2DQFB

Crystal structure of hyhel-10 fv mutant (y33ay53a) complexed with hen egg lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDAWSWIRKFPGNRLEYMGYVSASGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 20
structure length 114
sequence length 114
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqfB00
4WGVB 4NZTH 1IAIM 1UEMA 5TH2B 3HI6H 1MEXH 2C3WA 5J13B 1NUFA 4LLUB 4U4BA 1A1OA 1W0VA 3CVHH 5EU6E 4AG4L 3ZKXB 5C0JA 2QQKH 4PJIA 2ADJA 2DIAA 5F1NA 4NWTH 3UYOD 1DLHB 5F9JA 4IOSD 2E9IA 3IFPB 4KRLB 4L4VB 5HY9A 3VWKC 5D2NA 1KNOB 1UB6B 2C3VB 4P59H 4M6OL 2VDPL 4WDIB 3D2UA 1UGNA 3NIFF 1JNJA 5FHAH 5IMMA 5FECB 2ADGA 1MRFH 2X70A 3O6ML 4R90H 3VFRA 1C1EH 3N1PC 5D1ZA 4BELD 4KPHH 5I1LA 1CLZL 5I8OL 3LAFA 3VGGA 2P5WD 5DRXA 1U6AH 2EC8A 4XGZB 3SJVE 5B39G 4L9LC 1JPFB 4QXTB 1VSCA 1S5HA 3NGBC 4U1IB 1MLCA 3DUHA 4K8RH 5J9PB 1T0PB 1S7VA 1TJIL 3SGEH 3LEYH 2XA8H 4JFHD 3OKKB 4MNQA 3TO2A 1HZHL 4PB0H 4QHMA 3SKMB 4OZGF 4BM7A 2G75A 4PJ7B 3ZDYF 2OXHA 1JN6B 2DYPA 3O3AA 1I7UB 1RUPH 1WIOA 4E42B 4XVJH 5C08D 4CVUA 3HZVA 5EU7E 5D7IF 3DTXB 2VXUH 3VFUA 4MCZA 4RSVA 4U6VL 2WQ8A 2E6QA 4CMHC 2P4AB 1CZ8L 1DANT 3OZ9H 1YA5A 4GW4A 4RBPK 4UZGA 3DVNB 5HBBA 1VEMA 3SKOA 4DAGH 2GJ6E 4HUWA 3U46B 1FBIL 2DD8L 4KHTH 2XACC 5CBAB 2XKUA 1NJ9B 5IQ7H 5J11C 3GSOB 5SX4I 1JNHB 4XP6H 3CMGA 1R3JB 4JKLA 2R29L 1I7RB 1S7TA 5E5RB 3MO1B 2X4OB 1CFBA 3P4MA 5F9DC 5AYUH 1WCBB 1KPUB 1PY4A 4OZ4B 3HMXL 3V5KB 2Q3ZA 1WVZA 5TDNA 5CWSB 3WEXA 1OAZL 3QRGL 5F7KC 2EDHA 1CD8A 4PG2A 4HG4J 3E8UL 1HNFA 2A6JA 4FABL 2DTML 5IB3A 1EEQA 1A6UH 3HLAA 2V17L 3IDMB 2XZCH 3V8OA 1U8PB 2J8UA 3QG7L 5I6XB 3IRZA 5E8DH 1G7IA 1T3FA 1N5AB 5BXFA 5I8EA 1AQDA 4OFYD 3RWGA 1X7QB 5C6TL 1A6VH 4RISL 2YBRA 1FNSH 2GAZB 3UMTA 3JVGC 3IFNL 3EO9L 3O4LA 3TLRA 1XEDA 4Y89A 2A9NL 1QBAA 3ULVL 4XHQA 1N59A 2OMBA 1HHHB 4X6EA 1RURL 3SDXE 2J2ZA 2C26A 1KB5H 1BZ7B 2NX5D 3VWKB 4LMQI 4L3ED 4HXBH 1PKQB 3OPZL 4XPHL 2NNAB 1S9XB 1KBGL 5MP6L 1A1NB 3R4DA 1U8KA 3HC0A 1NDMB 5K9KA 4M02A 2HJLB 3WHXA 1Q38A 4XNXL 3VFTB 1ADQA 4H8WL 1WBYB 4U3XA 4L9LB 2XQYG 4FXGA 2BNQA 5FB8A 3DUSA 3NGBB 1IBGL 2F53B 4NO3A 3MRJA 2CKBB 5F8QC 4NBXB 2ATPA 1QRKA 3TPUA 1JZ4A 1JGVL 3U1SH 1I4FA 2FECI 4H1LH 5EOCH 5CIPH 1QLEL 3Q5OA 3HA0A 5IBLD 4Z7NF 5AD0A 3MRMB 3SDDA 1TENA 3C5ZD 4KTDL 1BQSA 5D9SB 4TOYH 4PRHB 1Q9KA 2BJML 3MNVA 4MSWA 3NFSL 4CMHB 5DR5H 2FGWL 4EI6B 1WLHA 1IM9D 3MYJB 3FO0H 1U8OB 3ARYA 5C6PB 5LCVL 3T0AA 5HYFA 1KCRL 3QHZL 2UZIH 2FJFB 4RAHA 3T1FA 4XC3L 3ZSSA 1U91A 5J11B 1XCTB 5EPMB 1FG2B 3ZKQD 3DO7B 2FX9L 3LSOA 1TFHA 3D85A 3O9WA 4WHCA 3T2NH 43C9A 4X4ZA 2XY1A 5BW7A 5MENA 1MRDH 4QXGL 1Z6JT 4PTTB 4LLQA 4NZTL 1XF4A 5DYOA 8CGTA 3HI6L 3NPZB 3OJDA 1MEXL 2H9GA 5E5UB 5EBLB 1RZJH 2XT1B 2HT4D 3CVHL 4PREA 3I6LE 1KIPB 3DUUB 1AD9A 4PGZA 2QQKL 5CEXA 2VXTH 1AE6H 3HHRB 4NWTL 5D5MA 4AY0A 1S7QA 4K3DH 3IKCA 5CZKA 1AH1A 4TUOB 2ZG3A 1JF1B 3LB6D 3QCVH 3HR5B 1T6WA 4P59L 5ACLA 2FLBT 1KJMB 5FHAL 2IPKA 3H8NA 1MRFL 4R90L 3AVEA 1C1EL 5GGVH 4KPHL 3DBXA 4F37F 5T33H 3IJHB 3OAUH 3P9MB 4O2CB 4EQ2A 5IB1B 4TUJB 3WJJA 1T4KB 1U6AL 3PWLA 5EU3B 1P5VA 4EDXA 1M7IA 1RZ8B 1QG3A 1J18A 4K8RL 2FLRT 1CDYA 1D5BB 2XA8L 4MA3A 3V8CA 1KTDB 4PB0L 5T3XD 1JGUH 1A47A 2QQLH 1MWAH 1I8LA 2VC2H 3D0VA 4QRRA 1OY3B 1A9EB 3SDAD 4XVJL 4MGXA 4Y19B 3K4AA 3ULSA 4I2XA 5DZOA 5C8JB 2VXUL 3ES6B 5KSVA 3PE9A 1T7WA 2C5DC 4IMLB 1GCFA 4YBLB 3OZ9L 3DETC 3PDGA 4O2FA 2Z35B 1LWRA 4DAGL 2BRRH 1I75A 3GSWB 4NRZA 2W0FB 3VJ6B 3GKWH 3L3IB 4KHTL 1G84A 1MELA 4XNMB 3MJ8B 5TGBA 3IU3A 4DQOH 5IQ7L 1HEZB 1ORQA 4XP6L 3BKYH 1JWMB 4KK8C 2YEZA 2WK2A 5D70H 2UUDK 3ZHLA 1QHPA 4ISVB 2CRMA 1IRAY 4JFEE 1HDMB 4ZD3H 1WAAF 1QFUH 4Y4HA 3DRQA 5AYUL 2QTEA 3IDXH 1MIEH 1OT2A 2QHLA 4PJEE 3WFEH 5CD5D 6FABH 4NZUH 1NCDH 1L9NA 2VZTA 4I18A 3MRBA 3VXPA 2AJZB 2BSRB 1AO7A 3O45A 3ARDD 1JGDA 1A6UL 2OS7A 2XZCL 3QH3B 4ONFH 4POZD 4BUGA 3N06B 2FD6H 2KL6A 1J0IA 4CDGC 2C1OB 5E8DL 1EMTH 5DJCA 1HILA 4EN3C 3U7WH 5F72S 1H9VA 1RJYA 3MOBH 4R7NB 1A6VL 1J8KA 1KJ3H 5F7EH 1JWUA 1UVQB 5BRZE 4JHWH 1FNSL 2X41A 3G5ZB 3K8KA 1U8NB 3EOTH 5CZXD 3C08H 3TYGH 3EGSB 3VDCA 4ONHA 4QOKD 3RI5K 2P5EA 4HMEA 5C6WH 4PGDA 3CPLA 1RFDH 1KB5L 4HXBL 3KPMB 4P57B 3CFJA 2OM5A 4P3CH 4C4KO 4R9HA 4N5UA 5GS2D 1MHCB 5DJYB 5IMOA 1ONQB 4DW2H 1U8LB 2ZPKH 3K74B 3U30C 3EFDH 2ZJSH 1NFDA 2N7AA 3VMOA 4QRQB 1IEBB 4GG6F 4KRPD 2MJWA 1S78C 1JPGB 3QFJA 2MKWA 4HWEH 4YHNA 1YPZB 1WWWX 3MRIB 3GSXA 4LSRH 4NKDB 4HW6A 4HG4K 1HIMH 4PJCF 1FDLH 4TOYL 3KDMB 3C5JB 2V2XA 5C0ND 4EOWH 4H88H 2COQA 3TV3H 2CPCA 3QJHB 1AGFA 3RVXD 4WFED 3LKQA 5DR5L 4KGLA 4Y4FD 5IJKC 5GRJH 1BGXH 3S37H 2DQGH 4J4PD 3WFHB 3FO0L 3OGOE 3F65A 4APQD 1QFOA 4YDVB 1REIA 2UZIL 1NC2A 4OZIF 1XGTA 3EBAA 1UXWA 2FHFA 3M07A 5DFTA 4XAKE 1MI5B 1Q72H 2OTUB 4G3YH 2NW2A 4X5LA 3T2NL 3VDBA 1MRDL 5EZLA 3JV4B 4X5XB 1S3KH 3MUHL 1A5FH 4UOW1 4Z0XA 3DARA 3DIFB 2F15A 4YXKH 4DKAA 4Y1AA 1CGYA 4X9IA 1RZJL 5A40E 4N1CA 1CLYH 4XI5D 3LKOA 4HHAA 1UWXK 4FQPA 5B4MD 1HINH 4DN4H 4JFFB 1JV5B 2W59A 2VXTL 3UTSB 4WW2F 1AE6L 4IRJA 1DVFC 1B90A 1OAKL 1KCSH 1J8HD 4K3DL 4S2SA 5KAQF 2XZZA 3QNXA 4OUUA 3QCVL 4EN3B 2ED7A 12E8H 5JA8B 4PJFA 5FYKD 3ZE1E 2AKRA 1U8IA 5GGVL 4JFYA 2Z31C 5T33L 3OAUL 1CXFA 1QSFD 2PCPB 5FA3A 3U2SA 4QTIH 3LKRB 4XPBH 4LLYB 1VEOA 3NZ8B 1G0YR 4WFGD 3PWUB 4QWWC 3UTTE 3GSQA 1EXUA 3BP7A 4N8VB 1MJJB 4QHLB 4D8PB 3QUXA 4Q2ZA 4XZUB 3O11A 1S9VA 1U8MB 1JGUL 2QQLL 1MWAL 2VC2L 1X4ZA 2NZIA 4QNPF 3TWCL 4PGEB 3HMXA 2HWZH 4KKCC 4NRXA 3VXSA 3FN0H 4I0PA 5GGSB 3SBWA 4IRZH 2BVYA 3KJ4C 5IVOA 4DN3H 5L8LB 1BBDL 3U30B 4O2EA 4NNYA 3WJLC 1G7PB 3REWA 3P0GB 2QKIA 4OV5B 4Y7MA 1R5VA 3NFNA 5ECJE 1R0AH 2R2HA 3MREA 2BRRL 1XGPA 2HFEA 3G6JE 3MV7A 4M5ZH 2WP3T 2M26A 5E99H 3FFDB 3GKWL 4NKMA 4HDIB 2ZNWA 3C6LD 5EOTA 2VLJB 4G6AC 2UZYB 5KG9B 1BOGB 1E28B 4DQOL 4GAYB 4XWOD 3ZYIA 4L1DA 3F58H 2AP2A 3BKYL 3SCMA 5D70L 2VDQH 5CJBA 2VMFA 3O2VH 2GSGB 1N5YH 1XCQB 4ZD3L 1QFUL 1N6QH 2YPKA 4OZHF 4OLZH 4QRUA 2R9HD 5BZDB 5JXED 4JAMA 3IDXL 4MVBC 3LV3A 3C8DA 1MIEL 3QWRA 2EDBA 3WFEL 6FABL 2ITDA 4NZUL 1NCDL 4U1NA 4HEPG 4Y4KC 3WUWB 4JY6A 4F9PC 3KPNA 5C0CE 4OZFG 2FX7H 1WIPA 1H0DA 5FF6B 4ONFL 4MMXC 4Z7WE 2FD6L 5HGGS 2EYRA 5DT1H 1EMTL 3C8HA 3MNWA 4KY1H 3U7WL 4H0IA 3MOBL 1CDIA 3ARGA 4KHXH 3RNKA 3FONA 1WBZB 1KB9J 4XP1H 4Z7UE 5E4EC 1KJ3L 1TZIB 5F7EL 4ERSH 3M1BB 3VXME 4JHWL 3L95A 4MB5A 1YUHA 1GZPB 3EOTL 4LLDA 3AMKA 3C08L 3TYGL 5DJ2A 1P9MC 1DVFB 4LNVA 1W0WB 4XMPH 3VI3E 4ORZC 2C4XA 3QUYD 5IOPA 2J4WH 1RFDL 4XB8A 2CLVA 3W0WD 4J3UA 3T3ME 5AG8A 4ZODA 1UH2A 1SQ2N 4P3CL 1EVUA 3TA3C 2CDEB 5F9WC 5LKNA 3L5XH 4IRSA 4U1LB 1MPAH 5D7LB 2BNUA 2Z31B 3RI5F 3SKNB 1BJMA 1T0NA 2Y7QA 3BP5A 2WUBH 4DW2L 2PTTB 2ZPKL 4KXZH 3TP4A 1R24A 2B0SH 2D9QB 1OGAD 3EFDL 1GZQA 2ZJSL 1MCPH 4LHUG 3L5JA 3RFZC 3G08A 2ADIB 3TVMA 3MRKA 4ZFOL 2MHAA 3EHBD 5M7QA 1NMAL 4RDQF 1IGTA 2GQHA 4HWEL 1U3HC 4JFOA 5EZJB 1H15A 4P4RA 7CGTA 1OARL 4LSRL 3QDGB 1HIML 3TCXA 1M6OA 1FDLL 3LHPH 4P4KA 2D0FA 3KJ4B 4EOWL 3MR9B 4IHOA 1XF3B 4H88L 1DSFH 3H9HA 4LCIH 4NN6C 3MOQA 3RRQA 3TV3L 4X4YA 3RZCD 4U1HA 5DMYA 1HH6A 3VD4A 4PJ5B 4M7LH 3FQXB 5GRJL 2MPAH 3S37L 2DQGL 1UH3A 2X1OA 3KPSA 5IB2B 3V6OE 1FYTE 1R5IA 4D9LH 4JM2F 5ISZD 1P4LB 4LCCA 4NQCB 1LDPH 4YGVA 4PY8J 3OKMB 4JFPA 5EU5B 2HJFA 4PV8A 3RKDC 3VWJD 1T20B 1CDGA 2YA0A 2IPTH 4JKKA 2FIRT 3QJFB 1Q72L 1U3YA 2IC2A 4G3YL 4R96A 2V2WB 2IPUG 1S3KL 4NBZB 4OGZA 1A5FL 1JMZA 4JRYA 4QHKJ 5C9KA 1JHLH 4YXKL 2I07B 2Y25A 5DHYA 3L1OH 3DNKA 1U58A 1CLYL 1EEUA 4Y4KB 1I1FB 3QEUA 5I8CA 2V2TA 4KMTH 4DN4L 5T3ZD 3FQUA 3PQYA 1MFEH 3M17B 3I6GA 3ZKND 2OYPA 5AYQA 3GNMH 4QO1A 1KCSL 3GIZH 1J0ZA 3IDNA 3IJSA 4R8WH 3SE3C 4X6FB 2E7BA 3EDDA 1FGVL 4GO6B 12E8L 3HUJB 4YBQD 5IFAH 3K8MA 1I1AA 4CADB 2JK5B 5E4EB 5GS2H 1MHEB 1A6AA 3DROA 4YDKH 1TQBC 3P4OB 4QTIL 2XPGA 4XPBL 4HUUA 2BK8A 5MEOB 1KULA 2X05A 1IKNC 1RIHL 2PW1A 1FN4B 1HKFA 1G7MA 3V9FA 2O26U 5E9DD 5A2IH 4NDMB 1J05B 4FXGB 1A4JB 4L5FH 2PNDA 1OM3H 1QOKA 2GSIA 4F3FB 3TA3B 3D3VE 1HH9A 5F9WB 2DRUA 2VR4A 1HN1A 4PJGA 2HWZL 5C3TA 4WTZA 1VFAA 4UIMA 2BY1A 4IRZL 3VXUE 3F7VB 2Z0BA 1FFOB 2EIZA 4D0DA 1ROWA 1ED3B 5KVMC 2VDMH 4KTYA 1CU4H 4YR6B 4C56E 4Y5VA 5GISH 4R4FH 1BD2B 4M48H 4ODVH 1R0AL 1CIUA 3B43A 3KLAB 1U3HB 3UX9B 3ILQC 2AJXH 4M5ZL 5E99L 2WUCL 5I1CH 1I9EA 3QBTB 5EG6C 2ZUXA 3F58L 3MV9A 5DJ0B 5F88B 2Y5TB 4PRPB 4NN6B 3KYKH 4X6DE 1FNGA 1L6ZA 4GLRI 2VDQL 5IM7A 3O2VL 5IVZB 1N5YL 15C8H 3RP1A 2WBKA 4PJ7F 1N6QL 1MQ8A 1KB5A 4OLZL 4Q6IA 5J57B 2HTKC 1WFUA 3QUZA 2YHGA 4LP4A 4QHUA 1BIIB 4RMQA 2WBJA 4L29A 3FT3A 4NOFA 4QEGA 3UPRB 2FX7L 4QRPE 3QDME 5SX5K 4O4YH 3CFDA 1FNHA 2E8ZA 4Y5XA 1ZHNB 5DT1L 4KMLB 3QDJE 3INUH 4KY1L 4DK3A 5INCA 4WUUE 4LKCB 4KHXL 4L8DA 4M8QB 2LVEA 2YD6A 4XP1L 3BKJH 5GGSY 1INQB 4PJHE 1QR1A 5GS0C 1IARB 2D31B 4ERSL 2X4PB 4H1LA 2BOCB 5CIPA 1QQDA 2DQIH 3BPCA 1JNNH 3BZ4B 4ZFFA 5HHOA 4XMPL 2H26A 4XRCA 2Y06H 4ZDHB 4OCSH 2VAAA 2J4WL 2JJWA 4PYHA 2FYYB 1SY6H 1BVKA 2ORBL 5IB4B 5D1XD 3MPCA 2DKUA 2ICEA 1FNEA 1YDPB 3GDBA 3LY6A 3D69B 2W92A 3ZT6A 1MPAL 4W6WB 4GQ9H 4LARH 1MFDH 3H9SE 2XXCB 4MS8C 5J6HA 1TQBB 2VTFA 2VZ3A 2WUBL 1RK0A 2JKXA 5HYIA 4C83B 4ONOA 5DZNA 2XKSA 4ODXB 1MCPL 1T1WA 2AK4E 1T03H 5HI3C 2NXZC 2HT2D 3C9NA 4QXUH 2EXWD 1ZT4A 3MV8E 3VFSA 4BFEA 1ZVYA 2YK1H 3H6JA 3VG9C 3RY6C 2ADFH 1EO7A 3MRLB 3IXTA 1KUMA 3LHPL 1XH3A 4MAYA 5ICXA 3SN6N 3OXRA 1B0GB 5DEFA 1KLGB 4ETYA 3KYOA 1DSFL 5C07B 3QEQA 4JQXC 2IH3B 1YNTB 1XR8B 4OQTL 4M7LL 4CL7A 2MPAL 5FO8B 4KUCF 2DQTH 1KB9K 1NCBH 3MGAA 1B9ZA 2WNGA 3L3KA 4PRID 5DQDH 4D9LL 1G9NH 3JSSA 5I8KH 1GGCH 5D4QA 1LDPL 4XH2B 4G8GE 5GSRA 2IPTL 3PGDA 5JNYA 1MFAH 3L7EA 4PJXE 5IG7A 3G5XA 4JM4H 2Q8AL 1KLFA 4R2GD 1J0JA 2EDJA 3ELAT 4X5WA 5JO5A 2ICWI 3RUGF 2NR6C 1JHLL 3QXUA 3RY5A 3L1OL 5I0DA 4MXQC 3ZZ1A 3FOMA 4FMKA 4KMTL 4UQ2B 2Q6WA 1IEAA 2P45B 2W60A 4RRPA 2AEWA 1MFEL 1ZXQA 4L4TD 2LFGA 4GXVH 2X40A 1BIHA 5T1LB 3GNML 4JFQA 5I1KH 4R8WL 4CMMA 5BS0A 3V6FA 5HI4C 2AGJH 3L3DB 1DQQB 3RIFK 3LN9A 4N0YH 4Z77A 4WWKA 2GIYA 5MERA 5IFAL 3HNTH 2E7LC 2X4QB 2AV7B 1ZA3A 3CFJB 5DEZA 1WF5A 5JW4M 2XV6B 4P2QD 2R69H 3RKPA 3LPWA 1HCFX 3EFFB 2YD5A 2JJUA 2B1HH 3ZHKA 1FJ1B 2MCPH 4LLMB 2AI0H 4HV8B 3NABH 2EZ0D 5F9OH 1QLRB 4L5FL 2GJ6D 5DUPH 1OM3L 4QY8A 5AEAA 1NUNB 2IAMC 1CG9B 1DP0A 3SDXA 1F2QA 4E41D 1OAUH 5JLZA 3EYFB 3P11L 3X14B 2BFVL 5DJXA 2VXSH 5JPMA 4PG9B 3O3BB 1CD9B 2VDML 5L2KE 5MEQB 1CU4L 5J3HC 1NUGA 5GISL 3TBVB 1T5XB 4M48L 2NXZB 4ODVL 4KKLC 3CFBB 5JHDE 2CUHA 4HAGA 2AJXL 1U8QB 4HWNA 3CCHA 5I1CL 3VG9B 1FL3A 3L3GA 4NC1C 5HYQB 2JCCE 4KV5F 2P7TA 4K71C 2EE6A 2HKFL 4Z7QE 1QZ1A 1BM3H 4JE4B 4V2CB 1T1XA 1ERNA 3B9KC 3KYKL 5B39A 4GKNB 2P5WA 4RBPH 4ALAH 15C8L 1S8DA 2EH7H 4U6YA 1Q9LA 1JZ2A 3MUGB 3QIUA 4U6HA 1LP9B 4ORGA 1KCKA 5DQJA 1YY9C 4G9FA 3HG1B 4C4KT 1X5LA 4JM2D 1U95A 3UTOA 5FUCE 3RJDA 4PR5A 2IQAB 5JUEH 1GOGA 2HG5A 2XN9E 4U7MA 5EUKA 3QXAA 5C08A 1NDGA 3WLWD 5JOFB 5FYJU 3FCTB 1FZKA 5BO1H 1WZKA 4O4YL 1AR1C 3OQ3B 4Z5RB 5HHPA 3INUL 2VLRB 4U1SA 1QO3A 3DVFA 4ZFOA 3VXOB 3BKJL 4P5MB 4RAVA 1IAKA 3VFNB 2DQIL 3OMZA 1HXYA 5A1AA 2W07A 5FO7B 1JNNL 3BVNB 3ZDXF 5DK2A 2C7UB 5HGDB 4S1DC 2CDFA 2Y06L 4OCSL 5BMFL 3FO1B 3PGFH 5ESQA 3RWDB 1SY6L 1PG7X 2FATH 2DKSA 2P46B 4JKWA 1L6XA 4CW1B 4E0RB 4HK3N 1QHOA 4CVZB 2BY3A 3UC0H 1X5IA 4GQ9L 4LARL 1AC6A 1MFDL 5ID1A 5D7KD 4M8VA 3GGWA 1K8DB 3BD3A 1VA9A 1YEEH 1L0XA 1G0XA 4WFFE 1YMHB 4ZO6A 3CC5A 4PLJD 1QACA 1WISA 4PJDA 3RWIA 1KIRA 3SE8H 4V1DB 5C1MB 2XG4A 4MJIB 3TZVC 4LVHC 4QXUL 3WIHH 4UNVA 4YAQA 3WSQH 3GUTB 3OKLA 1HHJB 2YK1L 2IAMB 4LCUB 2DQUH 4OFYA 4LGRB 3GMNB 3D1MC 2ADFL 2HN7B 3LIZH 4RNRB 1YN7B 4M4PA 3RVUD 5FV2A 4PJAB 2GTWB 2ICES 4L4VD 2VZUA 4M7ZC 5CSGA 1GPOH 3ROLA 2MFNA 2YUXA 2HLFD 1A7OH 3OV6A 4MXWL 4B0MM 2DOCA 2DQTL 3V0WH 1D5IH 4L3EA 1NCBL 4X99B 3I6LD 5DQDL 5JPNA 1G9NL 5I8KL 1GGCL 5CFHA 3SOBL 4K71B 1D9KD 3DX6B 2NYYC 2EICA 3QWOB 5A43C 1MFAL 3B9KB 3EJYD 4JM4L 1NGYA 4ZUSA 4HZAA 1LE9B 1YPZF 2Z4QB 1JPSH 3RVVC 1RHHB 1A9BA 1F6AB 4WV1A 2FWOB 4HAFA 1KJVB 2SEBA 3WNMA 2ITCA 5EORH 4PTUA 3MJ7B 2IANE 1S7WA 2Z91A 3U4BL 5C70A 4UUJB 1AD0B 3WNPA 1FAKT 5IHUL 2UY6A 4ZFGH 3C5ZA 4GXVL 2AXGB 2X4UB 4I5BA 2EO9A 3HZKB 1WICA 5I1KL 3H2WA 3U79A 4KK9C 2AGJL 4N0YL 2UY7A 4FZ8H 3O2WH 4ZXBC 3HNTL 2KQMA 1ZWIA 4F7MB 3KVQA 1HYRC 1QFWM 2MCG1 1LEKA 5M95B 3IVKB 1LK3H 5F89B 4DKDC 1PEZA 5DA4A 2P8MB 2R69L 4IOFC 1R3HB 2YPLE 5D6DC 2VE6B 3AMLA 3QZWA 5CJ8A 2B1HL 1YMME 3S6CA 3BEVA 2MCPL 5DGRA 2AI0L 5F9OL 2QR0A 2A6KA 4TNWK 4L8SC 4KJWD 5DUPL 2G60H 3MMEB 3BZFB 5IW1B 1B0RA 3BH8A 3SPVB 1N2RB 1ZLWH 2FJHA 3E3QC 3QDAA 5E8PB 1CGVA 1OAUL 3BEWA 4JANB 1GHFH 4ZSOA 2VXSL 5CMAA 3SGDI 5JORB 1MF2H 3MRFB 5CJQH 4OCWH 4HKZA 2BCKB 3ETBF 5ID0A 3T2PA 2NY3C 2XTJC 2K3TA 1RUKH 1P6AB 2CKNA 4LVHB 3GJFB 3TZVB 2WINA 1OP5K 2J3SA 2GW5A 1KCLA 2F54B 3MOAH 4XBEH 5D7JC 2C1PB 5DHVH 2GITB 4G7YH 4H20H 4WFHD 1GGIH 3D9AH 1BM3L 5IW3A 4M7ZB 2RFXB 3VWKD 1JGLH 3S96A 3STBA 3WIFB 1R3IH 2XG5A 1NSNH 4ALAL 1CVRA 1TDQA 1XGUA 3H7BA 5FYLE 2EH7L 4K9EH 4R6UA 5ITFB 4WU5A 3FRUB 4U0RC 3TNNA 2PTVA 4KUCD 3KPOB 5C0BB 5AUMB 4LPUA 3TT3H 4WU7A 5HHVH 3VFMB 2IWGA 4GKZB 5IMKB 5JUEL 2L4OA 3TBWA 5CSBA 3SDAA 3WL9B 2UUDH 7FABH 3VA2C 2F53D 1Z0NA 5BO1L 5EC1A 2GFBA 4OD2B 5E1AB 1G7HA 4W4NA 2A0LD 1K9TA 2XFXA 4XCYA 4OQ1A 6CGTA 3CD4A 5KSAD 3I6KB 4XAWH 4LVOC 5D2LB 1NAMH 4HZLB 4Q6YA 4EUPB 1AIFA 1HQ4A 3JWOH 5DRWB 2ESVE 3BKMH 1UJTA 1SJHA 3LEXB 3HNSH 4Z78A 3CZFA 4P2RB 1UCBH 3VXRA 4S0SD 2FIKA 2XQBH 1E4XH 3HE6A 2ICCA 3B8YA 4PJ9D 5KTEL 4FQQA 1XZ0B 2ZNXA 2CLRB 1ZAGA 3F7YB 5HXMA 1X3DA 1RK1B 3PGFL 2FATL 4OLVH 1JHTA 5KS9A 4ZXBB 1ZGLP 5E6IC 4ELME 4MLSA 5FGSA 3UC0L 1U92B 2H8PA 3CIQA 3WXVL 4M61B 1NGPH 1LVEA 4PD4J 1MSPA 4OGYH 4NZRH 1YEEL 1DBBH 1KJ2B 3WO3B 1LEGB 1FFNA 1IAIH 1NPUA 5KSBA 4UU9A 5AWNH 4L8SB 3HR6A 3VFVB 3WIHL 4PP2A 3WSQL 4NO0B 1FO0B 2DQUL 2DWEB 3LIZL 3THMH 1T5WB 4UOW0 3WLBB 2BSSB 3EYOA 1N8ZA 3S3PA 1K6QH 1IC5H 1GPOL 1GXEA 1XMWA 3MRHA 1C7TA 2Z8RA 1A7OL 5DD0H 4F7PA 1RZIB 1VEPA 2XTJB 2IBZY 1KLUB 3V0WL 1D5IL 3TIDB 1CDCA 2P47B 1TPXC 1W72H 2P1YA 2VERN 4P9HH 4CU6A 4I48A 3GKZA 5D7JB 5H37G 3NN8A 1E27B 3O3EA 5AAWA 4OFPA 3BYYA 3RPIA 2GCYA 3L3HB 1FVCA 2HYMA 4AIXA 1XR9A 3FT4B 4GAFB 4K3EH 1H3WM 1TITA 4GRWE 4N9GB 4HLZH 1JPSL 4LNRA 4JDVA 1M71A 5IROC 5H2BA 1WT5C 4U0RB 3ARVA 1ND0A 3OF6D 5IIEA 2PN5A 4Y19D 4L1HA 3CMOH 4OZGA 1U3ZA 1M7DB 1PKQE 4LCYA 1VPOH 2Q7NA 4O58H 4HQQH 4P5KB 4XXCC 5D7IA 4PY7B 3KYNB 5C0CA 1AXTH 4FZ8L 3KPRE 3L7FA 3TBYB 3O2WL 4LVOB 4Y4FA 1XIWB 5L9DH 4J4PA 1UWXH 1NGZB 4KRMB 2QADD 1LK3L 4APQA 1HI6B 3G5VB 2VLLA 5DK0A 3GSRB 3CLFH 1BLNA 5CINH 4PGBA 1E4KA 4MNGA 2HVKB 3CX5J 3GMLB 2OQJB 4U49A 3VRLF 1I8IB 4KVNH 3B6SA 1I85A 2V5SA 1X5ZA 3T3PF 4LEOA 3MBEA 3C5SA 5HVFB 1LO5A 3PGCB 1L4IA 2G60L 3BAEH 5I17A 1PKOA 2ILLA 1VKXA 1JWSB 5E6IB 2R39A 3U4EB 4J8RA 3ARSA 3FKUS 2OR9H 4POUB 1EZVY 3FT2A 3GJEB 5T1MA 3WE6A 4GMTL 5DEGB 1GHFL 1A02N 4BK4A 2I9TA 5ENWB 1MF2L 5SWQA 5I75C 5CJQL 3X12B 4OCWL 3SGKA 1A6ZA 1J86A 4I4WB 1MREH 2OSLB 3HZMB 4MZ2A 1J8HA 2GK2A 3RL1A 1RUKL 2FR4A 4Y2DC 3RL2B 1BPVA 4JCMA 5E94A 1XF5A 2R2BB 3B3IB 4MXVE 4O00A 3KXFE 4F2MB 1EFXB 4PBWD 3MOAL 4XBEL 3WKMH 5L2JA 3HAEG 4G7YL 1OF2B 2XTLA 4H20L 1GGIL 3D9AL 3E6FA 4IOIA 4DZ8A 1JGLL 1S9WA 3FO2B 4PP1C 3FFCA 3M8OH 4FQIH 1R3IL 5HYSB 1NSNL 4MZ3A 4KMQA 3G5XB 3BX7C 4K9EL 5EBWB 4PLOB 4MNHA 1SY6A 1PBYA 5BVJB 1TPXB 3BUTA 2APWA 3QR2A 4LOUC 3RDTA 2VZ1A 3OR6B 1H5BC 1EAJA 1HNGA 3TT3L 5HHVL 3FJTA 5D7SH 3LCYA 5I1EH 3ZL4H 3ZYOA 1UZ6F 4X6CB 4F33A 1U2CA 2GKIA 2R1XB 5JOPD 2QHRH 1G7JB 3PWNA 4WRLA 3PL6A 3VFOB 1GGUA 3RWJB 2VDOL 4WW1B 3IT8D 3IDGB 4XAWL 2K9UA 1NAML 4K7FA 4BQ9A 3O8XC 3JWOL 3BKML 1OQXA 2YD4A 2E9WA 1UCBL 5C0DA 3P4LA 2JJVA 1SJEA 2XQBL 1E4XL 3C6LA 2PYEB 1KPVB 1HHIB 1KGCE 5B3JF 3MLRL 4ZUTB 3PWPE 1V7NH 4NQXB 4HBQA 4JHAH 3AU1A 2ENSA 4RMWA 5CJXA 3FB7A 3MROB 5JXEA 1UQSA 2VABA 3UPCA 1FNLA 1MVUB 1TZHB 1TCRA 1FFPA 3DXAA 4H26B 4JRWA 3QISA 5J1TC 1U0QA 4OGYL 4NZRL 4XNQB 1DBBL 1DEEA 1N4XH 4QT5A 1K5NA 1IAIL 5DDHA 1FVDB 1A6WH 5AWNL 4JHZA 1JI1A 1P53A 2YD3A 4L3AA 5JIPA 4JFFD 4PGJA 4P2OD 3UTSD 3THML 4G7VH 3ZDXE 1ITCA 1J7VR 2YUVA 1AGBB 4YIQA 2CIKA 4GJTB 5EOCJ 3V0VB 1K6QL 2XWTB 2E3VA 1CD1B 1IC5L 3QO0B 5BV7C 5I75B 4EN3D 4Z7VB 5JW4R 3F7RA 2QSVA 2DWDA 1UACL 1QVOA 4H5SA 5DD0L 4FXKB 3VXUA 3QFDB 4FQJH 3ZE0E 3W0WA 2R15A 4Y2DB 4U6HB 1W72L 3OR7B 2KPNA 3KNBB 1WFNA 1DUYB 4P9HL 4UILH 3BFOA 5C0AB 1FZOA 3HB3D 1BJ8A 4JPIA 1N6VA 4O9HH 1ZHLB 3I84A 1W8NA 4JRXE 2P8PA 3S3JA 2FHBA 5IBLC 4Z76B 4UV4H 5FIEA 1RULH 1BZ9B 2CKBH 3C5ZC 3V7AE 4K3EL 1WUNT 1LGVA 3WHE1 3OKDA 4I0KA 4HKBB 1OGAA 5FUOL 2BC4B 5ERWA 4FRWA 3PF2A 2FX8H 1H5BB 1NGXB 3TO4D 3GMRB 1CBVH 5FYKU 3CMOL 2ZOLB 4PD4K 4C57C 1QKZH 3ORJA 43CAB 4JFZH 4ZAKD 1VPOL 4HCRA 4IS6A 1S78D 4HQQL 4F7EA 4NQDA 3QIWD 1CFTB 3L5WB 5DQ9A 3DHJA 1RD6A 1P4BL 3O2DL 4QKXB 1AXTL 1F3DJ 3T0EE 1C08B 4EZMA 4N0UA 5L9DL 1P7QD 2VLJD 4GRLD 1LK2A 5T1KB 5IW6B 1FFQA 3O8XB 1IQWH 1IZJA 1EO5A 2GY5A 3CLFL 4JN2A 5CINL 5ISZA 1PG7H 2HT4C 3VMPA 4KVNL 3VWJA 4AK1A 3RAJH 2A6IA 3UTQA 2OL3B 5HHMB 2JJTA 2RJMA 3D39E 3K2UL 3VXNB 1ZT1A 4JFDE 3WXWL 3BAEL 2BSED 4D0CA 3CFIC 5HYJE 1I8MB 3LB6C 1WAAA 3QUMB 2P8LB 3WUWG 2OR9L 1JK8B 4CUCA 4BH7A 1NH6A 4RQQA 3H9ZA 1RJZB 1HSBA 2VAJA 4FXLA 1RZGA 3QNZB 2GT9B 1G6RA 1MREL 4IBLT 4LK4A 4BA8A 2BHZA 2Z9TA 1LD9A 5K9OB 2H32B 1L7TH 2NX5B 1JZ3A 5HHQA 1ITBB 4HWBH 5GRUL 1BZQK 5E8EB 3MRCB 3WKML 4G8IA 1DVFD 1JTTA 1Z5LB 1QRNB 5E2VH 3E0GA 1FYHB 3MV8A 3RVTD 4BZ2H 1C5CH 3BIKB 3M8OL 4FQIL 4HX1B 3IS0X 5BV7B 5I19H 2PF6A 2AQ3A 4BSWB 5B38G 3TH3T 5IVXE 3GJFK 3GMQB 3EOAB 3N1FC 1Y6MR 3NCMA 3PHQB 2Z31D 3CFKA 1MJUH 4KJPD 5D7SL 5I1DB 3ZL4L 2PXYC 3EYVA 1OQOA 3CX5K 4XTRD 4K23H 2XWJB 1TTGA 4N90E 3VGFA 4S10A 1SHMA 2ZOKA 5DJ6A 3WD5H 3LS5H 4OFIA 4PJ8C 2AXFB 3S34H 1RIUH 5TPWH 4ZFZB 5DJAB 2QHRL 3LQAC 5EUOE 1CFQB 1VHPA 3K4DA 4A6YB 4HIJB 3CXDH 3QDGD 1ZVSA 2ERJC 4TVPE 4GG6A 4LCWE 2DLHA 4Y16C 4XNUH 3H9SD 3WIHA 1IM9B 5L6YH 3NTCH 5F3BB 3C2SA 5CD5C 4MQ7B 4M6NH 4OI7A 3I9GH 3Q0HA 4PJCA 3T09A 1LP9F 2AK4D 3ARDC 1C12A 1JZ5A 2VL5A 3GMPB 3FQTB 3RGVC 1V7NL 1X5KA 2YS4A 4LDEB 4POZC 5I16B 3PABB 2R2EB 2VZOA 2B20A 3P77A 1D5ZA 4YHLH 5AG9A 1FIEA 5K9JH 3NCJH 3AFLA 3FB6B 3T77B 3ZKSD 3BGMB 2JB5H 3P9LA 3MLVH 1X5AA 4OZIA 4HKJA 1N4XL 1RZ7H 3IYLW 2AJ3B 4PUBH 4MVBD 1R5WB 1A6WL 1AXSB 4NQEE 4RMSA 4WI5A 5H8DA 5HGHA 4Q97A 4LIQE 2BOBB 2XKNA 3O3UN 1X6LA 4WY7H 4G7VL 2AEPH 4TSAH 4HFWA 4JJ5A 4QYOB 1FCGA 4WW2A 3P73B 2NLJB 1UZ8A 2CRYA 5DUBB 3RBSA 4FQJL 4D9RE 4PJIE 5D1XA 5CHNB 3QG6A 1K8IB 1OW0A 3BHBB 4UILL 2XYCA 2P24B 1A6PA 5B8CC 4O9HL 2OJZH 2WV3A 4XCEA 5D2NE 1OD7A 2DLTA 1RULL 2DBLL 1BX2B 5DK3A 2CKBL 3HI5H 3GBLA 2AQ2A 3KPLA 2D4FA 4KI5F 1BFOA 1PLGH 2OX5A 4PJAF 4G6KH 4E5XA 3T08A 4J3VA 3KPPA 4K7PX 2FX8L 3BWAA 2B1AL 5KN5B 5J6GA 1CBVL 1TVHB 5I0ZA 2A6DA 1EHAA 5FA4B 1WWBX 4HIHA 1SJVA 4FTVB 2PXYB 5EIIB 1CFNA 1FH5H 4M1DL 1QKZL 4RIRA 4WO4C 5LAXA 3WO4C 4Z78B 1MUJA 2EDTA 3FAWA 4MNQE 4XX1E 5CGYD 3VE0A 1BD2D 2HFGH 4PJ8B 1PQZA 3RPKA 4RCAA 4DTGH 1U3HD 3N1QC 4A2LA 1BQHG 2R0KH 4G6JH 4MD0B 2UWEB 1JL8A 4TSBH 2BVPB 3BZDA 2ERJB 4YHPA 3ULUC 5LGKA 1JUFB 4JGMA 4Y16B 1NKRA 5EFIA 1MLBA 4ZUUA 1IQWL 5FKAA 5C86A 1T04B 4PRIA 4PRPD 5CLWA 1PG7L 4XI5C 5DHVA 3IF1A 2FO4A 5L2KD 3RAJL 2YRZA 3FB5B 3ARDB 4BJLA 1I7TB 5KBNC 3L3OA 3HCVA 1HHKB 3RGVB 2OJEA 3MRQA 3W39A 1WZ1H 5E5MB 2IBZX 1JNLH 2BSTB 2FL5A 2OZ4H 4NJAH 1A3QA 3MRDB 3CDYA 5IWLA 4WIQA 3ZMRA 1A21A 3I3EA 1UKQA 3TBTB 2FH8A 2VISA 4YE4H 3GSVB 1A4KA 1KG0B 4MD5B 2NTSP 2QSTA 4L4TA 4N5EC 1ZLSH 4W4OA 4Z6AT 3W11D 4QOKB 1BMGA 5IEHA 4NHUA 3O41B 3ARFA 2W65A 3CUPA 1L7TL 3L9RA 4LGPB 3U36B 1A1MB 4JPVL 4J3SA 1ZHBB 4HWBL 3RWFB 1OL0A 3ESVF 2UVFA 1NAMA 2J8UE 3MSPA 3HC3H 5E2VL 4P2QA 2V7HA 5JTWA 4BZ2L 1C5CL 4MDJA 1RJCA 4Y8DC 5DJZB 3VMNA 5I19L 3ZTNH 1RQ5A 5IEKB 5I2IB 3KPTA 2BP3A 2NY5C 4UOJA 5J12C 5A2LH 3O4LE 1MJUL 3I85A 4YFLF 1IM3A 3LQZB 4OLXH 5B8CB 3BH9B 2ZSWA 4F8TA 1DEDA 2IG2H 2BVQA 3HUJE 3PNWA 4K23L 4E41A 4Z8FH 4HFUH 4W68A 1F6FB 1RJLB 2LU3A 3WD5L 3LS5L 4BFGA 3LKNB 3S34L 4XWOC 1RIUL 5TPWL 2Q86A 2B39A 3SY0B 5IHLB 3G04B 4WEUD 1MCFA 4MJ5A 1DDHB 3CXDL 4HUXB 1I9IH 1CR9H 5DD6B 1PZ5A 5E0QA 4XNUL 2BNQE 2VKXA 4WWID 5L6YL 3NTCL 5KOMC 2I9LA 4X6BB 5C07D 3T4AB 2BMKB 1EZVX 4WO4B 5C0IA 4GS7C 3WO4B 4G80A 1RVFL 2X4TB 4M6NL 3I9GL 2VN7A 2FO1A 3GB7B 4PRAB 1JZ7A 1ZGLB 1EGJH 2C3GA 5ANMB 2VDLH 2X2YA 1TXKA 4WNQB 3PDOA 1N3NB 1FL6A 5K9QG 4K07A 1X4YA 2E9JA 4YHLL 1W72A 3NCJL 5K9JL 1FLRH 3NFPA 5I66B 4JM2A 2JB5L 3MLVL 5JQ6H 1BQUA 5D6CA 5D2LF 1RZ7L 3LN5A 4PUBL 1ULVA 3TNMA 2R1YA 1MHHB 1NC4B 5DD5H 1MVFA 3QUYC 4P2YA 2ARWA 1IVLA 4YO0A 3DX9A 5GSVB 5DJ8B 4RFEB 1BFSA 4RGNC 1NKOA 4PJBB 3OKOA 5MENE 2DI8A 4BFIA 4WY7L 5T1LD 4TRPH 3ULVC 3PHOB 4NRYA 2NW3A 4TSAL 4JFXB 4JDTH 4KI1A 3S88H 1QSFB 1N0XH 1IQDB 3MRRA 2CD0A 1HXMA 5HPMB 5HDBE 5F6IC 2ZCHH 4KAQH 2NY0C 5GS0D 3O3DA 3DMMC 2GJZA 1MCWW 4JZOB 1X5HA 3HPJA 5D5ME 5ACMA 3OXSB 2OJZL 1T1YB 2X4RB 3K2MC 5JW5A 5KVGH 4H8WC 4DKFH 3FQRA 3BRGC 4X8JA 4XVTH 1MCKA 2FBOJ 3AAZA 3HI5L 4ZO7A 5E8OB 35C8H 3U6RA 3PWVB 3J7HA 3UPAA 5BQ7A 4NOBA 3RZCC 5TH2A 5CKGA 5J12B 1PLGL 5KVFH 4IM8A 4ZOBA 4G6KL 2CLZB 4ZNCD 1Q0XH 4LLUA 2X4SB 2FBJH 3PV6B 3RX7A 2YPLD 2R23B 2IBBA 3BPLC 1J5OH 4LSUH 1FH5L 1HHGB 1YMMD 2PO6C 3BW9B 1DLHA 1EJ6A 1EAPB 3IFPA 1V3MA 4L4VA 3LQMA 1J0YA 2FEEI 2HFGL 2NXZD 4QRRE 4DTGL 1ZGLM 5DVOA 4HXAH 1KNOA 1UB6A 2C3VA 2R0KL 4G6JL 3IETB 4WDIA 3T2OA 2WAHA 5EZOH 4DUWA 5FECA 5I15H 4TTGA 3JXAA 4I2XE 1J12A 1ZHKB 4RGOH 3OKEB 3AXLB 4KC3B 1J1XL 4WCYL 5I30L 2NY4C 2KZWA 4OBRA 3N9GH 2Y6SC 2EDFA 3MTRA 4GS7B 4XGZA 1JPFA 4QXTA 4RFNC 2D4DA 2F19L 4OZFB 4U1IA 2VLME 5J9PA 4YPGB 1KXQE 4GBXC 4AMKH 3HG1D 3ZKNC 3OKKA 3DVGB 1SVCP 3SKMA 1OGTB 4NQTA 1UA6H 2V5TA 1WZ1L 2OLDA 4PJ7A 1EJOH 1JNLL 1JN6A 2OZ4L 4NJAL 1I7UA 2GK0B 4E42A 4YBQC 5I1AB 1TETH 1J9CT 1UH4A 3W2DH 1KPRB 2LAGB 3ZE2E 2OR8A 2HTLC 4YE4L 1KT2B 3DTXA 1MY7A 5FYLD 4X7TB 2N56A 2AVGA 4R4ND 4NQSB 2NR6D 5DFWH 3B8SA 1G9EA 3DVNA 5E6YA 2VXVH 3DPBA 3QUYB 1ZV5A 3U46A 5L8JB 4U1KB 1I3UA 4RGNB 2DIJA 5CBAA 1I1YB 1DE4B 3CDGB 1IAII 1NJ9A 1T89C 1HOCB 2FEDC 3HS0B 3HC3L 3GSOA 3GFUA 1JNHA 4OGXH 1EVTC 1R3JA 5HI4D 1I7RA 3MO1A 4FQLH 3ZTNL 2X4OA 3U4AA 2QBWA 5F6IB 4M4RA 1WCBA 1OP5H 1KPUA 4LHUB 4OZ4A 1EO8H 1Z2KA 2NY0B 3V5KA 3FO9B 3SDCC 1UJ3C 3NAAH 3MUZ1 5CWSA 3DMMB 3IXAB 2P5EE 1K4DB 3QI9C 2IG2L 4G43B 3IDMA 4YC2C 4Z8FL 1IKFH 1L0YA 4HFUL 3WDJA 2AERT 1U8PA 1EDQA 1NCNA 1F8TH 4OBSA 4V1DD 2XQYK 1IGFH 1W0YT 1N5AA 2IAMD 5F7HA 3RZCB 4KI5D 1BREA 1X7QA 4LPCA 1I9IL 1CR9L 3FQWB 2JLLA 4JO2L 4JCLA 4M9PA 2GAZA 2I5YH 4WHYH 5HJ3B 4JHBA 1NFDE 2R2CA 3BPLB 1CL7I 2PO6B 3QFJE 1HHHA 3MCG1 5J3HD 2M2DA 1BZ7A 3VWKA 4DUXA 3BDBA 2A6IB 1PKQA 2FHCA 5IF0B 1A64A 1EGJL 1S9XA 2NNAA 3DWTA 4LRIC 4NUJB 1A1NA 3G6AB 1HCVA 5T1DH 1ORSB 1NDMA 2EEAA 4QGTA 2D7TH 4X6CF 1B6UA 4FA8A 2HJLA 3B9KD 2I25N 4ZPVB 1FLRL 2NY4B 5ESVB 3VFTA 5DRZB 2NY7H 1WBYA 5JQ6L 4L9LA 1KOAA 4RFNB 5EU4B 3ARRA 4HIEB 1PSKH 2F53A 1JI2A 1I8KB 4O5LH 1YY9D 4GBXB 2CKBA 5DD5L 2D7PA 5F7MC 1PW3A 4F15C 4HPYH 1DR9A 3CVHB 1NBYB 5D1XC 1LDSA 3MRMA 4FHBD 2Y5EA 5EH1A 3RUGA 4TRPL 5D9SA 4PRHA 1OWRM 2CIIB 1RUAH 4HIXH 3H7LA 3BZEB 4JDTL 1AR1D 3S88L 1N0XL 4EXPX 4Y1AE 1QFHA 1YNKH 1YECL 4EI6A 2G5BB 3QYCA 2ZCHL 5TE4H 3MYJA 4KAQL 5E9DB 3NACL 4KGJA 4OSUH 1U8OA 3C8KB 4JY4B 2D0HA 2FJFA 2X89D 4S1DD 5K59E 1QSEB 4TULH 5BOZG 3C09C 1XCTA 2DB8A 5KVGL 5EPMA 3P0VH 1FG2A 3DO7A 4BH8B 2DLEA 4XVTL 4PJFE 3EDJA 2KUTA 35C8L 2AJSH 4PTTA 3VRIB 2QV2A 3KPRD 3GIVB 1FVEB 5KVFL 3SDCB 1UJ3B 1MCOH 5EBLA 1Q0XL 1T66D 4W6YB 3MLSH 2FBJL 1KIPA 2CRZA 2PUQT 2VLKB 3DUUA 1S5IH 1FZJB 4Z7VF 3QI9B 1J5OL 3OJMB 4LSUL 1QBBA 4YC2B 3MJGX 5FGRA 1T2XA 4D94A 4JZNB 4TUOA 4EI5D 1JF1A 1UFUA 1DUZB 4U2YA 4LSVH 3U9UB 3HR5A 4HXAL 1GAFH 1FIGH 1KJMA 2F54D 4ZTPH 5EZOL 4R2GC 3I3BA 5I15L 4R4BB 1A22B 4RGOL 4YHOH 3IJHA 5ETUB 3JVGA 3P9MA 1CXEA 4O2CA 4HWBA 3VFWB 5IB1A 2ICWB 3N9GL 4MJIE 4TUJA 3V5DB 1T4KA 4ZO8A 5EU3A 3NH7L 2MQ0A 1RZ8A 3MV7E 4OF6A 2BNRB 1D5BA 4AMKL 5C0BD 4LDOB 4DVBB 1KTDA 2OR7A 3W9DB 3KXFD 1JYVA 1UA6L 1DTUA 1MCJA 1OPGH 1EJOL 5GGRB 1A9EA 2NYYD 1MAKA 4L9DA 3OF6A 3NCBB 1TETL 3W2DL 3ALXA 5I1GH 3C2AH 1OP3K 4Y19A 3F5WB 4Y5YC 3L6FB 4OKVB 2VYRE 5EB9A 3IAPA 5C8JA 5EU7C 3ES6A 4IMLA 2DMCA 2NQCA 2Z35A 1PGRB 5EWIH 5GS0H 2VXVL 3MGTB 3GSWA 1B4JH 1ZKAA 3OWEA 5SWSB 2W0FA 3STLB 3VJ6A 1PX3A 3L3IA 1FRGH 3AS0A 3O6FD 5FFLA 4ZQKB 2JIXD 4XNMA 2B2XH 3MJ8A 1HEZA 4OGXL 1JWMA 1RSFA 1O0VA 4YZFE 1I7ZB 4ISVA 3U9PL 4FQLL 3BRFA 1HDMA 4DGYH 1EO8L 1AXIB 2V9RA 3JZ7A 3NAAL 1E4WL 4KK6C 1Q9OB 4IOFD 4FQXC 3CLEH 2AJZA 2BSRA 3BKCL 3BWAB 3AREC 1X5XA 3C09B 3Q1SH 1TVBB 1IKFL 3QH3A 3MXVH 1T21B 3CSGA 4GKSB 5GIRB 1F8TL 5GJSH 1IGFL 2C1OA 3ZDZF 5E08H 4NO0D 5M94B 4R7NA 4XT1C 3TF7C 1DBKH 1EUTA 2VITB 1UVQA 4BFBD 4PB9L 1WZMA 2I5YL 1A7PH 1RMFH 3G5ZA 3EOBA 2J6EH 3WKNA 1U8NA 2H2PC 3CX2A 3EGSA 1R6VA 5L8KB 1P6FA 5EU6B 1NBZB 4I3GA 3NIGF 3R06B 1EBPA 2ENYA 2CK2A 1I3VA 5ILTH 5GGUB 3KPMA 4P57A 3WLWC 1II4E 5A2KH 1A6TB 1IC7H 4R2GB 5D7JD 2FGZA 5T1DL 1MHCA 2D7TL 5DJYA 1ONQA 4OZHB 4O51B 3ZKMC 2B4CC 3PWJB 1U8LA 3NVQA 1YEGH 4U1MB 1ZLUH 2NY7L 3KPSE 1UWGH 3TCLB 4FQHB 1UADC 4QRQA 3SJVB 1IEBA 1PSKL 1AQKH 3H9YA 3OAYH 4O5LL 1JPGA 1K4CB 4NYLB 5IR1B 4HPYL 1YPZA 3BXNB 3Q2CA 3MRIA 5ABDE 4U7SA 4NKDA 3WHE0 2C4FT 4WI6A 3AS2A 4NQVB 3T0WA 5F7UA 2FJGB 4Y5YB 3KDMA 3C5JA 1RUAL 3VFPB 3MLPA 3GMOB 4HIXL 1A7QL 4JRYE 2CH8A 4LL9A 3V7AG 3QJHA 2EO1A 1XIWD 1YNKL 3S97C 4ODWB 5TE4L 1IAMA 1QFWH 3WFHA 3BSZH 4NO2B 4OSUL 4XB7A 3K1DA 2G9HB 3PQYE 4ZMAT 4YDVA 2GJ6B 4AEIH 1L7IH 3GHBH 2Q1EA 3VI4E 4TULL 3UBXG 2ICWJ 3P0VL 1MI5A 2OTUA 3RVUC 4KK5D 5FKPB 3JV4A 4X5XA 2AJSL 1O7VA 4FNLH 4QCIB 3DIFA 1MWAB 4PLKC 3MCLL 3RNQB 2F74B 3MLSL 1IL1B 4FQXB 3CFEB 1GGTA 1JE6A 2G5RA 4XPTH 1S5IL 1H8NA 3AREB 4JFFA 2X1WL 4KVCH 1JV5A 2OZ4A 3UTSA 1CQKA 1QLFB 5FYJD 5DMGC 1D9KC 3D39D 1DQJB 3N1MC 2ZCKH 1VERA 4JFDD 1MCEA 4LSVL 3S7GA 4PJGE 5T5NF 4D9QE 1L9MA 1WWCA 4EN3A 2NY1C 1GAFL 2YSSB 1FIGL 4OM1H 1EFXD 3EJYC 3MNZB 4ELKB 1CXHA 1SMAA 1NCAH 3I50H 1U2HA 4YHOL 1DQMH 3VRJB 2PCPA 1ZLVH 4EDWH 3LKRA 4LLYA 1ZS8B 3NZ8A 1MH5B 1AGDB 3PWUA 4JLRB 3LMJH 4N8VA 1MJJA 4QHLA 4D8PA 3BN9D 1Q9WB 3S4SG 3LH2H 4XZUA 2PR4H 2VN4A 4LRNH 3HRPA 1U8MA 5CEYB 3BISA 2X9WA 1NBVH 3MV9E 1OPGL 4PGEA 5LXGH 5GGSA 1S7UB 3VGEA 3S35X 1D6EB 2H1PH 3VXQB 5I1GL 3C2AL 3BMVA 4XCNB 8FABB 1MNUH 5C09D 5IFJB 1FNFA 2UWEF 3BP6B 1EEZB 4KZDH 1G7PA 4JQVC 1JFQH 5CBEB 3C60C 3IGAB 2GJJA 4OV5A 1JHKH 5EWIL 5GS0L 4KKAC 1B4JL 1KACB 4YDJB 3FFDA 1FRGL 4DEPB 4HDIA 2PYED 2VIRB 2VLJA 2B2XL 2BVUA 4C59B 5KG9A 4JVPA 3STZB 5J1AB 1BOGA 1E28A 1KN4H 4WGWB 4GAYA 2D0GA 4XCCH 4RZCB 1IJ9A 3BIBX 1F42A 4HK0B 4LPTA 4DGVL 2GSGA 1XCQA 4H25B 2I27N 4DGYL 5IJKA 3WIIH 5BZDA 5SWZD 1AGEB 4TSCH 5CAYB 1EGJA 2VDRH 3UBXI 5HHOE 2GTZB 3CLEL 3WUWA 1FZMB 4CRPA 2Q76B 3Q1SL 2WIMA 5FF6A 4F37K 3MXVL 4PLNC 3MZGB 5GJSL 3GJFH 3QAZC 5E08L 2JE8A 4K7PL 4WI8A 2VSCA 1NCCH 1AY1H 1VCAA 5GGRY 2R1WB 5DMIH 3VU2A 1WBZA 5IMLB 4KDTC 1TZIA 5GXBB 3M1BA 3UJTH 1A7PL 1RMFL 4M6AA 3TGXA 1GZPA 3QIBD 1Z9MA 1ZSDB 4M03A 1DVFA 1W0WA 3KS0H 1CICC 1D9KB 5ILTL 4PBVC 2G2RB 4Y2DD 1U9KA 5C0AD 3I02B 4CU7A 2NY1B 2IMMA 1J0HA 2CDEA 1IC7L 1CT8B 4U1LA 1Q8MA 2A0LC 4UBDD 2FZ3B 5D7LA 4Z7OF 4S11A 2Z31A 1NANI 3QEQE 5KSAC 3SKNA 2IADB 4PP1D 3PJSB 2PTTA 5EO1B 1YEGL 3FTGB 1UWGL 5EO9B 3TYFB 2JJSC 4G42B 2ADIA 4PJ9C 1AQKL 1LNUB 4LOUD 4EUPH 2IPUK 1I9RH 1JYNA 1U8JB 5EZJA 1LO2H 2NCMA 5JW3H 3QDGA 4DKEH 2WWKO 5IP4A 3MR9A 4BUHA 3I2CH 5C0EB 1XF3A 5KW9H 2X10A 4ZOAA 5F6HJ 5D1ZD 4GG8B 4PJ5A 3WJLA 3ULUF 3FQXA 3C60B 5T1KD 1WITA 5F7DB 5IB2A 1QFWL 2RGSA 3O8XD 3BSZL 5CEZD 3GRWH 3TT1H 2H3NB 3JUZA 1P4LA 4AEIL 4NQCA 1L7IL 2W9DH 3GHBL 4I13B 3OKMA 5GQBA 5EU5A 4OD3H 1KJ2H 1T20A 5BS0E 4MNQD 4NWUL 5I74C 1M05B 3QJFA 5HHMD 1R3LB 4XX1G 4K94C 1P2CB 1IGYB 3MA7B 2V2WA 1NFKA 1VFBB 4HF5H 3MLYH 1P4IH 2JB6B 4IDLA 4RAUB 5DS8B 4ZG1A 3NZHH 4I8DA 1FO0H 4PJBF 4JFEB 4OFVA 5FV1L 2I07A 3DSFH 4BKLB 4Y4KA 1I1FA 4PJEB 4KDVA 4XPTL 4F9PA 4KVCL 1BWMA 1YJDC 3M17A 4LF3B 3Q5TA 1HQRB 1I3RB 1GGBH 3AS1A 3ZHDA 4MWFB 2JELH 2VXQH 3EOYG 2ZCKL 4X6FA 3QAZB 2EDNA 4M93C 3HUJA 4CADA 4W70A 2JK5A 1NCWH 1QRND 1MHEA 3I50L 1QR4A 1DQML 3P4OA 4EDWL 5BRZB 5MEOA 1P9MA 3MUJA 2NMSA 1WGOA 5F1IB 1FN4A 3LMJL 1CICB 4NDMA 1J05A 1A4JA 4LMQE 3CSYB 1FC1A 2PR4L 3T0XA 1NGQL 4YBLC 4LRNL 4F3FA 3TA3A 5DSCB 5LXGL 1OCWH 5KSAB 2P5WE 3QRFM 2H1PL 1N64L 4GSDH 3RUGB 1F4YH 3F7VA 2QADC 3B2UD 1FFOA 3NIDF 1UG9A 1MNUL 4G9DB 2IFGA 1ED3A 3RQ3A 4G9FE 1KEMH 1CFSB 4JFHE 3MA9H 3BMWA 3EO1B 4KZDL 4YR6A 4PJ9B 1CWVA 1JFQL 5F96H 4X7DC 1BD2A 1JHKL 4ODSH 3KLAA 1U3HA 3OX8B 1ZANH 3SO3C 2N7BA 3QEGH 5C08E 1KN4L 4OI9A 4XP4H 5DJ0A 5F88A 5FOJA 4X4XB 3V5HB 2Y5TA 4PRPA 4PGCB 5IVZA 4OF3A 3GSNB 4X7SH 3LN4B 3WIIL 1F4AA 4TSCL 3UDWC 1OB1B 3T8XA 1CDBA 4NZDA 1BIIA 2VDRL 5CKAA 3TIEB 5B22A 3UPRA 5I74B 2Z93B 5FYJH 3AS3A 5F3HB 2BERA 4NKQB 4PRBB 1F3DH 1CQYA 2F5AH 1ZHNA 4CU8A 3SDDD 4POYA 3IFLH 4NFBA 1NCCL 1D5MB 5GZOC 1AY1L 4LKCA 4M8QA 5DMIL 4HK3J 5DC9B 1INQA 2DIBA 3ULVF 4FOMA 2DS4A 2D31A 2X4PA 2BOCA 1BHGA 1WFOA 1WZLA 1ZLWK 3RWCA 3BZ4A 3ARQA 4PJDE 1IT9H 2ZWLT 4ZDHA 2OK0H 3TEUA 2FYYA 5IB5A 4HWZB 3SE3A 3WNLA 3UYPA 5IB4A 3QXDB 1E6OH 1CYGA 5H94B 3QQ4B 4M93B 1YDPA 3LEYL 5E2TH 4OI8A 5T5NG 3D69A 1SYSB 4Q9QH 3D85D 3O9WD 5MEND 5GRXG 2HH0H 1RUPL 3RWEB 3MRPB 3QULB 4C83A 3DV6B 1IKNA 4L3EE 1BOYA 1PYWB 4ODXA 5SX4H 3UTTB 4HGWB 3SQOH 3EO0B 3C6SB 1LO2L 1YZZA 2PXYD 4FTVD 4XWGH 2IALB 5GS1C 2ZSVB 3MRLA 1AGCB 4OD1H 1GJIA 2X1QA 5LWYH 1B0GA 5E00B 4PJ8D 3I2CL 1KLGA 2QADB 3GI8H 5C07A 5KW9L 3TH2T 2IH3A 4FFVD 3UZVB 1YNTA 1XR8A 5I71C 5FO8A 3CZJA 1D5XB 4Y16D 2EYTB 3GRWL 5AAMA 9CGTA 3TT1L 1OSZB 3SO3B 2BDNH 4HKXB 3V6OC 3G6JB 2W9DL 3KYMB 5CSZB 4XH2A 4OD3L 4M3JA 1KJ2L 1PD6A 1ES0B 3S3SA 1DZBA 4P2OC 2ED8A 3RGVD 4HF5L 3MLYL 1P4IL 2ZUWA 3NZHL 1FO0L 4CNIB 4PBXA 3QHFH 1ZK9A 3DSFL 2VOTA 4UQ2A 4GRMB 3EOBB 3HAEB 4HH9B 3HB3C 5T1LA 2V5YA 4J3WA 1GGBL 4X80H 1FCCA 2JELL 2VXQL 4WJ5B 3L3DA 1DQQA 4Z7WB 2X4QA 1IC1A 1CGUA 2AV7A 3FZUD 1G9NC 1NCWL 2CQVA 4ZSOE 2W38A 4HS6B 4Z7UB 1JVKA 1DJSA 4Y4HD 1KC5H 4XBPB 3VD7A 2DAVA 3VXMB 1A0QH 4OT1H 3EFFA 3TO4C 5LVEA 4NHCH 1X4XA 1FJ1A 1LO0H 3OL2A 4LLMA 4HV8A 1QLRA 1ZMYA 5LG1A 3ZTJG 4TQEH 4OM0H 1AO7D 1OTUC 4ZAKC 1G1CA 2A73B 3MACH 3Q5YA 4UTAH 3QIWC 3U1SL 4AIOA 1CG9A 5EOCL 5LJYH 4B50A 3MUY1 1HE7A 1OCWL 3S5LG 3EYFA 3P3YA 3REVB 4GSDL 3X14A 4GRLC 1F4YL 2BVOB 4PG9A 3O3BA 3CH1B 2AXHA 1KEML 1H3TA 1ACYH 5MEQA 3MA9L 5I76B 5F96L 3TBVA 1T5XA 5T3XE 1WSST 3L3JB 1IAOB 4TUKH 5CS7A 3DX8B 2LU4A 4ODSL 3CFBA 1F11B 3VGAC 2OMNA 1U8QA 2IFFH 1ZANL 3OB8A 1M7XA 3SE4C 3RWHB 3QEGL 5HYQA 3RY6A 4WO4D 1YN6B 4J1UB 5GS1B 3WYRA 3DYOA 3QQ3B 4LBEB 4N0FB 4XP4L 4PV9B 2OL3H 2J6EA 4ZYKB 2Q87A 1F90H 4JQXA 4GKNA 5CP7B 2VWEE 3FMGH 5I71B 4X7SL 1MCQA 3ULUD 1KFAH 1ODAA 3MUGA 1LP9A 4PFEA 5DRNB 3VXRE 4WHTB 1LILA 3HG1A 3ALPA 4DJMA 4OGAD 1FYTB 2IQAA 4CN6A 3NCFB 3JV6B 3QFJD 3HPLB 1XF1A 5JIHA 3QA3B 5FYJL 5KS9E 3T0DA 4P2OB 2EKJA 4NPYB 5JOFA 3FCTA 3C87A 2MKLC 1NC4D 5IHBA 2F5AL 2H32H 4Z5RA 3IFLL 4MD4B 3RVTC 1T0MB 2VLRA 4LAJH 2IJ0C 3P4NB 3VXOA 4P5MA 4N68A 1SYVB 1H3GA 1DBAH 4P99A 4LPVA 3VFNA 5E7FA 4HD9A 4ZUWB 4NBYB 5KSBE 3DI3B 4KJPC 5FO7A 3BVNA 2C7UA 5HD8C 5HGDA 2ATKB 4N5ED 1SEBB 3FOLB 1IT9L 1UB5B 3NPSB 1T80A 3FO1A 2ED9A 2OK0L 3RWDA 2BY2A 3ARZA 4XTRC 1YEDB 4CW1A 1E6OL 2BVEA 4E0RA 4NKOB 3KR3H 2E7LA 2NXYC 5E2TL 1QEWB 5DVLA 4CVZA 5DMKB 4KKBC 4Q9QL 3EYQC 1NEUA 3DECA 4MYWB 3LEVH 4I9WD 2HH0L 5FOBB 1YEJH 4XBGB 1WV7T 1K8DA 4QOKE 3LRGA 4Q7DA 3TO4B 2P43B 4Y1AD 4EIZC 3BD5A 1YMHA 3HZYB 2HFFB 2BXZA 3SQOL 3AROA 3D25B 4ZAKB 4V1DA 3B9AA 3NIFE 4MJIA 4IRJD 4YEEA 3S35H 3GUTA 1HHJA 3QIWB 2IAMA 4LCUA 3PIQB 3GMNA 4XWGL 2XNAA 2HN7A 4QGYA 4RNRA 3D3VB 1YN7A 1KCUH 3N1GC 4PJAA 4XMKH 5HGBB 2W0KA 1HSAB 5EULV 1NGWB 2GTWA 5LWYL 1P7QB 4Y0GA 4GRLB 2CR6A 4XVUC 5TDOB 3BT2H 2FCBA 4BZYA 4MHHG 3TESA 4OZGE 4X99A 2B5IC 3VGAB 4C56B 4OFKA 4L8BB 3K7UA 3ZDYE 3IDUA 1BWWA 4X0KB 5IBUB 3ARBC 1QA9B 1UKTA 2BDNL 4M00A 3DX6A 4BQBA 3KGRA 2HJKB 2XI9A 2Z8SA 3QUXD 2YC1B 4ODHH 5D7IE 3LRSB 3QWOA 3B9KA 3VGBA 4WFEE 3KPQB 1WEJH 3VXSD 1LE9A 4I0PD 5IVNA 2Z4QA 4X6DB 1RHHA 1F6AA 5MEPB 2FWOA 4YHIB 1HWHB 3QHFL 1XGRB 1KJVA 4MNGE 5E95B 3MJ7A 5C2UB 3UAJC 4OKDA 4UUJA 1AD0A 2DMKA 2O5XH 1DBMH 1TMCB 4IEFB 1C7SA 5E24E 2AXGA 2X4UA 4X80L 3HZKA 4XC1H 4QRPB 1J0KA 3QDMB 4NM4H 4UQ3B 4JKMA 1KTLB 4RGND 4F7MA 3CVIH 2HRLA 5B38B 4L8CB 4M3KB 2H2SC 3QDJB 3DV4B 5T3XH 3SCMD 3IVKA 4WUUB 2DQJH 4U1JB 5F89A 3ULVD 1KF9B 2FECL 4P5TC 2P8MA 4FN0A 1R3HA 4PJHB 1KC5L 2B8OT 2X89A 1A0QL 2VE6A 2MQCA 1J8HE 1X5YA 4OT1L 5E8NB 3QWRD 3VH8B 1LO0L 4HEME 4LHUD 3IDIB 1CFVH 2NY0D 5BJTB 4TQEL 5B3NA 4OM0L 2YZ8A 4HJGB 5EA0H 3MMEA 3DMMD 3BZFA 5CGYC 5EN2B 5IW1A 3MACL 5C9JB 2NXYB 2AV1B 4UTAL 3SPVA 1N2RA 3T65B 4E9LA 3DJ9A 4QF1B 5F71A 3FFCE 5E8PA 3F6LA 3G5YB 3V6ZB 4WFGE 5K33A 4JANA 2BY0A 4QTHB 5HHNB 3H9SB 3B5GA 5JORA 1MCRA 3CXHJ 3MRFA 3LQAH 4NNXA 2HRPH 1ACYL 2BCKA 4TUKL 5CD3B 1BGXL 3TZVA 3GJFA 2AK4B 4NT6B 2IFFL 4HUVB 3DYMA 2F54A 5ACZB 1OP3H 2PO6D 4DFIA 2C1PA 2GITA 3DI2B 3NCEB 4MHHI 2OL3L 2RFXA 2YMXH 3SDXF 1B6DA 2X4NB 3WIFA 1F90L 4U0QB 4KJYB 3T2QA 4EEEA 5C0FB 4Z0BH 3FMGL 4HJ0D 3MZTA 1KFAL 5ITFA 3FRUA 2D7NA 2B5IB 3KPOA 5C0BA 5AUMA 3FRPG 5IK3B 1LE5B 4Z7NE 2NY4D 3V52H 3ARBB 3W11C 3VFMA 2Y6SD 4GKZA 3IU4H 1PG7W 4HS3B 5IMKA 4AENB 1MAJA 3SKJH 2PYFB 3WL9A 1HINL 5FUCC 1GH7A 5GGQH 5HGAB 4G8GB 1EUUA 4M1CD 4GBXD 1O7SA 2QSCH 3VGHA 4OD2A 5E1AA 4PJXB 3L5IA 3I6KA 3DXAE 5FGCE 5D2LA 4HZLA 1U93B 4U3CA 4FMFA 4EUPA 1K2DB 2HTLD 5DRWA 3SGJC 2CDGB 1DBAL 2YKLH 2I60H 3LEXA 1D3CA 4G8FB 4QXWA 4P2RA 1B3JA 3DX7B 2WWKT 3KPSD 5F1KC 1XZ0A 2CLRA 4D0BB 3F7YA 5KZCD 4NSKB 2FH6A 4AT6B 1RK1A 1MFBH 1FV1B 4XCFH 4ZOEA 3GMMB 4MJ6B 1YYMH 3KR3L 2OTPA 4ZXBA 4UNUA 2FEDD 1U92A 1QSED 1MCBA 2NY6C 3VXTB 3LEVL 1C5DB 3GRWA 2PW2B 4P5TB 4M61A 3FN0L 3V4VH 5D6DA 4K8RD 1W8OA 4N8PA 2H6PB 1KJ2A 2YR3A 4DN3L 3W0WE 1LEGA 3K3QA 3SDCD 4L8SA 4CGTA 4U3HA 1LO3H 3VFVA 5I1HH 3U0PB 3S35L 4NO0A 2VLKD 1Z3GH 1BQHB 4OIBA 1FO0A 2DWEA 3QI9D 3ME0A 3RIAF 1T5WA 1KCUL 4WEBH 3WLBA 4XMKL 1QD0A 2BSSA 3CJJA 1OGAE 3BUYB 3MC0A 3BT2L 4ODUB 4FFYH 1M4KA 3QDHA 3N0PB 4UDTB 4UV7H 3ULUH 1RZIA 3BP4B 3MFFB 4Q9RH 1KLUA 5L2KB 3TIDA 3D18B 3QQ9C 4XXDB 4EQ3A 4IMKC 3IJYB 5SV3A 5JHDB 3T8XB 2WLYA 1G9MC 1WC7B 32C2B 5D7JA 1E27A 4NQDE 2YWYA 1T1ZB 4ODHL 2JCCB 5GJTH 3L3HA 3TFKD 2BNRD 2ZKHH 3FT4A 1WEJL 4N0UE 4AQOA 4UMGA 4N9GA 5F1OB 3VCLB 3IFOB 2O5ZH 4WTZG 1DN0B 5ISZE 4IIQC 3OAZK 4B53A 5FYKH 1CIDA 3CSPA 3PP3H 5J4MA 2AJYH 4C54A 3X3FH 3JTTB 3P2TA 1M7DA 1Y18B 1JIBA 1FP5A 2O5XL 1DBML 3RWCB 4YX2H 2K7QA 2XN9B 2VDPH 4JJHA 4P5KA 4XC1L 1WAAE 4NM4L 3O6LH 5SWSD 4PY7A 3KYNA 5IB5B 3TBYA 3CVIL 1XGQB 1XIWA 2YPVH 5T3XL 2C9AA 1NGZA 2N1KA 2DQJL 1HI6A 3L5XL 3G5VA 3GSRA 3FAXA 3K80A 4LSPH 4MLIA 4M6MH 5E03A 1DFBH 4MDIB 2HVKA 3GMLA 4YXLH 2OQJA 1JJUA 1I8IA 4YBHA 3QUZD 1J88A 1VADB 3EJZC 5ICYB 2NY5H 5DHXB 2B0SL 1CFVL 1RHFA 3TN0C 3PGCA 1ZVHA 2BHYA 4PJEF 1OTSC 4F9LC 1AP2B 2XWBB 1S7RB 4ZS6D 3WUZA 1JWSA 2FSEB 5E6IA 3U4EA 3DRTB 5H35B 3AY4C 5MHSD 2NY6B 3GJEA 2GUOB 4ENEC 1P5UA 5DEGA 3SGEI 4PRNB 2Y07H 3U0WH 3D0LB 2APXA 2XICA 5ENWA 5FDWB 3X12A 4LCIL 2HRPL 4I4WA 5HHXH 2OSLA 1FBIH 3HZMA 2N4IA 4H1LG 3WS3B 3RL2A 3QNYB 3R8QA 2R2BA 3B3IA 5HHOD 4F2MA 3JV5A 1EFXA 5EU6D 3U83A 3A67H 1QP1A 1OF2A 1S9YB 4GXUN 4OZFH 4NZJA 5EC2B 4F80A 4EBQH 2YMXL 3FO2A 2YUZA 4BQ8A 5HYSA 4Y88A 4GG6E 4AL8H 4Z0BL 5EBWA 4JDZB 3ARXA 5BVJA 5C3LD 2A74B 4R3SB 4R4NC 2LQRA 5FM5O 3OB0K 3OR6A 2C4FU 2RCSH 3V52L 4PJCE 3IU4L 4G8EB 2C3XA 5DTFB 5TQ2H 3SKJL 5ALBH 4L3CB 4X6CA 3BQUC 3SJVD 1MY5A 5GGQL 1P1ZA 4X7EC 2R1XA 2QSCL 1WBXB 4U33A 3JWDC 5C6TH 1T22B 5C09A 3GIZL 1G7JA 3VFOA 5IROA 3RWJA 4WW1A 4FP8H 1WT5A 3IDGA 4IIQB 5JQHC 4P3WA 4F7TB 4JKPH 4JY5H 3ULVH 4OZIE 2YKLL 1NBQA 2I60L 4P49A 1RZKC 4RX4D 4AM0B 2IANB 4YDKL 4HUKB 2PYEA 3CXHK 1FORH 1KPVA 4MA1C 1HHIA 4HMDA 5ESAB 3WFCH 4XPHH 3HI1B 4JQIH 2V7NB 2W91A 5DO2C 1MFBL 2HA1A 2YXMA 4XCFL 1CD0A 4YFDB 4XXCA 4ZUTA 4YHMH 1TLKA 1EV2E 4NQXA 4FS0A 4JZJC 1OD9A 1YYML 1X9QA 3MROA 4YFEA 1CF8H 4AH2B 1MVUA 2GYSA 3EIFA 1TZHA 4H8WH 2KQNA 2ZUQC 4KI5C 5KSUB 1YEIH 3V4VL 4H26A 4HCRH 3O6KH 3P40A 3MGOB 1F5WA 4XNQA 2YPLB 5AZ2H 3IAQA 3TN0B 1YMMB 1FVDA 4KK6D 4GLRH 3JWNC 1LO3L 4LSDA 5I1HL 4FQXD 1AHWC 1BVLB 4R4FL 1Z3GL 3AM8C 4RRPG 3ARED 2LAAA 4YPJA 3U7AA 1V5JA 4EJ1C 4WEBL 1AGBA 3V0VA 2DLGA 2XWTA 1CD1A 3QO0A 4Z7VA 1S7SB 4FFYL 4UV7L 2WANA 3ULUL 3ROOB 5DJDB 4FXKA 3ZE1F 4Q9RL 3QPQD 3QFDA 2ZUVA 4Y2DA 4OLYH 5F8RC 4QNPE 3I3DA 3OR7A 5C0AA 3KNBA 1DUYA 2H2PD 5F7WC 1ZHLA 4KJQC 5DI8B 5T3ZH 4HULB 4Z76A 1D6VH 1FE8H 1BZ9A 1G6RH 2ZKHL 1X5FA 4HKBA 1H3UA 5LQBH 2O5ZL 1F3JB 4PRIE 3MV11 2BC4A 3ZKMD 2AW2A 2NTFB 5FYKL 1H5BA 1NGXA 4KH2A 3GMRA 2AJYL 1K3IA 3X3FL 4X4MA 1Y0LB 2ZOLA 4PPTA 4DK6A 43CAA 4CVWA 2WWMC 3BQUB 1QPPA 2NY2D 4YX2L 4CVXB 3IDJB 5F9AC 4HH8A 4YWGH 1CFTA 3L5WA 4GUPB 4OZHE 5FAAA 5INDB 3O6LL 4R0LC 2OXGA 3G6JF 1A7RH 1C08A 5T1KA 2YPVL 3MRGB 5IW6A 2P42B 3O8XA 1Q0YH 1X6NA 4EIGB 5EZIH 4LSPL 4GT7A 4L4TE 4M6ML 1DFBL 3QIUD 1T66C 2ESVB 2EDKA 4YXLL 4MA1B 4G9FD 3D87B 2HVJB 4ACPA 2NY5L 2OL3A 2ZZUT 1G7QB 3VXNA 1T03L 3TBSB 4JZJB 1NFIB 4XPFH 4EI5C 2UYLB 1I8MA 2Z8WC 3QUMA 1X5JA 2P8LA 4P2QE 4A2MA 4NN7C 1JK8A 2ZUQB 3GO1H 2XNAB 4ELMB 2AQ1A 3UCRA 2DBJA 1RJZA 1MFNA 2Y07L 4UT9H 3U0WL 3QNZA 1T2JA 1XFPA 3OHXB 4WTXA 4YDLC 4Z7WF 3Q6GH 1QYGH 4X8XA 4J3OC 2GT9A 5HHXL 1YY8B 4PLKD 2L7UA 2DJSA 1IZKA 4P3DB 4Z7UF 5K9OA 3V7MA 5FM8A 1AHWB 2H32A 3GSUB 2NX5A 2E5EA 4E41E 4LQ1A 5E8EA 3MRCA 3HE7C 1Z5LA 4U1GC 5D93C 1QRNA 3A67L 1H3PH 1NUDA 3OTTA 1A2YB 1ZEAH 5DMGD 3VI3F 4EBQL 4KRNA 3F6IA 4RWYH 3BIKA 4HX1A 2NY1D 4AL8L 3VW3H 3T3MF 4BSWA 2Q7YB 3X13B 1DN2A 4UIKH 3GMQA 3EOAA 4KQ3H 3GI9H 1RV6X 3PHQA 4QRSB 2RCSL 2VZVA 3CU7A 4U6XB 1XAUA 4QRTB 5I1DA 5TQ2L 5ALBL 5FM4A 3O6FC 1BF8A 2XWJA 1T7XA 4BSJA 2AXFA 3CH8A 4ZFZA 1BFTA 5DJAA 1QBMH 1CFQA 4NO5B 3MCKB 4A6YA 4GRWB 1JCKA 4FP8L 4HIJA 4OLWH 3VD9A 4MCYB 3A6BH 4FG6D 1PZUB 1F2XK 4JKPL 1IM9A 4JY5L 1AKJB 5F3BA 3AB0C 4MQ7A 4DCQB 3QEHB 4K3GA 4HS8H 3ARWA 1FORL 4H0GA 5D1QC 1EEYB 3C60D 3WFCL 4LFHD 4JQIL 2MTPA 4LFHG 4KKAD 2EDEA 2ZUTA 3NABL 3GMPA 2D9CA 2IMNA 4YHML 3FQTA 4R0LB 3WDIA 4DOHE 4AEFA 4JG0H 5FGBC 5I16A 3PABA 2R2EA 1CF8L 3KPRB 2LE9A 5HTSA 2MSPA 3FB6A 3T77A 1YEIL 2X7LB 3BGMA 4WI9A 4HCRL 1CS6A 3O6KL 3KLSA 2X9YA 5ITBH 4I77H 4LLVB 3GM8A 5AZ2L 2EDWA 4QHNB 3T4YB 2AJ3A 4JFED 4NNXB 1R5WA 5A3ID 4YNYB 1AXSA 1GSMA 2EEDA 5E6ZA 4JG1H 2BHUA 2BOBA 4EI5B 3WN5C 5D7KE 2DI7A 4NN7B 2BXYA 1IGCH 4UB0H 4ETQB 1UXSB 2APVA 3BO8B 3RBGA 5TDPB 4YDLB 4QYOA 2ZCLH 1Z9LA 3P73A 2NLJA 1E4JA 2B7DT 2EC9T 5DUBA 3BE1H 2X1PA 1OTTC 4TTDC 4OLYL 5CHNA 1K8IA 3BHBA 2APTA 3QZWG 5BRZD 2P24A 2EDQA 2ID5A 3B9VA 3HE7B 4KZEH 4L4VE 3KXFB 1IGIH 4U1GB 5D93B 5LGJB 4RFOH 5T3ZL 1CICD 1HWGB 1D6VL 1FE8L 4P46C 2A77H 1BX2A 5GRZA 1G6RL 3EUUA 4LSQH 3PG2A 4AIZB 2Y4SA 5EIVA 4DZBB 5DF0A 4ZUVB 5LQBL 5C92A 2EDXA 5DA0B 4JREC 3E1F1 4HJJH 1XIWC 4UDUB 5KN5A 3FB8B 1RU9H 1TVHA 5CJ5A 4TN9A 4X98B 4Z18A 1OAKH 4P23C 5FA4A 3HFMH 5C0RH 4FTVA 2PXYA 1UM6H 5EIIA 3BIAX 3O6FB 3RTQC 3FQNB 2JIXB 3ECBB 3WDHA 3UTZB 1XF2B 4PJ8A 3UEZA 4PJ7E 4YWGL 3MRNA 2E7CA 4HUMB 2EYSB 4MD0A 2UWEA 1A7RL 4KK5C 5DD1H 2DJUA 2BVPA 4YK4C 3OJ2C 2IH1B 1JUFA 1NCUA 3JTSB 4Y16A 1KV3A 3T0EC 1Q0YL 2Z92B 3F12B 1T04A 1JRHH 5D8JH 5EZIL 4DWHA 3AB0B 5E2UH 3E6HB 4UNTA 4R7DB 4X6DF 5D1QB 1C16B 1BP3B 3CDCA 1LMKA 3FB5A 3ARDA 1I7TA 1RI8A 3QQNA 3TWCH 4OIIH 5FO9B 1HHKA 3RGVA 2Y72A 1ZA6B 1R3KB 2HMIC 4XPFL 3SE8L 1V8HA 5E5MA 2BSTA 3PWPB 3MRDA 3Q6FB 1BBDH 1T83C 3GO1L 4HPOH 3TBTA 1BBJB 4XAKD 2ARJQ 3MJ6A 3GSVA 3PDDA 4UT9L 3LKSB 1Q94B 4JPWH 1FAIH 1KG0A 1QYGL 3Q6GL 4MD5A 4PYGA 4QOKA 3VXRD 1QFPA 3O41A 3HE6D 4PJHF 4XHJC 5DURB 1JGEB 1RZFH 3BN9C 1A1MA 2V9QA 3U36A 3ZYJA 3H0TB 1ZHBA 3WN5B 3RWFA 2A83B 3CU1A 5ICZB 1H3PL 4GW1B 1C5BH 1ZEAL 3Q3GB 5DJZA 4RWYL 3TJEH 1B0WA 1T7ZA 3QUKB 3S36X 3VW3L 5JDSB 5IEKA 5I2IA 4UIKL 1U8HB 3GI9L 4KQ3L 2B4CH 2YN5A 5FK9B 3LQZA 1GOFA 2PKDA 4WFHE 5B8CA 1YC8A 3BH9A 4G6FB 4LKXB 5EORL 2CO7B 3S5LA 1T7VA 3MJ9H 2DM2A 4YUEH 4FFWC 1RJLA 3UTTD 4P46B 4JRXB 4ZFGL 5JOEA 3LKNA 4OB5H 4LPWA 5KOVC 3SY0A 1QBML 4F58H 3G04A 1ZT7B 1DDHA 4JREB 4OLWL 4HUXA 5DD6A 3ILPB 3A6BL 3LS4H 5FCSH 4MAUH 3H42H 4N0RA 3WNKA 3KWWB 4P23B 4X6BA 1HYSD 3MX0A 3T4AA 1AI1H 2BMKA 5CGTA 2F53E 4WO4A 4HS8L 3RTQB 2X4TA 3MLZH 3OKNB 3O4OC 3UBXB 2VQUA 3GB7A 1FGNH 2DQFB 4M7LT 4PRAA 3SGDH 3ZT7A 1ZGLA 3RUGE 5IV2B 4JG0L 3KS0J 5ANMA 3K8LA 4PRHE 4YK4B 4WNQA 4XVSH 1N3NA 1V7MH 3VD3A 2OP4H 5IKCB 5EO0B 5IHZB 4MJ4A 3T0EB 1IILE 1KIQB 2EE9A 1FL5B 2CJUH 5F7LB 5I66A 4PJXF 5ITBL 1NMAH 4I77L 5BZWB 3B83A 4OTXH 3QIBC 1QSVA 1OARH 3QB7C 1MHHA 2E6PA 1NC4A 1HKLH 4M1GH 1VGKB 3D39B 4JG1L 3F7PC 3TM6A 1I1RA 5GSVA 4KXZI 4JFDB 3FHAA 4RFEA 5DJ8A 1IGJB 1WQVT 4PJBA 1CE6B 3S9DB 2FDBP 3WS6C 1IGCL 5HYJB 4UB0L 5J1SC 1FHGA 2VQ1B 2Z8VC 3PHOA 5C0CD 4N0CD 4UBDC 1P7KB 4JFXA 3HRZB 4X83A 1QSFA 1IQDA 3OG6B 4HBCH 3I75B 2ZCLL 2HKHH 4V2BA 5HPMA 5GZOD 4JN1H 4OAWB 4HIIB 5F93C 3BE1L 1WK0A 1VACB 3S4SB 1CDUA 4YH6A 4JZOA 3KG5A 1ETZB 1G7LB 1F58H 2Y23