAGA 4XVJH 4YZFF 1YYML 2DI9A 3DVNB 1T2JA 2X40A 1IGJA 1NAML 3HZKB 4Q9QH 4L29A 4JR9L 3AGVA 4W6YB 1YNTB 4M8VA 4QHKI 3GBLA 2ILLA 3QQ9D 1CG9A 1RZFL 4MDJB 4P4KD 2HH0L 2FECI 1HYSD 3W9EA 4X6DA 1SBSL 1I1AD 1I7TB 2EO1A 2VWEC 5B21A 5F9WC 1A7OH 1AGFB 4N0YH 5DFVC 2HT3C 5FYLD 4U1HB 4U31A 4EI6A 2VITA 3F7VB 2CMRL 1QVOB 4LDLB 3IKCA 4UDUA 5KVEL 3LKRA 1NMCC 3CPLA 5HHMB 1INDL 3O3AA 4KJQD 2A74B 2AGJL 2P7TB 5J56B 5KAQG 2VABB 1JTTA 1T1ZA 4R4BB 4Z9KB 5I8KL 2MSPA 3D69A 3IFLL 3QPXL 2B1HH 4ODWB 1NFDE 1CD1B 2HN7B 2A6DA 3GDBA 1TCRB 3O9WA 4PYGA 5C0JA 4P4KB 2PCPA 3MRQB 4YHIA 2MWCA 4YHPB 4QRQA 2IMNA 3TM6A 2PNDA 4QXWA 3GSNH 3NCFB 1I1AB 3VFSB 2GFBA 5FO7A 3MLWH 3MODL 3K4DA 1NKOA 5J1SC 3DHJA 3AC0A 1OARL 3V6BR 3OV6A 3GFUA 3DO7B 1TTFA 1ADQH 1IAII 4UI2A 3WXWL 3HRZB 3ZDXE 3QDMA 4K2UL 4LCCC 5A2LH 2CDEA 2Z4QB 3WUWA 4DOHE 2J4WH 1EFXD 3BZFB 5ICZB 5I0DA 3S36X 3WFCH 5F8QC 4HDIB 3W39B 1OAYH 3OGCB 3HG1B 1GGYA 1BP3B 3N06B 5BRZE 4ODBD 2EKSB 1FYTA 4WWKD 4X80H 4QY8A 3U9PL 4P2OC 3MJ7A 3THMH 3ZE1E 1VADA 5I66B 1CI5A 4JB9H 2JJSA 3JTTB 4JFQA 1Y0LA 4AYFA 4WTXA 2NX5D 4ORZC 5CGYD 4C4KO 5GRZA 4MCYA 5KW9L 1GJIA 5FHAL 3S34L 4KAQL 3JWDL 4ZUSA 3VWKD 5ABDE 3KPOA 3S37H 1JV5B 1ORQB 1GAFH 3F7YA 1T04B 1CXEA 1Z9SA 3C5ZB 3MRCA 5E8EA 5FUCC 4IMLA 2Z0BA 5E6IA 1ZT1A 2OTPA 3HNTL 3BGAA 3WJLC 5SWZB 1OP3H 1I3RB 1ZEAL 2YKLL 2MPAH 2EICA 1EFXB 5F7EL 2IALA 3BEWA 1AP2B 4XCYA 1IBGL 2C3WA 3MXVL 3K74B 2Q8BH 1KJMA 4OKDA 1FJ1B 1UJ3A 4XRCB 5EN2B 1MLCB 1OSPL 3QWQB 3WUZA 4DKAA 4WWKB 4YPGB 4P2QE 4HQQL 2XY1A 1E6JL 1ZLVH 1AKJA 2HFGL 4U1NB 1N5YL 2X4PB 4JG0H 2NXYB 1KCSL 4D9RE 4DN4H 1IAKA 3BUYB 1U3HC 2CLZB 4CN1A 3QNYB 5I18L 3ZE0E 5SWQB 1Q9KB 2B4CC 4PJ5E 1XH3B 2VWEE 4P49A 3CMOL 1IGIL 4YAQB 2YSSA 3FQNB 5T1LD 1YN6A 5F88B 5I17B 4WO4A 4OGZA 5D2NC 3S4SG 1NBVL 4F9PA 1AFVH 4R0LB 3VI3E 1SQ2N 3CK0L 3MLRL 1LO5B 5F7UA 3LHPL 3BH9A 3NOIA 5DK0A 3V7AG 1EMTH 2QKIA 1MFDH 4HFWB 4GRMB 4U6YA 5IHZA 1FO0A 5CZKA 2Z31C 4NNXB 1T20A 1A4JB 1P1ZB 5JZ7C 4GMSL 4C56A 5B38B 3VXRB 2PKDA 2A1WL 4MNGE 25C8L 5HDQH 4G6AC 1F4YL 1WAAA 5DJ6B 5GRYA 4WUKH 4S11A 1U8HA 2GJ6A 3CSGA 4LLYA 3P73A 1CLOL 2VAAB 2Z8VC 3FO1B 4NQEA 2F54A 4CADB 1OCWL 4IM8A 4XP9H 1MCBA 4Y4HA 4CDGC 3T0AA 2V2WA 4GH7B 4LSSH 5D7IE 3QUXC 2ITCB 2K7QA 4NQXA 1AQDB 4KUCF 3UTSA 1FZMB 2V2TB 1X5GA 3RPKA 4M6NL 5E5MA 1NFDF 3MCKA 3RTQA 2APBA 4IRSA 4LK4A 5IM7B 3TT3L 3DI2B 1Q0XL 3MLVH 5E6YA 1YECL 3S97C 4ODSL 1TZIA 1Y18A 3QEGL 2Z35B 3SDDC 3U2SA 4QTHB 5TE4L 3V0VB 3DI3B 1HHGB 2EH8H 2DTMH 3UTQA 1NFIA 3RBGA 3EIFA 2BVPA 5E00B 2E3VA 4G7VH 3H9SB 1OAKH 4U33A 1WEJH 3ZDXF 4KUZH 2FO4A 3MRHB 5FUCE 1IM9A 5D6CA 1KEMH 5FGBA 3SCMC 5I1GH 1T1XA 3OSKA 3NFNB 4C4KT 3BZEB 3DROB 3KYNA 4OZHA 4XC1H 4F57L 4XPGL 4NKMA 3RUGE 3LOWA 4FQJL 4YXLL 5CP3H 3ARFC 3P4MB 3P77B 2ADJB 4S1DC 4XAWH 5GIRB 1UKSA 4IMKC 5D7JC 4XHJD 2IQAB 1W2KT 5DJ2B 3WXVH 4DAGH 1UXWA 5ADPH 4N9GA 4D0CB 4YE4L 3S37X 4DUWA 4QYOB 1TJGH 1KOAA 1G7LB 2NY3B 4OZ4A 4X9BA 1YNLL 5D6DC 1JMXA 4DKEL 3MRPB 5GXBB 2R0LL 3WBDA 3ZDYE 2WP3T 3QEHB 2NXZD 4LNRB 2XG5A 4P5KB 4U3CA 2DKSA 4XP6H 4GAFB 1AJ7L 2R0WL 3HNVL 2DIAA 1C12B 2O5YH 3RAJH 4NDMA 4DVRH 1V3LA 2HT4C 4HSQA 4RFOL 5D96B 4PIRF 1FLRH 4CMHB 3DIFB 1EVTC 4MWFA 4H8WH 3LB6C 4ODXB 3TBSB 2D7OA 3ZSTA 1B0RB 1XFPA 3VGHA 5HHOD 4O02H 1KPUA 2OXHA 4PGCA 5F6IC 3Q5OA 3DUUA 5DGRA 3RWIA 1T03H 4ZXBA 3V79C 1MPAL 4RRPG 5DJXA 3V6OC 5DHYB 4Y4KC 1K4DB 2VR9A 5IMMB 1AH1A 3LVEA 3JV4A 1QRNE 3HA0A 2PR4L 4PG9B 4JGJA 3WN5C 2V17L 4KRPD 3RWCA 3E8UH 2PYEA 1Z3GH 3HPLB 1IC4H 3TBVA 3KDMB 4TSAH 5C71A 2NXZB 2DMBA 1U2HA 2P24A 3ZE0F 1T0NA 1OAQL 2D7NA 5GRVK 1DFBH 1P69B 4JFFE 2E5EA 2EIBA 5DA0B 3RWHA 1X5IA 4JFHE 4I18B 3X3GH 3RVXD 3PDOA 4B41A 1F6LL 3V7AE 3O3BA 1I8MB 5HHOB 5GRUL 3VI4E 5ITFA 4R4NC 1IC5H 2VDOL 1EEZB 5DEFA 4LCWE 3D39A 3QRGH 4GBXA 1FZJA 4W4OC 3JXAA 4NZUH 43C9A 3L95A 4UTAH 4CW1B 1ORSA 1JGVH 4TVPL 5D5ME 4M9OA 1RVFH 4X4YA 3O11B 1HQRB 2JK5B 4KRPB 2VLMD 4XPTH 2KUTA 5SV4A 5K33A 4ZAKC 3MGTB 2YD2A 3W5NA 1UQSB 1JZ4A 4YJZL 2APXA 4POYA 3HAEH 4Q0XL 1ZVHA 3ZHDA 3SDCC 4Y88A 2WUBH 5JUEL 2V7NA 1MEXH 1P4BL 4GKZB 4WNQB 4ZPTB 3DVGA 4LVOC 4HIJB 3VXUA 4ZFZA 4RISH 5H94A 1CFTA 3EJZC 2XG4A 4HKJB 5ID1A 4XB8A 5KAQF 4M7ZC 4X6CE 1FZOB 1TZHA 3V4PL 4H88H 4Z7WA 4F58H 2D3VA 4RBPK 5D7IF 5I6XB 5A2FA 2C26A 3DX9A 1A4KA 1DDHB 2JELH 4MQXD 3MROA 3LV3A 1XGPB 4HF5H 3KPSD 1NFDB 5CJOL 1BFSA 5BRZD 1W72A 4YFEA 4K07A 5J1TC 4PJCA 2FJGA 3QXAA 1NAKL 3QQ3B 4FTVE 1SEBB 4AEHH 4NQVB 1JWMB 5T1KD 1U8OA 2R4SL 2EC9T 5DVLA 1KB9K 3CDYA 1EEYA 1T3FA 4ZS7H 1X5YA 1MWAB 3MRBB 2R4RH 4RAHA 2ID5A 3AROA 2DQDL 2K7PA 1MH5A 2D0HA 2BFVH 2IF7A 3OPZH 3Q2CA 5IW6B 2PO6A 2YPVH 3D85D 4LSTH 2FH6A 3MJ8B 4NHCL 4YDVA 1M4KA 4LLUA 4X7TB 3A6CH 3LEYL 2V5SA 2I26N 4WUUE 4DOHB 4OGXH 2FCBA 1UH3A 2VDPL 4YEEA 4QHNA 3I85A 5TE7H 1UWXH 4R26L 2VXSL 2FR4A 4JREC 4OUUA 3SBWA 1S5IL 5K9KB 4HUUA 1A3RL 1HWHB 5DYOA 4GXUN 4M8QB 3MR9B 2C9AA 3KPSB 4PGEA 5EBWB 5BRZB 5CLTA 4JY5L 4XAKD 4QTIL 3I3EA 2FB4L 4PRHE 1BOGB 1EBPA 2EH7L 4C54A 1KIQA 2BNUA 1YN7A 2I07A 5T1KB 3V6OE 2Y07L 5K59E 3IU4L 4G3YL 3D87B 4Z8FL 5D1ZC 3DETD 3ZDYF 4GAYB 1A6AA 2OM5A 4OTXL 1YJDL 5HI3D 3V4UL 2YD8A 4LFHG 3UEZA 3DXAA 4TN9A 4Z77A 2EE3A 2N1KA 4UDTB 5JOEA 3CZFA 4PG2A 5C2BH 2DM2A 2ED7A 2HLFC 5LG1A 3QEUB 4ELMA 3BGFC 1O7VA 3UBXI 1U8MB 3VFWA 1K85A 4OM0L 3ARBA 1AGCA 5C6TL 2GK0B 4OF8A 1AI1H 3MRDB 3ARQA 4KK8C 1VGKB 1KPVA 4U6VL 4JRXE 4YXKL 4ZG1A 2CKBB 1J05B 2E7HA 5FYJE 3SKJL 2OP4L 4AT6B 4DVBB 5HSFA 2J1KA 2BCKA 4C57C 2P8LA 2IG2H 4PJ5B 4HMEA 5CUSH 2EDOA 3VFVB 2OTUB 4H0IA 4AJ0A 1HE7A 3BIBX 4K3EH 4JO4H 3MV9A 3ZKND 3C2AH 3O6LH 1YPZE 4WFFD 5HHNA 5C0DA 3CVHA 3O6KH 5JA9A 1Z0NA 5DC0A 1CGSL 3QWRD 2UZXB 4NO5A 5T3ZD 2C3VA 2ZCKL 4M48L 4XMPL 5F7DB 5KTEL 5D5MF 1XF5A 4JFXA 1YNKH 2DWDA 3MFGB 1OTUD 4PJ9A 1ERNA 1H9VA 5J7CC 3IF1A 2NNAA 1W72L 3TO2A 1E4XH 4PB9H 3U0PB 4HJJH 2YBRA 4KPHL 4XMKH 4AL8L 3FO0L 4LMQI 2WANA 3C87A 4JM2F 1U95A 4G8IA 2BX5A 5IR1A 1I3GL 3IVKB 4CVXA 1F3JA 4I9WD 1WC7B 2PF6A 2E9WA 3LPFA 4XCEA 1J11A 3DYPA 2EEAA 4PJXE 3H9HB 1X6NA 5DK2B 4X6CF 5FXCH 5KSBE 3U0TB 1I8IA 3GSRB 2HTKD 4G42B 3KPMB 5D7IB 4WIQA 1S9VB 4LCCB 3PP3K 4NBXB 4K3JH 1WZKA 1S78D 1FFOB 1IM3A 1HXMB 4IDLA 4KC3B 5L9DH 4BK4A 1MCIA 2EDNA 4TUJB 3T0XA 5JXEA 4FXLA 4GRWE 3EUUA 4KKAD 5MERA 1S9XA 1YYMH 5DRXB 3L3HA 4IDJH 4HK3J 5BZDB 1NAMH 2PYED 3NCBB 2R56L 4JZJC 2FHFA 3GBML 5I75B 4PPTA 3EO9H 4DZBB 3P9MB 1UWGL 3RVVC 4HX1A 1RZFH 5FKAA 2YK1H 5ISZE 2HH0H 2UUDH 5HGGS 4RX4D 4M61B 1SBSH 3D25B 2PTTA 3NFPB 4X6BA 4U05A 4XBEH 2UWEB 2WBWB 1QLFA 5L2JB 5FO8A 1ES0A 3BW9B 4YEFA 2FATL 5BCAA 4XCCH 4RFNB 2GSGB 3CX5J 3OG4B 2CMRH 1NGYA 3FQTA 3OGOE 3QNZB 3MO1B 3Q0HA 4F7PB 3F5WB 3SKOB 1DQML 5KVEH 1JHKH 3FT4A 4YIQB 1ZT7B 4L8CA 2RCSL 5IHUL 1INDH 2QJDA 4NSKB 1L6ZA 4HIHA 4FABH 1T21A 5K59F 5DC9B 1OGAE 1YQVL 4N0UA 5DD6B 3CGTA 2W38A 5DJCA 5I8KH 2EDLA 1T89A 2KDGA 3LZFL 3FONB 4Q2ZA 5ILTH 2VSDA 3ROOA 5JNYA 2FWOA 1U92A 4HJGB 3C8DA 1Z9OA 1MHEA 2PTUA 4G8FB 1AD9B 5JOPE 4XXCC 3MODH 4GUPA 3FMGH 2NY0C 1QFWM 1T2QL 4IRZL 1K6QL 1LMKA 4MDIB 1U58B 3ARGC 3WXWH 4OCRL 4Q9RL 4TQEL 1ZLWK 4K2UH 3NACL 3U83A 1EIBA 5ESAB 4MX7A 1FLTX 2NTSP 1Z6JT 5LBSL 1ZA6B 1S9YB 2C1PA 1GOHA 3AMLA 3GGWA 2ERJC 3HE7A 4MNHA 5EO1B 3RL1B 2Z31B 2R2HB 3MRMB 4PRNB 2EDXA 1H8SA 4U1GC 4LARL 5IB3B 5KVDL 3LS4H 5JDSA 1I7RA 4AQ1B 1UEMA 3S5LB 1NGZB 4JM2D 4XPHL 3RDTA 5CD5C 1TCMA 2ZOLA 4JDZA 1HHJA 3S34H 4KAQH 3JWDH 2GITB 1YPZF 4L8SA 5C09D 4F2MA 4LCWB 4NPYA 4I5BA 1ND0B 1QKZL 1EJOL 1OSZA 5I19L 3QUXB 4M1DL 5F7EH 1UZ8B 4LIQH 5D5MB 4GRLC 1FG2B 1IBGH 3MXVH 2JB5H 4EEEA 4LLDA 3HLAB 2RR3A 4MDJA 3TP4A 1JI1A 4HC1A 4FTVD 1XMWA 3NGBB 3C9NB 3MJ6A 4ZS6C 1KIRB 4YDIH 5IJVB 2BOBB 4WRLA 2VERN 3PQYD 1MJ8H 2YD7A 4JM2B 4OZFA 1E6JH 4UQ3B 3SDDB 4YC2C 4G80A 3LDBC 1UVQB 4O00A 1U8PB 1X44A 4CNIA 5IB2B 3UTPE 3OX8B 2VZOA 4PJXF 3EZJB 1NLDL 3LQAL 3DXAD 4LHUG 5C09B 2EZ0D 4X6CB 3ZO0A 2OZ4A 3UYPA 2DLIA 4WCYL 3CMOH 1IGIH 3L3OA 2HT2D 3D3VD 4R96A 5CEXA 2A74A 4QNPE 3W2DH 4HKZB 4JZOA 5GS1B 4HCRA 2JCCE 3ILPB 1S7TB 4LLWB 2QLVB 1EDQA 4N5EC 5IF0A 5CKAA 1JYVA 4ODWA 5AYQA 3VFUB 4KZEL 3CK0H 2HN7A 4GRWF 1TCRA 1GIGL 5TGBB 4FTVB 5I0ZA 1RPQA 3CUPA 2OQJB 3HRPA 4XB7A 5TPWL 4R97B 3VFSA 5GS0H 4FQIL 1IC1A 2ARJQ 35C8L 1BLNB 3PL6C 4OCXL 4GMSH 4S2SA 1L7TL 5BZWA 4K3HA 3DO7A 2A1WH 5L6YL 1H5BB 2AABH 5DD3L 4PLJD 4ZUVA 1OT2A 4WUUB 5ICXB 4J6RH 1WQVT 5DJZB 3STZA 1EK3A 3BZFA 3BDBA 3D2UD 5IQ9B 4TUOB 4X7FC 3GJFK 5E8PA 5C0BA 3HG1A 2F5BH 2VDLL 2J8UE 4BQ9A 1MCEA 4NFDA 3FB7B 3NIFE 4K7FA 4PRHB 2NPLX 3UZQA 4JY6B 1X7QA 5LQBH 3AXLB 3UTTA 3FCTA 3KLSA 4XNQB 1A0QL 4MA1C 1XGTB 2EIDA 4M6NH 4EVNA 2HJLB 3GJFB 3BP4A 1ETZB 2DQIH 1Q0XH 2DDQH 3OBAA 4HH9B 3HC4H 3BO8A 4NRZB 4P59L 4RWYH 3SE8H 1YECH 4ODSH 3OR7A 3BN3B 5J13B 4GG8A 5SWZA 3AB0C 4XNXH 3ARPA 4EUPH 1V05A 4QHMA 3QB7C 2XA8L 3D2UB 4Z7QE 3MV01 5CEYB 4Y1AA 4K8RD 4NCDA 1JF1A 4ODUB 4G7YL 5I1HL 3G5ZA 1ZVYA 5DUBB 3MV11 3RJQB 1MQ8A 4OKVA 3DVFA 1IEBA 3ZKMC 3IETB 3MSPA 2A6IA 4KDWA 1DANU 4P3CH 4X99B 1FVEB 4AQOA 5FF6A 4F57H 1UB6B 4PLKD 1C16B 4X9HA 4NRXB 2YUWA 3TFKC 1IARB 4X8JB 1RJYA 4CBPA 3MX0A 5I2IA 1DP0A 2O61A 3BUYA 1EHXA 2Y6SD 1K2DB 9CGTA 4Z7UE 3TIEB 5LGHL 3ISWA 4F7TA 4N0CC 2Q6WB 4MA8H 3HNSL 4LVOB 1YNLH 2ORBL 3SO3C 4NKQB 1YPZB 1P4IH 2R0LH 4QXUL 1MFNA 5FOBB 4D0DB 3CCHB 2HLAA 5MHSD 1HIML 4ONGL 3OKOB 2R0WH 1AJ7H 1MCQA 4X9FA 1PFCA 2OZ4L 2UVEA 32C2B 1QFWL 3MA7A 4X0KB 1JZ2A 2DQEL 5CCKL 4GRMA 4NO0D 4OF6A 2FX7H 3IGAB 4I0CC 4GS7C 4NNXA 3MGOA 5D7LE 4PLOB 4I0PC 2YXFA 3X11B 2YWYA 3VXRA 1FFPB 1MJUL 5F7KC 3FTGB 4F15C 5DJ6A 1I1CA 5F70A 2HP4A 1MQKH 4FZEL 4YHKL 2PR4H 3LN9A 3VFGL 3QXUA 4Z7VE 3CFDB 2VAAA 3FO1A 1KEGL 1DQDL 4RDQG 1OWWA 2QL1A 3VGAB 5DQ9B 2HFEA 4MJ6A 3DYOA 4QNPF 5BVPH 3HB3C 5IVXE 4ZO9A 1FCCA 2JCCF 4HLJA 3QIUC 5DGQA 1R3HA 2V2TA 1EX0A 5IB1B 1KJ2H 2VDOH 3TIDA 4GRWB 4QO1A 2Y7QB 3QNXA 5CD3B 2AS5M 2Y5TB 2Y72A 3REWB 4JHBA 2FX9L 4U1MA 3WKNA 3DRTB 2BERA 1N2RA 5CKGA 3V0VA 1SYSB 1F4AA 4LPXA 3BD5A 4EIGB 1M6OA 4WW1B 1Q94B 2AEQL 1UENA 1G1CA 3IFPB 2FIKB 4H8WC 4G8GA 2XN9D 3B6SA 4NC2B 2NY7H 3H9SA 5ANME 1KB5A 3RDTD 4LVEA 3UO1L 1JF5A 2QADC 3BH8B 2ZSVA 5JUEH 3VFTB 1XF1A 3VXOB 3MV7E 3OKEB 3UBXG 4NN7B 4WU5A 5DD1L 3MUJA 1P7HL 2C1OA 4RAVA 2A6KB 3DROA 5GSRA 3RGVC 1AO7E 2JJTC 2J8UF 2Z93A 5AAMA 4FP8L 3P77A 2ADJA 3NIFF 5B4MD 2BY1A 3OXSA 3V4PH 5T1MB 4PBWD 3BGFB 5DJ2A 2I27N 3PJSA 3VXNB 3VFPA 3QJFB 5SX5H 2P1YA 4OT1L 5J9PA 1KJVB 2VKWA 3LN4B 5D7KD 3MRPA 4OI8A 3VU2A 5HDBE 1NAKH 1U6AL 3HAEG 1DVFA 1CIUA 1TLKA 2R4SH 1NC4D 1N5AB 4YDJB 4O9HL 4OLXH 3PDGA 4XZUB 4ODXA 3NN8B 5IFJA 1CL7L 1U8IB 3QUKB 4PV8A 2ZOKB 4Z7QF 4Q6IC 5I16A 3BSZL 3PHOB 4RIRB 4F8TA 2W0LA 1N4XH 5FGSA 3G6AA 1OHQA 3RX5A 5D1QC 1ZHBA 1J18A 4KRMB 4NYLB 1I7UB 2VDPH 1EA9C 1IGYA 1NGQL 3P11H 4HD9A 4R26H 2VXSH 4PG9A 4ZFOB 1NEUA 1A3RH 3TWCL 3M17A 3FQXA 4GG6B 1JBJA 2W65A 3MC0A 4S1QL 4QTIH 4JDTH 4Z7UF 3ARYA 1AGBB 2EH7H 3WFZA 4MCZB 5DVMA 3MOBL 5HGAA 1NC4B 4G3YH 5DMIL 4XTRC 4LF3A 4ONFH 4Z8FH 2NR6D 1GZPB 3UTPD 1KPRB 1HXYB 1BZ9A 4PJIE 4QHLB 3FFCE 4OTXH 1FFNB 1I8MA 2H2SD 1YJDH 1TZGL 3V4UH 1AE6H 4BYHA 2WWMC 4UMGA 1C5DA 2M2DA 4QHUB 4HK0B 5HGBB 3ULSB 1HILA 1I85C 1TQBB 4APQD 3C6LC 3O11A 2XWJB 2KZWA 4P2CG 1HQ4A 2ICWJ 1B6DA 4RMSA 4PP2A 1FGNH 4S1RH 1FVDA 1G7HA 3UTTD 1TDQA 1HH9B 2R1XA 2EIEA 4PP1C 1NDGA 4OLYH 4HIJA 2FIRT 2GW5A 4PRIE 1B90A 2BY2A 2PXYA 4Z7VF 5EORL 2H6PA 1BIIA 4DEPC 3JVGC 4Q7DA 1KB5L 3VCLB 3Q6GL 1CWVA 1UZ6E 3CMGA 3MREA 4S0TD 2AJ3B 2JB6A 1BX2A 5IVXF 3SPVB 1MIEL 4IS6B 1WTLA 5IMOA 3B4NA 4OLUL 1QBAA 4HIEB 4APQB 3EDDA 5I1DA 2VISA 3TNNA 1K8IB 1CGSH 2MKWA 4IOFC 5C70A 1TJIH 3P4OB 4JKLA 1FSKC 2DQFB 2P47B 2B0SL 4XMPH 3TBYB 5KTEH 5BJTB 4MAYD 4HGKC 3CAFA 3BGMA 3F7PC 3E6HA 1CT8B 3RI5F 5DC4B 4O4YL 1V7MH 2WLZA 1OOAA 4AL8H 4KPHH 4MJID 3FO0H 1F6AB 5GGRA 3AY4A 4D94A 1F6FB 1I3GH 4LPTA 2VQ1B 1QACA 4QOKD 4AM0A 2RFXA 1Z5LB 5BV7H 4HUWA 1KSRA 4LEXL 2G2RB 3HMXA 3WEXA 3MR9A 4RA0C 2EDJA 5JORB 1TITA 5D9SB 1QSEE 4ODVL 2AV1B 4EI5A 1BOGA 2AV7A 4LLQA 5E94B 1KNOB 3MRGA 3U9UB 3B9DA 3EFDL 4EQ2A 2Q86B 2DM3A 2FBOJ 3K1KC 4MAYB 4Y2DD 1QSFE 4K23L 5GPRA 4U6HA 2XRAL 2H45A 3O4LE 2X1OA 1WCQA 4XP4L 3CLEL 4N8VB 5HDBF 4X5WA 5IEKA 3TN0C 1A21A 4G9FD 2MMXA 4QWWC 4MZ2A 1G6RH 3QUZC 5KVMC 4M6ML 4MJIB 4M7LH 3FB8B 5F3BB 4PR5A 4K71B 5DRZA 4L3EE 4HMDA 2R56H 3G6DH 1BFOB 1UWGH 5FIEA 3RNQB 1NMAL 3DECA 4LMQE 2GTZA 1T0MB 4KK6C 2CUIA 4O51B 1LNUB 3NABL 5LWYL 3S7GA 2CLRB 4P2QA 3WLWC 2FATH 5FCUL 4MA7H 1DLHB 4G6FB 5IBLD 1T6VN 1V7NH 2C7UA 1AD0A 4JO1L 3KWWA 5INDA 4NQDD 4Y2DB 4GRLB 3WE6B 1DQMH 2BJML 1HH6A 3QFJE 1OTTC 3I02B 1YY9D 2RCSH 5IHUH 4DVBA 4RMWA 1CXKA 1KXQE 4G9FB 4HEME 3FRPA 1UT9A 4ZUUA 1HSBB 4NJAH 1SYVB 4P5TD 4F7EB 2AEPL 1YQVH 3VE0B 3ZDZE 1PJ9A 4NUJA 1N6QL 1ONQA 1WWBX 1K4CB 1ED3A 1KJ3H 2CSPA 5F7LB 2I9TB 3MUY1 3LN5B 1CE6B 4POZC 1KXVC 1BBJB 2EDFA 3H42H 5IBUB 4UT9H 1J87A 3JUZA 6CGTA 1MI5D 4QXTB 1XF3A 5BVJB 1QR1B 1QHOA 4W4NA 1RZ8B 1T2QH 5GGTH 5D7LB 5K93A 4EDWL 5JW4N 3BJ91 1QFPA 4NQDB 2W9DL 3GO1L 5IT2L 3C8HA 4OCRH 5KVGL 4Q9RH 4JZNB 1BBDH 2DMKA 2YA1A 4MNGA 4FQPA 3NACH 5D7SL 1GXEA 3T3ME 1PLGL 2JJUA 3WFHA 4P5TB 3WIHL 4X4XA 4K7PY 3FQWA 4LHUB 3HHRB 1MWAL 4RDQF 4GFTB 4LPCA 3FO9A 1AHWB 4Z7VB 2Q76A 5K9QG 4UIKL 3O3DA 3PGFH 4LARH 2I24N 1MIMH 1GZQB 3GMLB 1T5WA 1EHLH 1UZ6F 3MLYH 1UFUA 1ZHLA 4H25A 4FZ8L 1LD9B 3QI9C 4LL9A 2P5ED 4WEBL 3U46A 3ZKQD 4G42A 4LCCA 5HVHB 3EYFB 1MI5B 3LKQA 5SX4H 5IVXB 5DHVH 5IVZA 3LD8B 2EDQA 3FHAA 4UT7H 1EPFA 3RI5K 1FV1A 1F02I 2FGWH 3TJHC 2VUYA 3HMXL 3QCUH 3O8XD 1CLYH 4NJ9L 3B9KC 4TTGA 1NEZA 1OF2B 1EJOH 4P2OA 4M1DH 4P5MB 2IEPA 3C60C 4MA1B 3OR6B 4BQCA 3BVNA 5F3HB 1G0DA 4BK5A 4M61A 4HGWB 4P46D 4UOW1 3F65A 3K46A 5F1NA 4Z7NE 4LCYB 3M45A 3OZ9H 4MHHG 4MD5B 2ZG1A 3WFDL 3WJLA 4NKOB 2D31A 4JRYE 2CUHA 3IXTB 3RKPA 2H3NB 3EW3B 3F62A 4NQUA 5AD0B 1AO7B 4JHZA 4F7PA 2YPKB 1UA6L 3RUGA 3LQAH 3O8XB 1J9CT 4YIQA 3KS0H 1YMME 3E2HB 4WCYH 3HCVB 5ENWA 2CJUH 1LDPH 3OXRA 2GY7B 2OSLA 4X9IA 3TCLB 5DD6A 4PGDB 4I3RL 5CJBA 2CKBL 2E7LC 5JLZA 3JWDC 1GIGH 1CR9L 3JTSA 4KU1A 1JNJA 5C07E 3E0GA 2EYTB 1U3HA 3QIBC 1F58H 5TPWH 3ZHKA 2YD1A 1AD9A 2NW3A 3OB8A 1I1FA 3MOAH 5J0BA 1RUQL 1W0YT 4JN1L 2NY5H 4O2EB 5LGKA 3FB5B 4OCXH 1MOEA 4UBDD 3R1GH 3HI5L 5D2NA 5L6YH 3FN9A 3FT3B 1AQKL 3UPRB 1S3KL 3AAZA 5F6HJ 3RWEA 4R2GC 3PWUB 3QDGD 3DSFH 5CWSB 5HI4C 2EEBA 1QRNA 2ADIB 1S9YA 1NJ9B 3SQOH 3RZCC 5EO1A 1JPGA 2Z31A 2AJZB 3X13A 4KVNH 2X9YA 3D1MC 4XVSL 5A16B 5KJRL 3L5XL 1A7PL 5IG7A 3WNNA 1P4LA 1YEDA 4P2RE 3S4SA 4JFFA 3ALWA 3ZDZF 2X5PA 4HS6A 4U6TA 2BDNL 3JZ7A 5C0RH 2QSCL 3RVTC 1QPXA 3FFCB 3MPCA 4BSVB 5IFHL 4HS8L 3EYUL 1HNFA 4MQTB 3UPCA 3TZVC 4UNUA 4KROC 1I4FA 4LCWA 3K3QA 5CIPH 5KANI 1JK8A 1K8DA 2VTFA 1ND0A 3QDGB 3QUXA 4OCWL 5FUOL 2XA8H 3Q6FA 3QIUB 4OI9A 3SN6N 3HLAA 5GS0C 4Y19E 3C5JB 1M7IA 1P2CA 3T3MF 4E42A 5AZEH 3L3JA 5SX4I 1RUPH 4UQ3A 2WM0A 5DJ8A 3SDDA 3ULVD 4LPYA 1VPOL 4ZOCA 4E5XB 1KCVL 3IU3A 4X6CA 3MRKB 3GUTB 2E8ZA 3VGEA 1HHHA 2G9HB 1SY6A 4PJGE 1KLFA 5T3XD 5DJDA 3SCMA 3T2OA 4EUPG 3QCTH 2QR0A 1VFBB 3ILPA 1G9NL 1S7TA 4LLWA 1HIMH 4XNMB 4Z76A 3VFUA 2HTLC 3EJYC 3ARFA 4B7IA 4J3OC 4GSDL 2HWZH 1RZIB 4IMKA 5D7JA 3TH4T 4NQSB 5CCKH 4GT7A 5I73B 4WFHD 1IL1A 1D6EB 3MUZ1 1NCUA 2FYYB 1NQBA 4QT5A 2GHWB 4XVTL 1HSAB 2IFGA 4D9LH 5D6DA 4JHWH 4TPRH 4RQQA 3MV8A 3W0WE 3NTCL 4Z7NF 1Q9WB 2YD9A 2B4CL 4WHTB 1FC1A 3QP3A 4TNVK 5FYLH 3RL2A 3V52L 4DJMA 3UC0H 4XI5D 1UXSA 3VFRA 2VXVL 1KEGH 1U8JB 3O2VL 3QH3A 2BP3A 4LIQE 1DQDH 3DHMA 1HOCB 1TVBA 4PRHA 2AK4D 3GMQB 5KS9B 5FK9B 1F45A 3WSQL 3V6OA 2QTEA 4Y4KA 3FQRB 5DRWA 5I1LA 5GGUA 3HAEB 1FL5A 4PGZA 4LHJB 2VE6A 5HYJE 3EYVB 3MUHL 1KN4H 3WN5A 2P43B 2B5IB 4HFUL 4KV5E 2X4TA 5BS0E 2Q7YB 1DTUA 2DQTL 3QO1B 4MAUL 5EOCJ 3KPRD 4TSBL 1MF2L 4L3EB 3ZKXB 4JFZL 2DLFH 2LE9A 4HUVB 2FSEB 5C7XL 4RRPA 4FQXC 5EU3B 3UTZA 5AZ2L 4QGTA 1INQA 4Z6AT 1CGTA 2ZZUT 5GGSB 3SDAC 1JN6B 4UNVA 2XPGB 1CU4H 4X6FA 12E8L 1XIWD 1IGTB 2HMIC 2AK4B 4W4OA 2RHEA 1XF4B 4QRSB 4UTBL 2LU3A 3MYZA 4JRXA 2L0DA 5ACZB 1OB1A 4QRPA 3B2UC 2FEDC 4E41E 4FP8H 4WI2A 3U1SL 2H2PC 1MHCB 1JNLL 2PYFA 2LV4A 4ZAKA 1WSST 2V5TA 5HHQA 1C08A 3T4AB 3SDCA 3HUJE 3KPRB 1CGXA 1KC5H 1YPZA 1D9KC 4D0DA 3CC5A 2X4SB 3BDXA 3WHXB 5B8CB 3GI9L 2L7UA 4H1LB 3GM0A 4HWNA 4LGRB 1YEFL 4GKNA 1U6AH 3OKOA 2P5WE 5JMOC 4WU7A 5JIHA 1SY6L 1A7NL 3OKDB 5D2LB 3Q1SL 2X4QA 1XIWB 3QJHA 1MAML 4NFCA 1I9IH 4L9DA 4JCMA 4X4MA 4IRJB 1J0YA 1QA9B 3NA9L 5IGXL 5HYFA 1FNEB 1JWUB 1U8NA 2WAHA 4WDIB 5L8LB 4UV7H 1UM5H 4HBCH 2A9NH 5JHLH 4Y4FC 3WLBB 3FZUC 2X1WL 3TBWB 3C8KB 1F42A 1J86A 1UM6L 1F90L 4EXKA 2VXUH 1BWWA 2FNBA 4OGAD 5FAAA 3O0RL 4X6EA 3IJSA 1PKOA 5TDOB 1YEGL 1QLEL 3TWCH 2V5YA 4JM4L 4PJXA 3HPJA 4YQXL 1QFWI 4LQFL 4QRTA 1C7TA 5KSBA 5IVOA 5MEOB 4L3AA 4HV8B 5DQ9A 5DMIH 1BHGA 4OFVA 2GJJA 3EFFB 5LCVL 1DJSA 1KLGB 3BN9C 4JKMA 3PWNB 5DQDL 2R2BA 4EBQH 3UAJD 2R0ZH 4MD4B 2VL5B 4DCQA 2QQNH 4PJ8C 3RNKB 5I1IL 1BREA 5HY9B 3GMOB 5EO9A 1A3QA 5F6HI 3KPTA 4V1DE 4YUEH 3QDJD 4WJ5A 3QPQC 4IJ3B 1VEOA 1TNMA 5D1ZA 3HI1A 4G9DA 2OR9L 3MNVA 5ISZA 5C07D 3DMMD 2YD5A 2CRYA 2AJSL 3TN0B 1IILE 2CKNA 2Y1VA 5IESH 3OKEA 2XWTA 3V5DB 4OIIL 1ZT4B 1CDHA 4F3FB 1XF2B 5LXGH 4LLMB 3SY0B 4NQCD 2R1WB 5F89A 3FOLB 2R23A 4HUXB 3VA2C 4XNYL 3L9RB 1IAIM 3Q6GH 4KK9D 3BWAB 4Y5YB 4L4VD 5T1MA 4D8PB 4FXKA 2L4OA 2W91A 2ITDA 1OGAA 2BRRL 4GXVL 5JHDD 1N26A 4OBRA 3QDJB 1T83C 5FYJL 3GKZA 4JFDE 4OQTA 3SQBA 1A2YB 4KV5F 5I76B 4EDXB 4WW2B 1NGWB 4UINH 5C07B 1DUZB 3BP7A 3DMMB 2BMKA 1I9EA 4OJFL 5J57B 1YJDC 2B8OT 5KSUB 1FIEA 3X14B 4M1CC 3A6BL 4XZUA 4MNQA 3NN8A 2X4NB 4KJYA 2ZOKA 4MS8C 4M4PA 4Z0XA 1LP9E 2VOTA 3PWJA 1FHGA 3BIKB 2LAGB 2A73B 3HR5A 1CGUA 3SKMB 2DJ4A 3CFEB 4KKBD 4I3SL 2DM7A 5JHDB 5ADOL 3PP4H 1VDGA 2GTWA 3UJJH 4Y8AA 3BRDA 5F7MC 1YDPB 3QUYD 2MJWA 1R3LA 2J5LB 2LTQB 2NY4D 4ODVH 3ARDB 1B2WL 3KYMB 1A6ZA 3VH8B 3DJ9A 3EFDH 2DAVA 1ZS8B 2ADGA 3HUJF 4KHTL 1RFDH 4ZDHB 3G6JE 1BQHB 1H8OA 4A6YB 1YY8B 3MZGB 5LKNA 4TNWF 2XRAH 5EUKB 4X98A 5FECA 1MFEH 3EOYG 2DYPD 4XP4H 3CLEH 1WLHA 1G7PB 3OKLB 5MEPA 1E6OL 3CFJA 3EOAB 1BGXH 1CXFA 2V2XB 4M6MH 4M43L 3OJVC 2BZDA 4YDLC 1W0VB 2JF1A 3GRWA 4YFDB 4QLRA 4QHUA 1VFOA 4HK0A 2Z8RA <