2DQFB

Crystal structure of hyhel-10 fv mutant (y33ay53a) complexed with hen egg lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDAWSWIRKFPGNRLEYMGYVSASGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 20
structure length 114
sequence length 114
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqfB00
3DJ9A 4FQIL 3LIZH 1PSKL 3E0GA 2W9LA 4F58L 3ARDB 1LE5A 2CJUH 5ALBL 1RURH 1GRWA 1JTTA 5F9WB 3IU3A 4N0UB 4XBGA 4PBVC 1IAKB 4X98B 1XF3A 3B83A 5CINL 3WNNA 5ANMB 1KSRA 4Y5XC 5FYJE 1BQHB 3FN9A 2H1PL 5I18L 4LPTA 5GZOC 3TF7C 3HMXH 1F3JA 4JKLA 3QNZB 5I66B 3RZCA 2NY1D 3D5OF 3KWWA 1P1ZB 5C07E 1QFWL 1N6UA 1SYVB 1R5WA 2PO6A 3LB6C 3OB0K 1H8OA 2GYSA 2YD1A 1R5IB 4PJ7F 1AFVH 2ATKB 3RVWC 1D5MB 3MJGX 3BEVB 1JGVL 2PW1A 3SKJH 3IT8D 1HHKB 1S5IH 3PWUA 3R0NA 4KJWC 4Y4KB 4X9FA 5DURD 5J1TC 1KF9B 1OAXL 1SEBB 2Y7QA 3OGCA 3FFDA 2VDQL 2ZSWA 4QHKJ 3BPLC 3VFOB 4KHTH 1BJMA 1M05B 2MCPH 3MJ9L 3PQYE 4MD4B 4X9IA 5DJAB 3T2OA 1OAUL 4DOHB 5CGYC 5H94B 4HH8A 3MGTA 4KKCD 1NH6A 3MODH 3VGFA 3VXME 1F3DH 2EH8L 4D94A 4ZFFB 4EN3D 5FUZH 3TFKC 4YDJB 3SDDD 5C6PB 2V2WB 1XIWB 3S98A 5C0FB 5D96C 4CVXA 3PIQA 4H26A 5IVXE 1A6AA 2ITCA 1IJ9A 3QI9B 1UZ8A 3O8XC 5J0BA 3PV6A 4F80A 2R1YB 2X41A 2VLLA 2ZCLH 4JG1L 1PG7X 3U0TA 5IKCA 2E3VA 2LU3A 3HNTH 5MEPB 1KJVB 3G5VB 4MZ3A 3ZTNH 3GMMA 4ZUWA 1T3FA 4JHWL 2YPLE 1HXYB 1XGTA 5IVXA 5DXWA 2R1XB 1I7RA 5FYKU 3I6KB 5L7XH 4PJDF 2WBKA 2IH1A 4HIEB 2HT3D 3BZDA 3VXMA 1TXKA 1OGAB 4OUOA 3WNMA 4HH9B 1NCWL 3PE9A 4KVCL 4QY8B 5HI4D 3O9WD 1E6JL 5IBUG 1DFBL 1A3QA 3QG6A 3PQYA 4K23H 4NCDA 2HRPL 5ADOL 1NC4D 3FCTA 4K3EH 1D5BB 5FK9B 3HE7B 4IDJL 3FQUA 5BJTA 4XCCH 4MA7L 5CCKL 1OTTC 4PJ7A 2YPVL 5F88B 1KT2A 3BWAA 4Q2ZB 1DE4A 1PLGL 1I9RL 5JIHA 5HYSG 3WXWH 4JY6B 4NRYA 1QLRA 3FT3A 2EO9A 1MEXL 4HKZA 4OFKA 2DMCA 1ES0A 4YDJA 3T2NL 4JQVA 3H9YA 3Q48A 1S7SB 3MV01 3GFUA 4C83A 4XCFL 4X6CF 4O5LL 2RCSH 5I76A 2NXZC 2R1YA 2L4OA 3BAEH 3D3VB 1OP3H 1FP5A 1I9EA 2JJWA 4KUCF 3KJ4B 1KJMA 1JF1A 4R6UA 2E9IA 3P3YA 2OJZL 2NY5H 3MSPA 4ZUWB 2CRIA 2LTQB 5C3LD 3J7HA 3UDWC 1JGEB 3NZHH 5FGBC 2D7TH 4D2NA 1GGIL 4PJBF 2XZZA 2PR4H 1RUMH 2YUVA 4KPHH 2J4WH 4JQIL 4MNGB 4H25A 1W0VB 1TLKA 2Z35B 3BJ91 5C0EA 4IRSA 5F7KC 2DI9A 3OJDB 1H5BB 1DQJA 1DEDA 4C57C 1S7RA 4TVPD 2W91A 2E7CA 1UKSA 4EZMA 1I9JH 3O6LL 5CP7B 3L95B 5BJTB 3C60B 5D2LB 3QRGL 4G8GB 4HBQA 2NZ9C 4Q2ZA 1RJYB 5TDOA 3RWEB 1S7UA 4JDTH 5MENA 1JK8B 3TPUB 3LEYH 4GKZA 1CTOA 3TWCH 3V4VL 4LSPL 1CBVL 3RVXC 4XPTL 4UV7H 3MNWB 1UM5L 3ISWA 4JANA 5C0FA 5BV7C 1ZAGA 5I8EA 1QSEA 2EDDA 3CH1B 1N4XL 1KB9K 3LKPA 3NCJL 3O6FB 1LHZA 4KUCD 1IM9A 1LK2A 3DUSA 3RGVA 4XCYB 3NAAL 1FLRH 4HJGB 2D9CA 2NY7L 5C0AA 3MOBH 4O58L 2ZG2A 1E0OB 3WNPA 4Z77B 3GM8A 4DGYL 4JVPA 4OV5A 3F65A 4Y4FA 4NQXB 2VLKE 4P4RA 3FONB 5TDNA 4G8GE 1KIQA 5H35A 2D7PA 2KBGA 3EOYG 4PJIA 1L0QA 1IEBB 3QQ3A 4HBCH 5GPRA 5C2UB 1VACA 4LOUD 1DR9A 3FB8B 1T04A 5CD5D 4Y5XB 4F3FB 4OZGA 4JQXC 3MRHB 1KCRH 3BH8B 1A8JH 3QDAA 4UUJB 3L3HA 3OJDA 5DT1H 3AB0C 4UNTA 2BDNH 4EOWL 2VXSL 3RVTC 5LAXB 3F62A 4W81A 5EOCH 1LK3H 4P4KC 3CSYB 4PJBA 5FDWB 4FQCH 1QA9A 3MYJB 1FDLL 2GUOA 4YR6B 3U30B 3AREB 2ARWA 3W82A 5JW4Q 2QQNL 1MRCH 5KSBF 5T1LD 5ILTL 4UU9B 5IJKC 3GEWB 1J87A 1JGLH 4FZEL 1FORH 4G7VH 4MLIA 5DJYB 4YNYA 3K1KC 2GTWA 4ZOBA 1HHHB 5B8CB 3WUWG 5CEZH 3KWWB 2QSQA 4TQEL 4WI9A 4P5KB 1ZEAH 5L6YH 1NKRA 4TUKH 4B50A 1FYTD 4Y5YA 3AMKA 3EW3B 4AH2A 4PG2A 5LCVH 3H3BC 4OGZA 1OT2A 2ZCKH 3C09C 1AP2B 4NHCH 1UJ3B 3MXWH 1WTLA 2O26U 3RPKA 3DGGA 4GOSA 3MPCA 4FFVD 1YMHA 5J13B 1E6OL 1XF4B 1AD0B 3TBTB 4J1UB 3ETBF 25C8L 4PRPE 4HWEL 4YHKL 2I60L 3L3OA 4G9DA 3BGMB 4MDJB 4MJIE 3VRIA 4KK6C 4QXUH 3CVHL 3L5WB 3CDGB 1XZ0A 4S1DC 4MDIB 3THMH 4LRIA 3ULUD 4JM2C 1S7QB 4OM1L 4HX1B 3HC4L 1JHLL 3U9PL 4FP8H 3QIWB 2DQGL 4PRBA 1EFXD 3O4LB 1D7FA 1Z3GH 3F12A 5IOPB 5JORA 2H2SC 3VFTB 2HT2C 2MQ0A 1QLFA 3OXRA 1TVBA 1HYSC 4MXWH 5JHLL 5MENB 4ODVH 4IDLA 1ETZA 4HK0A 5IB1A 1UXWB 5K9JL 4HD9A 1QLEH 1CXHA 1SM3L 5BRZB 1ITBB 2YZ1A 4QHNA 4K71B 1NCBH 4PRHA 3AAZB 5F96H 1HCVA 4NM4L 1RZ7L 3QPQD 3JUZA 3M8OH 5L88L 2P5EA 4P5TC 5ESAA 5DSCA 1U41A 4H8WH 4RZCB 2E9WA 3CX2A 1TZHB 5T5FH 4KZEL 1FJ1B 4M7JH 4WFHD 1TENA 4G7YH 2YA2A 3DHMA 1MLCB 2HH0L 4HKBA 4PJ9A 3U7WH 4TSAL 1RULL 3ESVF 2BRRH 5SV3A 2A6JA 5H37H 4ODXA 3T1FB 2H45A 4G6AC 3FCTB 3PXJA 4JM2F 2MMXA 5GRXG 1ZA6B 1NUGA 3PWVA 5BXFA 1A14H 3HAEB 1FZKA 4XMPH 5F88A 4QHLA 4YXLL 1B9ZA 5M7QA 5HYJB 4YEFA 4NWTL 2JKXA 1FVEA 3LKNA 3O3EA 1YJDH 5CWSB 5AAMA 2A6KB 5EZJB 5FFLA 2GIYA 2IBGA 5LG1A 3SDAD 1O0VA 4JFFD 1CFVL 2IANA 2B5IB 2GTZA 1I1CA 3AM8C 2VR4A 1P6FA 5I76B 3VFPB 2IQ9H 2EXYC 4HKJA 4XMPL 5E2TL 2EE9A 3TFKD 4TNWF 1A6UH 1KJMB 3TZVA 3JBG7 3ARUA 1S7VB 4FFZL 4IMKA 2APTA 3IDUA 3QIUA 4GRLC 2PKDA 3VFGL 1NMCB 1VB9A 1CK0H 4OFIA 2BRRL 1RULH 4TSAH 3VCLB 1PW3A 3TC9A 4M7JL 2IBZX 3RP1A 4KZEH 5BO1H 5ID1B 4X7TA 4G42B 4H8WL 5L88H 4YH6A 2DM7A 3HRPA 4NM4H 1F11B 1HQRB 3LKRA 1NGZB 1NCBL 3VMNA 4OI8A 2GW5A 1QLEL 4WO4B 4J1UA 5K9JH 1FZMB 2NX5D 4KU1A 3VI4F 4EJ1C 4KMLB 4YHPA 3C5JA 1KCSH 3PIQB 4H26B 4JFEA 1S8DA 4RGMC 4OZIB 4PLKC 4K7FB 4U0QB 4EI5A 3BIBX 4ZUUB 2EC9U 4YXHL 5D93C 1EFXB 1XGUA 1KJ2B 4PJEE 1FL6B 5KSBE 1CLZH 1KPRA 2AJ3A 3QH3B 2XPGB 1IFHL 1TFHA 3GIVB 1PG7W 3TBVB 4LVEA 4M48L 4PTUA 2FIRT 5GZND 4QXUL 3MRLA 4NKDB 5FOBB 5BQ7A 1IT9H 3BWUC 3VD3A 2VIRB 2I60H 3TZVB 4HWEH 5KS9F 5ICZB 25C8H 3VWJC 4WW2B 5FYLH 3T0EE 5LBSL 5J1SC 5LGKA 4Z77A 2EIDA 1E6OH 4P46A 2F54E 3DX9B 4K9EL 3GJFK 4XAWH 5FXCH 1AD9B 3PWLB 1FIGH 1OCWH 2FJHA 2YBRA 3MXWL 2PO6B 1JZ4A 1CFBA 1DQLH 2ZCKL 4NHCL 2I25N 2OMNA 2GAZB 2C26A 4OZGB 1PYWB 5D72H 4LGRB 4MNHB 3VXRB 1A6PA 1ZEAL 1ROWA 4APQB 4TQEH 5CEZL 3FZUD 2RB8A 5CZXC 4Y4KA 3O3AA 5F7HA 1FORL 4Y5YC 5CJBA 3G5ZB 5ISZA 5ILTH 5GRVK 1G7MA 1MRCL 4EXPX 1FFNA 5EA0H 2IG2L 1T5WB 5K9OB 1OTUC 1WJ3A 4WFFD 5JOFA 3SE9L 4UILH 4BK4A 4PP1D 4YX2H 4UQ3B 3UPCA 4PRID 2XYCA 2R2EA 3FFCA 5GJSH 5KOVC 1A7PH 1LK3L 1P7QA 4PGBB 1MH5B 4MD0A 4EOWH 2HTLC 3F7YA 4X6FB 3UYRL 1MIML 1T0NB 2NW3B 1ZVSB 3IDGB 1KCRL 4G8EA 4HFUH 1J1PH 3C60C 1I7TA 5I74C 1U9KA 1G0YR 3F7VB 1A9EA 3FO1B 3MV8E 4OF7A 3FOMA 3UROR 3W11D 3L3DA 3ET9F 4LLQA 2RAMA 3S35H 3QA3A 3DX7A 2P24A 1HOCB 1LDSA 4NO5B 5JUEL 1RIHH 3RX7A 1TQBC 4YFLF 4LHUD 2HLAA 2Z93B 4I13B 3UTTD 4O58H 5FM8A 2XA8L 2NY7H 4D0DA 32C2B 1B88A 3BHBA 1FLRL 3F6LA 1IRAY 4L8BA 4R4BB 1INQB 4EXKA 1FO0A 1N4XH 1PAMA 4X6DF 1PZUB 4MAUH 2NPLX 5T3ZL 4PGEA 3T3PE 2Q86B 4CN6A 1CLOH 2FR4A 3QXWA 1UM5H 3MNZA 5B8CC 4F37F 2BNUA 4NQEA 5T5NF 1CBVH 3H9SE 3MBED 2BVUA 3NCEB 4LOUC 4IRZH 3L3JB 1D5BA 3TWCL 1JPFA 1IAIL 3LEYL 1FNEB 1WBYB 4MXVE 4XH2B 2CLZA 4NUJA 4R7DA 1JGDB 2NY6D 1BOYA 1HH9B 4E42B 3PWJA 5IB1B 5SX4I 1XF3B 1I9JL 4NFDA 2UWEE 1ZLUK 5BRZA 4ALAL 1UCBL 2E6QA 4ZO8A 1CICA 4Z9KB 1K8IA 4K3HA 5C0DB 5ACMA 5IK3A 5E5MA 5EBLA 4F9PA 3CFEB 1VKXA 4P2QA 1AXTL 3D39A 2IQAA 4M43H 5KSAD 4KAQH 1U6AH 4HXBL 2W0LA 3S3PA 5F97E 1SYVA 2J4WL 4PYGA 3HG1E 5ESVA 3OJVC 5IVNA 2P48B 2YD9A 4MA1C 2VIRA 1MCEA 5EO9A 2GT9A 4Y5XA 5DHVA 3NZHL 2NY4D 4H1LG 4XNMA 4N0CC 4NRXA 3C5SA 2YN3A 4WTXA 2OJZH 4UNVA 3RWCB 3HZYA 4PJHA 5SX5H 3Q5TA 4X9GA 1UVQA 4DQOH 2APXA 1NCDL 1AE6H 4U6YB 3D0LB 1NQBA 3T4AA 5KG9A 4QCIB 3NPSB 2FLBT 5D7IB 3CZJA 2BSTB 2AV7B 3BP6B 4GG6E 3LRSB 1ITCA 2KPNA 4M1GL 1A9BB 1CN4A 1D6VL 3X17A 2IPKA 1MEXH 4F7CB 1NANH 4GT7A 3WXWL 4XRCB 2AABH 3EYQD 4HUVB 3DVFA 4TOYH 1WAAA 4HUNB 5HHXH 5ISZB 1ZHLA 4P5KA 4S1DD 2ITCB 3QI9A 2CDGA 4ZSOB 4AH2B 4JM2D 1BHGA 3HZMB 4UQ3A 5JMOC 2DQIL 4ZTPH 3RGHA 2R0ZH 3VXSA 5L8LB 3NPSC 2G75B 5FHAH 4UDTA 1CL7I 2AK1L 3HPJA 4UAOC 5ADOH 3PGDB 4K23L 4B7IA 1C1EL 4PB0H 1MCCA 3GJEA 1DFBH 4ZUSB 4YHIA 4KV5F 4S1SL 1I1AD 2R29H 3CK0L 2ZOKA 1NCWH 4OZHB 4G42A 1IGIH 5IB4B 4NKOB 4J3OC 4KTEL 2X1XR 1IEAA 4MQXC 3V6OC 4HIHA 2GT9B 4P9HH 5D7IF 3UPAA 2X4RB 4ZPVB 2BJMH 5DQDH 4K3JL 1ZXQA 2WBJC 4P5TD 4QXTB 4NRXB 4JCMA 4JHWH 4YO0A 4X9BA 3ZTNL 3VXRD 2QTEA 3EOBB 4NQXA 3HNTL 2Y4SA 1S8DB 4QRPE 3VGBA 4JG1H 3RTQA 2ZCLL 3KYMB 5IMLB 3QQ3B 1CQYA 3RZWA 3WDHA 1EERB 3SKUD 3B9DA 4PR5A 1D5IL 1XIWD 4NC2B 2CD0A 1SMAA 1U93A 4LQFL 5J7CC 3MNZB 3QDJD 1KPRB 2AJ3B 5I1GL 1B90A 1SYSA 1NGPL 1WBYA 2W60A 2WSKA 4LCWD 1J10A 4OD3L 3MODL 1S7SA 4P3CL 5DSCB 3MRLB 4S11A 4QRRE 4F7TB 2F9BT 1OF2A 1IE5A 1ZV5A 1FJ1A 1KPUA 4Y4KC 1V3KA 2RFXA 4KHTL 4RRPA 2FSEB 4KKLD 2VDQH 3C2SA 3QAZB 1BREA 2Q3AA 5JDSA 4WO4C 1YNKL 4UTAH 1MFAH 3DX9A 2EXYD 1WAAF 5ACZA 3DXAE 3RWJA 1R3JB 1JGVH 3SKJL 5FA3B 3D3VA 2R4RL 3NGBB 3QFJB 5DJCB 3CX5J 4K7PY 4MCYB 2BNRE 3PHOB 4GRLD 5A2LH 1S9XB 1QFWH 2HYMA 5D1ZB 5DQJB 3WFHA 4R4ND 3UBXB 4JE4B 3SDCA 3TO4C 2ZUSA 1NMCC 2DOCA 1FVEB 1ZGLP 1RV6X 3V5DA 1UJTA 3HMXL 1QSFD 1DQJB 3MRBB 5DD0L 4LNRB 1DZBA 5HYFA 5I18H 5CINH 3T0BA 2OL3H 3RVWD 1F00I 3S8WA 2M2DA 4WHTB 3L95A 3UYPA 1NGWA 3SY0B 4ONHB 5JOFB 2ERJC 5ALBH 1P2CA 3T4AB 1KYOK 1KLUB 2CJUL 2XG4A 3CDGA 4F58H 3I84A 1PSKH 3IDJB 3KR3L 4HFWA 2RIKA 4KWUA 2NX5A 3LIZL 5EN2A 4FQIH 4Y19E 3HB3C 4TULH 2R23B 1OSPH 3F7YB 1CFSB 2PYED 1M7IA 2M1KA 2Z0BA 3SKOA 1T03L 2HMID 3SDCD 1ZVSA 2E7LC 4PRBB 4YAQB 4ZNEA 1A02N 4KKCC 3FO1A 4DVBB 1AKJB 1MCIA 1VGEL 2BMKA 1P4LA 4DWHA 3I75B 1ZE3C 2VDLL 5FDYA 4MSWA 5D2NC 4HK0B 1XF5B 5TE7L 6FABH 2HJLB 4FQ1L 1SEBA 1LNUA 4YHIB 2NY4B 4YFLI 4ZXBA 1R3JA 3ARPA 4LMQE 2VXQL 1JV5A 1V7MH 3H9SD 4JFDB 5CLWA 3QFJA 3ILQD 1IEBA 3B5GA 3KPSE 4K7FA 4PGEB 1X7QB 4JZNB 5CMAB 1OGAE 2ZNXA 3UBXA 2AK4B 4TTDC 5TQ2L 3NCBB 4DN4H 2Q76A 3GBNH 5C0JA 4AEHL 3T09A 4L4VB 1HSBA 4PRPB 3VDBA 5M95B 5IMLA 1B0RA 4FQXC 3RL2A 5HI4C 3REWA 4X83A 3W0WA 4PLNC 3IAGC 5F7DA 1T83C 2DQTH 3WO3B 2VZOA 3JV0A 3MRHA 3PV6B 3BH8A 4X6DE 3SQOH 5JIPA 3OKDB 2YK1H 3LHPH 2XZCL 3P30H 4X7SH 1TNMA 2J6EA 5HTSA 2YEZA 4EDXB 2DM2A 3LPGA 1MI5E 3DI2B 1IGCH 3GMMB 2OR9L 4PGDA 1GPOH 1XR8B 1F8TL 5DMGD 4EI6A 1QHPA 5C0BA 3SKOB 4WFFE 2GUOB 3MX0A 4YR6A 4FFWC 1X5JA 3EO0B 3UDWA 4HUWB 3VA6A 1ND0A 3I6GA 4NNXA 5HPOA 3WFCH 1IAIM 1JVKA 3NIDF 3P0GB 3HR5A 4GBXD 2Z91B 2WINA 5E94B 4XWGL 2EKSB 4FZ8H 4X4ME 1F4AA 2R9HD 4ERSH 3ZO0A 5F1KC 3PG2A 4NO3B 5D6DC 3UJTH 5E08H 1MIEL 2JCCE 4AEIL 3IDYC 4JFXB 4ZFGH 2OI9B 4L8SC 3BKJH 4BFGA 4G80A 4N1HB 5DD3H 4PJIF 4R26L 2DQUL 3U6RB 1CT8A 4AENB 2OP4H 4XPBH 1N64H 2ED7A 3BJLA 4TYUA 1DL7L 2HAZA 2XACC 4QCIA 2VLKD 3DETD 1MY7A 1S9XA 3GJFA 3MV9B 3WIIH 2EE6A 3NA9H 2PTTA 3A6BH 4LIQE 3VG9C 2PYFA 2ZG3A 4RCAA 4P2OA 1G84A 3MRBA 3VFWA 1PKOA 1YPZF 4RWHA 2CKBL 5IWLA 3V4UH 1HSBB 1MFBL 3UEZA 1ZHLB 4LAQL 4P9MH 3F58L 3HFML 3MCLH 4OF0A 1BFTA 5CEXB 3CPLA 4WW1B 1IAII 3LEVL 3L5HA 2R8SL 3RWFB 1MFDH 3LN5B 1XGUB 1EGJL 2YD5A 4CN4A 4FA8A 2NY0D 3HC3L 1P84K 3UO1L 2EDOA 3Q5YA 4DVBA 1ND0B 5A43C 4XVUC 5E8NA 2XY2A 4GKNA 4QRTA 3LKSB 2Z35A 5KOMC 1EJOL 4ZXBC 1DBJL 1KB9J 1N7ML 2WP3T 1JI1A 1XGQA 2YUXA 3QT2A 2J5LC 5JO5A 2OL3B 3JV4A 4JLRB 3HN3A 1NFDF 5CILL 5GISH 2VKWA 1YQ2A 5CP7A 4Y1AE 2PNDA 3RL1A 2NY4C 1KJ3L 2J8UF 1U2CA 3ULUL 1A64A 3L1OL 4GAGH 2X1QA 1NGYB 1BQLL 4YC2C 1OLLA 1MVUB 2DQHH 5D2NB 1A7NL 2CKNA 2IAMB 4K7PL 4N1CA 1A6ZA 5CD5C 3B8YA 3VXUD 3GBML 1SYSB 3CFEA 5E00A 3GMQA 3D39B 4GG8B 5EZOL 4R96B 4BH8A 1FFNB 2V9RA 1KEGL 2JJSC 3G6JB 4U1MB 5HBBA 1FYTB 2FD6L 5BVJA 3K8MA 1TIUA 5F1SA 3VFNB 4PIRF 1L7TL 4M3JA 2X4PB 1JYXA 1H3TA 4Y4FB 5D5ME 3FAXA 4JFZH 1GSMA 3TVMB 3D1MC 2ATPB 1W2KT 3JWNC 3WSQH 1DANU 2EO1A 4L3EA 2QADD 4H8WC 3HUJF 5KG9B 3TYGH 5I19L 4HUXA 1VFMA 3D2UB 4PV9A 3DX7B 4RAHA 1IGFL 4XPAH 2C1PA 4OB5L 2YXMA 4ZFZA 3I9GH 1CGWA 2C7UB 1PD6A 3QJHA 4DTGH 5IMOB 3DRTA 4D9RD 2IPKB 4AM0B 4OTXL 4WIQA 3AY4C 1CTNA 3BHBB 1OARL 4MQXD 3QRFM 2CLVB 1DLFL 1FO0B 3TCLB 1T5XB 4Y0GA 4JKWA 2Z8RA 3MTRA 4PJXE 4NJAH 5DUBB 5HVHC 1T2QH 4BM7A 2VISB 5EU4A 3MROB 5DUMH 1KEML 4FXGA 1EFXA 5IESH 3EBAA 1B6DA 1A6ZB 3QULB 4MLSA 4MAYC 3WCYA 1MNUL 3GI9L 2VH5H 3INUH 4PGCA 3UJJL 1EAPB 4Y5YB 3ULUC 4OZHA 5TFSL 1IM9D 3O6KL 3DYOA 4YPGB 3CXDH 5BQ7B 2G9HB 3CVIH 4P57B 1UWGL 1CDGA 4NNPL 3VGDA 5E6IB 5I8OL 2AJVH 5JHDA 4KRMB 4HWNA 2E27H 4CVXB 3NPZB 3OMZA 3WN5A 2CQVA 2MNUA 1HXYA 3VG9B 3X14B 1CE1H 2ZG1A 5DC9B 3WFEL 1HYSD 1TMCB 1YEEL 4UT6H 1AD9A 4QRQB 4FHBD 2N4IA 5IB2B 5I73C 1F4YL 1PFCA 4KKLC 1QSED 4JAMB 4RAUB 3ZE2F 4J6RH 4NZTH 5D7KD 2VZTA 4NKIH 1PYWA 4FQPA 5IF0B 3P0VH 4LCWA 3O6FC 3GMNB 1QQDA 3ARDD 2LU7A 1FPTL 4ZFZB 2EE3A 4K7PX 1M6OB 5TDPB 5JHDD 2VLRA 4J2XA 2X1WL 2JF1A 2D03H 2OK0L 2FGZA 4LVHC 2HLFD 4U6YA 2PTUA 3OJ2C 1HQ4B 5I1KH 1KT2B 1J1XL 3STZB 2IBBA 4G6AD 4LPUA 1KFAH 2BSRA 3RBGA 3ULSA 4QRUA 3T8XB 3T1WA 1R0AL 2RGSA 3K81A 1G7PB 1Z9LA 4PGDB 4GLRH 5JDSB 1CE6B 3ULVF 2OSLB 3MV7A 2EDQA 4LDLB 4Z7VB 2BVQA 5D6CB 1UWXK 2EH7L 5L8JB 1C16A 3MRJA 4RNRA 1YPZB 2WINB 1IL1A 1CICD 1NMBH 5ANME 3QISA 2FYYB 3PHOA 1HIMH 1ZMYA 3X3FL 1UQSA 3UZVB 1QRKA 3QUYA 2ARJQ 2HMIC 4JGJA 4ENED 4YPJA 2HVJA 4OLVL 4RGNB 2DWDA 4E5XA 2BVEA 1L6XA 1DEEA 4NT6B 2VLMD 5MHSD 2K1MA 2PXYC 1QZ1A 5CD3B 4CMMA 2LTQC 2I26N 4HS8L 3V0WL 4AG4L 4R90L 3RAJL 5T3ZD 3GBLA 5E8PA 1EIBA 1VERA 1NBVL 3V95A 2Q86A 1CDBA 3O3EB 2F58L 3MREA 5HDLA 3L3GA 2AJZB 2OXGA 3RNQB 4QXTA 1U8OA 3VI3F 3GMPB 1IC5L 1A6VH 3TP4A 4L8BB 3ILQC 4Y88A 1D6EA 1KB5A 4MNGA 2GTZB 4Z7UF 5CZVH 1MUJB 5F7EH 4PY8I 2R2BA 1BBDL 3ESUF 1AHWC 2EDHA 3R1GH 2BMKB 1P4LB 4IRSB 2O5XH 3BDYL 5D1QC 5EC1A 1F02I 2A83B 2X05A 3MBEB 3D25A 1BIIA 5ITBH 3MRGB 2BNUB 1GZPA 4M8QA 2J8UB 2H8PA 4J23A 3BPNB 1K3IA 2NW2B 2HJLA 2F54B 3FAWA 1JNNL 1KN2H 2P47B 4LASL 4JANB 1J86A 5D2LA 5F44A 2JTDA 1ED3A 1FNFA 1G9ML 3PWJB 4GKZB 3MA7B 3LKSA 4MD5A 1BWMA 5C7XL 2Q6WA 2O5YL 1XF2A 2D7MA 1EO7A 2G9HA 3G5VA 5E8EB 3EYVA 5DMGC 3UC0H 2FSEA 1INEH 5DHVB 4XMKL 2ICEB 3TA3A 1XGTB 3G9AB 4QT5B 5FGCE 3WN5B 4HIXL 4CJ0A 5GGUA 1MQKH 1OAKH 5EORH 3DRQA 2C3GA 3BVNA 1UFUA 3MLUL 2FECI 5CD3A 2EC9T 2YRPA 3QB7C 5EO9B 1J0JA 4IIQA 5K33A 3NFSL 2KZ1B 5IMMB 3F5WA 4XPFL 2G2RB 4WCYH 5CUSL 1RUPH 4PRDB 3O3BB 3LS4L 4XP1L 1MQ8A 1P4IL 1M6OA 3GMPA 5TDPA 1U58A 1SY6A 5I16B 5JOEA 3DETC 4NOFA 3B3IA 4JRXE 2V7HA 3PF2A 2R2BB 5C2BL 2XV6B 4NKDA 2UZIL 3IFPA 1Q1JL 5FCSH 4LLAA 5C07B 4I48A 3FT4A 5LXGH 2BSRB 2A83A 4LVNC 2F5BL 5EG6C 1FYTA 1F4XL 1QLRB 3FT3B 3T8XA 3W5NA 2NXYD 2ADGA 1ZHBB 3DBXB 3MYZA 4UDTB 5BZDB 5FDWA 3SDAA 1MRFL 1U91B 4GSDL 1Z0MA 4G8IB 2VL5B 5DTFB 5CSZB 3SE3C 4L3CA 4N0UE 4UQ2B 3DROB 4PG2C 1RZFH 4WEBL 3A67H 3SDYH 4AENA 1YEIH 4UU9A 3NIFE 1U8MB 3EOTH 4HT1H 1HHIA 3QXUA 5HGHA 2OTUB 3H0TB 1UJ3A 2LFGA 4RFNC 1HCFX 2IPUK 3CUPA 4TTGA 3HPJB 3KYAA 2XN9E 1S9KC 5GGTL 5A2IH 4FQQB 5SV4A 1SEQH 3WNKA 4LLVA 2XKSA 3GJEB 4XMLL 5JW3L 5IJVB 2HVJB 4Z7OE 3MJ8B 2F8VA 1YEHL 3DV6A 5CAYB 35C8L 4LFHG 3W11C 1SY6H 5C08A 3FRPA 3NH7L 3V6BR 3LRHA 4BQ8A 1G1CA 3LS5H 1U8QA 1FNLA 4NKOA 1KXTB 4NQCE 4EI5D 4LLWA 1RJLB 1T5XA 3E3QC 4HPOH 1T4KB 1LP9E 5E8PB 4MXQD 1QACA 2Y07L 2YUWA 4QXGL 4KZDH 1HDMB 3GSXB 2ZPKH 4KGLA 4LBEB 5FOJA 3MREB 1RUAL 4UB0H 1IMHC 4F8TA 4CVZA 4OQTL 2NY2C 3HPLB 4M7KL 4F57H 1NCCL 4KHXL 1KGCE 1FAKT 1LE9A 1W0YT 1UYWH 1U8IB 5IW1B 4I3SH 1D9KC 3MRQB 3H8NA 5GRVL 4RFOL 3JXAA 4YHLL 3RL2B 3REWB 4ORZC 3ARBB 4Z76B 2HVKA 1QG3A 3N06B 2AXFB 1CLYL 1QLFB 3OXRB 1G7IA 2ZUVA 3D9AH 1YYLH 5DFTA 1VESA 4XP5L 4GRWE 2GFBA 2YEZB 1HHJB 1A0QH 2IALA 4NBXB 5GRUH 2FH8A 4EEEA 4QHNB 1YC7A 2J2ZA 4BQ6A 2CDFB 2NY6C 1X44A 4ZPTA 4OKDA 1YN7A 3TH3T 3EO0A 5CEYA 3I6GB 4NNXB 4X4YA 4D9QD 2XWTB 1X5AA 1A21A 4OCWH 1BZ7B 4JO1H 5HVFB 2JK5B 5DJCA 1VPOH 3JTTA 4KMTH 5IF0A 2C1OA 3AS3A 2A2QT 2ADFL 3G5YA 2ICEA 1J18A 5J3HC 3DV6B 1RJCA 2IAMA 1NAKL 3R8BB 2VR9A 3U6RA 4N8CL 3QPXH 2ZCHL 4XH2A 4KUZL 3JTSB 1N5YL 4ODTH 5A2KH 1QHOA 1QRND 1RJLA 1E4KA 1FO0H 4WEMB 3SDCB 1FL3A 2IH3B 3WKML 3G6JA 3T1FA 4XP6H 3MFFA 3PGFH 3V7AG 5T3XL 3GSNA 1CGTA 4JO3H 5BVJB 1CICB 5HHVL 3RIAF 4AIZB 5EZLB 3IGAB 1TZGH 2KQMA 5CZKA 5C07D 1P2CB 4NBZB 2VXTH 3O0RL 5C0IB 1DVFA 5B3NA 2DLTA 3VXSD 4OBSA 3EYFA 3ZHKA 2DJSA 3I75A 3NIDE 4U1IB 2ZJSH 4U2ZA 5DJZA 1M7IB 3BUYA 4JO4H 1A7RH 1TJIH 4G9FD 3H42H 2DWDB 1EV2E 5AYUL 2DF3A 3DNKA 4O2CA 9CGTA 4HUUA 4RGOL 4FQHB 5C86A 1NEUA 2ZOLB 1AKJA 1OTSC 1OW0C 1GGTA 1WBZA 4R8WL 4AEFA 1DANT 5C0ND 1ZGLA 4KKAC 4L8DA 3OPZH 1H3PH 4MSWB 3OGOE 4ODUB 3VFUB 2VAJA 5FEBA 5I1IL 4ZMAT 4WEUD 3ARFC 5C09E 4DGVL 1G9NH 5DHVH 2X42A 4MNQD 1J8HB 5D7LE 5HXMA 4Q9RH 2A38A 2MPAH 3MACH 1M71B 1OSZA 3I3EA 2D9QB 3VXPB 3TCXA 3LDBB 4L9DA 4Q9BA 2KH2B 2EZ0C 3O6MH 1MUJA 3LAFA 3IYLW 1EZVX 1KTDA 5GSRB 4ZAKA 5IBTH 3CFCH 3O8XA 2RJMA 5CGTA 2JCCF 1XGYH 2QL1A 2X89A 1MPAH 2VZ1A 4OAWB 3UTTA 2WUBH 3GSNB 1OM3H 3QIWA 2NY3D 3HPLA 1CVSC 2CSPA 3G08A 3GSWA 4YHML 1FE8L 4PJFB 3RIFK 4LVHB 1ZS8B 3T4YB 3JSSA 4PTUB 5INDB 1XIWC 3ARBA 1K85A 2RR3A 5D1ZC 5IB2A 2AAVA 5GRZA 1ZWIA 5D71L 5E2VL 3ZKMD 4JFED 1P9MC 3N9GL 3A6OA 2ARJB 1RZGB 2LU4A 5ICZA 3BUYB 3QWQB 4KVNH 1KN4L 3KHQA 4DZ8B 4XGZA 4NQCD 4OIIH 3MV9D 5JW5A 4P2CG 2OJEB 2BERA 2EDWA 2DBLL 4XTRC 4LSTH 4ENEC 4WO4D 2FDBP 2PW1B 3JTTB 1J8HE 5D7LB 1ZA3B 5GS2D 3KS0H 2K3TA 3CX5K 1T6WA 1W0WB 2QQKL 5JNYB 1ACYL 2ILLA 3RUGA 4PRDA 2ZSWB 4UT9L 1V05A 1A3RL 2YRZA 2YBRB 4LCIL 5FM5O 2W38A 1A4KB 3HI1B 3GUTB 4D9LH 5E56A 4HW6A 2HFTA 2OR8A 3TCLA 4DKFH 4NZRH 4PS4H 3MGTB 5HYJA 1YPZA 1TJHH 3S36H 4ORGB 4HULB 1OPGL 4WHCA 4PJDA 5IBLD 3VFWB 5HYSA 3NTCH 5FCUH 2G5BB 4KKBD 3G5ZA 1FFRA 2V2WA 3RI5K 3VXNA 4ZNCD 5FHBH 3CLFL 3DX8A 2A0LD 3C6LC 2FX8L 3V52L 2VDMH 3EZJB 4E5XB 1Z0NA 2FB4L 3QULA 3S5LG 4JPVH 3PQYD 3Q6GH 5I17B 1IBGH 1AO7E 1S9YB 3QHFH 3KYOA 1U8MA 3WHXA 4WW1A 4DEPB 4UNUA 2B1HH 4J8RB 3B2UD 3QIBB 4OCYL 4JZJC 4U1IA 4U6TA 4HCRL 1BGXL 3SDCC 3TO4A 4C54A 4HS3B 3ILPB 5KAQF 3B9EA 1RZGA 1GZQB 1K6QH 3DWTA 3WD5H 5HYJD 2FX7L 5I1DB 2VABA 1A47A 2XKNB 4OT1L 1NMAL 4R2GD 2Z93A 1EHXA 4JKMA 4XAKE 2B2XH 4XPGH 5ALCH 4DZ8A 5C08B 4UAOB 5JW5B 3HR6A 2CR6A 4QRQA 3U4BH 2CXGA 4X7TB 1WQVT 1QYGH 1HHKA 5B4MD 3HKFA 2FX9H 3KLHC 2DB8A 2YMXL 4E41D 1BIIB 1QFHA 2NX5B 4I5BA 2EDBA 4HG4J 1EMTH 1LO2H 3DURB 4R4BA 1L0YA 3C5JB 1KELH 2BY1A 3D69A 3LH2L 5LQBL 2AJSH 5ADPL 2DYPD 3VW3L 5JZ7D 5IQ7L 1HHGA 2Y5TB 3C08L 3MLSL 5F9DC 4NQEB 5IWLC 5E03A 4U1MA 1EAJA 3HZKA 5ID0B 2IF7A 3O4OB 4QT5A 1YEJH 2Y6SC 3SBWA 3ARBD 1O7VA 1ORQA 2Y1VA 2OXHA 4RIRA 5EU6A 5IK3B 5C0DA 5I1CL 2VITB 5D1QB 4U1KA 3RY5A 2EEBA 4XP9H 1JV5B 2Y06H 4OFVA 3QYCA 4FOMA 1PX3A 2NNAB 2A1WL 2AQ2A 5ESVB 4L3EB 2CDEB 4OFYD 5AZ2H 1WWWX 1JWMB 4YHZL 3BW9B 1UWEL 4FFWD 4XC1L 2DMBA 4V1DD 3CAFA 4L9LB 4I0CC 4JFFA 4A6YL 3C5SB 3KJ4C 2COQA 3E1F1 4QHUA 1X3DA 2NY1C 3VA2C 4BFIA 1U58B 4OZFB 4U1SA 4O4YL 1I1YB 4NRZA 5C1MB 3TV3H 2Z31A 5KVGH 3JTSA 5EU6D 3MV9E 4DVRL 3VXRE 3QQ4A 1BAFL 1RVFH 3BZEB 3BYYA 4JFYA 5D7IA 3QEQE 5DUBA 2BNQB 3W9DA 3MFFB 2QLVB 4KJWD 4DEPC 5GS0C 2E8ZA 1U8OB 3U36B 2BXYA 2QJDA 5KTEL 1J0YA 2YS4A 5L0QC 3MQIA 3WL9A 3CLEL 4EI5C 1QRNB 4NO2A 2Z8SA 5D1XA 4PRIB 1DVFB 4QTIL 5CSZA 2EE2A 4ZOEA 5D7SL 2DKSA 2WWMC 2X4SB 3LSOB 3MFGB 1X4ZA 5T3ZE 5I30L 2ENYA 4ETYA 1RJYA 5TDOB 2XFXB 1BD2B 4CADA 1EHLL 4YDIL 5DJZB 4PJDB 2VXUL 2HWZH 3N85H 5EDXA 2DI7A 5D7JA 4GBXA 4ZD3H 1H0DA 1NC2A 1L7IL 1JNHA 3QIUD 4OSUH 1FV1B 1WT5C 4X6BA 4F7PA 3L3DB 1LO0H 2ZOKB 3QUZC 3M45A 1CT8B 4CU7A 4L8DB 3E3QE 2HTKC 3WHXB 1AGCA 4Z7WE 4MD5B 1DUYA 4PJFF 5HVGB 3GKZA 1AO7D 4P5TB 5E6IA 5JHDB 4GG6F 3UTSD 1AJ7L 1F3RB 3O4LE 3BP5A 4L4TA 2NR6D 3G6DH 4GAFB 1VDGA 3OTTA 2VLJA 1X6LA 2X10A 4L9LA 4TNVF 5FUOL 1BX2A 1PGRB 4Q0XH 4DAGH 2FATH 3AC0A 1I1YA 1MWAH 1JHKH 5IB4A 3IKKA 4ZXBD 1N3NB 2ED8A 1G6RL 1MOEA 3KYMA 3BN9D 1S78C 2MFNA 3PXHA 3S37X 5KN5A 3IDNA 2C4FU 2YKLH 4ZOAA 5LWYL 5J3HD 1U92B 4HSQA 4QWWD 2F53E 2VN4A 3EJZC 2PETA 3P9LA 5D8JH 4JQVC 4I5BB 2YD7A 2Z4QB 3EOBA 3DSFL 1U93B 3N1GC 4LSSH 3ARVA 4WY7L 1E4WL 2X6MA 4RGMB 1BZ9B 4OCLC 3GHBH 4WTZA 4M1CD 3ZDZF 4OZHF 1LP9F 3B3IB 5F70A 3WE6B 1HHGB 1JK8A 3TPUA 1X5GA 1BD2A 3U7YH 3WHE0 2B1AL 3B2VH 4PJ9C 2ADGB 4U6HB 4KQ3H 1HHHA 5EBLB 2W60B 2I27N 3RKDD 3TNMB 5I15H 1MFCH 3HZVA 5AWNH 4UTBH 4NT6A 4GW1A 4PB9L 1QSEB 4MXVF 3JV4B 4JLRA 4OLYH 5JA8B 1TTUA 4UQ2A 2R69H 3IDXL 3TN0C 3RWIB 5IEHA 4MCZA 4PREB 5KS9A 3DGGB 3FB6A 2W9DL 1GGUA 4KDVA 3RWDB 4BH7A 1LEGB 2X4OA 5TGBB 5E70A 5C09D 4OZFG 1SHMA 5DD5H 1F58H 1LO3L 4S0SD 4URTB 3F7PC 2W1NA 1ZLSL 2VLJB 1NCNA 3BPCA 4NQVB 4L4JA 3I50H 4FTVB 5HHOA 1C08B 1EH9A 4PJIB 2QADC 5D7LD 4KK9C 4CKVX 3FB8A 2JIXA 2XRAL 5ERWB 1WZMA 3ZKNC 3QUML 5HI5D 5IHBA 1Q0YL 1P5UA 3BPLB 5FYKL 5MEOB 1U92A 3C9NA 1BJ8A 5FB8A 1CGUA 4Z7UA 4LNRA 3U1SL 4QOKE 1KENL 3QCUL 1W72A 4O9HH 3DXAB 2X9WA 3RIAK 3DX8B 4K55A 2AJXL 3S36X 3V0VB 5GGVL 4POZC 4NJ9L 4OZIF 4FQHA 1EO5A 2GJZB 4IRJA 4DGIH 3VFTA 1PG7L 1ZGLB 1XAUA 4R2GB 4MX7A 3QCTL 4RGND 5KJRL 1HZHL 2R23A 3PP4H 2NY3C 5I1EH 4X80H 4HUXB 4TPRL 4XP4L 3PGDA 5E8EA 2IAMC 4U1GB 5B3JF 1LDPL 1MCLA 3BD4A 3BOVA 2EEAA 3CU7A 3RVXD 4Z78B 5AG8A 1JFQL 2OZ4A 1XT5A 1LNUB 5D1ZD 1KACB 4PJCE 3ZDXE 2MTPA 3BVNB 4O51A 3KAAA 2DDQL 2Q6WB 5SWZE 5KS9B 4L5FH 4J4PC 3VWKD 4P5TA 4LLMA 4JRYA 4M5ZL 1AD0A 4L4VD 4MZ2A 5C92A 5E99H 3LZFH 4M93B 3SE4A 2Q76B 1WFUA 3CFIC 1MCOL 2QEJA 3MUHL 4R0LA 3G08B 5CJ8A 4XVJL 3UAJC 4TSCL 4R4FL 3RPIB 5JMRA 5L2JB 4A2MA 3OKEB 2R1WA 4JZNA 2QHRL 1H8SA 2GJ6A 2V7HB 4PLOB 2W9EH 2G2RA 2X2YA 1A7BA 4YUEL 4W6XB 4WI8A 2FO4A 1DBAL 4ZYKA 1WZ1L 4G6KL 43CAB 1U3YA 5AG9A 5TPWH 4HWBA 1DP0A 3GHEH 5F7WC 5SX5K 3SGJA 1X4YA 4R97C 5DLML 1NCAH 4K3DL 2UVEA 1AGDB 1IGTB 1BM3L 2H6PA 1RJZB 3F12B 3SGDH 5IOPA 5D1QA 1RK1B 2DI8A 3K2UH 3HNSH 5I9QC 4HUWA 4PJ8C 3CH8A 4OGXL 4UBDC 4NO0A 5AUMB 5GS1C 5I6XC 3QXAA 4LLUB 3KPMB 5IM7B 1OY3B 1INDL 5DUPH 3OF6A 2ED9A 1KV3A 4NO3A 1KJ2H 4ODBD 3KLSA 2WP3O 3KPOB 3GMNA 5F89B 3KLAB 4M6ML 3GIZH 1FFPB 3A6CH 2QSCH 1FN4A 4RZCA 3BQUD 1V5JA 5JOPD 1JF6A 1AXSB 4WU7B 2X4NA 2EC8A 2Q8AH 3WS3A 3OR7B 4PRAA 1HNGA 2AGJH 1LEGA 2VB5A 3HE6A 2X4OB 5TGBA 4P4KA 3FHQA 4YQXL 3C8KB 5T1KA 2LAAA 1DQQB 2Q8BH 1ACZA 3PWNB 1R5VA 2XXMB 5GHWH 1FL5A 3HNVL 4WO4A 1AGBB 5SWQA 1T21B 1ZA6A 1QRNA 4E41E 5BZWA 2Y9RT 1YY8B 4R0LB 5TQ0L 1G7QA 1FNAA 1CU4L 4LVOC 2BVQB 4KY1L 1Z5LB 3MRQA 1CU4H 1LILA 5TQ0H 4ZUUA 1CGVA 3UXFA 3DVNA 3CPLB 3WNOA 4N5ED 3HNVH 1KJ2A 4LU5L 4UIMA 2DLGA 5GHWL 4IRJC 4I2XB 3V8CA 5DVLA 5BOZG 3RWFA 3ARXA 1A1NB 3DYMA 3QH3A 3X3GH 5T3XE 4ZO7A 1U8IA 5IW1A 1F3DJ 2AGJL 3V0VA 3GSWB 5BV7L 5JZ7C 1E28B 4RMWA 2QR0A 4XVTH 1Q9LA 1U3JA 4Y16C 2UY7A 1OP5H 1YN7B 4Q6IC 4AT6A 2HT2D 4MX7B 2PYEE 1MAMH 2JK5A 3GIZL 3QIUB 3MOAH 1O7SA 5KZCD 1WZKA 1RZIB 2XKUA 1INDH 1U95B 2CDFA 4O2FA 3QPQC 5FF6B 5CEYB 3FO2B 4OGXH 3QO0B 3B8SA 2D31B 3VXMB 4OZFH 4FQLH 3K2UL 4NN6C 1JPTL 1QFWM 5F7MC 2AJUH 1MHHB 4JKPH 1BM3H 3U0PB 4K3DH 4PJ8B 1G7JB 4YDLC 5DLMH 2AK4A 4U0RB 5T1KB 5C8JA 5CJOH 3P9LB 3GHEL 3PP3K 1EXUB 5CKAA 2GJJA 3C6LA 5TPWL 5C0JB 3BP7B 5H8DA 3HG1B 3RWGA 1QBLL 1AGBA 1DBAH 3X12B 4WI4A 2AXGA 4YUEH 2W9EL 2WLYA 3EDKA 5AAWA 3RTQD 4UV4L 4PJXF 2LQRA 5FYJL 1Z5LA 1E4KC 4R4FH 2XICA 4TSCH 4W70A 4XVJH 3JZ7A 1KNOB 1MCOH 4NM8L 1B4JH 4P3WA 4ORGA 3LZFL 5E99L 3ORJA 1UM6L 2W59A 5DZLA 4ELMB 4PPTA 5FA4B 2NY1B 3IF1A 3FRUA 2G5BA 3QNZA 3GI8H 5EULV 1NFDB 1NLBL 3S37H 4HKXA 4OZFA 4U1SB 4DUXA 3HUJE 1K4CB 4ZOCA 3H7BB 4NN5C 4FTVD 3VI3E 1JFQH 3BPNC 5IHLB 1QFWI 3VFNA 4G6FD 3EDJA 2HG5A 4TPRH 1ZLVK 5I1EL 4GLRI 1HZHH 2FHCA 3QUZD 3QCTH 2ICES 1FN4B 5I16A 1PG7H 5GS2H 4NKMA 1AQKL 1QNZL 5D1XB 4JJ5B 5E2JA 1C12A 4M02A 3CDFA 1CQKA 1L6ZA 5GGVH 4LGSB 3U0PA 2AJXH 2C1PB 2XFXA 1UH3A 1A7QH 4BYHA 4J3WA 3ELAT 3QZWG 1FC2D 4N8PA 1IAMA 3U1SH 2G60L 3VXPA 1RK0A 1VEMA 3BP7A 4XAKD 2DD8L 3ZE0F 4EDWL 5FYKH 2BVTA 1J1OH 3D3VD 1Q0YH 3BO8B 2L7JA 5CJQL 4CU8A 2ERJB 3KPNB 4FQJL 1JGDA 4G8IA 2O5ZL 5DTFA 2ORBH 4X6BB 2XRAH 4JN1L 5J56B 3EJZD 1F5WA 4PLKD 4OUUA 1EO8H 2VQ1A 1ZS8A 3OKLA 3I50L 3QDHA 5EU4B 3MLRH 2NY2B 4UIMB 3TA3D 3FN0L 1KCVH 2ARJA 1LO3H 5F9OH 4M3KB 5DD5L 4BSJA 1GC1C 3C87A 3K8KA 5AZEH 4Z78A 4ESKA 2BCKA 3LKQA 4WVRA 3BDBA 4XI5D 3FOMB 2FL5A 4U1KB 1G6RA 3EJJX 3IDXH 3O45B 4GMSL 3FQXA 1RSFA 2BY2A 4OLYL 4PB9H 4Q58C 4TUOB 2YD4A 5AWNL 4DK6A 1J8HD 3MXVL 3JWDL 1UB5A 4JFPB 1XF1A 4KQ3L 4OZIE 1IQDA 1NC4B 2B1AH 4GXVH 4LBEA 2WWKT 3OB8A 3U7YL 5IHUH 5C6TH 2VDKH 3CVHB 4IS6B 4QGTA 1MJJA 3IXAA 5HI3C 4WHYH 4JHZA 1RY7B 2BOBB 2CKBA 4MA8L 1I1AA 4R7NB 5L2KE 1E4WH 3S34L 3VFSB 4LSSL 1BVZA 1DUZB 2BNQA 3W9DB 3O9WC 4MJ4A 5D8JL 3ARZA 4AY0A 5HYSB 4KK9D 1WIUA 1OP5K 5LAXA 1ES0B 4CUCA 4LEXH 3UTSA 2ESVE 3X12A 5L9DL 2CLZB 4NUJB 3GMQB 2FGWH 1KUMA 1QA9B 3MYJA 1G6RH 4C83B 4AL8H 1WIPA 4IM8A 4P5MB 3IDMB 1JHKL 3EYOA 2WNGA 1NAMA 1C16B 2E7HA 5KSBB 2XWTA 1EEQA 4DAGL 4PP1C 1ULVA 5JXEA 3ULSB 4Q0XL 3V2AR 4EQ3A 4V1DA 1JF1B 2FYYA 4W6WB 2AJYH 5B38A 4X6CE 3VXNB 1B0GB 4Z0XA 4WUUA 1MAKA 1AJ7H 4Z7VA 4H0GA 5EU3A 2F53B 4PJHF 3WLWC 1V3MA 4FTVA 1C08A 1SJXA 5DWUH 4RGNC 1AP2A 1LO0L 3SGEI 1NJ9A 3OAYH 3QIBA 2P8PB 3QUYB 2PF6A 1L7IH 4HIHB 4JZJA 1HKLL 3QP3A 3QUZB 3BRFA 3ZDZE 3CD4A 1N26A 3N85L 2HWZL 1OTSD 1IGML 4Z95H 4YBLC 1CD1B 1NBQA 2BNRB 3QO1A 4L1DA 5BS0D 4DCQA 1UVQB 4LSQH 4JM4H 5T1LB 1KPVA 5D7SH 4G9FE 1C5DA 2CRMA 1XH3A 2VZUA 5HDBE 4YWGH 2CKBB 1XGRB 3GK8L 4Z8FH 5KTEH 1TQCC 4E0RA 4I2XA 2V9QA 3MUZ1 3PDGA 5JW4M 5E8OB 2EDTA 2BXZA 2EZ0D 3MNWA 3GSNH 4ELME 3MBEC 4PGCB 1BAFH 4L3ED 4DVRH 4QGYA 3VGGA 1QVOB 2WZPD 4U1HB 2ESVB 3HZMA 3VE0B 4C56D 5DA0B 3TV3L 3EYOB 4FMKA 4XT1C 4O4YH 1A3LH 3D25B 3LKPB 4XHJD 3TJEH 4YXKL 3L5JA 5C0CB 2NW2A 1EEUA 4XC1H 2VAAB 1UWEH 1KIRB 3EYVB 5DJXB 5FO8A 1B0GA 3GMLA 3O2DL 2CIKB 2DQJL 3RIFF 2VITA 4PJ8D 4UBDD 5IB3B 5TDNB 2Y06L 3DTXB 3ZKMC 4WV1C 1YEFL 1WF5A 4GUPA 4RAUA 4TUOA 3VXUA 5I1CH 2P8PA 4JFHE 1I85A 3QDME 4JZJB 3KHOA 5F71A 4YHYC 2O93L 1NLDL 2GK2A 3VXUE 1LD9A 1U8KB 4ODXB 2XTJC 3QUMB 3MLSH 5JA9A 4Y89A 1OHQA 1B2WL 1C5BL 3C08H 2V2XB 4F33A 4XTRD 5IQ7H 4WI3A 1FZKB 1UKQA 2XQYK 1IQWH 1KPVB 2AJSL 3OJMB 3DPBA 3LH2H 3BXNB 3CFKA 3T65B 1DDHB 3OWEA 1WEJL 3HI5H 3LKNB 1LO2L 4QRUB 4Z18A 3FB7A 3QNXB 4CADB 1MI5D 3U36A 1CGSL 3STBA 3MV7B 2M8XA 4PRIA 4LP5A 4POYA 5SWSA 1R24B 1ZTXH 3EYQC 5BV7H 1I8MB 4P4KD 4BJLA 4NN6B 4F2MA 3C5ZC 3DO7A 2H32B 3MNVB 3U4BL 4F7TA 1JI2A 3IFPB 1MHCB 3V6OA 4J4PA 4PG9B 4I2XE 1KBGL 2RFXB 3SGKA 2B2XL 5ALCL 4KKBC 5C08D 4LSRH 1NMAH 4OT1H 4CW1A 2FX7H 2E5EA 3C8KA 1GGBH 1K6QL 2A9NL 3VRJB 2CXKA 5HHME 2R39A 1KGCD 4HCRH 5GJTL 4OCYH 4U3HA 1FL5B 4GMTH 1JGUL 2B1HL 1WT5A 1MCBA 3PWPB 2FHFA 3C09B 4KDWA 3QHFL 1G0XA 3B2UC 4Q6IB 4HIIB 4OLZL 3SDXE 1IBGL 4JJ5A 3Q6GL 1A1MA 1FFOA 3S96B 5ESQB 4JPVL 5JIIA 3V52H 4R2GC 2P5WE 5BS0B 5FCUL 1GYAA 3FO0L 4S1QH 1OW0A 1OPGH 3L5XH 4FNLH 2BSED 4H1LH 1QR1B 2Z4QA 5TF0A 1D6EB 1V7NH 5J11B 4PS4L 4LRNH 3TBSB 4DKFL 4OF5A 4EKXA 1I8IB 5CHNA 2I07A 1EBPA 4WUUE 3D6GA 4LDOB 4AT6B 3MRGA 1A3RH 1MHPL 1VFAA 2AXFA 5HDQL 1WFTA 2HT4D 1UXWA 3H9ZA 3V6FB 3A0OA 5MI0B 2QQKH 1AO7B 5D1XC 3H2WA 1PJ9A 4BA8A 4XC3H 5HHQB 4LSTL 1MCQA 2HVKB 1G6RB 5F1NA 2ESVA 3VE0A 1N2RA 4NPYA 2H2SD 5CJXC 4OCXH 2BNQE 1FNSL 5C3TA 5FAAA 3FB6B 4OCRH 4WW2A 4KVNL 2IALB 4U6HA 4Y4KD 5DDHB 5DURB 4KV5E 5L2KA 1JN6B 2A74B 5CJ5A 3D85A 3HZVB 5F6HI 4ZPTB 3C6LB 4I0PB 3PP3H 2E9JA 3PWLA 5MI0C 4LPWA 5D71H 4KXZI 3VJ6A 2VDPL 1OL0A 5IEHB 5HGDA 5K9KA 3RQ3A 3BH9A 4QYOB 1FE8H 5I71C 4M4RA 4YHMH 4X5LA 5DRXB 1KNOA 5IW6A 2NTFB 2WUBL 4R4NC 1NUNB 3JWOL 1MPAL 4WWKB 1G7LB 1JPGA 3SO5A 3TO4D 3BPCB 4NQVA 1REIA 1XGYL 5DK3A 4Y2DC 5LGHH 3CFCL 5IBTL 3QIWC 1G7QB 5B22A 2C4FT 3TBYA 5F7DB 4HKXB 1A6TB 3O6ML 3VD5A 4HPYH 4K8RL 4KJYB 4OI7A 5IR1B 3PNWA 4I18B 3IRPX 3MACL 2MPAL 5FECB 3LN5A 1U8NB 4MD0B 4Q9RL 5BZDA 1G9NL 1XR8A 3MJ6A 3NMEA 4PJAE 3V5KA 4DGVH 4H88H 3KLDA 3QUYD 4RMQA 2MSPA 4GKOA 4OF8A 5L8KB 3PUCA 1LVEA 2VL5A 1I7TB 3V79C 1CF8H 4O2CB 4W4OA 3S3SA 4AK1A 3OPZL 1FGNH 3V4PH 3WHE1 4PJGE 3TA3C 3CUPB 1C12B 2V17H 2VLJD 4L8CB 3CCHA 1I7UA 5F9AC 5JQ6L 1IEHA 1FYHB 2A74A 4JO4L 5DZOA 2IPTL 4G80B 2A9ML 5JO5B 2VWEC 1OLZA 3QG7H 5EOTA 3WL9B 2D31A 3O2WH 4P23D 5DJAA 2VXTL 3O0RH 1QFPA 3VFRA 3MRFA 3ZTJH 1TZGL 4PP2B 2VJXA 2V5YA 3NOIA 4UDUA 4JO3L 4YLQT 3L9RB 5T3XH 4TTDD 5DZNA 2BFVH 4WUKL 2P8LA 3OAUL 1QR1A 4S0TD 1UH4A 2VLME 4KJPD 3FJTA 3L3JA 3WKMH 4GBXB 5C0CD 5KSAA 3IJYA 4ODTL 3MRIB 4DKEH 1FV1A 2DQEH 3PHSA 4HXAH 4QWWC 4M6AA 1I8IA 2Z31D 1CCZA 4KUZH 3WMSA 3MRNB 4N8CH 4NN7B 4YHYB 4QNPF 2BHZA 1NAKH 1ZWIB 1WFNA 1X5KA 5IM7A 2LVCA 1G9NC 1UB5B 4JFPA 1BF8A 4Y5VB 4B7LA 2X4PA 1WC7A 4Q97A 1DBML 2PCPA 3P77B 2Y36H 4GS7B 4KMTL 1VPOL 4XGZB 1NFDA 1FFPA 2MQCA 4IEFB 4EIZC 3AGVA 5E2WL 2C9AA 5HHNA 3Q2CA 5F1NB 3QQ9D 3M1BB 1S3KL 2MOVA 4NOBA 1ZHNB 1LQSR 1QBMH 4UT7H 5TH2A 3QCVL 5D7KE 5CIPH 3D2UA 2AK4E 4RBPH 5DDHA 5GRUL 3KLAA 3AUVA 3VWJD 3QXVA 4XP5H 2L0DA 5GGTA 4IOFC 1YYLL 1CLYH 4JG0H 4P59L 4IJ3C 4X4XB 5E8DH 2EDLA 4F33B 1ONQA 4N8VB 5HGBB 4YHLH 3MCKA 2UY6A 4P5MA 5K93A 1N59B 3RDTC 2NY3B 3T2QA 1FG9C 1DDHA 2R2EB 4KHXH 1NCCH 5ITFB 3WIFB 2YD8A 3QQNA 1MFNA 1MVUA 1A6WL 1PKQE 2PYEA 5CLTA 4UB0L 4UDUB 3AU1B 3FZUC 4X4ZA 1E27B 1D9KA 1RK0B 3JV6B 4AIZA 4KZDL 5C0CE 2Y07H 1CDHA 1R24A 2DTSA 1MHCA 4CDGC 1Q9LB 1OTUD 4D9QE 2NZIA 1EUUA 4ONFL 3TIDB 5A16A 4OIAA 1SY6L 4G9FB 4XVSH 35C8H 3QA3B 1UXSA 3AXLB 5I71B 2FIKB 4L1HA 1U42A 1A1NA 5JW3H 2DQCL 2J8UE 1YEDA 1SEQL 3QDJE 5GGTH 2F19H 3P4NB 1CD1A 2QR0B 3GRWL 4XPHH 3LKQB 1Y6NR 2NY0C 4UIKH 4HT1L 1YEKL 2V5TA 3C60D 3QAZC 2H9GB 3A67L 4WEBH 3SDYL 5EU7E 4CDHA 3WN5C 1C5DB 4QXWA 4JAMA 2HKFL 2PO6C 3NZ8B 1MRFH 2IAMD 5HJ3A 4JZOB 3BMVA 1AI1L 1DQMH 5MEOA 2VQTA 1F4XH 3U9UB 2F5BH 1W72B 5FF6A 3RWGB 1Q1JH 1JJUA 4ETQB 2UZIH 4X6CB 1VHPA 3IXTB 2AEQL 5C2BH 3VWKC 4XCNB 2VE6A 2YSSA 1UZ6E 2GJZA 1RUQL 5CHNB 4NQTA 1G7JA 3BP4A 4PV8A 5DA4A 2IJ0C 5HHOD 3STZA 4YC2B 3WFBL 1MREH 2B4CL 3V7MA 5GS0H 3HG1D 5EUOF 1EXUA 5I1JL 4XP1H 1CYGA 3LS4H 3UAJD 3E8UH 4WCYL 1CE6A 4XPFH 1RZJH 2R2CA 4M4PA 1J0HA 4RISH 4QNPE 3IDMA 3GZKA 3MLUH 1OF2B 2VR5A 4P57A 5EORL 1OAKL 1MQKL 3ARWA 5C0BD 4V1DB 4HIXH 1UXSB 3WBDA 5ID0A 4Z0XB 1INEL 4Y4FC 4OV5B 5FO9A 5D70H 3T3PF 4KROD 2N56A 2O5YH 3GSRB 3FONA 5FA3A 1OB1A 3HZYB 4PJHB 5IT2L 1S9VA 3QNYB 3ROOB 4HLZG 4QYOA 3GMOA 1R6VA 3K74B 1ZA3A 3KPRE 5D1ZA 1JNNH 1KN2L 4I0PD 3MLYL 5FYLE 2BSTA 5IW6B 5JNYA 2FO4B 1P69B 3LV3A 1QQDB 2NTFA 2YN5A 3LEXA 4P2OD 4MB4A 3MUJA 1A9BA 2QBWA 4U1GC 1TNNA 4U6VL 5ITBL 4RX4D 3QO1B 3OKOA 3BPOB 4AQOA 4PJCA 2VWEE 3KPRD 3R1GL 4WHTA 1G9EA 4NO2B 4XCNA 2NXZB 3P4MA 5FO7B 2JIXD 5GSVA 4F7MB 5EFIA 1YECL 1ZT4B 5DK0B 2BVYA 1IC5H 3E2HB 4M8QB 5DJYA 3QBTB 1QO3B 3VGHA 1M4KA 1S7WA 4HWBH 2X1OA 3CSBA 4OGYL 1NBVH 1VFUA 3KPNA 4R0LC 2ADJA 3MJ7A 4GRLB 4AG4H 2BCKB 1Q94A 4ZTOL 4HS8H 5IGXL 4RX4A 4JREC 3G04B 4K9EC 2Z92A 4HHAA 2HT4C 1NGXB 5MEQB 3EO1A 2BVPB 2GY7B 3FQXB 3KPLB 1UQSB 3R8QA 1RZJC 3FOLA 5E6IC 3LCYA 1JWSB 5T33H 5BS0A 4WDIA 1GGCL 2CIKA 4GFTB 1MELA 1ZSDB 3BP5B 3NABH 3DLQR 4F7PB 3X3FH 2FHBA 4ZXBB 3KVQA 2P43B 5HHOE 1YY8A 4PTTB 4C56E 2NMSA 1F4HA 4G9DB 4IRSD 4MDJA 3BSZL 3VRIB 4DJMA 1DUYB 3IXAB 4PJGB 1ZLVH 5EC2A 1ZLWK 1I1AB 4R7NA 1OVZA 1K5NA 3QDJB 4XCEA 5KS9E 3ARDC 3DURA 1AR2A 3CVHA 3ECBA 5TF1L 1BD2D 1XCTB 3BIKB 4FN0A 4ETQA 3OR6A 3IJYB 5HHQA 1AH1A 3UZQA 2OK0H 3IS1X 2DTML 1WCQA 4NO0D 2O61A 3OKDA 2HLFC 5FO7A 3ULVH 4HK3J 3MRCB 1Q9OA 4PLJD 4WJ5A 3X13B 2P42B 4N0FB 4Y2DD 2B4CC 3HZKB 2D0HA 5L2KB 4M9PA 3HC0B 4NZTL 4J6RL 3WLBB 3TT3H 1J05A 1H15B 2YPLD 1MAJA 5GGRB 5IIEA 5ACZB 1PEZA 1GL4B 3KJ6H 3IETA 1TQBB 4UT6L 1HHIB 1YEEH 4PG9A 1D5ZB 2MCG1 3WFEH 3BH9B 2CDEA 3FMGL 4HZAA 2XY1A 2ID5A 4ELKB 4PJ8A 4QF1B 4JO2H 5FGBA 3SE3A 2X4TB 2E9BA 1A2YA 1I1RA 1ZT7B 2E27L 1AGFA 2AJVL 2CO7B 4JFXA 4NNPH 1UWGH 5EU5B 4WDIB 5I0ZA 1JPGB 1G7LA 1CS6A 1K3ZA 3CVIL 4QHUB 3V5HA 4BFIB 1DSFH 4XBPA 5I2IB 3EJYC 3CXDL 1YNTA 4Y7MA 3S35X 3SJVA 2AXGB 4JGUA 4MCZB 4PREA 4N8VA 3SGDI 3VGAB 5TFSH 5JLZB 4PTTA 3UJJH 4OLWH 2YD2A 4JFHD 4JGMA 4K3GA 4U05A 2VLJE 3C5ZB 3ZHDA 4L4TE 5JPMB 5EH1A 4HGKC 3AROA 2PTTB 3CZFA 3LV3B 2VO5A 4KI5F 5IESL 1OAZL 4LCCC 4Z7WA 1KEMH 5DUML 4XNQA 5HHOB 5J1AB 4AJ0A 4Y8DC 2H2PD 1CD8A 3OKOB 2JIXB 1XH3B 5BCAA 1SJHB 4CJ1A 2B5IC 2EDJA 4M61A 4WI2A 4M7LT 1G7IB 4X7EC 2B8OT 4P2RE 4Z7UB 1ZT4A 2KKQA 4KJPC 5DK0A 3ZKXC 2F74A 1JMZA 3I9GL 5D7JB 3CCHB 4OB5H 1IKFL 1QKZL 1IGFH 1QO3A 5J6HA 3L6FA 4N0YH 5HGAA 5GRWA 4KQ4H 1MCSA 3QXDB 4U1HA 4G43B 3WSQL 3VH8G 2WW8A 3BKMH 4NPYB 4JFZL 3ZSSA 2EKJA 1X7QA 3QEQA 5D7IE 1HINH 2BNRD 1L7TH 3PWPE 1I7ZB 5IJVA 3QDGD 1AGFB 4NQDA 2FD6H 4N90D 4F9PC 3JVGA 1RIUH 4TVPH 2UUDK 1KEGH 4GW4A 3QQ9C 4IBLT 3NACL 1YDPB 2ZUQB 5C0RH 1N3NA 3Q6FB 4RMTA 1T1YA 1IZJA 5EZOH 4AIOA 3L3KB 5A1AA 1T4KA 5EWIL 2ZZUT 2GQHA 2R2HA 2NYYC 4YE4H 1A7NH 1MVFA 3ALPA 4Z7WB 4ACPA 4OD1L 5C0BB 5CJXA 3ULUH 3L5IA 1AGDA 3IVKB 4BH8B 3P11L 5EU6E 2AXJA 3KGRA 1GC1L 5HHNB 4ODHH 4ZODA 5DD6A 5CILH 1L9MA 5GISL 5L2KD 1A1OB 4NGHL 1MJ7H 3KPMA 3GSVA 4TNWK 1U8NA 4ELMF 4OD2B 3T08A 1N7MH 3I3DA 1DBJH 1RK1A 2H32A 1H15A 3DMMA 4PUBL 5IFHH 1CGXA 4Z7QF 1B3JA 1BQSA 3QXAB 1T0MB 4LIQL 4G8GD 3MCKB 5HYIA 2BOBA 4GQ9H 2YC1B 5DD1L 1EHAA 5J6GB 1AIFA 5JW4N 2R9HC 4PV9B 1BP3B 4PRAB 3LEXB 3WIFA 5ITFA 1X9QA 1WCBA 3KXFD 1C7TA 5IEKB 4LEOA 3DRTB 4NQDE 1KOAA 1MFDL 1R5VB 3LEVH 3V5HB 1XFPA 3PWPA 2VOTA 4NHUA 1X6NA 5I0DA 3SO3C 1Q72L 4M7LH 4HC1L 1T1XB 1G7MB 2EXWC 4JM2A 5DK2A 3MCLL 3S96A 2CLVA 3U83A 3VXTA 3F58H 3TBSA 1UH2A 2LAGB 1LEKA 3P4OA 4P9ML 3VGEA 3P4MB 4P4KB 2AQ1A 4LAQH 3UX9B 2UWEF 3MRKA 3V4UL 1NEZG 2CKBH 4HUMB 1XMWA 3S7GA 4RRPG 5EIVA 3DVNB 3FB5B 1BLNA 1ZANH 4JR9H 3A6BL 3NA9L 1AO7A 1T0NA 2NW3A 4P2RA 4PY8J 1SJHA 5KSAB 4OV6F 1DL7H 1HE7A 2J8HA 3S5LA 5E1AB 3IVKA 1U8PB 4EQ2A 1L0XA 4XPBL 3G04A 3CC5B 12E8H 3EYFB 2GHWB 5EB9A 2DQFA 3PWPD 5E8NB 5DD3L 4PJDE 5DI8A 1F6AB 1SJVA 4ZFGL 3QUZA 4YHNB 1IGYA 4MS8C 5TE6H 4AEIH 5IBUB 1IKNC 1MIEH 2ZUUA 4MMXC 1JYWA 3UJTL 1WC7B 3TN0A 2CMRH 4G6JH 3ULUE 4D0DB 4XWGH 3AS2A 1FNGA 4M6NL 3IXTA 5FYJU 5I9QB 1F6LL 3LRGA 4XVUD 3VFUA 4RMUA 4N68A 3RUGE 3SJVE 3MBXL 1NGQL 1AIFB 1F8TH 1FHGA 4KROC 1JZ7A 1J8HA 2CPCA 2OR9H 5HY9B 4GRMA 4NNYB 2FEDC 4X99A 3RKPA 1MJ8H 2R0KL 5IUSA 1U8LA 4LHUG 4M8VA 1IC4H 4FG6C 2XZCH 2JELL 4I77H 2YK1L 1G9MC 5IFAH 3SQOL 1HI6A 5EOQL 2CO6B 1KTDB 1LMKA 2R1WB 3RY6C 1EEZA 4QHMB 4JM2B 5DK2B 2WQ8A 1QVOA 2DM3A 5DC4B 3X11B 5GQBA 1QSVA 1ERNA 2ZUQC 1FG2A 4AEHH 4WJ5B 3GBNL 1F2XK 5IR1A 5DS8B 1ZK9A 4Z5RB 1T7VA 1J5OH 3KPPB 5TQ2H 5H37G 5DJXA 5FO8B 4J3UA 3HCVB 3C2AL 4M9OA 3FRUB 3WLBA 4NCC2 3TBYB 1HNFA 5I17A 3UZEA 2DMKA 1S9YA 1V7ML 3KYOB 5INDA 4NZUH 4XXCC 2IGFL 1BMGA 2ATPA 1K8DB 1VSCA 2E7BA 3SDDA 2DJUA 2DL9A 3VXUB 5FA4A 1OD9A 4FQ1H 4HS3A 8FABB 3ZE0E 4HEME 1LO5B 4OD2A 1YQVH 4GAYA 2ENSA 4YGVB 3C5ZD 3TT1L 3PJSA 3RBSA 5CGMA 2UVFA 2VDLH 4OM0L 1SQ2N 4BKLA 3HA0A 4ZG1A 2X4NB 1GAFL 5J8OA 4FFYL 1DBBH 4JEGB 2NCMA 5HYEA 4C56A 4KKAD 5D7LA 2RHEA 3HE6B 4RWYL 1MCNA 1I7UB 4HDIA 5C09A 4GRWF 2AV7A 3RUGB 4LF3B 1AR1D 4TULL 3ARFD 3SKMA 1RIVH 4M7ZC 1FNHA 2BVOB 2P5WB 5BS0E 2EYTB 4UOW0 3KR3H 1XGPA 4IRSC 1RU9H 2D7QA 4DN3H 5ICYA 1DBKH 4PD4K 4PGZA 2ADJB 3RA7L 3BMWA 5FM5M 1FBIH 2VE6B 1OQOA 4Y4HC 5F9JA 1QOKA 4FRWA 3I6LD 3E6HA 1JRHL 4DKDC 1EHNA 1AQDA 3GSQB 3IS0X 2OL3L 4R9HA 4HJJL 2BVPA 3EO1B 2VDOH 3IAPA 3K7UA 2D2OA 5DD0H 4F15B 2W0KA 5DS8A 4Z5RA 5EZIH 4ODWB 3MGAA 1WZLA 5IROA 3ZE1E 4ZUSA 1RQ5A 1ZLWH 4MAYD 2D7OA 2VQ1B 3QFJD 2R4RH 4LK4A 4PLJC 3CC5A 2EYSA 1HKFA 2RQ8A 4QHKI 5AYQA 1MFEH 2ITDA 5ESQA 4NC0B 3MRRA 3G6JE 1MFAL 5IB5B 4UTAL 3H9HB 2XT1B 1IGYB 1YNKH 3T04D 2QKIB 5I1DA 3IJHA 5DGRA 2DIBA 4YGVA 5AD0B 4JFFB 3DRQB 2XNAB 2FL5B 3RJQB 3FO2A 2CK0L 1BJ1H 3OKNB 2YA1A 3KPRA 4YJZL 3EYUL 3OR6B 4XHQA 3EOAA 4P3CH 3EFFB 3D18B 4OD3H 3KG5A 4I18C 1NGPH 1KXQE 4MQSB 5A3IC 4UMGA 4PR5B 3ES6A 5I1GH 3RVUD 1UM4L 2V5SA 4LPYA 2EDYA 3NCMA 3O3BA 1CDIA 1DUZA 4LQFH 1UWXH 4N0FA 4FXLA 5IP4A 1I85C 3B43A 3V6ZB 4NFBA 1D5IH 4CL7A 4H1LA 4U6XB 3MLZH 3BKYL 2A77L 3AREC 1S7TA 3X11A 2Y5TA 2P45B 3ZT7A 3GSQA 1BQUA 1T7WA 1LO4H 3AU1A 5CP3A 1BFVH 3R0MA 1TZIB 1VA9A 1W8OA 1MCWW 1EDQA 1NL0L 1P7QD 1VGKB 2KQNA 5IBLC 1FAIL 4K3JH 1A2YB 1ZT7A 2BJML 5DQDL 2DIJA 4XBEL 3VXOB 4P9HL 3VXQA 2MWCA 1BVLB 4KTEH 1IGIL 3MJ7B 4S1RH 5EU3B 3DROA 3H7BA 1NBYB 3MLVL 3CMGA 1B4RA 4HHAB 5MEQA 1NGXA 4QRRD 3CK0H 3QIBC 2R29L 4F7EA 4FQ2L 3C5ZA 4S1SH 1K2DB 3P0YH 3M17A 4OCSH 1KIUA 4PB0L 1C1EH 2J7LA 2HG5B 2VSDA 2AK1H 2VN7A 4L29A 1KG0A 1VENA 5FHAL 4LLDA 2AJZA 3RNQA 3PJSB 5AD0A 2R0ZL 1AGEA 3LMJL 2DQIH 4ZTPL 3BT2L 5JPNA 3W2DH 2VZSA 4NN7C 4ZAKD 4JDZA 2D7NA 3EOAB 1Z9SA 2F5AH 3ARGC 5HJ3B 1A6TA 3BZEA 5HHXL 4TOYL 5B21A 3OF6D 1T83A 3FT2A 2AABL 4RAVB 5EC1B 2XN9A 3CMOH 3ES6B 3RU8L 4JPKL 4JPKH 3KLHD 4HZLA 3CMOL 3RU8H 1D6VH 1K5NB 3QDJA 4EUPA 4LHUA 4M1GH 2J8UA 2EYTA 1B0WA 2F5AL 4P23C 5BW7C 4N0UA 1YUHB 1XCTA 5HGAB 3VMOA 4P46C 1IAOB 3W2DL 1AE6L 1NCDH 3MGOB 3BT2H 3PV7A 1CLCA 3LMJH 4DQOL 2NYYD 1T7ZA 3OKLB 3T0XA 4PJ5D 1BBJB 1FYTE 1P6AB 4PRPD 4XZUA 2GFBB 3SHSA 1P1ZA 5C0CA 4GH7B 3P0YL 4OCSL 1VFBA 4FQ2H 4Z6AT 1PKQA 2Z31C 4JRXA 3MLVH 2Y6SD 4CGTA 4NSKB 3ULVD 4S1RL 5EOTB 4OI9A 1OB1B 4HXBH 4WFEE 4WV1A 1U6AL 4KAQL 4M43L 4HAFA 4NQSB 4ZO6A 4XBEH 4Y2OA 1AXTH 3MRFB 5FKAA 1FAIH 2VAAA 2J5LB 1NL0H 1ORSB 3VFOA 2DLHA 4L4TB 1GCFA 1BFVL 4GRMB 4XX1G 1UCBH 4ALAH 4EUPH 1LO4L 1LD9B 1U8KA 1RHHB 2EDEA 1F6FB 1N0LA 4WTWA 2A77H 5H94A 3BKYH 3MLZL 3BGFB 3KNBB 2X9YA 2H3NA 1B0RB 4JRXD 1T20B 3KPTA 4P2YA 4C58B 4BFEA 1RAMA 1IAIH 4P0DA 1NFDE 1FL3B 2IH3A 4IRZL 3CFKB 3ZDXF 1UM4H 3CFDB 4HZLB 2HJKA 4LHUB 1CLOL 2VLLB 1CI5A 1U3ZA 5T3ZH 2P4AB 3EYUH 4KXZH 3RDTD 4MAUL 3DV4B 3B9KA 5JXED 2CK0H 3SCMB 1KJVA 3WE6A 5EFIB 4MWFB 2WWMD 3T0VA 3SDDB 2XA8H 1BBJA 3B9VA 2YC1A 5B38B 4MHHI 3JVGC 1I4FA 2IFGA 4X6EB 5GS1B 1RIHL 1MFEL 3MJ8A 4FS0A 5JUEH 4HLJA 5J6HB 3ZTJG 4F2MB 4GW1B 2BHUA 1BVLA 3S35L 4MNGE 3QXDA 3QIUC 3G6AB 2CRYA 1ONQB 4RMVA 2E7LA 1NBYA 2P5WD 4D0CB 3RJDA 3QHTC 1YY9C 1J1PL 4HFUL 2P5ED 5EZIL 1JZ8A 3AVEA 5KANI 3QEQB 5FK9A 1MIMH 3JUYA 3UYRH 5D93B 4MMZC 2VDOL 4HJJH 2LABA 1L9NA 1JRHH 4DCQB 4PJCF 4H5SA 3BWAB 1A7PL 4F9LA 3AS0A 1FBIL 5GJSL 5CBEB 3RA7H 2PO6D 4UILL 4YX2L 3SE9H 1A1MB 1FFOB 1DBKL 4PJGA 1K4DA 2A6IA 4DN3L 5B3JE 1ZVYA 2IG2H 4N1EA 5EA0L 1RU9L 3O8XB 1AQDB 3SE4C 4A6YB 4WFGE 2FEDD 4X8JA 1S78D 1RIVL 3MV7D 1Y0LB 2X44D 5FB8B 4FG6D 3K4ZA 2F8XC 1VFAB 4OAWA 3GB7A 3UTTB 4PJAA 4RWYH 5J9PB 3IKCA 1M7DB 1DBBL 1IGTA 5KSUB 2FWOA 4FFYH 5D72L 1GAFH 2NLJB 3H3KA 2O61B 1DQLL 1NKOA 5IIEB 4OM0H 1D9KD 4B5EA 2H9GA 1FIGL 1OCWL 3MRCA 5KANG 3TT1H 2QSVA 4PFEA 4P9HC 4XAWL 1YQVL 3K0WA 4K9EH 2NTSP 3OL2A 2OTPA 1HILA 3OAZH 4ELKA 1VFBB 5LBSH 5FYLL 5GS1A 3ULUF 1FSKC 1UB6A 2IGFH 5IJKA 4NZUL 4X5XB 1IT9L 2EECA 3G6AA 5CS7A 5F1IA 4M48H 3WS3B 3C2AH 3QDMD 4Y4FD 3FQNA 1J5OL 1IFHH 3RHWK 1CLZL 3PWNA 3T0EB 2BOCB 1IARB 3HE7D 5EPMA 4XBPB 3RY4A 4RSVA 3V6ZA 3VJ6B 4YXHH 1AHWB 4LHQB 3UTQB 2V2XA 5HPMA 5FUCE 4LPXA 5I8CB 2WWKO 4GRWB 5IQ9A 5EOQH 4YFEA 3OKEA 5IFAL 4YBHA 4I0PC 1Q8MA 4R96A 2JELH 4I77L 1IC4L 4HIJA 4MQ7B 3T65A 1KCSL 3CZFB 5JHDE 4HS6A 3CDCA 5HI5C 3WJLA 1MJ8L 2R0KH 4YBQC 4WWKA 1KTLB 1NGQH 1TCMA 3MBXH 5FECA 4CMHC 4JPIB 4C4KO 4OZHE 3V5KB 4MJ6B 1MHEB 3ZT6A 4PRNB 5KSUA 1R3KB 1GGYA 3DO7B 4M6NH 4FXKB 4HC1A 4G6JL 5F1OB 5BO1L 2CMRL 3OHXB 3I02A 3PNWB 4OZ4A 2CRZA 2XTLA 2AKRA 5C0GA 3TVMC 3GMOB 4KI1A 5TE6L 5KZCB 2C3VA 1NDMB 4TUJA 3ILPA 1CK0L 5DQ9B 2Z8WC 4PJXA 3VFGH 4PJAF 4FFZH 2BVOA 2P5WA 3UMTA 3BX7C 1A6UL 12E8L 1U8JA 5E2TH 4MGXA 4GW4B 5ICYB 2IQ9L 4MJIB 2V5MA 3L3HB 1JYNA 3SDXA 3Q6FA 4JR9L 4U2YA 4L8CA 1EEYB 1ZANL 3ZDYF 5C8JB 3AM8A 1CFVH 5C6WH 1PQZA 2W0FB 3TESA 3MV8D 3ZMRA 2FNBA 3VI4E 1YJDL 2FLRT 4QLRA 4NWTH 3OQ3B 3MUGB 3REVA 3D69B 5IVXF 4HC1H 4M7LL 3VFRB 4YXLH 1Q72H 1K4DB 5DFVD 5D5MA 3RVUC 3V6OE 1FSKB 1A14L 1FZJB 2N7AA 4U3XA 2GTWB 4YPGA 5SWSE 4YEEA 4PRIE 3DOSA 1Y18A 5H2BA 3V6FA 5DD1H 2QKIA 3U7WL 4GQ9L 2HH0H 3HCVA 4LIQH 4G7YL 3ARED 4PRNA 4KDTA 4KMQA 5E9DD 5T5FL 5FUCC 4AYFA 2QSTA 4D0BA 3SGKC 4PUBH 5IFHL 4K8RD 4KI5D 3T0AA 4D8PA 5F72S 2ADIA 1T0MA 3M8OL 1RZ7H 5KBNC 5F96L 5JIKA 2GK0B 5BRZD 3T3MF 1MJ7L 4NGHH 3D85B 1RZIA 4O2FB 1SM3H 1U95A 4RDQF 4ODHL 5K9QG 1RHHA 2XIDA 1G1YA 4ODVL 2X4QA 1GC1H 4RFNB 3F8UB 4MXWL 3QDMA 5JHLH 4Y1AA 1II4E 3P11H 4NKMB 3HI1A 3GUTA 3OV6A 5F1IB 3BQUC 2OQJA 1Z3GL 3RFZC 4OD1H 1DCLA 3SDXB 5HGBA 1BZQK 2DQGH 2HRLA 3PL6D 4YE4L 1Q9OB 2IAND 4FP8L 1JHLH 3U9PH 5EPMB 3HC4H 4HWZA 3SKMB 1AC6A 4OM1H 5EWIH 1BLNB 3THML 2FJFA 4WU5B 2UYLA 2GITB 4NFCA 3WFZA 2OMBA 3REVB 3CVHH 5GS3A 4R3SB 5C0RL 3RVVD 3NACH 5JQHC 2A6DA 4G8FA 1W8NA 3WJJA 3IETB 1ZKAA 4LDEB 1TPXB 4ZQKB 4TVPL 1RIUL 4YHKH 2GEEA 3O41B 2CLRB 1CXIA 4ELMA 3RZCD 1E27A 2H2PC 1HINL 3AXLA 4MHHG 2FIKA 2FRGP 4X6DB 3VDCA 3NIGF 4X6EA 4IRJD 1OD7A 3BKML 2EDXA 5GXBB 1AGEB 3LN9A 4FXKA 4PGJA 3O45A 1MLCA 4KQ4L 4U1LB 5LCVL 3G9VA 5DRWB 4G9FA 4N0YL 2W0PA 4TUKL 5L6YL 1QKZH 1IKFH 4E41B 1YEDB 3R06A 5IB5A 3UCRA 3P4NA 2X09A 3DYPA 3OSKA 5D9SB 3L3GB 2P8MA 3ULVC 4G7VL 1JGLL 4FZEH 3ZDYE 5HHPA 2QQNH 3VWKA 1CVRA 4HLZH 4Z7NF 1FDLH 1IAOA 2OQJB 5CWSA 3EFFA 4FQCL 5GZOD 4M93C 4RGNE 4Z7VF 3UYOD 1KTKE 4FTVE 2JCCA 1VEPA 5EOCL 5HY9A 3U30C 1OAZH 2VXSH 2BDNL 3L9RA 2VUYA 4WGVB 2N1KA 4Z7VE 5DT1L 4X4MA 1B6UA 4MA3B 4JY4B 3MMEA 4A2LA 4X6CA 1EPFA 2FJFB 3ZHLA 4OLWL 4LCYB 4V1DE 1ORQB 4RIRB 5EU6B 4JFDD 3C6SB 3W39A 3ZKQD 1JMXA 1ZOXA 5C0BE 4HBCL 4G8FB 2XA3A 5FYJD 1DSFL 1S7XA 4HMCA 3QR2A 1G7HA 1MI5A 5DEFA 3MA7A 3MUY1 1K8DA 2XTJE 5DEZA 4EVNB 1P7HL 4JO2L 3UTSE 3ZE1F 1JWMA 4DGYH 4X6DA 3FMGH 5C0AD 1KXVC 2PCPB 2XN9D 3BDXA 3MOBL 4GAYB 5JXEC 3QWOB 2WM0A 3NAAH 3KJ6L 1U8HA 3T0WA 3NCJH 5KSVA 3H7LA 4BKLB 4UZGA 2H3NB 3TT3L 3CFJA 2OYPA 3NIGE 1F11A 1HQRA 1S9VB 3NCYP 3SDDC 4WW2F 3DUHA 3L3KA 4OIBA 2FJGB 3FTGA 3LD8C 4LCUA 4RMRA 5ICXA 4UV7L 4XPTH 5T1MA 2B39A 2BOCA 3O3UN 3ULVL 3CFDA 3GSRA 4LSPH