4RMQA

Crystal structure of the d59n beta-2 microglobulin mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKNWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Decoding the Structural Bases of D76N 2-Microglobulin High Amyloidogenicity through Crystallography and Asn-Scan Mutagenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rmqA00
3VXRD 3N1FC 4ZPVB 1IAOA 1FHGA 2NCMA 2MWCA 1MAJA 2D2OA 2PXYA 3MLWL 4CU6A 3CSGA 1I3UA 2FLRT 4KAQH 2YRLA 5DHVH 3WCYA 5J56B 2NXZB 1OARH 3K46A 3I84A 4TUJB 2DQTL 1OD9A 2QR0A 5HYJA 3DX9B 3TBTB 3B8YA 2XWTB 2ARJA 2A0LD 2X70A 5C2BL 3EDEA 2VXSL 2NX5D 5DJZB 1V7MH 1IGCL 4X7EC 4KMQA 5JO5B 1RULH 3N50A 5I18L 5CJ8A 1DQQB 1A6ZB 3SDAD 2IJ0C 4MGXA 4QHUA 4BH8B 4JY4B 1UJ3A 5E03A 3U9UA 4LRIA 5FF6A 2FJGB 4YUEH 3JWOL 4MD0B 1GZPB 3IDNA 1EZVX 4XZUA 5HDOA 4HS8H 2B5IC 3AY4A 4KJQD 1C5CH 4LU5L 3O3DB 1N5AA 2ZJSL 3PWPE 1IJ9A 4F33B 4R4NC 3VWKC 1NMCC 4E41A 3SQBA 4G8EB 3ZKXC 1OTSC 2VABB 3BKJL 1DR9A 1T20A 4JPIA 5HDBE 5D1XA 1A7PL 4MAUL 2DIBA 4K7PH 2NMSA 5EBMB 3MC0A 1JGVL 3ARWA 4ODVH 1LD9B 4G80A 4ZFFB 3O6KL 1ZAGA 2H6PB 3BFOA 4UV4H 4PLKD 1KCRH 4LLQA 1CYGA 3CFEB 4WV1C 1CDUA 2YMXH 1P2CA 3LMJL 4IRSB 4QWWD 5E9DA 5D7SH 3MV8B 1SBBA 5CILL 3MXWH 1UCBL 3D5OF 4YFDB 3QWOB 2IALB 2GK2A 2GTZB 3WBDA 1RY7B 4PJDB 5EU6E 5D8JL 3S4SB 2AJ3B 4ONGL 3QDMD 1U8NA 1JGDB 2W0LA 1MH5A 4F58H 5BV7B 1F6AB 3VXMA 4GRLD 4JREB 2ITDB 4IIQC 3S7GA 2NY7H 2QADB 5GIRB 4HKZB 3RVUC 3GUTB 3BPOB 2X4PA 4MCYB 1ZHKA 4Z0XB 2BVQA 2NXYB 2EE2A 3LS5L 1FO0A 1QSED 1RU9L 5F93C 3ZSTA 3NFSH 1GXEA 1TJIH 5DRXA 1TCMA 1F4YH 2ZCKH 5IR1A 2DQEH 5FB8B 3IAQA 2V5RA 1JF6A 1T03H 4OTXH 3PWUB 3Q2CA 2EDKA 1DFBL 1WWCA 4OJFL 2C7UB 5EBWB 1ZK9A 4LLMB 2G60H 1Z5LB 1GOGA 4I2XB 2R29H 4O9HL 4D0CA 5KVMC 1J12A 3WS6A 5CD5C 5JZ7D 1RZFL 1CF8L 4NQEB 4DN3H 1OAKH 2APFA 4E9LA 2QQNH 3W9DA 1A4JA 3ZE1E 4KDTA 1ZV5A 2DIJA 2RFXA 4S0SD 4DKAA 2HTKD 4DTGH 3ROLA 3BUYB 1ZT7A 1MCJA 4H8WC 2R0LL 4HLJA 5D1QC 3RQ3A 4BSVA 1D3CA 1T0MA 2Z91A 3HI6H 4KTEH 3GSQB 4PJDF 2BRRL 4LIQE 4YJZL 1OTTD 4PLNC 5JQ6H 2MJWA 2J4WH 3PWPD 3L3IB 3EOYG 1E28B 4L29A 1QA9B 3ZKNC 5GRYA 2VH5L 5T1DH 4KUZL 4LBEB 2ZPKL 4M4RA 3QEQB 4YZFF 2HVJA 5DJXB 1WZ1L 2X1XR 4IJ3B 2QQLH 5L6YH 2I5YH 5KSAC 2CKBL 4H20L 1AQDA 4UI2A 3WSQL 4NGHL 1JNLL 2JB5L 3D1MC 4P3CH 5B4MD 1S7UB 3UBXG 5KBNC 3ARPA 4FRWA 2X9YA 4MJ5A 1KB5A 1VESA 5EU6D 3EYUH 1T83A 2J6EH 3MR9A 2H26B 1BF2A 1R3KB 3B9EA 4PRHA 2MNUA 3B2UC 3P4MB 4UT9L 4UTAL 5GSVA 1FFPB 2YN5A 3ZE2E 2VLKA 5L2JB 5EZJB 1S9WA 7FABH 5IM7B 3GI9H 1BPVA 1BECA 4QXTB 4AIXA 5BW7A 1AKJA 4FQIL 3GIZL 1KCUH 1FNAA 1GOFA 2DKSA 2P8MB 2V7NA 4P5TC 4P5MA 1WWBX 1IAIL 1FO0H 2AEQL 1ZANL 4PGZA 1I7ZB 3TLRA 3BT2H 2ADFL 5CJ5A 1KIQB 2VB5A 1NGXB 4MJIB 4UTBL 3F58L 1AR1C 5AZ2H 5E2TL 3R1GH 3W11C 4KRNA 4WFGE 4A6YB 1WFUA 4GG8B 4YHML 4Y4KA 4XNYL 1KN2L 2OCFD 1D6EA 4X6DB 4HH9A 3H3BC 5ADPL 1BVZA 2BCKB 4LHUD 3HCVA 1U36A 3WNMA 1CLYL 5J1SC 4KROD 1Q9LA 4LDOB 3QUZD 3BISA 5GS0H 4KRPB 4Q2ZB 2D9QB 2I60L 1CDGA 1EEZB 1JI1A 1WBXB 1Y0LA 4R0LB 1NC4B 3ZDYE 4OIIH 5J11B 4I1NB 4Y4FD 3GSWB 2XTJE 2G9HA 1N5YL 2XQBL 4YHPA 1A1OB 4HZAA 3BJLA 4MHHG 4G7YH 2DQUL 1LNUA 4B41A 1OP3H 5AUMA 1A6TB 1NDMA 5BRZA 3CD4A 1U8LA 4OD3H 1QFWH 5IMMB 2PYEA 2A73A 2FSEA 4I0CC 5IK3A 4G9DA 4YH6A 1KN4L 1MCIA 3AXLA 3WO4B 2VLLA 1ZE3C 1L7IH 1GGBH 4F3FB 5MEQB 4NSKB 3PG2A 5M94B 3O0RH 1XGQA 4I0PA 3EYSL 5DA4A 5DEZA 1AQKH 1WQVT 4LSQH 4B50A 1G7JB 1S8DB 4WUKL 2R1WB 3VFMB 1LE5B 4EUPA 4NPYB 3GSVB 4P5KA 1KB5H 1PYWB 3PWVA 4X6DF 4JDTH 3V6BR 1QFUL 2KH2B 4QCIA 1M6OA 3HS0A 1U42A 1MCKA 1HYSD 3MRPB 3V4PL 4KKLD 2DIAA 3B9KA 5F3HB 2NY0D 1FZJA 1CFBA 2Y5TA 1AGDA 1A6AA 1KUMA 1T5XB 3RGVA 4EVNB 3PGDB 1ZWIA 4YDIH 4NYLB 4DAGL 1CN4A 2ZP0T 3WNPA 1CXLA 1B2WH 2QBWA 1EHLL 4PRNA 1PLGL 4ODSH 4EOWL 3BQUC 1UYWH 4PJGB 4QT5B 1JF1B 1WZMA 4PRIB 4FABH 2ITCB 3GK8H 1WTLA 4WFGD 3W2DH 1YNLL 5FK9B 4JFOA 1UZ8B 4PB0L 5L2KA 5HSFA 1DP0A 3IS0X 3VDAA 2HJLA 4ZTOH 4WY7L 2NY3C 4JN1L 1SVZA 5E1HB 3R4DA 1F8TL 3C5ZB 3GKZA 4C4KO 5DQJA 1SEQL 4OBRA 3EFFA 2WMPA 4L8BB 3MLRL 2ERJC 4K2UL 5I8OH 4BZ2L 2CLVA 2DBJA 5HVGB 1WIPA 3F7VA 3SDYL 4GG6B 5LAXB 4F2MB 2DLGA 3K8MA 5IB2B 1B6UA 1AGBB 2FJHA 3VH8A 3W39A 3SDXA 1IEAB 4ZUSA 1ZLWK 3NCMA 4PJFB 3WEXA 5E1AB 1KIPA 5J13C 1K2DA 12E8L 2XTJD 1T1ZB 2Q8AH 4MQ7B 5DJ6A 1CD0A 2Y7QB 2JK5A 4HFWA 3ARQA 1AXTL 2XKNB 2JIXA 3QG6A 2IPTH 1OAXL 3B43A 3DROB 1U3HB 2X4TA 5I16B 1DQLL 2ATPB 4HXBH 1H8NA 2O5XH 3MYZA 4DK6A 5HHXL 4UZGA 1EEQA 4P2QE 1OSZA 4WFHE 3ORJA 1T22A 4RBPH 2RIKA 1XGPB 1YYLH 1OW0C 4J4PC 4Q6IB 2YK1L 1YEKL 4KXZH 3V4VL 2J8UE 2X09A 3ARDD 3SOBH 3WIIL 3CLEH 1VFBA 1IAIM 4EEEA 1J8HB 3QJHB 4PJGF 4NCC2 4IHOA 3IDIB 5EC1A 2EH7L 3MLXH 3UC0H 1FBIH 1QFWM 2EEBA 3I50L 4HK3J 5D2NB 3BPNC 1RVFH 5T5NG 5KAQG 4YAQA 3RDTA 1JTOA 1XGYH 4ZNEE 4XNMA 3CMOL 4EUPH 2BP3A 5IB4B 4FQQB 5KANI 4IIQB 4ZS7H 3ZKQD 3LDBC 5TDNA 2VSDA 3IU3A 3NCYP 5DZNA 2RQ8A 3UJTL 1CWVA 1CLCA 4LKXA 4ETQB 3P4NA 4ODXA 2NZIA 4ELMB 2P43B 3SGDH 5LVEA 4KHXL 1KSRA 3CFJA 5HYQB 4WW2C 3TT3L 3DGGA 3B6SA 3T0EA 5EZLB 1REIA 1QYGH 2AK4A 2YPLE 1IM9B 3S97C 3OZ9L 3MRGA 1WBZB 3AS1A 4EIGB 1NEUA 1RUAL 5IGXH 5K9QG 1HOCB 1U93A 3G6DL 4YXLH 4YHIB 3UYOD 4YPGA 4CDHA 1RK0A 1ONQB 4JM2A 2VUYA 1PJ9A 3MRMA 4DVRH 5MENA 5J9PA 5KS9E 3OJVC 1QD0A 5EO9A 4M1CD 3WUWA 1CFSA 4WEMB 1OLLA 1NUGA 1A1NA 4L8SA 2IADB 3X17A 3DYOA 5DJYB 3WN5A 3O2VL 3S3PA 4HMCA 3T1WA 3DHJA 5JW4Q 4S1SL 5CZKA 2X4OB 1LO2L 4WUUE 3DX8B 1VDGA 3NH7L 4XPTL 4UB0L 5E99H 5CS7A 2P42B 4Y0GA 2NTFA 3IDJA 4CGTA 1B88A 2BNUA 1B4RA 5BMFL 1W8NA 4FQ2H 2FRGP 4GW1A 2GITA 2HH0H 1AHWB 4LKCB 5C0AB 3TNNA 1DE4B 5FUOH 1OAZL 3TJEH 2BJMH 3KLDA 4NUGH 4QKXB 1PFCA 2BFVH 1WV7T 4ZPVA 1T7WA 4S1QL 3PWLB 4G8GE 3VA2C 5IEKB 2EO1A 4OFDA 1MHEB 5E6ZA 1JNHB 3O6LH 35C8L 3NPZB 4P2QD 4OBSA 4WFHD 4QTHB 4TUJA 3VFSB 1NMBH 3DX9A 5BOPA 3TBTA 3DVIA 2XWTA 1ZSDB 1BJMA 4IMKC 1Q9WB 3C08L 4LQFH 3WHXA 5DJZA 4WCYL 5JO5A 1WF5A 4NIKB 4F7CB 1DQQA 1A6ZA 1E6JL 3TVMB 4BH8A 4JY4A 4LSRL 1BX2B 2FJGA 4LEXL 4XPFL 1GZPA 3KHQA 4Y5VA 1Q1JL 3O3DA 1OT2A 1FLRH 4F33A 5FYKU 4F80A 5T3ZH 1R5VB 2MPAH 4HC1L 1T1XB 3CVIH 3PUCA 5L7XH 2C1PB 4G8EA 3RJDA 2VABA 4Z7UE 1EEYB 4XVJH 3SKJL 4R97B 3U0TB 2AERT 5EBMA 4P5TB 4OM1H 5TQ0L 1PKQB 1LD9A 2YPLD 4ZFFA 4JPWL 5FYJE 4R9HA 2H6PA 2HFTA 3WFDL 1KF9B 1JPST 4HJJH 5I8KH 1HIML 5DT1H 5ICZB 3CFEA 3WS3B 3FO0H 1DCLA 4CU8A 4IRSA 5CSZB 3ZYOA 3U9PH 4RMUA 3QWOA 2IALA 2GTZA 2ED8A 5L8KB 3Q0HA 3S4SA 2AJ3A 4BYHA 2O61B 4NBXB 1F6AA 1NGYB 3EDKA 3BIKB 4LAJH 4MB4A 3RUGF 2ITDA 2ICWI 4JR9L 1YEIL 4PLJC 1YPZB 2H9GB 5B38B 3OPZL 5GIRA 4HKZA 3DUSB 5FM5M 1IVLA 4RIRB 3GUTA 3PHSA 4Z0XA 4MCYA 4WUUD 5L0QB 2QHRH 1JGUL 4ZUTB 2JB6B 4UNVA 1LK3H 3KVQA 1RUQH 2BY3A 1R0AH 2ICES 2A6IA 4QHNB 3BDBA 4YDLC 3QNXB 4N8VG 5I6XB 4QXGH 3U6RB 4GS7B 3V9FA 5HHMB 5HY9B 2H1PH 4OLXL 5FYLE 5FB8A 3SN6N 4HWNA 1IM3B 1NBYB 4JCMA 5IMOB 2VXTH 2OK0H 1P4BH 3C8DA 2GTWA 3PWUA 1XT5A 1D5IL 2C7UA 2DQHL 4G6MH 5EBWA 4PJHE 1JMXA 2H32B 1P53A 3NZ8A 3CXDH 4LLMA 2CGRH 5ACZB 1Z5LA 4I2XA 4XP4H 4G8GD 1CK0H 5H94B 4ZO9A 4XT1C 3T77B 5IWLC 2WM0A 4NQEA 1W8OA 2EEDA 2WLZA 5I1HL 3PP3K 3WNNA 2BNQB 3FOLB 4N68A 2IC2A 5DC0A 1P5UA 3BKML 1TPXC 3MBEB 1KB9J 1Z9MA 3L5XH 3BUYA 1HZHL 5MEOB 3DSFH 2LQRA 3VWJB 2VLRA 2DQDL 1OY3B 1QRNA 1H5BA 1A6VH 4XP6H 5L88L 3GSQA 4PJ9C 4XCNB 1CE1H 4LCIH 4LPCA 3OR7B 4LL9A 4NC2B 3MLUH 2EIEA 1KENH 5T1LB 1ZA6B 3FRUB 4WI7A 3FJTA 4W4OA 3WFZA 3L3IA 3JWNC 5C08B 1E28A 1YNTB 3QDAA 5KZCB 1YPZF 3QCVH 1FGNH 2HT2D 5H37G 2D4FA 4LBEA 4JQIL 4F15C 1MEXH 1PDKA 1HH6B 5FDWB 3QEQA 1IARB 2A6DB 3AAZB 1QKZL 5DJXA 5AWNH 3I9GL 3SDDB 7CGTA 3G04B 2W92A 3LQMA 3KPPB 3TEUA 5FYJD 2A9NH 2IFFH 2GY7B 3O81A 2WINB 4LHUG 3V6OA 2A0LC 4DN4L 2VDLL 5DMGD 1N2RB 1P7KB 2XRAH 1MCSA 3SDAC 2XZCL 1FIGL 2VNCA 3OB0K 1TNNA 1NKRA 2DDQH 2H26A 1NMAH 1X3DA 3HLAB 1R3KA 5GGVH 1UQSB 1NCDL 4KJQC 3P4MA 4NFBA 4JFYB 1ZGLM 5EUKB 2QKIB 4Q9BA 5FM8A 1TJGH 1FFPA 1PZ5A 4TQEL 2NW2A 1BFVH 5L2JA 5EZJA 5BJTB 5IM7A 3TN0B 5BV7H 2E7CA 3SDCB 3OAZK 1A7QL 4G6FD 1D9KB 2NY2D 2VQUA 2R39A 4QXTA 3T4YB 5EC2B 3RTQB 5D1ZD 3RY5A 2ERJB 4L4VE 3SE8L 3FO9B 3ZDXE 2XOTA 2P8MA 4QOKB 1CXKA 3HFML 3HG1E 3LKQB 1JGEA 4MNGE 5BO1H 4XBGB 5FYLD 1TJHL 1I7ZA 3HE6B 3C87A 1IBGL 5GGRY 3FB7B 1KIQA 2A9MH 1NGXA 4MJIA 1MELA 4K8RD 2ZCHH 2ZUYA 1V05A 1KEGL 1WT5A 2XACC 3KJ6L 4A6YA 3INUH 2WBJD 5DK3A 4DGVH 4WENB 4MXQD 2DLFL 3U7YL 5KJRL 4X9HA 3OXRB 4GW4B 4GRLC 2VO5A 2D9CA 1CDCA 4X6DA 5I1CH 2BCKA 3P3YA 5MI0B 3HAEB 3S3SA 1A6UL 4P3DB 4HBCL 5IB5B 4N8PA 3VFRB 2N7BA 4LSDA 5LXGH 4X8JB 3BVNA 4JZNB 4Q2ZA 5GJSL 2VLJE 4H5SA 2BK8A 4DGYH 1GH7A 1EEZA 3V5DB 2EDJA 1C12B 4R0LA 1NC4A 3RNKB 2NY5C 1NEZB 3ABZA 4XVSL 1UT9A 1U2CA 1Q0XL 4RFOH 4NKOB 5DK0B 4KTDL 4E0RB 1YECL 3GSWA 2HT4D 3GHEH 5JW3L 1PSKL 1KBGL 1A1OA 2ICEB 1RZGB 1HILB 2BC4B 5CJBA 4J3VA 1YY8B 1A6TA 3SO5A 5JZ7C 3TH4T 5JHLH 1FNSL 3G5XB 2YA1A 1DLFH 1I7TB 4HUWB 5IMMA 5HYJE 4NDMB 1I1AA 1OVZA 2FATL 1VENA 2HTKC 2HJKB 3MOAL 4OCXL 4F3FA 3FT3B 5MEQA 4KPHL 4NSKA 5EB9A 5IMLB 2KQMA 1NKOA 2BNRB 4LNRB 1DBML 3QR2A 4M8VA 3V52L 3HPJB 1G7JA 5I1IL 2R1WA 4JHBA 1OTTC 3VFMA 3X3GL 1LE5A 1EHXA 1LEGB 2HTLD 5SWSE 3GSVA 2VWEC 1PYWA 1QFHA 4HXAH 4PJAE 4YNYB 4DUVA 4J23A 3RY4A 4HKXA 2Z8RA 4E41E 5ISZE 2ZUWA 4FA8A 4JY5L 2H45A 1J1OL 3JV4B 1CU4H 4KI5E 4WW1B 4S0TD 1JV5B 1Q38A 3MRPA 4K9EH 4L4VD 4U6HB 5DDHB 5F3HA 3UDWC 4JFDB 2FZ3A 1RAMA 1T5XA 3HG1D 4OD1L 4EVNA 3PXJA 3PGDA 5HVFB 5HYFA 4NYLA 4ODUB 3ARFD 4NWUH 5CGYD 4YWGH 5A2KH 2AAVA 5E9DE 4WI9A 4YHLL 5JR1L 5I8EB 4PJGA 4QT5A 1JF1A 5GZND 4NOBA 4PRIA 4NWTL 2ITCA 3UXFA 3ARTA 3TBWB 1FAKT 3ARUA 5FK9A 4I3RL 1UZ8A 5F1SA 2WBKA 2C5DC 2ZCLL 4A6YH 5CEZH 3RX7A 5JUEH 1N64H 2FJFB 2GAZB 4ENEC 5GJTH 4F7TB 4JPKL 1LILA 1E4XL 2Q86B 3QT2A 3C5ZA 1EUUA 3U7WL 4GBXD 4K3DH 2LE9A 5I74B 3RY6C 5KVFH 4KQ3H 4L8BA 4KZEH 5F8RC 2VLJD 3C5JA 4JFEB 3A6CL 3ESVF 2IMMA 1YEHH 4KQ4L 4U6XB 4XWGH 5AYQA 4GG6A 5LAXA 4F2MA 5IB2A 4R2GD 4YC2C 5C07B 1AGBA 4J12A 4CJ0A 3SGKA 5C6TL 4LVOB 1IEAA 4YHKH 3STZB 4PJFA 5E1AA 1X4XA 1S7QB 3QRGL 4Q9CA 3ULVF 3R0MA 3BDYH 4ERSL 4MQ7A 4JZJC 2PXYD 2DLHA 2Y7QA 2HJFB 1Q0YH 4HIIB 4MVBC 4RMWA 4XCCH 4K7FB 1G9NH 3RZWA 2XKNA 5J8OA 1JYXA 1U3HA 3E0GA 4P59H 5HHNB 5I16A 2ATPA 4OZHF 1M05B 4JO3H 4OGXH 2VZUA 3OB8A 3OJ2C 4NCDA 2PN5A 3BUTA 2P5EA 5HYJD 4KROC 4IOSD 3Q5OA 2A1WL 3BAEH 3C60B 2FR4B 1XGPA 5IJKC 2LV4A 4Q6IA 4NQXB 3LIZH 3NPSB 3QJHA 3AS2A 3RRQA 1ZTXH 3P0VL 3LH2H 3IDIA 3K7UA 4UV7L 4FFVD 1MFAL 1BJ8A 2ZSWB 4Y4FC 4PGCB 1ETZB 5D2NA 4Z7NE 3DBXB 2UUDK 2AXGB 5SWSD 3GNMH 3DVFA 1EV2E 4D0BB 4E41D 5ISZD 5B8CA 1C7SA 4FQQA 5E6IB 5FOJA 5D1XD 4KI5D 1AO7B 2FGZA 2OP4L 1UVQB 4YHOL 5F1OB 1RZKC 3EO1B 4ETQA 3MX0A 4NRYB 4ELMA 2CLZB 4U0RC 1D5MB 5HYQA 2LU3A 5SV3A 4L9LC 2K7PA 4HS6B 3MCG1 4LFHD 5EZLA 2QL1A 1IM9A 4KKBD 1KXTB 1WBZA 4Q0XL 1NANI 1HOCA 4YHIA 5E9DD 2PR4H 3QG7L 3V7MA 1ONQA 3MXVL 3QUYB 5HDQH 3U1SH 3MSPA 2R4SL 3QUXB 1ZS8B 3GKWL 5D71H 3TA3D 1A14L 4PRHE 4XB8A 3LKOB 1ZGLP 4BFIB 3GSOB 5IHUL 1JK8B 2VLKE 2GIYA 5INDB 1JIBA 4Y19E 5JIKA 2IADA 4NJAH 4OCNC 4OI7A 3K2UH 4Z76B 5DJYA 1PG7W 1JTPA 2YUWA 2AJXL 2X4OA 4ZNCD 4KKLC 4TTDD 1DSFL 3DX8A 3P11H 3MBXL 2NY0C 4GUPB 2PW2B 1OAUH 4HK3N 4RGNB 2YA0A 3PL6C 5JXAL 1IL1B 4UNUA 3QIBB 4BSWB 1K3ZA 4MB3A 3MFFB 2ZWLT 5SX5H 3WKML 4ETYA 4X9GA 5LBSH 5JPMB 3GJFK 1YY9D 3L3DB 5DI8B 2QQKH 1AHWA 4LKCA 5C0AA 3LEVL 2Q7YB 4LVHC 1BBDL 4M6ML 1EVUA 3FQTB 1WJ3A 3BGFC 1CZ8L 2UWEE 1A6WH 2NY6B 3NN8B 4JHWH 3MUJA 1W0WB 3HTLX 2DRUA 2OBGA 5D7JC 3PWLA 4W6WB 1OQOA 2Y1VA 3GRWL 4YR6B 1T6WA 4F15B 1MHEA 4LP4A 3QQ9D 1JNHA 5EFIA 2B20A 1X6LA 5HYIA 3QCUL 3VFUB 4QTHA 3RX8A 3VFSA 1R3HB 1FGVH 4LSPL 3ZT7A 1AFVL 3LCYA 1ZSDA 4RZCB 1Q9WA 1I1YB 5D96C 1X5JA 3M1BB 1U8PB 3S35L 4F7CA 5M95B 4O4YL 3U30B 1FZOB 5F7YC 3TVMA 1AY1L 1T89C 2XTJC 4WU5B 4X7SL 1JJUA 4LU5H 1WFOA 2ZJSH 3NFNB 3ULUE 1A7OH 5EORH 5F7LB 5F7UA 3LSOB 5HPOA 2VDOH 2VL4A 1RZJH 4LSVL 4GMTH 1MCCA 5HPMB 1R5VA 5BRZE 1T1XA 4H8WL 3MUGB 4TULL 2C1PA 3LB6D 4UT6L 1GGUA 1A7PH 2PYEE 4MSWB 1EEYA 3VGDA 3TPKA 5M7QA 3CLFH 1S9VB 3U0TA 2DMBA 3C6LB 2P7TB 4O5LL 3PP4H 5IJVB 2JJSA 3OTTA 2Q8BH 5DQDL 4Y1AB 1SM3L 3ARDC 1IC1A 3Q6GL 3ZKSD 2EDLA 4U6TA 5ICZA 3WS3A 2VQ1B 3NAAL 1UCBH 1KELH 4XC1H 4ODBD 5FUCE 5CSZA 3O2DL 3PV6B 4PRHD 4GH7B 1BHGA 2I07B 4ONGH 3M17B 1UZ6F 4Y5XB 1NCWL 3HZYB 3T0XA 3UTQB 2I25N 2VLKD 3UTPE 4Y19D 2O61A 1I7RB 1NGYA 3BIKA 2XA8L 1P84J 1RMFH 5FGBC 3TO4B 1YPZA 2H9GA 5B38A 3U2SB 3DUSA 1NLDH 4RIRA 1A9BB 1MRDH 4M93B 1NUNB 5TE4L 3CIQA 4ZUTA 2JB6A 5JIPA 5DFVD 4WEUD 3SKNB 3O3EB 2M1KA 2BDNL 4OB5L 3WNKA 4QHNA 3U4BL 3L1OL 3PGCB 3QNXA 3U6RA 1CFVL 5J12B 5HY9A 3UBXI 1IM3A 2YUZA 2OR8A 4EJ1C 1NBYA 1X4YA 4M7LH 5IMOA 4MXVE 4OKVB 3MCLH 3LKNB 4X7CC 3AB0C 3FT4A 3VFGH 3PIQB 5LGHH 2FGWL 4M1CC 1LDPL 4Y4KD 1BQUA 2FEDD 4O9HH 5IKCB 2IANB 2JELH 5ACZA 4BUHA 5H94A 5K59E 3RIAF 3T77A 3BESR 1A2YB 3LHPL 5AYUH 4N5UA 3WFBL 4Y88A 2YD9A 2BNQA 2P5WB 3FOLA 2VN7A 3UYRH 1G7IA 4K71C 4Q9QH 3MBEA 4U1IB 1NAML 5HHVL 2EIZB 5MEOA 4FFWD 4HLZG 4QXUL 3VWJA 4TVPH 1A3QA 4NZRL 3SDXE 1WEJL 4R3SB 1U8OB 2BRRH 5MP6H 3EDFA 2A38A 4XCNA 4JGJA 4ZSOB 3BDXA 5H2BB 1VFOA 1JMZA 3OR7A 1HN1A 1J1XL 3ULUD 5T1LA 1ZA6A 3CXHK 2F8XC 5C08A 5A16B 1YNTA 5BRZD 1BFTA 4PR5B 2D7PA 2BVOB 4M6NH 5FUZH 3AS0A 4O2FB 3IDUA 2PYED 1HH6A 3IFOB 5FDWA 2A6DA 3AAZA 3SDDA 1CDHA 4WNQB 3G04A 3RWFB 4OZIA 1H8SA 1X5HA 3OKEB 3KPPA 1MPAH 1UC6A 3B5HA 2WINA 4JFZL 3VGAB 1JNLH 2JB5H 4I0PD 1L0YA 4DQOL 2VR4A 4JRYB 3NABL 1P7KA 2Q76B 4C56B 4KWUA 2H8PB 3AROA 2CKNA 3P73B 1MFBL 1IGML 1IT9L 4X7DC 1CIUA 1IC7H 1FCCA 3HLAA 1UQSA 3UTPD 3REWB 4Z0BL 1CTNA 3BN3B 3UJJH 4JFYA 4F9PC 3V8CA 1KTLB 5EUKA 1BREA 2QKIA 5BJTA 3TN0A 3SDCA 1D9KA 3B9KD 3HKFA 4FQIH 3T4YA 3CFCH 3HC0B 5EC2A 5EZOH 5GGTL 3RTQA 4TUOB 3T0EE 3FO9A 1BZ9B 4ALAH 3CVHB 1GIGL 3LKQA 4K07A 3CAFA 4XBGA 1YNKH 2ADFH 4LMQE 2LAAA 3HE6A 3QEHA 3VFOB 1OQXA 3FB7A 5D2LB 1D6VL 2F74B 5MENE 2R8SH 1LMKA 3B9VA 4ZXBD 1LK2B 3W9EB 4HUVB 3X11B 2FYYB 5BS0B 2BHUA 1C5DB 1ERNA 5CD3B 4YGVB 2BY0A 3NTCH 3WFHB 1JFQL 4PBVC 4GW4A 1LQSR 2FHCA 2XWJB 4F37K 4BQ6A 3MJ6A 4GRWB 3HAEA 5I1KL 1UXSB 4P3DA 5IB5A 4WHTB 3VFRA 3LQAC 1FORL 4X8JA 5EA0L 3VFPB 4JZNA 1K3IA 3V5DA 4LSTL 3FFCE 5A43C 1C12A 3N06B 3RNKA 2UY7A 1NEZA 4W70A 4KV5F 4F57H 5DFWH 1PX4A 1PD6A 1HKLL 5DK0A 4E0RA 1LO5B 4Z78B 5LQBL 2DQUH 2JIXD 2AI0L 1OPGL 2ICEA 1HINH 5HD8D 1TETH 1HILA 2BC4A 3P2TA 4OGZA 1YY8A 3QXWA 2NTSP 5ID1B 4M43L 4CRPA 2PTTB 1H3WM 4RCAA 3G5XA 4PGDA 3VJ6B 1I7TA 3BH8B 5A40E 4NDMA 1CFNB 1K4CB 1FNEB 4NNPH 2HJKA 4MJ4A 3FT3A 5I73C 1BOGB 5FYJU 5IMLA 3RHWK 1DBKH 3HZKB 4NZUL 4HG4J 2BNRA 4LNRA 2OLDA 5I71C 3S34H 4E5XB 1PEZA 3HPJA 4FZEL 3QUML 5DEGB 3RDTD 3T2NH 1GZQA 5JW4M 5IBUB 3NIGF 2XN9E 4YNYA 4QRTB 1OM3L 2HKFL 3CK0L 2B1AL 5CLTA 4GRWF 1PEWA 2QSTA 2HT2C 1U8JB 3L3GB 4H1LB 3JV4A 1DBBL 2K9UA 2VE6A 5I1JL 2XY2A 3QIUB 4NKDB 4M4PA 1JV5A 4KJYA 5DDHA 4U6HA 3T0ED 3KPMB 1QFOA 4JFDA 8FABB 4ONHB 1INDL 3WFCH 2W59A 1U92B 1MFDL 1EHLH 4L9DA 1EFXA 3MA9L 5DMGC 2VR9A 3F62A 3FMGH 5MEND 3MV8E 4HFUL 3HC4H 5I8EA 1FG9C 4PJDE 1N8ZB 3BGFB 1A8JH 3OJMB 3TBWA 1DDHB 5FGRA 3SBWA 2HWZL 3TYGL 2W60B 2X9XA 4GLRH 4P23D 4JN1H 4TSBL 5C0CE 4J3UA 1F8TH 2FJFA 2GAZA 5L8LB 5EU3B 1UENA 4JKPH 1DEEB 4F7TA 2Q86A 3V0WH 3RKDD 2NY2C 3VI4F 4YZFE 1WUNT 2AJSH 3HAEH 3ZHDA 1EGJA 5D1ZC 4ZTPL 2VYRE 4K55A 4LPVA 4JFEA 3W0WE 5K9QI 4POZD 5D96B 3FFCD 4U6XA 4WI3A 1MOEA 2GUOB 5C07A 4QGTA 2DI7A 5I1DB 4RISH 4K8RC 3STZA 5HYSB 2R4RL 1DEDA 1TQCC 4LFHG 1S7QA 3CH1B 3GMRB 1F3RB 3IJSB 3EOBB 5GS2H 3ZT5A 3O3BB 4G6JL 4I2XE 2HJFA 4MXQC 1QNZH 1CVRA 3MGTB 4HMEA 4JO2L 4K7FA 5ILTL 1FFOB 3VXSB 3AGVA 1G84A 4C58B 5HHNA 3TT1L 3QXTA 1BMGA 4JFPB 4NQEE 3ULSA 1MFCH 1M05A 5HHXH 4JQVA 5EU5B 1A6PA 4Y16B 3PHOB 2Y06H 1BM3L 3C60A 2FR4A 5JTWA 2YK1H 1YEKH 4NHCL 3ARZA 2OQJB 3RNQB 4NQXA 5GGVY 4S11A 1DJSA 4FFZL 4I9WE 1UWGL 5HTSA 5I76B 1BOYA 3D9AL 5I66B 1G1YA 4PGCA 1ETZA 3RPKA 4CMHC 1NL0H 3DBXA 2HT4C 2AXGA 2XN9D 3Q3GB 4FG6D 4XMPL 3MLVL 4D0BA 1NH6A 4NC1E 4X6EB 1X5LA 3H0TB 3ULVH 4U3XA 5E6IA 4P4RB 1FL6B 2JCCB 2L0DA 1AO7A 1UVQA 5C3TA 3EO1A 1TQBC 1UM6H 2X7LB 4J6RL 4NRYA 3JTSA 2CLZA 5FA3B 3TT3H 4AEFA 1D5MA 3NGBC 2BY1A 5JNYB 3V6OE 4HS6A 5E5RB 5DD5H 3X3FL 3ZDYF 5IUSA 1ZT1B 4IRSD 2R9HD 1QTYT 1YEFL 4PJEB 1VEOA 5F6IB 3MV8D 3QUYA 4Q9RL 1MCNA 3QUXA 1ZS8A 3DO3A 5CZVL 4U1MB 3SCMB 3EIFA 4OIBA 1OP5H 2WV3A 3RIFF 2HTLC 3LKOA 4IOFD 3GSOA 1JK8A 5C0CD 1L6XA 5INDA 1IAKB 2Z0BA 1OF2B 3T2PA 2FECI 3FONB 4Z76A 1CL7I 4S1SH 1TXKA 4JB9H 2NXYD 3MODH 1Y6KR 3ZMRA 2JKXA 4Y5YC 2DQGH 2YN3A 4YBHA 3T3PF 4GUPA 1XF5B 2PW2A 1HXYB 4HIXL 3W0WD 4PB9L 1EGJH 5FYKL 3QIBA 4BSWA 3RP1A 3ARFC 3MFFA 5CGYC 2PCPB 4NNYB 4JHAL 4L3CB 3A67L 1AGCB 5JPMA 1CGTA 3BEWB 5CAYB 3L3DA 4G7VL 5DI8A 4R7DB 4N1CA 2LTQC 4P49A 4H0HB 2Q7YA 5CEZE 2A2QT 3FQTA 1URLA 4QRQB 4JJ5B 5GS1C 3WIFB 5E2UL 3NN8A 5T5FL 4X6DE 1W0WA 1FNFA 2JCCF 4NQED 5HXMA 35C8H 4YR6A 4HEME 4M6OH 1L9NA 4GBXC 4FXGB 2ZSVA 5ACMA 1RSFA 3VFUA 3LKRB 4QRPB 1R3HA 3SE9L 4NN6B 4ZFOL 5FDYA 5J57B 4RZCA 4W68A 4EDXB 2WWKO 4XPBH 4PJEF 4BELD 4QHLB 1OAYL 1I1YA 3M1BA 1VHPA 4I9WD 3WV0A 4R2GC 1E6JH 1U8PA 4I18C 4LLYB 1FZOA 4LSRH 4XPFH 1QR4A 3DVNB 4WU5A 4NQTA 2PXYC 1YEJL 3NFNA 4GXUN 5AAWA 3UTOA 3LSOA 5A2LH 2FX7H 1CXHA 2J8HA 5HPMA 2EZ0D 2BY2A 1FE8H 3MUGA 1VGKB 1PG7L 5IESL 1BWMA 2XFXB 2VKWA 4MSWA 2YOCA 3FHAA 5IFAH 1X5AA 4GSDH 1AI1H 3C6LA 1A7NH 2P7TA 4FP8H 3ALXA 5IJVA 3U48A 4OLZL 4Y1AA 4EQ3A 8CGTA 1HIMH 3MLZL 4LQ1A 2FIRT 3QQ4B 1MY5A 1C7TA 2VQ1A 3R0NA 4HH8A 1UJ3C 4XXCA 5F7WC 4LRIC 4DOHB 2YSSB 4OF5A 3PV6A 4XNZC 1L9MA 2I07A 1I9RH 3AY4C 4Y5XA 5JW5B 3HA0A 4G8FB 4JLRB 4ZAKB 4OFVA 3HZYA 2RBLA 1N0LA 3UTQA 4Z8FH 1DZBA 2OYPA 1I7RA 2EH8H 1CGWA 2HRPL 5I2IB 3TO4A 2IH1B 5D1XC 4EZMA 4KI5C 3G08B 3WHE0 4JG0L 3U2SA 1A9BA 5JIHA 5HHPB 2NQCA 5CFHA 3SKNA 2PF6A 3O3EA 4YDKL 5TPWL 4X6CF 3UTSA 3PGCA 2PO6B 5DWUH 4OUUB 2XIDA 4KKBC 3LKSB 3WJLA 1QP1A 3HE7B 2BVYA 4MA1C 4U4BA 1JRHL 4PJGE 4M7JH 4TSCH 1G7LA 4OKVA 2HAZA 3LKNA 4MS8D 5CEZD 5F9OH 2V5SA 3PIQA 1U0QA 5TE7L 3RL1B 3LEYL 5IKCA 1KJ2B 2IANA 5DLMH 3Q5YA 3MREB 2X6MA 3KYKH 4EUPG 1SVCP 4R90H 5JORA 1NBZA 3GI8L 5IEHB 1A2YA 1KPUB 3I3BA 1F6FB 3BKMH 4KRPD 4TTDC 1DTUA 2P5WA 2OZ4L 1U95B 2ADIA 5KSVB 4U1IA 3LVEA 2EIZA 1NC4D 2DQDH 3MLTB 4U31A 1AD9B 2OTPA 1Z9SA 4FQ1L 4TNWK 1QO3B 1JPTL 4LCUB 2ZG3A 5EO1B 5ALCL 4FHBD 4PJFE 4R3SA 1U8OA 1YY9C 1OP3K 1UM4L 1KT2B 4ZSOA 3D87B 5H2BA 2OL3L 5AD0B 4BQCA 4PJXB 3OF6A 1FC1A 1IKFH 3LN5B 5BVPH 1U58B 2BSSB 5A16A 3OL2A 3BRGC 4UQ2B 3WS6C 4KRLB 4PR5A 4HT1H 4JQIH 2BVOA 2CH8A 1AH1A 1XEDA 3VA6A 2UZYB 4O2FA 1D7FA 4GFTB 2NY5L 3IFOA 4KDTC 1I9IL 2MQCA 5HVWA 4PJIF 4XHQA 1EHAA 3EOAB 1IGJB 3EZJB 1AXSB 4WNQA 4M7ZB 3NCJH 1CL7L 1DUZB 2DB8A 2GK0B 4G5ZH 1J8HE 4PRBB 4PJBB 4JRYA 2D03L 5DK2B 4JDVB 3QUMB 4RDQG 1DL7L 2Q76A 1LWRA 3LZFH 3BIBX 3IFPB 2H8PA 4XCFH 1BAFL 3P73A 3N9GL 3O4LB 5D2NE 4RFNC 5JIIA 1TTUA 1WIOA 4YO0B 4KK6D 3AU1B 4P4KA 1FRGH 1A4KB 2AEPL 2N56A 5DD0H 3VH8G 1S78D 3REWA 2HVKB 4KGJA 4TQEH 2BVPB 1U41A 1KTLA 2RHEA 3QIWB 4OQ1A 4N1EA 4NM8H 3LB6C 1F4WL 4OV6F 3OJDB 4KHTL 5KN5B 1RIUL 3MRNB 3L7EB 3SE8H 3JWDL 1EIBA 3HC0A 5DMIL 4XRCB 1INEL 4TUOA 2AK1L 1BZ9A 3CVHA 4KC3B 1DQDL 4RGOL 2Q20A 3QEGH 1IBGH 3S37H 1DBAH 5D70H 2OMNA 3GEWB 1DN2A 3VFOA 5D2LA 2WWKT 2F74A 3T0AA 3O3AB 2R0WL 1T83C 1LK2A 2IEPA 3W9EA 3X11A 3KJ6H 2FYYA 5BS0A 2D7MA 4OM0H 1C5DA 4YGVA 1IC4L 3VFVB 3I2CH 3IFLH 4M5ZH 2QSCL 1IFHL 1BQSA 3O4OC 4H88L 1FNGB 4JRXB 5C09E 3WFHA 3C5ZD 4LDEB 2XWJA 3LS4L 1GC1H 5DJAB 1CXIA 3ZHKA 3EO9L 1UXSA 5BW7C 4XP5H 3H9SE 4XMLH 5IG7B 1A1MB 1A0QH 1YYMH 2C3XA 4WHTA 5D72L 5DFVC 3ZL4L 3VFPA 2FLBT 4OUOA 4PJBF 1J5OL 4PIRF 1NGQL 3UO1L 3T0BA 1CS6A 3ARGB 4J2XA 1JN6B 5C0AE 5GGRB 2W91A 3ARSA 4NT6B 3KYNB 1ZKAA 3GMNB 3BD3A 1KBGH 1LO5A 4Z78A 4R4ND 4Y4KC 2FEDC 3WNLA 2XV6B 4U6YB 3T3MF 2Q3AA 1ZLUH 2GCYB 3LN9A 2GJ6E 5T1KB 2VDPL 4RBPK 3P9MB 4NO5B 3RUGE 2HLFC 1JWSB 5F9WB 5J0BA 3CDYA 5ID1A 2PTTA 5GS3A 2F53B 4DEPB 1TVDA 4OCRH 3VJ6A 2C9AA 3BPLB 5D9SB 1F3JA 3BH8A 3O6FB 2FATH 3MMEB 2QSVA 1CFNA 1K4CA 1R24B 4P46B 1FNEA 4P9HL 1P5VA 2FEEL 1I4FB 3TCXA 4TVPE 2CRIA 3NACH 5EBLA 1G6RL 1QLEL 1MIML 1J8HD 1IAMA 1BOGA 3VXUB 5JOEA 1L4IA 1DBMH 4FFWC 3HZKA 3MV11 5LG1A 1RIHL 4E5XA 5KVDH 5FV2A 1J11A 3VW3L 2J5LC 3WXWH 4QO1A 5DEGA 5TF1H 3DXAB 4NN7B 2AP2A 4P57B 1QBML 2W9LA 4QRTA 2GJZB 3VMNA 3FRPG 5E8DH 3RVUD 1U8JA 2XZAL 3L3GA 4H1LA 1FH5H 4NZTL 2KZ1B 1YQVL 5ICXB 3RBSA 3TWCL 3QIUA 1VA9A 4LLUB 4NKDA 3RWJB 4UNTA 1T04A 2C26A 3C6SB 3KPMA 4LIQL 1PKQE 2ARJQ 4TNVK 8FABA 3S98A 4ONHA 4ZOAA 1U92A 2VZTA 1DLHB 2HN7A 3DV6B 2FH6A 5DHXB 4I0PC 4TUKL 4P2YA 3RVXD 1KCVL 3QULB 5JR1H 2WP3O 3CVHH 2O5ZL 1MWAL 3SY0B 4LK4A 3DX6B 5KTEL 4HPYH 4CN6A 3VMOA 5B39B 1IKNA 1RZKL 3BRFA 4PV9B 2XZQL 5GGSY 1FG2A 2W60A 1GGCL 3TYFB 4Q58C 1ZLSL 3X12B 3X14B 5C09D 2MCG1 1MIEH 2P4AB 5EU3A 1YPZE 1DEEA 3ZT6A 1EEUA 3PDGA 4EI5B 3H9SD 3B9KC 4CADB 1G7MB 1Q72H 3TJHD 4X4XB 4GRWH 1CCZA 3RGVC 3E8UL 2VC2L 3A6CH 1WZLA 2GFBB 3QDGB 4HMDA 5HHME 4Y8DC 3IFNL 3S88L 2X4QB 2X05A 2GUOA 1ADQA 4LLDB 3D2UB 5C0AD 4P99A 5I1DA 4PG2A 5CJOL 2EXWD 5HYSA 4KRMB 5IVNA 4QRRB 3CH1A 3GMRA 3IJSA 3EOBA 4WI5A 2EDHA 3O3BA 3BKYL 2AEWA 2GJ6D 3MGTA 3VXSA 1FFOA 1KNOB 4PY7B 2WSKA 5F7DB 3S4SG 4JFPA 5LCVL 1HSAB 5EU5A 3L3HB 3E2HC 4Y16A 5J4MA 2BNQE 3PHOA 4PS4H 3BZEB 4RGMC 1JWUB 3C09B 4KVNH 4TVPD 2X70B 1YEGH 4AYFA 3ARVA 4OT1L 1DVFB 4J8RB 2V9TA 3UTTB 2OQJA 3RNQA 1MJ8L 1B0WA 5KSBF 1IGFL 4HGKC 1QQDB 1O7VA 2VZSA 3TVMD 4DW2L 4UV7H 1VKXB 1IZKA 3TZVB 5I76A 5I66A 4XP9H 4XNZB 3TCLB 3O6ML 3DNKA 1MAKA 5F96H 1XFPA 4DGIH 5C08E 3EDDA 3OKMB 3Q3GA 4X6EA 3EOTH 2W1NA 1CGUA 3H0TA 3LN4B 4LLAA 4QY8B 4PJ8B 4HS3B 4YHOH 4P4RA 4E42B 1FL6A 2AJZB 2JCCA 1J7VR 4NUJB 1OLZA 5HJ3B 3QPXH 1T0NB 4G80B 4P5TD 4WJ5B 5GSRB 2X7LA 3RZCB 5FA3A 5JNYA 1FAIL 1NAKL 2VDRH 4Q0XH 2DMKA 3MXVH 3F6IA 2ZZUT 4PJEA 4DJMA 1BJ1J 1SBSL 3DRTB 1P6FA 5I1LB 2KL6A 5IHLB 1BGXL 4GMSL 4U1MA 3OG4B 3SCMA 5I1GL 3RDTC 4L3EB 3VXMB 4D3CL 2R1YB 2B0SH 3W5NA 1E4WL 1N7ML 3WMSA 1NBVH 3VXTB 3ALWA 2G75B 1NSNL 2X10A 4MWFB 1IAKA 1OF2A 3M8OL 2D7TL 3QI9B 3FONA 5DUPL 5CGMA 1XIWB 3EYOB 3LKPB 4AL8L 1MREH 1S5IL 3T0EC 2Z93B 3MRJB 3QWQB 4HX1B 4QOKE 5J6HA 1XF5A 1HXYA 1MJUL 1GPOH 5HHMD 1KYOJ 2V7HB 4JM2C 5AAMA 2PCPA 1GJIA 1RJLB 4NNYA 4L3CA 1AGCA 3KXFB 3BEWA 3M07A 4OZGB 3EUUA 4MLIA 4OFPA 4UINH 2DL2A 1CZ8H 1ADQH 2IGFL 2AABL 5FO9B 4LVNC 1ZHLA 4QRQA 4JJ5A 1NFIB 3WIFA 5F21B 4L8SC 15C8L 1IRAY 3OMZA 1KJVB 1P9MA 4ODWB 3WN5C 4WFFE 3KDMB 3EZ8A 3STBA 3HC3L 2BNQD 3IS1X 3O2WL 5D7IB 2E27H 3R8BB 4C59B 3DMMB 4YXHH 5D6CA 4FXGA 3MBED 4LSPH 4FQHB 5KSUB 1AFVH 3LKRA 4QRPA 4PGEB 5IBTL 1A5FL 1QBAA 4IDJL 1CLOL 1T0MB 3VWJD 4POZC 1E27B 3SKUD 4QHLA 3WKNA 1EZVY 3KPSB 4O4YH 5GRXG 5C7XL 4U1LB 4LAQL 4LLYA 5T33L 2VITB 2ZOLB 3KR3H 4MXWL 5T1LD 4KKNA 1G0XA 2VRAA 3DVNA 5HGHB 2WQ8A 2LU7A 4ZQKB 1E6OH 5C08D 1OB1B 4LSVH 1GGTA 3L95B 5DVMA 2UZIL 4LSUL 2VDQL 3JTTB 3U0WL 3P4OB 4UT6H 2FO4B 2CO6B 1VGKA 4FNLL 2XFXA 2NXZC 3SDDD 1UA6L 3CX2A 5DQDH 3ZDZF 3EYFA 4M1GH 3D6GA 1SY6L 1RUML 3KS0J 4HUNB 4R26H 4XP1L 2BNRE 5C1MB 3NAAH 4OZGF 3QQ4A 2EE6A 1B6DA 4MJ5B 4PJ5E 4NRXB 2CK0L 2KBGA 4ZOCA 1KFAL 2YSSA 2FBJL 5EDXA 1VEPA 4Y5VC 2B4CH 5JW5A 3D69B 4G8FA 2NY3D 4WEBL 4ZAKA 3ULVE 1VPOH 2F5AH 1J0IA 3GBMH 4S1RH 1WK0A 1S9WB 4FG6C 2ORBH 4LPYA 2XA8H 2W9EH 2XG5A 1DUYB 3ZYIA 3P30L 3SDCD 1NPUA 1D9KD 5I2IA 4OLYL 2IH1A 2VDKL 4OZHE 3EYVB 4G6KL 2A77L 4PP2B 5TE4H 3PWPB 4N0YL 5HHPA 4N8CL 4JFDE 4P5MB 4QOKD 4IOIB 4JVUA 4CN4A 4BQ8A 1CFVH 4OLUH 3V95A 2PO6A 3L9RB 2DD8L 4OUUA 3LKSA 4XAWL 1I1FB 5IFHL 4IRSC 2R9HC 3HE7A 4BZ1H 4FS0A 5C0JA 1N4XL 1S7TB 4AMKL 1U8KB 1Z6JT 1A7RL 2YUVA 3QFJB 2DF3A 2Y72A 5BV7C 1FZKB 3RL1A 1D6EB 2VDNL 1ZVHA 1KJ2A 4IOFC 4JREC 2DS4A 3FO1B 3MREA 3HCVB 1OSPL 2QADC 4WFFD 6FABH 3WFBH 3BPOC 3VGBA 1I3GL 2NXYC 5IEHA 1KPUA 3R8QA 4OLWL 2BMKB 4J4PD 2ZUQB 2DLTA 1U95A 3AM8A 4JFEE 5MEPB 5HI3C 1PKOA 4K23L 5KSVA 3GBNL 1NLBL 4WHCA 3MLTA 4HJGB 1AD9A 4OF3A 4OSUL 5C07E 5ITBL 5FA4B 3V5HB 5K9JL 4LCUA 5GS2D 2HFEB 5EO1A 1G9MH 5IFJB 4GKSB 1KT2A 1J1XH 1NANH 4KVCH 1WITA 1NGPH 3LQAL 5AD0A 4PJ7B 4PJXA 2YXMA 3LN5A 1U58A 2BSSA 4UAOB 4UQ2A 3QXAB 1MI5B 1MNUH 3V4UH 1ORSB 3ZHLA 1T80A 5F1IA 1FP5A 3DHMA 3WNOA 4BJLA 3EOAA 1UACH 1IGJA 3QHFL 1AXSA 4AEIH 3I3DA 1DUZA 5DMKB 2VXQH 2GK0A 4UT7H 2BNRD 5DZOA 3H3PL 1VADB 1H5BC 1G7PB 4PJBA 4CVZB 4P9ML 5GGQL 5DK2A 4JDVA 3QUMA 2DWDB 1LHZA 4PJ5D 5DUML 2FDBP 1KCLA 1KCSL 3IFPA 3M45A 1ED3B 5GZOC 2E7HA 3O4LA 4AENB 4NKIH 3HI5L 4YO0A 3JVGA 4W4OC 2VMFA 3ULVD 4D94A 3AU1A 1A4KA 1JBJA 3IYLW 3CFDB 1P7HL 25C8L 2BVPA 2OS7A 5IP4A 1J1PH 2V2WB 3TPUA 1PQZB 2EZ0C 1QHPA 3QHZL 3DWTA 5DJ2A 5JQHC 4Y2DB 1O5DT 3OJDA 4IJ3C 1F90L 4OI8A 5KN5A 3MRNA 1CLZL 3L7EA 4JFDD 3J7HA 4LASH 4WI4A 4XRCA 3V6OC 3T2OA 4PRNB 1JL8A 3D85B 4DFHA 3RVTC 2OXHA 5E8EB 3A6BH 3CFIC 4XNXH 4L5FL 5I19L 3O3AA 2P1YA 2ICCA 4PJ7F 5DVKA 5E08L 5DVOA 3IJYB 1T5WB 5GRJH 5DMJB 1D5ZB 4YHZH 4QHKJ 3VFVA 4JKWA 5FYJL 4JRXA 3MOBL 1FNGA 4LPWA 5DJAA 1KJ2H 3MRIB 5FCUL 3KPLB 4RGMB 1UWEL 2C4FU 1S5HB 5IG7A 1A1MA 5EA0H 3SE4A 2XQYG 2ED9A 4JFED 4RGNE 5T3XH 5SWZB 1S9XB 5JMOC 2D7OA 2VZVA 4PP1C 5C07D 2DQJH 2R2CA 3U0PB 2VL5B 4G3YH 1D5BB 3ARGA 5ADOL 2VDMH 1HHHB 4NO2B 5DRNB 3RI5F 1WT5C 5GGRA 4UDTB 4EBQH 4Q97A 1K85A 3GGWB 4MS8C 5D7LB 2F5BL 1QACA 4NT6A 1LEIB 3KYNA 2B1HH 3GMNA 1UZ6E 2WUCL 3QG6B 1L7TL 4FQXB 1CGSL 4NQVB 4U6YA 4AEEA 2ZUTA 2GCYA 5T1KA 1AJ7L 2ILLA 3P9MA 4OQTL 4K3EL 5FYLL 4F9LA 1JWSA 3N1PC 1YDPB 4R4FL 3GO1L 1FFRA 3P4LA 1EO8L 2F53A 3C60D 1N6QH 2F19H 5D9SA 3O6FA 2R0KH 4K8RL 4KRPC 3MMEA 4J3OC 1R24A 4P46A 2YKLH 1I4FA 1BQLH 1NUDA 3C9NB 4Z7QF 2DQCH 2RAMA 3C2AL 3CU1A 4NZUH 4R0LC 2K3TA 3VXUA 1JPGB 2XYCA 3BP7B 5ANMB 1H3PH 4B53A 5I0DA 5J11C 3UEZA 2NY1B 3NA4A 3QUMH 1G9NC 4P2RB 3D18B 4YAQB 1MAML 4KK8D 5IW1B 5C0NC 4TSAH 3B5GA 3DXAA 2HKFH 3N85H 1W72L 5DJ0B 4P57A 4Z18A 2GJZA 5E6ID 2IPKB 3GJFB 2FB4L 1DBBH 5IVXB 4NHUB 2YD1A 3F8UB 2J88H 3K8LA 1CICB 2MFNA 1I1AC 4Y2OA 5ICXA 1VEMA 3JV6A 3VG0L 4LLUA 3RWJA 3DGGB 4QNPF 1ZLWH 4RX4A 1WZKA 3C6SA 1MFDH 2FX8L 4OZ4B 2MMXA 1DLHA 3DV6A 4KAQL 4JM2B 3CDFA 4MAYB 3PGFH 5TDPB 4BZYA 1A64A 1HH9B 1OARL 3QUXD 3QULA 5I0ZA 5E2WH 3CMGA 1JHLL 2H2SD 3MRRB 5EO9B 4XC3H 1CFSB 1C5BH 3ARBB 1H3VA 4L1HA 3IDGB 3GMMB 1BEYH 4KK6C 4WGVB 1V7ML 5KVGL 2FO1A 2XY1A 1S78C 3RA7L 3TYFA 3QAZB 3X12A 4KKCD 3X14A 3DURB 1IGIH 3MNVB 4EI5A 4CADA 1G7MA 2W9DH 5SX5K 4X4XA 4RGND 1A3RH 1RURH 2M8XA 3IDJB 1FZMB 1LDSA 3QIBD 2Q6WB 3UPAA 2GFBA 2IMNA 4JJHA 5IT2L 3QDGA 3ALPA 1QVOB 4PJ9D 2X4QA 4MLSA 4K7PL 4LLDA 1YZZA 3D2UA 1FN4B 1FYTB 4ODVL 4N1HB 1X6NA 5E7BA 4QRRA 4UV4L 2NY6D 5KW9H 2IANE 1MHPL 5ILTH 5IVXF 2YMXL 3WXVH 3TT1H 3G9VA 5TGBB 1KNOA 3D3VB 1FCGA 1IAII 3C5ZC 4J3SA 4N9OB 3MXWL 4PY7A 2R0ZL 3WIHA 5F7DA 3FQWB 3EO0B 5GISH 1M7XA 1MRCH 1HSAA 2CJUH 3L3HA 1F6LL 4NQCE 3BZEA 2P5WE 1QFWI 1JWUA 4NHCH 1UADC 1UEYA 4JM2F 3RWCB 3WHXB 1DVFA 4J8RA 2NY7L 4JCLA 2J7LA 3UTTA 3DRQB 3RFZC 4KI1A 5TE6H 1UWGH 4DZ8B 1JHKL 3SGKC 1QQDA 4G6AC 4PFEA 4FFYH 5I1EH 1VKXA 2EE3A 2X44D 3TZVA 1JZ8A 3AUVA 4Y5VB 3NFSL 4MDIB 4N90E 1GHFL 1TJIL 2VWEE 3TCLA 1F4YL 2ZCKL 1NCNA 1DQMH 2DJ4A 2XQYK 2L7UA 3OKMA 1U3HC 3OG6B 2P49B 4KH2A 1T03L 1F4AA 4LPTA 4OTXL 2EDFA 5BQ7A 3LN4A 3NCFB 4PJ8A 4HS3A 4QY8A 4E42A 2AJZA 5I15H 4NUJA 5HJ3A 4ZS6C 5DQ9B 3TF7C 3C6LD 1T0NA 4WJ5A 3RZCA 5GSRA 1OOAA 4JGMA 4Q6IC 4HF5H 2P24A 1J0JA 2QJDA 2VTFA 3FCTB 1EDQA 2MKWA 4JRYE 1J0KA 4DN3L 1YEFH 2DTMH 1OAKL 4AH2B 2J6EA 5FIEA 4C56E 3H3KA 1I8LA 2QQNL 4WDIB 3DRTA 1UCTA 4KDVA 4DTGL 5I1LA 1RZJC 4KV5E 5D2NC 1T2QH 4I13B 5I9QB 3LRSB 4L3EA 5B8CC 5EOCJ 2VAJA 3WD5H 2R1YA 4EDWH 5F3BB 1WWWX 3HI6L 4B0MM 3VXTA 2G75A 4KTEL 1I9EA 3W5MA 4MWFA 5IVZB 3HR5B 3QI9A 1C1EH 4P0DA 5JQ6L 4ORZC 1XIWA 3EYOA 3LKPA 2J4WL 1GYAA 5FXCH 4J1UB 1MCDA 3HPLB 1EUTA 2A6IB 5HI4C 1K6QH 1ES0B 4PGJA 2Z93A 1SMOA 1K5NB 3MRJA 1T6VN 4HX1A 1NCCH 2DYPB 5HGBB 2E8ZA 1ZXQA 2F58H 2V7HA 3RVXC 4G7VH 5JOPE 1EO5A 1RJLA 2GTWB 2I5YL 3KXFA 4OZGA 1MVFA 2YPLB 3JUYA 2OTUB 5GRWA 3NZ8B 5FO9A 1XZ0B 1F58L 2IAND 5E2UH 4QTIH 5T5FH 1NFIA 3GIVB 4P3CL 1SJXA 3NIGE 4TPRH 1BJ1H 2YZ8A 4AY0A 2RB8A 4PJCA 5IOPB 4NO3B 1KJVA 1TZGH 4ODWA 2OJZL 4GRWE 4HAGA 3KDMA 2WZPD 3ZE0E 4NQCD 2P5WD 3WIHH 5D7IA 5ESVB 3TJHC 2HP4A 1LO3H 3DMMA 1J0HA 1JNNL 2R1XB 4JEGB 4FQHA 3V79C 5KSUA 1RV6X 7FABL 4PGEA 1OAYH 2VLRB 1T0PB 1H8OA 3GI9L 1E27A 1H5BB 1QRNB 3VRLF 1CTOA 3B9AA 4WFEE 2DL9A 2MOVA 3KPSA 4WUUB 1CD1B 4XNUL 1AHWC 4EIZC 4U1LA 4AK1A 1KCUL 3T4AB 3RX5A 5F8QC 2VITA 3OF6D 2EXWC 2ZOLA 2PTUA 4N90D 1FO0L 5HGHA 3B3IB 5DYOB 2DI9A 4ZQKA 4YEEA 1OB1A 5TFSL 3C8KB 3L95A 3BT2L 4MA8H 4HPOL 3T09A 3JTTA 3P4OA 4PRDB 5AZ2L 2FO4A 4PUBH 3R1GL 3NCYS 4F8TA 3CXHJ 4U6VH 1HHIB 3PNWB 5CP7B 4M61B 3SGDI 3VI4E 4URTB 3LY6A 4G8GB 2DBLH 2CQVA 3HAEG 3MLZH 1KB9K 1P1ZB 4JRYD 1T1WB 1UGNA 4C56D 3GSNL 4ORGB 3QXUA 4NJ9H 3TVMC 4NRXA 2CDEB 2RR3A 3IJHB 3K80A 3PF2A 4LRNH 2C1OB 4X6FB 3PP3H 3D69A 3IDYB 1VFAB 1PZ5B 2NW2B 4ENED 1NEZG 2IAMB 2J12B 1IGYB 4OIIL 5ESQB 1DUYA 1RIVH 5CWSB 3HUJB 3EYVA 4N5ED 4PP2A 4R97C 3PWPA 5F44A 5A1AA 2JJSC 1GGIH 2UYLA 5F7EL 2CIIB 4YDKH 1JGEB 4IOIA 1GAFH 2HFGH 3L9RA 5IROA 3T8XB 1HXMB 2JLLA 1BFOB 4OD3L 5JOPD 1QFWL 1I1FA 1IQWL 2DOCA 4X98B 3UDWA 3BWAB 4LARH 1S7TA 4PTTB 1GGBL 1L7IL 3D48R 3KS0H 1CDJA 1U8KA 2YD7A 4MVBD 2V5TA 3QFJA 2VQTA 1FZKA 3FO1A 5B3JF 1UKSA 4ODHH 1DQJB 4HWEH 1AQKL 3VD3A 4C55A 3GI8H 1H15B 3K1DA 3GHBH 2XNAB 5L0QC 3BVNB 1FDLH 1NGZB 3OAYH 5FCSH 2A6JB 1KB5L 3TIDB 4KKAC 2VN4A 4NM4L 2BMKA 4H5SB 5I6XC 5MEPA 1OGAB 1OWRM 4GS7C 4IBLT 3UJIL 4WFED 2DQIL 4HJGA 1YEEH 2IFGA 1WIUA 5FA4A 3V5HA 2HFEA 1CR9H 2DQFB 4X4ZA 5GRUH 5IFJA 4GKSA 1X5GA 4XBEL 1MF2H 2YUXA 3X13B 4YDIL 1B2WL 4PJ7A 4ODSL 1T1YB 1WWAX 4ZFGH 3KLSA 1UYWL 4L4TB 3UPRB 3QXAA 3HUJF 3K4AA 1MI5A 3GK8L 3KJ4B 3W2DL 1ORSA 1KPVB 1I1AB 1I9IH 9CGTA 3VRIB 5GPRA 4ZTOL 1V7NH 4I3SH 3MBEC 3THMH 5F88B 3T3PE 5DMKA 4BK4A 3VWJC 3N1MC 2XXMB 1VADA 3T0DA 1G7PA 2V2XB 5DFTA 3QH3B 4CVZA 5IMKB 2DWDA 4DKFH 4LHQB 3QUZA 4IRJB 2I9LA 3TGXA 1ED3A 3WDHA 1R5IB 5I8OL 2Y25A 4AENA 43C9B 3FOMB 2AEPH 4LMQI 3MJ9A 2V17H 4HKXB 4HQQH 3CFDA 3CX5K 4FQLL 1E4KA 1I85A 2V2WA 2BZDA 1B4JH 1PQZA 2JCCE 3QIUD 4KHTH 2AGJL 2R69H 2Q8AL 1PZUB 3KNBB 4Y2DA 3SDDC 3JWDH 3RAJH 5DMIH 2FZ3B 4WHDA 1UWXH 3PL6D 2NY4B 2IPTL 3JV5A 2G5BB 3QO0B 4RMSA 4HXBL 2Z8VC 3ULUL 2YRPA 3D85A 4PJEE 2DJSA 5E8EA 4I4WB 4NP4L 3CDCA 2UZXB 1YYLL 2VAAB 3CLEL 3IJYA 1T5WA 5TJWK 4HUXB 5D7JD 4YE4H 1IFHH 1GSMA 1D5ZA 1ZLVH 4MNHB 3MLXL 4NZJA 3UC0L 5ELIA 4YPJA 3OX8B 3SDCC 3TN0C 1Z9OA 4FXLA 1D9KC 3V5KB 1HSBB 2EDTA 4DZBB 1S9YA 3MRIA 1RUKH 2WK2A 3JBG7 1IEBB 3RTQC 4LCWB 3KPLA 1MCEA 1F3DJ 4BA8A 1S5HA 1HHJB 1SEBB 1XGYL 3C5JB 5F9AC 4JFXB 4DUWA 5SWZA 1S9XA 1NGQH 1X5KA 4X4YB 3HE6C 3U0PA 2VL5A 3TV3H 3ESUF 1D5BA 2HKHH 4WU7B 5INCB 1I8IB 3CNKA 4FZ8H 1HHHA 4NO2A 5DRNA 4UDTA 1QYGL 3GGWA 5D7LA 1LEIA 3IDXH 4FQXA 4P2OB 3BN9D 2D3VA 4NQVA 3RU8H 3B4NA 2JTDA 3H9YA 3QZWB 4UIKL 4LDLB 5MI0C 2DM4A 3PJSB 2P5EB 1YDPA 1EMTH 5H37H 2GT9A 4KJPD 4P9HH 5E2VH 4QRPE 3DUUB 1B3JA 2QLVB 3C9NA 1KPRB 4O02L 3BYYA 4X6CE 2C3GA 3F7RA 5DRWB 1Z3GH 2QQQA 4GT7A 1JPGA 3QFDB 3BP7A 4K3GA 5ANMA 4UDUB 3BZ4B 1RK1B 3T1FB 1N6UA 5IQ7L 2YPVH 5DS8B 4ZG1A 4P2RA 2X4UB 3D18A 4TRPH 1MLBB 5B8CB 3WJJA 5IW1A 4CAGA 5C0BB 1NCAH 4NBZB 5DJ0A 1XGTB 4XPGL 3MJ9H 2HH0L 4DVBB 3EJZC 4JO4H 2IPKA 3GJFA 3MCKB 3RBGA 5IVXA 4NHUA 4NZTH 2ARWA 2BJML 3TJEL 5FKAB 2VZ1A 4CW1B 1CICA 3EFDH 5CMAB 4NUGL 4F7MB 2CUHA 3G9AB 1T3FA 1I8KB 3OAUH 2BFVL 2YS4A 4LF3B 4GG6F 3SQOH 4OZ4A 3EGSB 3N1QC 2CIKB 1EBPA 4PJFF 2EC9U 4MAYA 2O5ZH 1MWAH 5TDPA 4JDZB 2KZWA 1HH9A 4MX7B 4JRWA 4DOHE 1N59B 1NMBL 3O3UN 5D5MB 3SCMD 3MRRA 4O2EB 5FHAL 3ARBA 4HAFA 3ARYA 3IDGA 3VD7A 3ULVC 3GMMA 1UKTA 5HGAB 3N1GC 3FN0H 5E95B 4FOMA 1FV1B 4LNVA 5BZWB 3DURA 5KG9B 2O5YH 3MNVA 1QFPA 1X5ZA 2LABA 4WTXA 2DM7A 2Q7NA 3L3JB 1MCPH 4PJAB 3E8UH 1FLRL 5ISZB 4PJIE 1FZMA 2VXVH 2MPAL 4ZUWA 3CVIL 5LWYH 5L7XL 2Q6WA 4UILH 1BVKB 5MHSE 3IFNH 4IEFB 1QVOA 2N1KA 4XVJL 3KWWB 1FN4A 1FYTA 5L8JB 3SBWC 1EXUB 4APQB 5SX4I 3NMEA 4HJJL 5I8KL 4M5YH 5GGSB 3FO0L 2E7LA 5TGBA 5KVEH 5GHWH 5EFIB 4ELMF 3D3VA 3N0PB 2V5YA 3U9PL 3FQWA 3EO0A 3TA3B 2PW1B 5T3XE 4XVTH 5CUSH 5I74C 4U33A 1H3GA 4QRPD 4XPAL 3RWCA 5FECB 4HWBL 4RAVB 2N4IA 43CAB 1KCKA 2BOBB 1IGFH 5C70A 4ZODA 1A3LH 3DRQA 4YHNB 4YXKH 2G5RA 4DZ8A 2QHRL 5D5MF 5KOMC 4LVOC 5CJXA 1LK3L 5L9DH 2EYTB 5F7FA 5FKPA 1R0AL 5DGQA 2UVEA 4X5XB 3U79A 4EQ2A 4OI9A 2F15A 1YN6B 4PJXE 4QXGL 4MDIA 4DK3A 4CJ1A 5DZLA 1MFEH 2H1PL 3SE3A 3A6OA 1ACZA 5EUOB 2VXTL 4M48H 2CKBB 4V2CB 2NLJB 1P4BL 4MA7H 5DD6B 5BXFB 5E8NB 4G6ML 1QLRB 4ZDHB 3GJFH 4ZD3H 1J9CT 2W0FB 3C60C 1J18A 1SY6A 5DQ9A 3CXDL 1FAIH 4XP4L 1CK0L 4QGYA 3NBNA 1TTGA 1UH2A 4MMXC 1X9QA 3FCTA 3NPSC 4PJBE 3BWUC 4DFIA 4WWKB 2APTA 3FAWA 4AH2A 3CPLA 1SBSH 1TMCB 3GSXB 2X89A 4WDIA 3BSZH 3O4LE 4XB7A 3MYJB 3L5XL 4ZAKD 4D3CH 2J8UA 4KK8C 3DSFL 3LRSA 1NSNH 5F3BA 3AS3A 4I77H 3L7FB 2CXGA 3DUHA 3M8OH 4XP6L 3T3ME 3ILPB 3MLYH 5E6IC 5IQ9A 5IVZA 1CE1L 3HR5A 1HCFX 4LCIL 3ZTJH 5I1AB 1KENL 4M02A 3GZKA 1KTDB 4J1UA 3HPLA 4ZNEA 2CD0A 5JHDE 1ES0A 3E6HB 1K5NA 3QCVL 2PO6D 1FGNL 5FO7B 5MHSD 2J8OA 1CG9B 2DYPA 5HGBA 1MEXL 1TVHB 1WFNA 2Z8WC 3HE7D 4N0FB 3QUYC 4KK5D 5AWNL 3QUXC 4P3WA 4OGYH 3FT4B 1NDGA 1WTGT 3AMKA 2AABH 2H2SC 1LO4H 2A9NL 2YPLA 1M7DB 2OTUA 1FPTH 5FEBA 1SJVA 1XZ0A 2R15A 3FAXA 5EUOF 5EIVA 2XRAL 3GIVA 4M3JA 1WICA 4KKCC 2CO7B 1BIIB 5IOPA 1L6ZA 4NO3A 4AZ8A 3UMTA 3HC3H 3P9LB 5T3XD 3ZLQC 3MJ8B 4WIQA 2DDQL 1JPSH 1NMAL 2Q1EA 5EOCH 1G7IB 5ESVA 3TBYB 4Y19B 2R1XA 4RGNC 4GAFB 1TJGL 1BFVL 4JG1H 5DR5H 3QIBC 1UB6A 4YDVB 1KOAA 3OXSB 1MQKH 5BV7L 4ONFH 1JZ3A 4L8DB 1CD9B 3MA7B 4LAQH 4WUUA 1CD1A 2J1KA 3T4AA 5EOQH 1KLGB 1E4XI 3HNVH 3GMQB 2WNGA 4X0KB 5BO1L 2R2EB 2NY6C 4ODTL 3B3IA 5DYOA 1YJDH 2UZIH 3C8KA 1T4KB 1EAPB 2VDQH 4XMKH 4M6AA 1FFQA 1HWHB 2A9ML 3FB8B 1U6AL 4CNIB 3U0WH 3HZVB 1UH3A 3U46B 2B8OT 4Y4HB 4FNLH 4PRDA 3RIAK 3NIDF 2F53E 1UA6H 2C3VB 2RCSH 2UWEB 4DGVL 4OZIB 3BKCH 1HHIA 3HNTH 3PNWA 2XA3A 5CP7A 4M61A 4JO1L 1TNMA 1SY6H 5I1CL 4G8GA 1P1ZA 5EU7E 1T1WA 1KEMH 3RKPA 3VXUE 3P0YH 3CDGB 1G7QB 4ORGA 3U30C 4YIQB 5CEXB 3O4LD 3BH9B 5A2JH 1JGLL 2CDEA 4HBQA 2E9BA 3FN9A 4XXDB 3IJHA 3PWJB 2C1OA 4X6FA 4OZFB 4DGYL 3DXAE 5EWIH 1VFAA 2IAMA 2LFGA 4HCRA 3QIWD 2VXUL 1IGYA 5ESQA 1Q94B 1A21A 4ESKA 3OKNB 4OLYH 5CWSA 2A77H 3HUJA 3T65B 1R6VA 1UM5L 3GHEL 4N8CH 1MCFA 5CBAB 4AEHH 1U3ZA 4KY1H 4PG9B 3C6LC 5JHDD 4W6YB 2CIIA 3RJQB 4HIHB 2XKSA 5CINH 5AZEL 3B8SA 4MD4B 4NKMB 5E24E 3HNSL 3QEHB 4WTWA 4XAWH 4I0KA 3T8XA 1HXMA 1BFOA 1DLFL 4XXCC 3IRPX 1VGEH 5KSBE 1N4XH 4X98A 2OSLB 4GQ9L 3BWAA 1I75A 4Y5XC 4PTTA 4UIMB 2AXFB 1UXWB 2OI9B 2AJVL 2OTWB 4TN9A 3TO4C 1DQJA 1I9JH 4Z95H 1H15A 1I3GH 2P46B 4OZIF 4ZUUB 5IBUG 2HG5A 2FX9H 2XNAA 4M93C 1NGZA 3I85A 2A6JA 4HXAL 2PYFB 3TIDA 4NN5B 4K3JL 1R3LB 1UEMA 2YWZA 1UH4A 1KG0B 4HIEB 3HMWH 3S35X 5TH2B 3GBNH 2Z31B 1NLBH 1OGAA 3QDGE 4H1LG 4CUCA 1XR8B 5J12C 3WJLC 4HV8B 1CU4L 3DI2B 4MD5B 4LSSL 3ARGD 5I17B 4AG4H 3QCTH 1JE6A 3MGOB 4HKJB 1KJMB 4X7TB 2DQFA 4QRRE 3X13A 1CDIA 1GC1C 1WC7B 4NWUL 2P44B 4YWGL 5E00B 3D39B 5T1KD 2Z8SA 1T1YA 3MV7B 5E4IA 2IQ9H 4L4TA 3UPRA 4ZXBB 3OV6A 3MLSH 1L0XA 4LCCB 4PGDB 2X1WL 2F53D 2X4RB 2E9IA 5EZIH 1GGYA 1KPVA 3O6FD 4UQ3B 3VRIA 2WBJA 2EXYD 4HK0B 5BOZG 4A6YL 5CEZL 1N64L 3DARA 2GY5A 4AM0B 5E2JA 3UTTE 5F88A 3VXUD 4P9MH 5GGQH 3KPOB 2H3NB 1MRFH 1NC2B 2V2XA 3QH3A 5IMKA 4K3DL 5KVFL 4U2ZA 1XCQB 1MJ7H 4KQ3L 5CEYB 4KZEL 4IRJA 5F72S 1GZQB 1R5IA 1ACYH 1T66D 3DXAD 43C9A 1A9EB 3FOMA 4MB5A 1BWWA 4XWGL 3CC5B 3SO3B 4YHYB 4M1DH 1CIDA 3RWHB 3CH8A 5HYSG 4O58H 4S10A 3MNZB 2VE6B 4YHKL 4HCRH 4JM4L 4RFEA 4KJYB 3I02B 3SKOB 4XCEB 4RX4D 4M03A 3KNBA 1Q0YL 4XCCL 5HHOB 1G9NL 4D2NA 3S5LB 1MVUB 3DGCR 3QO0A 2G5BA 1EFXB 5HGGS 3VGAC 4P59L 2QTEA 4R96A 4JO3L 4OGXL 5DEFB 4PTUB 3O9WB 2V2TB 1YN7B 4I4WA 3BAEL 5IW6B 1NCUA 3KG5A 4TNVF 5FHBH 4U49A 4L3EE 3VXME 1FSKB 3LIZL 5B22A 2VAAA 3D25B 2YRZA 4HUXA 4B7IA 3LH2L 1KJ3H 1WCBB 4MNHA 1PY9A 4FQCH 1L0QA 1HHGB 1S7SB 1MY7A 3OX8A 4EI5D 4EN3B 1RZ7H 1HSBA 3V5KA 2XPGB 3MRHB 4DZBA 4KMLB 3TFKC 4WO4B 1IEBA 3GNML 4N5EC 4LCWA 4XTRC 1PBYA 2Y07L 2F8OA 1HHJA 2LVCA 4KZDH 1SEBA 2FL5B 2NNAB 4OLVH 4JFXA 4HW6A 3DOSA 3QDGD 4F7EB 4LEOB 4OF7A 4X4YA 2R56L 3ZDZE 1IEHA 1ZGLB 2OMBA 4K94H 4MDJB 5ADOH 3DLQR 4XWOC 3I6GB 3KXFE 5FGCB 4OZGE 4WU7A 5INCA 1I8IA 2F5BH 4QRRD 4A2MA 2WUCH 3HG1A 2E6PA 1CE6B 3OKOB 2G2RB 2PR4L 5HDQL 3U1SL 4P2OA 3ULSB 3QZWA 5EBGA 1NFDB 1TDQA 3PJSA 1MCHA 3F12B 4GAJH 4AQ1B 5LJYH 5GS1A 1KLFA 5F7HA 4P23B 1VERA 3DUUA 1DVFD 3IF1B 3DO7B 3UTTD 3QUKB 3K2UL 1KPRA 3PV7A 5D93B 2APWA 5DRWA 3KPSE 5EOTB 1F3DH 3O8XB 1S7RB 2YZ1A 3QFDA 2CMRH 5DD1L 3TZVD 3IKKA 3BZ4A 4UDUA 1RK1A 2Z92B 4S1DD 3T1FA 1C8PA 1NCTA 5GRVK 1U9KA 1OAUL 3BW9B 5DS8A 2VLJA 2X4UA 3NCEB 4YQXH 4NNXB 3Q6FA 4GW5B 1MLBA 1EK3A 1P4IL 3FFCB 3AREB 3GSRB 5C0BA 1F4XH 2IG2H 3ZTNH 5LBSL 1XGTA 2FB4H 5I30H 2QQKL 4DVBA 3MCKA 1WISA 3IDMB 4LVEA 5FKAA 3VG0H 4CW1A 3JTSB 3RZCD 3LAFA 5CMAA 2OR9H 2YXFA 4F7MA 1A6WL 4JHWL 1I8KA 4TOYL 2FX8H 2WUBH 4LF3A 1IILE 3PWNB 4UMGA 3EGSA 5I75B 2X9WA 2CIKA 3HZMB 2GSGB 1ZVYA 1N3NB 1SMAA 3LV3A 1DBJH 4JDZA 4ZUVB 4MX7A 1JHLH 3SKMB 4U3HA 4YX2H 2UY6A 1N59A 1N6VA 1FGVL 4QF1B 3LD8B 5D5MA 1ZEAH 4O2EA 2C3WA 4L3ED 5KVGH 1F11B 3VXMD 1N0XL 5HGDB 3RA7H 1VCAA 3TM6A 2P8PA 5HGAA 1NFDF 3QI9D 1FV1A 1T7XA 3KPNB 3SJVB 5BZWA 1D5XB 3MJ7B 1XIWD 5KG9A 4HJ0D 3QIUC 4KMTH 4IRZH 4H26B 2IF7A 2KUTA 3IRZA 3L3JA 5SWSA 1A7OL 5EORL 2XN9B 4PJAA 3S9DB 2B2XH 4L1DA 2VDOL 1SYVB 1RZJL 4GMTL 5ISZA 5IT2H 1I8MB 2FD6L 1BVKA 4GOSA 1VFUA 3JXAA 5HVHC 3KXFD 5CSGA 5F9JB 4LCYB 4OCYL 4PREB 3CFKA 2LU4A 3CLFL 4U3CA 1X7QB 1IKNC 3PP4L 2Q8BL 3KWWA 3MUHL 3K0WA 3QFJE 1WCQA 1EXUA 3MLWH 4APQA 1MHPH 3RIFK 1SJHB 5BVJA 4PPTA 3CU7A 3IXAB 5GGSA 5GS0D 2Y6SD 1KELL 2R0ZH 4XC1L 4UBDC 4U0QB 2DQTH 4PV8B 1KTRL 3TA3A 2PW1A 4XCYA 2ZSVB 3DMMD 3RWGB 1RQ5A 3C8HA 3HRZB 1ZMYA 4TYUA 2M26A 5C2BH 5C0CB 2VXSH 5CCKL 1IGCH 3FQXB 1NJ9B 1RMFL 5FECA 1AGEB 5I18H 4RAVA 3KPSD 1JZ7A 1JHKH 2BOBA 43CAA 1KULA 3NZHL 1NLDL 4YHNA 1MRDL 3DYMA 4OF6A 4G42A 4WHYH 2I27N 3GFUA 4PG2C 1F13A 3OKLB 3JWOH 2EYTA 4AT6A 4X5XA 4JAMB 5DC9B 1GHFH 1MCOL 3W0WB 4Y89A 4PJ7E 1YN6A 4U1HB 4X9FA 5E4EB 5JDSB 5C6WH 3BN9C 3BKJH 5EUOA 4M7LL 1MI5E 2CSPA 3O45B 2CKBA 2NLJA 3MCLL 1CGXA 4MAUH 5DD6A 5BXFA 4MQXC 4Y16C 3CZJA 3VFGL 5GXBB 5LGHL 5E8NA 1QLRA 4ZDHA 1JGVH 3IKCB 5DURB 1IMHC 3O6KH 2W0FA 4KJPC 2JELL 3GSNA 4YK4B 1QBLL 3EW3B 3LMJH 4WWKA 5CILH 5AYUL 5FO8B 1MLCB 4XX1E 3GSXA 5D8JH 1RZ8B 3UYRL 4Q9QL 3MYJA 4BKLB 4HWZB 4HGWB 4RMQA 3DIFB 4YEFA 4TVPL 4GLRI 3L5WB 3L7FA 5MP6L 3ILPA 1HKFA 2ZOKA 3PHQA 1AKJD 2YBRB 3LS5H 1RU9H 5I1AA 5FAAA 1XCTB 3TNMA 5FFLA 1KTDA 4JQXA 3UTSB 3E6HA 1G7HB 4M6NL 4L4JA 5FO7A 5FUZL 2CDFB 1CG9A 4Z7QE 1TVHA 1J10A 5F6IC 4N0FA 1DFBH 1G7LB 2B4CC 1JYNA 4OJFH 2HMIC 1KV3A 4DUXA 3JUZA 5L2KE 3SCMC 3QFJD 5SWQB 5C0GB 1F58H 1MPAL 1M7DA 4EI6B 1HE7A 3SGJA 1SYSB 2AJUL 2MSPA 1RZFH 1CF8H 4X8XA 2HLFD 5FM5O 2OJZH 4RWHA 5JORB 1BIIA 1NBZB 4HHAB 3P9LA 3B83A 3MJ8A 3UCRA 1IC7L 1JNNH 2ADIB 3UJJL 5SWZE 3TBYA 2R0LH 4QNPE 4Y19A 3T0VA 4XNQB 2RJMA 1I3VA 2YD5A 3QPQC 2CLRB 4MQSB 4YDVA 2H2PD 3OXSA 3MO1B 4L8DA 4XNUH 3MA7A 1X44A 3CFCL 5EZOL 1JUFB 3WYRA 5D7LE 1KLGA 3GMQA 4ALAL 1XR9B 3K8KA 5TFSH 3P40A 4X0KA 2VH5H 2R2EA 1YNKL 3U83A 4KUZH 1OD7A 2ZPKH 4HPOH 1T4KA 1EAPA 1JPFB 4LHJB 4CN1A 1P9MC 1T7YA 4X4MA 4CNIA 1MI5D 3FB8A 5C92A 2R8SL 3HZVA 2XG4A 2ICWB 3U46A 4Y4HA 1WZ1H 3G6JB 5C0IB 1T2XA 2CKBH 2C3VA 4X6BB 2UWEA 4H20H 2C3HA 1NFKA 3QRFM 5C6PB 2V5MA 1S3KL 1RJYB 4NN6C 3NTCL 3WSQH 2YPKB 4NGHH 4U7KA 3QB7C 1S7XB 2NYYD 1G9MC 4KTYA 5F1KC 3K4DA 4GKOA 3GSNH 1OHQA 1MUJA 5A2FA 5ANME 4Z7WB 1JI2A 3CDGA 4PY8I 1XF1A 1G7QA 4YIQA 1JYWA 5CEXA 3BH9A 1JCKA 5T3ZE 4P2RE 1U3JA 5B21A 4P4KB 4MHHI 4XXDA 4UT9H 3PWJA 3S36X 3W82A 4UTAH 2AW2A 4OZFA 4HIJA 5HI5C 5IIEB 4NO0B 1LEKB 1WAAF 4FMKA 4NQSB 5IVXE 4UU9B 4N9GA 4Z6AT 1Q94A 3OKNA 4F57L 4U1JB 2GW5A 4Y2DD 1QOKA 1U8IB 3GIZH 4YFLI 4XH2B 2MHAA 3WLBB 3T65A 3RGVD 5CBAA 5F7EH 1IAIH 2AK4E 1BLNB 2AEQH 4PG9A 1ZANH 1HINL 2RGSA 4FXKB 3V0VB 1TETL 4HIHA 5AEAA 3D85D 1Y18A 2E7BA 4MD4A 5B3NA 1XF3B 4NKMA 1Z0MA 4UTBH 3F58H 1IQWH 1M1SA 5E2TH 1BZ7B 5L2KD 1T7VA 4NNPL 2OSLA 4YHMH 4BQBA 4ZAKC 4XNYH 1KN2H 3H9ZA 3F5WA 3KYAA 4H0IA 1DBKL 2ICWJ 5ADPH 3DV4B 4UIMA 2AXFA 1UXWA 1Y6NR 3S34L 2J3SA 2OTWA 3G6JF 4MNQB 1SQ2N 3OHXB 1CLYH 4JANB 3HRPA 4ZUUA 3T2NL 5DO2C 4NM4H 5ID0B 2I60H 5SWZD 2PYFA 4N0CD 5J6GB 1R3LA 3MROB 1KG0A 2JJUA 3ILQD 4HIEA 4OGAD 2PO6C 5TH2A 2Z31A 3JSSA 1V3JA 1XR8A 3UJIH 4Z7WF 2DQIH 4HV8A 4MD5A 5GGUB 3HE7C 5I17A 1I3RB 4KK5C 1BQHB 3H6JA 5TDOB 1U2HA 3MGOA 4RMVA 4HKJA 1FYTE 1KJMA 4X7TA 5D7LD 2XI9A 1B9ZA 4XBEH 4QYOB 1N5YH 2XQBH 3WFCL 5E7FA 2VUOA 4FQXD 1PG7X 3DI3B 1WC7A 5C0DB 1WVZA 3GDBA 3FMGL 3D39A 5E00A 1DANU 5F6HI 1VFMA 3MV7A 3D3VE 4D0DA 4JFFB 3HC4L 4ZXBA 5B39G 4LCCA 3QP3A 1KN4H 2VOTA 1F3JB 2X4RA 4UQ3A 1LE9B 4PBWD 1ITCA 3J8F7 3AM8C 4HK0A 5EBLB 3U36B 1E0OB 5EG6C 4AM0A 4JKPL 3EYSH 5D2LF 1SHMA 3EYQD 3IGAB 3V0WL 2DN7A 3HMXL 3DX7B 3KPOA 2H3NA 1NC2A 4WUKH 2AJSL 2NY1D 5T3ZD 1XCQA 4P2RD 5CEYA 3QNZB 3F6LA 1ZOXA 4FQPA 4OFYA 1ZVSB 1A9EA 1QFUH 4WI8A 3CC5A 4FQLH 1IC5L 3ISWA 5AG9A 4OZFH 2AKRB 2EKJA 3RWHA 3ZE0F