2DQFB

Crystal structure of hyhel-10 fv mutant (y33ay53a) complexed with hen egg lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDAWSWIRKFPGNRLEYMGYVSASGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 114
sequence length 114
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqfB00
1FJ1B 1TTGA 3QG7H 4XRCB 1RAMA 1OHQA 5E6YA 3PV6B 4PJDE 1ITCA 5SWQA 5IFJB 4P5TB 2PETA 5JW4R 3RPIA 1AFVH 2Q86B 3P4MA 3X13B 2C3VB 2APWA 1AO7E 3X3GL 1CLOL 5FYKH 5CEXB 2DYPB 3MBED 1DVFC 4U2YA 4PLKC 4YQXL 1XGYH 1YY9C 5IQ7L 2P43B 4FABH 1OD9A 5I1IH 2A2QT 4UV7H 4HS6A 3SGKC 1QRNE 4R3SB 1W0YT 2JJTA 3SKOA 2JK5A 3R4DA 3C5SB 1GPOL 1PZ5A 1L7TL 2Z92B 1YQ2A 4WJ5B 5CEZE 3DMMB 3BSZH 3G6JE 3JV4A 4X7TA 4NCDA 1MHHA 1JFQH 1JP5A 3C2SA 1IKNC 2OQJA 2RQ8A 3GBLA 4E41A 3VXTA 4PRID 5B22A 4NKQB 3C08H 3CVIL 3M8OH 4PRNB 4BZYA 1P5VA 3BMVA 4YIQB 3HPLA 4QWWC 4X4XB 5KJRH 4UTAH 5DMJB 4JRWA 5C0CD 1FLRL 5EU4A 3NCEB 2QJDA 4MXVF 4JRXA 3RUGA 1I8LC 5I1KL 2MQ3A 1XF1A 5DC4B 5EUKA 5IVXE 3DROA 3RL1A 5E5RB 2YS4A 4DCQB 4K9EC 1QRNB 2EXYC 1EZVY 5D6CA 1QHPA 4NGHL 4XB7A 5EUOF 1JV5B 5GGVH 2VE6A 7CGTA 32C2B 1U8HB 3QUKA 5FDWA 3ARDB 3MLTA 3BVNB 1XF5B 2V7NB 3MNWA 1A4JB 3G6JB 5KTEH 5KOMC 3BDXA 4KGJA 5JLZB 3O6FD 4QY8B 1YYML 1FORH 1KTLB 5E9DE 4NC1C 5ESQB 1A2YA 1Y0LA 5CBEA 4RGOL 4XP1L 2CLZB 2N1KA 3DX8B 2PXYC 2ZG3A 5F9JA 2F54A 5CEYB 2YKLL 1A6PA 2PYEE 1GZPA 4LSPL 2W0LA 4WHYG 5CMAA 1AKJA 5MENA 1GGIH 3RQ3A 3MFFB 3VFUA 3BN9C 2VYRE 1MNUH 4BSWB 5H35B 1CLZL 2ICES 3DUUB 3R0MA 3U79A 2A6KA 1KB5A 1TNMA 3UJIL 5F6HI 4HJJH 1BBJB 5IVXB 2XKNB 3FB5B 1F3RB 5GGRA 2P46B 3HE7D 4WFGE 1U8LA 3WFHB 3CFDB 5DA0B 2Y72A 2FR4A 2BP3A 3WV0A 3HS0A 5ALBH 4KHTL 4I48A 1QTYT 5EH1A 1IGIH 5EU7C 1X5XA 3C8DA 3LKSA 1S7VB 4H20L 2AXJA 5DJAB 4GAJH 5A2JH 5IT2L 4OQTH 5I71C 3PL6A 1UCTA 4NWTH 4JFPB 5E9DB 15C8L 5EOTA 3WUWA 4FQJL 4IRSD 4YR6A 1BJ1H 2FX7L 2BRRL 2FEDC 2Z8RA 3N85L 4RISL 4ZS7L 2PYEB 3H3PL 1CDJA 2DLFH 2QTEA 1P2CB 1YNLL 2EC9U 1KCRH 4HCRL 4L1HA 4NQSB 2VKWA 3MRJA 4ZO8A 5HHQA 1KBGH 1NAMA 2YUWA 1UJTA 4JLRB 2HG5B 4M6ML 1X6NA 4KVCL 5HI3D 5AG9A 5IROA 4MX7B 2OJEA 1A6UH 3BP4A 2OSLA 1QBAA 3ULSA 1K5NB 1NAMH 5FO7A 1V05A 4ZFOL 5JDJA 3TN0A 2IPKB 1SBSH 1A4KB 1WEJL 1MRCH 4I18B 2VAAA 3VXSE 5C0GB 1D5MB 1U58A 3K0WA 1BFOA 2NY5L 4M5YL 3VW3H 3ZYZA 3GUTB 2AGJH 2VQUA 3MREB 1A1MA 1RHHB 3ZL4H 4KJQD 2VR9A 4D8PA 1A7PL 4CUCA 3BPLB 4K8RC 4MJIA 3CSGA 3RL2B 4Y19A 5ESAB 2G75A 3E3QE 2CDGA 1SMAA 1WK0A 5DMIL 2L7JA 4LPWA 4XP5L 4PRDA 43C9B 4AEFA 1SJHB 5T3ZH 3PP3K 4IRZL 4ODTL 1FP5A 1DTUA 1G9NC 4PGZA 3RWCB 3K8LA 4E42B 4S2SA 4HIIB 4LSSL 5GZOD 4NZRH 1OD7A 5ECJE 1NDGA 2PO6B 5HYIA 1B0RB 1OCWH 4GSDL 2DI9A 3BP6A 2H2SC 4HEME 4UT6H 5TF1L 3BGMA 5SX4I 5EOQL 1JYNA 2H45A 4I4WA 3O45A 2NY1D 1GH7A 5CBAA 1PLGH 3SDYH 4JFYB 5CGTA 3VXSB 5T5FL 4JQXA 1EBAA 5I8CB 5DSCA 3U7YL 1KCKA 2NR6C 3X11B 5K93A 5H2BA 1AY1H 1SJXA 5TDPA 1FL6A 2BVEA 1DN2A 3VXRB 4GH7B 1CXFA 1RZJH 1DEEA 1NMBH 2X5PA 4PTUB 3KLDA 4HGWB 2DQFA 3QDGD 4LCCA 1AGCA 1DFBH 1XGUA 4P2CG 4X6CA 1KIQA 3VCLA 4S10A 4XHQA 5GGVY 4HWBA 2Q7YB 3GJEA 5F1NA 4KUZL 4UBDD 1LK2B 5D1ZD 4QTIL 4JY5H 5FM8A 1B3JA 2VERN 4Z7VF 3IDJA 3L5HA 1KCVH 3SOBL 3B4NA 2X9WA 5L7XH 5FM4A 4EQ2A 4PGBB 4HWBH 1MFDH 3FZUD 2D7MA 2YSSB 2O5YL 4AG4L 4BFIB 1F3DH 4FQXC 4MAYD 2ZUQB 3LQZB 4OBSA 5J8OA 3QYCA 2FLBT 3I50H 4ERSH 1KTKE 2BNRA 1S9KC 2PNDA 1IM9D 4ZXBC 4YHZH 1W8NA 5ANMA 4U0RB 1JN6B 5E8DH 1X9QA 4FNLL 1B9ZA 2EDBA 4XP9H 5MEOB 3LRSA 1G1CA 2B0SL 2IMNA 3IXAA 1UJ3B 3MLRH 5F88A 3DGGB 1P7HL 4XC3L 3GNML 3LOWA 5I1HL 2EYTA 4X5WA 3BQUA 1G7IA 4FG6C 1VFBB 3P0YL 1Q72H 1CL7L 1WWBX 3HFMH 4JFFB 4M6NH 1B0GB 4TSBL 4Y16A 4RGND 4WRLA 4WI4A 2IC2A 4FQ2L 2ZCLL 3HUJE 4KRNA 1I7UA 1OGAA 4ONOA 2R39A 5IGXL 1CDBA 3ECBA 5IJKC 2XZAH 4IJ3B 1IAIL 4M7KL 5B38G 2RIKA 5DJ2B 4R7NA 4PREA 5E24E 1J05A 3QUYD 3KXFA 4IRJC 1JTTA 4Y19D 4RRPG 1NCDL 2Q7NA 2YK1H 5HVHB 3MUGB 1A7RH 4GS7B 1S78C 5TQ0H 3VG9B 5FV1L 3VXUD 4JFHD 2BJML 1R5IB 2WLYA 3EJYD 4EVNA 1QLFB 5TE4L 2P5ED 5E2UL 1NCCH 2BOBB 1S9YB 4Q0XL 4HSQA 5ENWA 1KJMA 3QPQD 2CDEB 1JF5A 2EZ0D 1MCCA 3OG6B 2UYLB 4AEHL 5A2IH 1S7QA 5DFVC 1M05A 1J1XL 3K8KA 1N64L 3HUJB 3CH1B 5CP3H 5AAMA 2CXKA 5E6IC 5SWSD 4Y5XA 4YPGA 4H0IA 1CXKA 3UTSA 2VLKE 4Z5RB 3DBXA 4JB9H 2PTVA 1IGJB 3FKUS 2EYSA 3T3ME 3ZTJH 3VD7A 2QADD 3QXAB 2VLRB 1DQQB 4YK4C 2FGWL 2KL6A 2ATPB 5D5MA 4D0BB 2XXMB 4ZUUB 1MCWW 3MQIA 5I17A 3MUJA 5TE7H 1LK3H 2VXQL 2ZCHH 1TJGH 4QRUA 3MLVH 1T3FA 2A0LD 3BUYB 3EYFB 2PR4H 3VFSB 5C0BE 3QWQB 2J3SA 5C6PB 3QNYA 4JO1L 1IL1A 1VESA 3AXLA 2LAAA 1U8OA 5FV2A 4PS4L 3CFBA 4X5XA 1YC7A 1DSFH 1OAQH 3FQXA 2IAMB 2YPLE 3EOBA 4YHYB 3IDMB 4GKSA 4HLZH 4XCNA 1DBKL 3HNVL 3WFDL 3RWFB 1BVKB 4UT9L 3W5MA 3S97C 2UZIL 1A9BB 3WO3B 4MVBC 2JKXA 5C09E 4MXWL 5ICXB 3HI6H 3HZYB 3F65A 3TBTA 1NL0H 2VLKB 1U93A 3NCBB 1A21A 3S9DB 4YNYB 3IU3B 2I27N 2D4FA 4P4KD 4UT7H 3CX2A 4BKLA 2XN9A 4GG6E 2ZOKA 1BIIB 3QCTL 2CPCA 2GK0B 4XHJC 2P1YA 4HMCA 2V5TA 3O8XA 4PGCA 1HH6A 1EA9C 25C8L 1RFDH 2FJFB 5ADOL 3PABA 3G5XB 4OF6A 5IEKA 2LU3A 3ZE2F 1MQ8A 4D3CH 4RIRB 2I9TB 2FX8L 4I1NB 4MA8L 4P2RA 4LVOB 2Y06L 4JREB 1P1ZA 5T1LB 5C0BB 1IBGL 2WUCH 3MCKA 1VPOH 3MPCA 3VRJA 4YGAB 1ITBB 3D9AL 4M6OH 5C0AE 4O02H 4U1JA 5EFIB 3CFJA 4DGYH 3RNKA 3K46A 4KV5F 2YPLB 4R90H 4V1DE 5M94B 5J9PB 4Q6IA 2NZ9C 4YC2C 1I7RA 5L88H 2BRQA 1Z9SA 4QOKE 4YXLH 5C09B 3L3OB 1CE6B 2Z9TA 5CILH 1XR9A 1ZOXA 3BSZL 4M7LH 5T1MB 1G0XA 4FFVD 5HHOE 2NMSA 1N5AA 4ZO7A 4GG6B 4NWUL 3ARGA 1HKLH 5MERB 4AIZB 4DKAA 2Y5TB 2IWGA 1LO4H 2PTTB 3HI5H 4PV9A 5I8OH 3BZEB 2NNAB 3V9FA 4DKEH 1X5HA 3HG1A 3QRFM 2AXGB 3PWLA 1II4E 3GM0A 3QQ9D 5JTWA 1FG2B 4PUBH 5HDQH 1LO0L 3SPVB 2VRAA 4G9DA 2Q20A 4L8DA 3EZ8A 4K3DL 1AQKL 1QVOB 43CAA 3KPRE 3HE6A 3QQNA 1I1RA 3DYOA 3MRIA 2R2BA 4S0SD 1FVDB 3JVGC 2J2ZA 4HFWA 4TRPH 5EO1A 5C0AB 4L29A 3QO0A 1F4YH 2B1AL 1NMAH 3MRKB 3CDCA 1BOGB 1ZHKA 4V1DB 5L9DH 3BJLA 4NQXB 5JOEA 3CXHK 2X1XR 4JG1H 1WAAA 1I1CA 5HVFB 2EDDA 4KRPC 4QOKB 4D0CB 2JIXB 3UO1L 5FGRA 5DRXA 4NKIL 3TZVC 1YPZE 3MGOB 4O2CA 2I5YH 5EZIH 4JO3H 4LQFL 4XPTL 1WT5C 4IOFC 1T6VN 1VEMA 3RGVD 1YC8A 3P9MB 4NRYB 1FORL 1T2XA 3C6LC 4MD0A 5GJTH 1AXSB 3TV3H 2ATKB 1FL3A 2YD1A 3VWKB 3PWUB 2O61B 3NTCH 5F7FA 1J9CT 3B6SB 5EBLB 3SDXA 2A73A 3OZ9H 5BXFA 1EHLL 1G1YA 4CJ0A 4PJBB 5CUSL 2Q8AL 1INQB 3U2SB 5FKAA 2F53E 5HJ3A 2EH7H 1RUPL 1CI5A 1QEWA 3BIBX 4MCYB 3KPRB 3OKDB 4HDIB 4OD1L 2AEPH 4H0HB 1JRHL 5CD3A 2HJLA 5E8PB 3QZWB 5ACZB 3LMJL 3MRBB 3VFTA 5D96C 3KPOA 2JB6A 3HC4L 5I1AB 4K94L 5ITFA 3JWOL 1KB5L 2DDQL 4HXAH 1NGWA 2NY0D 4KQ3H 1MCNA 1U8KB 2FO4B 5E2VH 3GMPA 5C1MB 2A6JA 1EVTC 1IAOB 4J4PC 3DRQA 1AI1H 5INDA 3FRUB 1YPZB 1S8DB 1U92A 1HILA 2GKIA 4OT1H 5E00B 3JZ7A 4LEOA 5AWNL 2BFVH 4PRPA 5DDHB 2ED8A 3HA0A 4NC2B 4FQCL 1FE8H 2NY7H 4OCWL 4X8JB 1X7QA 2SEBA 2GTZB 4G6MH 5HXMA 1WF5A 4U1HB 1PKOA 4XBGB 1T4KA 1HSAA 5EC2A 5J6HB 4CMHC 1DE4A 2LTQC 4U05A 3K1DA 3GI8L 4F7EA 2BHYA 2F53B 3BIKA 4GAGH 4GRWF 3UTPD 4JPWH 4LDLB 1KJ2L 3TA3B 3QCVL 1WCBA 2F58H 3STBA 5F1KC 4LSDA 5DJ8A 4NCC1 4ZYKA 4HS6B 3P0GB 4NNXB 2GFBB 3FFCE 4OF0A 4QRRD 2Y36H 3K8MA 4RX4A 3ARGD 1OGTA 4WI7A 1J8HA 4NNYB 5DVOA 4RMTA 3C09C 4CADA 3T8XA 4ZUWB 3EBAA 3KPMA 3HG1D 1G6RL 4ZFFB 2W59A 4GKOA 3FB7A 2YMXL 5D7LD 5HYJA 4KROB 5C0RL 4XWGH 2JJSC 3IRPX 2QL1A 1ADQH 3E0GA 3PWPE 4S1RL 1AHWB 4E41B 3LQAL 2EIZB 2X09A 3QDME 4LRNL 3ARBC 5DJYA 2H3NA 5DLMH 3ZKMD 4C54A 1EZVX 4OF3A 1UM5H 2BVQA 5E0QA 2FEEL 2YBRB 1ES0A 1INDL 2BVOB 5JUEH 1HHHB 5F6IB 4P5TC 1EUTA 1B0WA 1CU4H 3MA7B 3IVKA 5AD0A 5F9AC 5D7JD 5EUKB 3WYRA 2A1WH 3LN9A 3AVEA 4JN1L 3JV6A 2JELH 4LCYB 3SO3B 1MCQA 2A83B 1YJDL 3CFIC 4WCYL 5EC1B 4X6BA 5E6ZA 2OL3B 4MQXD 5ID1B 1FFNA 4GUPA 2ORBH 4POZD 1PQZA 2E7BA 2VLMD 4KMQA 2X4QA 4CAGA 2CKBL 4PPTA 1CGYA 1UB6B 1AC6A 1IILE 5BMFH 3PWPB 3DMMC 4XBEH 3GJFB 4CL7A 2V7HA 5DJ6A 4ZS6C 3ES6A 1I7ZA 4QT5A 1IGTB 3QDMB 2AEIT 3P11H 1QPPA 4WVRA 1CFNA 2HP4A 3S35L 3EOYG 4QRPE 4OLYH 1XFPA 3HLAB 4BH8B 1ZT1B 2YR3A 4Q2ZB 5DRZA 2L0DA 3NBNA 3T4AA 5IESL 1NUNB 2CIKB 2XPGB 4XNMA 5FCUL 4AZ8A 4ZAKA 3QEHB 1JHKH 2OLDA 4OAWA 1YEHH 1PEZA 3QEUB 4HWBL 3WIIL 1I8IA 3MV8D 5EDXA 3VGAB 4ZDHB 2YA0A 3ZKQD 3K4AA 3P2TA 3I50L 3CLEH 3N06B 4G6FB 3K7UA 3IDGB 1R3IH 1YEDB 1S7WA 1BQHG 3QUMA 4D0DA 1M6OA 4NBXB 4XNZB 2E3VA 1RK0B 3MLZL 4ZSOA 1HEZB 4R96B 5E4EB 3TYGH 2RBLA 4U6YB 1P7QB 5KVEL 4DW2H 3NPSB 1C8PA 5JW3H 3ARDC 3QUMH 4M93B 1FZKA 3KPSB 3LKOB 3NIGF 3QUZD 4FFWD 3AREB 5A1AA 5FUCE 3HNSH 4Y88A 5HHQB 3SDCC 1XR8B 3VFVA 4RMRA 1A6WL 5TH2A 2DLHA 5FYJH 4ACPA 1A7NL 5I75C 4HT1H 1HWHB 1I1AB 2DQHL 1OQOA 2GSIA 3P9LB 4PJDF 3PDOB 1U8IA 1ZANH 1YMME 3ILPB 4JM2D 4HH9B 1BVLB 1QFWM 3CSYB 3N1FC 1H5BB 1A3RL 4JHWL 5EULV 5DZNA 4D9QE 4KI1A 5HPOA 5JDSA 3OQ3B 3IFPA 1U95A 3WE6B 4CJ1A 1OTSC 3WSQH 2M2DA 3LSOA 2CKNA 2YZ8A 4KKCD 3WIHL 5ISZD 3FQUA 4LVHB 4QHMB 2XXCB 2YN5A 5HGBA 1T03H 3RWEA 4YPJA 5CZVL 2NXZD 1E4KA 1CD0A 3VGDA 1WWWX 4JFQA 4KKAD 4AYFA 1NUDA 5JXEC 4L8CB 1K9TA 1CDUA 5AYUH 5HGHB 4DKDC 5JHDB 3UBXG 1NC2A 3ULVC 1KEGH 4XNYL 4LCUA 1X5LA 4U1KB 2BDNH 1TENA 3ARFD 3G6JF 1JJUA 2WINB 5F7EH 5JQHC 4G6AC 2W9DH 2OR9L 4U7SA 5ID0A 3TYFA 3VFMA 3WXWH 2EKJA 1A02N 1D7FA 4WV1B 1JPST 1Z0MA 1BD2A 1X5GA 4ZUTA 5TE6L 4MAUH 3N9GH 1KG0B 1OAUH 3EGSA 1YMMB 1T0MB 4Y4HA 2ARWA 1NBZB 4JRYE 5FGBA 1K2DB 3SDDB 3ARXA 4LLUA 4NJAH 2X70A 5D2NE 4LF3A 4FQHB 5IB5A 4I18C 4EKXA 1UA6H 3PHQB 1F90H 5IVXF 1T21A 5DVMA 4FTVA 1FYTD 4YX2L 4X9BA 1AGFB 4RZCB 3OKLB 2FH8A 2OXHA 2Y07H 3O4LD 4HKZA 2DQFB 3MV7A 4B50A 5IF0A 4QHKI 4B7IA 3BPLC 3NCCB 3U7AA 5GSRA 3E6FB 4A2MA 4KK5D 2JF1A 2D31A 2VIRA 3L7FA 5CJQL 5DQJA 3GMOA 5F71A 2VITA 4MB3A 3SDAD 4E5XB 3KS0J 1X5KA 3M07A 5L6YL 3ULVF 4DJMA 4G8GD 3DJ9A 1HZHL 4PJ7E 5I19H 3T0ED 4KY1L 5BS0D 3LV3A 4JFDB 2P24A 2UV3A 1N4XL 3P4OA 3S3PA 1U8JB 1DUYB 3LQMA 5IM7A 4NIKB 4AT6B 2PO6C 4J6RL 4JRYB 5KS9B 2HFEB 1YEKH 3MBXL 4CW1A 1MEXL 3Q6GL 5D2NB 1A14L 2CD0A 5SV3A 1C12A 4Y4FA 1S7TA 2EC8A 4JFEE 3O6LL 1A7OH 3NPZB 2EDJA 2GUOA 3B9VA 5JNYA 2D3VA 3CXDH 4W4OA 5GIRA 3DYMA 3V0WH 1C1EL 4QO1A 3MCG1 4PJ9D 5JPNB 1ZEAH 2ICWI 4Y16B 5IBTL 2Z35B 1TXKA 4YHMH 4HBCL 5D7KD 2BNQD 4O4YH 3U9PL 3HMXL 1KCSH 3OJMB 4PJ5E 3E3QC 5E08L 3OXRA 3ETBF 1VFUA 4JKPH 1YEEH 4PJ7B 4HUWB 5I1CH 1CBVL 1UYWH 2UVFA 3ROOB 4BSVB 3DETD 5DK2B 1Z3GH 4UILL 5B38B 1WWCA 3T0VA 4R7NB 3B5TA 1MWAB 3C5ZB 2V6HA 1TJHL 1QO3A 3TIDB 3VWJA 5CCKH 4H5SA 4LCWD 4XMLL 4PJXE 5MEPA 4DZ8B 1GZQB 4H1LG 3RAJH 4KI5C 3F8UB 1KTDA 4OTXH 1T0NB 1QFHA 3TVMD 4NHUB 3BMWA 1Z9OA 5HHPA 4UNVA 1F97A 4GBXD 1MCEA 3TO2A 4JFEB 1KIPA 4H1LH 5F3BA 4PJCE 4HS8H 5KSBA 4U0RC 3MLPA 4LLAA 3JTSB 1RURL 3MJGX 4JY6A 1MI5E 3I9GH 1UJ3C 4TPRH 3JWDH 4H26A 5DRNB 1NMAL 3MRPA 1A3LL 1W8OA 1J0HA 3DTXB 4PJ5B 4LPYA 4OCSH 3ZKXB 1BX2B 1RZKC 4Y5XB 2BK8A 1I3RB 3KDMB 3P4NB 1A6TA 5IUSA 1J10A 1G7MA 1I1FA 4HXBH 4V2CB 3QWOA 4OUUA 3O3DB 5BJTB 3PGFL 2VWEE 3QEQD 1M1SA 4U3HA 5GISH 2CRYA 1TZHA 4FTVD 2HN7B 4IJ3C 4PJXB 5AUMA 2O5ZH 2VL4A 4P5KA 4YXHL 3EO0B 4QRTA 2NX5E 1Q0XH 3TH4T 2WUBL 4X6DA 5IHZB 3NTCL 1NFIA 1G0YR 1P4LA 7FABH 3SJVA 2O5XL 4G8IB 1WC7B 2GITA 5HVHC 3OZ9L 1RZFH 3FFDA 4GS7C 2A74B 3D3VA 1LE9B 3RVTC 2O93L 4PJEE 4XH2B 3VG9C 1LMKA 1MI5B 4P2QA 4KK6D 4MQ7B 1PW3A 3S35X 4R4FL 4PYGA 5CLTA 3FQXB 3WJLA 3QDJB 2FIKB 1YUHB 3KLAB 1IGCL 3MRHB 5EBWA 2CLVB 1P69B 1GJIA 1KFAH 1XCTB 3TPUA 5T3XD 2C3XA 1DLHA 5E2VL 1OP3K 4N90E 1AR1D 4YDVB 1S5IL 3LHPH 4G8FA 4RAVB 3NCMA 5DS8B 1QFWI 2AJVH 1V3MA 3O9WB 5C07A 2OK0L 5DR5H 1R5VB 1FNGA 3QIWB 1NFDE 2HLAB 2I60L 5F8QC 4JY4B 3QISA 3B9KB 3D85D 4AK1A 5IEKB 1TQCC 2NX5B 2AJUH 5TQ2H 3F7QA 4HUUA 3HR5A 2IG2H 4XZUA 3A67H 3T1FB 4JJ5B 2AI0H 2GEEA 4YUEH 2WWKT 4YZFE 1WZKA 1SEQL 3QIUD 4XCYA 3GKZA 1UCBH 2YZ1A 4O2EA 2NY2D 4TNVF 1SMOA 2PW1B 2NYYD 1UQSB 1X44A 1XAUA 4P3WA 1V3KA 3OGOE 4JPWL 4Y8DC 4LRIC 5J57B 5JXAH 3BI9X 3GSNH 4JKWA 4P0DA 4LNRA 5L2KA 3ARVA 2GCYB 3HZMA 4FQIH 4WI5A 4WTWA 3T09A 3M17B 2IAMC 4U1IB 2Z31A 4DEPB 3L95A 4YHYC 1KNOA 2D7PA 5JZ7D 4LVEA 4I0CC 4TUOB 4XP6L 1XR9B 1ZT4B 4LKXB 5HHVH 5EOCL 1IQDB 3OF6D 4LU5H 3O6KL 4HIHA 1S3KL 1PG7H 2XNAA 2BSRB 3MRMB 1T5WB 3HUJF 4WI2A 5JMOC 3O4OB 2AABL 2QQLH 3KHOA 3MRLA 3B2VL 4QXUL 4XAKE 3TT3L 4JDTL 3ZKNC 1HINL 3VI4E 5DHYA 2D7OA 5I1GL 1HHGA 5I16B 4WY7L 4O51A 1CE1H 4UINL 3C8KA 5LQBH 5JUEL 3ARPA 3GRWA 4L8DB 4HK0A 4QRSB 4XPAH 2CIIB 1DVFA 1XGTA 3CSPA 4KJYB 4LVOC 3TLRA 3VJ6A 1XGRB 1S7SA 4JREC 4ZUSB 4U2ZA 1BJ1J 5EUOA 2BHZA 3U0WH 3D39A 5IHLB 4PB0H 2R1XA 4HC1L 5F8RC 3IAPA 1QACA 3H9HB 2QKIA 2XA3A 3UTQA 3I6LE 1IEAB 3H9YA 5FOBA 4MNQE 2HTKC 3CLFL 5JQ6H 4TQEL 1U91B 1CIUA 4G7VL 8CGTA 5GS0D 4OV5A 2GSGB 3VFOB 5D70L 1RZ8A 4MJ2A 4Y4KD 3OXSA 1N8ZB 1IKNA 1WZ1H 4I2XA 1UWEL 3MRFB 5AYQA 1N59A 1NCWH 4Y2DB 1HNGA 2K7PA 3V8OA 1ZGLA 2HKFH 3GSXB 5IIEB 1QFUL 1N6QL 3TJHD 3CC5B 3LEYL 4UDTA 4YFDB 4J3TA 1F4XH 3T3MF 3T08A 3KYMA 1JI2A 2VDLH 3NFPA 4LAJH 2CUMA 4APQB 3L7EB 5DZLA 1ZA6B 1Q9WA 1MCRA 1OPGH 1OSPH 3GSQA 1BOYA 1E6JH 3SE4C 2VXUH 1YNKL 4IM8A 4NHCL 1EO8L 5E8OB 5KSVB 1N5YH 4G3YL 4OLVH 4ZFGL 1I8LA 4R7DA 4YDIH 4X7CC 1S9XA 1OM3L 1INEL 3QHZL 3LDBB 4OSUH 3AB0B 1QYGL 4YHLH 2WSKA 1LP9E 4OZGB 4KPHH 4LMQI 3UDWC 5D7SH 5FXCH 2MKLC 2MHAA 1U8MA 3UCRA 1G7QA 4ELKA 3V6FA 3UP1A 4JHAH 1HXYA 1WVZA 1N0XH 3FTGB 4L4TA 2PCPA 3H8NA 1V7NH 4OZIE 5BO1L 1ORQB 3A6BL 4TUJB 2IPUG 4R2GB 3KYNA 1A9EA 4JGJA 4NO5A 3R8BB 5I76A 2IGFL 2PXYA 1N26A 4L8SB 3TBVB 1EO7A 4WTZG 5DD0H 1FFOA 1NANI 1A0QH 2OJZH 2ZSWB 2P5WA 4JG0L 4CNIB 3EO9L 4L4VA 4ZUVB 4CMMB 4M9OA 4ZOBA 3W39A 3VWKC 4LSVL 1A1OB 4MXQC 1MVFA 3ARSA 4GG6F 1KPUA 5ICZB 2ARJB 5E8EA 2ADGA 3S34H 2P8PB 3S37H 1MFCH 3V5KB 2N7BA 2WBJD 3UPCA 2CRMA 1JPTL 3EHBC 2ESVE 2IANB 3X12A 4WGWB 2APBA 2H32A 1ORSB 5I74B 3HB3C 1QD0A 4MB4A 4YDKL 5GJSL 1LP9B 3OR7B 4F3FA 5IHBA 2OM5A 4JANB 2ITCB 4XXCC 5HYJB 1S7UB 1D5IH 1U41A 4NQDB 5FYLD 3FO1B 5EO0A 1T03L 4OZIB 2NY4B 4OFVA 4WTXA 3RVWD 2H1PL 4P5MB 1WCQA 3ALWA 3PNWA 2YPKA 4ZFOB 1PYWA 2ZKHL 1YY9D 3O6MH 1VGKA 3VU2A 2B4CH 4CGTA 1K8IA 2AV1A 2BDNL 5BOPA 1YYLL 4IEFB 2ED7A 3D69B 2ADJB 4I3RL 4ENED 1A6ZB 2EE9A 2W92A 5FO8A 3DX6B 3V0VA 3MLUL 3MRNA 4G8EA 5F7NC 3V5DB 3RWJA 1KOAA 3STZB 2VZ3A 1ONQA 4F37F 2DQUH 3IDNB 4DGIL 5MI0B 2QSQA 4IS6A 5EU5A 3JV6B 5LWYL 3I6KA 2OMBA 3VFGL 4OD3H 3UTTE 4P9ML 3TA3C 4L3CB 2J6EH 2DMCA 4PJBF 4CDGC 1UWXH 1GAFL 4GXUM 4KHXL 1I4FA 3A6OA 6FABL 1EJOH 4AM0A 1H9VA 1S5HA 5KAQF 3U36A 2Z93B 1HIML 1OWRM 2JJTC 3LEVH 5LGJA 3QI9D 4UB0L 4QWWD 2X89A 2NW2A 1RZGA 4HUKB 4IBLT 5DUBA 3B3IB 1BLNA 1DQDL 3MV9A 2OP4L 1A1NB 2C26A 5CHNB 5EBGA 4KROC 2DQDH 4M48L 4N0CC 4ONFL 4EBQH 2CGRL 2D9QB 5C6TL 3VD3A 5DD5H 2XG5A 4K8RH 4Z7VA 1AHWC 5DRZB 5CINL 1YPZF 4K23L 4HFUL 5J6GA 1CFQA 5K9OA 2AJYH 3QR2A 3IJYA 1CR9H 1Z9MA 4CN6A 4M43L 4LPVA 2EXYD 1ZLWK 4R8WL 5DEFB 1AE6H 2DQCH 3EOAA 3SQBA 1I3UA 3VRLE 3HC3H 3Q3GA 4Z0XB 3W9EA 1G9NH 4HWEH 1D5ZA 2EYRA 2GYSA 2YPVH 4PY7B 3UTTB 4UIMA 2UWEB 3WDHA 5I30H 4KAQL 3BD3A 4RNRA 4NPYB 5CSBA 2AK4A 3S36H 1BQHB 4L4JA 3BPCA 2VDQH 4C83A 3SO3C 1EFXA 4GMSL 5KVGL 3I3DA 4YHNB 2VO5A 4XMKL 1XIWD 1JPSH 5T3XL 1FV1B 1KN4H 4G42B 3BN9D 3SGDI 2EXWC 3TBSB 3KLSA 4LQ1A 3FQTB 4M5ZH 2A6IA 1O7SA 1DQTA 3T65B 2XZQL 1FVEB 3V6OC 2WIMA 5D1XB 4WI9A 3DO7A 2XZCL 1A5FH 3DV6B 5IWLC 1N7ML 1VACB 3O2WH 4YHML 4O4YL 2LE9A 1NGZB 4G9FD 3I6GA 5HBBA 4M8VA 4F7MA 5FECB 5IVNA 2JJVA 1G9MH 4WO4D 4G43B 4KGLA 2E9IA 4F7CA 1UB5A 1IZJA 3UTZA 4ZPVA 2VABB 5IW1B 2GIYA 4FQXA 4X0KA 3VXMD 1IM3B 2W60B 4L8BA 2XYCA 3KPTA 3UTOA 4HULB 4ZXBA 5JDSB 2LVEA 2V5SA 3NABL 4PRIE 3U4AA 1P53A 1DANT 3LN4B 3VGAC 2HVJA 5FHAL 4NFBA 3QJHA 2DD8H 3DO3A 3F7VB 5J3HC 1CGSH 4UDUA 1UEMA 1ZMYA 1M7DB 4NZUH 5C0CE 5B3NA 3IETA 1OAYH 1BWMA 1NKOA 4HKXA 1QSFA 3RY5A 1EX0A 3MBEB 5FA3B 1J0YA 2XWJB 5E4EC 4ORZC 4XNQA 4RQQA 4Y7MA 3UBXB 3BE1L 3U7WH 5HY9B 1JGEB 4NQCD 3NPSC 5SX5K 3W11C 3JWDL 2CUHA 4M93C 2IJ0C 1C08A 3UX9B 2IH3B 3C5JA 2XFXB 3NAAH 1R3KA 4JM4H 3AREC 3DX7B 1KN2L 5E2WH 4LLVA 5IJKA 3OB0H 4JPIA 5EBMB 5CKAA 4Q9RH 1DDHB 2W0FB 2I07A 2YD8A 4R26H 1LO2H 1B4JH 1AXTH 1YMHB 3KR3L 4PGDB 5IVOA 1U3HA 1I1AC 4IRJA 4ORGB 1CS6A 4WDIA 3E6HB 4Z7WE 5B39A 1IC5L 1S7XA 4PRIB 3TN0C 4Z78B 1OP9A 5F1IA 1E6OL 1H5BC 1BAFL 1OB1A 1OAXL 3CPLA 3OB8A 3RI5K 1UWGH 2R2EA 5I1DA 3DX9B 2X4UA 4I5BB 4M61B 3OX8A 1Y6MR 1I7TA 3L5JA 3CGTA 5C0CB 1T1ZA 4EUPG 3TCLA 1U6AL 2DBLH 2DQEH 4NYLB 5DMKB 4POUB 1R3JA 4LVHC 2VZOA 1Z6JT 4MLIA 5C9KA 3RJDA 1LO3L 2IBZY 1HHKB 3U6RA 35C8L 5GSRB 4ETQA 2AS5M 3FOLA 3C60D 3MXVL 2VIRB 4MA7L 1CDIA 4GRMB 3WNKA 3RKDD 1EGJA 1FAIL 1KFAL 1QSEA 1ZSDA 2MSPA 4WHDA 1MJUL 5E6IA 1H3WM 4P3DA 3B8YA 1MFAH 4C55A 3MZTA 2YA1A 1KJ3H 5I73C 2FZ3B 3RVXD 3WHXA 1EGJH 3TIEA 4GRLD 4QXGL 3QJFB 3G08A 4JDVB 3QB7C 4U6HB 2VB5A 2VAJA 4OCRH 4AH2A 1PY9A 1OW0C 2BVPB 3MTRA 1CTOA 3RIFK 3O6FB 1AD9A 4U1SA 5IB4A 4GXUN 4WV1C 5IG7B 1G7JB 2QBWA 1CG9B 1QNZL 3GO1L 3EYVB 4HX1B 4CKVX 3OPZL 2BXZA 4CN4A 2DQTH 4Z7WB 5HHNA 4NN7B 3L5WA 3HCVA 5TQ2L 2HTLC 5TGBA 4LSUL 5DK0A 1NEZB 5ERWB 2W07A 3SDDC 3MLXL 4JQXC 4OFKA 4WHTA 2AI0L 4YUEL 4XBPA 1RZJC 1CLYH 1F58H 4FFYL 4P3CL 2YRZA 4TVPD 5HHOD 1ND0B 1ZWIB 4MMXC 3UZVB 4H8WC 2CJUL 3NIDF 4OB5H 3EYSH 3P4LA 4MJ4A 5IB2B 1R3HB 3UPRB 1JZ6A 3CNKA 3S5LA 4IDJH 3O11B 4LCCC 1IJ9A 3GKWL 1MPAH 1ZLVH 3UXFA 3MRGB 3T77A 1JPFB 1SY6A 2EDKA 3X17A 2BOCA 2XOTA 3LKQB 1T7XA 2Q8BH 3VGFA 3HRZA 3MODL 4DQOL 2VH5L 3G5ZA 1PG7L 1UC6A 4Z7NF 4N5UA 3CCHA 3MRCA 4FXKA 3TEUA 1SY6H 3O2DL 4H1LB 4Z0BH 5EO9B 4FG6D 1V7ML 3RUGE 3F62A 2YWYA 4IRSB 5HDOA 4M03A 3VH8G 1TETH 2PYFA 2H6PB 4XCCH 3HMWH 5ICYB 1ZK9A 4N8VA 5D2NC 4FFZL 5T1KD 4BUHA 4WUUA 2VL5B 1FO0B 5DD1L 3D25A 3S88H 1NGPH 5C0DA 3BAEL 5ADPH 1LO5A 3QIBA 5FYLL 3PQYD 2ZWLT 5CKGA 3IGAA 2X05A 2ENYA 2DIJA 3GRWL 4FXGB 3MACL 1H3PL 3GSWA 3SCMD 2EEDA 2FGZA 2E6JA 2FHCA 1PJ9A 1ETZA 4ODVL 4Y16C 5DURD 2X4TB 3WXVH 4AEIL 1HSBB 4PRHA 5HGDB 3V4UL 1CDHA 1JWMB 4EOWL 1HK6A 1U2CA 2VZSA 4HWZB 3IFNH 5EA0H 3RIAK 3THMH 1BVZA 3QWOB 3TC9A 2ZNXA 5E03A 2XZZA 5I8EB 3BGFB 2DF3A 4O9HL 5MENE 4U1GB 1TZHB 4QHLB 2F74B 2YRPA 2CMRL 5BV7H 3KPLA 1WZ1L 4QF1A 5C71A 4WNQB 1TFHA 3C5ZC 3GI9L 1N2RA 3QDGE 4RFEB 1PZUB 1K6QH 4KKLD 5C0EB 3K2MC 5JOFB 2NY6D 3T2NH 3VFPA 4NO0D 3WHE1 3GSOB 4HZAA 4NKMA 2MCPL 1OSPL 3BXNB 1KELH 4TOYH 3OHXB 5BZDB 2VJXA 5KS9F 1MH5A 4NOFA 4Z95L 4JQVC 4MJ5B 4WWKD 1C16A 5E2TH 1CT8A 2YUXA 3VFNB 1CD1B 2G60H 2NXYB 4N1CA 2CRZA 4ODWB 1E0OB 2QR0A 3QQ4A 3SE8H 2WWMC 4XGZA 4QEGA 1Q9LA 2H26A 5IMMA 2GJ6A 5FB8B 3CFEA 4XT1C 3WS3A 4ZNEE 3N1QC 3LH2L 4Z76A 2WP3T 2I9LA 2VLLA 5EPMB 1IC7L 4K9EL 3ZKXC 4Y5XC 4XWOC 1CF8H 1V7NL 1WT5A 4XCEB 2APTA 4TSAH 2Q76B 4CU8A 1MF2L 1L7IL 2W65A 1NH6A 1RJYB 1MHCA 4PJ7F 4X4MA 1KJVB 4F7TA 5C08A 3FFCD 5BRZD 3QDGB 1KTRL 3TJEH 3ROLA 4PV8A 4NKDB 4YE4L 1FIGL 4RGNE 3FN0L 5EU3A 2XRAH 1TZIA 4PBXA 3T4YB 1RJLA 3GSNB 4O2EB 2ZNWA 2X4OB 5D1ZB 3D0VB 1S9WA 5B3JE 2PW2A 4EIZC 3MRQA 4G5ZH 4GRWH 4YHIB 5D7IB 1TQBB 5JW4M 4NSKA 4O5LL 1FL5B 4UOW0 3KJ4B 5IW3A 1ZKAA 4NN6B 1I9JH 1M71A 4JKLA 1Z5LB 4MAYB 4X7SH 4MJIE 5K9QG 3RTQD 5KVDH 3QNXA 4Y19E 1I3GH 3F5WA 3QH3A 1IM9B 4J4PA 4HGKC 4JAMA 5CJOH 4ODUB 4OGXL 3DIFB 5DYOB 3VXUE 1ZHBB 5EU6D 1QLEH 3QA3B 2BVTA 2HT3C 4LIQH 3N0PB 4Z8FH 3BO8B 5FK9A 2P5EE 1WBXA 5AZEH 4WUKH 4ZD3H 3BWAA 3O9WC 4K3EH 2FD6L 2J8HA 3H7BA 1MLBA 1T20B 3NN8B 4RGNB 1XF3B 3X14A 3HZKB 2IQ9H 1KB9K 3B9KC 1G6RB 4JFXB 3N1GC 3GMQB 4X98A 4Y5YB 5KW9H 4UV4L 3KLHC 4PJXF 1YN7B 3FT4B 4KTEL 5SWSE 1GOGA 4K3GA 1MFBL 1UM4L 5D2LE 3K81A 1RUQH 4MCZA 1TJIL 3PWJB 2EDFA 1BM3L 4PBWD 5DVNA 1IGFH 1VGEL 1F4WH 3CIQA 3QUYB 4WU5B 3M1BA 3RWDA 5TDNA 4QRPD 5JORA 4IMKC 3WKMH 3H9SD 1XEDA 4HK3N 1DZBA 4LHUD 5ESVB 1MIEH 4MZ2A 1HYSC 1MJJA 1IGMH 3LS5L 3LZFL 1DBML 4P2OD 1KEMH 1CK0L 3G6AA 1UFUA 1F3JA 3LIZH 3IFLL 3EJZD 1CTNA 1JCKA 1YN6B 3UYRL 4D9LH 3RHWK 4DEPC 3VXUB 1QFWL 2JJSA 4X9GA 4X6EB 1KXQE 4XMPL 3BKJL 3HZVB 2DIAA 2FJHB 1IC1A 1UEYA 1RJZB 3ARBA 1R0AH 1SYVB 2P5EB 3MNZA 5E1AB 4EBQL 3GGWA 4PY8I 4C56D 1GOFA 3O4OC 1FJ1A 2Q1EA 4XRCA 1KYOJ 1DL7H 1R3LB 2HAZA 4ZOAA 4OLUH 4XVSH 2VZUA 3PV6A 5DMGC 5IFJA 2CKBB 2H9GB 4P5TA 2BNRE 2Q86A 3X13A 3ULUD 5SWSB 3L1OL 5K59E 2C3VA 5E99H 1TVBB 5D2LB 4PLNC 1GGTA 3ABZA 4QGYA 3TZVD 5F97E 3FRPA 5CEXA 2DYPA 2QADB 3IDIB 2A77L 5MEQB 4HIJB 4IHOB 3P77B 3BP5B 3C6LD 3NCFB 1E4WL 5FYKU 4ELKB 1U8NB 5I30L 3P73B 3IKCB 3FT2B 3KWWB 3VD9A 4R3SA 4XX1E 1BZQK 3C5SA 4U7KA 2Z92A 4WJ5A 4I77L 4I9WD 4G6JL 1ZHNA 3DMMA 1IC4H 1C5CL 3QSKB 4KVNL 4FS0A 1C5BH 1Q9OB 1EEZA 2Q87A 3R1GL 2B20A 3B2UD 1JZ7A 2P5WB 3S98A 1F11B 3IJHB 4NZTL 1HOCB 4HG4K 4Y2DC 2ICCA 2RHEA 3KXFE 5GRJL 4X99B 4M7JL 2DJUA 4PJDA 4N9OB 1KPUB 4PRNA 1CZ8L 1BFSA 1P4BH 2X1PA 4YIQA 5HDLA 2DLIA 1MJ7H 4X4XA 4DUXA 5LKNA 4GKZB 4OLWL 4GAYB 4ZO6A 1AO7A 1Q0YH 2B2XL 3OKNB 5SWZD 1AGBB 1NAKL 4WWID 4P4KB 5EIIB 4LAQL 3RJQB 4WHCA 1CIDA 4CVZB 5JA8B 4YZFF 1HXMB 2J88L 3FL7A 3QEGH 4TVPL 2VQ1B 4XPFH 3AB0C 5LCVH 1H3VA 5D4QA 4S1QH 1NBVL 4DCQA 2IFFH 3MLYL 5IP4A 1QRNA 4RMSA 2K3TA 4FQPA 5GGSB 1LHZA 1R24B 1JV5A 4JQIL 1CGSL 32C2A 1U8HA 4IOSD 1FH5H 3ARDA 3BVNA 4JJHA 3RBSA 1NCBH 1XF5A 1RIHH 2R1YB 2BZDA 1CXLA 2V7NA 3HKFA 3RPKA 1GRWA 3CFCL 2B39A 1A4JA 3G6JA 1D9KD 3GK8L 5JLZA 3HR6A 4QY8A 2F5AH 4R2GC 3HC0B 1KTLA 2HH0H 3V4VH 1K8IB 3OJDB 5ESQA 1P9MC 5DVKA 2CLZA 1J88A 5CEZH 3DX8A 5CEYA 1L0XA 2XIDA 4I0PD 1EH9A 1NC4A 3FO0L 1OAKL 5JHLL 1KENH 4BSWA 5H35A 5DUML 5EU5B 3DUUA 3WKNA 3SBWC 1JTPA 1QP1A 4FZEL 3BT2H 1BBJA 5IVXA 4PR5B 1S7RB 2XKNA 5GGQL 3ARBD 1QA9B 3FB5A 4OLXL 5IB3B 3I02B 4U6VL 5I74C 3CFDA 4KK9D 2BY3A 1RVFL 2FB4L 5FA4B 1CYGA 5EZJB 1UZ8B 3AAZB 1JGUH 1QFPA 3T0XA 3JSSA 4OZGF 5MP6L 2X4NB 2QQKL 1S7VA 5JXEA 1RUMH 1PBYA 5DJAA 5EWIL 1RIVL 2NY4C 3D18B 1VFAB 3FOMB 1DCLA 5E9DA 4JFPA 3W9DB 4EN3D 3IDXH 3RP1A 2DTSA 4H88H 2NTFB 5DWUH 2PYEA 2Z4QB 1P2CA 1HE7A 4NQSA 4JLRA 1EGJL 2HG5A 4EDWL 3ZSTA 2VLJB 3CUPB 3KPQB 1NLDH 4KFZC 4OFYD 1RUKH 4R6UA 4N0YL 1IGYB 2AERT 4CVWA 1AGEB 3V5HA 3DMMD 3RGVB 5MI0C 5CWSB 3IDYB 1K5NA 3L5XH 4ZS6D 4F57L 2AXFB 2AJXH 4LPXA 5C7XL 2IPKA 2VDML 1A4KA 2CK2A 5GS0H 2VR4A 4I18A 5HSFA 5I18H 4OUOA 5C0GA 1D5MA 3GBNH 1MFEL 1YNTA 4OCYL 3L9RB 1CFVL 3GUTA 1LP9F 3MREA 1RHHA 3EAKA 4F8QA 2IBGA 2V9QA 2AK1H 1JNJA 3BKYL 4F9PC 5IVZB 2QLVB 4ELMB 3V95A 1G7LB 3RL2A 4L3AA 4NP4H 2ZZUT 5ESAA 1T83A 2UUDK 2V9RA 3FQWB 5KSUB 1CL7I 1KCUL 3F58H 2F19H 2F15A 4BQBA 4OZIF 4HV8B 43C9A 4WFFD 2DMBA 2NY0B 1SJHA 1UENA 1U2HA 5DI8B 2FX9L 3HG1E 2AQ3A 4LP4A 3RWCA 3SE3C 3AS1A 2DB8A 1KACB 4E42A 1YEGL 4HIIA 4X0KB 2R4SH 1Q94B 3PDGA 2PO6A 1B0RA 1D5XB 4OD2B 1WISA 3LEXB 1SJVA 1UXWA 1X6LA 4P57B 3QRGL 4ISVB 3VGEA 2DICA 4HW6A 4JFYA 4PP1C 1TETL 4URTB 3VXSA 1F45A 5I8CA 1QKZL 4JDZB 5IB1B 3SDCD 4XCCL 1U0QA 3RWGB 4UIKL 1WAAE 3NGBB 3X11A 3L3KB 4MD5B 1IKFH 3L6FB 3FAXA 5IFHL 1DQMH 4KWUA 1Z2KA 3B8SA 3VXRA 4EDXB 2YXFA 3EYUH 4PP2B 5F7YC 3ZE1E 4ZNCD 4PTUA 4HGWA 4U1LB 4MA3B 1BGXL 5D1XC 3F7YA 4QRRB 4YAQB 1J0ZA 3WN5B 4N0RA 1AJ7H 1GGCL 4ZG1A 4Y1AD 2VDRL 1IAKB 2CSPA 2F5BH 2VDOH 3W5NA 5EZLB 1LK2A 3IFNL 1CQYA 3AUVA 3THML 4R97B 2J8OA 1A7BA 3WIFB 4F2MB 5BZWB 5D7LB 1QZ1A 2IBZX 5C0NC 3ZLQC 4WW1B 4BZ1H 4LOUD 1CGWA 4PGBA 5CGYD 1FPTL 1CN4A 1F8TH 2EE2A 1FRGL 4BFIA 4MSWB 2X44D 1QG3A 3LQZA 3ULVD 1IRAY 3V7MA 5BVJB 1KV3A 3CPLB 3L3HB 5DQDH 4N90D 1JN6A 4EUPB 3SN6N 1KELL 5MEOA 3PUCA 2UWEF 1UJ3A 5FHBL 3DGGA 1CFSB 5D7JB 4W81A 5EZOH 3MBEC 4K3JL 4PRPE 1VFBA 1LEGB 3D87B 4JFFA 3NA9L 2XY1A 4PGEB 1WFOA 4J3XA 1C7TA 3DXAD 2C3HA 2A38A 4HKBB 2VDKL 5I15H 4H0GA 2D03H 4GG8B 2EEAA 1GHFH 3BZ4B 3TNNB 1W0VB 3ZHLA 2R0WH 3ULUL 4TSAL 1DBJH 5DJ2A 5A43C 4HUNB 3AMKA 1KLUB 3DURB 2I24N 1CCZA 5HPMB 3W82A 3FCTB 3OMZA 5FGBC 3VE0B 2CR6A 1SHMA 3RX8A 3PV7A 3VRLF 5A2KH 4U1NB 1G7PB 3VMPA 2DLTA 3MUGA 1FNAA 1J8HE 1F2QA 4HJ0C 3EDFA 4ONGH 4JO4H 3C2AL 3MLWH 4OJFH 1KGCE 4G5ZL 3SQOH 4PIRF 3QCUL 3OBAA 4OQ1A 1R5IA 1DBBH 4FZ8H 1ZLUH 1QLFA 3PXHA 2BOBA 9CGTA 1S9YA 1NQBA 4J23A 3MV8B 4JR9H 3RBGA 1RUAH 2HYMA 1CXIA 2R0ZH 5C8JB 4MD4B 4IIQB 5HHXL 2UYLA 4JZOB 5HI5D 1FNSH 4LLQB 3WS6C 1T7VA 5D1QD 3HUJA 3CH1A 4OM0H 3Q48A 5ISZE 1LEKB 3P0VL 2DQIH 5JPMB 3DECA 4KTDH 5C2BH 5T33H 4ZMAT 4Z5RA 1IGJA 2DTMH 4DVRH 3S6CA 3A0OA 1K8DB 3GHBH 3QXAA 2VLRA 1DQQA 1QRKA 4YDJB 4RCAA 1OF2B 3I6LD 4KMTL 2ATPA 3VH8B 4DOHE 3QUZB 5DHXB 4ZUUA 4MNQD 2ADFL 1J86A 3OTTA 5CD5D 1EIBA 3OR6B 5FUOL 4NN7C 5DT1H 4YGVB 1YQVH 1DQLH 3QQ3B 4RSVA 1JYVA 1X4ZA 4LRIA 3BUYA 3EYFA 5TDOB 1I9IH 3VFSA 3REVB 1AQDB 1E28B 2Y5EA 2C1OB 3K2UL 2XY2A 2AVGA 4KH2A 3V7AG 4JM2B 4HF5L 5DUPL 5T1DL 2IAMA 5BV7B 4KI5D 3R0NA 1MRFH 3IDMA 3W2DL 3RWFA 1BVKA 4UUJB 4Z6AT 5CIPH 1A9BA 2FCBA 5ISZB 3MOAL 1IVLA 5ICXA 4WI3A 3HZYA 1FYTE 3MOBL 2NXZB 5HD8D 2VLKA 4BELD 1FBIL 2C4FU 3IU3A 3O4LE 4YNYA 3HI1B 2YWZA 2GT9B 3KJ6L 5D8JL 1BIIA 5I8KH 2GK0A 2OTUB 4L1DA 1PVHA 4M7ZB 5FUZH 3RA7L 4DOHB 2ZUVA 4X80H 1QBBA 2R0KH 4HPYH 5JW5B 3H0TB 3O3AB 5D71L 4DAGH 3U1SH 3BGAA 1YEJL 3ARFB 3VXNB 3G5XA 4JFFD 4G8GE 4RIRA 2I9TA 2VR5A 1FGNL 1G0DA 3T0EE 5BS0E 3NZHH 3QFDB 5T1LA 4Z7WF 3GHEH 5C0BA 4LNVA 3WNMA 3SKNA 4XP4L 1QSVA 4R9HA 2EDRA 4XPGH 4ODHH 1JRHI 2WQRA 5EFIA 1DR9A 4W6YB 2YPLA 5IHUL 3V2AR 4OF7A 5J9PA 4FQ1L 4G80B 3CMOL 4X7EC 4NQED 1MOEA 4YFLF 2A9NL 2BSSB 2F9BT 4RFOL 5C09A 1JYXA 4S1SH 3L3OA 1CE6A 1DLFL 4LSQL 1FYTB 2BMKA 5IJVB 3DRTB 4BQ9A 3RVTD 4IMLB 1LD9B 5T1MA 1MHCB 1JF1B 2ESVD 3BGFC 3O4LB 1F5WA 2ZUUA 5F21B 4F7TB 4U1GC 1ZXQA 1F6AB 5KSAD 4GG6A 2DQJH 3RZCD 4AIZA 5MERA 5IFAH 2Y5TA 4GQ9H 4JKKA 2PTTA 4NM4H 1TZIB 3BZEA 2NNAA 5D7KE 2BNQE 1ZS8B 3SDAB 4MDJB 3CFKB 4X4YB 1EEYB 2HA1A 3SKJH 2AXGA 3FO9B 4G8GB 1WZMA 3SE4A 5DEGB 3KS0H 4FQLL 1FG2A 3T0EB 5BS0B 4L3ED 3SPVA 4DGVL 1X5ZA 3G9VA 1QVOA 5GS2D 2IH1B 5F6HJ 4TSCH 1FVDA 5KVFL 5GZOC 4NM8H 4LCWE 5C0AA 3P30L 3UDWA 3QEGL 5JR1H 4YEFA 1LDPL 2R8SH 3MRKA 5GGTA 1ZLSL 2NXYC 2VLRD 1GGBH 1BOGA 4MHHI 1EMTH 4V1DA 5LCVL 4NQXA 2IFFL 4ALAL 4QOKA 4XCFH 2OZ4H 3MA9H 5GGTH 4D0CA 1KYOK 1LNUB 4BH7B 3CVHH 2GAZB 4YHKL 3DV4B 3V6BR 3MGOA 1NCBL 2C9AA 4OF5A 2A9ML 3ZDYE 5DJDB 3LY6A 3P9MA 1BD2E 1FNLA 2P4AB 1AXSA 2ATKA 3MRRB 4BQ8A 3VWKA 5CEZL 2BNQB 2RFXB 2AJZB 3PWUA 4Q9QL 1RY7B 2O61A 5INCB 4LASH 1DEDA 4K7PY 1TPXB 1MY7A 4CN1A 3B6SA 5EBLA 4P23D 4PJBA 5CP7B 1INQA 4LKCB 3U2SA 1B6DA 4M1GL 4B53A 5D1ZC 4CBPA 3QEQE 1BBDL 3AU1B 1MCOL 4MCYA 1DBAH 3KPRA 2WBWB 1LGVA 2IQAA 4FTVE 2E9JA 3OKDA 3L5IA 4HDIA 4OIIH 3OKEB 1TQBC 1JYWA 4LCWB 3LPWA 5GGUB 5E8PA 2X42A 3QZWA 5ACZA 4LSRL 3KJ4C 3MRBA 1U9KA 4NN6C 3MUY1 3TVMB 4MAYC 2D7TH 5I1AA 4XXCA 3TESA 5FAAA 1U8KA 2FO4A 4GBXB 4NRXB 5J89A 2F8OA 4XVJL 1IAOA 4DK3A 1T66D 2XA8H 3FRUA 4XNXH 1YPZA 1S8DA 2YUZA 5E00A 5I1EH 5DDHA 5A2LH 3NFSH 5DD3H 3QUXD 4X8JA 5DMYA 3W81A 5J4MA 2WWKO 1RU9H 4H88L 3IFOB 2GTZA 5T3XE 5CFHA 4U1HA 1QBML 3ULVL 4RGNC 4XBGA 2X4PB 5J6HA 4RAUA 5IK3B 4MNGB 4CVXA 1XZ0B 4EZMA 4YHOH 2QHRH 2F53A 3FB6B 3QEQB 4WI8A 3TA3A 3P9WB 2P8MB 1XGPB 2WIIB 4PJAB 4NUGH 3H42L 3OKOB 1NGXB 3IF1B 5JIHA 4GT7A 5GZND 5DJCB 4NNXA 2GFBA 5KBNC 4I3SL 3BISA 5D7IF 1MCHA 4NNYA 2DBJA 2E7MA 4JPKH 4PJGE 5DTFB 4DTGL 4HIXL 1EHXA 1OLLA 4ZUWA 3W0WD 1MJ8H 1ZHNB 4ZFFA 3UC0L 4OZHB 1BQLL 3CK0H 4UTBH 1PDKA 1EEZB 1J1PL 4K2UH 1V8HA 1SQ2N 1AHWA 1D3CA 3IJSB 3EJYC 2EIZA 2WV3A 1FNFA 5ALCL 1J1OL 1YJDC 4PJDB 2Q3AA 2WW8A 3MLSL 8FABB 5LXGH 2COQA 1OY3B 3QPQC 4GXVH 2BVYA 1I1YB 2YBRA 2EZ0C 1OARH 2BVOA 3NACH 1WBZB 1JGDA 3ARTA 3C6SB 1AO7B 1HHHA 1YEIH 4OCXH 3MA7A 4NN5B 5JO5A 3QFJD 4RWYH 2DM4A 2HRPH 4TNWF 1JNNL 2ZJSH 2JIXD 5KSBE 3IDUA 3BH9B 3O0RH 3FONB 5FGSA 3RDTB 2D0GA 2QADC 2XQBL 4LCYA 5B3JF 3D85B 3K4DA 2R4RL 5JIKA 2A83A 2X4RB 4LEXL 3X3FH 5EC1A 1GC1H 4PJGB 2E9BA 1P4IH 2OL3A 3I2CH 5F1SA 2RCSH 5ID1A 3EFDL 3OJ2C 3Q6FB 1FFPB 4YWGL 3QIUB 3TT1L 3ZTNL 2NY2B 2V17H 3TNMB 1IKFL 3V6OA 2A0LC 3PP4L 5H37G 1UB6A 4EI5B 3WFCH 2V2XB 1FGVL 2OL3H 4PJ8D 3BEVB 4OKDA 5IWLA 3PWPA 3BEWB 3WFEH 3GJFA 4LGPB 1ZTXH 4P59H 1T2QL 1RULH 4DKFH 1IGTA 5DJZB 3QDMA 3G5YB 2LABA 4ODSL 3HLAA 1NC4B 2CK0H 4BH8A 1ZT1A 4Q2ZA 4XC1L 2YD6A 3GJFH 2VDOL 3T2QA 4PLJD 4KZDH 3VMOA 2MPAL 2CIKA 2XPGA 3U9UB 5TJWK 4EIGB 3GSUB 3WL9B 1T04B 2W9EL 3QEHA 4WHYH 1UT9A 1MREL 4QXTB 3QEUA 3CH8A 2PF6A 1JPGB 4U1MB 1MAKA 1PSKH 4P4KC 4KXZI 4ZDHA 1WIOA 3CDYA 2AV7B 2ZUSA 2I25N 2XQYK 5D2LF 1KIUA 4D9RD 3IDGA 1PAMA 1YEDA 3KYOB 5FYKD 4OQTA 1BMGA 4P2YA 1FZMB 2R29H 2IFGA 2XTLA 1RK0A 3EDDA 3EUUA 1HEZA 3FJTA 1KPVB 4R96A 5DHVB 2QV2A 3OGCB 4U6YA 4QGTA 2B4CC 1P7QA 1TIUA 5IBLD 3LB6C 4P46B 4OLZH 4PJFE 1FCGA 3CX5K 3KPSA 5EZOL 5I1JL 5LBSH 5C0IB 3LKOA 1FLTX 3L3IB 3AREA 5SV4A 3JUYA 5FEBA 2JTDA 1OT2A 4LHUG 5HDBE 5K9JL 4Y5VB 1XR8A 2AXHA 1MSPA 2OTWB 1WSST 2VXSL 3BDYH 1RZKL 1UXSB 1I1AA 3P9LA 4GQPH 3V5HB 3PDOA 4FRWA 4QCIB 1HKFA 5DVLA 4BZ2L 3FQRB 3DYPA 3ILPA 4HH9A 4FFVC 4N0CD 1UM6L 1BVLA 1P5UA 3CSYA 1H5BA 4X9IA 4E41D 2VC2L 3VG0H 5FKPB 1YNTB 3EOTL 3WE6A 1HCVA 1NLBH 3GMLB 3LRGA 2JCCE 4EQ3A 3MX0A 4ZTOL 4QHMA 3QQ9C 4GMTH 2P8LB 5B8CB 4POYA 1JNLH 1MCPH 4BQCA 2AJSL 4PJFB 4JRXD 4L8CA 5HGHA 5JHDA 2FNBA 4FMKA 5GRUH 5F96L 4OI8A 2IPTL 1W0WB 3T0BA 4LBEB 4U1KA 4NZDA 3INUL 2WINA 1MAML 4OM0L 2ZCKL 4K7PL 3RWHB 1P7KB 2XWBB 5FYLE 3IKKA 1OW0A 4KTDL 2EXWD 3DUHA 1J5OH 4WV1A 4LSTH 3SE9L 1ERNA 2VUOA 5K33A 3ALXA 1UXWB 1HQ4A 4W4NA 1KG0A 3BHBB 5H94B 1YMMA 1T0MA 5F7MC 1CD9B 3G6DH 4XPHH 4BJLA 5F7UA 2J1KA 4HH8A 1NBZA 4WEBL 1K2DA 1VHPA 4I13B 3RGVC 3SDDA 1JK8B 3IDYC 5F89B 1FDLL 2F54D 4Q9BA 1LILA 4FQHA 4ZOEA 3ZT6A 1NJ9B 1ZVSB 2JCCB 4OGYH 1SM3H 3PHQA 4JO2H 1AKJD 4TUKH 1HWGB 4W68A 5MEND 4G6KL 1IFHL 1AGFA 1I9IL 4RZCA 3OKLA 1CDGA 4NZJA 2P48B 4MLSA 2WBJB 1WIPA 3Q1SL 1UG9A 2AEQH 4XPBL 4N8CL 3F7YB 4I2XE 1OAZH 1FZJB 3E2HC 1G9MC 3E6FA 4C4KO 3I3BA 4H8WH 2FL5B 4NKOA 2HFGH 4JPVH 4E5XA 1GIGH 2FATH 2H8PB 4RDQG 2EH8L 3O3EB 3DVNB 2J4WL 2DQGH 2NY0C 1VADB 2CDFB 4NCC2 4JFDA 5GHWH 1YECL 2QEJA 4UAOB 3BKCH 1U8JA 1DUYA 1LEIB 3BKMH 1IQWL 1TZGH 1VFOA 3DLQR 4WGVB 1BFVL 1P7QD 4JHZA 4Z7QF 5I8KL 4AT6A 4P9HC 4NDMB 3CD4A 1EJ6A 4CDHA 3PL6D 4JRYA 5KS9A 5L2JB 2HFEA 4AMKL 4X80L 2XG4A 5IBUG 3JV0A 5D2NA 4RGMB 4IDLA 3ARED 2R0LL 2V2WB 4JVWA 5DJXB 1QQDB 4OZFG 2QQNH 3ARQA 3NGBC 2VDNL 3OWEA 1I8MB 1I9RH 1V5JA 5LGHL 2B1HH 5JPNA 1JGLH 4LLDB 3MV01 4NC1E 4YXKL 1VFMA 3GMNB 2LQRA 2Z35A 4MWFB 4K71B 4W6WB 4K7FB 4LARH 3TN0D 1L0QA 1PKQE 5KN5B 4ELMF 12E8L 5GGRY 3V4PH 1VA9A 4PJ7A 5AZ2L 3QI9B 4HUWA 4KZEL 3ROOA 4BSVA 1DJSA 2ICWB 3MO1B 4JEGB 5DK2A 5B38A 3SKUD 2R69H 4HPOL 3G5VB 3H9ZA 1A7QL 1MWAA 3C5ZA 3FHQA 3EIFA 4M4PA 3TIDA 3MZGB 1MHPH 1U3HC 1JGVH 4MJID 5T3ZD 5TPWL 1N3NB 1MHEB 1HHIB 4DZ8A 1GZQA 5C2UB 4YDLC 5DC0A 4RRPA 4UU9B 1T0NA 4NHUA 1MWAH 2IPUK 3ZKMC 4ODXB 4PRBB 4G9FE 4NUJA 1EO5A 1FVCB 1F6FB 4BFBD 1ODAA 4JQVA 4JFEA 5D72H 4M1DH 4B0MM 1AC0A 3JTSA 3UZEA 1KT2B 3UROR 3V7AE 4YFEA 5CP3A 3VXME 4FA8A 4M6AA 1JWSB 4F80A 5D7JC 3GIZL 2DLEA 3B9EA 5DRNA 5ILTL 3GSRB 1KC5L 3PWVB 2JB5L 1O0VA 2ZUYA 2DIBA 1RK1B 3DTXA 1FQ9C 1RZ7L 1PKQB 2FBJH 4LGSB 3E8UH 4PG2C 4PJ5A 5ITBH 3SDDD 1IMHC 1BX2A 5F9OH 2FHBA 3U4BH 1XIWB 3WLBB 4Q74A 4XNUH 1I3RA 3WFBL 3KDMA 3P4NA 3ZO0A 4MQXC 1JUFB 4M62L 2BSTB 3RY6A 1X5JA 2VXTL 3O3DA 5BJTA 3GBML 3JTTB 1MIML 3OV6A 2XACC 4DWHA 2HN7A 4NQCE 1CDCA 4PJXA 2OCFD 2X6MA 3EO0A 3MYZA 5DD6B 1JHLH 4KQ4L 5HYSG 4XVUD 3SGEH 1D6VL 3I75B 4G9FB 5IHZA 3FO2B 2RB8A 5TFSH 2HFTA 4G8IA 2E27L 4WO4B 1WC7A 2FWOB 5EORH 1UACL 2A74A 4L5FL 1LE9A 3LS4L 3O2VH 1Q9KA 4XH2A 1MI5A 2J5LB 3DUSB 5CIPB 4MQ7A 4JFDD 4PB9L 3VXMB 1T1WB 3WLWD 4HHAB 3RU8H 3QDJA 2FIKA 1YUHA 3KLAA 4LCIL 1NCAH 3MRHA 1UWXK 2CLVA 1XCTA 3MXWL 4DK6A 4GLRI 3QPXL 2BNRD 4FP8H 4GKNB 4IIQC 3ZE1F 1E4XL 3D2UA 4YDVA 2W0PA 3NCJL 1KCLA 4RAVA 2HLFD 2D2OA 2ZPKL 3KYKH 5DS8A 3VDCA 3HNTL 3T0AA 5BVPL 3O9WA 3BD4A 1R5VA 4NQCB 3QIWA 2Y4SA 2HLAA 4JY4A 4RBPH 3BQUD 3QG7L 1JHTB 2FYYB 3B9KA 1KLFA 3DPBA 1MAJA 2NX5A 1RU9L 3QUZC 4Y16D 3T1FA 1AFVL 4JJ5A 4J3VA 2AK4E 1WFTA 1EPFA 3D1MC 1OGAD 4NOBA 4NNPH 3FN9A 5FYKL 3SKNB 4O58H 3BJ91 4HQQH 4YHOL 2EDNA 3MJ7B 2NLJB 2PW1A 4HUVB 1UQSA 1XGYL 4OF8A 3QIBC 4IMKA 4FABL 2CO7B 5I1IL 2P45B 5DFTA 4Y89A 3C5ZD 1QBLH 4UV7L 3LAFA 3KXFD 2GCYA 4FHBD 2HKHH 3M17A 4HGMA 4U1IA 5BV7C 4U4BA 1AP2B 2BMKB 4TUOA 3G9AB 1ZT4A 4U6XB 4LKXA 3MR9B 1IQDA 4KKCC 4TVPE 5H8DA 3CK0L 4UTBL 2BSRA 1JFQL 2RGSA 3MRMA 1T5WA 3X3GH 1CLOH 3ZDZE 4E0RB 3C60B 5HI4C 4BUGA 4KKAC 3G04B 3CZJA 5F7WC 4YQXH 2MQCA 2VXVH 2WWMD 2DMKA 1AXIB 5IQ7H 3C08L 5K9QI 3P40A 3M8OL 4M7ZC 5I16A 3OSKA 5KJRL 4UTAL 3ARFC 3FT3B 2AW2A 2G2RB 4GRLB 4QRSA 2CIIA 1S9VB 1GPOH 4XWOD 4KJYA 1L7TH 2E8YA 1XGRA 3UTSD 1H8OA 4ZUSA 2ZJSL 3UEZA 4A6YB 1ZVYA 4AIXA 1QSFE 4WFED 3CVHB 4ETYA 3H9HA 1LE5B 4K7PX 4X8XA 1IEAA 1FG9C 1CFTB 5GGVL 4KU1A 1U91A 4JM2F 3CVIH 3MJ8B 3NMEA 5J7CC 2F8XC 2GSGA 2RR3A 3VFOA 5IEHB 5KTEL 4LMQE 5HHOB 4GW5B 1N8ZA 3NFNB 3PQYE 1FLRH 1TCRB 3MRFA 4Y2DA 5I1KH 1JZ5A 3GSXA 5IIEA 1HI6B 2KKQA 3CC5A 1MCBA 3QDJD 3VFRB 3RZWA 1URLA 3OAYK 4KK5C 2X7LB 1GGIL 4APQA 3L7EA 1ZA6A 3SDAC 1MNUL 3OB0K 1J18A 3IXTB 4NGHH 1I8KB 3ZYOA 5KSVA 2IQAB 5E8OA 1HH9B 5A3ID 4OV6F 5FOJA 2HJKB 3T2PA 4HJJL 4Z7OF 4C57C 4LK4A 2E6QA 2XN9D 1PX4A 1U42A 1YYMH 4OZGA 3O8XD 1L9NA 1OTTC 4LFHD 4XP1H 1KXVC 5ALBL 2YKLH 4MDIB 5KG9B 1IGIL 3KLHD 5T1KB 2BSED 4LSPH 3FTGA 4P2RD 2VZTA 4HD9A 4GAJL 1ORQA 4EI6B 5DJ0B 4TUJA 2CH8A 4O2FB 1FSKB 1CWVA 3PQYB 1P9MA 1CLZH 4OQTL 4NWTL 1IEBB 2HFFB 1ZT7B 4L8SA 3TBVA 1UZ6F 3ZE2E 3UJIH 2ZSWA 3FN3A 3SCMB 4CNIA 1R5WB 5DURB 2DLFL 3MRDB 4ZUVA 2DWDB 4CMMA 1HYSD 1KCRL 4HIEB 4RAUB 5B21A 3BYTA 1A1OA 3TWCH 3BD5A 1KBGL 3GB7B 3S4SG 4CVXB 3WMSA 5IW6A 1ZHLB 1TPXC 4KHTH 5ICZA 2ARJA 2HMIC 3SBWA 1A6UL 2P8PA 3B83A 3DETC 3V5KA 4NBZB 3VXOB 1NAML 4H20H 2IANA 5DFWH 5F7KC 1ORSA 1SBSL 2Y7QB 1MRCL 5BRZE 1LP9A 3OR7A 5IT2H 1NGYB 2EDHA 2NW3B 1ADQA 3ORJA 5F70A 15C8H 2QSCH 1BQSA 2PKDA 4FQJH 4JANA 2NY6B 2ITCA 1VERA 3VW3L 4NO0B 3PGDB 2CQVA 2FX7H 2BRRH 3PHSA 3N85H 2AGJL 4ZS7H 3F6IA 3ZL4L 3H3PH 1S7UA 3BZFB 4GBXC 4NQDA 3FO1A 5E94B 1YNLH 4OZIA 4WWKB 1BECA 4P5MA 4ZFOA 4QHKJ 3HE6D 2HT4D 4KVCH 1ZGLM 3O41B 5BQ7B 3TFKD 1JZ4A 1ZV5A 5T3ZL 3P3YA 2BNUB 2X40A 1JGDB 1ZLVK 3UPAA 1WEJH 4S11A 3D69A 2GQHA 4NO2B 2ADJA 1A6ZA 5JO5B 3DX6A 4NZRL 4QNPE 5EU6E 2NY5H 3V5DA 3STZA 4M5YH 1OCWL 3IDNA 4UT6L 1YZZA 1TVHB 1WJ3A 1UH2A 1A7PH 2ZOLB 1UADC 3FFCB 3LRHA 4L3CA 4OLEA 1PLGL 2J7LA 4N0UE 3SDYL 5BRZB 2R15A 1HQRB 2VSDA 2XTJD 2Z93A 5DMIH 4XP5H 1GVIA 5IR1B 1AY1L 4PRHE 4TUKL 4F33B 4UOW1 4F9PA 4IRZH 5IMLB 3QG6B 3B3IA 1RZJL 3MGTB 4NO3B 1NMBL 2ARJQ 1A1NA 5CHNA 4LSSH 2ICWJ 2AEQL 4GSDH 1REIA 4U6TA 3U46B 2B5IB 3H9SE 1DFBL 3RTQB 3BN3B 3D0LB 5TF1H 2E8ZA 3RFZC 5EOQH 5TF0A 3ZDYF 1KF9B 3SE3A 3EYQD 4JY5L 1G84A 5C3LD 2F8VA 1K4DB 5T5FH 5DEFA 1KCVL 5FM5M 1QLRB 5L7XL 1H8SA 3U7YH 4JGMA 2YC1B 4Z0XA 1NCTA 3PGCB 1MFDL 3ILQD 5E2JA 1MCIA 4PRPD 4PY7A 5KVMC 3BH8B 4XTRD 3PHOA 3UTTA 4JZJB 4C56E 2DL9A 4ERSL 1RZIB 2UWEA 3K4ZA 3QWRA 4N0UB 4NPYA 3RDTC 4YHZL 4KDVA 1BQHA 5E8DL 4S1DC 4PJAF 4YHNA 3LKRB 4AJ0A 4XP9L 4HS3B 3ULUE 1FV1A 3VD5A 4G42A 3MLRL 4WEUD 1ZLWH 4KUZH 3TBSA 3QIUC 4QTIH 3FQTA 3T65A 2R9HC 1FVEA 1AGDB 3SOBH 2NYYC 3HAEG 5D1XA 3QNZB 1T1YB 1Q72L 4EI5C 3HFML 3DV6A 1B90A 1JGLL 4M6NL 4QRPB 1VKXB 3H9SB 4OZHF 1VACA 4AG4H 4LHUB 2IAND 5C08E 3RRQA 2DKSA 4RX4D 4J1UB 1J8HD 1NGZA 4P2OB 2AEWA 3FB8B 4Z77B 5FECA 2WMPA 1KGCD 2XZAL 4G43A 4BSJA 4I9WE 5JZ7C 5IOPA 4FNLH 2VABA 5HYJD 5IW1A 1ZGLP 4ZQKB 2B0SH 1PEWA 2J8UE 1IM3A 2W60A 4WFHE 4XC3H 3GNMH 3ZZ1A 4C56B 1WBYB 5IMKB 1RPQA 5I1HH 5T5NG 5J12B 5IQ9B 2YK1L 3LN4A 3P0YH 1A7RL 2Z91B 1MCDA 4X5LA 4TSBH 3F7VA 5TQ0L 4NRZB 1M7DA 2WNGA 1RJCA 4FQ2H 1KXTB 2ZCLH 2ENSA 1NPUA 4M1DL 3E1F1 5SWZE 3TZVB 4R4BB 3MBEA 3D48R 5FA3A 5IGXH 2XWJA 4PJGF 1NCCL 4M3KB 2X4SB 1FC2D 3UBXA 5HY9A 1NUGA 1JGEA 1IAIH 4M7KH 4P46C 3C6LB 3QXWA 1W72B 4KRMB 2NY3B 2IH3A 3MMEB 2XFXA 2LU4A 2JLLA 2DJ4A 5JW4Q 3DX7A 1BZ7B 5ITBL 1EHAA 1NCDH 4XNUL 5EBMA 1DDHA 4U3XA 2W0FA 5F7DB 4JB9L 1HQ4B 1BFTA 1DUZB 1YMHA 5GS0C 1YDPB 3IB4A 4PGDA 2WAHA 5EG6C 2J8UB 2BJMH 1I3VA 1CICB 4ORGA 3E6HA 5TE4H 3CZFB 5E2UH 5CSZB 4PRIA 5TE7L 4Z78A 4JKMA 1LK3L 2LVCA 2ZCHL 1TJGL 1FNEB 4MNHB 3TJHC 3MLVL 5GRYA 4EXKA 4AEHH 5J13B 3DX9A 4I5BA 3GM8A 4M61A 1J1XH 2PR4L 5HTSA 1K3IA 5C0CA 4NYLA 5SWZB 3O2VL 5DMKA 4ZAKD 3HRPA 1HHKA 1DSFL 1OAQL 4HAFA 3BPNB 4NKOB 3RU8L 1J0IA 1T83C 3VFWB 4GRMA 3WS6A 2YOCA 3PJSB 1IAMA 2FGWH 4KKBC 3LN5B 4LPTA 5J06A 3HI6L 4NQUA 2FZ3A 4MB5A 1NL0L 2VXQH 4M1CD 4C59B 1FN4B 1XMWA 3QJFA 3F7RA 4JDVA 4UT7L 4U6HA 2H2PC 3RWIB 2HJFB 1D9KB 2BVPA 3QXDB 3O6FA 1NBQA 4CU7A 3JXAA 3U48A 5IG7A 1G7JA 4JO1H 3S96B 2Y6SD 1CG9A 4HX1A 3EYVA 1EXUB 1RFDL 5IBUB 4NC0B 4Z7WA 5ETUB 5LAXB 4I0PB 2VZ1A 4D3CL 1MQKH 1NEZA 5ERWA 5E8NB 3PIQB 2BCKB 5DXWA 1DBKH 3HNVH 2WBKA 3SGJA 4OZFB 2UZIH 3KYAA 4HMEA 2WUCL 1VCAA 1VPOL 4MXWH 1ND0A 1ZWIA 2OR8A 3NIGE 4M6OL 4XVTH 3ZYJA 4O02L 4S0TD 2XI9A 1MLCB 1O5DT 3UAJD 5J11B 4DGYL 4HKJB 5IB2A 3UPRA 1R3HA 4R90L 5B4MC 3VRIB 3ZKSD 1C5DB 3O11A 3QCTH 4F15B 5L88L 4YXLL 3MRGA 4PBVC 3EW3B 1NCNA 25C8H 1JPFA 1H0DB 5ADOH 4PJFF 4JFOB 1U36A 5CILL 4AENB 5AAWA 4UZGA 1ED3B 1T5XB 4M7LL 2FX8H 3LKQA 2WM0A 4MA8H 2Y06H 5HHMD 5HDBF 4FQQB 1HKLL 4UAOC 3RVWC 1IBGH 4H1LA 1LO4L 3HI5L 5EO9A 1U8QB 5I8OL 1I85C 4EN3B 1X5YA 2ZUQC 3D9AH 2VXVL 4IRSA 4DKEL 1NC2D 2IADB 4NUJB 4WFFE 4ZFZA 1XGQB 1A47A 3OKMB 1P84J 2H6PA 4PUBL 5HDQL 5ICYA 3MYJB 4RA0C 2VL5A 1FO0A 4RGMC 3MFGB 2MNUA 5M7QA 2JJWA 4ENEC 1MCSA 4X6FB 3S7GA 4TRPL 3SKMB 1BD2D 1F4YL 4DUWA 2JCCF 3T3PE 4FXGA 1FO0H 3AROA 5L9DL 3T0WA 4Y4HD 3V8CA 4NWUH 4JG1L 4RA3A 1BREA 2X4TA 5I2IB 4K71C 1HSBA 1CGXA 5HGDA 1JWMA 1J8KA 4HWZA 5C9JA 4HJ0D 4KK8D 2C1PB 5I8EA 3U4EB 1NEUA 2I5YL 5EZIL 3QI9C 4JO3L 2IALB 4QHLA 2F74A 1LO0H 3IS0X 2LV4A 1BWWA 4WNQA 4QHNB 3ZSSA 4K3DH 1AQKH 4MS8C 5GJTL 3TV3L 3MV7D 4ZO9A 1MVUB 2XWTB 5HYSB 3QO1A 4D94A 4RFEA 3DHJA 4OFDA 2B1AH 5C0EA 1OSZB 5JOFA 4Y1AE 4XXDB 4F7PB 5F7HA 1HDMB 5C0JB 2G9HB 3GSOA 4PJCB 1NKRA 3BXNA 1Q9KB 3OHXA 2EH7L 5BZDA 1MCLA 4OM1H 4MJ5A 1AIFB 5I66B 1Y18B 3GIVA 5E5MB 3UO1H 1PGRB 2AEPL 4NKIH 3O81A 3VFNA 1CD1A 4ODWA 4LQFH 1EAPB 4XPTH 3ULVE 4BK5A 4HXAL 4KQ3L 5FB8A 5CS7A 3PWNB 3D2UB 5FO9B 5DRWB 3SDCB 1X5AA 2EE6A 3L3JB 2R2HB 4Y4FD 1AI1L 5EPMA 1E27B 4OT1L 1UKQA 2FJGB 1XIWC 2BFVL 4XCEA 1EHLH 5I75B 4NBYB 4QLRA 5CUSH 2Q8AH 2Q76A 4GW4B 2UY6A 1FE8L 3KAAA 1F6LL 1RUPH 2NY7L 3GSVA 1RJYA 3HPJB 3QT2A 1KJVA 5HYQB 4OD1H 3QDGA 4G6ML 1JRHH 4NKDA 4L9LB 5DO2D 2FHFA 3LMJH 1M7IB 3DXAE 4X4ZA 3T4YA 4Y1AB 3SHSA 3FAWA 1KUMA 1GCFA 3GSNA 3QDAA 3TWCL 1XH3B 3HC4H 4K94H 3NH7H 3JWOH 2X4OA 1KB5H 2DDQH 2EKSB 5D1ZA 3U0PB 3D0VA 4PJEB 4GAGL 3IT8D 1M4KA 4YHIA 5D7IA 4WO4C 4PG9B 1UKTA 2Z0BA 2F58L 1FL5A 2KUTA 2J5LC 5AWNH 4QTHA 3VWJD 1TTUA 1Z5LA 4MAYA 1GGYA 2Y36L 1CXHA 4FQCH 1N0LA 1MRDH 5CGMA 4OCWH 1NDMB 1IM9A 2QSCL 3WUWG 1PY4A 3K80A 2HRLA 4ZNEA 5FGCE 4ODUA 1KJ2A 1D5BB 3DIFA 5DYOA 4YO0B 4XWGL 5CZXD 2D9CA 1ZHBA 1BZ9A 1ADQL 3QA3A 4UNUA 2P49B 3BO8A 3R8QA 1DN0B 1NFDB 3ESUF 3GI8H 1F13A 1JNHB 4MHHG 5JIPA 2X9YA 1KJ2H 5DLML 3QCVH 1QHOA 1L6ZA 1UM5L 4OKVB 5D93B 1CGTA 1EEQA 3WUZA 4R0LB 4TTDD 1NSNH 1T20A 3NN8A 5HYFA 1XF3A 3HZKA 1K4CB 1G6RA 3DXAB 4JFXA 5IKCB 4N0FB 4Z9KB 3GMQA 4Y5YA 1YN7A 3FT4A 1CU4L 1TITA 2FH6A 3CSBA 2KDGA 1G6RH 2BERA 2A1WL 2YMXH 3PWJA 4BFEA 1HNFA 1T2JA 5C0RH 2JELL 3J8F7 3TO4B 3QUYA 2EDLA 1OLZA 4WU5A 3VXRE 4S1RH 3LQAH 5E1HB 5HGGS 5ESVA 4LRNH 4R4NC 4IOIA 2ORBL 4KUCD 5FF6B 4UQ3B 4KTYA 5FGCB 1YN6A 2V5MA 3SJVD 3ARZA 1INDH 3VXUA 2W9LA 4X6EA 5BW7C 3D3VD 5BMFL 1A6AB 3HZVA 2FJHA 1WV7T 4XBEL 4P2QD 1RJZA 3TGXA 1SYVA 2P5EA 5D9SB 3WHE0 3P11L 5E1AA 4OLYL 4KI5E 2NXYD 3C60C 3K1KC 4JN1H 1R3LA 3RKDC 5LG1A 3KPNB 5GSVB 5D1QB 2EC9T 3EO1B 1YJDH 1XF2B 2CKBA 5AG8A 2H9GA 4WCYH 3V52H 5SWSA 1JHKL 1KPRB 1TVBA 2ZG1A 1YEHL 5D2LA 1NCUA 5IV2B 3REWB 3RVXC 4GRLC 3STLB 3IDIA 5MEQA 2CKBH 2ZSVB 4PJIE 2DKUA 4HIJA 2MTPA 5C07D 1QFOA 4QYOB 4IHOA 3P77A 3BP5A 3CLEL 3VGBA 4MNQB 5MHSD 1R3IL 1U8NA 2DKMA 3P73A 3IKCA 3FT2A 3KWWA 2MCG1 4JFFE 3S35H 3ZE0E 4HUXB 3TYGL 3TPKA 1KIRB 4DW2L 5IESH 4OI9A 5JW3L 3QUML 1XF4B 5FCUH 3BW9B 1Q9OA 4WTZA 2HT2C 4LLYB 4J8RB 5L0QB 1CFBA 4N9GB 4Q97A 1F11A 3IJHA 3WIIH 3HNSL 1HOCA 4JVUA 4K3HA 4RMWA 1T7YA 2DOCA 4NQEE 4X99A 3S4SB 5L2KD 2OYPA 5ACLA 5IW6B 4C58B 3NZ8B 4KC3B 2Z31D 4Z7UE 1GL4B 5FYJL 2BC4B 2FSEB 4HT1L 4GKZA 4GAYA 4KJWD 3OKNA 3MLZH 1AGBA 1ZANL 4P4KA 5EIIA 2AAVA 4PJIB 4CVZA 2KQMA 1HXMA 5KVEH 3RNQA 3WDJA 2X10A 5KANI 2VQ1A 1JWUB 2QSTA 4F8TA 5HGAB 3WSQL 4XX1G 1AD0B 3AY4C 5GGSA 1R24A 3BP7A 4JHBA 4L3EE 3PG2A 4GW1B 3TBWB 4TNVK 4X7FC 2E7LA 2R1YA 4X4YA 1DVFD 4PLKD 1A6WH 2IEPA 1ZLUK 1U8PB 1JI1A 3F12A 5AYUL 1A7NH 2DQHH 3HC0A 2EDXA 1KEGL 1FSKC 5J1AB 3H3BC 3D39D 3OJDA 3MNVA 4HEPG 2VLRE 1FHGA 1EERB 2K9UA 3BESR 5F7EL 3WIHA 3WNLA 4NQEB 3SCMC 2W9DL 1A3RH 4JHWH 2J6EA 3ZDZF 2V2TB 4Z7UB 3WXWL 2WQ8A 5I9QB 3WIHH 4WU7B 4MAUL 5C0FB 3N9GL 1OAUL 2ESVB 3QULB 4KMLB 2AJ3B 5CZVH 3PXJA 5KSAB 1T89C 3RZCB 2AP2A 3BOVA 3QHTC 4PR5A 4JZNB 1S7RA 1QA9A 5IB3A 1WGOA 1J7VR 3I02A 4NJAL 1UA6L 4XNYH 4PJHE 1F90L 2DJSA 4KKLC 1T22B 1NBYB 4OIBA 1D6EB 4OGZA 5FA4A 5EZJA 1UZ8A 2NY6C 3AAZA 3ZTJG 4L3EB 1SJEB 4OZ4B 2X4NA 2OR9H 2Y07L 2YN3A 4WIQA 1MUJB 1SEBB 4I0KA 1CVSC 4WWKC 1YY8B 3D18A 1NUFA 1BIHA 1VFAA 3FOMA 5TE6H 3W9DA 4LLMB 4F9LC 1W2KT 2NTFA 1TQCB 3ZDXE 4KXZH 5DEZA 1OP5H 3A6CH 2RAMA 5I19L 1DANU 2Z4QA 3V6ZB 2D4DA 4NT6B 4AL8H 4UOJA 3VXPB 2GJZB 5F6IC 2VLJA 4L4TD 3CUPA 3KPQA 5GS1B 4YX2H 3PHOB 1IGYA 2A6DB 1GC1