3K81A

Structure of the central interaction protein from the trypanosoma brucei editosome in complex with single domain antibodies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
b'VQPQESGGGLAQAGGSLRLSCVVSGITFASEAWGWYRRAPGKQRELIAAINNEGRTNYVDSVKGRFTVSRDNAKNVMYLQMNSLKPEDTAVYYCNANLQTGTLSGARLYWGQGTQVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MP18 RNA editing complex protein
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Immune system, rna binding protein
total genus 18
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k81A00
4H5SB 5D1ZB 4R7DA 3GBNL 1ITBB 4HJ0D 4NC1C 2DLTA 1JK8A 4XZUB 1NL0H 4O02L 3REVA 5F7NC 4AEIL 1IEHA 4CNIB 3FN9A 1U8JB 3VFMA 1NBVH 1GGBL 1KLUA 1MEXL 2UWEB 1SM3L 2NY2D 1Q0XL 2AK1H 4GRLB 5HI4D 3S36H 5BMFH 1OCWL 3UBXA 2HAZA 1U58A 2JB5L 4HW6A 3OZ9H 4WFHD 2RR3A 3DYOA 4MCZB 1WBXA 3LIZH 5DURD 2R4RL 1FL3A 4G9DB 4LOUD 1GIGL 2DQEL 1KXVC 4OZIE 4PRHA 1Y0LA 4NOFA 1PKQE 1JRHI 4QOKD 1NDGB 3QCVH 1J5OL 4F58L 5HI3C 2WIMA 3C60B 3OKLB 4U1NB 3ULSB 3I6KA 1QR4A 3O41A 1MI5B 1U91A 2EICA 1T2QL 4HQQL 2VDNH 3AS0A 5KJRL 2FIRT 4WFFE 4ZNCD 2IALA 5I1IL 2JCCB 35C8L 3UMTA 3KPOB 4POYA 1WIOA 1JPGB 1AGFA 3QIBC 4NQDA 1C7TA 1NCDH 5EOQH 3HAEG 2CPCA 2UYLB 5GS0D 1MIEL 2P24B 2FDBP 3CLEL 5I17A 4P46C 1H5BC 3D39E 4NQCE 1F42A 1KJMA 4KKCD 4XWGH 4LPVA 4YXLH 1WF5A 4HZLA 3MNVA 1XF5B 3MLYH 3MOQA 5L6YL 2QL1A 1KBGH 5IF0A 5JNYA 3QDGD 1W72H 4PJCF 4ZUUA 5GGSB 2W0PA 2HJFB 1J0ZA 5HYEA 3RNKB 4BUGA 1B4JL 4L3ED 1WFOA 3LSOB 1AXSA 2YD6A 2CRYA 1RJLB 4C56E 1OP3H 3WFZA 5E4EC 2DQHH 3IU3A 5HPOA 3CCHA 1DQML 5EORL 3EYVB 3D9AL 3N1GC 4J8RA 3PWUB 1UXSA 4H8WL 1YEJH 4E41D 1QLFA 3E8UH 3P4NA 4HPOH 1S9XA 3HI5H 4PGEA 4XC1L 2PXYB 2MNUA 2IQAB 2OR9H 1N4XH 3QDJB 5KOVC 2YSSB 4QXTB 3O6FD 1R3KA 2VXUL 1Q38A 5E8OB 4OFDA 4GBXB 2DB8A 2BNRE 1CZ8L 2COQA 4X0KB 4X6DA 2OTWA 1RULH 3FMGH 5HGDB 3GMQB 3ARQA 5DD5H 4QCIB 2JK5A 3PQYA 4GRMA 5ESVA 3WUWG 2JIXD 1H0DB 4UNTA 4E5XA 2HFFA 2A38A 1KCSH 1SYSA 4YBLC 1AHWB 4DQOL 1LP9B 5HI5D 4Z7UE 3GSQA 4IRZL 2HTLC 4WEUD 2UVEA 2ZWLT 4JM2C 4LCUA 2W59A 4S2SA 1RJZB 2XICA 1FIEA 4ZS6C 3TCLA 4OCSH 3C6LA 4K23L 3QQ4B 4LSRL 1D6VL 4O2CB 3WD5L 1MHHA 2R2EB 3SN6N 1XIWA 4ELMA 5LGKA 3H7BB 1G1YA 1H3XA 4OCLC 4P3DA 1MQKL 2MHAA 1KEMH 1NCNA 1MCCA 4PV8A 4HAFA 4Z77B 2I9LA 4M6OL 4HHAA 4L1HA 5J12B 2AI0L 4FP8H 5EA0L 3W5NA 1TPXB 3MREB 1HYSC 3IFLL 1H3VA 1XZ0A 5ICXB 5LXGH 3RWFA 5IEHA 1U3ZA 3X11A 3D85D 4PRAA 4NM4H 4D0DA 4X4YB 4RGOH 5FKPA 3MLTB 3HC0A 4RRPG 1WWAX 5T1KB 5DYOB 2QQLH 2P5WA 4H8WC 4YWGL 1J7VR 2EDJA 3FCTB 4G43A 3DI3B 3VXSA 5C9KA 3H2WA 3GBNH 3J7HA 3OAZK 4RZCB 3RKPA 1M71B 4OFVA 4C83B 4O02H 2CDEB 2YC1B 4AEIH 3ZE2E 4PRPD 4NKMA 5E08H 1CDIA 2HT2D 1M7IA 1B2WL 1GGBH 1MEXH 3I02B 4W4OC 1N7ML 3KJ4C 3PHQB 2YR3A 5B4MC 4KROD 4ZAKC 3DXAA 1OCWH 3QXDA 2JB5H 3IFNH 5EU6D 3K8MA 3TBSB 2W9EL 3N85L 4PJBF 1GIGH 2DQEH 5F1NA 3PGDA 5IB5A 1IQWL 3HCVA 5C0IA 1UZ8B 3OJDB 1LO3L 4M03A 2BNUA 4OM1L 1YPZF 5DJ0B 5ECJE 4V1DB 1BBDL 4F58H 3NFNB 4UV7H 5CJQL 5LJYH 1OB1B 3U1SL 3ULUE 3OF6A 4HQQH 2LAGB 3O9WB 3VRJA 5IFAL 3DVGA 5KJRH 4RMRA 1OTTD 4APQD 5E9DB 4BH7A 2B39A 5TDPA 4YEEA 2HLAA 5I1IH 5FV2A 3H3PL 1T7WA 2AS5M 3TO2B 3FB8A 1HDMA 3EYUH 3IF1A 5D2NB 3VFRB 3LRSA 1WBZA 5GGUA 1MCJA 3QEQB 1MIEH 3LEXA 4O00A 4QGTA 1ZHBA 5T3XD 5KVFL 4QY8A 3CLEH 2F53D 2Z8WC 3KLSA 3TIDB 1F58H 4M93B 3BRDA 3MRBB 2HT3D 3IDMB 4P57A 3EOAB 1R3JB 1U3YA 4KHXL 4PJ5B 5DJ2B 3MJ9A 3BDYL 1RAMA 2PNDA 4P2QD 4Z0BL 1T3FB 1MLBA 4LMQI 4S1SL 1ZT1A 1KPVA 1BIIA 4QHLB 3VH8A 1U95B 1CL7L 4ZPVA 3F8UB 1UB5A 3VXTB 3AMLA 4QEGA 5KZCB 3C2AL 1DQMH 5EORH 1YMME 3OR7B 1D5XB 5EZLA 4H8WH 1TMCB 1J0IA 4PYHA 4EIZC 2YK1H 5J3HD 3HMXL 4CGTA 1JNHA 5LG1A 1GGUA 4XC1H 4MSWB 4Y19D 2DYPB 2HWZL 3EFDH 2CGRL 2C7UB 4X7TA 4CRPA 3SQOL 1T20A 4M5ZL 3TA3B 4WENB 3C6SB 3ZDYF 4XRCB 5D6DA 2VXUH 5FO7A 3IJHB 4JFFE 3V7MA 4EN3B 1JTTA 4NHCL 5D7LD 3MRDB 4KKNA 4X7DC 4XCNB 1WZKA 3S37X 5L2KB 3VRLF 2A6DB 4GMSH 3NVQA 2QHRL 4JPWL 3CFEA 1DE4A 4O2EB 1JV5A 4ZFOL 1CDHA 3B2UC 3DLQR 4OZFG 5D6CA 3VXMD 2B8OT 2HFEA 5EZJB 4LDLB 5FYLH 2ZUQC 1CGXA 4DQOH 4LHUB 1WITA 2KH2B 2H9GB 4KK6D 4S1DC 4MQXC 4IRZH 1YY8B 3A6CL 4FXLA 1NEZG 3TCXA 1NBYA 4ODTL 5KS9F 2AJ3A 4YDKL 3I75A 3B9EA 4K23H 4LSRH 5D1XB 1YUHB 3KPLB 3WD5H 3HS0A 3EIFA 5D7IB 1D3CA 5F1SA 2KL6A 1NMBH 15C8L 1RUAL 3C08H 5ADPL 1D9KB 1MQKH 4F9PC 1OSPL 4TTGA 3MR9B 3HI6L 4M6OH 4ZQKA 4MHHI 5JW5B 4KJPD 1ZOXA 5EA0H 5CP7A 5IM7A 4RA3A 3IFLH 4FTVB 3H9SD 5ITFB 3U6RB 3QUYA 3QUMA 3QHZL 4KVNL 2IPKB 1H3GA 3SDAC 5MERB 3RHWK 1F97A 3CUPA 4HUUB 1VEOA 3VFOA 2VAAB 1T5WB 5DS8B 3LQMA 3UYRL 1VFMA 4P4KA 1V5JA 2IH3A 3QNXB 4QHUA 5IB4A 3VXNB 1L0QA 4NNYA 2I5YH 5FIEA 3TPKA 3ZHLA 2NY1B 3ARFB 4XMPL 5JIPA 3QFJE 2VLKD 1ZHNB 3BEWB 1I3RB 5FM5O 4X8JA 5B38A 3VDCA 2GSIA 3PXHA 4MD5A 4UQ2B 3SDXA 3WSQL 1IAIL 1IKNC 2HKHL 1NANH 3V8OA 2OTUA 5MEPA 3W2DH 3O6KL 4JR9L 2HRLA 1MFCL 3KLDA 2X2YA 3N85H 3WIIL 2EDEA 3DX7A 1IQWH 5HJ3B 3LKQB 1WLHA 2G75B 4L3EE 3CDFA 4KVCH 1AGDB 1CU4L 1LO3H 1HSAB 3KWWA 5HHMB 5GGVL 2XWJA 1LEIA 4OM1H 1BX2A 3CU7A 1TENA 3B3IA 5HYFA 1ODAA 1C8PA 3RL2B 5TE4L 1SYVA 2F5AL 2R1WA 2YZ8A 2EDLA 4Q6IA 4XNUH 5E8NA 3U1SH 4WWKA 3VFPB 4IOSD 2YD9A 1QYGL 2H3NB 5IFAH 3PJSB 4XCFL 3GI8L 2CO7B 1WAAA 4CJ1A 4XP1H 4NYLA 1Q9KB 1EVUA 3T2NH 3H3PH 3T0VA 1XGPA 1SEBB 5JMOC 3FO1A 4KZDL 2X1OA 5E8EB 5DJXB 1J8HE 4L29A 1I3GH 3VXUA 4R26L 4R4BB 3WHXA 2BVUA 5EH1A 3PHOA 1AO7E 2QSCL 3GHBL 1AXIB 3KLAA 5KVFH 3ARDC 4MLSA 4XMKL 4ZNEE 1OF2A 4XBGA 4X80H 2A0LD 3ARSA 1CDYA 1VGEL 4F8TA 25C8L 5FA4B 4KHXH 2EYSB 3U0PB 5EO9B 4QO1A 1FRGL 4MWFA 1WTLA 4R96A 3BDYH 1KN2H 3QH3A 4JM2F 3FO9B 4G80B 4NSKB 2IAND 4Z0BH 4DW2L 3HZMB 1HEZB 2X4SB 2F8OA 4OGAD 4WGVB 3U0TB 2DJSA 1CL7H 4I4WA 4X83A 3LEVL 3CXHK 4RNRA 5FKAB 4YXHL 5F1KC 1T0MB 2XTJD 3C2AH 5IIEB 3IKCA 1FVDA 1B6DA 3O8XD 4WDIA 5SWSD 2WBWB 1KIRB 4LDOB 5TDNB 2ZNWA 3HMXH 1X5GA 1HKFA 4X9BA 1CS6A 1S7TB 1WZ1H 12E8L 1BGXL 2HWZH 2CGRH 3GUTA 3SQOH 4LFHD 5DFTA 5A16B 3RNQB 4X6FA 5CWSA 4M5ZH 5EUOF 5FGSA 5EU5A 2EDRA 1OPGL 3E1F1 4LCCB 3MYJA 4OD2B 3SDCD 4R0LC 2XZCH 4L9LC 4XVUC 5CZXD 4Q9RH 2OM5A 4QHNB 3TESA 4EI5B 1MCOH 2QHRH 1DQLL 1Z5LA 2NXZD 1SJHA 2E6JA 3ET9F 4N0YL 5JA9A 3U4BL 2VUOA 3LKPA 4M7LT 2GKIA 5DD1L 3IDIB 1P9MA 5HDBE 3HC3L 1HHIB 4MNGB 4RFOL 3DX8A 1AP2A 4H0IA 2HRPL 1S9YA 1IRAY 4PJGF 3AM8C 5HVHB 3ZMRA 4TNVF 5E6IA 2XZZA 3O4OC 1FG9C 4UBDD 1CE6B 3A6CH 4L8CB 2DQTH 1NUNB 4ODTH 5FO8B 1CQKA 1HH6B 1LD9B 1YN6B 1PG7X 4YDKH 2BNQD 2QV2A 2DI9A 5B3JF 1FSKB 2NY6C 4OJFH 2FJGB 5ADPH 15C8H 1P6FA 3MMEB 1NC2B 1OSPH 4R6UA 3ARTA 5KAQF 3VD4A 2ATKA 3GMMA 4O58H 1W0VB 5HBBA 2DMBA 1AIFA 3HI6H 3S4SA 2NY0C 3D25A 4UQ3A 4D9QE 3OB0H 4IRJD 1RZJL 1NUFA 5F9JB 2GI7A 2XXCB 4BSWA 1NSNH 1VB9A 3C8HA 2HVKA 5AZ2L 4PTUB 5CMAA 1QSEE 4KVNH 3QHZH 4Z7NF 2WM0A 4UAOC 1XAUA 5HVWA 2X4QA 4L3AA 1NAMA 4Y8DC 1NDMA 4WIQA 2R2BA 5GS1A 4MA7L 4XX1E 3CFJB 3FRPG 4NM8L 4G8GA 3UYRH 4CADB 5FB8B 1IZJA 2ATPB 1LDPL 2R15A 5T3XE 4P49A 5GGSY 2F53E 2APWA 1UENA 4XMPH 5HGAB 1VFOA 4O51B 2BERA 1URLA 2A9NL 3O2VH 3FO0H 1KTKE 1IAIH 2HKHH 4MAYB 4P2QE 1ADQL 3O6KH 4JR9H 5C0BD 1BQHA 3PNWA 2EIBA 4KV5E 3WIIH 3N1FC 4P23B 4Q6YA 2ITCA 1CU4H 1LWRA 5GGVH 2R23B 5IVZB 2CIKA 2F58L 2VQTA 4P5KB 1T89C 5TE4H 2FYYB 3LRGA 3SY0A 1QYGH 3BVNA 1HKLL 1MJ8L 4I18B 4NN5B 4Y19E 4Y4HC 3QXVA 2YUWA 3GI8H 1YJDL 1F11A 1BVLB 4JO3L 2HT4C 1FG2A 4LKCB 4J3XA 1Q1JL 5IVOA 3UDWC 2R39A 4KK5C 3HLAA 3BH9B 4KZDH 2EKSA 2Q86B 4LL9A 1HK6A 5FV1L 1KLGB 2QADD 4WUKH 5D2LF 1JWUA 4R26H 5AYUL 1QLEL 5D7LE 3C5ZB 2QSCH 3T0ED 3GHBH 5I1DA 3VFWB 3Q6FB 1RK1A 4YZFF 4MA3B 2Y6SC 1WJ3A 3TO4A 2CXGA 5DXWA 1XMWA 1ULVA 5DF0A 1JWSB 1P7KB 5CGYD 5IVXA 3H3KA 5DJCA 1H8SA 1RZJC 1G0YR 1QHOA 2N56A 1IBGL 3PABA 5C07B 4M48L 4DW2H 3CVHB 1UG9A 3FT2A 5EUKA 5ENWB 1U8QA 2DS4A 4U6XB 5FA3B 4DCQB 3BQUB 3LEVH 4UIMA 4WI3A 4OIBA 2G5BA 4HIJA 4PJFE 1F8TL 4QLRA 2CLVB 3QFDA 4NPYB 1WFUA 1YQVL 4EOWL 3FQRA 4U1IA 3K4DA 3WO3B 5DA4A 5IEKA 1EO8L 4BM7A 3VA6A 1AJ7L 12E8H 1BGXH 4Q2ZB 3STLB 4ODHL 1B4RA 1KG0B 1LO5B 1TNMA 1CFSA 4HMEA 2OJEB 3SGKA 4U1LA 4EDWH 4HUMB 5JDSB 1O7VA 5FYKD 1JUFB 1HILA 4LNVA 3WNOA 1OPGH 1QRNA 1AKJB 4PJXA 3P9MB 5K9OA 4OF6A 1NC4B 4EKXA 4JY5L 5IBUB 1DQLH 4X6BB 1XF4A 4N0YH 3VDBA 3LB6C 3U4BH 4RMTA 5DD1H 2P5EB 3RWIB 2ZNXA 1K8IB 3ZHDA 3HC3H 1A2YA 3G5YA 4RFOH 1IM3A 5C0GB 1BM3H 4U1GB 5IW6B 1IT9L 5E7BA 1YJDC 2XQYG 2P8LB 5HY9A 2IADA 1G7MA 2X1QA 4Y4KD 2ICES 2B0SL 1A9BB 3OX8A 4WW2C 5SV3A 2C1OA 5D1ZD 1KLFA 3CMOL 3AY4A 4PG9B 3BN3B 4ODWA 5JO5B 1BLNB 4U6TA 2CDGA 2X4UB 4IJ3C 4GRLD 1QA9B 1EBPA 3PIQA 4AEEA 2VDML 4QTHB 2QQKH 5IQ7L 3NIFF 2DJUA 4JZOA 5AZ2H 4U7MA 3EGSB 1KGCE 3G5XB 5ISZE 3KPSA 3RY4A 2WQRA 3B9DA 1G7QA 1MPAL 1NLBL 4I0PB 3SKOA 4MA7H 5CKGA 4NM8H 3MBXL 4KKLC 3C60D 5DK2B 4NZUL 4Z7WA 4JRXD 1MI5D 2XA8L 1LDPH 4MDIA 1XR9B 1YZZA 3KPPB 1G6RA 4DAGL 3F7YB 4Z7OF 1ZXQA 3ZE0F 1E4KA 4CU8A 3HG1D 4LAJH 4NJ9H 2A9NH 3MTRA 3CVIL 3L3GA 3QRGL 5E2WL 3FB7A 1E27B 2OMBA 2IANE 1ADQH 2NY3B 5I8KL 3T3ME 4KH2A 3HTLX 3ME0A 3MRMA 1JGLL 3GSRA 3PGFL 1WVZA 3NA4A 4TULL 4CVUA 2KQNA 5EIIA 2F58H 4ZPTA 2Y5TA 1JRHL 3N50A 2NY7L 2PUQT 4LNRB 4PJ9B 5SWSE 2GTWA 5F3HB 4EIGB 3VG9B 2XN9A 4XTRC 1YEIL 3TT3L 4X5WA 1LVEA 2D7OA 2XWBB 4JJHA 1YDPA 1P1ZB 2O5YL 2Q1EA 3QJFB 1IAKB 1A4KA 1MJ8H 5CSZB 2UUDK 3I85A 1YJDH 1WIPA 3BKYH 4YHPA 4JO3H 4YDIL 3ZSTA 4AY0A 4LCWA 4WEMB 4RFNB 1X5JA 1Q1JH 3GMPB 3CDGA 3X3FL 2NY4C 4A6YA 3L5WA 2B7DT 4LGSB 3P9LB 5EOCL 4N9GA 3RWCA 3ZKND 1A7OL 1V3LA 1Z9LA 5JXED 3RUGF 5F70A 2PXYD 4PR5A 4X4ZA 3U9PL 3W9DA 1AFVH 1LILA 5C9JA 1JGDA 3VXRB 4HIIB 1Y6NR 3QEHA 1A22B 3WXWL 2D0FA 2JTDA 1CD9B 2OLDA 4ZUSA 1GPOL 1IBGH 4ODSL 4P5TA 4GBXD 2Z91B 3SBWA 2EYTA 3TV3L 1S5HB 4ZOBA 1OD9A 5D9SB 1RHHB 3VMNA 2FO4B 4FMKA 2BOCB 3F5WB 4L8BA 2SEBB 4NCC2 2BNQE 1F8TH 2E7HA 3DTXB 5A2LH 3MLWL 4OV6F 1YQVH 4EOWH 2P47B 3DV4B 4Q7DA 4AIZB 4TPRL 3VG0L 1EO8H 1XCQA 1AJ7H 4KK8C 4ODHH 4QXWA 2NR6C 2Y23A 4PP1C 2AJVL 1CXHA 1I7ZA 3C6LC 1YEEL 4AH2A 3FFCA 1XIWC 4WUUB 2ZPKL 5DQJB 3QDMB 4PJAE 1JYVA 1QKZH 2W07A 4PJEE 3DOSA 2YRLA 5IK3A 2L0DA 3OKMA 1FFNB 4JY5H 1OGTA 4JDTL 3KPRD 3MLZL 1U8PA 3IXAA 3V4UL 3KYOB 5JUEL 2H26B 3W39A 1UM5L 3MJ9L 3MBEC 3T3PE 3IDNA 3MUHL 1IT9H 1MLCA 1EVTC 3P77A 3RGVD 3S96B 2B1HL 5F9WC 4AM0B 5DRWB 1H5BB 3KYAA 4D9RD 2B0SH 3DX9B 4MA8L 5IROA 4IDJL 2DWEA 2VLLA 4N0UE 2PKDA 1KNOA 3CMOH 1HE7A 3CSBA 3GEWB 4OZIA 4PLKC 4P2OA 1U6AL 1JN6A 2JB6B 1PKQA 3KLHD 4JQXC 4F3FB 3AUVA 4P3WA 3B5HA 2ADJA 1RZFL 2NY5L 3FB6B 2DJ4A 5BRZA 2UUDH 3LKSA 3AREC 3LPWA 2Z4QB 1P84J 4ONHA 1PYWA 4X98A 1AQDB 4UTAL 3U9UB 1R5IB 4FN0A 3ARVA 4NRZA 2VR5A 3AU1A 2BVQB 1U36A 1U3HA 1WISA 3VI3F 4JRYE 1J0HA 4H5SA 1FJ1A 1MPAH 1NLBH 3HUJF 2K7PA 2FZ3A 4V1DD 4XZUA 1ZKAA 3RTQA 5GIRB 3MBXH 1V3KA 3D39A 3FFDB 4NQCA 3ILPA 4OKVB 2XA8H 3T0EE 4AZ8A 2V2TB 3BP6B 3O9WD 2NY2C 4NC0B 4DAGH 3NZ8B 5C3TA 5E9DD 1LO2L 4OLWH 1IGJB 2A1WL 3S3SA 5EU3A 1ZLSL 5HHOE 1H8OA 1RU9L 4MCZA 3CVIH 2FH6A 3S98A 4LOUC 3QRGH 1G7IA 4MJ6B 1ZWIB 5DFVD 1U41A 5E2WH 3HN3A 2O93L 4U49A 4FFVD 1CLYL 4WO4A 4JLRA 3AFLA 4OZGB 5C08B 1KEGL 4F33A 5I8KH 5CEYA 2Q7NA 4POUB 1JGLH 4OCMC 5GZOC 4HMDA 2FEEI 3F62A 4TULH 4CMHC 1DQJA 3VWKA 4JM2B 2BOBB 4HWEL 3W0WE 4PJ5D 5L2JA 1JRHH 4OCRL 2NY7H 2LQRA 3LPGA 1ZA6A 3JWDL 1YEIH 5IBTL 4B7LA 3EDEA 3KPOA 3E6HA 1QZ1A 3K2MC 4ORGA 3RVVC 1S8DB 1OAKL 3U82B 1QSFD 4NQSA 3PDGA 5C0EB 3X3FH 2P24A 4QRRB 5E6YA 4AQOA 2BNRA 5SX5H 5KZCD 3VE0B 1Y18A 2EXYD 4PFEA 4JB9L 5EOCH 1B0RA 1T03L 1A7OH 2DLHA 1DBBL 1FGNL 4P2RB 5TDOA 3RVXC 4U6YB 1YNTB 3EO0B 5MENE 2NY5C 1T1ZA 5HHXL 3U9PH 1UA6H 2DYPD 3NCYP 3SCMC 4BFBD 4TNWK 3CC5A 3B5TA 1Z6JT 3BGFB 2ZOKA 1A1NA 1FZJA 3TA3D 2HJFA 2JELL 2WP3T 3DUSB 2UZIH 4FQLL 5D6DC 3FQWB 5C09B 1GPOH 3P73B 3WYRA 4NWTH 2J7LA 4Z7UA 1N5AA 1RK0B 4EN3D 3S88L 3TV3H 3N06B 3KYNB 4TQEL 3QUXB 1ES0B 3RL1A 3TN0A 4JKKA 4OCXL 5FYJL 5C0CB 2WWKT 4X99A 2WLZA 1CFVL 1J10A 3RX8A 3KJ4B 3EW3B 1UFUA 4U4BA 1X5FA 3SDDA 1VKXA 2DWDB 4J2XA 2CSPA 5J6HB 1RURL 5F89B 5J8OA 3MUGB 3BGMA 1XCTB 3QDJA 4EUPA 4LHUD 4GQ9L 3UJTL 3VG0H 4Z7VB 1K9TA 1TTGA 1W0YT 3GSWB 4NUGL 5IMMB 3GMOB 1S9WB 1KCRL 1PSKL 2AJVH 2EH7L 1YEEH 2YXFA 4Y5XC 3U36A 5DD6B 2ZPKH 4PJ8B 4IMKC 3R06B 1IKFL 1KIPB 5DDHB 1QPPA 3WE6B 1KTDA 2UVFA 1S9VA 3S37L 5HGDA 1A1OB 3MLZH 1F6FB 3CH1A 3SPVA 3V4UH 4RGNC 3QNYA 5JUEH 1K8DB 4JJ5B 1QFHA 2GITB 2BY2A 4JRXE 5HI5C 1CVRA 1UM5H 4PJHB 3MJ9H 1BJ1H 5I1LA 5C0AD 4WFEE 3QWRD 1DUZA 5D71H 3QUYC 5T3ZL 2B1HH 3HG1E 4N8VB 5IB1A 3T08A 5I8EB 4D3CH 2VO5A 2APXA 4MA8H 4IDJH 3QUZC 2CK0L 5DVKA 1LE9B 4P4KC 1PD6A 5HYQB 4WI5A 1MCDA 1U6AH 4WTWA 2NY1D 5FGCE 1BEYL 3ARFD 5JQHC 1F6LL 4Y5VC 2VLME 2V2XA 4LSQL 5AD0B 5CJXA 3V2AR 3MREA 1RZFH 3KPMA 4V2BA 3BZDA 4NHUA 5B21A 1TZIA 4RWYL 4GKNB 4QT5B 3DIFB 4GW4A 1JVKA 4PY7B 3QO1A 3MLTA 1NBQA 3CX2A 3NCFB 3SE9L 5DYOA 1QO3A 3MROB 1CT8B 1OWRM 1BD2D 1OAUL 4G42A 5J89A 3UTSD 5CKAA 3KPNB 2CDEA 3O6MH 4Q6IC 5SX4I 4WWKC 4JFQB 4TVSa 3IU4L 3I02A 3SE8L 2DL9A 2J8UE 2OTPA 1PX3A 5D5MF 1R3HB 4FG6C 4KROC 1LO2H 4IRSD 3NFSL 4QRUB 5DC0A 1FFPB 2A1WH 4KJYB 1ZLSH 3RWDA 1WFTA 4X6DF 5L0QC 1TJHH 1UJ3A 3OJDA 1EO5A 4MMXC 3NIGF 1KEGH 1JGEA 5DUPL 2F54B 4NQTA 4BJLA 4JN2B 1YMMA 1MJJA 1XH3B 2C26A 2VL4A 5T1DH 4LSPL 3WHE1 4JN1L 4OCRH 2X70B 1R24B 1OTTC 3D2UA 4LEOB 3CAFA 1RZ8B 3UJIL 3JWDH 5IBTH 3B9AA 4L8SC 4ALAL 1WFNA 3X13B 5HSFA 3FZUC 1R5VA 4Q9QH 4GFTB 5B8CA 1OAKH 3QUMH 2DMCA 2WUCL 3QEQA 1BBJB 5T1LD 1JPTL 5DQDL 4JFFA 5GS2D 2FSEB 3QPXL 1EEYA 1A7PL 1P5UA 4QGYA 5F3BA 1F3DH 5GGRY 3V52L 3L6FA 5IW1A 1T03H 3GBML 5KSVA 1DBBH 3VRIA 5MEOB 1TVHB 3KPRE 2ADGB 1KCVH 3B9VA 1S7VB 1QFUL 2IAMD 5HHXH 3LH2L 5F6IC 3PWNB 1BFTA 5FHAL 4DOHB 3QIWD 3G6JB 4JKLA 3PHSA 2JELH 4FQLH 5FCSH 1FFOB 2R0LL 3MRRB 3UTZB 3S88H 4TQEH 2DDQH 1H15B 4D9RE 3CSYB 4NZRH 4OCXH 2JF1A 5FYJH 4TRPL 5IV2B 5E6ZA 1NLDL 5I1HH 1I1AB 3GSOB 1P9MC 4FFWC 4L8DA 1CFVH 2WWMD 2VLRE 2RHEA 1RURH 4Y89A 1YNKH 2HVJA 1T80A 3SE3A 3DMMB 2R2HB 3MA7B 2C7UA 5BXFA 3UJTH 5GRXG 3T65B 3QPQC 4NO0A 2IGFL 5HGHB 4OLUL 4NUGH 2V5SA 3VFTB 3C6SA 4ZFOB 1KCRH 1PSKH 1MCWW 2EEDA 1FNFA 2EH7H 2AJZB 2XKSA 1Q94A 2ENSA 3NCMA 3PL6B 1CG9B 1PY4A 4M6NL 5L2KA 2A6DA 4K7PY 4WHDA 1HQ4B 1I1FA 2VISB 1FP5A 2W92A 4O2EA 1MHCB 1TQCB 1NC2D 2ZJSL 1FNEB 3ARBA 1YEHL 5EZIL 2AXFA 4HG4J 4N8PA 5ERWB 4ZFGL 1X5KA 1C16A 3LN4B 3LVEA 3QFJA 4KK6C 3QQ3B 1TZHA 5B39B 5KSUB 1G84A 4JY4B 5HYSA 4PD4J 1VHPA 4LASL 3UZEA 2DBJA 4KU1A 4U1KB 3G6DL 3QIUD 2QR0B 5T3ZH 1U8NB 3ARDB 5D1XA 1YUHA 1XGUB 3LZFH 2E7CA 2CK0H 4NNXA 1C12B 4WNQA 1PG7L 3EBAA 3ZTJG 3M17B 5K9JL 5I1AA 2KDGA 4NFBA 2EE9A 3PXJA 4L3EA 3MX0A 3MRIA 2ZSWB 1BEYH 3V5HB 3X14A 3HNSH 4NQED 4LSQH 1PY9A 4FTVA 4BQ8A 2X89A 3TH4T 1EDQA 3U7YL 4MAYD 3BMWA 2D7TL 3DSFL 3OBAA 1CD1B 4GKZB 4K3EL 1J05B 3BAEL 4P23D 5MERA 1Q72L 4FZ8L 2VAAA 5E95B 2DAVA 3SE9H 1T5WA 5DS8A 4NKOB 4RA0C 1ZV5A 4XCYB 1QSFE 1BQLL 3C2SA 1J8HA 3BIKA 1MCWM 1OAUH 1OGAB 3FONA 1AO7A 4KRPB 1ZGLB 1F02I 4JGUA 5HXMA 1ZHNA 4HGMA 1KJ3H 5TH2A 2FHCA 2ZKHL 5J56B 3S6CA 1A21A 1KT2B 3ZL4L 4QHKJ 4GOSA 3NFSH 1PZUB 1FNGA 4WV1A 4AIOA 1PFCA 2BFVL 1MFBL 3NPSC 2G75A 3GJEA 4YDVA 5DTFB 3IGAB 4XPHL 1HSAA 1DEEB 2VABA 2AABL 5DUPH 1DVFD 3MODL 2AKRB 3SKMA 2LV4A 3PDOB 4ISVA 2YKLH 3O4OB 3MRHB 4HKBB 3ZDXF 3VFPA 3JVGA 4LSPH 3OHXB 4JN1H 1EAPB 5KSBE 2VLJD 1NFDB 3V0VB 5C07D 4CVXB 4POZD 4GG6E 4X6EA 3TBYA 2P46B 1T1XB 1J0YA 2NY6B 4EXKA 3GSNA 4YGVA 4M7JL 3NIDE 5E8EA 5CEZD 2WUCH 2ZCHL 2D4DA 4R4BA 2O26U 1HHKB 1JPTH 1NAMH 2D31A 5DQDH 2ARWA 2EDOA 1OQXA 1IAOA 3QPXH 5A43C 1A7PH 2V6HA 2ITDA 2GT9A 3V52H 3WFEL 1UC6A 4DVRL 3GBMH 4JPVH 1AE6L 9CGTA 1KJVB 1G6RL 1MVUB 3ZHKA 3KXFD 1QFUH 3LH2H 3GIVA 1U2CA 4JFOB 4OZHB 3E2HB 2ADFL 3FO9A 4G80A 3R8QA 3SGKC 3ZT6A 2P48B 1GHFL 1HEZA 1Y6MR 4OGAC 3RIAF 2R0LH 4MB4A 5C0AE 5JORB 2IG2L 3JV4B 5BVJB 4YHNB 4M7KH 3F58L 3QAZC 2GSGA 4L4TE 3TVMD 2ADIA 2XTJC 3L3IA 2EC8A 3T04D 4TRPH 3MRGB 1FV1A 4GUPA 1G7HA 4HX1B 1NLDH 3IJSA 2FATL 4NO2B 4ELKA 1PQZB 2YHGA 1N2RA 4I2XE 1U8IB 4X4XB 2VL5A 2DLFL 4PREA 5TDNA 5IMOB 2XNAB 2ZG2A 2A6JA 3QG7L 4WU5B 5GRVK 4AL8H 3Q2CA 1DCLA 1OTUD 2Z35B 3VXQB 2QTEA 1P4LA 3TBTB 3FQTB 2IGFH 4NRXA 1K2DB 3FT3A 4OLUH 4PTTB 2PW1A 3HMWL 3HZKA 4LCCA 2FJFA 4XI5D 1HQRB 3MV7D 1F13A 4QTIL 5DA0B 3B2VH 4A6YL 4EI5A 1QSEA 2NXZC 3FOLB 2ZJSH 1CICC 2PO6D 5KANG 1T83C 3GMRA 1IILE 1YEHH 5EZIH 5BS0E 1BD2E 1CIDA 5INDB 4XXDB 1IL1A 5FUOL 4LU5L 3UTSE 4XCEA 1HYRC 4ZFGH 4PRNB 1A3RL 1WAAF 1UH2A 4UBDC 4LASH 5J11C 1JTPA 2NW2A 1TVBA 5MEQB 4GXVL 1HH6A 4HDIB 2DQCL 1YN6A 5FDWB 3I9GH 4PY8J 4P2QA 4KJWD 2YA1A 2PTUA 1OSZA 5K9JH 3WN5B 4U0QB 5I1CL 2VYRE 2VQ1A 5KOMC 4QRPD 4XGZB 4GW1B 1E4KC 3WNMA 3HZYB 4M8QB 3TYGL 2X4RA 3G08B 1X6NA 4G3YL 1M05A 5FYJU 3BPLC 3U7YH 2D7TH 3DSFH 4JFXA 3VXPB 4K3EH 4Y19A 1DTUA 1U8HB 2QSQA 1FQ9C 4LIQE 5H8DA 2NY3D 5TPWL 3BAEH 4R3SA 4Y4FB 1V7MH 5IHZB 5CS7A 3GB7A 1Q72H 2NLJB 4XBPB 1JPFA 2CK2A 1ZMYA 5IB3B 4JANB 5ILTL 3RZCB 5DI8A 1BQLH 2VIRB 3TM6A 4NP4L 3LQZA 2ATPA 5D7LA 2E5EA 4G8EB 4NC2B 5DEZA 2NNAB 4OZ4A 2DIBA 4MCYA 2X6MA 2Q76B 1E4WH 3MOAL 4BA8A 3PDDA 4OLYL 2GUOA 2ZKHH 1IC5L 1I9JL 3F7QA 4U6HB 3AS2A 4ZSOE 3ZL4H 4M7ZC 3MJ8A 5DMYA 2BMKA 2FB4L 4YPJA 4C57C 4XCCL 2V5YA 2EDQA 1TXKA 1B0GB 2BFVH 1MFBH 1MFEL 3UYPA 3QB7C 2XFXB 4XPHH 3TF7C 2R23A 3TNNB 2AABH 3QHTC 3MODH 1MHPL 3NFPA 4ONOA 1FLTX 2AV7B 2WANA 5CHNA 4PJDF 4D94A 2OBGA 1JMZA 3KGRA 2VR4A 1S7XB 1QBLL 4U3HA 2X4NA 4WW2B 4NKDB 4ONFL 1U92A 3SBWC 2D7MA 4R7DB 5DJAA 4LLQA 1BVLA 1T21A 3WDHA 1JK8B 3REVB 2X9WA 1KACB 4LARL 3KYMA 3JBG7 1VENA 4W70A 1JHLH 4M7JH 1X5XA 3S36X 2Q86A 3VFMB 2QADC 4PRDA 1FBIL 1KLGA 1KLUB 2DKSA 2ZCHH 3WJJA 1II4E 4YHKL 3UBXB 1U58B 2HFTA 4MA3A 1CDCA 1MFNA 3DRQB 1WBXB 3O3UN 3WFEH 1RUKL 5DMGC 4Y16B 3QQNA 3SOBL 1G6RH 5E2UH 5FFLA 1RUPL 4LPXA 4PRHB 4LVHC 2ADFH 3AXLA 2R8SH 4JY6B 3P0VH 3MGAA 2D9CA 1GHFH 1T7VA 3MXVL 3UAJC 4WUUD 2IG2H 3I6KB 3F58H 4XB8A 4HWBA 3V6ZA 1U91B 1MFDH 4DCQA 1BJ8A 4Y2DB 4KZEH 2FX7L 4OLEA 2FATH 2IALB 4NPYA 4OIIH 4YIQA 1I1CA 4GRWH 5IGXL 4KFZC 4NQDB 2DQUL 5BW7A 2C4XA 3NPZB 3QG7H 1KG0A 1VEPA 4KMTL 1GH7A 2VMFA 4NQEE 2IPUG 1EFXA 2D7PA 2E6PA 3OTTA 4P59L 5JDSA 5IROC 1JUFA 3ZYIA 3RX5A 3BN9C 3MNVB 4HZLB 1PKOA 4QTIH 1NC4A 4A6YH 4H0GA 2FR4A 5I1EL 5ISZA 2Y5EA 4KTEL 1I1RA 1LO4L 2P5EA 4UUJA 3EKCA 1K8IA 2MCG1 4LF3A 4Y0GA 3EO1A 4XMLL 1JFQL 3GI9L 4PJCE 1IM9A 5FUOH 2FLBT 1KF9B 2VXQL 1KYOJ 3IU3B 1H8NA 3CCHB 2NY4B 4Y4KC 1NFIB 1UXSB 1EMTL 1A9BA 4TVPL 2WNGA 3E6FB 5J13C 1S9XB 3EHBC 4GXVH 4QHKI 3D6GA 4YHYC 1UVQB 4TSAL 3KNBB 5D1ZC 4PGEB 2BDNL 3VD9A 3RTQC 1EIBA 5JW3L 4EBQL 3QQ9D 5H94A 3QXTA 3OXRB 4Y1AE 5JO5A 1MCQA 1BLNA 1R3KB 1QQDA 5JW4R 3P0YL 2X4UA 2DLEA 4GRLC 4FOMA 3TYGH 5SWSA 4G3YH 5EZOL 2VLJE 3OJ2C 4WO4C 1N64L 2JK5B 3PQYB 5ESVB 1R5WA 4HK0A 5TPWH 4B5EA 4E5XB 2HFFB 3C5SB 3OPZH 1SYSB 5C08D 1L7TL 2XQYK 3W82A 4I0PA 4U6VL 5EIVA 5CEZE 2A77L 3GSQB 3BWAB 3VWKC 1A3LL 2HTLD 4GG8A 4LCUB 4NP4H 4JM2D 1WT5A 4S2SB 3EYFA 1S7RA 3SDCA 1WZLA 1G0DA 5ANME 3RVTC 3F7YA 3TCLB 5JIIA 2IFFL 4ZS6D 3UTPD 5I19L 3B6SB 1RZGB 5KW9L 1MHHB 1JZ8A 5IHUL 3RDTB 1XIWB 4XPTL 5D1QB 5DT1L 4ELMB 4OLYH 1S9KC 1IC5H 5FGRA 4ERSL 3QWOA 1I9JH 3KXFE 3BWUC 3FO2B 4NBYB 4P3DB 3VGGA 2MHAB 1AGBA 1E27A 4DGVL 4PV8B 3B4NA 2WQ8A 4QRRD 4XCCH 2I9LB 1RJCA 2YXMA 3FB5A 4HHAB 1I7RA 3RAJH 1MFEH 4FQIL 1XZ0B 4RDQF 4P2RD 4P2YA 2J6EL 4X7CC 5IEHB 4HUVB 4PGBA 1MHPH 4MGXA 3DETC 1WCQA 4PRAB 2XRAL 2FEEL 5FKPB 3HC0B 3H9ZA 3ULUL 1P1ZA 5DQ9A 1IAKA 4ONFH 5C09D 4G43B 4ZO9A 1TZGL 3VXSB 1RHFA 4WJ5A 4LARH 3LD8B 5CLTA 5C0CD 1M7IB 2KZ1B 2X44D 5GZNC 3GHEL 1MFAL 4YHKH 4PJAA 3MV7E 5HHNB 4PJEA 5JHDE 5B4MD 3DSNA 4ZAKD 4HMCA 4HH8A 2PXYC 3P11L 4HK3J 2J3SA 3QXWA 3S34L 1RUKH 2W1NA 3SOBH 4HIIA 5F1NB 5IB5B 4H20L 3HCVB 5C0IB 1RUPH 1RZ7H 1EJ6A 4YBQC 2BNUB 4GBXC 3MRJA 4PJBE 3MRCB 4HS3A 3MXVH 4RQQA 2A6IA 4PJ8D 5IQ9A 4TSBL 1KCUL 4RFEA 2OK0L 1A0QL 3WUZA 2XY1A 1YPZE 4Z7WF 3VRJB 4XP6L 1X4XA 3DVGB 2C9AA 4N0UA 4PY8I 4YFEA 2FX7H 3RQ3A 5TDPB 2HLAB 2PN5A 3FB8B 1HDMB 2JJTA 3IF1B 4U3CA 3U2SB 2BVEA 2DQUH 1WBZB 4OQTA 1CXEA 3LEXB 4QRPE 1ZHBB 1QRKA 5C6TL 4QY8B 4KMTH 2NTSP 3GBLA 3HE7B 3SJVB 3ZO0A 4P59H 3QA3A 1E6OH 2HFGL 4P57B 5DQJA 1EX0A 1FO0A 1O0VA 4NDMA 3BPOB 3CX5K 1R3LA 1FFNA 1LMKA 2XOTA 3S35L 1J18A 4GRWF 4JRYA 3KYOA 4KTEH 1MLBB 1HCVA 5F7KC 4IOIA 1KPVB 1TPXC 1EGJL 5GGVY 1REIA 1JFQH 1IARB 3GI9H 5IR1B 5GPRA 3ULUC 2BZDA 4UDTA 4MXVF 1UM6H 5IESL 1UB5B 2VXQH 2CLRA 4EJ1C 1X44A 4M00A 5EZLB 1FYTB 1SEQH 3ELAT 5HHOA 5MP6L 2AK4D 3FQNA 4TSAH 4KQ4L 4OLXL 3LDBB 3S5LA 2W65A 3UTTD 2BDNH 4WI9A 3O4LB 4X7TB 1T20B 1B88A 4EBQH 1G7LB 3HA0A 4PP2B 3SDYL 3IS0X 5FO7B 3P0YH 4ZO6A 1BFOA 4HGWA 3DWTA 2D0GA 4EUPH 2FX9L 2YRPA 3W0WA 2Z4QA 3ZDYE 3Q3GA 1DE4B 1L7IH 2GJ6D 1JV5B 4P3CL 4MQ7A 3B2UD 4NKIL 2C3HA 5I6XB 3VRLE 1UJ3C 2C3XA 1BHGA 3Q0HA 2HFEB 4OF0A 2YBRA 1L7TH 2B2XL 1FNAA 2F54D 1WCBA 2EEBA 5HHPA 1LK2A 1ZT4A 4BFIA 2A77H 4S1DD 4URTB 1A3LH 4MQXD 4AENA 4XVSL 4M5YH 3Q5TA 5HDQL 4JFPA 1NBYB 1TQBB 3O9WC 4IHOA 1UEMA 3DNKA 3I84A 3NZ8A 3I75B 2IFFH 1WEJH 5I19H 5KW9H 2C5DC 4I5BA 3H8NA 4KY1L 4NN7B 5IHUH 5MENA 4XPTH 1IGJA 5DT1H 3DUUA 1G9ML 3WJLC 4ERSH 4LP5A 3HAEB 2YD1A 5KS9E 4B53A 3N1PC 4HAGA 2K9UA 4DGVH 4XXCA 4KUCD 5IWLA 5DJYA 4M93C 4RGNB 1CFNB 3HHRB 4BQ9A 1I75A 5DMKA 5IM7B 4WHCA 4FQIH 4AIXA 4KDVA 2O5XL 4KGJA 5JIHA 2BOBA 4CVWA 3JV5A 3QUMB 4ETYA 5D70L 1ZAGA 2XRAH 3SDAD 4DN3L 4NT6A 1LO0L 3CUPB 3X3GL 1UZ6F 3ULUH 2H6PA 1UWGL 4P4KB 1TZGH 1FL6B 4H0HB 4QHUB 4E0RA 1UGNA 1FCGA 2P8MB 5C0EA 4MMZC 1NANI 4HFUL 5IMKA 1FCCA 1U8MA 2YWYA 3MACL 4X8JB 5CD5C 4IOFC 5B38B 3GHEH 1MFAH 2NX5D 2GSIB 4OF8A 4MD5B 1P2CA 3SDXB 3ARZA 4DTGH 1GOFA 2XWTA 4PGZA 2OTUB 3P11H 3S34H 3SE3C 5JXAL 3DMMD 3ECBA 5C0JB 3DX7B 3EYSL 4JRXA 1CGSL 1EEUA 4LHUG 3KWWB 1LEIB 2XWJB 4EN3C 1RK0A 2CUIA 1BX2B 2FIKB 4WI8A 3B3IB 2APFA 4UT7L 4LQFH 4L4JA 3MV8D 2PETA 3Q5YA 3HFML 4QHMB 4TSBH 1KCUH 4Q6IB 1A0QH 1PBYA 1EUTA 4L3CA 4WWKB 3WUWB 5AUMA 5CUSL 3IFOA 4XP6H 5BQ7A 5H37G 2IWGA 5I75B 2UWEF 5DVMA 4LPWA 4RMQA 4OT1L 5I9QB 1XGPB 1XCTA 4JDVA 1IMHC 1G9MC 5FYKU 4L29B 3VXUB 3WNPA 3WHXB 4W6YB 3PHOB 5IMMA 3GMOA 1S9WA 1I8MA 2LE9A 3ARDD 4XBGB 5D1XC 4MS8C 3H6JA 4F80A 4HWUA 4HJGB 2OI9B 5C8JA 2PR4L 5DDHA 1D9KC 5KN5A 1FAIL 5HHVL 1LEGB 4MWFB 4R96B 1A1OA 3GO1H 3BZFA 4P99A 1CL7I 3QH3B 3S35H 2ICEA 4Q97A 1MOEA 1EA9C 5EB9A 1S7WA 1N26A 2ZUVA 5HYJD 3VFVA 4TUKL 3HKFA 4HF5L 2VZOA 4LSSL 4PJHA 5I74B 2JCCF 3QT2A 4I4WB 5IESH 4RNRB 5JLZA 4QNPF 2FBJL 4PV9A 2J8UA 3IKCB 4Z78A 1FVDB 4QRQA 4WDIB 4QRSB 1ZVYA 1FIGL 4KQ4H 1LE9A 4K8RL 1F2XK 1P7QA 4DUVA 2MKLC 1A02N 3ULVL 1VFBA 3ARFC 4X6FB 4CMMB 4QRTA 1WWCA 3ALWA 4YNYB 5EU5B 3S3JA 3SDYH 4L4VB 4HUXB 3MYJB 3NACL 2FX9H 4XVUD 5EUOE 4JO4L 1IEAA 1BVZA 4WV1C 1Z5LB 4UU9A 4OLVL 1SJHB 4P3CH 3LKPB 4CJ0A 4NKIH 5IJKA 4RISL 2DRUA 3O3AB 4NZJA 4U33A 32C2A 5LGJA 3DX8B 4WHTA 1AP2B 5A2JH 4ODVL 2EDKA 2B2XH 4E42A 5E6IB 2BVOA 2X4TB 3BRFA 5HDQH 3KR3H 1KULA 3JVGC 4UTBL 4PJGE 2KKQA 2W38A 1R3HA 5DD3H 3KPRA 4H1LA 3STZA 4KY1H 4M1GL 3MGTA 2GHWB 1G9MH 4TTDC 5K93A 1IGML 5DMJB 2NY6D 1WQVT 4LLVB 5GRJH 5B3JE 2ATKB 3GMMB 5FAAA 1AIFB 4M1DL 4DEPB 2P49B 1DLFL 1EXUA 3S4SB 5FXCH 1ORSA 2EE6A 3D25B 4UQ3B 5AZEL 4X6CB 2NY0D 1L4IA 3FAXA 5EOTA 5DR5H 2X1WL 1LP9F 2VWEE 1NFKA 1BZQK 4LPCA 1IEBA 3HPLA 4S1RL 5CMAB 5KVGL 3O3EA 2VLRA 1MREL 3QNZB 3P0GB 5D70H 2X4QB 4DN3H 1LO0H 1NAMB 1JZ3A 1NDMB 3X3GH 2R2BB 4UIKL 5GS1B 5CILL 3WBDA 3W9EB 4Z7NE 2Y36L 5C0DA 5BOZG 1NGWA 4K8RC 2FNBA 4U1HB 4HFUH 4P9HL 2IBZX 3ULVC 1RIVH 3MACH 3AS1A 5E99H 2QQNL 5DEFB 4M9PA 2I24N 4RX4A 5MEOA 1A14L 5JXAH 3X17A 4LLMA 1NUGA 3B8SA 5GGTA 3G6JA 5GRZA 3MV9B 2CQVA 2H8PB 3EYSH 2ITCB 1CGSH 1FFOA 4LCCC 3RWJA 2CIKB 4UT7H 1UKQA 3OJVC 4EI5C 3HI1A 3CSYA 3HFMH 2CMRL 4OZFB 3H7LA 3FOMA 1AC0A 2AK4E 4KAQL 5CUSH 1LK3L 3EJYC 2FJHA 2LAAA 3UTTE 4Y4HD 1F11B 2JJUA 4ZO7A 1KPRA 3KHOA 1HZHL 2HT4D 3GIZH 4N9OB 4ZUWA 5HVHC 1SVZA 4KK5D 3WMSA 1NGQL 4R4FL 4XPGL 3VFTA 2KBGA 1J87A 4F2MA 5I1DB 2ILLA 2I9TA 1RK1B 3VD3A 3PL6A 4Z0XB 2GJ6E 3GSNH 1CG9A 3TO4B 5D2LE 2Y6SD 3QZWG 1X9QA 5INCA 1FSKC 1HQ4A 1QBBA 4J3SA 5IVXB 4Y8AA 5JR1H 4UINL 5DJCB 1MHCA 4YZFE 5D7JB 3PABB 1F3JA 2HYMA 3ES6A 3FT2B 5EUKB 1U8QB 1SJEB 4TUKH 4HF5H 4LSSH 3QQ3A 1U9KA 2EDBA 4NWUL 3JUZA 4UIMB 3U48A 2FBJH 1DSFH 3ZKMC 4F37K 2G5BB 4G9FE 4HIJB 5IT2L 3BH8A 1FZMA 3CVHL 1MQ8A 3QFDB 1HXMA 4Y4FD 5F7DB 2O5ZL 1XGUA 3FQRB 4HWBL 4M8VA 1P4BH 2FHFA 5IEKB 3AVEA 3EOBA 1FIGH 4FQXA 1T5XA 4K8RH 5EOCJ 4YO0A 3GMLA 4OGZA 2CUMA 2CXKA 1HILB 5TGBA 3LKNB 5DLML 1JIBA 3BIAX 1B3JA 1WWBX 1QRNB 4PJXB 5K9OB 3MJ7B 3D3VE 4JO4H 4PLNC 2DQGL 1FZKB 4LLWA 4OLVH 1ZLWK 1XF4B 2QKIA 1J05A 1QFWM 4P23C 4GG6A 1ETZA 3EDDA 1YEGL 2WUBL 4RISH 3T0AA 4HT1L 3V6BR 1A2YB 1IM3B 3FN0L 4ODVH 4N5UA 2H45A 1OGAA 2DIJA 5HY9B 1ZGLA 2IADB 5FM8A 4M4PA 4C59B 2NX5E 2Z31A 4KDTA 3OX8B 3IDUA 5T3XH 5DWUL 2PW2A 4NN5C 4KJQD 5F7UA 2CR6A 3I50L 1OW0C 4CW1A 4M1GH 4R4NC 2P43B 4N0RA 2ERJB 1IGMH 4ODWB 3WJJC 2OCFD 4QF1B 5EU7C 4YJZL 4MQTB 4GXUM 3C5ZC 4EQ2A 2CDGB 5DTFA 1X5HA 4BZ1L 3ILQC 4M1DH 3MV8E 2A83A 4L4TA 5JOFA 3PIQB 3BISA 4I2XA 3MRHA 2M26A 3DJ9A 4JZOB 2XQBL 2OQJA 4S1RH 4BKLA 5KVGH 1Z2KA 4PRHD 1MREH 1NFDA 3KPSB 3UCRA 1BJ1J 1NCBL 1AGEA 1G7QB 5DJ6A 3CFKA 3ROOA 4CVZA 4MJIE 5DHVA 3NIFE 4UIKH 3SKOB 5CILH 4CDHA 4KKLD 2Y36H 2BP3A 4MDIB 1KENL 5D7IF 5DVNA 1NBVL 3BQUC 2CKBA 1G6RB 5KSAB 4DGYL 1A6TA 2P7TA 5H35A 2AK1L 3QP3A 5F7FA 4P9HH 3CDCA 3OZ9L 2QQNH 3LEYL 3D18B 4OKDA 3L3GB 3LIZL 4J3TA 4NQDD 4Z7OE 3FB7B 5BW7C 4J7RA 1MVUA 4PGDA 3ZE0E 5BS0A 2D03L 4JFOA 5HYJE 4TOYL 1FDLL 1W2KT 1QEWB 1L6ZA 2BSRA 4UOW0 4YHNA 5BVJA 3NABH 5EIIB 3AAZB 3DBXA 2FD6L 5A3IC 4IRSA 4GAGL 2GTWB 3DVNA 2XN9B 2YEZA 4XTRD 1PQZA 1EK3A 1YDPB 2Q3AA 4KAQH 4X4XA 1A4KB 1IC1A 3OAYH 1UEYA 4Z95L 5HGBA 4C54A 4XB7A 1T6WA 4U1GC 1HZHH 4LCWB 2AQ1A 4WI7A 3EUUA 1K6QL 3CDGB 3UYOD 1OTUC 1BJMA 1Q8MA 1ZLWH 2NY4D 1NGQH 3IS1X 3L5WB 3TBTA 3DROB 4R4FH 2I27N 1H3UA 3FAWA 4XPGH 3RWCB 1X5LA 4PJIB 4ZDHA 2AJSL 4PR5B 4QXGL 1OLLA 2OS7A 1KBGL 5C9JB 3P4LA 1CCZA 1V05A 1JGDB 3RZWA 4UINH 3QEHB 3RUGE 4ZS7L 1MY7A 3N0PB 4P5TB 3ZTJH 5ESQA 4PRNA 4C58B 3QEUA 4ZOCA 3LRHA 3ROLA 2NCMA 4L8BB 5L8LB 3E8UL 5CAYB 4HPOL 2YA2A 2OMNA 2IAMA 2R69L 1A6AA 4ZSOA 5FDWA 1MIMH 2O5ZH 4HWBH 1N4XL 4I0PC 5DSCB 3FRUB 5EBLA 4LSTH 3K4ZA 1WIUA 4NFCA 1F90H 1WT5C 2BSTB 4KK8D 2DLIA 1F3DJ 2KUTA 2NR6D 4LVHB 4PP1D 3C6LD 4U1SA 1UWXH 4AH2B 4GW1A 3GSUA 3FFCB 1ZT7A 1L0YA 1XIWD 5DLMH 4OQTL 1F3RB 3QI9A 5IK3B 3OKMB 3X12B 1OGTB 2DQGH 2ZOLA 1YC8A 1U8PB 1VADB 3H0TA 1U8HA 3SGEI 3FKUS 1J12A 3Q5OA 2WUBH 3W39B 1ORQA 3ULVF 5IB3A 3RPKA 1KTRL 5JHLL 3RZCA 3FN0H 1JZ5A 3IDNB 1X5ZA 5SWZE 4UOW1 3MCKA 3P77B 5GSVA 1HHJB 4KQ3L 2LABA 4PJ9C 5DK0A 1YMHA 2Q76A 2DWEB 2VLLB 5DWUH 1JL8A 4U1MB 4MX7A 2P5WD 7CGTA 4G6FD 1KNOB 3I50H 3VXSD 4OZIB 4P2OB 1JN6B 1ZS8A 2QHLA 4PLKD 1PKQB 5C6WH 1LHZA 1B0GA 2WK2A 4FP8L 2ADJB 1UCTA 4BZ1H 1OLZA 3QIUA 2VZ3A 3LKSB 3DXAD 5T5FL 3WKML 1DEDA 3QDHA 3ARED 3NAAL 4ONHB 5F71A 1PYWB 5CIPB 3DHMA 3IDJA 4X98B 5CBEA 5JIKA 1P53A 1TLKA 4JPKL 4Z7QF 5IFHL 4RGOL 3ZYOA 4NRZB 2XQBH 4K3JL 3M07A 3AU1B 2QQLL 1U3HB 4YHYB 1NCBH 1FJ1B 2FZ3B 3RTQB 2J8OA 2GFBA 3D39B 5F97E 4NQCB 3ILPB 3VI3E 3IVKB 5E08L 4AEFA 1KENH 3OF6D 3HUJE 3VDAA 3B9KA 3QO0B 4DGYH 1KTLA 3I6LE 1RSFA 2NZIA 3IFNL 4G7YL 3LEYH 5EU3B 3DRQA 2JJTC 2YPLE 3JUYA 1MH5A 2VH5L 4Y16A 3TYFA 3OJMB 1G7IB 4I3SL 4MA1C 1VEMA 1TIUA 2D03H 4WO4B 3OKDA 3DURA 4YFLI 3IKKA 4JLRB 5C0FA 2NZ9C 4PJCA 3D48R 1Q9LA 2VE6A 4F33B 3WS3A 4JY6A 4C56B 2ZUSA 5CEYB 4TOYH 1FDLH 4MXQC 2EIZA 5GZOD 4G8FA 4UV7L 4XNYH 1DQJB 3VWKB 5K9KB 5FOBA 3O3DB 1KC5L 2FD6H 5L2JB 4Y2DA 1XF3A 4GAGH 1ZA6B 1J1XL 3GRWA 1ZSDB 4ZUVB 3VXOA 2HKFL 2L7UA 1KSRA 5KVDL 1H3TA 5IKCA 2R1YA 1M6OB 2FHBA 3E6HB 4Z95H 4ORGB 3EYUL 4YC2B 4Y1AA 1TFHA 3RVVD 4MNHB 4NQSB 1K6QH 1VGKB 1P6AB 2BNRB 4R97B 1F58L 1Y18B 1YEFH 1B0RB 2WIIA 2GTZB 4JPIA 3PP3K 5TDOB 4X7EC 3SO3C 3RVXD 2AJSH 1T1ZB 4QXGH 3UP1A 3CC5B 4IMLA 3SCMD 1JYXA 2ZOKB 1A1NB 1FZJB 2GCYB 4FXKA 4X8XA 4PG2A 3TWCL 1HSBB 4ZS7H 3V4PL 4Z7UB 1N5AB 1UADC 1TCRA 4W4NA 3RL1B 4HUWA 3TN0B 4Q9BA 5ANMA 3THML 3RVWC 4X99B 1NFIA 1S78D 2GK0A 3K2UL 3FHAA 1CFQA 3L3HA 3BP7A 2YK1L 3E6FA 3SDDB 1VKXB 3KXFA 4JFDE 3V6FA 1UVQA 3NZHH 2R69H 3KNBA 4JFEE 5K9QI 1P4IL 3UJJL 1A7BA 4PLOB 3BGMB 3EFDL 4EUPB 3QQ9C 4R7NA 5DUBA 3OXRA 2Y4SA 3EAKA 3EZJB 2R0WH 1Y6KR 1W8NA 3RX7A 5FGBA 3TVMA 2ZUYA 3ARYA 4J3UA 3OSKA 3U36B 4J4PC 4GMSL 4OQTH 4GLRI 3WL9B 1OTSC 2DBLH 1KTDB 1S9VB 5DJZA 4PRIE 1P69B 3D87B 3NCCB 4XXCC 3G04A 3CH1B 4MDJB 3SPVB 4WTZG 4Q74A 5IWLC 2I26N 3QNYB 1FO0H 3ZYZA 3C5SA 4RGND 5FYLL 3PF2A 2ZG3A 3BMVA 3L3OB 3Q48A 5I1LB 5JHLH 3GMNB 3BWAA 4BFGA 4OTXL 1AR1C 3QULA 5MHSD 1DUZB 4KQ3H 3QUYD 5JHDA 3HNVH 3B6SA 1RZGA 5IB1B 2VXSH 4O5LH 3RDTA 5D1QA 3QUZD 4L9DA 1RMFH 1NMBL 1VERA 3C08L 3FO2A 4M02A 4P4KD 5CCKH 2F19H 1MUJA 3VGAC 4PJBA 4ZODA 5GSRA 2V2XB 1DDHA 3KPMB 43C9A 4U2YA 1YPZA 5T5FH 4JZNA 3WKMH 4G8IB 1XGQA 3NAAH 4NHUB 4HUVA 4NOBA 2G2RA 3O2DA 1TZIB 2DQJH 2GJJA 4MVBC 3BGFC 1Q9WA 4GW4B 5DRNA 4JPKH 5IFHH 4OFYA 1CGTA 1J11A 3QO1B 5FYJD 4GH7B 4BQ6A 4K3JH 2HH0H 1QO3B 5ADOL 1N8ZA 4FFZL 2RIKA 5I18L 4G42B 3PP3H 4EDXB 3MRNA 3ZE1F 3QUXC 1C7SA 3UO1L 2I5YL 2YOCA 1AGCA 3EOTH 1J88A 1J0KA 3MLSL 3BP4B 4WWKD 4D9LL 1B9ZA 1X5IA 2DIAA 5HHNA 2Z0BA 4FG6D 1YECL 2EC9U 5KAQG 3KHQA 3DX6A 4G7YH 2R56L 3TBWA 3W2DL 3RWDB 1MRCL 1I4FB 2VH5H 5D5ME 4I3SH 4XVJH 3U46B 5KG9A 3VXUD 2VUYA 3F65A 4KVCL 1UJ3B 1KCLA 5DRZB 1JGEB 3WLWC 2BK8A 3MRCA 4K55A 4X6DE 3ARGA 5ETUB 4PJ8C 3H3BC 5IMLA 3C09C 1ZGLP 1YMMB 2GJZA 1MJJB 4XNUL 3ZZ1A 3NIGE 1M1SA 4N8VG 1KC5H 3DUHA 3V6OC 3D2UB 5FUZL 4OUOA 4JFZL 1J1XH 3VFNB 1ED3B 1BREA 2HKFH 4HXAL 4XP1L 5T3ZD 2CRZA 1FGVL 4ZXBB 5KVDH 3T2NL 1GL4B 1R5VB 5JMRA 3FZUD 4OUUB 1MF2L 2H41A 4R8WL 3U2SA 5B8CB 3L3KA 4I3RH 3G6AA 1I3GL 3CPLB 2W9LA 3RWEA 4JFFB 2OXGA 1EEYB 2YD3A 1OAZL 3HE7A 4X80L 3SJVA 2Q87A 4RMWA 5F3BB 3IB4A 4XC3L 3L6FB 5IW1B 5KSVB 4NKQB 5M95B 4HS6B 3VRIB 3L95B 3VFUA 5D8JL 3UTOA 1KN2L 3S9DB 3TWCH 1V3MA 3PWPD 3V4PH 3MLVL 2VDKL 2X4OA 1DZBA 5E0QA 3UEZA 5E8DL 5IR1A 3BE1L 6CGTA 5GGTL 4OIAA 4OI8A 3THMH 4X9FA 3LQAH 5IJKC 2P5WE 1FYTA 3K2UH 5DURB 4L8DB 4FFWD 4J23A 5KS9A 1GOGA 5KTEL 5BV7L 2VSCA 1WZ1L 3NGBC 1HN1A 1P4IH 2HVJB 3UJJH 3O4LA 1ACYL 4MYWB 5BXFB 1JHTA 5EPMA 1G7LA 4NO0B 3U30C 3QPQD 4FQCH 5ACMA 2W0KA 1KUMA 2A6KA 2VXTL 1FYHB 5F7MC 4PP2A 2W60A 3DXAE 4WHYH 1Q94B 2XZCL 4Q9RL 3OAZH 5CJBA 1MCOL 1I1FB 4JGMA 3ARBB 3QIBA 2EC9T 2AXFB 5LBSL 1ITCA 3VW3H 1CXFA 4HUNB 2YUXA 4HLZH 4HZAA 1C16B 4I3GA 4P46A 4DKEL 2O61A 3QFJB 1A64A 2ZZUT 1CR9L 1TZHB 1Z9SA 5HYSB 3AROA 4OTXH 1D6EA 2DQTL 1WK0A 1NCTA 2P4AB 4WFHE 3CK0L 4NNXB 4WNQB 1DBML 2NYYC 3HAEA 3L7EA 4G8GD 4OJFL 3PWJA 4AG4H 2OXHA 5I1AB 4L3EB 3MRIB 1KJ2B 4UV4H 1M7XA 5I16A 4HV8A 4O58L 4QOKE 4EVNA 2LU4A 1HIML 3X14B 1A47A 1CFNA 4EQ3A 4LGRB 2R0ZL 1NSNL 5EWIH 5BZWB 1NKRA 1NMAL 3CU1A 2CO6B 4UT9L 3PP4L 1BWMA 4KKAD 4HD9A 1J8HB 5ADOH 4FFZH 3BIKB 3OL2A 4OAWA 5I18H 1FL6A 5BV7C 3FONB 1AO7B 1G0XA 3UO1H 2A9ML 2P8MA 3MLSH 5IB2A 1MCRA 1HHGA 1I1AC 4D9LH 5TH2B 2X1PA 4HKXB 3O2VL 3FO0L 1NCCL 2VDLL 1YECH 3HNTL 4KI5D 2AXJA 3RI5K 5ID0A 3QDGE 1X7QA 1FNGB 4WV1B 2R56H 4BYHA 3DMMC 1C08A 1MRCH 4XPBH 5J1SC 5C0JA 1MVFA 4JO2L 3HZVA 6FABL 3GJEB 4H1LH 4YDVB 3T1FA 3QG6A 4HFWA 5B39G 5F9DC 2VABB 3LS5L 3PL6C 2FIKA 2WBJA 1B6UA 3SKMB 3BZ4A 4ISVB 4QHMA 1B0WA 4E41E 4DFIA 3BZEA 1TQCC 4M1CC 5FCUL 3WUWA 2FCBA 2BRQA 5FUZH 2CLZA 4JFZH 1LEKA 2YD7A 4HIEA 2PF6A 3RFZC 4X6EB 4HXAH 3TBYB 1NCWL 1FGVH 3ZDXE 5FM5M 4RIRB 1U8KA 1F4YH 5I1GH 1HWGB 3GSNB 4IIQA 1MF2H 4R8WH 4YGVB 3FQUA 3QXAA 4WUKL 3CDYA 2AJUL 1QFPA 2D31B 2QQQA 3WFDL 1IAOB 1DQDL 5IFJA 1OAZH 3ORJA 2RFXA 2ITDB 5EUOA 1X4ZA 3D85B 3L7FB 1DBKL 4XC3H 4YUEL 2GT9B 4OZGF 4UI2A 4HJGA 4FQXC 2CKBL 3MNZA 5ICZA 4KC3B 2OSLA 5D8JH 1LEGA 3GIVB 5DJ8A 4LGPB 1S7QA 1CD0A 2Z9TA 3MLVH 1DANU 2VDKH 1QRND 4W4OA 2GSGB 5E8DH 1OP5K 1EHLL 3BE1H 1EUUA 4PJGA 4HBQA 1E6JL 4ZAKA 2ADIB 5GGTH 3L3IB 4IDLA 4AENB 1FV1B 4GUPB 2ZUTA 1G7HB 4RRPA 3IJSB 5DHXB 2XXMB 4ELKB 5CJ5A 4QRSA 1N2RB 2VL5B 2F15A 4GQPH 5DZLA 4PREB 5HTSA 3WDIA 5KTEH 3IAGC 5BV7H 1OOAA 5EC1B 3W81A 1A4JB 4B41A 2A6JB 1J8KA 4QYOA 4PB9H 1ACYH 5F44A 4KRPC 1I1YA 2V17L 4NO5B 4CMMA 1ZHLA 2Z93A 1P4LB 4EDWL 4NRXB 2Z31C 3FT3B 4KDTC 4YNYA 2R29H 2PW1B 2VXTH 1NCAL 2PCPA 4HKJA 4L4VA 3HZKB 2PYED 4HUXA 1JZ6A 4CN4A 2FJFB 3WLBB 4APQB 2F8VA 5I2IA 2Z92B 1QSEB 4LMQE 5FYJE 2EYRA 1CICD 3GMRB 5EO0A 2Y25A 3BFOA 5LBSH 3O3AA 5C92A 2IMMA 1IL1B 2Q8BL 4RSVA 4LIQL 4XCEB 5C2UB 1BM3L 2F53B 4Q0XL 1XGTA 4PRPE 3BYTA 4DKEH 1CR9H 3FHQA 2X4TA 5GRUL 3NN8A 2J1KA 4MNQD 4Z7VF 2NW2B 4MJ2A 1TVBB 2PTTA 1YA5A 1WAAE 5LAXB 5KBNC 1FZOB 3BO8B 5EU6E 2X4PA 3CK0H 4FQQA 4P2QB 1UT9A 4UZGA 1TITA 4LLYA 4GMTL 3STBA 1DBMH 1OSZB 4PGCB 3KDMA 3TJEL 3W11C 5I73C 4LLVA 3SGJC 2VQ1B 3RY6C 2YPKB 2WW8A 3SKJL 1HIMH 5CJOL 2DM2A 3CFDA 2AV1B 2X4RB 3WXVL 4X6CA 2R0ZH 4FZEL 1M05B 3BW9B 2AK4A 4PJHF 2QQKL 2FO1A 4JFXB 4Y19B 4GAJH 1NMAH 3E2HC 3UTTA 3QNZA 3TIEA 4R3SB 5GRWA 3GB7B 3FJTA 4UT9H 3T77B 2IFGA 3PP4H 1BOYA 1JPFB 4NQXA 5DI8B 4FHBD 3LQZB 3W9EA 3V7AG 1FAKT 5D7LB 4S1QH 5E00A 5FUCC 2A9MH 3BRGC 4WI6A 1UB6A 4OZ4B 4MCYB 4PIRF 4U1HA 2XN9D 1C5DA 5D2LA 1A1MA 1DANT 2GUOB 4NJ9L 5DEFA 4N5EC 5IP4A 5HVFB 1NCCH 2VDLH 3H9HA 3HNTH 4JQIL 1JGUL 5EFIA 3MJ8B 1OP5H 2BMKB 4LCWD 4ETQA 1YYML 3PWPE 1IFHL 2AJXL 1DR9A 3CZJA 3N1MC 1BF2A 4JO2H 3MV9A 1OY3B 6FABH 2H8PA 3O6LH 1ZHKB 3MA9H 3LS5H 1FE8H 3R8BB 3NFPB 5SWQA 1IAIM 5T33H 4G9FA 5CHNB 4PJFB 1DUYA 3MCG1 3VU2A 4OZFA 2J88L 1U42A 4H26A 4HS8L 5FCUH 4WRLA 2X4NB 4DZ8A 4PJDE 1U92B 5CEXA 5F7HA 3IETA 1HINH 4HPYH 2B5IB 4YGAB 4LLQB 3BKYL 5DJAB 1T21B 4PBWD 1NCWH 3KG5A 3KYMB 3L5IA 3P4OB 2ED7A 1NEZA 3F12A 4PRDB 2OX5A 3E0GA 2AJUH 3WFDH 4JKWA 4N1EA 5IG7B 5DHVH 1DQDH 4XP4H 3D3VA 1JYNA 1DBKH 4Z0XA 4YUEH 2VKXA 1A6ZA 1AFVL 1OP9A 2JJSC 3HRPA 5DMGD 2AQ2A 2CKBH 1D5IL 2RB8A 1JZ7A 3WN5C 5DEGB 5D7JA 4HIXL 3VXME 1R6VA 3AXLB 2N7BA 3BT2H 4LRIA 1O7SA 3FFCD 4PJ7E 2EECA 3SGDH 1NUDA 3UAJD 1SJEA 3OGOE 4XHJD 4XT1C 3QI9C 3V6ZB 1EHLH 3G9VA 2BY3A 1E6JH 1CGYA 5E8PA 3VFGL 2JKXA 2ESVD 2VXVL 1L9NA 1DQQA 4Y4FC 4G8GE 5F7DA 2HJLB 4KUCF 1RV6X 4YIQB 4MAUL 1UYWH 1INQA 3RZCC 3JV6A 2DTML 3GRWL 1GAFL 2V17H 1YEDB 4DGIL 1EZVX 3PGCA 5IVNA 1EFXB 2H2SC 1IC7L 2MFNA 5MI0B 1ZVSA 3H9SE 1NCAH 1RZIA 5F6HI 3LKNA 3G6JF 5F88A 2VZ1A 1QKZL 1MELA 1TETH 3WNKA 3BN9D 3T2OA 2FWOA 3MJ7A 3QXUA 4P2OD 2FR4B 1FZKA 5ISZB 5JA8B 3JTSA 4OF5A 3VWJA 4MJIA 4P9ML 4UUJB 2RGSA 5TE6H 4OFIA 5E2VL 4LF3B 2X42A 3EO1B 1NMCB 1OM3L 1ERNA 4F7TB 3GDBA 1IM9B 3MRFA 2Q8BH 5D4QA 5FECA 1KB5A 4LIQH 3P2TA 3QBTB 4OFKA 5BRZD 3ALPA 3PV6B 4Q0XH 3RHWF 1EERB 5GJTL 2VLKE 1W0WA 2EXWD 2P44B 2OP4L 3UBXG 5GRUH 1U8OA 5IOPA 3MV01 3EHBD 4GW5A 4KJQC 5I76A 5HD8C 3RJQB 5F8RC 4K2UH 2IANB 4WU7A 4NUJA 5ACZA 4GMTH 3RTQD 3RU8L 5H94B 5HYJA 1GVIA 3D39D 1KN4H 1EH9A 4NQCD 3TJEH 3WDJA 5AEAA 4ZFFA 1NGYB 4QF1A 1QQDB 4XAKD 5FO9A 5E1AA 3SKJH 5CJOH 2Q20A 4JG1L 4U05A 5SWSB 4JGJA 4UNUA 3VCLA 3KPQB 4PLJC 4Y16C 3WXVH 4FZEH 2BHZA 1T7ZA 3GJFA 1R5WB 4HK0B 4LVEA 4WO4D 4I0KA 4ZG1A 3REWA 1X4YA 2VZSA 4NQVB 5C2BL 1JF1B 3TZVA 3INUL 1CDGA 4GG8B 1DFBL 3VWKD 3ZDZF 1UCBL 1CFTA 1S7RB 3EYFB 3SDCB 3LKRA 4Y2DC 4R0LA 4L9LA 1FFRA 3VJ6A 5KSAA 3RVTD 5L88L 5E24E 5F93C 4OLWL 3OKNB 1FN4A 3OWEA 3QWOB 4MD4B 3OQ3B 3D18A 4F7CB 4JQIH 4X7SL 3RUGA 1JGUH 1QUNA 3VFSA 1AGBB 4CN1A 4JHAH 1YYMH 1NJ9A 4U3XA 3FB5B 3NTCL 4XH2B 1IFHH 2AJXH 1I7RB 4MB5A 5E56A 5ESAA 1QEWA 3SEPA 3NH7L 3MLRL 4RGMB 3AAZA 2GY7B 2XTJE 4PGBB 2BNQB 1V3JA 2BHUA 3DETD 2XZQL 4DKDC 2J88H 4PG2C 4HS8H 4GXUN 1MAML 1ND0A 2D4FA 5DQ9B 3HE6A 4TVPD 1U3JA 4JO1L 4WJ5B 3WV0A 3RKDC 3TN0D 2YZ1A 1OARL 2Q7YA 2G9HB 4N90D 2PYEE 5AYQA 5IBLC 3DROA 5GZND 4PJAB 4PJEB 2PYFA 3SDDD 4PJIA 3MLUL 2JJWA 2EDDA 4RMUA 1UA6L 3ZKXB 3QDJD 5EBWA 2X05A 1D5IH 2V7NB 3FQXA 2UZIL 4HIXH 2ARJA 3LN9A 5DVLA 4NWTL 3MRJB 5E7FA 2GK2A 1O5DT 4YBQD 1I8KA 3MGOA 4HS3B 5SWZA 2LTQC 4RQQB 1NFDF 2CH8A 2A6IB 4LRNL 2CJUL 5IQ9B 3P40A 5HPMA 4HWNA 4RFEB 3UPCA 4MNQE 5JOEA 1VFAA 1N3NA 5IW3A 3QWQB 3RVUD 4N0UB 3DO7A 1LGVA 3ZKSD 2A2QT 3VFGH 2VXVH 1I85A 1OQOA 3FRPA 3BDXA 4Z7WE 4MAUH 5DSCA 3FRUA 4TYUA 4P4RA 5JZ7C 5DMIL 4MA1B 1Q0YL 2DTMH 3CZFA 2BSTA 3GRWH 1GAFH 4DGIH 5GHWL 1ZTXL 1IC7H 4PBXA 4OZHF 2Y7QB 3QA3B 1D5ZB 3RDTC 5D1QC 1FO0B 2DLGA 4NDMB 3HR6A 4XP5L 1J1OL 1UH4A 1R3LB 4EI6B 3X12A 1U2HA 3F7VA 4GKSB 4JRYB 2ZUXA 1VADA 4NJAH 4P9MH 1PZ5B 4IOIB 5BO1H 5E2VH 1OM3H 1YNLL 4GRWE 5D96B 3WEXA 3V8CA 4HKZB 4UDTB 3T0EB 4BK4A 3ULUD 2KZWA 5HVGB 1Z9OA 3SGEH 3QCUL 5GJTH 1XEDA 2FX8L 5D71L 2XN9E 1HHJA 3BESR 4K71B 4HIHA 2CLRB 1PVHA 1ACZA 4HG4K 5CEZH 2OP4H 2MQ0A 4MXVE 4D3CL 4W6WB 5HHOB 2YPLA 2P1YA 3FQNB 4U1MA 5T1KD 5CZVL 5IJVB 4ZUTA 4P0DA 3S5LB 3SO3B 2W65B 5C0BE 3TNMA 4YPGA 2XKNA 5A2KH 1MNUL 4Z5RB 5J7CC 3LD8C 3RU8H 3FN3A 5C0NC 1UKSA 4WY7H 4DVBA 1V8HA 4LDEB 1BZ9A 1MCKA 4MD0A 1BFOB 4HGWB 3W0WB 4JG1H 5CIPA 3Q3GB 1EEQA 1YN7A 5JW4M 4NFDA 4MQ7B 1QNZL 4JVWA 5CSGA 2ZP0T 2E8YA 2VITA 2YBRB 3JWNC 5C2BH 4FQJH 1WCBB 5HHPB 1LK2B 1Q9OA 1ZT4B 4BFIB 1YMMD 3INUH 3O6ML 1DFBH 3IVKA 1WSST 4JFPB 1UCBH 4IHOB 2VZVA 1OP3K 3D2UD 3QO0A 5L88H 4YK4B 1AD0B 4I5BB 5MENB 5E03A 3DUUB 4IBLT 5I8CA 1T04A 1T6VN 3WFCH 2Z8RA 5CINH 4X7SH 3TJHC 1QR1B 3BKML 4M43L 3GNML 3QEQD 1TJHL 3WIHA 4JFFD 3VH8G 3RIFF 3NTCH 5DJYB 3HE7C 3PG2A 4C56A 1GGYA 5DMKB 1A7RH 1CLOH 3NH7H 3MLRH 5K9KA 3BPOC 2GW5A 3L9RA 3O3DA 4GAYA 5T1DL 5J6GA 2ESVE 3OGCB 1DBAL 4JFDA 5FHBL 4JFEA 3RRQA 2XZQH 4NT6B 1OT2A 1ZSDA 1QSZA 4G5ZL 3BJLA 4I9WD 4ZUVA 1MAMH 5J9PA 2H6PB 1M6OA 4Q9QL 3O2DH 2YD2A 4MNHA 3QUML 4E0RB 4JO1H 1A6PA 1UZ6E 1EJOL 1VGKA 1OARH 2YD5A 1SVCP 3VGAB 5FYKE 5IMKB 1U8MB 4K7PH 1TJIL 1E4XI 2X9XA 5CD5D 4IOFD 1P2CB 5JPMA 3MZGB 3DYMA 2YA0A 4PRIA 2GTZA 2XWTB 3MLUH 3LDBC 1KCVL 1ZA3A 5FF6A 3D69A 1HI6A 3ECBB 2FBOJ 4HSQA 2F74B 1CDJA 4NO0D 2GCYA 2Y07L 3CFBA 4JRXB 1HSBA 3A6BL 5BRZE 4ODUA 4WW2F 4O4YL 2DDQL 3I2CL 5L2KD 1JTOA 4LRNH 1PW3A 2CJUH 4NZRL 3HG1B 1ZLUK 1S78C 4L3CB 5I1HL 1T2XA 5AUMB 3IFOB 5I6XC 2VB5A 3BKCL 3ARBD 5BQ7B 4J6RH 2AP2A 3EYOA 4YR6A 1BFSA 3OG6B 4GS7C 1YNKL 1NBZA 5FGCB 4JDVB 3QFJD 2MSPA 5L8JB 5DMIH 4XAKE 3D0LA 3VGEA 2EH8H 1Q0YH 2UWEE 4BK5A 1TQBC 1I8MB 5GHWH 1ZTXH 2BC4A 5KVEH 5D1XD 2C3GA 4NN7C 4YDLB 3R4DA 1CBVL 4MS8D 5C86A 1S7SA 4HEPG 4JM4L 4JVPA 3S35X 5C8JB 3C09B 5C1MB 3WHE0 3ZYJA 3LOWA 4XP5H 1J1OH 3WL9A 3ZT7A 5KN5B 1D9KD 1DN0A 3BZFB 2J5LC 2ICEB 1W8OA 4MDJA 1S7WB 4GLRH 3G5VA 3VFVB 4O9HL 3JWDC 1MI5E 4LCYB 3L3OA 4FTVD 1YNLH 5DGQA 3GMNA 2X89D 4JKMA 5JLZB 4PV9B 5B38G 3QCUH 2FX8H 2J8UB 2NXYB 4Z78B 4QRQB 5J06A 2JCCE 3OAUH 5BCAA 3LZFL 4YXKL 1IGTB 1CXLA 4QNPE 2QJDA 4OQ1A 1NCUA 3T4AA 4LPTA 5CZVH 5D5MA 5HYIA 3TH2T 1J8HD 2VN7A 3CFIC 1P7QB 4JAMA 1CIUA 1AO7D 1VFBB 3PWLA 3VMPA 3QJHA 1T22A 1MNUH 4M7LH 4QRTB 1MJUL 5ALCL 3S3PA 3HNSL 1KB9K 3GGWA 2MWCA 5A2FA 1IEAB 1WZMA 3T4YA 4G8IA 4I13B 2P45B 4UU9B 2C1PB 4H88L 1CN4A 1QNZH 3VGFA 1GGIH 1NGZB 4TVPE 32C2B 4JDZA 3RP1A 4ZYKA 5LGJB 4WHTB 5HHMD 2LVCA 2DKUA 3NGBB 4AYFA 2WBJC 4E42B 4EDXA 4UDUA 4N90E 4LSVL 3BHBB 4DZBB 2BVOB 3O45B 3U30B 3BP4A 1U8LA 1KJ3L 1QSVA 1YYLH 4RWHA 2EE2A 1KELH 5I8OH 3KPRB 4XWOC 1JZ4A 5I75C 4H1LB 3STZB 3QDJE 3K7UA 3MGTB 4NCDA 2DQDH 1CLCA 5I9QC 4TTDD 2VTFA 1K4DB 1I4FA 4IIQC 1ZLUH 1HNGA 3OKEB 3Q1SL 3BKMH 4M43H 1MCHA 3GNMH 4P2CG 3U46A 3MBEA 3MRPA 5BJTA 4HWZA 5FK9A 2ED8A 3RGVB 5DRZA 2ICWI 3HAEH 4GT7A 3UPAA 1EXUB 1ORSB 5I0DA 1PLGH 4J3WA 5ETUA 1GRWA 2OI9C 2YKLL 4TNVK 5EOTB 3NCJL 8FABA 3DI2B 1IEBB 3HPLB 2E6QA 2VAJA 3O3EB 2VLRB 2RBLA 1C5CL 1DBAH 3E3QC 5EBMB 5FHBH 5J4MA 1FNLA 4BQBA 3C9NA 3VFNA 1ED3A 3K1KC 4G5ZH 1LP9E 4ZXBA 5GQBA 1CE1L 4LP4A 4JQXA 5I74C 2EZ0C 4OUUA 4ELMF 5C0DB 1SM3H 4MHHG 2ID5A 1Q0XH 1NGWB 3WCYA 3U7AA 3CPLA 2Y72A 1EJOH 4K8RD 4QWWC 1NAML 3AREA 4JFHD 4YFLF 1F45A 1JZ2A 3ULVD 1TJIH 2R4RH 5EG6C 2MOVA 2AEPL 4JPVL 1FC2D 1HOCA 4HS6A 3L95A 2E8ZA 3WFHA 3TPUA 4Z76A 2IF7A 1I8IA 3HR5A 4LLMB 1J5OH 3MZTA 3UTQA 4YDJA 3QUKA 2Y07H 1JNLL 3A6BH 4D9QD 1VESA 1T2QH 3T0WA 1N0XL 4M7KL 3RWJB 2E27L 2VWEC 4PRBA 5BV7B 4O4YH 4BZYA 3I2CH 3HI1B 4EI5D 1QSED 1E28A 35C8H 3FOMB 3P4MA 4TUOB 4D0CB 2J8HA 3I3EA 3BKCH 1JI2A 2FJHB 3EJYD 4R90L 1CGWA 3UXFA 1CF8L 4FXGB 1KPRB 4ZUWB 3DVIA 4AL8L 4QOKA 5E6IC 5A40E 2YMXL 4AMKL 1ONQA 4F7EA 3S4SG 3QCTL 4LPYA 4H25B 4F2MB 5L6YH 2I9TB 4HULB 3B2VL 5TJWK 1CBVH 3V5KA 5CGTA 5INCB 5EC2A 4JM4H 1R0AL 3F6IA 3LS4L 5CP3A 3G5ZA 1B4JH 2N7AA 2AXGA 1NKOA 2YN3A 1PEZA 5C7XL 1F3JB 1QSFB 5HHQB 4DEPC 3ES6B 4V1DE 4OGYL 3D9AH 3BUTA 4TUJB 4O9HH 4L5FL 4LLAA 2X5PA 2IH1A 2ZCKL 4F8QA 2YN5A 3MNWA 4K94L 5F8QC 3OR6B 3ZKMD 5E9DE 3BH8B 1FZMB 3DGGB 4OM0L 1HXMB 3SCMA 3I9GL 3QDGA 1QVOA 3F6LA 4YXKH 5D2NE 5GS1C 1KYOK 1KXTB 1BQHG 5ELIA 3EOBB 4FQXB 1N5YL 3QEQE 1T5XB 4FQ2L 2LU7A 1JYWA 4FABL 3ARWA 1KJ2A 4YO0B 4XNXL 3GMLB 2EDHA 1CZ8H 4XNMA 1MJUH 5ALCH 2ICWA 5TGBB 2OL3A 1N6QL 1BECA 2BCKA 4LBEA 1VACB 4E41A 4PJ5E 3R0MA 5T5NF 2HLFC 4ODXA 5KSBB 4LLWB 5BZWA 1OAXL 2QKIB 4I9WE 4H88H 4YE4L 4GG6B 1ETZB 1V7ML 3O11A 4G6ML 4KKAC 2Q6WB 3O6FA 4J1UA 1XGRA 1S7UB 2EIDA 1D6VH 2I60L 4LSVH 4Y5XA 1MCSA 4ZNEA 5JPNB 1HH9A 1WWWX 2Z31B 1E4WL 4IMKA 3VI4F 5LVEA 1KB5L 2PW2B 3C5JA 2NMSA 1LNUA 4HKXA 5EN2A 4KI5C 4CW1B 2JIXA 4R4ND 5I66A 2AI0H 1T4KB 4JZJA 5E5UB 4Z9KB 1CGUA 3Q1SH 5C0AB 1KOAA 4MJ5B 5F7EL 3C5ZD 5TQ0L 5E5MB 5C0RL 4TNWF 2A74A 1BIHA 3LKOB 3ILQD 5L2KE 2ARJQ 4FQHA 3T0DA 2A83B 4L4TB 3TO4C 5JOFB 5GRVL 5C6PB 4I2XB 2DMKA 3QUZA 3L3JA 4YWGH 3V4VL 3NCJH 2OQJB 5D7JC 4BKLB 1SHMA 1C5CH 4K94C 4I8DA 4LRIC 4M61A 1AGEB