2DQFB

Crystal structure of hyhel-10 fv mutant (y33ay53a) complexed with hen egg lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDAWSWIRKFPGNRLEYMGYVSASGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 20
structure length 114
sequence length 114
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqfB00
4L1HA 4HWEL 3DLQR 4ZFFB 3QZWB 1G7IB 1RQ5A 3AREA 3B2UD 3ULVD 5E8OB 3ALPA 2EEAA 4M1DH 5FYKE 3ISWA 1A7OL 3RVXC 1PSKH 1WSST 1U42A 2IG2L 4NP4H 2R69L 3PWNB 3RUGF 1ZVHA 2BSSA 3STLA 2CMRL 3QIBB 1TJIL 3LRSA 4G6JL 3VFUB 5CD5D 1SJXA 4MA3A 4RGOH 5IEKA 1UXWB 3MV8E 3PXJA 2ZOLB 1LNUB 5FYLE 1BIHA 4L3EA 3WJLC 3ZKXC 3AU1B 4LIQL 1UWEL 4FZ8L 5KN5B 2KZWA 3S35L 4FXGB 4QRQB 4W6WB 5C0AA 5BVJB 3V4UH 3DUHA 4PRNB 2EYTA 4HKZA 4AZ8A 4QHLA 2OS7A 3HMWL 4X83A 3KJ4C 2PR4L 1A14H 4MB4A 1AHWB 1EHNA 3HG1D 4CN1A 2RCSH 5TE4H 3DGGA 3NH7H 4NKIL 1QNZH 1FH5L 1ADQL 1VGEH 1DUYA 2C1PA 1L4IA 3K4AA 4RZCA 2NW2A 2XA8H 3NCBB 4HWZA 5C09A 4TTDC 4NZJA 3WUWA 3GMMA 5I66B 4LVOB 5ADOH 4HS8H 1EEZA 2A1WL 4G43B 5HHVL 4QT5B 5F9DC 3NFNA 5EOTB 4JRYE 4LL9A 2H8PA 3MSPA 4BZ2L 3KHQA 4LCCC 4TSAH 3MRPB 4U6HA 3T8XB 1OAZL 4NPYB 3QXTA 4MX7B 4XVJL 1KEML 1I8IB 5EZLA 4OZIA 2WLYA 4LP5A 5MP6H 1D6VL 3U7WH 4NQSB 2MPAL 2A6IA 4Z8FH 1BVLA 1R3JB 4D9RE 1EUTA 1PD6A 3MV8B 5JDJA 3ARGD 3GGWB 2AS5M 3L3IB 4YFEA 1U8JB 1UCBL 5DJ6B 1EJOH 1QPPA 2YD9A 4GKNB 4OLEA 5D2NE 1M71A 4UDTA 2PO6D 1LK2B 4IMLB 4LHUD 2XRAL 1TMCB 2AJXH 4QF1B 3WJLA 5IW3A 4EIGB 1SVCP 1IGFH 3QDJE 3K3QA 4PRHD 3WFZA 2CK0L 5I1CH 3MREB 3V7MA 3TCLB 3L5XL 3TIEA 1MJUL 3P77B 5A1AA 3REWA 3TJHD 1KC5H 1HNGA 4XP4L 1JWSB 5B22A 4LARL 3Q6FA 3MRRA 3DBXB 1F4YH 3ZTJH 4JRYB 3NAAH 5BRZE 4C56A 5CEXA 3SGKC 3Q5OA 4LSVH 1FZOB 3MRHA 3JWOH 4AH2A 5IEHA 5I30H 3WJJC 1MOEA 3ROOB 5D1ZB 2AV7A 3VI3F 1T1XB 3BUTA 4LCCA 1NGXB 4X6CF 4HS3A 5FAAA 2X4SB 3QUKB 2R56H 4C4KO 3G6DH 5ISZE 2X1XR 4B50A 1NMBL 5IVXA 1J8HB 2R0LL 3HB3C 3FT4A 4AG4H 5D2NB 3U0PA 1HOCB 1K4CA 2VUYA 3I6KA 5J57B 2R2HB 4Z18A 2A2QT 1IEBA 1I9RH 1ORQA 4KHTL 1I1YB 3QDJB 1II4E 3DVIA 5BS0E 3QO0A 5JORB 1JTPA 1I7ZA 2H1PL 1ONQA 4MNGE 2WBJD 1U91A 2ADGB 4D94A 1JI2A 4XNUL 4XPBL 5CMAB 5L88L 1ULVA 3DVFA 4AIOA 5SX4H 5DGRA 3OKEA 5JLZB 3G5ZA 4XBEH 4NT6A 2N7AA 2HJKA 3GKWL 3VJ6A 5FV2A 5BRZB 1UM4H 5BXFB 2HKHH 4K94H 1RK0A 4ONGH 5C0BB 5DO2D 1OSPH 2XQYK 4NZUH 5EIIA 3IFLL 2Q7YB 5EH1A 5ETUB 1NGPL 2B1AL 2Q6WB 1KB9K 5HYJD 1U41A 2BXZA 4JLRA 3SGKA 4FQLL 1E6JL 2OMBA 4LVHC 1YEFL 5I17B 3WJJA 5ISZB 4QRPA 4PV9A 3LSOB 4PRIE 1HXYA 1ZLVH 3EOBB 4GUPA 5C0GB 1OAKH 1RUAH 3EZJB 1V3MA 1GGCL 2NY4C 3MBXH 4Q6IB 4LQFL 2YWZA 1BZ9A 3K74B 4HC1A 1AXTL 3VMPA 4JFDE 2OL3L 5BS0B 5ITFA 4G5ZH 2VXUL 3BQUB 2R0KL 1TQCC 4KPHH 4MNGB 5DUPH 3PIQB 2ESVA 4NSKA 4X98B 3MLSL 4UV4H 4XXCC 5SV4A 1HXMB 5D6DC 3FRPA 2Q8BL 1QEWA 2W9DL 4GW1A 3T2NH 4B41A 1NLDH 4XWGL 4CU8A 3EJYD 5KANI 3VH8G 1JPGA 2VISB 5DT1L 3NCJL 4R26L 4M1GH 1JN6B 1INDL 3DXAD 3S7GA 2BDNH 1P4LA 4LGSB 3LB6C 3HZKA 5I16A 4OZHA 4R4ND 4QHMB 3S36L 3F5WA 4QRTB 3O2DH 4U1SA 3ZE2E 4D9LL 3IT8D 3DWTA 4G80A 1HI6B 5DEZA 4DAGH 2R1XB 3GBMH 4G42A 4UU9B 5EFIA 1MLCA 3BAEL 1FO0A 2BERA 3PXHA 5DJ0A 5BVPL 4MDJB 2CRIA 2EDRA 5DDHB 4Z7NF 4FRWA 3AC0A 3S96A 5SX5H 2VZOA 2XZCH 4I3RH 5F9WC 3OAYH 4OCLC 5A16B 1PZ5A 4JFDB 1EFQA 3AREB 1ZV5A 1JUFA 5C2BL 2FJGA 4YC2C 3WIHH 2GTZB 3SDDC 1IGYB 2BHZA 4FQXD 5GGRA 4JDZA 1K8IB 2BJMH 3CVHA 5GZND 1CFTB 1XAUA 1NEUA 43C9B 2DYPA 5GGQH 2YMXH 4XXCA 4H88H 4WHTB 1DQDH 2EXYC 3QNXA 4YPGB 5CEZH 3DUSB 4WUKL 4LNVA 3T0ED 5JPNB 3TNNB 3QFDB 4JREC 3TO4D 4MD5A 5C86A 4C58B 1JNNL 4UB0L 2YPLA 3TBVB 3VFSB 3T4YB 1PKQA 3KPTA 4KKAD 4Z7WE 5IJVA 1RURL 4QHLB 2DQTH 3SDCD 3MYZA 1B4RA 5A2LH 1Z3GH 4ZFOB 1EAPB 1KLGB 1ORSA 4WI8A 2F15A 4KJPD 4NIKB 4U1NA 5J6HB 5HD8D 2DI8A 3C5ZC 3L1OH 1RIHH 2V2XA 4RZCB 2NW2B 5EA0H 1C08A 1JE6A 2UZYB 1LVEA 1QQDA 1UEYA 2VXTL 3D87B 3GMOA 4NUGL 4YK4B 3TVMD 5DD3H 5IT2L 4HDIB 1X5KA 2F19L 2EDQA 3FN9A 3M1BB 4XWOD 5EZLB 5JA8B 4YDKH 2FBOJ 4WWKC 3RL2A 4UQ2A 1EAJA 1F02I 4KJQC 4OZIB 1FAKT 4ZUUA 1NANH 5DS8A 3B3IA 4P3CL 1AQKL 3SDDA 4YXHL 4XB7A 3DROA 5ICYA 2A6IB 1BVLB 4M6OH 3AS1A 1KN4H 1HINH 4U33A 2WUBH 4EQ3A 2FB4L 2OMNA 4KZEH 3H42H 3V7AG 1EGJL 1MLBB 4OD3H 2YD8A 3L7EA 4I77L 5CHNA 4AT6A 1L9NA 2R0WL 4NO2A 3FRPG 4UDTB 2VDRL 3GZKA 4HUWB 3NN8A 1EFXD 3VH8B 4L4TA 3RNKA 2DJ4A 3T4AA 4U6TA 2H41A 2XI9A 1U95A 2JTDA 3P40A 3O4LE 4WU5A 4AL8H 4WW2A 3WNKA 1F13A 3NFSL 1S7SA 5BV7H 5F8QC 3KJ4B 1ZVSB 4I3GA 3VWJC 2RAMA 3PGDB 2R2BA 3QIBD 3C5ZA 4WY7L 2FNBA 3WFBH 1FV1A 1C1EL 3LN4A 3R1GL 5KAQG 1CF8H 3WFCL 4UOW0 5DUMH 4MQXC 3CFBA 1IE5A 3IAQA 2AQ3A 3VD9A 1XR8B 1V05A 1ES0A 1FIGH 2ED7A 3CUPB 2RGSA 4LCCB 3H9SE 5A2IH 4HS3B 4I4WA 1CGUA 4WWKA 1HHIB 1WEJL 2CPCA 2L0DA 4Y1AD 3LPGA 3TBYB 3FB7B 4UV7L 3HAEA 2NLJA 4PRPA 5JW4N 3O81A 1BFVL 3OGCB 3X11A 2O5XH 4YDJA 4PJAA 4QHKI 3UTPE 1IVLA 2DD8L 1MCWW 1DE4B 3LKOA 2GHWB 2QKIB 5E00B 4PJIE 3ULSA 2WP3O 3R8BB 3O4LB 1OPGL 5DUBB 3X3GH 3JV6B 5FYKD 2RBLA 2DMKA 2WWKT 3BVNA 2GFBA 3LKSA 4JN1H 2HMIC 5SWSE 1R3KA 3N1FC 5JXAH 3QQ3A 5TDPA 3OKEB 4YBHA 4OAWA 2DBJA 1GHFH 1TZIA 4O2FA 3HUJA 4FFZL 4PJ7F 1X5YA 2XG4A 3QHFL 4KI5C 3QEQE 1MUJA 1FNSH 4QY8B 3W11C 5HPMB 4KH2A 4TYUA 1BECA 2FL5A 3MV8D 1QRNE 5FYLD 3GM8A 3U36B 3VWJA 4MA7H 1ZLWH 4Y2DD 1LO4H 1Z5LA 4G8FA 1X6LA 2X4NB 4BJLA 4PJDA 3LAFA 3CFCH 3H9SB 3LH2H 3RVWD 4NQCE 3AVEA 1D5XA 3MUJA 4CMMB 2P48B 4MAYA 1HXYB 3VDCA 4PGJA 4FHBD 3MV01 3JVGC 1FJ1B 4JPIA 4J3VA 7CGTA 2DWEB 1FYHB 1FLRH 4X4XA 1RHHA 4U05A 1U8LB 3TYGH 2DLHA 4PJIB 2ZCHH 1YPZA 1MRFL 1SM3H 3DVGB 4GQPH 1IAOA 4NSKB 2AEPH 1RIUL 4JRYD 4X5XB 1I3GL 1RJYA 1MCCA 5GS0C 2F8OA 1EO8L 3TJEL 1FNAA 3FB5A 1F6AA 5D1ZD 1S3KL 2X44D 1QLRB 5GSRB 3QEQB 4D9RD 2AGJH 1F3DJ 1QRNB 3RRQA 5I1KL 3DVNB 5C0DB 4CUCA 3VFTA 4ONOA 2NY0B 1OGTB 2IQAB 1FN4A 1M7DB 2ZSVA 4KTYA 1ZOXA 3LEYH 4NQCB 4G42B 4RFNC 3OJDB 5DURD 4LEOA 4F2MA 3QDJD 4YDIH 1S7UB 3EIFA 4R4BA 3CZFB 3BZ4A 4W4NA 1K5NB 4GAFB 1W0YT 4DWHA 1NBZB 4MQ7B 3S96B 5E08H 4QYOB 5H37G 4E42A 1VADB 4EUPB 1CGWA 5C0RH 2EDYA 3N1MC 4QTIH 5AG8A 4HQQL 3JVGA 1WBZB 3EO9H 1DBBL 3NZHH 2IF7A 4D0DA 1MFEL 5BRZD 4NQDA 3QUML 4OLXL 3CVHB 1MRCH 3HAEG 3C87A 3FL7A 4X6BA 4S2SB 3IFPB 4I48B 1TQCB 5DQJB 1RZJC 5I1AA 1J10A 1J1XL 5DJCA 4NKOA 1LDPH 3IDXL 3EBAA 4K7PY 4JHAH 3OJ2C 3BKMH 4X9HA 4U1GB 5E94B 1J0KA 3DSNA 5ANMA 5ISZD 2FEEL 4MD5B 4MJ6A 4GT7A 4U3XA 1S9WA 4PYGA 4W4OA 4M03A 4JO2L 1ZT4A 5ESVA 5E2WH 5DHYB 4XCEA 3SCMC 4MD4A 4XNXH 4RIRA 3WN5C 2V5YA 3L95A 5BS0D 1CVRA 5CD3B 3LDBC 5E1AA 2V2XB 3K46A 4P5TC 2VSCA 2ZUSA 1C08B 2A77L 4NO3A 5EOCL 3UYRH 3F6LA 3P9MA 5DJZA 3VFGL 3FOMA 4R0LC 4HKJA 3FONA 4PLJD 1RJZB 4YBQD 5IFJB 4CN4A 2FECL 3QG6B 1ZGLM 5GISH 3KXFB 1FIEA 2BC4B 2V2TB 1G7LB 1GC1H 2MOVA 4ZUUB 1A4KB 4YC2B 4HWBA 4Z7QF 1MFCL 2C26A 3P73A 2LAAA 1IILE 5JPMB 3JWNC 3VGAC 1ZS8B 2FZ3B 4G6AC 1NGZB 1AFVH 4OFYD 4PRID 1YUHA 4RWHA 3U7AA 4GRLC 4Z7OF 1D5IL 1TXKA 5LQBH 1HWHB 3QDHA 1JGDB 2HT2C 5EOCJ 1MRDL 4Z7VA 1A1OA 3H2WA 3K80A 4ORZC 4JFDD 4G7VL 3KPOB 2J8OA 3FFDA 1S7SB 1C12A 1RFDL 2JIXA 4BQ9A 4D3CH 4LLVA 3SCMA 4NJAH 2Z93B 3GO1L 3WN5A 4XVTL 1W0WA 1IL1B 2R2BB 4E41B 1ZHNB 2GCYA 1VHPA 2DLEA 3RVUD 1EVUA 3QG7H 4AJ0A 5F9JA 3LN4B 2OXHA 3K0WA 4FOMA 5DFWH 1AIFA 1EO7A 3C8DA 3NA9H 3BPNC 5CGYC 3WCYA 1GZQB 5EIQA 3I6GB 2VZSA 4R0LA 4OFIA 5D6CA 2YSSA 4OCSL 3O6MH 1WT5C 1KB5H 4G6MH 4XBGB 1T66D 1NL0L 2FX7H 3CLEL 5I1GL 3LN5A 4HWUA 2W9EH 4JKPL 5CJQL 5FYJD 1CK0H 5GRVK 3ARDC 3BPCA 3DYPA 2DF3A 3UJTH 4QEGA 3LHPL 4Z5RB 2VDKL 4WHYG 4X8JA 3VRIB 5H2BA 4KKLD 3CC5B 4LLYB 1X7QA 2XOTA 2YC1A 3D25A 4PTUB 3P4LA 4XMLH 5JA9A 1QUNA 1NMAL 3LD8C 4K3DL 4X6FA 2IBGA 1QA9A 5GIRB 3EYFA 1A6ZB 4LLMB 5JXED 5EWIL 1XIWB 3FQXB 4PRAA 4GRLA 5IG7B 5DD1H 3IRZA 3F62A 2OI9B 1SBBA 3T0AA 2HWZH 5L8JB 1R3KB 2D31B 5EN2B 5TDPB 1DN0A 1QG3A 5HPOA 5TQ2H 4O2FB 2A6JA 3HUJB 2HFFA 2WSKA 3NVQA 1H15B 3CD4A 4OZGA 3MRFB 2AEQH 1CGSH 4KK5D 1IGIH 1HIMH 1CR9H 2HA1A 4XCYA 7FABH 1IGTB 4HJJL 2D0HA 3TNMB 5DJXB 3D0VA 1JGEA 3OKYA 4YZFF 1OGAE 5KS9B 3U4EB 2V6HA 1T5XA 5FOBA 2QV2A 5INCB 3HS0B 4YHYB 1BGXH 3OKKA 3RWIA 4PJDB 3MNVB 3TLRA 4BSVB 4GKOA 2M8XA 1AR1C 3V6FA 2Y7QA 5D2LB 1RZKC 4TUOB 1OTUC 2V9RA 1R5VB 4Q9QL 1G9NC 4PJ7A 2Z91B 3D9AH 1E4XL 4R4FL 4EI5D 1A22B 3GHBH 2OR9H 4PJ8D 1XGPA 4HUKB 5E99H 3ARDA 2APTA 1ED3B 4LMQI 2R1WB 1Z9SA 3MGOB 5FK9B 4JFXA 2BP3A 4U7SA 5JUEH 3TYFB 2GK0B 1MCIA 2YK1L 3RHWK 3IDMB 2UWEA 4O9HL 4AEHL 1U8OB 3MV11 3QI9C 1UZ6E 4KV5E 4OV5B 4X4ME 3D69B 1MFAH 1DZBA 3P4MB 1MCOL 3ZE0F 1D9KC 1MCPH 3TFKD 3WL9B 4KKNA 3PWPE 3GSVB 3VRJB 3WLWC 1S8DA 1WTGT 5KSUA 2RQ8A 1N2RB 2NY2B 3RKDD 2FJHB 4CNIB 4HPYH 3EGSA 4NKDB 1OGAB 1C5CL 4GMTL 4HGMA 1NAMA 3PWUA 3MA7A 5DXWA 4R2GC 1BFTA 5FKPA 2ZSVB 5DRWB 3DRQA 3VXME 2CRZA 2Q8AL 3OHXA 4EDWL 4YDVB 3KYOA 4OLVL 4OM0L 4XAKE 4YHOH 3TV3L 2AXFB 2IFFL 4HZLA 2VQ1A 3MJ9H 3MLZL 4J8RB 2P42B 3GNML 5K59F 5CZXC 5DMGD 3O4LD 3MRBA 2F54E 2PYED 3MNWB 1DBJH 2NPLX 4JGMA 2K7QA 4LCUB 5I1HL 1MY5A 3O0RL 4HIEA 4N9GA 4CL7A 3O41B 5CIPA 5CKAA 4OFKA 1IFHL 5I8OH 4F8TA 3KYKH 5IB5A 5JNYA 4FFWC 1S9YA 5A2FA 2R4RL 2FCBA 1VFAA 3KHOA 4Y4FB 1SEBA 1FCCA 2XQYG 4K8RC 1CDUA 2D9QB 2ED8A 5CJXA 1YECL 4JO1H 1EEYB 5D4QA 5CEZE 2BRQA 4XAWL 3H9SD 3QI9A 2AXGA 4KRMB 1EPFA 1EK3A 5TPWH 5CBAB 4G6FD 4Q0XH 4WI7A 4MJ6B 2HFTA 3PHQA 1D9KA 2HTKD 1YY8B 4PTTA 2WM0A 2W0LA 1NFDF 2ZOKB 4OQTH 4PG2C 2NZIA 3EYVA 2VQTA 1H8OA 3UTPD 3SDAB 3VXMB 1QBLL 2IH1B 4N8CH 5F6IB 2NY5H 2G75A 2F58L 2X2YA 4JJHA 1NLBH 2D7TL 1Q38A 2F54B 3TN0C 3RVVD 2YRPA 2W0FB 8CGTA 4RFNB 1BOGB 4ELKA 2Q3AA 4Y5VB 4XVUD 4AM0A 5SWSD 5E6IA 1PGRB 4LRIC 1QO3B 1IAII 1JZ7A 4NWUH 4W68A 4UBDD 3QP3A 3QEQD 3QEHA 2C7UB 5ALCL 4JR9L 3CLFL 1QRND 2L7UA 2ZNXA 1MEXH 2E7BA 4BZ1H 4X6EB 4BSJA 2NY0D 1QSEE 2C3WA 2WIIB 4PRDB 4U6VH 2B0SH 2QQLH 4NYLB 1HH6A 3O3AB 5ESAA 4NQCD 2VE6B 2EH8L 5C1MB 4U1MA 1JTTA 3N9GH 5IFHL 2ICEA 3MJGX 1R3IL 1T7ZA 5FDWA 3HI5H 4L8SB 2YD6A 1VEOA 2HFGH 1RUQL 2IJ0C 1GOHA 2DQGH 3HNVH 4NZTH 1B90A 2MQ0A 2W07A 4UIMB 1P7QB 2AJYH 1I3UA 2UY6A 3U0TB 2R23A 3Q5TA 4RAVA 1JK8B 5AZEL 2YPKB 3B4NA 2MMXA 4PG2A 1AP2A 5I2IA 3HNTH 1X5IA 3ECBA 5J8OA 5K9JL 1DUZA 3VGHA 4YEEA 4HGKC 3TBSB 1XCTB 3IKKA 3WEXA 3LDBB 4X0KA 4N8VA 3G5YB 4X7CC 3VXNA 4P5TB 4XRCB 1JYWA 1XF2B 2EICA 4WU7B 5BMFH 3I3BA 3BXNB 1I8MA 5KZCB 1RZ7L 1CL7L 5J12C 5T5FL 3DMMC 3KLAA 5J1TC 4M61A 3KNBA 1CQKA 5D6CB 4LRIA 1PW3A 1SVZA 2FJFB 2AEIT 4N0YH 1QSEB 5F1OB 4G8IB 3NFPB 3EO0B 1BD2E 4S0SD 3GJFH 1KCUL 1EV2E 4QGTA 2LU3A 1MCNA 5GJTL 2X70A 4L8BB 4OIIL 4RCAA 1AE6L 2DQHL 3OB0H 5IK3B 5TQ0H 4M62H 4ZYKB 1LP9E 4HWEH 4KRLB 5FKAB 4F7TA 2B4CC 4RNRA 4O51A 1R3LA 4ELMF 4QXTA 5B38A 3D25B 1EUUA 4J4PC 1KG0A 1FYTA 2IG2H 4U1IA 4OCYL 3S9DB 1CFQB 3DTXA 4F7EA 1VB9A 3VFPA 1DLHA 3EFDL 2Q1EA 3IS0X 5BV7B 3DRTA 2A6KB 1E28A 4D2NA 2CMRH 5F7NC 5D7KE 3PGFH 3AAZB 5HHQB 1TJIH 4ENEC 3IU3A 1N6VA 4G6JH 6FABL 5HI3D 1SJVA 1L0QA 1AXIB 5C6WH 5L0QC 3ARYA 4ZPTA 2ID5A 5KVEL 4YGAB 4KK9D 5J6GB 5E1HB 4TN9A 2NY6C 2CDEB 1UWEH 3EDJA 4FZ8H 4LIQH 4RMRA 4YNYA 5JOEA 5ERWB 3S35H 4MJ5A 2X4OA 4YFLF 3FCTA 3NPZB 3QCTH 3AB0C 3QEGL 4M6NL 3OJMB 4FQHA 4M8QB 1OP3K 3RWIB 1P69B 1KTKE 2PR4H 4P9HC 2F53E 3JTTB 4MYWB 1BD2B 3DMMA 1TCRB 5H35B 3QXWA 4NKIH 3UZEA 5FCSH 1FH5H 1ADQH 5HGAA 4NO0B 3W0WA 1KULA 2FRGP 2MHAB 3HE6C 1LO0L 2FYYB 1LP9B 1MHPL 3R0NA 3BIKB 2EEBA 3FO9A 4EZMA 2BVTA 1J87A 2A1WH 4M7ZB 3UTQB 5HHVH 2XWJB 1T20A 3RI5K 4PJBF 4BKLA 3ARDB 4JE4B 3LMJL 4BZ2H 5LWYL 1IC5L 4LKCA 5JO5B 5I6XC 1U8KA 3BZFA 5C8JA 3MOAL 5IB1B 1KEMH 2DM2A 1N5AB 4NRZA 2VL5A 1QOKA 4U6YA 3C5SB 2F5AL 4J4PA 4P4KA 2FH6A 2MPAH 1JFQL 2W60B 3LD8B 4JO3H 5B3JE 4JCMA 3V6ZA 3K1DA 4DUWA 4BZYA 2A74A 2Z8SA 1UCBH 3QB7C 3RP1A 2HLAA 1R0AL 1RK1B 3GSNL 1IQDA 4NBZB 1YY9D 2E9IA 5L2KE 2WBKA 3R4DA 1C8PA 3ABZA 4TSCL 4L29A 3RWDB 2VABB 1DP0A 2Y25A 1OQOA 3RZCB 1JZ8A 1WTLA 1JGLH 1GZPA 5CSZA 3MQIA 2CK0H 1YNTA 1A02N 4LGPB 4M4PA 4YHNB 3R06A 1MJUH 2VKWA 3ARFD 3G6JA 2VQ1B 5CKGA 5T1KA 4N8VG 3E6FB 2FGWL 4HX1A 5I1JL 3N1GC 1A7QL 5A3ID 5HVFB 5AEAA 4XP4H 2NXYD 2ICWB 2HT4C 1XIWD 3IAPA 1SEQL 4N9GB 1BX2A 4U2YA 1FGVL 1QPXA 5GGRY 2X7LB 3BFOA 3V95A 3F8UB 3HE6A 4JG0L 3SY0A 1OLZA 3H9HA 1TZHA 4F33A 4YDLB 4PP2A 3KS0J 2I60L 4W6YB 3RIAF 4UT9H 4JQXC 4IS6A 4JB9L 5HVGB 5I8EA 1JYNA 2MCPL 2ZUYA 1S7VA 3O2VL 4P2OB 1LD9A 5DHXB 3A6OA 1TFHA 4M62L 3G9VA 4MAUH 4JZNA 1QVOB 5B38G 2AJSL 3QI9B 2R0LH 3M07A 3KPQB 2HT3C 5C6PB 4OB5L 3JXAA 4KK6C 2XKUA 4MJIE 2MTPA 4S0TD 4ODUA 4ZG1A 1CFSB 4KHTH 2APFA 5E5RB 4MDIA 5K33A 5L2JA 3IXTA 4NHCL 2E5EA 1DDHB 3T65B 5JW5A 4FQ2L 3N1PC 3PJSB 3IGAA 3AXLB 1F3JA 4HS6A 3PP3H 4AEFA 2YEZA 4XNUH 4XPBH 4XBPA 5HHOE 5L88H 2Z31A 3C8HA 4MHHI 3T77A 2ATPA 1VGKA 3VXSA 3OF6D 2P8MB 1T1ZB 3UTTE 1OAXL 1BFOB 4LVNC 4RMWA 4AM0B 5EO9A 3CH1A 2VLRB 3GKWH 2JF1A 4XCNB 2CSPA 3PP4L 1FE8L 1KFAL 4N0CC 2IMMA 5IIEB 4OCRL 3EYSL 3QIWC 3IFLH 32C2B 1NGPH 2B1AH 3OR6A 3FJTA 2NY2D 4FQLH 1E6JH 3TH4T 1OGAD 4X99A 1VACB 4U0QB 1YEFH 3SDXA 3MXVH 4ZO9A 4JZJC 3WHE1 2PYFA 3BPOC 3I3DA 3NIGE 1GGCH 4MJIB 4X8XA 4B5EA 1IGCL 3MJ7A 4PJ5E 1A3QA 3FO2B 1U36A 3U6RB 4P5MB 2OL3H 3KPSA 2VIRA 2VXUH 3W9EA 5C6TL 2R0KH 1E4WH 3NGBB 4OLUL 3MLSH 3V5KB 2NYYD 4P23A 4BH7A 2Q8BH 2VZTA 4H8WH 2W9DH 4IHOA 5HHOB 1T2XA 5D1QC 3F6IA 3PHOA 3B9DA 4JFPB 1HCFX 5E8DL 4XWGH 5EU6B 1RSFA 4GAGL 3KDMB 3UTTB 4Y4FD 1S5HB 4I0PC 4RBPK 5DT1H 3NCJH 4R26H 1F8TL 3FQRA 4QCIA 3TN0B 1INDH 3M45A 3QA3B 2J6EL 3PWPD 5MEOA 5EU3A 3S36H 5LGJB 1NCTA 4D9LH 1CD8A 4L3EE 3ZKMD 1TLKA 5DJDA 3OR7B 1WISA 3I9GH 3E6HB 1ZHBB 4R7NB 2B5IC 1MIEL 4HUVA 4X6DE 3SDAD 4G8GD 3VXMD 2NY1C 1FNGA 4XC1L 4XAKD 2XPGA 2X4RA 5FYJL 4BH8B 5DK2B 3MGTB 4JZJA 1FZKB 4OT1L 2F54D 3BP4A 5KSBB 4F58L 5IB4A 2JJUA 4ZSOA 5DGQA 5B38B 5C2BH 3DV4B 2NZ9C 5EPMB 3IDGB 5F7UA 4UNTA 4Y5XA 3FQUB 3X13B 1ZMYA 1DQJA 5LKNA 3DRTB 2VDOH 3BZDA 2JCCA 12E8L 4FQQA 5ESQA 1F11B 1FVDA 1WBYA 3O4OB 4WUKH 4PJEF 5TJWK 4JFOB 4LASL 4YNYB 5D1QA 5CEZD 1MFBH 1E27A 4PJHF 3PWVA 3HN3A 4I0PA 1GGYA 3CSPA 1T1WB 3SN6N 2P49B 1KN2L 1UB5A 3MR9B 5B21A 2X5PA 1I8KB 3BD3A 4KY1L 1RURH 4ODWB 1ZLUH 5D7IA 1JNLL 3C2AL 5JHDA 4X6DB 4KI1A 2CLRA 1OWRM 4KJWC 1NGWA 3MNZB 4OBSA 1P7QD 3TT1L 3TPUB 4CW1B 2ITCA 1H3UA 4NN6B 1V5JA 1CGYA 1OF2B 4FFVC 4NUGH 5IT2H 5BZWA 1T5WA 2EYRA 3KYMB 3HMXA 4FTVA 3SQOH 4Z7WF 1U8KB 5EBLA 2XNAB 4HW6A 4HUXA 5FM5O 5HDOA 3VWKB 1T22A 3EKCA 1Q9WA 4RGNE 4P3CH 1AQKH 4RISL 4YXHH 2W0PA 1U8IA 1RZGB 1KBGL 3BUYA 4J3SA 2Y36L 2FB4H 3ZL4H 1IMHC 2DKSA 2ZPKL 3GSOB 2D03L 1A21A 1EGJH 1QSED 2OQJB 4LQ1A 3UTSA 2MFNA 5FB8B 2R0WH 2R0ZL 3BWUC 2AK4E 5T1LA 3NACL 3E8UH 1ZVYA 2IAMA 4G6KL 5D70L 3H6JA 1TQBC 3QUZB 1NBVH 5IVXE 3BX7C 2ORBH 4ONHB 1CT8A 3O45A 3QUXC 5HGHB 5C0CE 2YBRB 3AY4A 4MMXC 1RUML 5B39A 2IANE 2W91A 1U8HA 5DTFA 1TNNA 2VN4A 3L3GB 3NFSH 4HX1B 5IW1A 3VRLE 1JPTL 3NCYP 4JPWL 3MRIA 1XGRA 5JQ6L 3BN9D 1F97A 3D0LB 5C0NC 3K8KA 5DEGA 1KPRB 3QFJE 3D3VA 4WY7H 2EE6A 2MNUA 3H7BA 2X6MA 1C1EH 2BSTA 3R1GH 4GG6A 4PY7B 3MRMB 43CAA 1LEKB 4JFZL 1T6WA 5CZVL 4RGNB 4QWWD 4HBQA 5TDOB 4EIZC 1U3ZA 3O6FD 2D0FA 3QH3A 5I76B 1PBYA 3GK8L 3P4NB 4L9LC 2MJWA 1WEJH 1D6EA 3TO2B 1LO5A 3STZA 4NHUA 4UV7H 1FFPB 2VLLB 4LRNL 1BD2D 1BFVH 1KCRL 4Y4HC 2AK4B 3FQNA 2X4PB 2LQRA 5DA0B 1J5OL 1NFIA 4NO0D 2DD8H 4Z76A 2WWMD 1RVFL 4RRPA 3UDWC 1JNHB 4BUGA 1A6UL 1MWAA 3KWWB 1Q9OB 1U8NB 4MD0B 3QO1A 4TPRL 4E5XA 2IANB 1HH9A 3SGDI 4GAYB 1QTYT 4XBPB 2HTLD 5F3HB 3QUXA 4ZAKC 5HJ3B 3N06B 4RAUB 1SBSL 4D9QE 4XI5C 2VAAB 4LLUB 5FHBL 4AENA 3QFJB 3MFGB 5E9DE 4C57C 3CH1B 5D7KD 4AEIL 4FFZH 3QHFH 4CDHA 3GMRB 4IJ3B 2DIAA 4PFEA 3RVTD 3VXPB 2VO5A 1FRGL 1AKJB 1DVFB 5F1KC 4GG8B 5HHPB 3DX6B 2E7CA 2FDBP 4K3HA 1T1YB 2NTFA 3ARVA 1EIBA 2BX5A 5HYQB 4HIIB 4PJ9A 2PXYC 3G5VA 1UVQA 3FFCB 3MLUL 2BRRH 1NCAL 3SKUD 2Q86A 1F3DH 3F7YA 4KWUA 1NGYA 5IHBA 3KLHD 3U2SA 3RZCD 2RR3A 3RWHA 4PJFE 3EOAB 2F53D 2XV6B 1NAMH 2X05A 2FLRT 3Q1SL 2H32H 4L9LA 4LSDA 3SKJL 4ZTOL 5ABDE 2VH5H 4K7PX 1H3XA 4KK8C 5L7XL 3IFOB 3WDJA 2UYLA 4Y4HA 5GGSA 4L4VE 2ZUTA 1RIUH 1ZLSL 5IFAH 3X3FH 3C6SA 2IPUK 4IHOB 1A7RL 3KPNB 2VZ3A 4ONFL 1EO8H 4M7KL 3TJEH 3UDWA 1CFBA 2V7HB 3NBNA 4GAJL 1VA9A 3LQAL 1Q8MA 1ZEAL 3NZ8B 4XPHL 1S3KH 2ZUVA 3F7VA 4QCIB 1YC8A 1KTRL 4R7DA 5HHNA 4P2OD 5I1KH 1I3RB 2CKBB 2NR6C 1MHCA 4YX2L 4F37K 2G9HA 4WUUE 5B39G 4M7JL 4FQJL 4O58L 1U6AL 4NFBA 1NUNB 5SX4I 3ZYJA 5L2KD 4N90D 1CFVL 5C0FA 5T33L 2VZVA 5ICZA 3BGMA 5EG6C 3VG9C 2A83A 2C3VA 2OTPA 1AGEA 3QIWB 1TETL 3FOLA 4HIXL 3C9NA 5F7YC 4PJFB 4YWGL 2LVEA 3HA0A 4P2RE 5HI4D 2PXYA 4OKVA 3RUGE 3T2PA 4P57B 2AJZA 1S78C 2AV1A 4NNPL 4HQQH 1Y18B 3UXFA 3IXAB 3UEZA 1B9ZA 1NSNL 4K07A 1DBBH 3RWGA 5T5NF 2AKRB 4L4VB 4EOWL 1DEEB 1MFEH 2R2CA 2EE2A 4M1DL 3QUMH 4OLXH 3LVEA 2CR6A 3B6SB 1PSKL 5GRYA 1S7XA 2JCCB 4NP4L 1JTOA 1F2XK 4F80A 1J1XH 3GMQB 4I2XA 3IDXH 3B9KC 4LIQE 4K7FB 3I6LE 5DJ2A 1A7NL 1CGVA 2FR4B 3OKMB 5F96H 1OAUL 2ZUWA 4D8PA 3BP7A 2IBBA 3PWVB 4WUUB 4YE4H 5C2UB 4D0CB 4JO2H 4QGYA 3CXHJ 4GS7B 1FVEA 3ARBC 4I0CC 5F7EL 4YIQB 4RX4D 4WTZA 3GJFB 2WINB 5D7JB 1K2DB 4IRJB 3P4OA 2VLKE 3TZVA 4P2RB 2G60L 4PJGF 3RUGB 4FABL 3FN0L 5J13B 4MA8L 5MI0B 4LSTL 2CIKA 1XF3B 2A77H 4LP4A 2D4DA 5EOCH 2GUOB 35C8H 5HHOD 5EBGA 1VGEL 3VFGH 2O5ZL 2DMBA 3T3PE 2NY1B 1XH3A 4ZOAA 4Q74A 5IBTL 1U93A 1UB6A 4GO6B 4NDMA 5CGMA 3SJVA 3UTTD 3OWEA 3U48A 1I7TA 4U3HA 2IMNA 2WV3A 3K8LA 4PUBL 4HUXB 3G5XB 3IFNL 5GSVA 4NFCA 4LF3A 4MGXA 2IALA 5CBEA 3GBNL 1MFCH 3QQ4B 4MLIA 3D2UB 1PQZA 5MHSE 2P8LA 1B6UA 1OWWA 5C07E 5AAMA 1Z9OA 1WC7A 4FQPA 3VXUB 3MGAA 3HRZB 5I15L 3C60D 1UT9A 3VFRA 4U1KB 3ARRA 3HZYB 3B9KA 3VXOB 4NNXB 4PREA 4NCDA 1D5IH 1AR2A 2ZSWA 4PJ5D 2EDXA 4M9PA 1MRDH 3THMH 3O45B 4G7VH 2AJXL 4F7PA 2VDNL 2UUDH 5IQ7H 2VLKB 2Q3ZA 3C6LC 3W9DA 3FT3A 2ZKHL 3K4DA 4HG4J 1RFDH 3ARBA 3VI3E 1JV5A 1N4XL 1A64A 3GO1H 4OZ4A 4XVTH 4X6CE 3MBEB 1YQVL 1EHLH 3DX9B 3H7BB 4GH7B 2DL2A 1YEGL 3QNZB 2P5WB 3EOTL 5SWZA 3GSXB 43CAB 4DZBA 3BEWB 4POZD 5I1LB 5C0JA 1IAKB 4JQIL 1UKQA 1Q9LA 4LSVL 2J5LB 4NWTH 4Q7DA 3LV3A 3UMTA 4WCYL 4HT1L 4XGZB 3QH3B 5TE7L 1NL0H 3HE7B 4L3ED 5I75B 5I1GH 3ZKSD 3MV9E 4JKPH 3TF7C 1CYGA 5CJQH 2BVPB 3A0OA 1NUGA 5GS2H 3LHPH 2VDKH 4JVUA 1TTFA 3RTQC 1OSZB 1KGCE 1HKLH 5JQHC 1MHHB 1G7JA 3VXQA 1NMAH 4K3DH 5DZOA 1BLNA 1MWAB 2EDDA 4JKKA 4NUJA 3VXRE 2IFGA 2YWYA 5EWIH 3BHBA 4F9LC 1CS6A 3CGTA 2IPKA 4XXDA 2LU4A 2XWBA 3PV6A 3S97C 4GKZB 2B20A 1FLTX 5BZDA 3QUXB 3VWKD 4U49A 1U8MB 3C6LA 5IOPA 4ODVL 1RUPH 1WWBX 2A73B 4WTZG 4HJJH 5HVHC 3FHQA 5IVZB 3RGVC 4LCWA 4WNQA 1JMXA 4CU6A 3BH8A 1I4FB 4YQXH 1XCQA 3VA2C 4K94L 2E9WA 4ONGL 1TTUA 5KOVC 3TESA 5IQ9A 3MV9B 1CU4L 3QUZD 4Q9QH 4MNQA 1NCCL 3K2MC 1F4AA 3NCCB 4HXAL 3OKNA 5TDNB 5AUMB 1UQSA 2QEJA 4L9LB 1E4XH 4R4FH 1FG9C 4N1HB 1X5GA 2H9GB 1RUAL 5CS7A 2XT1B 5BJTA 4JFFE 3GRWA 2DKMA 3VI4F 2BMKA 1UACL 3VXRB 1LE5B 2V17H 1HYSC 5K9OA 3VFWA 2YK1H 3C6SB 4WGWB 4AEHH 4R96A 5DUPL 5MENA 3BGAA 1JWMB 4UZGA 3W5MA 3TM6A 1MCOH 3DETD 5EZJB 1L9MA 1MVUB 1HHJA 4F9LA 4RGND 3F7VB 2OJEB 3OKDA 2H45A 4PB0L 4ZAKB 4Z7NE 3UO1L 5FYKU 4ALAL 4UT6L 2O5YL 3KGRA 1NDGA 1C5CH 1KPVA 4GMTH 2Q76A 1VKXB 2AK4D 3CDCA 1FCGA 2DB8A 2Q8AH 4CVXA 2VWEE 4PR5A 4EDWH 3RGVA 1AGEB 2XZAH 1Z2KA 4OLVH 1I1FB 4OM0H 3VCLA 3TV3H 2IFFH 1WFOA 3LQMA 3B2UC 4DAGL 3ULVC 4MWFB 5DJAB 3L5WB 1NCWH 4X7DC 1NC4A 3QSKB 4OV6F 5C0CD 5I1HH 3O0RH 4JM2F 1I7UB 2BSRA 3RY6C 5I18L 1OOAA 2OL3B 1Y0LA 3VA6A 1X6NA 3ESUF 4HLJA 1QKZL 1FPTL 4JFFB 1IFHH 3BD5A 3MCG1 4ZTPH 2CXGA 2AABH 3QFJD 5CD5C 3H0TA 3BIAX 3GDBA 4LBEA 3LKPB 4PJXA 5KSVA 4MCZA 1AKJD 1DVFD 4R90H 2ICWI 3T0BA 4HLZH 5I1EL 5IVNA 2QL1A 2YKLH 1J05B 1YECH 2P7TA 3IRPX 3MUZ1 1B2WH 1CWVA 3HFML 1NJ9B 3L7FB 1T21A 3L3HA 5DJ2B 1FL6B 3KYNA 1DEDA 2E3VA 4D8PB 3BP7B 1LILA 1TVBA 1NBQA 3SKOA 1I1AB 2RIKA 4Y89A 5DMYA 5EU4B 3J7HA 3OKOA 5AWNH 2UV3A 2DTSA 1QBLH 3QXAA 1CI5A 3PQYE 4QHNA 4Z77A 4ZDHB 2V5MA 1RHFA 3ULUC 2JJVA 4S1SL 5D9SB 4QRSA 2D7TH 4ORGA 3FQWA 3L5IA 2VR4A 1P5UA 1A2YA 3EZ8A 3EJJX 1OTTD 1IGJB 1LEGA 1W2KT 4WDIA 3L1OL 4K9EH 1RIHL 4JY6A 1IM9D 1XH3B 5EA0L 4NDMB 4D9QD 2ESVD 1P4IL 5E9DD 3RY6A 5DD3L 2EIEA 4BELD 3ARGC 4N0FA 2EC9U 3CLFH 3IDIB 2AJ3B 3QYCA 5EOQL 5D5MF 2JLLA 4HUNB 5GGTL 3RWEB 2EDHA 2CRMA 3BJLA 1S7WA 1VFUA 2PO6C 3QWOA 2BHUA 5HI5D 1NAKL 2KQMA 4P2YA 4P4RA 3OKLA 2G5RA 2EH8H 4LCIL 3VFRB 5IFHH 5DEFB 1KN4L 5D72L 5E8PB 5JHLL 4HF5H 1Q0XL 3I84A 1DQQA 1RUQH 3TJHC 4ZOEA 1A6WL 2E8ZA 1AGDA 2DS4A 3PQYB 3WFDH 3EDDA 1U8QA 1KIPB 3HG1A 5AZEH 4WW1B 4EKXA 3MRLB 2IWGA 4PG9B 15C8L 1DSFH 3FB8A 1EZVX 1NUFA 3EW3B 4L4VD 2X4TA 3ARBB 5EZOL 5IMLA 3EO1B 4A6YH 4AL8L 5HYIA 2B2XL 2G2RB 1EHAA 3NCFB 4JJ5B 4N9OB 1WV7T 5INDA 3V0VA 3JWDL 5FUCE 3VDBA 2R4SH 5F88A 4DGIL 2GAZB 1RZ7H 1CL7H 1TIUA 1S5IL 4F9PC 3N1QC 1P6AB 3G04B 3LV3B 1FBIL 3OB8A 1NCDL 2E8YA 2VSDA 3ARGA 4DKAA 1KCUH 3OQ3B 1JHKL 4XH2A 1FIGL 3D85B 1VCAA 4XB8A 3ZDXF 2DLFL 3KPMB 1T03L 2H26B 4OIIH 3CFJB 4LLDB 4P2CG 8FABA 1AE6H 2DQHH 5D7JD 2AJUL 1HN1A 3ARXA 4IRJD 2X42A 2BY1A 1WGOA 4K7PL 2PO6A 4LHUA 1J9CT 4P2RD 3BRFA 1YEKL 2WBJC 2J7LA 1B0WA 5E6YA 5IBLD 3MACL 1QR1B 2E6PA 3O9WA 4PY8J 4PRHA 4PJ7E 3ILPA 5LXGL 4OCYH 1BLNB 3EFDH 3RWFA 2HAZA 3BHBB 2IPKB 2GY7B 4ZNEE 1FFOA 4TNVF 3MUGA 4HXBH 4WVRA 3QQNA 6FABH 3FAXA 5BQ7A 5KVEH 5DO2C 3ORJA 4LU5L 3QT2A 3UJJL 4X7EC 4P9ML 5JXAL 3D2UD 1VENA 4A2MA 4LPUA 1B0GA 5J1AB 1PY9A 3UBXB 4LPYA 2PW1A 3I6LD 3QEGH 4M6NH 1T04B 1D3CA 1AGFA 3S88L 4Q9RH 3QDME 1XCQB 3VGFA 3RX7A 2BNUB 2DLTA 4F9PA 3V6OC 4M93C 4EI6B 3MRQB 4MNQB 1PG7X 4S1RL 1LO0H 1X4XA 2VLKD 4KMQA 1MHPH 4L8DA 2CQVA 1OP5H 4E0RA 2F8VA 4UTBL 3OX8A 3LMJH 2CLVA 2MWCA 1IC5H 1J0IA 1FLRL 2WUCL 3T1FA 5LWYH 4GBXA 1RZIA 2BMKB 3MBED 5CLWA 3EJYC 3MOAH 2AXHA 2OZ4L 5GRJL 3TYGL 2ZCHL 5FIEA 2WBJA 1K6QH 3RTQB 4M3JA 4XP6L 5J3HD 1P84K 3GIVB 2F5AH 1OW0C 4XNMB 5KOMC 1Q72L 1JFQH 4I8DA 2B39A 2DL9A 4H1LA 2YUVA 4R4NC 4HULB 5C0IA 2P46B 1CDCA 3KS0H 5DD0L 5F9OH 3INUL 1VFBA 5GZOD 5L9DL 4I18C 4PJCA 4G9FA 4IIQC 1R0AH 5MHSD 1N59B 1CIUA 3GSNH 3HE7D 3HRPA 4KVCL 5C07D 2KBGA 4TNWK 1KJ2A 3CSYB 3MLYL 4NC1E 4CJ0A 1KPVB 4KQ4L 2AGJL 3QDMB 4V1DE 5HYJA 1FVCA 4OTXL 1YN7A 3UZQA 4WEUD 4PR5B 2ED9A 1A6AA 4BFIA 5DRNA 1N8ZB 3PDDA 4PRPD 1EBPA 1A7QH 1WZMA 1HKFA 3QHTC 3LEYL 2H32B 2VITA 4PLNC 4ZXBD 4YBLC 2C4FU 4YDIL 5HDBF 4FQXC 1TJGL 3V6OA 2CDFA 1FGVH 4HGWA 5FHAL 5E08L 3TGXA 4R97C 4JG0H 5TF0A 3UYOD 4IOIB 4NQEE 4HUUB 2APXA 1Q94B 2LAGB 5AYQA 4MNHA 1QFPA 4W70A 4YGVA 1I85C 5KSVB 5DYOA 4JB9H 3EO9L 3NZHL 3T0EC 3I02B 2IQ9L 3L5HA 2BNQE 3TO4C 3BESR 1WAAA 4LHUG 2JB6B 2N4IA 3SE9L 4XNQB 5TH2A 2AJSH 4KKAC 5ALBH 3HR6A 3SDCC 3KYNB 4OB5H 1UYWL 4HH9B 4NN5B 2NY7H 4OLWH 3MV9D 3QULA 2HJFB 5F71A 2A0LD 2VLJB 4KJPC 3SKMB 4I18A 4V1DB 4NGHL 5HD8C 1F4XL 4NHCH 4IIQA 5DK0B 5FA3B 4FQ2H 3WE6A 4F15C 4MQTB 2D0GA 4MAYD 3LKQB 4Z77B 1U3JA 1U92B 1KGCD 4JG1H 3IJHB 3TVMC 2JKXA 2HVJA 1FQ9C 1ZHLB 1MCKA 5E56A 1MCWM 3VXRD 4K3JH 1RJLB 1BFSA 3GFUA 1SYVA 4GLRH 1T2QL 1TPXB 3X14A 3D39E 4Z7QE 2IPUG 1M05A 4XNYH 1OAXH 1UZ8A 4XWOC 1KOAA 1XR9B 5FEBA 4AEEA 5DD5L 1ND0A 2VERN 4R3SB 3IKCA 5EUOB 1JYVA 3RNQA 4NQEB 5E5MB 3PP4H 1T7WA 3UYRL 1ERNA 1KFAH 3DGCR 4DVBB 3K2UL 3QUMB 4FQXA 4OCRH 4PRBB 2XFXA 3EYSH 3ZE1F 4AMKH 4GW5B 2XN9E 5CCKH 1ZT7A 1HQRB 2WBWB 1BWMA 2BNQB 4J3TA 4Z7OE 1G6RA 1TDQA 4TVPL 4ISVB 3LEXB 3PWLB 3F7RA 2Z4QA 1D5BB 1WF5A 4RGMB 2HMID 1I85A 5A43C 3WHXB 4TVSa 4O2CA 5EB9A 5HYSA 3TO4A 1A5FL 1IGCH 1W72L 5FFLA 2OTUA 4KI5D 1WLHA 1V3KA 1AGBA 1QHPA 2BVOA 1MVFA 3UAJD 2WQRA 4Z7UA 2CK2A 4ZOBA 1UJ3C 3VFOB 4WV1C 4FG6D 4ODBD 1H9VA 3JV4A 2LU7A 4JFFD 3C8KA 5LQBL 3QXVA 2V7NA 4Z95L 3QIBC 3I75A 5ID1B 2VL4A 2XYCA 3P2TA 5IMLB 5E8DH 3D39B 3GSWA 1KSRA 4GAGH 4PGDA 5TGBA 1WCBB 1OM3L 5CSGA 3V0VB 3WS3A 3TVMA 4ZS6D 3BRGC 1F8TH 2X4QA 4XX1E 4OZFA 3WNOA 1S9XB 2J6EH 3DECA 4LHQB 3F65A 4JKMA 4X5WA 5KG9A 3GEWB 3RDTD 3WNLA 1UH4A 3U9PL 2XN9B 3CCHB 3BW9A 1YZZA 1QYGL 4MXVF 4F3FB 1QLFA 1QZ1A 1Z0MA 4ERSL 5I19H 1G9MC 3BZEB 1I1AD 2QADB 3MLTB 1KTLA 4HHAB 1YJDL 2YOCA 2OLDA 3ZZ1A 1UM5L 1MIEH 2H6PA 1KJMA 4Y19E 1YMHB 1EHXA 5ILTL 2H3NB 2HKFL 4XC1H 2F74A 1FG2A 4IRZL 5FYJH 1FNEA 4U2ZA 4LVOC 3KPLA 4OT1H 1FL5A 4JGJA 4LHUB 1CK0L 3I50H 1EFXA 1YEIL 4NM4L 2JJWA 2GJZB 3UJTL 2ARJB 3ILQD 4PRHB 1EVTC 3ILPB 3QXUA 1NGQL 2PW2B 3EYOB 3QZWA 1G7IA 3BKJH 4I5BB 5E8OA 1QFUL 3QQ9D 3WS6C 4U6XB 3PGCB 1R5WB 5DMIH 4YZFE 1LMKA 3V8CA 5DVLA 3AFLA 4V2CB 4WV1A 1GL4B 2Y9RT 3OAUL 1ZSDB 3HPJB 4Y2DC 5CILL 4DUVA 2HWZL 3QIBA 5FF6B 1BBDL 4LASH 4UMGA 4ZUSB 4ZUTB 4OGYL 1UXWA 4ODHH 2ZOLA 4P49A 1LNUA 1B0GB 3RVWC 5TQ2L 1KT2B 4QNPF 1MJ7L 4YXLL 3IDUA 3AU1A 5KN5A 1CGSL 1IGIL 4KY1H 4FXGA 4QRQA 1NQBA 5D7LE 2W65B 1PZUB 5BVJA 3C2AH 4PRNA 4LSUL 4Y19B 2XY2A 3PQYD 2AP2A 3OG4B 2ITDB 3TT1H 5EUKB 1KELL 5DMJB 4OZIF 2RFXB 5GGSY 2YZ8A 1NH6A 3ZE0E 3M17A 4OLYL 4HFWB 1KJ3H 3D9AL 4CDGC 2CLVB 5I66A 1DBKL 1T0MB 3L9RB 2EZ0D 4G43A 2J8UB 4HV8B 4QT5A 2WBJB 5EOTA 5D1ZC 2EIZB 5HYSG 2ADFH 3WKNA 4RISH 4NPYA 3T8XA 3DO7B 4MX7A 1I8IA 2DQCL 1KBGH 3WS6A 4WI5A 4C55A 2ZPKH 1CFNB 1MFAL 2D03H 3Q48A 3MRGA 5D2NC 4QHUB 3DXAE 5K59E 3MV8A 2H2PD 3CXHK 1KNOB 1KJ2B 3MX0A 3GGWA 3L3IA 1U8JA 2WMPA 3D85D 4Y2DA 4UI2A 5EBMA 5CJBA 5DJ6A 4Q9CA 4GKNA 5D70H 5CP3A 2OR7A 3T08A 1LK2A 4HPYL 5B4MD 2BCKB 4QF1A 4QRUB 1F6LL 1RUMH 1A6AB 3LZFL 4OZFG 3CK0L 3SE8L 1JPTH 1KTDA 3OAZH 2VITB 4JPWH 3MREA 1HEZB 3TCLA 1T0NB 5JQ6H 1PY4A 3KPRE 2CDFB 3P77A 4CU7A 1DBJL 3G6AA 1RMFL 1KEGL 1FC2D 1JWSA 4RAHA 1XGTB 2RJMA 3FB6B 1GSMA 3AMLA 3DBXA 4B0MM 3B9VA 3VXSE 5IVXF 4JRYA 2E27H 1JRHH 4JFZH 1FZOA 5CZVH 1NFDE 1ETZB 2GW5A 4L3CB 3BJ91 5A2KH 2EDJA 3GK8H 3VRLF 3CFEB 3SE3C 5L8LB 4YUEL 5F6HJ 2D3VA 3ROOA 5D1ZA 4DGVL 1T1XA 3VGEA 1NGXA 5K9KB 3IU4H 4UDUB 5ITBL 3DXAB 1AO7E 2X4SA 3QUKA 3QZWG 5E7BA 4LRNH 1BOYA 1M7IB 1KCRH 4L3AA 2IC2A 5IB2B 1J5OH 4QRRE 1MHEB 4APQB 1J8HA 5TPWL 4OD2B 5TE6H 5D2NA 1HOCA 3WE6B 2R2HA 1RZ8B 4XP9L 1I1YA 1UEMA 3QDJA 3UP1A 2O93L 2GSGB 1UWGH 1S9VB 5JORA 2K7PA 1BQHG 2HG5B 2C4XA 4PLJC 4YBQC 4JKLA 3KPRB 2E7LC 2ADGA 1ZGLB 1NLBL 3VFMA 4WI4A 5FHBH 4O4YL 3HPLA 4HC1L 3O8XB 5CMAA 5HDQH 4OSUL 4AEIH 4RFEB 5FM8A 2J88H 4O2EB 5JLZA 1FRGH 2HVKB 4P2QE 4PS4L 1MQKH 3FZUD 3KPPB 3MOBL 5BRZA 4Z78B 4ZO6A 1LO3L 2Z35A 5BXFA 1QBBA 2MCG1 4M5YL 4U0RC 3MLUH 1UG9A 2Q7YA 1CZ8L 2QR0A 5GPRA 3QDMD 5ETUA 2Q6WA 1I75A 5DVOA 2JJSC 3GSRB 3T0EB 4O2CB 3HC0A 5I17A 5HYSB 5IUSA 3IAGC 5ICXB 5ISZA 3Q1SH 4DGYL 2X89D 3LSOA 3SE3A 2OTUB 2B0SL 2QQLL 4QRRB 1XF4B 4ZTOH 1AGCB 2V5SA 5IKCB 5L7XH 3V9FA 4XMPL 3SDCB 4NC2B 5IM7B 2Y06L 3V79C 4JFQA 1FL3B 5CINL 3BH9B 3O11B 5BS0A 2HFGL 1G7HB 1FO0L 4OZHF 2V7NB 2BVYA 4MNGA 3RVUC 4J2XA 1A7RH 4ONFH 3PIQA 1ZK9A 5E95B 3FMGL 1NMCC 1ZEAH 4XPHH 2F8XC 4OZFB 5KAQF 3EYUL 3U79A 4NQVB 1IQWL 2E7LA 1I8LC 2VISA 4P2QB 4YX2H 1T66C 5KG9B 2P45B 3I85A 2KKQA 4M7JH 1JN6A 4FQIL 4FQJH 4O58H 1U6AH 3CVHL 2CDGB 1CFVH 5T33H 4QHMA 4ELME 4QRTA 1IZKA 3VE0B 2XZZA 4ZUWB 4V1DD 2WAHA 1TETH 4HIXH 1HI6A 4KKLC 3SKNB 2H6PB 4YWGH 3RU8H 2R1XA 4N0YL 4UU9A 1QFWM 5E8NB 1CCZA 4OFYA 1FNEB 5AZ2H 3ARZA 1A47A 5FM5M 4YK4C 5JHDE 5DVKA 3KPLB 5T3ZH 1E4KA 1NPUA 5DDHA 4NNPH 4PGEB 3FT2B 1NSNH 1ZA3B 5A16A 4JFDA 4EOWH 3U0WH 1CGTA 1P9MC 5HHME 2HLFD 2GTZA 4NQED 1FZJB 1IGYA 2RHEA 5E5UB 4M7LT 4KK5C 1UJ3B 3B5TA 4FTVE 4WV1B 4NM8H 1FFNB 1K8IA 2IGFL 5CZXD 4HJ0D 5E6ID 1CFTA 1INQB 4OJFL 3RWCB 2BNQD 5ACZB 3PGFL 1A7NH 4LDOB 43C9A 1BQHB 1OAUH 4WHTA 1P4BH 4YPGA 1ZLVK 2NY3D 3DUSA 4U1HB 5FO8B 5KW9L 5JPNA 2NXZD 1ZA6B 3TNNA 3QFDA 4KRNA 2DIJA 2PN5A 4ELMB 5F7EH 3TBVA 3VFSA 1I8LA 3Q6GL 3QCTL 2MQCA 4HJGA 3UTSE 4PJBE 3T4YA 4EI5C 1GYAA 2PNDA 4Y1AB 4DQOH 4PJ8C 1A4JB 4ZFOA 1EAPA 2G60H 1KLGA 3KJ6L 4FABH 3FN0H 3O3EB 5F7MC 3BP6B 4MA8H 1R24B 2PETA 4LSTH 4RA3A 5J6HA 3H8NA 4RMSA 4MCYA 1HDMB 2O5ZH 1H3GA 3GSQB 3M17B 4Y4KB 5IBTH 3D39D 3CMOL 4H5SB 4JHWL 3DO3A 4PGBA 5M94B 1NEZG 4PUBH 3DX8B 3ZT7A 4KC3B 3TFKC 3IFNH 3LCYA 5EC1B 4HDIA 4BK5A 4NQXB 1K8DB 3D48R 3GBNH 1D5MB 3M1BA 3ALXA 4GG6E 2XN9D 5DD6A 2EIDA 3RKDC 1P9MA 1Z9LA 3EDFA 3MRGB 4JO3L 1T0PB 5I15H 2QADD 4WW2F 3T3PF 2Z8RA 1DQML 4Y2DB 1PX3A 5EBMB 4PBVC 1MLBA 4FFYH 5SX5K 5I74B 5DMGC 1JP5A 2DBLL 1R6VA 1J1OH 3LN9A 3OAYK 4LDEB 4HUWA 2PKDA 3VH8A 2VDNH 2I07A 1I9EA 1GOGA 1CLZL 3AM8C 1JGLL 4DK6A 1V3LA 2ZKHH 1ACZA 1O0VA 1KTDB 3N85L 4Y8DC 5IMKB 4F7CB 1N4XH 2ATKB 2YZ1A 3G6AB 1YQVH 3QJHB 5I8CA 1FYTD 1ZVSA 4YLQT 1FZMB 2ICCA 1YEGH 2EDWA 3PGDA 4YO0B 3EOTH 3DHJA 1YMME 1F42A 5DK3A 4JQIH 5B8CB 4PJAF 1G7PB 4WCYH 4HT1H 5HHXH 2LFGA 4OUUB 4OCXL 4RMUA 5TE7H 3QRGL 3HHRB 4UT9L 2HTKC 3GSNB 1XR8A 3CUPA 4Y0GA 3CPLB 1CDGA 4ZO7A 4MXQD 1I9JL 2OR8A 1HHIA 4MAUL 1EDQA 4Y19D 3TBYA 3FB7A 5GS2D 1I9IL 3QEUB 5B3NA 4POYA 3OGCA 3RVVC 3QJFB 3HUJF 3MODL 4URTB 1DE4A 5DURB 2QKIA 2I26N 4XVUC 5E00A 3W0WD 1U3HB 2VC2L 4M1CD 3O4LA 2LE9A 5DUBA 3JV6A 5FGCE 3RBSA 1CE6B 1TVDA 4ODXB 4UBDC 3VFMB 3W39B 4PJDF 5FGSA 3AM8A 5J9PA 2D7OA 3HPLB 4ODVH 1CN4A 1MCHA 5HVWA 1EXUB 4ZNCD 4WFHE 3P0GB 2NY0C 1YMMB 4HIHB 1H0DB 3L5JA 4H1LH 4QY8A 1W0VB 5HPMA 3GHEL 4IDJH 4P4KD 5M95B 5CP7A 2Z35B 4LOUC 3U36A 4U4BA 2R8SH 2DQUL 4CJ1A 5F89A 1QFWL 2D4FA 3MO1B 1CXIA 1YPZF 1ZTXL 2QR0B 1NEZB 2X4NA 1CU4H 1MPAL 5D7LD 2EE3A 3H9SA 1NCCH 4FXKB 4TOYL 1FNFA 3HC0B 4HXAH 3BDXA 3MXVL 4CMMA 3UBXI 2JB5L 3T0WA 5HGGS 3ZYZA 3GB7B 1VSCA 1FJ1A 4WHDA 2DWEA 1JZ5A 3LQAC 1A9BB 4JFQB 4GMSL 1PEWA 1UACH 4KROB 1U8LA 4PJIA 1NDMB 2X9YA 1Q9KB 2EDTA 3DVGA 3ZYIA 1N3NB 1HSAB 4J12A 5MERA 5I0ZA 1E4WL 5FGCB 4KI5F 4X5XA 2OSLB 4H8WL 4P46B 4U1GC 5SWSA 4OFDA 3HC3H 5J7CC 4PB0H 3UO1H 2WQ8A 4M4RA 5EO0B 1QLRA 5GSRA 4ALAH 3QEQA 4UT6H 2O5YH 1QRNA 5K93A 5JTWA 1HHGB 3DVNA 5C0DA 4JQVC 3WFEH 4CADA 4JFHE 1OGTA 2FBJH 4APQD 4CVZB 4HFUL 2P4AB 5J0BA 2GT9B 2IQAA 3S5LB 5F3BB 3OXRB 1H8NA 1M7DA 4OGAD 3I9GL 4NQCA 5FYJE 1A3RL 3U9UB 3OJDA 4U0RB 5GS0L 1S7UA 4PRIB 4HZAA 5I18H 1WFNA 3CZFA 1OQXA 3EHBD 1K5NA 1YEEH 1QKZH 4LHJB 1FPTH 1NBZA 4MQ7A 4QYOA 2YR3A 3KPRD 4H0HB 4PJEE 1VADA 4JRXE 4EUPA 1P2CB 3U1SL 5HGBB 4F7MB 3W2DL 4NO5B 2AVGA 3O8XD 1JGUH 5HI3C 3ES6A 4PJHE 4KK9C 2P43B 1UWXH 2Z31D 1WBZA 4RQQB 5DJ8B 3VXSD 5I1EH 1ZLWK 3SJVE 4KQ3L 3HFMH 2VDOL 3CMGA 2AI0L 4S2SA 4DVRH 3QBTB 1X44A 3IFPA 4I48A 4NRXA 4MHHG 5DQJA 4RDQG 5BOPA 2HH0L 4P59H 3T2QA 5D6DA 4GSDL 3RL1B 5DQ9B 2O61B 1I1CA 1NMCB 4HIJA 1AO7D 3WIIH 5E94A 1OCWL 2BFVL 2YUWA 3ELAT 1MFBL 4HWBL 4Z0BL 4QRRD 1JHTA 4HJGB 5DHVH 2VDLL 3PWJB 1TVHB 4S1SH 4HK0B 1CXLA 1KJVB 2BNRE 2W9LA 2D2OA 3GI9L 2KL6A 3HZVB 5DHYA 2MKLC 4JQVA 1RZJL 2ZCLL 2PTTB 5CD3A 4MCYB 3CFDB 4P0DA 2NW3B 2R39A 4JPKL 4PJEB 4JRXB 1H5BC 4LCYB 1P4IH 1HQ4A 4PGBB 1KENL 4P23D 3Q2CA 3VW3L 5C70A 3L6FB 3PL6B 4PJHB 3ZTNL 5BOZG 1RJZA 1KPUA 4P2QD 5EOQH 3SQOL 5IFJA 1MI5E 1CLCA 5GGTH 2ADJB 3QG6A 4EVNB 1KIRB 3KXFA 5DD6B 3EUUA 2BC4A 2V2TA 1G7LA 1A4KA 2NX5E 3UPRB 1NAKH 4Z7VF 3RJDA 2XTLA 3NCEB 4LCIH 5JMRA 1YEHL 5LGHL 4KRPB 5JPMA 4KTDL 5D72H 5JHLH 3ZL4L 1Q0XH 4YHKL 4LFHD 1ZS8A 2FZ3A 3ARFC 4GKSB 1NGZA 3S37X 1J12A 5A3IC 1A6WH 4S1DD 1UADC 4YH6A 2BHYA 2NXYC 1XIWC 3E8UL 4Z7WB 2I07B 5F9AC 1VFOA 3JV5A 2OI9C 15C8H 2BNRB 1JGDA 1NBVL 2FEEI 2ORBL 4WEBL 4DOHE 5GQBA 2PYEE 5EZOH 3KPOA 2B2XH 3DURB 4EI5B 4QOKE 3BE1L 2DAVA 4N5ED 2X1OA 3JWDH 4PJ8B 3JWOC 5I8CB 4GJTB 4F57L 2Z93A 2FO4B 2QQNL 4JN2B 4DZ8B 1KLUB 4DGIH 4JKWA 1N7MH 1IL1A 4E41A 1ZHNA 3V6BR 2KDGA 4YHYC 4JAMB 1S5IH 1AD0B 1Q0YL 3W82A 3H3BC 1MI5B 1H5BA 1FBIH 1NCDH 1PKOA 1KYOK 2SEBB 4DTGH 1SQ2N 1OAYH 1GZQA 1MH5B 3I6GA 2NX5B 2FWOA 5LAXB 4Y8AA 1JHKH 2PTVA 2DLFH 4FQCL 4XBGA 4J3OC 1T03H 2FECI 4Q2ZB 4EUPG 4ETYA 3STBA 3TA3B 3HI1B 1BMGA 2AJUH 4K7PH 4DFHA 4HCRA 1YEKH 4N1CA 5DRZB 3MACH 5E6ZA 4Z5RA 1MCFA 5JHDD 5LXGH 1BBJB 4TULH 3VRIA 4HPOH 1BZ7A 5DZLA 3F58L 4OZGF 3CC5A 4LLYA 1FORL 1YA5A 3ARFA 4Y4KD 4PTUA 4L1DA 1MFNA 2C3HA 4DOHB 1T2JA 2PYEB 2CO6B 5GIRA 1A6ZA 4LLMA 3LS5L 1XIWA 3FQXA 5HHMD 4QOKB 5IG7A 1PDKA 1KCKA 3CDGB 1XEDA 4LU5H 5J9PB 1NKOA 4K94C 3UJJH 4P9MH 2D31A 4FTVD 5EN2A 2NY2C 5MENE 1IC4L 4O00A 5T5NG 5LG1A 3EDEA 1H15A 1UM6L 3MRFA 3S88H 5CP7B 1IT9L 1IGTA 5DI8B 3TNMA 5DJXA 2ZWLT 5F89B 4MVBC 2YHGA 2IADB 5KS9A 5FA4B 3U4EA 2UVFA 5INCA 1NC2D 3HS0A 4HKBB 2HJLB 4BSVA 3MNVA 3UTSD 1DANT 2BRRL 4CRPA 4S1RH 4L5FH 4XHJD 1PFCA 4G6FB 4M5ZH 4TQEL 2ADIB 5D2LA 4TUOA 2UWEF 3EFFB 3U7YL 2IAMD 1R5VA 2NYYC 4MS8D 5DFTA 2Z91A 1PYWB 1NAML 1F00I 1J1PL 2QHRL 4UTBH 4Y88A 2WUCH 4P5KB 2OZ4H 2VH5L 5GRJH 4Y4FC 5LGKA 2P8PB 4XP6H 5A2JH 1ED3A 1JVKA 2R1WA 3MGOA 5FK9A 5MERB 1Q72H 3B5GA 4OFPA 3GUTA 3TYFA 3OF6A 4KJWD 2GK0A 3X3FL 5IFAL 1IGMH 3WXVH 3IDMA 1CD9B 5DD0H 1U8OA 3INUH 5GHWL 5SWSB 5L9DH 2K1MA 3D18A 4OV5A 2DM7A 3D69A 4K2UH 4IDLA 3P4MA 4X9BA 4KVCH 2GY5A 3WL9A 5C3TA 3WNPA 1MCBA 3NIDF 3MLYH 1WFUA 3GSVA 25C8L 3VRJA 4C4KT 1MAML 4KQ4H 4PGCB 2OJZH 4M6AA 3SDAC 1AD9A 4OTXH 1N2RA 2FJHA 5F6IC 4CNIA 2ZJSL 4NKDA 3V0WL 1OGAA 4JFEE 4CADB 1L7IL 3MCLL 4IRSD 1CVSC 5FECA 5DRWA 1K9TA 1I7RB 4U1LB 4YDVA 1K3IA 5C08E 3L3KB 4Y5VC 1WBXB 2AXFA 3AS3A 1U3HD 4J8RA 3S35X 1TJGH 4YHIA 4LCUA 3MNWA 5FHAH 3HCVB 4JVWA 1LK3L 2XACC 1IAIH 2D7QA 3LQZB 3ES6B 3O41A 1QSFE 4K71C 3EYQD 1OT2A 1X4YA 1E4XI 5ELIA 2IQ9H 1YMMD 2FX8H 1WITA 4Y4FA 3SE9H 1BVKB 4U31A 1CE1L 1S7TB 2VR9A 4X4MA 1R5IB 4QTHB 4NRXB 1EEYA 1DFBL 1UYWH 4PJGE 1G9EA 1WZ1L 4L8SC 3RIFK 1VPOL 2KZ1B 3ARTA 2KUTA 3I2CL 4HIJB 4PJ9D 4NGHH 1E0OB 5CBAA 3H7LA 1F4XH 5F96L 3O2DA 2GTWB 3LKRB 3RZWA 3QWRD 4MSWB 1YY8A 4YE4L 2ZG2A 3KG5A 1JHTB 2ZOKA 1XGQB 1IKFH 1PG7W 3SDAA 4WTWA 3REVB 3VXMA 3O6LL 2IH1A 3ZTJG 4YHPB 4K8RL 5C08B 5IV2A 5DF0A 1OB1B 4KROD 1T2QH 2DICA 1WWWX 3QXDB 5GRZA 2F54A 1JWUB 2CIIB 2I9LB 5F1SA 5DD5H 2W0FA 1J0HA 1BOGA 4Y5VA 1HQ4B 35C8L 3K2UH 4P46D 5E2JA 3WIHA 1QSFB 2KPNA 4NCC2 1QO3A 1CXEA 1KPUB 3IETB 4WFHD 5C0EB 2NQCA 5JOPD 3TH2T 5IW6B 4TVPH 2C7UA 4XNZC 4FMFA 4LLQB 3NPSB 3RAJH 3DI2B 4YR6B 4EJ1C 3WKMH 5FOJA 4MQSB 4TUJB 1XZ0B 4X6EA 5F1NB 2WIIA 2WANA 2VQUA 1A5FH 4PRDA 1W72H 5E8EB 1PJ9A 4NYLA 3O3AA 3ZMRA 2VE6A 3LPWA 2XIDA 1O7VA 5L6YL 1S7RA 4L8SA 3BN9C 4G7YH 4EN3B 5BV7C 3MMEB 2EYSB 4Z95H 1WIUA 4JFYB 4UIMA 1P7QA 1G7QA 3THML 3SDYH 3U0TA 1JK8A 1V3JA 5IQ7L 2YPKA 3U4BH 3BEVB 1CXHA 1OM3H 2D7MA 2W1NA 3BPLC 3Q3GB 2WZPD 4KXZH 2ICES 4Y16D 4QWWC 5AG9A 4XPFH 5CJ5A 3MLPA 3TBSA 1XCTA 3O6FC 4YAQB 1AQDB 3U9PH 1TJHH 3G5YA 1EHLL 1HK6A 4P5TA 1RU9H 4XRCA 1XF2A 1QYGH 4WU7A 2HYMA 3BXNA 1H5BB 4N0UE 5IROC 3V52L 4ERSH 5KSBF 5DJYB 5JZ7D 3TBTB 2DWDB 1YJDH 1R3HB 4WO4B 2FWOB 5D93B 1UM5H 4NWTL 2FJFA 2WWMC 2BOBA 4JFHD 2G5BB 5ILTH 1QSEA 1BQLL 2HKFH 4G8IA 4IRZH 3NFPA 3EO0A 2AQ1A 2J4WL 4M7ZC 4NM4H 1YEIH 1AC0A 4L8BA 1ROWA 5BCAA 4YHML 5IK3A 1CG9B 2I9TA 4TRPL 4ZYKA 1NGQH 2HTLC 5FKAA 2CGRL 1BZ7B 4M6ML 1QFUH 3TZVD 3ARPA 3ARFB 1HKLL 4L8CA 4JRXD 4WI9A 3FRUB 4ZQKB 1CFQA 3IDYB 3PL6D 2NXYB 3MPCA 2H2SD 3RVTC 3OAUH 4BFEA 2KQNA 2A6KA 4UQ3B 5CILH 3SGEH 4TTGA 1BBDH 3DX7B 3AAZA 3SJVD 5HHQA 5IHZB 4OGYH 1K4DB 4Q97A 1MJ7H 1GRWA 5J6GA 4YXLH 1RUPL 1SJEB 2CDEA 3KLHC 3RZCC 5ERWA 3UROR 2WLZA 3MRNB 1WIPA 1IEAB 3OXSB 4KRPD 3O6FA 4ZPVB 4M8QA 5JW4Q 4H25B 4LSUH 4YQXL 3VI4E 1DBML 2XTJE 1T4KB 1CL7I 2A9ML 3QDGE 4R8WL 5IROA 1A1MA 3JTTA 3S6CA 1BD2A 1AC6A 1KELH 1TCRA 2BVQA 5H35A 1SJHA 2BNRD 1WT5A 4NO0A 2MHAA 3P9LA 3WO4C 4OLYH 1SY6A 4YDLC 2FYYA 1LP9A 3BIKA 1DBKH 3CVIL 3UTQA 2EKJA 2XWJA 5JO5A 2AXJA 5EBWB 6CGTA 2I5YL 4P2OC 2V17L 5IB1A 3IJSB 2DQCH 1JF1A 4P9HL 3GUTB 1N5AA 3QIUD 3C5SA 1BJ8A 1LO2L 1MI5D 3D18B 3ROLB 1CDJA 2W60A 3C5JB 1XT5A 3G6JF 2NX5D 3GJFK 4UUJB 2VXQH 5DC0A 3ARWA 4YFLI 1MELA 1RK1A 4POUB 3L3JB 3TA3D 1AD9B 3OB0K 5HI4C 2A9NL 1U2HA 3OTTA 1BIIB 2IH3B 3RWDA 2VABA 1F90L 3RZCA 3LZFH 3CK0H 5FECB 4G8GE 3SE8H 1J0JA 3QDGB 4DJMA 2GJ6E 4C59B 4YHNA 2XZAL 2WP3T 3V5DA 1XF5B 2XICA 3BT2L 3E6FA 4YHIB 1NCWL 5GS1C 1RMFH 1KEGH 3E3QE 2ICWA 1LE9B 4QOKD 1H3PH 2D7NA 3CX2A 4LSPH 2X7LA 1N26A 4CMHB 4ZTPL 1PLGH 2AABL 5F7FA 1QHOA 4YUEH 4DGVH 1E6OL 4R90L 1N0XL 4M02A 5ITBH 4KUCF 3HR5B 3QDAA 3V4VL 2YKLL 2CRYA 4P2OA 5DZNA 1OT1A 1B2WL 4O02L 3S37L 3VXTB 3BP5B 4ZFZB 3JTSB 3PWPB 3WDIA 3N0PB 1QVOA 4JM2B 3VG0L 2I25N 1LDSA 3HNSL 2BOCA 3KPQA 1A6TA 2UZIL 5F7LB 2QTEA 1G6VK 3NGBC 3SO3C 1CFSA 4XMKL 2M2DA 4XP9H 3PV7A 5AWNL 1DDHA 1ODAA 3T65A 1A7PH 4G8GB 2DQIL 2GJ6B 3PJSA 5IV2B 4KKBD 3AXLA 3W81A 4QXGL 2YA1A 5E70A 3E1F1 1MAJA 3DHMA 2J2ZA 5D5ME 2XKNB 1JNJA 3VD4A 4O4YH 4HC1H 4OSUH 2AK1L 2O26U 3SDXF 2P8MA 1T1ZA 2EKSB 2X40A 1BFOA 1GC1C 2COQA 3LEVL 4K9EL 2VLRA 4PS4H 3AGVA 3MOBH 4XCNA 1LO3H 5GRVL 5MEND 2A38A 4LPVA 2B8OT 4YHZL 4X7FC 1BAFL 4M5YH 5IIEA 1CIDA 3C60C 3FO0L 3HC4H 1CZ8H 32C2A 3EJZD 2X09A 4K71B 4WFEE 1VACA 4WIQA 5F7DB 1DR9A 4DGYH 2DTML 2E6QA 1A8JH 1Q1JL 4NJ9L 1RJCA 1UXSB 5DSCB 4MJIA 3KR3L 4XMPH 5HTSA 3VGBA 4IOFD 2Y06H 3FO2A 5DHVB 3RGVD 3O2WL 2FO1A 4HF5L 1CGXA 4HD9A 4RX4A 3U6RA 1S7RB 3ZKND 4P5MA 5CINH 1FO0H 3OZ9L 3MYJB 3WFDL 1G7QB 1V7NL 3V5KA 1CXFA 5D5MB 4PB9L 3O4OC 3M8OL 1DSFL 3FMGH 1YEDA 5HHOA 1NBYB 5E2VL 2VDQL 4POZC 3O3DB 1IBGL 4JFPA 1ZE3C 4A6YL 2M1KA 5EU6A 1RY7B 3EYUH 4NN7C 4KTEL 3KDMA 3UTTA 3ZDXE 1S5HA 1IQWH 3PDGA 4FQIH 3TN0A 2E7HA 3CVHH 2R4SL 3HLAB 3QA3A 1UH2A 3DUUB 4GLRI 5HYEA 5LJYH 2Y72A 1X9QA 5LGJA 1X3DA 2QLVB 3MCKB 4MZ2A 4DUXA 5D71L 5DMKB 1KF9B 4RWYL 3OR7A 2BOBB 4JFED 3E6HA 1ZHBA 5JW4R 2IBZY 4R7NA 4TUKL 4NN6C 4WI6A 4LLWB 4GXUM 4XNZB 2CR3A 5DC4B 3PP3K 1M1SA 2JCCF 4JHBA 4U7KA 3MUHL 5C08D 4PJ5A 4BH8A 5T3ZD 1JPSH 4L4JA 5DK2A 1KCVL 2FX9L 3MGTA 3WMSA 2I9TB 3FQTB 1FZKA 3DV6B 5KSBA 1YDPA 3CDFA 3VWKC 5D1XB 1BF8A 3DV4A 3DIFB 4L8CB 5EPMA 4G8EB 3IDGA 3HI6L 1LEIB 1AXSB 3FQUA 3RHWF 4XZUB 3X13A 1ZKAA 4AIZB 1N6QH 1QSFD 2FHCA 4HEME 2IGFH 2LTQC 4XPTL 4OJFH 3C08L 4HXBL 5D7IF 3B8YA 3MLVL 3HMXL 4DKFL 2F9BT 4LLAA 1F11A 4D0BB 2HFEB 5KW9H 2P24A 4JFOA 3BPLB 5C9JB 3QUZC 4IEFB 3ZT5A 3T0DA 1BPVA 3RX5A 3O6FB 3Q6GH 1T1WA 4NNYB 1EZVY 4KFZC 1KB5A 3MR9A 5ENWB 4M7LL 3LOWA 4XCCL 1JF5A 1I8KA 4Q9RL 4ODWA 3KJ6H 3KAAA 2EH7L 1A1MB 1VESA 4EN3D 2GEEA 2BVQB 3MV7E 4X6DA 1YN6B 2PCPB 1SJHB 3MNZA 1DQLL 1FFQA 3CFKB 3P9LB 3QPQD 5I73C 3TPUA 4CW1A 3CMOH 3F12B 4JHWH 2ZUXA 1GGBL 4KU1A 4X5LA 4J1UB 1OF2A 3WBDA 5H94A 4XPAH 3DETC 2LVCA 4HKXB 3KYMA 4RGNC 5IGXL 4ZUVB 5GGUB 5J11B 2XNAA 1JPFB 3ULUD 3FTGB 1JF1B 2MSPA 1K6QL 1V7MH 1IM3B 2AEWA 3VWKA 5I1IL 4QXWA 5CWSB 3E0GA 2WWKO 1RZGA 4K55A 4WO4D 5F9OL 5EC2B 5H37H 1DQMH 3GSOA 2OQJA 5HDBE 5I1DB 2NNAA 5EO1B 4N90E 2DBLH 5FB8A 1BQSA 4LAQL 2EC9T 1MCSA 4IBLT 3ZT6A 3UTZB 1J0ZA 3QUYB 4PPTA 1CLZH 4I13B 1Y6MR 4HCRH 3QUZA 1J8HE 4GG6F 3S4SG 4ONHA 3SGDH 3GSUB 3HAEH 2F53B 3N85H 5HGHA 5F1IB 2OCFD 2YBRA 3MV7B 3V5DB 1ZT1B 4TSBH 3L3GA 3O9WD 1B3JA 4IJ3C 3IJYB 1DVFC 2F5BH 4RSVA 1HYRC 4XC3L 5SWQB 3QNYA 3D0LA 3TIDA 3GMNB 1MWAL 1KPRA 4PBXA 3ZDZE 4XP1L 3WO4B 4PY7A 3MRMA 4OCXH 3QRGH 3RWJB 1LEKA 1F4HA 1MIML 1TTGA 5IHLB 3MZTA 2DQDH 4R9HA 5TDOA 3LKNB 5I76A 1ZLUK 3P4NA 1I9JH 5C0BE 5TF1L 3HKFA 5C9KA 2GKIA 3TO2A 5IMOB 5IR1B 2NCMA 3MLWH 5ALBL 5AAWA 1I9IH 2BOCB 1FFPA 1A6TB 2VLLA 5L2KB 1P1ZB 2VB5A 2NY5C 2NY7L 4OLWL 1D5ZB 3WFHA 1L7TL 2AK4A 2X4PA 3MODH 1HHHB 1OTTC 2FSEB 3IVKA 1EJ6A 4X7TB 2VC2H 3ZE1E 2VLME 1JZ2A 1JNHA 5DRXB 4HUMB 3MJ9A 2APBA 3KWWA 5C0CA 4XPGH 1Q9OA 1U8NA 4MD0A 3AS2A 3VD3A 2HRPL 2IANA 4JG1L 4WI3A 3DPBA 2GIYA 4GAYA 3SO5A 4LNRB 3PNWB 4K3JL 5KSAD 5F3HA 1VEMA 1A1NB 4GBXD 5HJ3A 4RAUA 1DN2A 4I0KA 2VAAA 4XNYL 4LLUA 3QFJA 4I3SL 4CN6A 2W92A 3MLRL 5GS1B 5HI5C 3GMRA 1ITBB 1EMTL 3GHEH 2P5EE 4JANA 3NCYS 3VXPA 4TVPE 1AKJA 1DVFA 2DQUH 4GG8A 5HHPA 4X7SL 1QFWH 3DX6A 4OBRA 4AMKL 1W8NA 2XWTB 1T1YA 1ZTXH 2C1OB 5CCKL 4G9FD 5HYQA 4HIIA 1MPAH 4KKCD 3GMPB 3FFCA 5JOFB 4TOYH 2GJJA 2J1KA 2YD1A 1CICB 1C16B 1HILB 5HGDB 4DCQB 1JRHI 4N5UA 2XTJD 5D7SL 4JQXA 4Y5YB 2JB5H 3BI9X 3QDGD 4JY4B 3EOAA 2EE9A 1QFOA 1B0RB 2PUQT 3WUWG 5J06A 1F3RB 4OQTA 4GW4A 4GMSH 3ARSA 1G1CA 3IFOA 4JDVB 5JIIA 4MXVE 3SO3B 5IB3B 1U9KA 3BWAB 3PABA 1KXTB 1YEDB 2ENYA 4U3CA 4UTAL 1OTSD 3JZ7A 1IM9A 3KPNA 2V7HA 3S4SB 4WJ5B 1UGNA 1RPQA 4PV8B 5E9DA 3NZ8A 3QWQB 3T2OA 3CSGA 1HHKB 4DKEL 4WHYH 1QBMH 2P5EB 4GS7C 1I3RA 2CKBA 4I9WD 5EIVA 2FD6H 4JM2D 3BGFB 5D7JC 1QRKA 4IRJC 5T1MB 4GRMB 4HFUH 2VUOA 4X80H 5I19L 5J13C 5IBLC 1W72B 1A3RH 5MI0C 1BEYL 5GS0H 1AJ7L 4PP1D 3C60B 3QIWA 3IDJB 5CEYB 5C0AE 2YPVH 1CD1B 1XGUB 3RPIB 4QO1A 3T0VA 1Y6KR 1CBVL 4PJFA 2GJ6D 3V5HA 2E6JA 2DQFB 5IP4A 4JY5H 3WLBB 4PJ5B 1GGUA 4P57A 3OPZL 3RI5F 3U1SH 1X5FA 1G84A 3W2DH 4PLOB 1YDPB 3I50L 1Y18A 5KJRH 3IXAA 4QNPE 4OQ1A 3TEUA 2OTWB 2AKRA 3P11L 4L4VA 3WIFB 5C09E 1DEEA 2R29L 3BKJL 4KQ3H 5DMIL 5EU5A 4KGLA 3B6SA 2AI0H 2C4FT 2HH0H 1DANU 1YYML 3GMQA 1MAKA 3NA4A 4IM8A 3PHSA 4BQBA 4GSDH 4DFIA 4K7FA 4MA1C 4RMTA 2P24B 4YXKH 4OZIE 2FR4A 2BSSB 3STLB 1OCWH 3OKMA 2BFVH 4ODHL 1QFHA 3LRSB 4NN7B 4HWBH 5IEKB 4MA3B 4Z0BH 4WUUA 1ZXQA 2K9UA 2Y1VA 5JMOC 1X4ZA 4D0CA 4L3EB 2VDLH 1KB5B 1X5JA 3GI9H 4BQ6A 1Z6JT 5DLMH 4YIQA 3GJFA 2WINA 5D7JA 1RZJH 1K2DA 4IRJA 4EBQH 5C0AB 2ZCLH 4WW2C 4JO4L 3MBEC 2EYTB 4HKZB 4P2RA 5T3XL 3RUGA 1XFPA 5J3HC 3FAWA 4JPKH 1XF3A 1DL7L 3VW3H 2GUOA 1KENH 5H94B 2VXVL 3KLSA 4NOBA 3DGGB 1CLYH 3FHAA 1DUYB 2J5LC 1CDYA 2C1PB 3ZTNH 1KJ3L 5GZOC 3NIFF 3WYRA 4HWZB 5C09B 4NCC1 2D9CA 3HE7C 1PVHA 1TITA 5I75C 3WUWB 3G5XA 2DM4A 3GMMB 4OCWL 3SBWC 1EEZB 4WFGD 1N64L 5FXCH 2ADFL 3NFNB 2H8PB 4C56E 4F8QA 1FNHA 5MEPA 3QQ4A 3VDAA 1FSKB 3D2UA 4U6HB 3RX8A 1YEHH 5LGHH 2CLZA 4MB5A 3MXWH 4KTDH 4WFED 3NTCL 2LTQB 3VXUA 4YHKH 3BSZH 2OP4L 3JBG7 3HRZA 2NNAB 4U1KA 4FS0A 4ZOCA 4ZXBC 3HZYA 3VXOA 1XGYH 3Q5YA</