3K81A

Structure of the central interaction protein from the trypanosoma brucei editosome in complex with single domain antibodies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
VQPQESGGGLAQAGGSLRLSCVVSGITFASEAWGWYRRAPGKQRELIAAINNEGRTNYVDSVKGRFTVSRDNAKNVMYLQMNSLKPEDTAVYYCNANLQTGTLSGARLYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, rna binding protein
molecule keywords MP18 RNA editing complex protein
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 18
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k81A00
4RFEB 1RUML 2FWOB 2NZ9C 2EE9A 1N5YL 3ULVL 2D7TL 1MCJA 1BJ8A 3BJLA 4IRJC 3IDXL 5E2VH 1GRWA 1C8PA 1VCAA 5F1NA 4GKZA 2VDKL 5H8DA 5EBGA 2DTMH 4KQ4H 4ZO6A 2CUIA 3IS1X 4P2OC 1D9KC 5HYSA 3ALWA 4QRUB 4XXCA 3QDGB 4WEUD 4Z7OE 1LO0H 1FNGA 4AEHL 1GPOL 1IAMA 1U95B 2NX5A 5MHSD 1WZMA 4PY7B 4EN3A 3E2HB 1NQBA 2ICWB 3NCJL 3MLSL 4KUCF 4XNZC 3S36H 3SHSA 3BUYB 4AIOA 1R3KB 1KGCD 1KXTB 4L8SA 2XYCA 4MDJB 3EOTH 4OGXL 2DM7A 3IXAB 4ZFZA 2DICA 1CN4A 2DQDH 4GRWH 8FABB 1T4KA 3SCMA 1S7XA 3W11C 3TNMA 4MXWL 3NAAL 2PO6D 4X80H 3RGVD 1BQHB 2ITDA 3QNYA 5I74C 4PREB 3C9NB 5CUSL 4OD1H 1NLBH 3OKEB 5C86A 5T33L 4CW1B 1V7MH 4DN3H 4OGZA 2X4QA 2C3VB 2VISB 1QFOA 5KW9H 4OM1H 5EOCL 4NOBA 4JVWA 4DKFH 4BFIA 4MA3A 5DD1H 2AEQL 5CSGA 4NIKB 3P0VL 4LFHD 3BEVA 4BZ1H 5JXAL 4K23H 2VXSH 4UBDC 3HG1B 3OKOA 4FFVD 4OCXH 1FE8H 4JFPA 4Y2DD 4CGTA 4JFDB 8CGTA 4LSSH 3MRGA 5KSAD 3PG2A 3G5VB 5D1QD 3HUJE 3BP6B 2EDDA 4KJPD 25C8H 4MB3A 3L7EB 1XR9B 5EC2B 5KSBF 3PDOA 4IEFB 1RZ8B 1A47A 3DRTB 3QPQD 4NRZA 4PBVC 5I15L 1J1OH 1T7XA 3I84A 3B9EA 3BJ91 5EIVA 5D2LA 1HHGB 4G43B 3PXHA 2XQYG 1KIPB 4P99A 2IAMD 4NHCL 2X10A 3VE0A 1UH4A 3KYMB 4M1GL 4I8DA 2HMIC 2OL3L 3C6LD 2R0KH 5IHZB 2VITB 2GYSA 2QKIA 1LEIB 3QDMB 4WJ5A 2E7CA 4A6YB 1T7WA 2BNQD 3TVMA 2KZWA 1OQXA 1T0NA 2HFFA 3HRZA 3X11A 4M61B 3TO4C 4MZ2A 2GUOB 1T5XB 5IHBA 4Z7WF 4U1NA 4YEFA 1TCRA 3E6HA 5LGKA 1BQHG 2MMXA 5K59E 1F90H 4X5WB 1DN0B 3QYCA 4KK9D 2PKDA 5CJQH 1YY8A 5IB1A 3C87A 5DJ6A 4I3SH 4ELMF 1FNAA 5D1XC 2YC1B 4F33B 3SDYH 3EO9H 1GIGL 3VD3A 1IC7H 4OQTH 4Y19D 3IRZA 2A9NH 3DX7B 4J3WA 4HXAH 3QIBC 4GW5B 4JRXD 4XZUA 3G6AA 4M1DH 3IGAB 3IKCB 3EGSB 4Z7VE 5GS0L 1CICA 2V5MA 5CEZL 2FEDC 2H45A 5E1AB 5L7XH 5GS2D 3F5WB 4RGMC 3OKKA 5IBLD 1G7IA 4J4PD 3QZWG 2VSDA 5KVGL 5JUEH 5E5MA 4NWTL 2VDNH 2R2CA 5MI0B 3HPJB 3BPLC 3NIDF 4ERSL 2GJ6A 3SE9L 1JGEB 1TPXB 2O5YH 3A0OA 1QA9B 3VD7A 2R0LL 5HDBF 5B8CA 3OAUL 1OY3B 1KCRL 5IMKA 3AMLA 4GMTL 5K9OB 5DD0H 4AENA 4K3DH 4P5TB 2P8MB 4LKCB 1RUKL 4L4TE 2MHAB 4ODVL 5GRUL 3TZVD 1FVCB 3ZYZA 4H5SB 2EDJA 4LSTL 5KVEL 2OCFD 1LO3L 2NY3B 3BHBA 3KWWB 4LVHC 1DUZB 4KQ3H 1TITA 3FOLA 3ULSA 4GMSL 3UPRB 2VLJD 2X4NA 3L3KB 3UBXG 2GFBB 3AS3A 5I1DA 3VRJA 4NKOB 4NQDE 1QSFE 3ZO0A 1RHHA 4MJ6A 5EU6D 3ZL4L 2VLRD 1JZ2A 3ULUD 1LQSR 4Y5VC 3TNNB 4J3VA 4P46B 1A7PH 4YDVB 3QWQB 4NDMA 4FQIH 4WI5A 4XNQB 2MCG1 2F53A 2XN9D 1X5LA 3JTTA 4MNQD 3GNMH 4IRSB 2R23B 3FKUS 4TNVK 3RIAF 1T1WA 3I2CH 4NRXA 2M26A 4JPVL 3MRPA 5INDB 1VESA 2MFNA 2NW2B 4Q2ZA 3GSXA 2E6PA 4HUWA 4HH9B 4IMLB 4N90D 3TP4A 3VFUA 1YEJH 1Z2KA 4L3ED 3S88L 1J1XL 3MLRL 1OLLA 2OXHA 4WW2C 1WV7T 5HYFA 1UG9A 1V7NL 2F5AL 4I9WE 3HMWL 5AUMA 3VXSE 1IRAY 1R5VB 4I5BB 5DRXA 3BIKB 2F54E 3D18B 2RIKA 4Z8FL 2DQFA 3OZ9L 4FNLH 4X6FB 2P5WA 1VFBB 4OCYH 4TOYL 1ZSDA 3WXWH 5KSBA 4GG8A 5DMGD 1W0VB 1H3GA 4U0RB 2G9HA 3DTXB 1YUHA 4M93B 3S96B 1U2CA 3RUGB 1NGYA 4ZSOE 3KDMB 1NC2D 1CGWA 1UZ6E 4JO3H 3VW3H 1EEZB 1CBVH 3IFLH 3S5LA 3QCTH 3DV4A 4U1IA 3A67H 5FYKE 4WFHE 3CH1B 1MEXH 2YRLA 4OUUA 1SBBA 5FK9B 4ZUWA 2XWJB 5D5MA 3OB0H 2XG4A 5J3HC 5FHAL 4EEEA 3FB8B 1FNSH 5GJTL 5GISH 3BXNA 5CIPB 2CKBB 1TNMA 4X4ME 3BZFA 4LHUB 5DJDB 5KTEH 1HOCA 2FL5B 5CS7A 4DN4L 3LN4A 1ITCA 2B39A 5LXGH 1KTRL 2KL6A 3BPOB 1FFNA 4ZPTB 3CIQA 4Z7WA 3QIUC 3DUSB 1KCVH 4B5EA 3U0PA 4JEGB 4LLUA 1T6VN 4PB9H 4NCDA 4XP5L 5I1HL 1JPTH 2NR6D 3HZVB 3VGAB 4RFOH 4ISVA 5F3HB 4ELMA 3QNZB 4C56B 1XIWB 3UDWC 4N0RA 4QHLA 1JF5A 3GSNL 2CLZA 5EFIB 4HLZG 4JHZA 4HWEL 3V0WL 1IGFH 1BBDL 1NAMA 1IL1A 2X1XR 1GZQA 2UYLB 4J3XA 2Q76A 3SDAA 3F7VB 4MD5A 3NTCH 4P3DA 5DHVH 5A3ID 4HDIB 4LDOB 3FQXA 3SGJC 3VGBA 5MP6H 1HKLH 2DQJL 2FECL 3FO9B 5CILH 3PV6B 2F74B 1UM5L 2VXQH 1W72A 4ZO9A 2KBGA 4NKMB 4YAQB 3MO1B 5C0JB 5HHMD 3GRWA 1UM4L 3O3AB 2WUCH 5BQ7A 5ILTL 1P4LA 2NY1D 1WEJH 5C0CB 1NBVL 3CZFB 5EBMA 1RJZA 3LQZB 4LEXH 1MCPL 3DETD 2HTLC 4PLJC 3S7GA 4YFLI 3QQ4A 1RZ7H 4KROB 4GW1A 3VXPB 1N4XH 1KC5L 5I8EA 5T3XH 4RMSA 3Q1SH 1RUQL 3VI3E 3WO4B 3CNKA 5KVDL 3SBWC 5HPOA 3T0WA 4LU5H 4F37K 3L5XL 4HS8L 3RKDC 1FAIH 3RAJH 5H37H 3NCYP 4YE4L 3GKWL 5IFAL 1IZJA 1X5IA 4PUBH 2APBA 1A6ZA 3ECBB 3QDGE 4M9PA 1K5NB 4LHUG 1RZKH 1JI1A 4XB8A 2WZPD 4D9LH 1DQJA 2W0KA 1ZVHA 5HVHC 4WRLA 4K7FB 5FECA 1XCTB 2WP3T 3ZSSA 1KJVA 1YEIL 1XF2B 2FIKA 3SKOA 5DR5L 1IGML 1OPGH 3SDCB 1IEBB 4JQXC 1I1RA 3C5SA 4H8WC 4IRZH 3QXDB 3OWEA 4K9EL 4G8FA 4FTVD 5HHOA 1AXTL 5ENWB 1OT1A 3CXHJ 3O3DA 4JO2H 5C3TA 3MLWL 5E7BA 4GQ9L 4DK3A 3BYYA 3DIFA 4PJ5A 5FYKU 4OLXH 2ICCA 3C5ZD 4OBSA 1G7HA 3CFBB 3NACL 1J1PL 4KMLB 2EXYC 2IANB 3VXUB 3KHQA 1A0QH 1RURH 4M1CD 1BM3L 3ARFB 4JQIH 1ROWA 4W81A 2HT3D 4MXVE 5HDQH 3SPVA 3WIHL 1XCQB 4NKQB 2DBLH 2J3SA 1QBLH 3FRPG 2VABA 4MA1B 4X99B 5D7JB 3V6BR 4DKEH 2BFVL 2IALB 3QUYD 3WJJC 3CFEA 4LSVL 2WBWB 3BZ4B 1N8ZB 5SX5K 4X4ZA 5BVJB 3HNTH 1Q8MA 4MCZB 5ICYB 2GQHA 3RY6C 1U92A 4KHXL 4QNPF 1INEL 3NPSC 1AGBA 4U6XA 4JO1L 3IDJA 5EU3B 2J6EA 3MGOB 4R0LC 5F72S 5C09B 4GKNA 4BFGA 1C7SA 2EYSB 2Z93B 1PQZA 1T1YB 4L4VD 3QDJA 4PTUB 1S7VA 3CVHH 3HN3A 3L5JA 1EPFA 3T65A 1U58A 4TVPL 2IPTL 6FABH 5ID0A 5MEND 3T4YA 3C2SA 3OHXB 2V7NA 4AIZA 3MLYL 3S3PA 3TN0D 1OLZA 2R1WB 2E27L 3OXRA 4IRJA 4YPGA 4JDVA 4WNQB 5HGAB 4WFFE 5GJSH 3WFZA 4WHYG 3RVVD 4RGOH 4V2BA 4ZOCA 2ZNWA 3DV6A 4YHOH 4IJ3C 3VFTA 1D9KA 4KPHL 3NA9L 1CFTB 2JJUA 3ROLA 4PJGE 4PRAA 5KBNC 3LB6C 4U1MA 4UQ2A 3U2SA 2IADB 2A6DB 3QDME 4PJDE 5FUCE 5IM7A 2E7MA 2O26U 4HIXL 4JFFD 4NYLB 5SWQB 1UJ3B 3QXAA 1P4BL 3UTQB 2W9DH 3BZDA 3SE8H 4KKCC 3MFFA 3C60A 2B4CH 4FFZH 5C6TH 4DZBA 5IKCB 5CEYA 1UC6A 3DJ9A 4GS7C 5DJZB 1KNOA 3D1MC 1RMFH 5EO0B 5GGSY 1VGEL 2OR8A 4EKXA 3U0WL 3BSZL 1OM3H 2VR9A 2VL4A 1MCCA 3GMRB 3BD3A 4RMQA 4RQQB 3FT4B 3AGVA 5EO9B 2BVQA 2AJZB 3PJSB 3DROB 4NO3A 4R2GB 3TEUA 2ZG2A 1G1CA 3PQYA 3ARED 3NBNA 1NGZA 4GRMB 4TQEH 1NGXA 1LEKB 4HUMB 3RX7A 3RZCC 3C09C 3GIZH 3WLBA 1U8PB 4FZEH 4G3YL 1I9RH 4PGJA 1CZ8H 5DZNA 3MRDB 2G5RA 3HPLA 4YXHH 3E0GA 5I19L 4OV5A 2FJGA 4P4KB 4PJCB 4AEIH 1TVBB 3SE4A 1HEZB 3FTGA 2YA1A 2EIDA 4QRQA 3SEPA 4N8PA 1XGQA 1RK1B 3AB0C 2I24N 4AMKL 3JWDC 5IP4A 2RJMA 5IMLA 3ZMRA 4K3HA 4WW2F 4Z95H 1XGYL 5K9QG 5EOTB 1VHPA 4ZAKB 1SJEB 5DD6A 4G6AC 3O0RL 2ADIB 1L9MA 4NQVA 4YHKH 5T1DH 5K9JH 1ETZA 3CDFA 4OZGF 5KZCD 3VXMA 4BH8A 4HUVB 4X6DF 5D2NC 5HVGB 3FB6A 3MRJB 4OZHF 1G6RH 1JCKA 1S7TB 5E8OA 3MRRA 3HB3D 3QH3A 1TJGL 3V0VA 4HD9A 2W60A 2UUDH 3K4ZA 3W82A 4PJ7F 4LCUB 1KCSH 2CO6B 5MEPB 3HAEB 3HC4L 1DQTA 1N2RA 3MRQA 5E6YA 1E6JL 4MJIA 1OP3K 4MS8D 2ZOLA 4YWGH 3TO4A 5JXED 1ZOXA 1L6XA 4U6YB 4U6HA 3D25B 3T3PF 4ONOA 1KTDA 1OGAB 1T4KB 3U30C 3SCMB 1AXIB 5FKPB 2PYEE 2P46B 2BC4A 1DANU 3VFGH 3PP4H 4G8EB 5D1XA 1OAXH 2AKRA 1FFOA 3QNYB 1CU4L 5HPMB 3R1GL 3SGKC 4JDZB 4XGZB 3BDYL 2JJSC 4LLDA 3SGEH 3QIBA 4Z18A 4NM4H 5JOFB 1L7IL 3DVGB 3STBA 4BYHA 5DS8B 4NN6C 1CR9H 3VGFA 4ODSH 1EFXA 1I8MB 2PO6C 3RGVC 4MAYC 1XF1A 4BFIB 3FQTA 3QHTC 4MA3B 1CIDA 5E6ID 2ZKHL 3RUGE 4U1GC 1AH1A 1UENA 2R1XA 1TQBB 3DX6B 3DSFH 4LPUA 1JHKL 4IOFD 4I2XA 2OYPA 2ARJA 4GKSB 2CJUL 12E8L 4OFDA 4I0CC 4IS6A 2DRUA 3O8XD 1D5IH 1LGVA 1NFDA 3MRGB 4R26L 4NQDD 1QSFD 2BXYA 2CUMA 2HT2D 5F7EH 3T0EB 5F21B 5FYJH 3PDOB 4YFLF 1OARH 2APXA 4NRZB 2DIBA 3KPPA 4FFVC 4RZCA 4X9BA 3RVTD 4HBQA 3NIGF 3HMXH 4LQFL 2H2PD 2AABH 5KSAC 4UDTB 4KHTL 4FQ2H 5D1QC 1MPAL 3PDGA 3VE0B 1AGEA 4D0BA 3HAEG 3O3BB 4MWFB 4C56E 2AJVH 5CBEA 1RZIB 4IDJL 3ZE2F 1DFBH 3GKZA 4QCIA 1MH5B 4K71B 3C08H 3WFBH 3UYRL 4W68A 4P5MA 5E00B 1JE6A 1MSPA 4MCYA 3TVMB 1S3KH 3V6OC 4Y5VA 2XTJE 4WI7A 4ETYA 3X11B 4GW4A 5I8KL 1U93B 5IVNA 1WICA 1NC4A 5DYOA 1HZHL 4I9WD 4U1NB 3VXSD 4FQXD 5GGRY 2F54D 5FOJA 1A1NB 1INQA 3MTRA 4OZIF 1I9IL 5FO9A 4YK4C 3S4SA 3UO1L 3VG9B 4YHML 1MHEB 4PRNB 1YY8B 2PXYB 1JV5A 4OFYD 2RFXB 4G9FA 3QG7L 5JW3L 5EC1A 1WFOA 1VKXB 4XAKE 5C0CE 2DD8L 2FDBP 2DLFL 3TPKA 1DBJH 2FX7H 3RWDA 5IMOA 4XZUB 3G6AB 4CVZB 1T03L 3O3UN 4C4KT 3QUML 3P30L 1E4XI 1KN4L 4WW2A 4F7PA 3UTZB 3PL6D 2FBOJ 1T0MB 2D4FA 4OZFB 1R24B 4KK9C 5JW4Q 3KPMA 4E42B 3BGAA 3LMJL 5JO5A 4OZGA 2DQHH 4YHZL 3IF1A 3Q5YA 2YWZA 4ZUSA 5HHQB 1P1ZA 1AQDA 2X4UA 5IFJA 5E8NA 4Q6IA 5E8EB 2DL2A 1ZHBA 4OZHA 5JLZA 3EUUA 4XMKL 4H25A 4M62H 1SVZA 1I9JL 4HKZB 4BQCA 2YZ1A 3CU7A 3MOBL 4ONHA 1XAUA 2CXGA 4PJ7A 2DOCA 1B2WH 3RY5A 5IMKB 4WEMB 4J4PC 4PLNC 4JO4L 1IM9A 3BKML 1B90A 2DQTL 4LKXA 1AKJA 1S5HB 4CJ0A 1ZHKA 3QIUA 5BXFA 4GAGL 4WCYL 5C0IA 2AK1H 3AM8C 2VWEE 3LHPL 5JOPD 2GJJA 3FOLB 4H26A 4RGNB 2IFGA 2P48B 5I1DB 3UDWA 3VRJB 4QLRA 4J7RA 1FZMA 3EFDL 5IEHB 3IXTA 1EZVY 3TZVC 4KK8C 4N8VB 4Q0XH 3NFSH 1H3PL 3LEVL 2E6JA 3QWRD 4YIQA 2R56H 3ZYJA 4NDMB 5CZXD 1KCLA 1T7VA 1Q38A 1J0ZA 3ROOA 4HGMA 4YFEA 5FUZH 3SGJA 3MLTA 4RDQG 3RWFA 1ZLVK 3O2DA 4YLQT 2QSCH 4PV8A 1UA6L 1CDJA 1EGJA 3VXOB 2A38A 2W65B 5EU4B 5DZLA 5GZNC 2BCKA 4PRBB 4OAWA 4UB0L 1OAQL 4HUWB 2JJWA 4EI6B 2OTWA 4X7TB 2DMKA 4KJQD 4OZFG 4MQXC 1D6VH 5C09E 2EH7H 4OKVB 4HIEA 4Y4HB 3HC0A 2R29L 5TE6H 5JHDA 4LNVA 1IQWH 5MEQB 4PJEF 4ONFH 2B2XL 4GAYB 2PYFA 4OFPA 5LCVH 2X4PB 3IRPX 3GMPA 1F02I 1OF2A 4HCRA 3U4AA 2EDRA 4KMTL 3JWOH 4LVOB 5HYJA 3EYUL 5BJTA 1JJUA 1HH9A 2NY2B 4YDJA 3G6DH 4TRPH 4KTEL 3SBWA 1YYLL 2CRYA 1UGNA 1PZ5A 4HMEA 1NGYB 3NFNB 3OR6B 2BJMH 5F93C 3WXVH 3FB7B 3S5LB 3DV4B 4KKAD 2J88L 4U1IB 1U3HB 4JFYA 3ZE1F 4XP6H 2EIZB 3RU8H 5L2KA 4Y5XB 5AG8A 3CH8A 4WWKB 4PTTA 4Z7QF 4KVNH 5DMGC 2GCYB 4MA7H 4XPTL 4HJGA 3UTSD 4OBRA 2DTML 5BV7L 1CGUA 3EYFA 4JQXA 3V52H 1N59A 1OAUH 3M45A 4Z7WB 4N0CD 1BWWA 3V4PH 3MRIA 5EZJA 3U0PB 5FA3A 3QRGL 4ZQKA 4LLUB 2ZZUT 4OZIA 2ZSVA 2R0WL 3G5YA 4QHUA 4PRHA 3IAQA 3O2VH 4N8VG 1I4FA 4NZTH 4HBCL 1WQVT 2DTSA 2JIXA 15C8L 3HG1D 3PHSA 3WFDL 1VENA 3V4UH 5IGXL 3EOTL 4WV1B 2DQDL 1IEAA 4JFDD 4L8BA 1KG0B 3VMPA 1GVIA 1EO7A 4MD5B 4P3DB 4FQPA 5F9DC 1GGCL 2DIAA 2NR6C 4LPXA 4G8GB 3IJYB 3BQUB 3VFRB 3KYKH 3MGTA 4P23B 5ALBH 2OSLB 1A7QL 2GTZA 3MOQA 1NLBL 4PJCE 2VDQH 3AS0A 4ZS6D 3RY6A 5E99H 4QRPA 4WFFD 4YFDB 2P8PA 1A4KA 5ADPL 4PFEA 1RJZB 1DBKL 1LVEA 3KS0J 5F8RC 4R0LA 1JPST 1UYWL 2LU3A 1I7RB 2DMBA 3TT1L 3MV9B 5HD8D 1MJ7H 1T20A 1C5BH 4I3GA 3QDMD 3LEXB 4OLWH 4KK5C 4PLOB 5I8EB 4S1QL 3CMOL 4YBLC 1YEDB 1HNGA 4YHPB 3S5LG 3TO2A 1TVHA 3ES6A 3WHXB 3NCEB 4ODBD 4RAVA 2WLYA 1OAYH 3V7MA 5DMYA 1X5KA 1A6ZB 2QQKL 3CFCL 4PYHA 5IEKA 2VQTA 3UTOA 2P24B 2NX5E 2NYYD 1Q9KA 2VOTA 2YHGA 4PS4H 2DYPA 2YEZA 4U1JA 1CD9B 4M5ZH 3TWCH 1JZ7A 3L3IA 5KANG 5KSUB 3DGGB 1P4IL 4ZYKB 3C5SB 2WQRA 2NTFA 3CFKA 5I1GL 2EKSB 3QAZB 3KLAB 1RVFL 1ZA3B 3ZLQC 1X5JA 4W6WB 5CSBA 3P4LA 1YEFH 2R0KL 4YGAB 4OCMC 5I17B 3TJEH 1MI5A 2YD5A 3DIFB 1RZKC 1MWAH 3UC0H 1WZKA 2IPUK 2SEBA 4ELKA 5TE7L 4XCYA 2VXUL 2X44D 3FO2A 1SJXA 5GGRA 1I3RA 3T2QA 4JZJA 1V3KA 3QO0B 5I75C 4NHUB 4W6XB 1X6LA 5GRXG 1C7TA 4WGWB 3IFNH 5GSVA 1L9NA 1F90L 1EHAA 3MV7A 4FQJH 3WIFA 4XNMA 5C0EA 3NABL 4PJEA 1YN6B 3RZCA 1UB6B 4RFNC 3SDYL 3EO9L 5DLMH 1KB5A 3C5ZC 1IC7L 5F7WC 4ZMAT 2A9NL 4P5TD 1JYWA 5BZWB 4DQOH 1U92B 1ZTXH 4LRNL 4GRLB 3GBNH 3SJVA 4HHAA 2VNCA 4M1CC 3KNBB 1CXIA 4U6XB 2NY3D 5ICXA 5IB3A 3DRQA 1DQML 2OM5A 3VFOA 1MRFH 4ODWB 1HI6A 3CLEL 4MAUL 5SX4I 1JZ5A 1U58B 2EDTA 3IS0X 3EAKA 1AGCA 2G75A 4XPGH 2DKMA 3R8BB 4LP4A 3WFCL 3F7RA 5ID0B 3G04B 4AIZB 4OD3H 4P46D 4IRJB 4YPGB 4M6NH 1NMAH 1U91B 5D2LE 1FSKC 2V5YA 3QQ9D 4IRSD 5D2NA 2H26B 4PGEA 2P42B 2YUZA 3DV6B 4OSUH 4P2OB 1D9KB 1FJ1B 3EDFA 3LCYA 4MHHI 4M48L 1BF2A 5C07A 2EDOA 5J56B 1A1OB 4AT6A 4LASH 1IC4L 2YD4A 1C16B 4WUKH 3OL2A 3UP1A 1T1ZA 4KQ3L 4XNZB 1SYVA 3FHAA 2XWTA 4WHDA 4NUJA 4NQED 3MFFB 3OKYA 5CJ5A 2Z91B 3LSOB 4DZBB 4XMPL 2XKNA 1H5BA 3QUZC 1UCBH 1NAML 1GGUA 4U1KA 5C0AB 5IV2A 4HKJB 1EHLL 1L6ZA 1T66D 3UXFA 1AI1H 1EBAA 1A7PL 1KIQB 1Q94A 2Y07L 1X4YA 5I74B 3BP5B 5F7LB 5HHVH 1F6AA 3MBEB 3SGKA 2JJSA 1ZMYA 1G7JB 2DDQL 3GRWL 4J8RA 1FFPB 2B4CC 2CK0H 4I48A 1X5AA 1KJ3L 4TUJB 5D93C 4LHUD 3O9WC 5C0GA 3HR5B 1YY9C 2PO6A 4U6TA 5CSZA 3RGVA 4HGWB 1YEJL 3HPLB 4JE4B 1MUJB 1F11A 1FV1A 3LKQA 2FX8H 4MA8L 4O5LL 2FJGB 4X5LA 1DVFC 5ITFA 1B4JH 2YKLL 1N6QH 3OX8A 1SEQH 2YN5A 3FTGB 5K33A 4QRQB 4D2NA 3VXRB 4LNRB 1U8NB 1WFUA 5ACZA 1O7SA 1K4DA 3DO7A 4C56D 4XNYL 1XIWD 2ZUQB 4R7NA 2XACC 1OD9A 5FA4B 3ZHDA 4HG4J 1QZ1A 4NQVB 1N26A 5H35B 2UWEB 2X4SB 3VW3L 4MQSB 3IFLL 1CBVL 4M5YH 4JFZH 1IAIM 4PBWD 3VXMB 1U8MB 4FS0A 4V1DB 1ZLSH 3O2WH 4CADA 4QRSA 3VWKB 1XF4A 1Z9LA 3HI5L 3O6FB 4Y5YC 3ARVA 3CPLB 3D69B 4Y2DA 1Y6NR 2P8LB 5E8OB 3UEZA 4RGNE 5KSAA 5KTEL 5D1QA 3QH3B 4I0PC 4OLZL 3EKCA 4GG6F 4JJ5A 1P7HL 4LCCA 4X5XA 5B38A 3LV3A 3SO3C 2CDGB 3ARYA 3G9VA 1VADB 4TNWK 4XAKD 1Z0NA 1YNLH 4N0YL 3OG4B 5C0CD 3Q6FA 5GGVH 1KCVL 3MRQB 5E5UB 3T8XA 2ATPB 2N1KA 1NBZA 3V6OA 2F53E 1JPTL 3NCYS 4KDTC 3TO4B 1YEKH 2FB4H 2M2DA 4RFOL 5TQ0H 2IAMA 2H9GA 4U6HB 4KROD 3KPLA 1KTDB 2J8UF 5D7KD 2CR3A 5GHWH 4E0RB 1ACYH 1IGFL 1BPVA 2BC4B 5EWIH 3ULUH 3QEUA 1Q1JH 1OTUD 2J5LC 4K2UL 1FFOB 4I77H 2BNQA 4MS8C 1QPPA 4LLDB 4PGCA 2EXWD 5JXEC 3QIBB 4U2YA 3FN3A 4Y1AB 5ICZB 3MXWL 1QFPA 3BZEA 1NDGA 4NKDA 1I7UA 2VUYA 3MNZB 4F7CA 3IJSB 3C6SA 5GPRA 2J6EL 3QHFH 1X5ZA 4L1HA 3SDCD 3HA0A 3CCHA 5GSRB 3TESA 2Z4QA 2DWEA 1ZEAH 4LEXL 3TV3H 4Y19A 4JRXA 2R1XB 1BIHA 5ERWB 4JDTL 1UM6H 2IH1B 4Z9KB 1RZ7L 2ARJB 3K2UL 5IVZA 2EECA 3LIZH 1S78D 4NNYA 4FQ1L 3U36A 4IS6B 3DBXA 4HC1A 1R3HB 4O4YL 2V6HA 5D72H 2IGFL 4LLWB 1FAIL 2IAND 2AP2A 3VXUD 4HQQH 1N7MH 3FQNB 4J4PA 3ARFD 1U8LA 2MKWA 2VDRH 2B1HL 2VXTH 4Z7WE 2OBGA 4D9LL 5D7JD 3EYSL 3MUHL 3EO0A 2X40A 3O8XC 3HE7B 5HI4C 4ZDHA 4NNXA 4ONGH 5E08H 5MERA 4HIIA 3L7FA 4NZUH 4N8CH 4OF7A 4QCIB 3OAZH 1EZVX 3QULA 4MDIA 3QCVL 4LBEB 5ESQB 4F58L 1E27A 4LOUC 2YSSB 3GSOB 3GI9H 1T22A 3VMNA 4HWBH 4JO2L 1A7BA 5C09D 3I6KA 3TZVA 3T4AB 1HILA 4I18C 4Y5VB 4XRCB 3F12A 2H2PC 5HGHB 1CFVL 1A6TA 4G8GE 2NPLX 5FO7A 1QOKA 3QUKB 3JV4B 2O5ZH 1NAKH 3NCBB 1ADQH 4PJAB 4BA8A 1KJ2H 1INQB 2EDNA 3ELAT 5DJ0B 5I9QC 4S1RH 3PWUB 5FO8B 3D0VA 3A6BH 4Q9CA 4NJAH 1QFWH 1A7OH 3L5WA 1RURL 1Q9LB 5EU6A 4JM2D 2BDNL 1MCEA 1UQSB 2VLRA 5HDQL 2DLHA 2AXGA 5JR1L 2DBLL 5D7SH 4XC1H 1OP9A 1XF5B 1QBLL 2PW2B 1BBJA 3NIDE 5DEFA 3EOAA 2A74A 2C4FT 1AY1L 2OTPA 2XN9A 3BISA 4FQXC 4MNQA 3U6RB 4F7PB 4WW2B 3EJYD 2B0SL 2WBJD 1NLDH 4X6BB 2HLFD 2BY0A 4JCMA 2HJFA 3KPMB 3NIFF 1KIRB 5K9KA 4WW1B 4JN1H 1EBPA 5JO5B 2HLAB 4AK1A 5SWZB 4MNGA 4N1CA 1QRNB 4UAOC 3LRSA 2Q87A 2A83B 1P1ZB 5DVKA 3RWGA 4X6DB 1ZHBB 4JLRB 2VLMD 1AXSB 2FRGP 3Q48A 3PL6C 1BOGA 3MJ6A 2JJTC 3PWPB 2JCCA 3U46A 4EIZC 4ONHB 3V5KA 2YRZA 2VERN 5GJSL 2W9EH 4R2GD 4MQ7A 4RGOL 3U9UA 4EOWH 3EYOB 4PP1C 3SDXF 1NC2A 2CSPA 2I5YL 5HDLA 4JKWA 1AKJB 2ZPKL 1CF8L 1R3IH 1ZHKB 3QIUB 5BXFB 1J05A 5DEZA 5CEXA 2ZG1A 5C0IB 4QKXB 1C1EH 1A6AA 1AIFA 1CFSA 3L6FA 2J8UA 4PJ5E 4KI1A 2ZP0T 5DJ2A 3WN5C 4YXKL 1MJJA 4H88L 5IROA 4NWUH 1QYGL 4FFZL 3K3QA 1VGKA 3IXTB 2UZYB 4LGPB 4KGLA 3EYVA 4TUKL 4YHIB 1CT8A 1N5AB 4JVUA 4R7DB 1URLA 1S9WA 1CVRA 2ZCKH 2Y7QA 4LLQA 4ZAKD 3ROOB 2ZUWA 1U6AH 1KJMA 3MLTB 5I18H 5JMOC 1N0XH 4F2MA 5IVXF 1E28B 3HNVL 4TSCH 4XHJC 4CMMA 3HE6D 2XPGA 1BFSA 4LIQE 2BCKB 3UTPE 3PIQA 4WFGE 4TQEL 2BVPA 1BFVL 4JN2B 2Z8SA 4WFEE 4UILL 3OJDA 1N0LA 3WUWB 2CDFA 1QLEL 3GK8L 3UJJL 1NBYA 1Y0LB 4LL9A 5JORA 2BHUA 2BY3A 4MGXA 4XP1H 4ZNEA 2BOBA 3RWCA 4LPCA 3MXVH 5AZEH 5EIQA 3R4DA 1BVZA 1MAML 1I85C 3HLAB 2HVKA 5DJAB 4KJQC 1EAJA 5F1SA 1HXYB 1MJUL 4LF3B 4UV4H 1F4YH 4WDIB 4AJ0A 1OGAD 5HXMA 1QFUL 4JFYB 4P9HC 3O6LH 2CIIB 4YHKL 5T1DL 5J89A 4E5XA 4PTTB 3E2HC 3ZTJG 1J87A 5HVHB 1A9BB 3JWOC 4HK3N 5EULV 1I7ZB 5E4IA 1NCTA 3MRFA 4RAHA 3KAAA 4KKAC 4QTHB 1PG7X 4P4RB 2YXMA 4JG1H 4M7KH 5FUOH 3CFIC 2FCBA 3U9PL 1QKZH 2O5XH 5FA3B 4KMQA 3U48A 2NXYB 4OZIB 3REVB 2DI9A 2F15A 2V7HA 1UXSA 4B50A 3MA9H 4YEEA 1QHPA 2XKSA 4HPYL 1FDLH 3CSYB 4XC3H 4GJTB 1S9VB 3ET9F 1II4E 1LD9B 2JIXB 4HX1A 3CDGB 1RFDH 4AEFA 1MFEH 1PYWA 2C1OA 1QLFB 4F7TB 2V17H 3S37X 4LSUL 5TQ2L 3SN6N 4FTVA 2FATL 1FO0B 1W8OA 2RCSL 3VFGL 1BREA 1EEYA 3QXWA 1ZAGA 2UV3A 2CXKA 4NUGH 3CFDA 3T0ED 1I1YA 1BQSA 4NRYA 3FFCB 3F62A 3C5ZA 4PRIB 2P1YA 2ATKB 4HF5H 4NM4L 3WUWG 2OZ4A 2EDFA 1CK0H 5EN2A 3NPSB 3HR6A 2W1NA 3VXRE 1CR9L 5L88L 1PJ9A 3I02B 5BW7A 1CQKA 3DURB 1T04A 5B39B 4R0LB 1R3JA 1RUAH 2X70A 1LO5B 4PRDB 3PNWB 3QUYA 1J8HB 1F2XK 3UYPA 1T20B 5MEOB 2UWEE 1FVEB 3AXLB 1IAKA 3TVMD 4JPKL 2XZAH 1H0DB 1IGJB 3VXME 3ES6B 3SDXA 4NSKB 3P0YH 3KJ6H 4K94C 5B22A 2DM2A 5TF1L 4DGIH 3MRLB 2PCPA 4OLVL 4GO6B 3H3PH 3GI8L 1FC2D 2R4SH 2WINB 2Z35A 4X9IA 4L4VA 4A2LA 4WTZG 4ZPVA 4IJ3B 2PXYD 4H1LA 2IG2L 5FYJL 3DX8B 1KBGL 1BIIA 1MCLA 1OARL 2AJUL 4HJJL 2Q86A 1IAII 2DAVA 5MENA 1CWVA 2YEZB 5IBTH 1P2CB 3TN0A 4GXUN 5DUPL 1PG7W 2GTWA 1MREH 1FZJA 1CVSC 4LLYA 1KEGL 4FQ2L 1NPUA 2NTFB 1MLBA 5DK2B 3I50H 3CSGA 4OD2A 5KVFH 3HFMH 3MV01 1MY5A 3QUZA 4GS7B 3BN9D 2OJEB 3MOAH 4XBEL 3C08L 4H0IA 5IVXA 1MI5B 2NYYC 1Q0YH 3PABA 4GLRI 2YMXH 3OJVC 1FN4A 3RL2A 2D7QA 2SEBB 4ELKB 4FXGB 1G1YA 4XCYB 1A21A 3BT2H 5GRJH 2C1PA 5JDSA 1JNNH 1TZIA 1F4AA 4JFFA 1JHTB 1LP9B 1YC8A 2GSGA 4J12A 2NLJB 3O2DL 3V4VH 2MCPL 2WIIA 1YQVL 3VU2A 1EGJL 3MQIA 1PLGL 4HFWB 4Y1AE 5GSVB 4N0FB 2YOCA 4NKIL 1SBSH 3D9AH 1QNZL 3X12B 4PJEB 1I3VA 3RZCB 3WE6A 3WL9B 3C09B 4QY8A 4LP5A 1GOFA 1YECL 4HIJA 1DBJL 4KUCD 4KZEH 1KB5B 1NUNB 1T83C 5DFVD 1JWUA 1EAPB 2LQRA 5B39G 5MI0C 3SJVB 4HHAB 1M05A 4HCRL 2WLZA 3IDXH 5L0QC 3LKSB 5ICXB 3AB0B 5EU7C 2Q7YB 3VFOB 1MVFA 5FB8A 2DQHL 3HZYA 4TUOA 3TBTA 3NZ8A 2XNAA 2YS4A 5BZDB 5FIEA 4ORZC 3UZEA 3WNMA 1MF2H 4P5TC 4JFQB 4JZNA 2ZCLL 4AEHH 2N7AA 1GPOH 1JTPA 1T3FB 1K8IB 4M62L 1G9MC 3CFJA 4OQ1A 1MVUA 2NY3C 5HGDB 4F3FA 3MLSH 1WZ1L 2PNDA 4TTDD 1DQQB 1HQ4A 2YD8A 3AVEA 4PGEB 4W4NA 4Y5YA 4MSWB 1O0VA 3GO1L 1VFOA 5EBWB 3SKMA 3B6SA 4OGXH 1B2WL 5JPNA 5DDHA 1LE5A 2AV1B 4H8WL 4R4BA 1OHQA 4QT5B 2IBGA 2F58H 4MXWH 5C07B 1BJ1J 5D6CB 3FO1A 1LO4L 4CUCA 4HSQA 4AT6B 4XCNA 4J1UA 3MV8D 5CUSH 1SYVB 4Y4HD 3WNPA 4Z5RA 3TIDA 3N50A 5ACMA 2L4OA 5T33H 4KDTA 4G42A 3T77B 3MODH 4S1SL 4XP4L 3GB7A 4LAQH 1ZT1B 4F9PC 4OT1H 3U30B 5E1HB 3IFOA 5EOCH 2FO4B 5IQ9B 1OQOA 1SHMA 3IB4A 3QIWC 3ZKXC 4ZFOB 4CVXB 1Q94B 3GGWA 4KV5F 3RZWA 4DK6A 1U3HD 2CLVB 3P0VH 1EO8L 2AEWA 5JXAH 1A02N 5JXEA 2FJHA 1A14L 4J8RB 5T3ZE 2XI9A 4I4WA 4WWKD 4TSAH 1NFKA 3QJFB 3OF6D 4PJIF 1T2XA 4M7JH 3LN5A 3QUXB 4QHNB 5DMIH 2BVOB 1RSFA 3QFDA 4U0RC 5C0GB 4GRWB 4BKLA 1XZ0A 4DEPB 5SWZE 2E3VA 1D5MA 3OG6B 4MAYB 5CP3A 1D6VL 4OFIA 5FYKH 4X6DE 3FONA 1Y18B 4BJLA 4CMHB 3VGGA 4OZHE 1JYVA 5TE6L 3REWA 3BMWA 3MJ9A 3TBSA 1CD1B 1DSFH 5E70A 4KVCH 2ZOKA 3DO7B 4NHCH 3P0GB 5DTFA 3RWEB 5EBLA 4PJ7E 1LNUA 2FLBT 3L3DA 4TRPL 1XR8B 3BPOC 5E6IA 3RVXD 3WXVL 4DFIA 1KPUA 5L2JA 1IMHC 3S98A 5J1AB 2W07A 5F89A 3IAPA 2C3HA 2AW2A 4F7EA 3HRPA 1NDMB 4QRSB 1T5WA 2DQIL 4G8GD 2GI7A 3BQUD 1XIWC 4QYOA 4P23D 3O8XA 3DOSA 2VKXA 4POUB 4NQDA 1CL7I 1MHCA 1IKFH 1CS6A 3HCVB 3V52L 5A2FA 1X5GA 1OAUL 4Q9RL 1DZBA 1VFMA 2OJZH 3FAXA 1RJLA 1G6VK 1GIGH 1NBZB 2IH3A 4R96A 2P5EB 3L5IA 2EEBA 4I18A 1WC7B 4OI9A 3MV9D 3O2VL 1F45A 5FHBL 2YPVL 3EIFA 3VXNB 4J6RH 4BFEA 5LVEA 4DAGL 1NKRA 2ESVB 3V4UL 5GS0D 1BMGA 3V9FA 1FGNL 2BX5A 1W0WA 3QEUB 5LGJB 4HIHB 1XGTA 3EDDA 3QJHA 5DXWA 1HHKB 2HP4A 4KKNA 4PGCB 5KVGH 1BLNA 4NZDA 2JELL 3GSRB 5IB4A 3KYKL 5F3BB 4KROC 3LQAL 4FQXA 2F54A 3BZEB 5I2IA 1I7UB 5ADOH 2VDQL 5JPMB 5IB2B 3C6SB 4JCLA 2HFGH 1G7MA 3WIIL 4MB5A 1OTUC 5HYJE 2R0LH 1IC5H 3JWDL 1M71A 1IT9H 3OAUH 4GMTH 3L3OB 1D6EB 4PRPB 1PD6A 4Y19B 2EXWC 4Y4FB 1GOHA 3K81A 3QXUA 4ODVH 3DXAB 4LSTH 2DI8A 1MJ7L 3OKLB 5L2KE 1C5BL 4KTDL 3PL6A 4NNYB 1LO3H 3ZE2E 1XMWA 2JJTA 3CJJA 4GMSH 3DBXB 3P4MA 3DX9B 3HTLX 4LFHG 4MD4A 4PJXB 5TH2A 3LAFA 1KN2L 5DQJA 3EO1B 5C6PB 3ZL4H 3C5JA 1CXEA 1S78C 3Q2CA 5FYLE 5GGTA 4Q7DA 1TTGA 4OZIE 3TWCL 1A1MB 1DQDL 4H0GA 3L7FB 4JPVH 2HT4D 4Z78A 4GRLD 3WN5A 1CXHA 4OCSL 3DI3B 2H8PA 4P57A 3MSPA 5KJRH 7FABL 3ARFC 3X17A 4XXDB 1QBAA 5HTSA 5FXCH 2VDPL 1T22B 4WFED 4LHQB 4PY8I 1YEFL 4U0QB 2H32H 4G7YL 4JKMA 3T1FB 4JFOB 3KLHD 3AROA 3S88H 4KWUA 2AJ3B 4R4FH 3ABZA 1A6TB 4HS3B 1KPVA 4N9GA 1V7NH 2X4TA 2ZJSH 3CDCA 1TDQA 4DGYL 3FFCE 1ZV5A 3S97C 5HYQB 3D0VB 2XT1B 5GZOC 3FQRB 4NGHH 4PRIE 3ARBB 2W91A 2VRAA 4TOYH 4LK4A 3X3GH 3GSUB 4RA0C 1AO7D 3IFNL 4K7PY 2MQ0A 2AXGB 3ARUA 2XXCB 3QWRA 1BBJB 3V6ZA 3U83A 2GAZA 4U1LA 4P2OD 1D9KD 1YNKL 5DLML 3D6GA 4H20L 4RFEA 3S35X 1J8HE 2FWOA 1IM3A 1NCBH 1ZTXL 2HJFB 4U49A 1K2DB 2IMNA 3R06B 5FHAH 4JM2C 2CK2A 3E8UL 2QJDA 5GJTH 3RJDA 3LRSB 1I8KB 1I85A 3FQWA 4PY8J 1KLFA 2F5BL 1PVHA 1KFAL 4LCWB 2EDBA 5J7CC 3O41B 4IOSD 1WZLA 4QRUA 2ED8A 3EJYC 5IK3B 2WBJC 4NO0B 5C0AD 5IWLA 2HLFC 3EBAA 4XP5H 4YXLL 5I1HH 4GG6B 3DVFA 4F7MB 1ZGLM 1EV2E 2AXJA 3MBED 3GSNH 5LQBL 3U9UB 1JGVL 4M6OL 2R0ZL 3RBSA 4EUPH 1T21B 4MDJA 2AI0L 3NGBC 4HWEH 5L9DL 4D9QE 2P45B 4MJ5A 1BBDH 3IXAA 4QO1A 4L4JA 5GRWA 2VQ1B 1PFCA 3EJZC 2HAZA 5L8JB 1MI5E 1Z9MA 1FL3B 1CFSB 5IW6B 4F9LA 4JJHA 5DC0A 5AYUL 1MIML 2YN3A 4PREA 1YJDC 3C9NA 3UTSA 1UM4H 1G7QB 1UKQA 1CGVA 4CW1A 1VGKB 3VXRD 5ILTH 1UJTA 1JNLL 3G5ZB 2C3VA 1UCBL 2VISA 2EO9A 1NBVH 1S9WB 1KXQE 4P9MH 1WCQA 4PJEE 2R2HB 4X98B 4LLQB 1MCPH 2H2SD 5EPMA 4JANB 1MCBA 5AZ2L 5DGRA 4UNVA 5HDOA 1RIVH 4KDVA 5DQDH 1KC5H 3SJVE 4V1DD 3HG1A 1RUQH 2MNUA 5CGTA 3PIQB 3VWKD 5KVDH 2VDLH 3O6FD 2Z31B 5D9SB 4OI7A 3L5XH 4HS8H 4JFDA 4JFHE 3SKNB 1ACZA 4ZAKC 3G5VA 4YE4H 5E9DB 2CDFB 5IFAH 1NBYB 5I8CB 4Z7QE 5KSVB 1S7UB 3UJTL 5JORB 3L7EA 1XR9A 2HMID 3GUTA 5DHVB 2BOBB 3RWCB 4KKBD 3HE6C 3LZFL 5ETUB 1RZ8A 3DRTA 1SEQL 5HHMB 1YEIH 1YYML 2Q8BH 5ACLA 4YBLB 2N7BA 1HHGA 1OGTA 4C58B 4G43A 3TO4D 4JFXA 1KIPA 3GSWB 5BMFH 2QHLA 5C08B 3V79C 2PW1B 2UUDK 2NXZD 4HUUB 4K9EH 3KYMA 1AXTH 5IJVA 2D0FA 3EW3B 3MLWH 2VITA 4E5XB 5IHZA 5F9JB 2W9LA 5C07E 4OLYL 4UINL 3OQ3B 3B8YA 1LEIA 3QDMA 3QI9C 4A6YA 5J12B 3O2WL 2VJXA 5SV3A 1DBAL 1I1AB 3QIBD 1T5XA 1J1PH 3MRFB 4Y1AD 2VLLB 1BM3H 4X5WA 1DN0A 5FEBA 2MPAH 1MRCL 3T2PA 5HY9B 5GRZA 2BFVH 2V7HB 2YC1A 5MHSE 5IBUB 3T3MF 3U7AA 2VLKB 3DX7A 4GW5A 3N9GL 1F3DJ 3IGAA 2UVFA 1YEKL 4KHXH 2BRRL 1PYWB 2EE2A 3EGSA 3TIEA 1INEH 1J7VR 3S37L 4OJFL 3VWJB 5GHWL 3PP3H 2LTQC 1JNJA 3ULUL 3H6JA 3F5WA 3DYMA 5LKNA 5JIKA 4GRWE 1JZ3A 2FR4A 4PGDB 3VDAA 4QTIL 2XXMB 3BGMB 2HJKB 1S8DB 4TVPH 4UQ3B 2IPTH 4FQHB 1S7RB 1T83A 3NVQA 1C08B 1GZPB 1RY7B 1B0RA 2GEEA 2WW8A 2E27H 3BIBX 5EN2B 3MACL 5C0DB 3HE7D 1JGEA 2CKBH 1QA9A 1X3DA 3SQOL 1U8KB 1MCIA 2E8ZA 3T0EC 1Y6MR 5K9OA 3Q3GA 3QPXL 3TV3L 4EDWL 2YPLB 4P5TA 2P8MA 4LKCA 1HQRB 2M8XA 4WWID 3VI4F 2IFFL 2MHAA 1FVCA 4BH7B 4H5SA 5ITBL 2DL9A 4N0UA 3SDXB 2BOCA 5IUSA 4JQVC 3KWWA 2XA8L 1DUZA 1P4BH 2ITCB 2PCPB 3RRQA 5L8LB 3UPRA 2XOTA 3L3KA 2GFBA 4BQ6A 2FEEI 4BK5A 4K71C 1KACB 1ZWIB 4NKOA 5EOQL 1N7ML 4DUXA 1JN6B 1BIIB 1VGEH 3DYPA 5HHXH 3CVHB 3U0WH 2VDRL 3BSZH 2VXTL 3GHBH 4P2YA 5T1LB 2Y36H 3TC9A 5IT2L 2V2WB 5D6DC 4P46A 4YDVA 5H37G 4XNQA 1A6VL 2F9BT 4X9GA 3V6OE 2HFEA 4O2CA 4AZ8A 2C3XA 2OTUB 4HWNA 2ADGB 2FHBA 3VG9C 5IBUG 4ZD3L 2PXYC 5E95B 5INDA 3QUZB 5LG1A 1GGYA 2ESVE 1F6FB 5IVXB 4G3YH 3PABB 5SWZD 4B7IA 1FN4B 1QRND 1L7TL 5CMAB 4HWBL 1F4XL 1ES0B 4IMLA 5TE4L 5IQ7L 2C1PB 4K3GA 2IQAB 2I9LB 1TZIB 3UCRA 4K3JL 5T5NG 4U2ZA 43CAA 1NAKL 1ADQL 4NQEA 3CXHK 3PWPD 4ZXBB 1KJ2L 1R5VA 2QR0A 3BIKA 3B9VA 5BCAA 1QFWL 3BN9C 4X6FA 1A7OL 1FL5B 5T1KB 1VFBA 5J3HD 3RDTB 4QY8B 1W0VA 3N1QC 3O9WB 4HIJB 4XC1L 4APQB 3DTXA 3O0RH 4Z0XB 4AH2B 3S96A 4Z77A 3RUGA 2DM3A 5IR1A 4WHYH 4Y19E 1EEZA 1AKJD 5DA4A 4NPYB 4K8RH 1DVFB 1Z0MA 3DXAE 4ZUVB 2VE6A 1Z5LB 5FK9A 2XWJA 5C2BH 1FHGA 1I9EA 3FB8A 4R8WL 4BZYA 5CIPA 3HZYB 4TUOB 3GMOB 3NZ8B 2FL5A 4PJXE 3B83A 3RIFF 1TJGH 3K46A 4JG0L 5EIIA 3HI1A 1UZ8A 4JM2F 4TNVF 3DUSA 3CFJB 3HC4H 3ULVC 3MREA 4TSBH 4F3FB 1H8OA 2JTDA 3DPBA 3ORJA 1E6JH 1U8JA 5DFWH 1MCWW 3BH9B 3VJ6B 5D4QA 3KPOA 3QNZA 4C56A 1XIWA 1F4WL 4DKDC 3B6SB 5HBBA 2W9EL 4QEGA 2VZ1A 1JWSB 3DMMC 3SDDC 4R4BB 4I0PB 5E2JA 1ZLWK 4LEOB 4HAFA 3SO3B 3V8OA 4XH2B 5KZCB 2UYLA 1R3IL 4E41B 1CLZH 1ORSA 1CU4H 3JV6B 3WDIA 4HDIA 1C1EL 4J1UB 2GHWB 1JGUH 3BDYH 2R9HC 4UT6L 3AS1A 3WLWD 3FO9A 3GBML 1F13A 4G42B 1L4IA 4PLJD 1L7IH 3GB7B 4NKMA 1G6RB 3UJIH 1CXKA 4YAQA 3FRPA 3MO1A 5C0JA 1RPQA 4NWUL 1WIPA 5BRZB 5K93A 4EZMA 5EU6E 2D9QB 3DWTA 4ENEC 2VZVA 4QRTB 5C0CA 2XICA 2E9BA 4QHKJ 2J5LB 3CZFA 3LQZA 2ZKHH 4Y4HC 3LKOA 3QFJA 4PP2B 1VFAA 3VFMB 1U6AL 1HSAB 1KULA 4XP9H 1N0XL 4JY6A 2FJHB 5J6HB 1IAOB 4P2RB 2OZ4L 3VXPA 2CJUH 12E8H 1D5ZA 1G0YR 2E9WA 3QISA 3U4EB 3BE1L 4R26H 5ISZB 3QFDB 3QNXB 4MNGE 1R5WB 1YDPA 4N90E 4LCWE 1MQKL 4EQ2A 1U3HC 1GAFL 4NCC1 4TVSa 3TFKC 1OWRM 4Y5XC 1AR1D 1PX3A 1NGQL 2NXYD 1DTUA 1X5YA 4U7MA 2I9TB 4K7FA 5D1ZB 4GG6E 2ZOKB 5KN5B 4KHTH 2OR7A 4MYWB 5C6WH 1LNUB 1TJIH 3PHQB 5KANI 3L3DB 4IDJH 5D71L 4FA8A 1IEBA 1DEEB 1OAZL 1KENH 5EORL 4CN6A 2EXYD 3QXDA 3MMEB 4UV4L 1YA5A 5DF0A 5D7LB 4Z7UB 2IEPA 4KJWD 5ESVB 5F89B 4EIGB 5IF0B 1B3JA 4WO4C 3KXFB 2XZQL 4W4OA 4CDGC 2WV3A 5T5FL 5GGUB 5C0FB 3L9RA 4MMZC 3FFCD 4JFED 4PRID 3CFBA 4YGVB 3ARZA 1I9IH 3UO1H 1U42A 2Z8WC 4YHMH 2IANA 3VXUA 3MUZ1 3RVXC 3BWAB 2EDHA 4DUVA 3ARFA 3QG7H 5JW3H 4L8CB 1LEGB 4JG1L 5I16A 1XCQA 3INUL 2DD8H 2DLFH 2O5XL 3BVNB 5D70H 3UMTA 3V7AG 2IH3B 4R96B 4LGSB 1H15B 3H7BA 5DI8B 3BQUC 2MKLC 1T03H 2IALA 4P23C 3FB5A 5FGRA 3BZ4A 3QUMH 1J8HD 3P30H 1N8ZA 2YD1A 4XC3L 5BVJA 3H9HB 4MCZA 5IVOA 5TDPB 1RFDL 1MFEL 4ZOAA 5I9QB 2FZ3A 2PETA 1MFBL 2VSCA 2V17L 4K7PX 4YUEL 1JPFB 1RQ5A 4YHZH 5EU3A 5I1LA 1P5UA 5C09A 2Z93A 1T1YA 1HK6A 4PTUA 5E9DE 1IZKA 5ANMB 5IB4B 4XMKH 4NUGL 1M7DB 2RQ8A 1I9JH 1TCMA 4OGAD 5GS0C 3GIVA 3MOBH 3LKNB 3LB6D 4PJ9B 5FFLA 5HHME 2R1WA 4QXUH 5HGAA 4JM2A 1M71B 2LVCA 4P2QD 4Z0BL 1U8IA 2RB8A 4D9QD 1M6OB 2X1PA 4UAOB 4CN4A 5C08E 5DWUL 1S9KC 1RUAL 2F8OA 3BKMH 2DQTH 7CGTA 1LMKA 5JZ7C 5IG7B 4ETQA 3MRKB 1CFTA 1MI5D 1A3RL 1BX2A 2WBJA 3PL6B 1SY6A 4GAGH 5TGBB 4UT9L 3QHZL 2DI7A 3LHPH 1MY7A 2A6DA 4LLAA 3P4MB 1FG9C 2J7LA 1ZHLB 3P0YL 3KJ6L 1WT5C 1VEPA 4MD4B 1NCCH 1UJ3A 4NYLA 5SWQA 3UTQA 5T3XE 3H3PL 3EFDH 3RPKA 1FC1A 2R4SL 5IKCA 3DHJA 2GITA 3C5JB 1H3PH 5CJOH 3LEVH 1CGXA 4HK0B 4JKLA 4K3EL 3RZCD 3MR9B 4MX7A 5H94B 3GMRA 5BVPH 1EVTC 3FT4A 5DJYA 1QQDA 4Z78B 2AJZA 2C9AA 4BUGA 1DEDA 1JGLL 2BVYA 2H8PB 3DROA 1YEGL 4PV9A 4EDXA 1R0AH 5D96B 3ARGD 4GRMA 5DC9B 5KVFL 1OAQH 3P4OB 1G7PB 3ZT7A 4MQTB 3I3BA 5DQ9B 1DUYB 1Q0YL 4NOFA 4PJIB 3NIFE 4N9GB 2R29H 4G6AD 1J5OL 2IF7A 3DNKA 2B2XH 3IYLW 4GRLC 3P4NB 3FZUD 1TVBA 4UIMB 3FL7A 1HEZA 4RDQF 1TJHL 5F96L 4KMTH 3D3VB 4KRPB 1SBSL 2XA3A 1BQLL 1YYLH 2H41A 3KLHC 2GAZB 2LAGB 2P43B 4U1LB 2E8YA 4B7LA 4ZAKA 2J88H 4KZEL 2ADIA 4D9RE 1SYSB 5C07D 1I3UA 1IM3B 5JW4R 3HE6A 3WD5L 1UEMA 4BUHA 1O5DT 5JQHC 4HUVA 3SDXE 1AC0A 4XPFH 3S3JA 4WVRA 3MRJA 4XPTH 4DOHB 1DANT 2HN7B 3FQWB 1KPRB 5BV7H 1S7TA 4YO0B 3KYNB 1MF2L 5I30L 4L4VE 1S9YB 4L9DA 3QRGH 4BSJA 1LILA 4LCUA 3TCXA 5MEPA 2R0WH 3HAEA 4NT6B 5MENE 1PBYA 2DIJA 4NZJA 3QI9A 1ZE3C 1YN7A 1UADC 4HBCH 4ZODA 1UFUA 1YC7A 15C8H 4L9LB 1WIUA 3WFDH 4O9HH 4U6YA 5FGSA 5IGXH 1CLOL 3M1BA 4MJ5B 4MLIA 3D25A 4M8QB 3ULVF 1OGAA 4Y89A 1SEBB 1XH3B 3QUXD 1HCVA 1F3JA 5FKPA 1X9QA 5IJKC 2DLTA 1H8NA 2F58L 1NH6A 5IVXE 2W0FB 4G8EA 1GGCH 1NJ9A 4MAYD 2OS7A 3C8HA 3B4NA 1EIBA 1HH6B 1KLUB 4HEME 5HPMA 3B3IB 2OR9L 3MBEC 4JDZA 4XGZA 1A7QH 3UTSB 4JFFE 4JY5H 2BP3A 3OTTA 3MODL 5JOFA 3DVGA 2X9WA 4LAQL 5DS8A 5IHUH 3S9DB 3ARXA 3N06B 3RBGA 5ADPH 4IOIB 4OT1L 3IT8D 4EI5B 1DBKH 4GAJL 2FECI 1I8MA 1IFHL 5DJCA 5EPMB 1UYWH 3GSQB 1BZ7B 1IKNA 1FZKA 3TT1H 1JTOA 4EVNA 4JR9H 4QWWC 2DJSA 4KK6D 2G60H 1TFHA 4I13B 4S1QH 3CMOH 3DX6A 4KXZI 1UACL 3H42L 4GKSA 4TSAL 5JIIA 3ZT5A 4XBPB 1CDYA 3EZJB 4M7JL 2ZUQC 5I76B 4UNUA 5DMIL 1QBML 5FM4A 2H2SC 3VGEA 2NY0C 5JMRA 2QQKH 3CFCH 3GUTB 5FYKL 3T0EA 4V2CB 4PJHF 2RGSA 2C7UB 3BYTA 4X7CC 4PGZA 1UB5B 3VWKC 4AL8L 1DSFL 3O6FC 2P5ED 1OGTB 4KVCL 4JFXB 4JQVA 1MOEA 3KPSB 1P4IH 4UDTA 4TULL 1GOGA 5I1GH 3O3BA 4MWFA 3HI6L 1RVFH 1RZIA 1U2HA 2ESVD 3AU1A 1MH5A 2OK0L 5IJVB 3Q6GH 4KKBC 5LBSL 4MB4A 1CG9A 3KPQA 1UWXK 1RUPL 5E00A 5TE7H 2VXUH 1ZK9A 5EA0H 1DLHB 1U93A 1EXUB 5D6DA 4J3SA 4JAMB 2NY7L 1RV6X 3G9AB 2WIMA 2EDWA 4AM0B 2NXZC 2OQJA 1GC1L 1A1NA 4OFKA 4Q9QH 5A16B 3V7AE 1MHEA 1IKFL 4PRNA 2PXYA 4D0CA 5BRZE 3NABH 3OGCB 2RFXA 5IFHL 4P59L 2HRPL 2OJZL 5J1SC 1VKXA 4YBQD 1MJ8L 1G9NH 2VDML 4PRPD 5ECJE 3ZTNL 4Y4FD 2ZUSA 3MJ7B 4CVZA 4LRNH 3DXAD 3TIEB 1MFDH 3UTZA 1T0MA 4OZFA 3BP7B 4J6RL 1R24A 3BEWB 1JMZA 2FX9L 4RWHA 3GFUA 4E42A 1DQMH 2B20A 3CLEH 4YHLL 4MAUH 2FR4B 3O45B 5HHQA 5SV4A 1MWAB 3B8SA 3UTTD 5E8EA 5E2TH 5DSCB 1AGFA 3WFCH 3RNKA 1XGRA 1B0RB 3OKMB 4HKZA 3NMEA 2P44B 4BELD 5ADOL 5L0QB 4C57C 1ZGLP 2HFGL 1IC5L 1IT9L 1NANH 4ZS7H 3JBG7 4M48H 3Q3GB 1GGTA 3IDMB 3V5HB 5D7LE 4WENB 4Z7UE 2WQ8A 4KK8D 3RL1B 1S5HA 3FT3B 4N0UB 1IC4H 5GGQL 3D85B 2BOCB 4YJZL 5CLWA 3HE7C 2V2XB 3KXFE 3T0DA 3O3EB 3OAZK 4XMPH 3TBWA 4X6CF 1IQDA 3ARBD 1ZA6B 2XY2A 1NAMH 3T1WA 2YA0A 1CE6B 5IEHA 5JNYB 3RVUD 5GZND 1T7YA 4KUZH 4NJ9L 1EHLH 4N8VA 3SO5A 4Y16C 3ALXA 4YHNB 2Y07H 4MQXD 1W72H 2HFEB 4O2CB 4ODXB 4QF1B 4JPWL 4KI5C 4Z6AT 2DDQH 1MIEH 3GRWH 2AEPH 1JPGB 1X7QB 5KJRL 3VXOA 1KJ3H 2W65A 5EU4A 4PRBA 5E5RB 2QQLL 2EZ0C 1K9TA 1KCUL 1K4CA 2QQNL 4EI6A 3ZKXB 2GY5A 3QIWB 1J11A 1PW3A 4X7TA 4LCWD 2IWGA 3OXSA 4O5LH 4MA8H 3PGCB 4OKVA 4R4FL 3MV8A 1HIMH 43CAB 3L3HB 2YKLH 4NNPH 4Y4HA 4UOW0 3O6KL 4NO0D 4NQEB 1JZ4A 2ZJSL 5MEQA 3KPRD 1SMAA 4GAYA 3MBXL 2QR0B 2X4PA 4NGHL 1UWGH 1GSMA 3X3GL 4XNYH 4PJHA 1J86A 4FXLA 5LAXA 3CX5J 4Z77B 3NFNA 3OR6A 4JY4B 1CDHA 3WFEL 5IR1B 3RVWD 3FB7A 4P5KB 1U3HA 2EIZA 2O61B 2VE6B 4Y5XA 1NCBL 2HRLA 4WWKA 5F7NC 3HI5H 1CTNA 3OF6A 5GXBB 3STLB 3ETBF 2GCYA 4M6MH 1QLRB 4OLZH 5HI5D 3ILPA 4HULB 5EIIB 3HI1B 1UZ8B 1UCTA 4N0YH 3T2NL 4B0MM 3EFFA 1YNTB 4HAGA 2DLGA 3MREB 4A6YL 2IQ9L 3LS5L 5EU5B 1U8JB 4WO4A 1M7IB 3W5NA 3KPOB 2VAAB 1IAIL 3VXTA 4JM4L 1U8OB 4OF5A 4KV5E 2Z31D 4WV1A 1JWMB 2OL3A 3FN9A 1KG0A 4K2UH 3WUZA 4KKLD 4X8JA 1ORSB 3BPNC 1OB1A 5E9DD 1QR1A 1ND0B 1XGUB 4RWYL 3LN9A 4G8GA 4PJIE 3IJYA 5DHXB 3BQUA 3VFRA 5JOPE 4XCCL 4P23A 5DO2C 4G9DB 2OSLA 3MXWH 3CC5A 1PX4A 3B9DA 3MLUL 1RZFH 4KK5D 3I6GB 5HVWA 2J6EH 1P5VA 3GJFK 2PTTA 3D3VE 4L1DA 5DVMA 3AY4C 5C08D 4P9ML 1LK3L 5F71A 4ALAL 3DHMA 2I07B 4CL7A 1VDGA 1A22B 3WLWC 3LKOB 4NP4L 5I1AA 3BKJL 3QFJB 1I7RA 1VFAB 3RPIB 3MV9A 4JDTH 1RIVL 4JY6B 3T0XA 5DQDL 4DVRL 3K2UH 3TA3C 1JI2A 4FQ1H 3WNNA 1D5ZB 3LEXA 4M3KB 3ARDC 5GRYA 2NY6B 3BAEL 1YEDA 5DMKA 4YHPA 1ZHNA 1I1AD 2VDLL 4O4YH 2QSVA 5T3XD 3SY0B 3WHXA 5L6YH 1OOAA 4ZO7A 2IGFH 1QSEA 1YDPB 4U7KA 4WEBL 4NQUA 2JK5B 2B1HH 3MRNA 1F3RB 3QDHA 3PV7A 3EYSH 2P24A 2GK0B 2DQEL 4X6CA 2N56A 1T2QL 5IMMB 3SKUD 2GIYA 2Q8BL 2VLKD 1NKOA 2IJ0C 2UWEF 5KSUA 3DGGA 1IGTA 5BMFL 4PJBF 4ZYKA 4XNUL 4F58H 3QCVH 2EKSA 2YZ8A 3KLAA 2R2EB 1ZA3A 4LSQH 3VWJD 1K85A 3EOYG 1AR1C 2ARJQ 4Y4KB 5I66A 4XAWL 3HS0B 2NXYC 3NCMA 5I17A 4U7SA 4WHTB 3WKNA 1HNFA 4WI4A 4HG4K 1CFVH 1F2QA 3L9RB 4RRPG 4JVPA 5J9PA 4XCEB 5E4EC 1J12A 5F1IB 3UTSE 3QO0A 4RNRA 4NHUA 2NNAB 4OI8A 2VR5A 4KJWC 2BDNH 3H9ZA 2VL5B 4RISL 5I16B 1CE1L 2MPAL 5JR1H 1CGSH 2XWBB 2ADJB 1YN6A 2BERA 1XGPB 3H7BB 3IU3B 1HWHB 1UB6A 3FFDB 3FB5B 4D9RD 1AY1H 4WI9A 4WUUA 2AJSH 2YPLD 2APTA 2B0SH 1DBBH 5BZWA 2Q1EA 1TVDA 2B8OT 4GRLA 1CDBA 2FZ3B 4BFBD 2HVJB 3VH8B 3GMNA 3HG1E 3KNBA 4K7PL 2FBJL 2YBRA 2C3GA 5I1LB 3CUPB 4JFDE 3IDIB 1TZGH 4ODWA 3W0WB 4L5FL 4KRNA 4XWGH 1OSZB 1S7SB 1T80A 5FM5O 4G7VH 3NZHH 3LQMA 3SE3C 3G04A 2ARWA 3GIVB 2M1KA 5T1LD 1U3JA 43C9B 1KJ2B 1AE6H 2QEJA 3MZTA 4K07A 5DUMH 1QTYT 1U91A 1P7KB 2KKQA 4JM2B 1AO7A 2CKBL 1U8IB 2H26A 1RU9H 3KPSE 4P2OA 3M17A 1FJ1A 2I5YH 3QUZD 4ETQB 2ZPKH 2CH8A 1CF8H 2DQCL 1FFQA 4XTRC 4OGAC 1BX2B 1JP5A 2WBJB 2K7QA 4Y7MA 2X9YA 1A1OA 2YA2A 4U6VL 1C16A 2ZNXA 4WHCA 4YXKH 1W2KT 4H88H 4AG4L 3MLXH 4ZXBD 1E6OH 2Z91A 3SKJH 1QYGH 3LSOA 3MLPA 3IJHA 3NGBB 4XXCC 2GITB 4TUKH 2ZUYA 3T08A 2RAMA 5DK3A 5T1KD 2VN4A 1OT2A 4IIQB 3RDTD 1KELL 5C0AA 5HHXL 4WU7A 5I0ZA 5IJKA 2ICEB 32C2B 3GHBL 3O9WD 2A9MH 4HKJA 2D2OA 4MX7B 1A8JH 4M7ZC 4XX1G 5CWSA 4APQD 1YY9D 2Y36L 1KIQA 5DJYB 1B88A 1QQDB 3PUCA 3BP5A 3HNVH 3OR7B 5C0ND 4NQSB 4LSRL 1DVFD 3MBEA 4L8SC 4DVBB 4MLSA 4PV9B 1G7JA 4EDXB 3LKRA 3ISWA 1FFPA 2D4DA 3BI9X 1BFVH 3BESR 4TUJA 4UILH 1OTSC 5EUKB 1UKSA 1JFQL 2GK2A 4PJAF 4X4XB 5E2WH 4L29B 3GK8H 1QLEH 3UJJH 3HR5A 2V9QA 4JGJA 3VH8G 2EE6A 2HG5B 1J0HA 4HGWA 1HDMA 1MUJA 3DECA 3I9GH 4ORGB 1BZ9B 3DARA 4LHJB 4FQCL 3FMGH 1MAMH 3ARGC 4U1HB 5J6GB 3VXRA 3ARQA 4LNRA 1U8NA 3DLQR 2NY5L 3OV6A 3B9AA 3F6IA 1F00I 1MJUH 2Y23A 2A73B 5FA4A 5EU7E 1A6PA 1RK0B 1QFUH 4I0PD 1Y6KR 2VUOA 5H35A 4YC2C 2UWEA 3FZUC 5DC4B 2X4SA 1EO5A 1ZT7B 4FZ8L 4PJBA 4E41D 4K8RL 3HE6B 5BS0B 1WBYB 3TJHD 1QG3A 1U8MA 4N0UE 4V1DA 1WJ3A 1XF3A 4HZAA 3VWKA 5C2BL 3O6FA 3CPLA 3D69A 4CU7A 4XBGA 1RJYB 2P8LA 2EC9U 4G8IB 3DI2B 4CU8A 3MRBB 3I6LD 5BRZD 3U9PH 2CDGA 1U8HA 1VADA 2Z92B 3L3GB 4JZOB 2FH8A 2LV4A 4TSBL 3QI9B 3ARPA 4HPYH 2ATPA 1YN7B 2ORBH 4D8PA 1FG2B 3J8F7 2ICES 4F8TA 4P2RD 3M1BB 1FRGL 5KS9F 3QEHB 4LSUH 5TQ2H 1F3JB 2FATH 4E0RA 5ISZD 2RCSH 3DO3A 1NJ9B 1CLZL 1T6WA 4PB0L 1IGYA 5E56A 3CK0H 1JGUL 1INDL 5T3ZH 3GMMB 1A6WL 3FOMB 4NC2B 3ZDYF 4R6UA 4NQEE 4Y1AA 5ICZA 4QXGH 3UJIL 3QUXC 5D1ZD 3MNZA 5L88H 1UEYA 3IJSA 2J1KA 3GHEL 1FORL 5IB5A 4DEPC 1Z3GH 3MZGB 5DJCB 2LTQB 1ZKAA 3WIHA 5DEGA 5GSRA 1FZKB 4EVNB 5D7LD 4CMHC 2NW3B 5ERWA 4XP9L 4JPKH 2IH1A 2VXVH 1CICC 3HZKB 3KXFD 4OCLC 1ZVSA 5TF1H 4OLVH 4TNWF 3GI8H 2X7LB 4ODTL 1R3HA 2BMKA 5HI4D 1X5FA 3ZTJH 4G6JL 1AQKL 4LLWA 1JRHL 1YEHH 1Z9OA 3FQNA 1CGTA 2IG2H 3OAYH 1ZS8A 4J3TA 1KBGH 5KG9B 4KK6C 4LOUD 2AJUH 4HJJH 1SY6L 5FYJD 1U9KA 4NQXB 1QEWB 2N4IA 5DUPH 2Q20A 3NA4A 4G6ML 3HE7A 1KEGH 3IKKA 4N5UA 4UT7H 1TJIL 3HUJB 2PUQT 3GM8A 2HJLB 3AU1B 3BH8A 5FM8A 1KENL 1RZJL 5H2BB 3RNQB 3T3ME 2CLRB 5I1EL 5ESQA 5HYEA 4LBEA 4XBEH 2YSSA 3GSOA 4JKKA 1CG9B 2J8OA 4GBXD 3KPQB 2OI9B 3GSVA 4P3CH 3T4AA 1SM3H 3CGTA 4XRCA 4NM8L 2GKIA 4M3JA 5CD5C 2B1AL 5HGHA 3W9EB 5KVMC 1I3GL 3O2DH 4R9HA 3QUKA 4U3HA 3JV4A 2MCPH 4PJAA 1YQVH 2OQJB 1EGJH 4YDIL 1PLGH 5DJ0A 2Y5EA 3PWUA 5FO8A 4NKIH 2A6KA 4PJ9D 3VA6A 1QNZH 4D0CB 5JIPA 3L3JA 1Q9LA 1N64H 2YRPA 1UQSA 4S0SD 3UZQA 1YECH 5D70L 4DZ8B 1XF5A 4QGTA 2PW2A 4QRRB 2CMRH 4HS6A 3BX7C 3ARTA 3PDDA 4HXBL 2D03L 4MJ2A 3U6RA 3QFJE 1K3IA 4HCRH 1BWMA 4X6BA 1KIRA 2V9TA 1D5XB 4WW1A 1D3CA 5D7KE 4M43L 2HLAA 5SWZA 4YBQC 3VI4E 1QRNA 2IC2A 2OMNA 4YX2L 2XQYK 2A83A 4Y4FC 4X6DA 2ZCLH 4PP1D 1AGFB 5J13B 4JLRA 2K7PA 5DT1L 3RNKB 1AXSA 4AYFA 1V3MA 3HNSL 2X1WL 2F8VA 1XGRB 2CD0A 3JSSA 3PWPA 1WZ1H 2BHZA 1C5CH 5CBAB 5F6HI 3P9MA 3GO1H 4QXUL 3JUZA 1I8IA 3C2AL 4NO5A 4NFCA 2BSSA 1I8LC 3NOIA 4HUNB 4H8WH 3B5GA 3EYOA 3IVKA 5C92A 1GYAA 5FYLH 1LO4H 1VACB 3SGDH 3JVGC 5C3LD 3M8OH 5KS9A 2PN5A 2QADB 2VTFA 3FRUA 4PG9B 3PWLB 3M07A 1EX0A 1NANI 4S1SH 1NCCL 2QHRL 4XP4H 3TBWB 1IQDB 2CRIA 3B9KC 4XHJD 3S3SA 3DMMB 3SDDB 2IANE 4ZNCD 3VXUE 4BQ8A 3D3VD 4XX1E 4KRPD 2FH6A 4RA3A 4YHIA 5CJOL 4JKPH 1ZLWH 1N5AA 1IILE 4R7DA 3BPCB 2DBJA 5F9OL 2I60H 1EO8H 5BVPL 3ZDXF 3OSKA 5DRNA 1A14H 1E28A 2A6JB 3ARBC 3JV0A 5E7FA 3PHOB 3F7YB 1ZT4B 4X7DC 5I8OL 3RVUC 2IBBA 3X3FH 1R0AL 3P2TA 1NFIA 1K4CB 4JN2A 1JZ8A 1LP9F 1Q9WA 3AY4A 3OXSB 3WUWA 1TTUA 3W0WE 3MV8B 1Y0LA 2KQNA 1AFVH 4KRLB 1S7QB 4BZ2H 3MCLL 3RHWF 3TYFA 2D31B 2EH8H 3NFPA 4LARH 1D5BB 4PJHB 4POYA 3X14A 1P84K 3QXTA 3ARDA 3HLAA 5LAXB 5DJAA 1JNHB 2WUBL 4FP8H 3U0TB 1HXYA 3E3QC 3KPNB 4LF3A 4WDIA 4X9HA 4LDLB 5CKGA 3BD4A 3GMLB 1CDGA 2CIIA 1P7QB 2JB5H 1A3QA 2DQIH 1DDHA 3H9SB 4BQ9A 1GXEA 4WTZA 3LS4L 5F1OB 3LPGA 5SWSB 3H9YA 4XPFL 1A9BA 1HHIB 1FNHA 1CLYH 1I7ZA 2XIDA 1BD2A 3ILPB 4XVTL 2WWKT 4S1DD 3RVWC 3ESUF 4Q9RH 4QTHA 3QR2A 4P4RA 3ARSA 1MHHB 3EFFB 4KFZC 4EI5D 2VLME 3QB7C 1REIA 2YXFA 1RD6A 5J8OA 3REVA 4WO4B 3BP4B 5LWYL 3KR3L 4RX4D 3IU4L 2GJZB 3CSYA 5FHBH 5TDOB 1S9VA 3VXTB 2P7TA 1LD9A 2YPVH 3VFWB 3CDGA 1ZGLB 5HI5C 4DAGH 2Q3ZA 1A4JB 4O9HL 1DLFL 1FGNH 1QLFA 4F7TA 4NQCB 4ZUUB 3LEYL 2HTKC 2OL3B 2R69L 2VIRB 1FO0A 4X8JB 1G7LB 1OB1B 4F57L 1QR1B 1KB5H 1WWBX 4ZFGL 2JELH 2XQBL 3WJJA 3LQAH 3FFCA 4PJFF 4JFEA 3CC5B 2KH2B 1PKQB 4PRIA 4ZUTB 4JY5L 4XI5D 1YMMA 2ATKA 5FCUH 2Z31C 3WIIH 2PTTB 4YZFF 3MNWB 4O2EB 4PR5A 5IHUL 3JWDH 2WNGA 1CTOA 3KPSD 4KKLC 2VZ3A 3I02A 4MVBD 4PG2C 3DURA 4JHWL 1AP2B 4LCIL 5B39A 1QVOB 5M94B 5FDYA 5I1AB 1LO5A 4FABL 3QEGL 4PRDA 3PNWA 4YHYC 2JB6A 1J8HA 3WMSA 1NCDL 5C7XL 3ZKSD 4JR9L 4KTDH 4OF0A 5MEOA 1FYHB 2G60L 4GRWF 4LSDA 1FVEA 3AXLA 1CCZA 4UV7H 5DMKB 1ZHNB 1H0DA 1IGJA 4NSKA 3MLZL 4ESKA 3MRLA 2ERJC 1QSEB 1KN2H 3EZ8A 2WINA 3MRNB 5HGBB 1WAAF 1X4ZA 5ESAB 3DX8A 3QQ3A 3MUGB 1ORQB 5F7DB 5J12C 3OJ2C 4X6CB 4XPAL 1LE9A 5IESH 2CIKA 4LPVA 1VERA 4XHQA 3PGDB 1I1AC 1P2CA 4HEPG 2Z9TA 1MCHA 1DQDH 9CGTA 1IGTB 4JPIA 4P2QA 4OCSH 4HKXA 4DUWA 7FABH 5DK2A 5JTWA 2XFXB 2VDPH 2DQUL 2E7BA 1OGAE 4PGBA 5E2UH 1S5IH 5I66B 1V3LA 3Q6GL 1YEEH 2OJEA 4G7YH 4CNIA 2X89D 5M7QA 1BFOA 4FXGA 4Z76A 1DP0A 3ZE0F 5J9PB 5DJ8B 5EA0L 4DGYH 1DL7L 1BVKB 2W0LA 1JHTA 1LP9A 4RNRB 3C60C 2Q8AH 2NLJA 3PP3K 4HFWA 3VWJC 4Q9QL 2XY1A 4N0FA 3QA3B 2D0HA 1UXWB 3U4BL 3X12A 1VPOH 1EK3A 2W59A 3WL9A 1YNKH 3AC0A 1YZZA 4H20H 1G9NL 4WUUB 1EAPA 4PJ8B 1HXMB 5JHLL 3D2UB 5J57B 1JGDB 3N85H 1MFDL 3D85D 1ZANL 3GMNB 3E8UH 2FNBA 3LKSA 1UH2A 2YBRB 3ARGA 3MRMB 2F5BH 3QEQB 2Q7YA 1KFAH 3O6MH 5C9KA 2EDLA 3W5MA 4LPTA 5BZDA 4ODHL 1CQYA 1WBXB 2H32B 3E6FB 4ZTOL 4JFQA 4C83B 4KRMB 3T0EE 5E2TL 1A7NH 3SE4C 1T3FA 4YXLH 1K8IA 2D7PA 5HGDA 2G5BB 3QG6B 1DQQA 1AO7B 4LVEA 3TT3L 5LQBH 3QZWB 1JGVH 4M6OH 2R0ZH 2AI0H 2VH5H 4MSWA 2HA1A 5L9DH 5EBWA 3HZMA 5A2KH 3QP3A 3M17B 2AV1A 4ZS7L 4KGJA 3VFNA 4LDEB 5C9JA 4QT5A 4R90L 1KT2B 3VD5A 1BOYA 5D6CA 5I0DA 4PJXF 2R8SH 3QIWD 5DVOA 2GSIA 2OMBA 4O58L 5AYUH 1MIMH 4RIRA 4OB5L 1ITBB 2KZ1B 4E9LA 1BGXL 5JW4M 3T77A 2V2TB 3IJHB 2VR4A 5DGQA 1JNLH 2NMSA 1ZT1A 1X4XA 3MUJA 3L95B 3RWHB 5D5MF 4PJFA 3KGRA 4PJGB 4WU7B 2FO4A 4KUZL 5IQ9A 5CWSB 3MYJA 1OSPL 5AZ2H 4QOKA 4PJDB 4ZFOA 1KLGA 1KUMA 3UBXB 4CVXA 2LABA 3KLDA 2UVEA 3VFPB 1W72L 4QRRE 2CLVA 2XRAL 4ZXBC 1MIEL 1LWRA 3BKYL 3LKRB 2AEPL 3GSNB 2MQCA 4QGYA 3QJFA 4EUPB 1E4XH 2MWCA 4OIIH 2DF3A 3QUXA 3RDTC 4BM7A 4QHNA 1BZQK 2BVOA 1HSBA 4Q9BA 4APQC 3U7WL 3D48R 2AEIT 4GUPB 1NCAH 4MAYA 3UJTH 1PKOA 1HDMB 2NZIA 5C0NC 1AJ7L 1CGYA 2MTPA 5CAYB 1Y18A 1MCRA 3LZFH 1HIML 4NNPL 5CP7A 5DURB 1GCFA 1MCDA 1KV3A 3IDYB 1WTGT 3RI5K 4O00A 3MLVL 1YYMH 1CD1A 5B4MC 2OLDA 4HC1H 1JYNA 1UWGL 1MQ8A 1WAAA 5GS2H 4XNXL 1WTLA 5FF6A 4AQOA 3RWEA 3TH2T 1KB9K 2Y9RT 2NY0B 2BSTA 1XR8A 1A9EA 2D7NA 4OLYH 4UINH 5J1AA 4PJBB 5JQ6L 2XV6B 2CPCA 1NDMA 2CKNA 1YPZB 1DBAH 1XF3B 2EYRB 2AXFB 4X7SL 3ULVE 4ZOEA 1CYGA 4XBGB 4M6ML 4G80B 4X6EA 1A3LL 3WJLC 1PG7H 4OIAA 3FCTB 4O51B 3ILQC 1MRCH 1U8HB 3HCVA 3TJHC 2HKFL 4GSDH 4W6YB 1UWXH 2P5EA 3QFJD 1WC7A 4D8PB 3N9GH 3OKNB 1H3UA 2BRRH 1P9MC 2CRMA 4NQTA 4N1EA 1JUFB 3S37H 2NXZB 4OJFH 3VXNA 1DN2A 2ESVA 2NY6D 1DQLL 5CLTA 2DB8A 4KTYA 1BFTA 4HZLB 3VCLB 5LGJA 4FFWD 4HIHA 3GMQB 4X83A 2WM0A 4FRWA 4KAQL 3TLRA 3MCG1 4S10A 3WKMH 4QTIH 5IW1B 2J12B 4BK4A 1HHKA 1RIUH 2Y5TA 1IGYB 4EUPG 5ALCH 3RIFK 1JHLL 2E7HA 3GSRA 3MV8E 5F3BA 1ONQB 1WSST 4W70A 4XCFL 4YBHA 4LIQL 4AQ1B 2FLRT 3MACH 4CN1A 5JPMA 1QR4A 1RZFL 5IB2A 3QO1B 5IB5B 1FYTA 3BDBA 4S2SB 2PYEB 2DN7A 3OKDB 3SQOH 4PJHE 3D39D 5IOPB 4NZRL 5DEGB 3SGEI 3VXQB 3L3OA 1D6EA 3QPXH 4EDWH 4PRPA 2JKXA 2XZCL 4Y4FA 4QXTB 4NC1C 4Y4KD 1KYOJ 1TTFA 2IFFH 3DXAA 5I71C 4OQTA 5ITBH 4UTBL 3OKLA 5D1ZC 4YR6B 4OLEA 2BNUB 1H3TA 1ZVSB 2XA8H 3H9SE 4OZ4B 3DX9A 4I3RL 2BMKB 5L6YL 5SWSE 4PJXA 1VEMA 3IFPA 5A2IH 5EOQH 1I8LA 3EO1A 3MX0A 4Q6IC 1U8QA 1ZS8B 3UTTA 1SVCP 2BXZA 4GXVH 4RCAA 2CRZA 3DUHA 3C8KB 5IT2H 3JVGA 3QRFM 1A6VH 1NUFA 5LJYH 4L3CA 3AM8A 3P9LB 3UAJC 4G5ZL 2Q6WB 5I6XC 1A1MA 3KS0H 2F8XC 1LDPH 4ZD3H 3BH8B 2EDXA 5GZOD 4LLVB 3B9KA 1OCWH 4XXDA 4LSQL 3WFHB 4NQCE 4CVUA 1L7TH 1F4XH 3GSVB 1H8SA 5TE4H 1WCBB 4MNHB 2X09A 4Y16B 3T1FA 4JFOA 5IQ7H 1PZUB 3W0WD 3L5HA 4K3JH 2AJ3A 2NY4B 1NMBH 4HS3A 3S36X 5HYQA 2A6KB 1PKQE 3FQRA 3ARBA 1C12B 4Y8DC 3L3JB 4UZGA 4R3SB 3W9DB 3GSUA 4DTGH 4GBXC 4CKVX 3NN8B 3RWJB 1CGSL 1MHPL 2XTJB 1GH7A 5CINL 4HS6B 1P6AB 2VZUA 5T5NF 3MV9E 2AJSL 5B3NA 4FQQB 1DBBL 2DKUA 4PJ9C 1K2DA 4YNYB 3R06A 4GT7A 2XKUA 1IBGL 4R4ND 4R8WH 3EDEA 1S7WB 2IPUG 1I8KA 3CXDL 5CEZE 1TZGL 1QSEE 4LCWA 4UU9A 3BN3B 4JG0H 3O41A 1MELA 2ZG3A 1JPSH 3VD9A 5KAQF 4XWGL 1AGDB 3H2WA 3N0PB 5IK3A 4NO0A 1WIOA 4G7VL 3NZHL 2OXGA 3EJZD 3KPRA 2AQ3A 1BF8A 2MOVA 4GG6A 4X6CE 4F7MA 1SMOA 3U82B 3X13A 3P9MB 1AE6L 1A5FL 2J4WL 5DUML 1I8IB 1F4WH 2A6IB 4LMQI 4NO5B 2BSSB 1RU9L 1B0GB 1T21A 1FZOB 3IVKB 5FDWB 2ID5A 3PWVB 2H1PH 4Q97A 5B21A 6CGTA 5INCB 4JRYA 5KS9B 2VQ1A 1WF5A 1FL3A 1WWAX 2AJYL 2E5EA 2GT9B 1IC1A 3FRUB 4UT6H 1IGIH 5IW6A 3RTQB 4LCYA 3MROB 3GBMH 4KC3B 3ZDZE 1P69B 1QSZA 3CDYA 1LK2B 3MLXL 1E6OL 3SKJL 1G7QA 5D96C 3SGDI 5C0BB 1NMCB 3G5ZA 2K1MA 1GGBH 5HJ3A 5A2JH 2AK4B 1WUNT 1PSKL 3MNVB 3RGHA 2R2HA 4X98A 3JV5A 3BPNB 3MGAA 3MJGX 2A9ML 4JANA 4HWUA 5C2UB 3WSQL 4FFYL 3ZKQD 4LLMA 2MSPA 5DRNB 5JDJA 4WUUE 4G6FB 3S6CA 2OZ4H 5AAWA 2UZXB 3EYQC 4RAUA 5BS0D 5FOBB 3BE1H 2GW5A 4KRPC 4RBPH 4EBQL 3LDBC 1NFIB 5E0QA 2Z31A 5D9SA