3B9VA

Crystal structure of an autonomous vh domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIGWVRRAPGKGEEWVASIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWGGDGFYAMDYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Analysis of the Factors Contributing to the Stability and Solubility of Autonomous Human VH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords heavy chain variable domain
total genus 28
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b9vA00
5ICXB 2Q87A 4OGXH 3OZ9L 3DXAB 5JOPD 3MRQB 3VFVB 12E8L 2J4WH 4XCYB 3UEZA 4APQA 3QIUA 5FIEA 1A6TB 3V6FB 3SKOB 1DDHB 3MOAL 5FO7A 3ARUA 4R4BB 4X6DB 3G6AB 1FO0B 1F3JB 4KK9C 2I25N 2XOTA 3PGDB 2IAMC 5IIEB 4KTEL 4KDTC 3JXAA 5J1AB 3BZ4B 5I8CB 1T1WB 4YHYB 3OPZL 4WWKC 2DTMH 3M07A 3UTPD 2ZG2A 3E8UL 1IE5A 3CU7A 4P2OA 4U3CA 3I84A 3TPKA 4TUKH 4GRWH 1L6ZA 5CZXC 5I75C 1HHGB 3IDYB 1ZHNB 3REVB 2P5EB 1YEKH 1EHLL 4WW2F 2R2HB 1JGVH 5FV1L 5SWSE 4F7EB 3WXWL 4LLUA 4HKZB 5BVPH 2CDEB 3S96A 1A6AB 2XRAH 1MCWW 2H1PL 4XVJH 4P46C 2RFXB 3HNVL 3TO2B 3VFOA 1K8IB 2FYYB 3HNSL 5SWQA 1HDMB 2W60A 2LAGB 1WITA 1LD9B 3HG1E 5DUMH 3FKUS 4UV4L 3GBNL 4D8PB 4Z77B 4HXAL 1YNLL 2P24B 4RGNE 1BPVA 1IQDB 2CMRL 5DSCB 2FJGA 3V6ZB 5T1KB 1N6VA 3ARGA 4YDIH 3QIWD 4D0CB 3O0RH 3GSVA 1CG9A 4HC1H 1U8OA 1ITBB 5C6PB 4PJBA 1JPSH 3BZ4A 3PWUA 1G0DA 3EFDL 5GSVB 1YEJH 4U1KA 4KKAD 3GSNH 4HIIB 4AEHL 2HJLB 3PWVB 5JXAH 5TF1H 2IGFL 1K5NA 4G7YH 2D2OA 4KKLD 3V6FA 5I16A 4XCCL 2V17L 3ULUF 2IAMA 3WS6A 3MRQA 3NIFF 3VFVA 2YS4A 3DXAA 1SYVB 4RFOH 3U7WL 4RQQB 2QQKL 3AS2A 1QLRB 9CGTA 3LD8C 5MEPA 2EICA 3MV7A 1TMCB 2PW1B 3BGFB 2DWEB 3OKMB 4DGYL 1ZT7A 4HBCH 2IPUG 4P3CL 2FEDD 4Z18A 2OS7A 2YD8A 1QR1A 1AO7E 4OGXL 4OAWA 5FM8A 1YN6B 1SYSA 3ULSB 1A5FL 3MA7B 3KXFE 3KPMA 2FJFB 4NSKB 3IU4H 4IHOA 4YE4L 4P3DB 2G2RB 5LQBL 1RZJH 1NLBH 1AD0A 2DYPB 3P77B 3REVA 5DMKA 3RAJL 5KW9L 5C0ND 3EYOA 4QRRA 1BZ7B 3RA7H 4NHCL 5A40E 3IF1A 3QFJD 1T1WA 3MXWL 3ECBA 4WUUB 4OLVH 4GRLC 2ZUWA 4G6FD 2V7HB 4JG0H 3EOBB 2ICEB 1QRND 2D4FA 4Z7UB 4HUVA 4YBLB 3RIAK 5LG1A 3FQUB 1PJ9A 5HHXL 3MLUL 4NM8H 5EBLB 3BXNB 3L95B 4QRPB 4ODWA 4PG9B 4AEIH 1C7SA 3PHQB 4QLRA 1G7PB 1DLFL 2DYPA 4JY4A 5DK2B 5SWZE 1UM5L 1IL1A 4RCAA 3CXDL 1EEYB 2FLRT 2ZJSH 3VD5A 5FM5O 1G6RB 4J3OC 5D6DA 3STLB 2C4FU 3H3BC 4CNIA 1H5BA 2PXYA 3MRIA 1HHIA 1HWGB 5JQ6L 3NMEA 3BGAA 3HC0B 4ODHH 1DE4B 2A83A 4P2QE 1TQBB 2R56H 1Q9LA 2F8OA 2EYSB 5JDSA 1V3KA 2W9EH 3RIAF 4KJQD 3DSNA 4MWFA 3IFOA 4O9HH 1U8IA 3KPLA 5D5ME 2W0LA 3WXWH 3TA3D 1U2CA 4GW4B 2OJEA 4J1UB 2GITB 2CLVB 3MV8B 4N0UE 1JI1A 4LRNH 7FABH 4KHXH 5JOFB 3U9UB 4QXTB 1MNUH 2ZCKH 3TBVA 4M3JA 3T4YA 3H3PL 1CIUA 1F4XL 3LEXB 2XQYG 4Y2DC 5CMAB 4DAGH 3L1OH 4HV8B 3SDAC 4XCNA 4PGDA 4HQQH 4HMDA 5I66B 4FQXC 3OKOB 2X4RA 1TETL 1DLHB 1JYXA 3MGOA 4KHXL 4GBXA 3HN3A 4NWTL 5FECA 1MI5B 2W92A 1DBKH 3BEWA 4KI5F 4KY1H 1NPUA 1ORQA 4J3SA 2DI9A 2Y5TB 2NPLX 2NY3C 4JFFD 1G9NL 4O2EB 3P4NB 1PQZB 1CXLA 2DRUA 3GDBA 4NQUA 4ONHA 4O5LH 4ODSL 4MSWA 2GFBA 1GHFH 4LVHB 2B1AL 1ZHKB 3PNWA 1UADC 3LB6D 3ULVL 3QRFM 1RJZB 1IGYB 2UZIL 4P9MH 3OG4B 3GI8L 1J18A 3AM8C 4OLYL 1OTUC 3L3GA 1DBJL 3QO1A 4JFFB 4I0CC 1U3HA 4YLQT 2L7UA 4ZDHB 1EGJL 3B5TA 4N5EC 4K3DL 4WUKL 2FX8L 2YZ1A 4MJIA 4QRUA 2IH3A 3MRFA 1C08A 1A6WL 1KCSL 3ARFC 2R0LH 4PJBF 4KHTH 1BM3L 2UWEF 1BHGA 4QTIL 4Y16D 4L9LB 4EIGB 1T66D 5I19H 1GYAA 1TJHL 3DI2B 3SOBH 1RVFH 5IUSA 3BJLA 1FVCB 3MLUH 3CIQA 4JCMA 5E8NB 5DC9B 3KPRE 2J88H 4KDVA 1RUQH 1BVKA 1KYOJ 3TBTA 4MLSA 5KG9B 1FFRA 4JREB 4C83A 1DN0A 4GS7B 5K9QI 2JIXB 4LLWA 2IH3B 1CDYA 3BKJH 1OGAB 5HYJE 5KSAA 1VGEH 4K2UH 1SJVA 1YY9D 3G04B 3OXSB 1RULL 4XCFH 2K1MA 3PE9A 4OFDA 4KJPD 3CZFA 3MRRB 1M1SA 3MGOB 3ZKMC 4I0PD 4KVCL 4JPVH 2D9CA 1EO7A 3FB6B 3LEVL 1EAJA 5D2LF 4QF1A 1RZ8B 2FD6L 2YN5A 2NW3B 4R4FL 3LEXA 3V7AE 4M6NL 4JR9L 4XP5H 3I6KB 4TSAL 1OY3B 3IXTB 4KK5C 1T7WA 3AM8A 4PRHD 1QLFA 4OZFB 5A1AA 2CUMA 3WL9A 5F70A 4NKMB 4LHUG 1UQSB 1HQ4A 3T2OA 1JWSB 1DVFA 1KN2H 1KTLA 2Z31B 5D93B 2KQMA 1IM3A 5M7QA 4ELKA 1YEJL 4Z8FL 5CMAA 1YC7A 4UBDD 1PSKL 3D3VE 3IRZA 4FFWC 1S5IL 4GXVL 3H9HB 2NW2B 3DX8A 3OAZH 4X9BA 1NKOA 1EAPA 2ATPB 1YNTA 1UH4A 2HKHL 2RFXA 1UGNA 1DSFL 1YEHH 3C6LA 2BY1A 1FNAA 3HG1D 4WDIB 4E9LA 1OAZL 1YY9C 5GS0D 5A2JH 4EI5D 3DMMD 1UH2A 2NZ9D 5D2LE 3DMMC 2Q86A 1FE8L 1RZ7H 1V7NH 1NH6A 5EU7C 2XZCH 4OD2B 2BSTA 2VDOH 4ZXBC 5F3BB 3FO0L 3OXRB 3AY4A 4Z7WE 3PL6A 2QQNL 4NQSA 1YY8B 5F3HB 5JHDD 3HR5B 4GAJL 4YNYA 4O4YH 5J6HA 4YQXH 4DCQB 4K3JL 3W81A 3PXJA 3VGFA 2YD7A 3EO0B 1L0QA 4E42B 5DJ8B 1TVBB 4WI6A 2IFGA 4PJ9D 2A83B 4WTZA 2DLFH 3F58H 4Q2ZB 4GJTB 1A4KB 1AC0A 3LN4B 4JFQB 3QPXH 2V5TA 5HDLA 3VFSA 1E28B 5DWUH 4WHDA 1QLFB 4OZFA 4DQOL 4YXHL 3CFCH 2CRMA 3BZEA 4M7JL 5F7DA 3S88L 3GJEB 3NIGE 3WBDA 1C12A 2RJMA 2XQYK 3NGBB 2R2EA 2Q8BL 3V9FA 2AJ3B 2Z9TA 1QFPA 3RDTA 2VMFA 2B4CH 4JY4B 3DO7B 3P4LA 3JV6B 2OTUA 1IKNA 1PW3A 4ZUSB 2M1KA 3OR6B 2G2RA 4HKJB 5DUBB 2AEQH 2DQDL 3DURA 2X89D 4ORGB 3KNBB 5DMGD 3LKOA 3O4OB 3WXVH 2FLBT 5J89A 3V2AR 5GXBB 2H8PA 3GGWA 3EJYC 2IMMA 4Q58C 3VRIB 4ETYA 2B7DT 2I24N 4X4YB 1I1RA 4AM0B 3MBEB 2DOCA 2ESVD 4TUJB 4XT1C 3IFNH 4XBGA 3SHSA 3WFBH 1G7PA 3MACH 1OGTA 3WD5L 2XWTA 4HFUL 2EZ0D 4POZC 1PEWA 1BF8A 5IHZA 2J8UB 3KS0J 4KI1A 4TPRL 5CSZB 4QRPD 1ZLVK 4HWZB 4HIJA 2GJ6B 3Q2CA 3HTLX 4OIIL 4PJXA 5E5UB 4ODSH 4Z7VA 1WWAX 1NC4B 1QR1B 5DRNA 4KAQL 1AGEB 2FNBA 4D9RD 5KANI 4G3YL 5KZCB 4LQFL 4XP4L 1ZLUH 4G6FB 4JDVA 2CLZB 1ZVSA 1TCRB 3NCJL 4NNPH 4UTBH 1B4JL 3OR7B 4X9IA 1OAQH 5CJBA 5ESVA 3FN0H 3RNQA 2DQHL 1P2CA 2AJXL 4R7DB 1NSNH 4P2QD 4Y19A 5HYQB 1ZAGA 4OLWL 1LO0H 3GMPA 5EO0B 5AZEH 3KYOB 3TPUA 3PV7A 4LDLB 1IGIH 3C60D 2V7NB 5J1AA 5DHVH 3N85H 5L9DH 5SV3A 3VJ6A 4LF3A 3QI9D 4XPAL 4MXWL 1YPZA 5IMOA 1K4DB 3UTQB 4NNXB 3TGXA 4MS8D 4P4KC 1YMMB 4RMRA 2MCPH 5E95B 2ZSWA 2WIIB 4P5MA 1RJLA 1WWWX 4R2GB 3VXQB 1VFAA 4RGOH 1HHKA 3O3EA 4PJEE 1V7MH 2HJKA 2J8UE 3QUKB 5GJTH 1GGBL 1TTGA 1TZIA 3KPRA 3TZVA 43C9A 2A74A 5CBAA 3JV4A 5F1NB 4YHML 1XF3B 2GJ6D 4KKLC 5AAMA 5J06A 4R4NC 4BH8A 1WF5A 4QRQB 2B39A 2EYTA 1I8IB 1ZTXH 2CUIA 2I9TA 3VFRB 5I15L 4S1RH 1Q9KB 2WUCL 3PGFH 1SVZA 1VHPA 1GAFH 4P2OD 1J8HB 2EC9U 5T33H 4MNGE 4GQ9L 2VZ1A 4JG1L 3GHBH 4ONHB 3VFGH 4Q0XH 4Y5YA 5HHOE 1KIRB 1AC6A 1F90L 2ZUQC 4KV5F 4U1IB 5I18L 5GS2D 2F54A 4DUVA 1Q1JH 3MUY1 4ZSOA 5HDQH 5EBWA 3DI3B 2WBJD 3ILPB 1GRWA 3OR7A 4OFVA 1A6AA 4YFDB 5FFLA 3T0XA 2J12B 4ZOAA 3UDWA 4XH2B 5HPMB 4GRLD 1R24A 1VCAA 1J0ZA 4OFYA 4TOYH 5T1MA 4ONGL 5D5MF 3QQ4B 1OARH 1PVHA 1I1AA 2IQAB 3L3IB 5C0EB 3IETA 1GZQB 2E27H 4RA0C 5C0JA 3DLQR 2HT4C 5CJQH 1G1CA 1PBYA 5C0CD 2ADJA 3RX7A 1S7WB 1A4JA 2GY7B 3IDMA 1JYNA 4NQCB 4YDJB 1CDGA 4OF6A 2EDEA 3MRLA 4OCLC 1TLKA 4XPGL 1VFMA 2NXYB 3S5LA 2BHZA 2BP3A 2GTZB 1MCWM 1YEDB 1BZ7A 1BX2B 2VH5L 4FQ2H 5E24E 2RBLA 4OIIH 2BK8A 3QRGH 4OF8A 32C2A 4HKXA 4JO3L 4Z7UF 2FECL 4LKCA 2FJFA 1B90A 3GHEH 2UY7A 4I18B 1ZA3B 2XIDA 4JFOB 3U2SA 4RFOL 1JMZA 3MLWH 3WUWA 3P4OA 3PDOB 2DQEH 5ALCH 2J5LC 3HUJB 4K3JH 4X6BA 5I73B 2F54D 5GIRB 3S36H 4GAJH 3VD4A 3MLRL 1IAOB 4HIXH 5KSBB 2ZUTA 3SKMA 2DWEA 5BXFB 1KCSH 1DTUA 3QIWA 5DEFB 1T4KB 4F2MB 4F7PB 5CLTA 3L5HA 3UJTL 4PJHE 2DBLH 2JJUA 1NCBH 4ZYKB 4U1LA 4AJ0A 2GAZB 1JHTB 3HE6D 5EH1A 3CMOL 3SDDC 1I7UB 5I1GL 5E6YA 2P8MB 1FJ1A 2XZAH 3AMLA 4I4WB 4WENB 4MA1C 4OV6F 1N64H 1G7MB 1NGPL 1UYWH 2QSQA 1DL7L 3V52L 3X13A 3SY0A 5D1XA 1JYWA 3NFSL 4MXVE 5GSVA 2PUQT 3D1MC 1QVOA 2XICA 1U42A 2VSDA 5T3ZE 3ARVA 4LPUA 3MV01 4TSBH 3MPCA 2NXZC 2NXYD 5F7EH 4YR6B 4Z7UE 3TWCH 4XVTH 3ZL4L 2XYCA 2CIKA 1A6VH 3GMRA 3LIZL 1KB9K 3VFMB 1FVDB 4NBZB 3FB7A 4NZJA 1XCQB 1GXEA 3OKDB 5TDNB 3RI5K 5L2JB 3O6KH 4QGYA 4XC1L 3ARFA 4F8QA 2HA1A 2QHLA 5FYLE 1QFWI 2JE8A 1AFVL 4ZO8A 4IDJL 3WKML 1XF2A 5T5FH 5JW4N 1XCTA 3LIZH 4U31A 3NOIA 4MA3A 3SGKA 1IAIH 3F5WA 1G7QB 3TP4A 5IB2A 1NUFA 4BQ9A 3KPTA 4R2GC 3QXWA 4B50A 2W0PA 5KAQF 1KXVC 4LGRB 4N5UA 5KVDH 4Q6YA 2Q1EA 1JRHI 2GAZA 3O4LB 4PV8B 3S34L 2BVPA 1CGWA 2APBA 1T1YA 3GSXB 3S36X 3QNYB 2BCKB 3P9LA 5T1KA 3SN6N 1BIHA 1QEWA 1T89A 1AJ7H 2F19H 5DD0H 5FGCB 2AXGA 3ZE0F 1MAMH 2W1NA 2DQGL 5E6ID 1LD9A 3MQIA 1ONQB 5F7FA 4EDWL 2E3VA 4UT7H 4LVOB 1BAFH 3SCMA 4L8SA 3VWJD 3TVMA 4PRAB 3ZYJA 5I30L 1NCWL 5IK3A 1D5ZA 1JGEB 4U3XA 1UZ6F 1DUZB 1IC4H 4X6CB 5ID1B 4G8EA 2Z92A 4FQJL 4HKXB 2R2HA 2WP3O 3DIFB 4G8GA 1W0VB 2YPVL 5D1QB 3QNYA 3GMMA 4CN1A 4R26L 3KPNA 4HK3J 1F6AB 4MHHI 2GCYA 3S37X 5JOPE 5IBTL 1OAKL 1X5IA 4ZFOL 3TNNA 4XNZC 1NCNA 5I1KH 2P5EE 1RUPH 5CWSA 4NKIH 5D1ZB 4UB0L 1DQMH 1RURH 5SX5K 1YQ2A 4Z7WA 5D70L 1Y6KR 3BO8B 1UM6L 4R2GD 2EH7H 3MRDA 5C07B 4XNXL 5FYJL 2V5YA 5DRXA 2WLYA 3HMXL 3BWAB 1D3CA 3D9AH 4KUCF 4N1CA 3KGRA 2CDGA 1T20A 4B5EA 4G5ZH 5SWSD 4JFFA 5GGVY 4EBQH 2Z8VC 3AXLB 4F7MB 1LEIB 1CZ8L 1MVUA 5E6IA 4FZEL 3LH2H 3RUGB 3L5WA 3KYOA 3K3QA 4CN4A 5HYSA 4MJ5B 4ZXBA 1TNNA 3HKFA 3DRTB 4JRXD 1RZFL 1WC7A 2H26B 2WBWB 3A6CH 3V79C 2VZVA 3MA9H 1NJ9B 1IBGH 1UWXK 3AFLA 3D87B 1EK3A 4ODBD 1FLRH 3GMOA 2OL3H 3BT2L 2JJTC 3EO1B 3OF6A 1FZKA 3N0PB 4OLUH 1JWMB 5DS8A 4WFFD 1M7IA 4L8SB 1BQHG 4QT5B 5C0CB 2DB8A 1AKJB 4URTB 1FC2D 3TT1H 1Z3GH 3O2WH 4M5YH 1KJ2B 4Y16A 4LSSL 5FF6B 1HHKB 3SDDB 1A9EA 2APVA 3TBWA 2CIIA 2HFEB 4OCYH 2BMKA 1UZ8B 4HDIB 1S7TB 4ZUTB 2GHWB 4PJ5B 5GGSA 1AGDA 3IKCA 3HZVB 1P1ZA 2YSSB 4GW4A 2MQCA 3V5KB 5KSAD 3I50H 5C0AB 3QUXA 3S7GA 3UZEA 3EHBD 1BIIA 4ZUVA 4X7EC 4NM8L 4LFHD 4IS6B 3IFPA 1PG7L 4PJ7F 4NOFA 3IT8D 4XBEL 4WJ5A 2IBZX 4FQXB 5JO5B 2CKBA 2VXVH 2ZKHH 5IG7A 1NC2A 2ATKB 1IGTB 2H41A 3OG6B 3VXRE 4O2FB 5FHAH 5GGUA 3R06B 2LQRA 4FFZL 5LGJA 2EKJA 3WNNA 3STLA 1MVUB 4H88H 1MFBH 4M62H 3OF6D 1CLOL 3FT4A 4MX7B 3C08L 4PUBH 1MCKA 4F37K 4OD3H 3GEWB 1CFVL 4N9OB 3BZEB 2FZ3A 4NUGL 2YRZA 2VITB 5LWYH 3QQ4A 3RHWF 3OQ3B 1A7RL 1FNGB 2HT3C 3CJJA 5FOBA 3TC9A 2E8YA 1I1YA 4LASH 4HUVB 2DJUA 4JAMA 3FOMB 2FHBA 1AI1H 2ORBH 1KGCD 3SE3A 1DUYA 4NRXA 3P0YH 3HC3L 4ZO9A 3I6GA 4D0DA 2W0FA 2VXQL 2B0SH 1MRFL 1IAII 3QEHB 2F5AL 1T80A 1SEQL 2J8UF 3H9ZA 5FUOH 4WI3A 3QJHA 4X98A 4MA8H 4NQSB 4MJID 4ZQKB 5DYOA 5CJXA 4PJEA 4TVSa 1MRDH 1GZQA 4XB8A 3D39D 5C92A 5A2IH 4ZUSA 3W9EB 1MUJA 2OTUB 2V2TA 3PQYB 2FHCA 1FYTE 1Q9OB 1L7TL 4LHJB 1JPGB 4FXGB 4PYGA 1GCFA 1GGIH 3X3FL 3K7UA 5D2NA 5I1JL 5KSBA 3QAZB 4F33B 3C6LB 1NMAH 2CUHA 43CAB 4FABL 5FK9A 2R2EB 2X7LA 3MREA 3U7AA 2G5RA 4OLVL 1S7UA 2AJVH 5E2VH 4Z95H 5KVEL 2RCSH 3WIIH 5JZ7D 5D6DC 1YYLL 4IJ3C 1BIIB 4ZUVB 1CF8L 1EUTA 4DW2L 5MENE 4U6VL 5IF0B 1GHFL 4MS8C 4LEXL 1P1ZB 2YSSA 3W11C 5D7JA 2PNDA 5HVFB 2ED8A 3CC5A 3JTTB 3OAUL 1WAAF 1U8OB 2VLRE 4XMPH 4DCQA 5BVPL 3PWVA 2OL3L 1DANT 1UWEL 3BT2H 4EEEA 1XGPB 4MAYC 1Q72H 5TF0A 3FAWA 1BZ9A 2HKFH 1W8NA 5E1HB 1XGRB 3TPUB 1QFWM 1R6VA 4XPAH 1H3TA 2EXYD 1EVUA 4OZHE 4NQXB 4ODUA 2GQHA 2P7TB 4Y2DA 4RIRB 1BLNA 1LQSR 3KDMA 4PJXF 1BQLH 4JFZL 5CLWA 5CEZH 4KWUA 1FN4A 1ZANL 1F00I 4LSPH 1HKLL 4KMQA 2GTWB 2W65B 2WQ8A 5E2UH 4M1CC 4ZNEA 3EFDH 3EJJX 1NCAH 3JV4B 5F1NA 5SX5H 4PJCE 4C56A 4X7SH 5BZDB 5BS0A 4WHYH 4HIJB 4M6OH 4YAQB 4KRPB 4Y4HC 1OL0A 1JF6A 1U0QA 1N0XH 4P5MB 5CIPB 5I1EH 3BIAX 3U9PL 4AIXA 1WCBB 4HEME 5L88L 4P2OB 5GRUH 2V2WA 3T1WA 1K6QL 1MJ7H 1NBYA 1WQVT 1BVLB 3DMMA 1OTSC 5FYKL 4QRQA 1QSED 2MQ0A 4R0LB 4U7SA 3OKKA 3LKPA 3OX8A 2EH8L 2VKXA 3KPRD 4FP8L 3SKOA 1REIA 4Y19B 1RHHB 1N7MH 1WBZB 3MROA 4HKBB 4NUJB 2EDOA 1KIQA 1OF2B 2DLIA 4KC3B 1QACA 1TZHB 3UYRL 2UY6A 1JV5B 4PJXE 3GNMH 1CXKA 3RDTB 4HLZG 2CDFA 1VADB 3WCYA 2EDQA 5DLML 4R96A 2C3VA 4XNQB 4LSVL 5IBLC 4CKVX 5JHDB 4NO0A 1RHFA 1K9TA 3M8OL 4KJYB 4HPOH 3VRJA 3EYVA 3ALXA 2VLMD 4KQ3L 5C8JA 1KLUA 1INDH 3K2UH 3QUXD 3QXTA 2QKIA 4XX1E 5ITBL 1ONQA 4J6RL 3GSQB 4MVBC 1Z0MA 4ZODA 3EFFB 4UQ3B 4OF7A 3ROOB 1RZKH 3HFMH 1HYRC 3M8OH 5INDB 4PB0L 2ADJB 1CD9B 3DV6A 3QQ3A 1RMFL 3CVHA 2QJDA 5JORB 2H3NA 1NGXA 2A1WH 1X5ZA 4OZ4B 1QG3A 1I3GH 3TM6A 1M4KA 1CWVA 3W39A 1DCLA 4U6TA 5CIPH 3Q6GH 5JDJA 3RVVC 4QXGL 3T2NL 3WIFB 3WUZA 3ILQD 2OX5A 1FNFA 5AUMA 3RVXC 1OP3K 2Y1VA 3IFOB 4NJAL 4U1HA 1I4FA 3IRPX 5JXEC 3QP3A 4G8FA 2OR7A 3CLFH 3EBAA 2IADA 4ZFOB 2QSVA 1YEFH 2X4PA 1QBAA 3LKOB 5L88H 4UI2A 1U58A 1QKZL 5GRVL 2GI7A 2Y5TA 1XCQA 2XTLA 4J4PC 3V0AC 3QEQB 3LN5A 4WFFE 4JZOA 3NFSH 4YDLB 1OD9A 2FBJH 3L3JA 1JGDA 3PJSA 2HFGH 3DSFL 1FL5A 1AGFB 5ESQA 1U36A 5T5NG 3RUGE 3MCKA 1B0RB 3L3HA 4KQ4H 3VXMD 1EZVY 5DUML 2D7MA 1A9BB 1XGUA 3VW3L 4JHWH 3KLAA 1K4CB 5ENWB 2H6PA 4JFDB 1VPOH 3HNVH 2Y07H 5B4MD 3AS0A 3STBA 3P9MB 4PR5B 4WWKA 1S9YB 2BHUA 1OLZA 2ARWA 2G75A 3HAEG 5I17A 2Z93A 5C70A 3CFJA 3REWA 2VZTA 3VH8A 4KROC 1QA9B 2QEJA 4XC1H 4JZJB 4CRPA 2FEEL 5H8DA 1JPTH 4K9EC 3HUJF 2P8MA 4LRNL 3P4MA 5D7JD 1WFTA 3INUH 2NYYC 1TNMA 1NCCH 3T0DA 3MRGB 1QSFA 1CLZH 4RDQG 3IB4A 5DMKB 4MB4A 3VGEA 4F2MA 3L6FB 1VGKB 4DTGH 1GSMA 5TDOB 2NX5E 3WHXA 2VXSL 2VAAB 3VG0L 4J8RA 4N0CD 1JGEA 4FTVD 1SYSB 3OZ9H 2FX7L 1V3LA 2NY2B 3T3PE 1HYSC 3HHRB 3ULUE 1X5AA 2DS4A 4QCIB 5FUCC 4X6CE 1MI5D 1R5VA 5I71B 2HWZH 1LWRA 3FO9A 3DV4B 2OTPA 1ZVSB 4PP2A 3B83A 4PGBA 5ERWA 4QHMA 4RQQA 2XACC 3L3KA 2F58L 4Y4FB 1QPPA 1CT8B 1NBVL 4PJFA 4XP9L 2BFVH 4MAYB 1OAYL 4H8WL 4YXKH 3F7YA 4XNMB 2ESVE 1MPAH 5GRJL 1OPGL 3GIZH 4PRHA 4C83B 5I1LA 3I6KA 1MELA 5CSZA 2Z8WC 3E2HC 3VI4E 3EOAB 3ROOA 4RWYH 3G5YA 4FQJH 2BNUA 1O7SA 3MZGB 4EN3A 2P5WA 5DJZB 1WFUA 2F53A 2YPLD 3KJ6H 2IPKA 3BW9A 4LVNC 1R24B 3WDHA 1P4BL 4LLWB 2HTKD 1AXTH 2VYRE 1DQJB 3SDXA 4RAUA 1A7RH 3OWEA 5EOCL 3FZUC 2VISB 3FT2A 1QSZA 3QCTH 1EUUA 3DUHA 3MV7B 4U3HA 2FGWL 4C55A 4O00A 5JHLL 2O5YH 5BQ7B 3LV3B 1RJCA 3ARZA 3MV9A 4AEFA 1R3JA 3DUUA 1F4YL 5BS0E 4Y5YB 2VDQL 4UDTA 4HV8A 2GT9B 4OM1H 1DQDL 1NGQH 1OP9A 4JM2F 3REWB 3VH8B 1D9KA 1JWUB 4DVRH 3QNZA 4FXKB 1RUAL 5K9OA 5J6GB 2Y72A 3K2MC 5IHUL 2VLKB 3EDEA 4JRYD 3F7RA 3QYCA 4F8TA 3QDGD 2G60H 1Q0YL 2EYSA 5KJRH 3ZKXC 1FAKT 3L9RA 3N1MC 1GZPA 4MCZA 3VW3H 4JFEB 4PLKD 4EI6B 1WTGT 4X5LA 2X4OA 4G6AC 4O2CB 4PJ7A 3HI5H 1IQWL 3U7YL 1Z3GL 3O2WL 3TO2A 4NZUL 3T0AA 3NZHH 1YNKL 2E9BA 4JO2H 4IMKA 3RDTD 1JNJA 4JFXB 5CINH 1U3JA 4LPYA 3E1F1 4TTGA 1F11A 1J0HA 4YDVA 4ODUB 4FFVD 5TPWH 2E7LC 4HAGA 1FNEA 5BCAA 4L29B 1RZGA 3AROA 5C0BE 3QDJD 3SE3C 2GY5A 5E2JA 1KB9J 1OB1A 4RGOL 4PRBB 5IVXE 4LP5A 2A9ML 4GH7B 3NBNA 4RDQF 4BSWA 4QXUL 4WTWA 1D6VH 4LLAA 5GPRA 3R4DA 5DZOA 4MQ7A 4S1QH 3T65B 3C5JA 4X5WA 4OB5L 1P4LA 3EIFA 3HZKA 1DUYB 4NRXB 5C0CE 2VN7A 1IAMA 4OUUA 4UQ2A 1ES0B 1RK0B 4PTUB 2VOTA 5ALCL 4LKXA 3L95A 4QRPA 2YR3A 1MSPA 4JPVL 4ALAL 5C6TL 3T77A 2JB5L 1IEBA 3FT4B 2PYEB 4JM4L 5AZ2L 3EZ8A 3FONB 3MGTA 4LBEB 5CEZE 1QHPA 4QF1B 4R96B 1LE5B 3P4OB 4QXWA 2AJUH 4G6AD 1EEYA 3HB3D 3ZKSD 1RZGB 5I1AA 3CFBB 1MY7A 1RUPL 3GSQA 3ZE2E 4OUUB 5DEGA 3RTQA 4YGVA 1A1NA 4K71B 1FL3A 4IIQC 5EN2B 3QIBB 3ZMRA 2R1YB 3CXHJ 2OP4H 4P5TC 4ISVA 3CU1A 5T3XD 3NAAH 3WD5H 4PG2A 2HVJB 2E6PA 3RVWC 2PTUA 2C3VB 4XNQA 1U8QA 5GS2H 3QHFL 2IGFH 5HYJB 1CGUA 2ITCA 4JM2A 1FFPB 4P4KD 4Y4KA 3CFKB 2V17H 4OCSH 1T1ZA 2DWDB 2VR9A 4OLZH 4XPHH 4JQVA 5D7SH 3LRHA 4DOHE 3LEYL 4AYFA 1U8KB 4LHUB 5MHSE 1KEMH 3ULVF 2EDFA 2X4QA 4F7TB 5J9PA 2ZSWB 4UU9B 1ZWIA 2AEQL 4OKVA 4JKPH 3B3IB 4W6XB 5JTWA 3HC4L 2D7PA 1WZKA 2BX5A 1MLBA 3HZMA 3H9SE 3HI1A 3O2DA 1FGNH 1BVZA 3U4BH 5ALBH 4PJGE 1FV1A 3W0WD 3HRZA 2X4SB 3S34H 4UV4H 4JO1H 3G6JF 4GRWE 4LSSH 4F9LC 5FUCE 1KLGB 5KVGL 5GSRA 2OK0L 5J12C 1NANH 1VENA 5EZIL 3Q1SH 1Q0XL 5CZXD 1II4E 2PCPA 1AXSB 1KB5B 3OKLA 5SX4H 3QO0B 4RAVB 1G6VK 4E5XA 3LS4L 5FYLD 3VXME 2Y23A 4PBWD 3GMNB 3K4DA 2J6EA 4HK3N 1CQKA 2QADD 1M7XA 4YH6A 3OPZH 2P48B 1MCLA 3VGAB 1DQJA 1D7FA 2ADGA 4ELMA 4QRRD 3B3IA 1IILE 4HWBL 4E41B 2ZCLH 3FRPA 2WMPA 2MJWA 5C0RL 1QNZH 1S7QB 4M93C 1IM3B 3X17A 1G7IA 3F12B 5DJ6B 3HMXH 3C5ZB 1IKFH 1LO0L 5AZEL 1WWCA 4YHIB 4K8RL 1UM4H 4DFIA 1URLA 1QZ1A 1VFBB 4RFEA 3MJ8A 4F7CB 2FIKB 3D25B 4KPHL 3MREB 4U6YA 3RGVA 4AQOA 4PJIE 5JIIA 4RWHA 2NX5D 5HHMD 1KB5A 2IH1B 1CFNA 2Q7YA 2I60H 3BRGC 5D7LE 3TYGH 1N4XH 2OBGA 5IF0A 1ETZB 5ERWB 4CU8A 5C7XL 3CH8A 1R3IH 3QG7L 3AXLA 2UZXB 1R5VB 1LEIA 4L5FL 5JPMA 5FUZL 3QUXC 1BGXH 5SWQB 5KTEH 2YPVH 2FEDC 4AH2A 1UA6L 2WUBH 3O9WC 2IG2L 4HKZA 1TTFA 5HHXH 1B9ZA 1IFHH 3RWGA 5DURD 4DGIH 1A64A 3BVNA 3LN4A 4JFQA 5EULV 1MFCL 3QBTB 3VFSB 1I1YB 5IFJB 2OP4L 2ID5A 1NCUA 5F6IB 1JGUH 4FQHA 4TUJA 5DJZA 3U4AA 3X11A 3B9AA 4GKZB 1A7QH 3GHEL 3P0YL 1A47A 4V1DB 1P7QB 2WSKA 5DVOA 2R2BB 1P7KA 3HR5A 1I75A 4M61A 4H25B 5CFHA 1NEZB 1EIBA 1OB1B 3WHE1 1J9CT 4MQSB 1LK3L 4NJ9L 3RWCA 3BD4A 3G9AB 2NXYC 1KPVB 3PIQB 2UUDH 3FN9A 5TDPA 3L3GB 1FNGA 3PP3H 3BPNC 3CDFA 2VLLB 3DV4A 3BGMB 3AGVA 1ZT4B 4Y5XB 5INCB 2EDHA 3MCLH 5EU5A 5AWNH 2DIJA 3M1BB 4BZYA 4QHLB 1CBVL 5BS0D 4B53A 5IROA 3IKCB 2VLRB 4NO0D 4GG6A 3UAJD 3S97C 2YEZB 1RVFL 1VFOA 4QXUH 3MJ9H 1ED3A 5HGHB 5BRZB 3UBXG 5J0BA 2CKBB 3FAXA 1K8DA 2JTDA 3G5VA 4PLJC 1OM3H 3LS4H 1A9BA 4C56E 3QUZC 4G8FB 4IM8A 4XPTL 1I4FB 1UB6A 3D39B 4PD4J 2HJLA 4LSTL 4PRDB 4KZEH 2BHYA 4TUOA 1QFUH 3ALWA 4ODHL 1R0AL 3LRGA 3UTSE 2VXTH 5GRUL 5DVMA 1Q9WA 5HHVL 4PB9H 3RNKA 2CD0A 3VE0B 5FO9A 1VB9A 1CL7I 1JZ6A 2HRPH 3C8DA 2XZAL 4HUXA 1G9EA 4PY8I 4XCEB 4YHKL 1J1PL 2X70B 3IFLL 5E1AB 1EFXD 5MEQB 4K71C 2XRAL 3EFFA 1HI6B 2EDRA 4GAGH 3ELAT 5T5NF 4WI5A 25C8L 4JZOB 1CXIA 3W39B 3IVKB 1LDPL 4JVWA 2FATL 4F15C 3ZKQD 2AEIT 2JIXA 5JORA 5LAXB 2M8XA 4Z78B 5E8OB 3SO3C 3O3AB 4F7EA 4BQ6A 1WT5C 2NTFA 5C09E 2O61A 5TDPB 1LNUA 1OGAE 3SPVA 1GGYA 4GAYA 4R9HA 4Y2DD 1OSPH 5IBUB 2Z31A 5CGTA 3CX5J 1AP2B 5TH2A 1E6OH 3HE6A 5ELIA 5E7FA 3K1DA 3F65A 5FYJU 4N9GB 4XGZB 7CGTA 4OFPA 3QUZD 4HWNA 1MJ8L 1FO0L 4I48A 4PP1C 3QRGL 3RY6C 4P2RB 2RGSA 2ITDB 4OCWH 1DDHA 5FO7B 1JHTA 3PABB 1LDSA 1A6TA 2X4TB 5D7IF 1KXQE 1K8DB 4NN6B 5DEZA 4PTTB 1QO3A 4LCWD 1BFOB 1LP9E 4KQ3H 1NFDF 3L3KB 1MJ8H 1S7XB 5DFTA 1HXYB 4Q6IA 1M05A 1FSKB 1ED3B 1S5HB 4U1GC 3S98A 3KPSB 5EC2B 5EWIH 4G6MH 4OCRL 3BIKB 4KRPD 2DMCA 5GGVL 1S7RB 4WFGE 4D9QD 2YC1B 5SWSA 1T20B 3WHE0 3NFPA 4TULH 3BH9A 5MENB 3LS5L 5T3XE 1Z9MA 5KS9E 3BPLC 1T04B 1NBYB 4FN0A 2VXUL 2P5WB 3DYPA 4X8XA 4JO4L 2R0KH 4NZRH 5FB8B 3TNNB 4I0PC 1F4AA 1HSBB 1E4WL 1D6EA 3QEQD 4NN5B 3FJTA 3T08A 4BZ1H 4P9ML 2VLRD 1XF4A 4OLXL 5IVNA 3KPQB 4UTAH 3HE6B 2V5MA 3PGFL 5DK0B 1BJ1J 5T1MB 4LK4A 1MFEL 4X0KA 2NY0C 3UPRA 3U7YH 1CFVH 4JY5L 5C09A 1MFDL 3QDHA 3V8OA 3F7PC 3PG2A 4BH7B 5JW5B 3B8YA 4M02A 5EC1B 2W91A 3VWJA 3IDUA 5IEKA 3GMQB 3QPXL 2V7NA 3OMZA 3GMRB 3LKQB 3MLSL 3MRHB 1U58B 1F58H 3I02A 1XT5A 4BZ2L 3MV7E 3L1OL 4JQVC 1M7DA 3QZWA 3WS6C 2VDPH 2EIBA 4R7NA 3ROLA 3SDXE 4LCWB 1EEZA 5JXAL 4LLDA 4WW1A 3MODH 15C8L 3ZLQC 1E4XI 3D2UD 3SY0B 2ZSVB 1ZHNA 1EO8L 1VPOL 3PHOB 4I9WE 4IMLA 3AC0A 2FO4B 4JHWL 3MV9E 1U8LA 2HKHH 4Q9QH 3K0WA 1T5XB 5HDBE 4UV7L 2HT3D 4JHZA 3O3EB 1QSEE 3G5XA 5F89B 3VXPA 5GGTH 1W72H 1FYHB 1DSFH 1YEHL 3KVQA 3IDXL 1WWBX 2P45B 3GMLB 1IGFL 3MBED 4FA8A 2WANA 4LVNB 2IPTL 1YPZB 3VD9A 1A22B 4M03A 3O4LD 4Y8DC 1WZMA 4HC1A 2H1PH 4LGPB 2NZ9C 1AD0B 4WRLA 4FFYL 4LCCB 5CD3A 3ZDZF 1H5BB 2CPCA 2AEPH 1KV3A 1RK1A 5E4EB 3T3MF 1KSRA 4PJBE 2YC1A 1GPOL 2KDGA 3CK0L 1IT9L 2AXFA 4U0RB 2DM7A 4N90D 5LGJB 1JZ3A 3H9SB 1R5WA 2W0FB 3E3QC 2EEAA 5DD3L 3U48A 3SDXF 1ZXQA 4F58L 3TJEL 3SKUD 3OB0K 3L3DA 2DF3A 4P2QA 5I1HH 1QLRA 1JFQL 4P23B 3VXUE 5C9JA 1S3KL 2Y25A 5TE4H 4OCXH 1HHHB 5EDXA 4HUNB 4GKZA 2G5BA 4TQEL 1JUFB 3SQOL 1WJ3A 5IQ9A 3PP3K 1SJHA 3GUTA 4NYLB 4YX2L 2ZG1A 4QEGA 3PV6A 1YEDA 3L7EB 3RBGA 3MXVH 3P0VH 3FQWB 1ZLWH 4NZTL 5JW3L 2XXMB 3CSPA 3NCMA 3OGCB 3ZKXB 4C59B 3F7VA 4TQEH 3IDMB 3A67L 4CMHC 3TVMC 5BVJB 4YHLH 5TE4L 3DTXB 4MD4A 5L2KA 3UTZA 4G42B 4UIKH 3H7BA 5HI5C 4R4ND 4Y5VC 1NGZB 32C2B 1T0NB 1NUDA 2X44D 1A6ZA 4WFHE 1BBDL 4XXDA 3W82A 4XCCH 3SGEI 1HEZB 2NY6D 5JW5A 2B5IB 4IOIA 4UMGA 1ZS8B 3BHBB 4MNQB 5E9DA 2P5WD 4P46B 1S7WA 3KDMB 1A7BA 4XVTL 4GMTL 1KTDA 1AQKH 1BREA 4FOMA 4LNVA 3QG6A 3TBYB 4IS6A 1RU9H 1F3RB 5E4EC 3U4EA 1F2QA 2X10A 4C56D 2WBJC 1YEEL 3CGTA 2R1WA 4HHAB 5LGHL 1BQUA 1YJDH 4JVPA 1Z5LA 2P8PB 4KQ4L 2H2SC 5E6IB 3OGOE 1N5AB 4PRDA 3SJVE 2OLDA 4O51B 4PY8J 4KKCC 5F7HA 1I1FA 3PGDA 4GXVH 3BP7A 4GXUM 4KGLA 1OP3H 1N64L 1J10A 3KPSD 1FG2A 1Y18B 1J0IA 4ZUTA 1BECA 4DK6A 5K9QG 4K3HA 3PDGA 4X6DE 3HE7B 4LCUB 2XPGB 4OLUL 2R29L 4OZFG 4X99A 2XG5A 4ZMAT 5E2TH 1AH1A 4ZXBB 3UJTH 3CLFL 3R0NA 1UCBH 3PL6C 5D7SL 2Y06L 4ZOEA 1EPFA 4JPIA 4W68A 4ZUUB 4JRYA 2YPKB 3P30H 5GHWL 3QCVH 4L3ED 1IARB 1GGUA 3MV9B 3U30B 4YHPA 1WSST 5HGBB 2CJUH 2C3GA 3RTQD 5DJCB 3BKCH 2V5RA 3TESA 3TT3H 4NZDA 1T22B 2IEPA 4KTEH 5FOJA 3B9KB 1DVFD 4AK1A 1MI5E 2HKFL 5HYSG 4JR9H 1MUJB 3BOVA 2V2TB 5CGYD 3MYZA 1CGVA 4AEEA 5F9JA 1RAMA 1OAQL 3RJDA 1CI5A 3MNVB 3RUGA 3SE9H 1YMHB 4C58B 3L9RB 1M71B 3MLYL 5IEKB 3BP4A 4MD4B 1CDUA 3SDCC 1X5JA 2ICES 4XCFL 3KPNB 1BQSA 2J6EL 4I0KA 3SDCD 4GMSL 4D0DB 1AXTL 1KBGH 3JWOH 1ZGLP 3SDDD 4NC1C 4NZRL 5E99L 1N5AA 2M26A 5DVKA 3CMOH 3RGHA 5BO1L 3RU8H 4YHOL 3DJ9A 4M1CD 3SE4C 1F8TL 1CXHA 1FVEA 4DN3H 1MQKL 4HCRL 2XTJB 3ALPA 3JUYA 4BSJA 3TBYA 1U3HB 1WT5A 5IOPA 3QH3B 1GGTA 1IFHL 5DC4B 5C0BA 1U6AH 4EOWH 5GGQH 4DKEH 4FQ1H 3RGVD 1JF1A 3ES6B 4QHMB 1NLDL 1GPOH 3O8XC 4KKBC 5HHPB 3LMJL 4M7ZB 1ZE3C 4I2XE 1H8NA 1NC2B 2ATKA 2DQCL 3QNXB 3ABZA 1ZLWK 3SKJL 4FP8H 4H8WH 1OAYH 2ADFL 1ZEAH 1CFQA 3HPLA 4YXKL 2YZ8A 5B38G 3TCLA 3BPOC 4OIBA 4YBQC 1B6UA 3HLAA 4JREC 3Q3GB 4PJ9A 1A3RL 4MXQD 1DBJH 3BN9D 3ZHDA 4WHTA 2Z4QB 3JWDL 2YMXL 2MQ3A 4FQLH 3ARXA 4XBGB 1P6AB 1NDGA 2BDNH 3VXRA 4O5LL 4R90H 4U1JA 4OZHB 1D5BB 3MUJA 4HS6A 1AO7A 2ESVB 3SDCA 5B3NA 4YNYB 2X1WL 4E41A 1YY8A 3VGDA 1E6JL 1EO8H 2F8XC 4KTYA 1C5BH 3TNMB 4FFZH 4RMVA 4WWKB 1G7LA 4P0DA 4S2SA 1CR9L 3QEGH 1JHLH 3EYUL 5AYQA 3T0WA 4LRIC 4KZDH 5DO2D 2F8VA 1J1XH 1AXIB 3CDGA 2AQ2A 5J7CC 5IB4B 1PZUB 2ILLA 4GKOA 2BSSA 4UUJA 4XVUD 3RZWA 5E2TL 4L8BA 4DVRL 3MV7D 3HC0A 4I5BB 4KJQC 5T3ZH 4JCLA 3I02B 3LOWA 3WFCL 4YC2C 4MDIA 2YWYA 5BRZA 4R6UA 5TDOA 2FO1A 2BOCB 4H25A 5L0QB 4Z6AT 5FCUL 5BV7L 4OD2A 4HLJA 2ZUQB 1U41A 2OM5A 3C6SA 5HDOA 1JI2A 4PB9L 1MLBB 3QDJE 3N06B 4M1DL 5IMKA 4I9WD 5C0GA 4JFOA 5KSUA 5INCA 4MCYA 2DLGA 3FO1B 4PREB 4FQXD 1DP0A 3WNKA 2AVGA 5DEFA 5HGHA 4OT1L 4NQDB 4G9DB 5DHVA 5CWSB 4UAOC 5D9SA 2GSGA 1RZFH 2OJEB 2XTJC 1DQLH 3LKSA 4J1UA 4XPTH 3GM8A 1KEGL 4EVNB 3O4LE 3TH3T 4ETQA 2FEEI 3W5MA 4FZEH 1ZA3A 4I18A 2VUOA 4WO4C 2VQTA 1I7UA 3QHFH 5C0FA 3AU1B 4PJ9B 1CXEA 4YHZH 1B0WA 1MCIA 3QZWB 1YC8A 1I9RH 5KSVB 3DROA 2JJSC 2GIYA 1D5XB 4JLRB 5ICYA 3ARRA 2Z8SA 2WW8A 3NGBC 1MCCA 1J1OH 2VQ1B 3C5SB 4N8VG 4UINH 4K7PX 1UT9A 1JZ4A 2AABL 12E8H 2FIKA 5E8PA 3IDYC 5EIVA 3CH1B 5IMLA 1JPST 3VXSD 4HPOL 1JK8A 3B5HA 1TITA 1DBBL 1BFOA 2QSTA 2P42B 5DJAB 1NL0H 4QGTA 4PRNA 5DI8B 1A21A 5CZKA 2E27L 3DVNB 2R23B 3TT3L 4NPYB 3OX8B 3MRMA 4NO2A 5GS1A 1MCHA 3BAEL 3DV6B 3O41A 5HD8C 5JPMB 1E6OL 3VWJC 5M94B 1N7ML 5AD0B 3ARDB 3UC0H 4EOWL 4JGMA 2VB5A 4LPVA 1FIGL 2JELH 4QCIA 5AG8A 3F12A 4MYWB 5GGTA 4XNUH 4Y7MA 4KJPC 5JA8B 2IANA 1VEPA 1OPGH 3GIZL 2NTFB 2ARJQ 3VRJB 1EMTL 1QBLH 2X4SA 4HJJL 5DJDA 4U6YB 1KJVB 4FTVA 1BWWA 2I26N 3FB7B 3U9PH 3QIBC 3V7MA 2F19L 1MJUL 1QSFB 4YHKH 1OAXL 5EZJA 4YDIL 1MHCA 5I1DA 1OWWA 4YXLL 1S7XA 1UB5A 3MJ9A 3EYQD 4S1SL 4UU9A 1KPRB 5CJOH 2PYFA 4NQEA 2PTVA 2X4TA 1CU4H 4C57C 5FM4A 3SE4A 4GT7A 1K4DA 3UTQA 3NFNA 4Z7WF 3RL1A 3MRPA 1FL6A 2R4SH 4UDUB 5AEAA 3GB7B 2R9HD 1FORL 4U2ZA 3K8LA 1JPFB 1IBGL 3TZVB 4M7LL 2K9UA 3RUGF 1FL5B 1H8OA 4DFHA 1LHZA 4HEPG 3NVQA 5DJAA 5GRZA 4XP5L 3RNQB 5DSCA 5DC0A 1C16A 5IHUH 5DJXB 3BDBA 5L7XH 2P8LB 1L9NA 3G08B 5HTSA 5E9DB 3AMKA 3QPQD 4MD5B 1X4ZA 3TV3H 2E6JA 5DDHB 4I2XA 4PRPD 4GG6B 3KJ4C 2MKWA 1EA9C 5GGRA 1GJIA 4I3SH 4I77H 1FZJA 2FJHB 4WEMB 4HUMB 1OQXA 4ZFZB 1HH9A 1D5XA 2X4RB 4NJ9H 5A3ID 2BOBA 4WI8A 1MHPH 4QOKE 5E00B 1D9KD 5FDWB 3ULUL 4JANA 2BNUB 1A3RH 4NQED 4NQCA 3AY4C 4FQCH 1J8HE 2APXA 5IP4A 2WBJB 5ANMB 2ZCHH 4MNGB 4LBEA 5BZWB 4WTXA 4V1DA 4PIRF 3HCVA 4WI9A 3N1PC 1KJMA 2R23A 3KYNA 1NBQA 5I30H 4WCYL 1ZWIB 1NAML 2BSRB 3VDAA 1S78D 2XA3A 4LHUA 3PHQA 1HHIB 4PGBB 5HHMB 3EYVB 4MCYB 4Z5RA 1MAKA 3E6HA 1NFIA 5B22A 3EO0A 4BA8A 1OT2A 3HRPA 5FYJD 3FRUA 1S7VB 3QI9B 2AXFB 3EW3B 1IGFH 3PWNB 3BKYH 3S4SG 3M1BA 4XMKH 1CS6A 3U2SB 4NO3A 3TIDB 1NMCC 4IDLA 3VFUB 3MXVL 2W59A 3G08A 4XP1H 1INEH 3QUYD 4TYUA 2EDDA 2ZWLT 5ESAA 4DEPC 5IW3A 1NMCB 2JB5H 4NWTH 1ZANH 2EIZB 3HCVB 2N56A 4LP4A 2JJVA 3KXFA 5EU6A 5GQBA 4YK4B 5C08D 2QADC 1LEKA 1AGCA 5HHQB 2X9YA 4JEGB 3RI5F 3WMSA 1JYVA 3RL1B 2NNAB 3ARYA 1F58L 2YA2A 2FO4A 3C5ZA 3MLSH 4Z7VF 1MHEB 5EO1A 1SYVA 5TQ0L 5C0IA 4PREA 3NACL 2Q3ZA 3DYOA 4Y1AB 2Z35B 2FZ3B 1CICA 4I0PA 4MQ7B 1E4XL 3KR3L 4BYHA 5BZWA 1P53A 2WIMA 2XN9A 5HJ3A 4TSBL 4MAYD 1H0DA 3MRHA 3C60C 4XP6L 4M5YL 1E0OB 3B5GA 4AY0A 3B9DA 4C4KT 3T0VA 3WJJA 5GGTL 3QI9C 2OCFD 3B9EA 3MRJA 2Q7YB 1XR8B 5B3JE 4UV7H 4Y5XC 1F5WA 5FM5M 3FB6A 4OCMC 5EUOB 1N2RA 4B41A 3CDGB 5C09D 3PWPB 4JFPB 3D25A 2P49B 3VWJB 4YFLI 4XWGL 1ZMYA 4CVZA 4PJ7B 1CN4A 4EQ2A 1MCDA 3TLRA 3FB5B 2JELL 3QUKA 1UZ8A 5I2IA 2Q20A 4NP4L 3VGHA 3ZKND 1G7IB 3I3EA 2XI9A 4KRLB 3D3VA 4YDKH 1PG7X 1IGIL 1MCRA 4YZFE 2DQUL 1FFPA 1GGCH 3JVGA 5IWLC 4RRPA 3IJYB 5I71C 1AGCB 5TFSH 3L7FB 5F7KC 5JXEA 4PJAA 1MCFA 4F33A 1FFQA 2LE9A 1CK0L 2KPNA 2EIZA 5GZOC 1C08B 3PL6D 2OZ4L 3MRBB 1Q9OA 1NJ9A 1CT8A 4XP4H 2P44B 4D94A 1JGLL 3GSRA 4KXZH 5TFSL 2EDYA 4BKLB 4OGYH 3WDJA 4JM4H 4NCC2 5AZ2H 4BZ1L 4G8EB 1I9IH 1NEUA 5MENA 4Z7OF 2GJZB 3RP1A 2Y6SD 5IMLB 1PY4A 3I75B 3KYKH 5DTFA 3UAJC 1FO0A 5BMFH 1UJ3A 2OSLB 3TO4B 5DJDB 4LHQB 5FA3A 1RQ5A 4NPYA 2Z8RA 3BWAA 5F7DB 3FOLB 3VWKB 3UDWC 5EUKB 3TBSA 4P5KA 1DQLL 3KLHC 4M5ZH 1Q1JL 3C87A 1I7ZB 1K4CA 4HXBH 5ENWA 1MRDL 4UQ2B 4KRNA 3QG7H 3CVHH 5HDQL 5IESL 5IJVA 3W0WB 4NO5B 1EJOH 4PY7B 4WY7L 3S3JA 5GRYA 1B3JA 2MNUA 4OCRH 2ZOLB 4GMSH 3GIVA 3LVEA 2Z93B 4U7KA 4PGCB 5DO2C 4L3EA 2EDBA 2WM0A 2YD4A 5IEHA 3F6LA 2YD6A 5CINL 3W5NA 3DIFA 1P7HL 1PD6A 1R5IA 2X4UA 3OAYH 4ZAKD 1EFXA 3B4NA 4RX4A 3CXHK 1MFBL 4P2CG 1LE5A 1Q9LB 4GQPH 4KTDL 4DGYH 4LSUH 3O2VH 2XZQL 1U9KA 4JM2C 4Y4KC 1NAKH 1Y0LB 5DDHA 2V5SA 2VAAA 4KZDL 4ZFGH 5GS0H 1E28A 4XBEH 4CADB 2GITA 3KPPB 1KIPA 2MHAB 4PS4H 3DWTA 3SE8L 4LLQB 1LO5A 4L8BB 3SDDA 3AS3A 3CUPA 1FE8H 1NSNL 1PGRB 4XWGH 1R3HA 1JNLH 3NA9L 3THML 1JPFA 4PGDB 4KFZC 2QKIB 1FRGH 1PG7W 4NQTA 2BERA 4XNXH 2XTJD 4QKXB 4UOJA 1Z6JT 3RWEA 5DS8B 1OVZA 3DOSA 5FYKD 5GRWA 2K7QA 2FBJL 3QDAA 1OD7A 3P0GB 3U1SL 3QNZB 4FXKA 3BUYA 1FLTX 4ZYKA 1CLYH 3UJIL 1J11A 3QQ3B 1MJUH 3MLZH 1F11B 3BMWA 4EN3D 4XI5D 1L7IH 2Z91A 1LO4H 5JPNB 1HIML 1FPTL 1K3IA 1JF1B 4TNVF 5D7JC 3C6SB 5ETUB 3GSRB 4M3KB 2ZJSL 1XGQB 4X9FA 1G7LB 4S2SB 2JCCE 5KSAB 4GKSA 5IB1B 4QOKD 5C8JB 4PGCA 4OCSL 5HGGS 4W4OA 3BGMA 1KN2L 1QLEH 3U6RA 2A73A 2D0HA 4YEEA 4XAKD 5B39G 1BGXL 4U6XB 5GGQL 2BSSB 2DQDH 3BDYH 1Q38A 4UQ3A 4DKFH 4L5FH 1CTNA 1U8PA 3I9GL 4YHYC 4Z7NE 5D2NC 4L9LA 5DD5L 2NY7H 3TN0B 2VTFA 1WBZA 4HKBA 5E2WL 1NUGA 4G6ML 4I3RH 3MA7A 3MOBH 3PWLA 1IC7L 3HC3H 5ABDE 3ULSA 4ZFFA 4R3SB 2DQFB 1LGVA 5FYJE 4MNQE 3UTOA 4N0CC 3T0EA 1ERNA 2BXYA 4E41E 1J0YA 2WBJA 4I77L 2OZ4H 2X5PA 3QXVA 3CDYA 3QDGA 5I74C 5IM7B 5DFVD 1G0YR 3U0TA 5HI4C 3ARED 5C0AE 1BJ1H 1IGTA 3ECBB 1UFUA 4OD1H 2HLAB 4NC1E 5E8DL 1KB5L 3LKNB 3BKYL 1QQDB 4N0UB 1IC7H 4OZFH 5BRZD 2JLLA 5E2WH 4WU7B 5B8CA 1AY1L 2XWBB 3O9WA 2DQUH 2W07A 1M71A 2HJFB 5I19L 4YAQA 2ZCLL 4OB5H 3QDME 1A1MA 5D7KE 2QQKH 1KPUB 2X41A 3TIEA 2ARJA 3H9YA 4DN4L 1TJHH 5IVOA 2KBGA 1KELL 3MRLB 1R3KA 4PJGB 2VRAA 5IQ7L 5DRWA 4UT7L 2VUYA 5E94A 2Q3AA 5EOQL 3V0VA 1ADQA 1P9MC 4HFWB 4Z7NF 4Q0XL 4RGMB 1U3HD 1V7NL 5C0JB 1CFBA 3G5XB 1YMHA 2R9HC 3IETB 3TBVB 3TH4T 1KCVL 3KPRB 3F7YB 4XNMA 1JVKA 4MGXA 2DTSA 4G8GE 4L3CB 4CVZB 1VACA 1T1XA 1BD2B 1PX4A 3VXNB 3FZUD 1LEKB 2DJSA 1N0XL 1MIMH 3GMOB 4OQTH 1FRGL 2GW5A 4KPHH 3FQNA 2VDRL 5FGBA 3B9VA 3V4PH 3VD7A 3MODL 1F97A 3V4UL 1ORSB 2CRIA 5GSRB 3LN5B 3LEYH 15C8H 2IWGA 1MJJA 3R0MA 4LCYA 1JJUA 1BZ9B 1RZKC 1DQQA 1F4XH 3GSUA 2WWKO 2DMBA 3VXSA 1XGPA 2ZCKL 2O26U 4JN1H 2R69H 1RPQA 4LU5H 5E0QA 1EH9A 2Y7QB 4N1EA 3K74B 3GRWA 5ADOH 2FR4A 4EBQL 5DQ9A 2ICWB 5LXGH 1J0JA 1VACB 1FZMA 4IRZH 1ACZA 2E5EA 5CD5D 2DKSA 4PRIA 4OFIA 1J0KA 2ITCB 4JM2B 4HWZA 4Y4KB 5I8CA 1C1EH 3C60A 5F8QC 2OK0H 1XF5B 1L0XA 4ZNEE 3JWDH 2EE6A 3EHBC 3GRWL 4X6DA 2AEWA 2H9GB 5D2LA 3PWPD 4I3RL 3IS0X 4PJGA 3ARBA 1JL8A 1D5IH 5J11C 4AL8L 1UWGH 3RKDC 5E00A 2H8PB 2NZIA 3IFPB 3HS0A 5DR5L 3ZDXF 2FHFA 4M7KL 4AENB 4JFDE 4K3GA 5DUBA 2QSCH 1EEUA 2DBLL 2R1XB 5HHNA 4KJYA 5HVHB 4ZXBD 3ZKMD 5EOTA 3FHAA 4M43H 1JN6A 3HI6H 3NPSC 3C6LD 1NFDE 1PDKA 5CP3H 4MJ6A 3VFNB 4U0QB 2B0SL 4ZTOL 3MLWL 5DRNB 1H3UA 4JQXA 5C3LD 3SJVA 4JQXC 1LO4L 3JWOL 3C8KB 3UO1L 3PABA 5ID0A 5T33L 5SWZD 3G6DH 1QSFD 5I16B 1N59A 4XNYH 3EYSL 5FO8B 3DX7B 3QAZC 1A1OB 2B1AH 2CLRB 1K5NB 3QWOA 4K8RD 2XKNA 5FEBA 2YD5A 4KXZI 4X9HA 4P5TD 1JRHH 4L3AA 4S10A 5INDA 1NGWB 2ZSVA 2HVKB 4MA3B 4P59H 2G9HB 1T2JA 3GSNB 4X7SL 3C08H 2AAVA 4ZS7L 3QDMB 2R0ZH 3SE9L 3HR6A 5ACZA 5ILTH 4PJEF 2NY1C 4OD3L 5FOBB 3TO4C 1ND0A 1BQHB 2DLFL 3F58L 3X14A 1VEMA 3KPMB 4P3CH 3VWKD 2P24A 4UT9H 1WFOA 4U1IA 1T03H 4L8CB 2X6MA 4A6YA 4XAWH 4WGWB 3VRLF 5FGSA 4S1DD 3ZHLA 2NX5A 1ZT7B 3TFKC 1N5YH 2C4FT 5TF1L 3MLVH 2DJ4A 5GS0C 3BESR 2D31B 1EEZB 4XMLH 4M4RA 4JFYB 4R7NB 2FATH 2NY6C 3IJHA 2HG5A 4NQCD 4ODVH 3MJGX 5I6XB 4LVOC 1ZLSL 1NGYB 4BQBA 1I8LA 2W9EL 5FV2A 1HE7A 2VLJA 5HYSB 1RFDL 1G0XA 2HJKB 1ROWA 4O9HL 3FCTA 3D85D 5L8KB 1P6FA 2F5BL 1SQ2N 1U95B 3QHZL 1BF2A 3HAEH 1AIFA 2XTJE 2J2ZA 3NZHL 2EXYC 5KSBE 4TNVK 4E42A 5H35B 5FYKE 3RWFA 1W72B 1SBSL 1D9KB 4YBLC 1YEEH 3QIUB 4JFFE 1CF8H 4QRTA 4HWEH 1P4BH 4NFCA 3KPPA 3MRDB 4XB7A 3WIIL 2VC2H 3MFFB 3PL6B 1H3PH 5I74B 5BZDA 3LKQA 5E7BA 2KL6A 5BV7C 2NMSA 4MDJA 5ICZB 1YYMH 1AKJA 3D69A 3E2HB 3LS5H 4Q7DA 3BZDA 5LKNA 2KKQA 1HN1A 4KU1A 3V5HB 3Q6GL 1MCEA 1VDGA 3D5OF 4LLDB 4WW1B 2DQIH 1G6RH 5E9DD 1YECL 1W2KT 3K80A 4GBXC 1KPVA 1MREH 2Y6SC 4Y2DB 5EU4B 3FT2B 3P9LB 3CVIL 1PX3A 4YFLF 1MEXH 3DRTA 3CD4A 3LDBB 4N8PA 1BJMA 3C9NA 1PYWB 3WLWD 3BP5B 1HQRB 4WEBH 3RY6A 1G9MC 1WZ1H 3RY5A 2NY2C 2XWBA 3O9WB 3HAEA 4PRPA 4XPBL 1CGTA 4UB0H 2FGZA 4Y4HA 5I1IH 3CAFA 1VGEL 4K2UL 4XGZA 2EH7L 4WFED 4OI7A 1SJXA 3BIKA 4OZGE 3SQOH 3GSOB 1OCWH 3QHTC 2PXYC 3VFTB 3G5YB 1H8SA 3B6SA 4B0MM 3GSWA 3BO8A 3VCLA 4E41D 3ISWA 5HBBA 1JFQH 4WEBL 3LY6A 4OZIE 3MO1A 4UILL 4ORGA 5KZCD 5ADOL 5C0AD 2VITA 1MH5A 4HBCL 5D7IA 5CP7A 5DVNA 4MAYA 1U95A 3WFBL 1XGQA 3HAEB 3NIDF 3H8NA 2DLEA 3TN0A 1QQDA 5E08H 2YN3A 3IDIA 2APTA 1WLHA 3GKWL 4RMTA 3FO9B 2LAAA 4WTZG 4ZAKC 1PYWA 4YR6A 1NGYA 1AGBA 3GSNL 2E9JA 4LOUC 4L1HA 4WUKH 4EIZC 5IMMB 3NTCL 4DN3L 1RZ7L 4Y2OA 5H35A 5BW7C 2D31A 2Y36L 3EDDA 5DYOB 3T04D 1FHGA 2A6JA 2XY1A 5C86A 3GHBL 2F53E 3QCUH 2DM2A 5HXMA 1G7QA 4RNRB 1W0WB 4KI5E 3BSZL 3Q48A 2ZPKH 2WK2A 1H15B 1UACH 1J5OH 1FJ1B 2VLJB 5K9JH 1XMWA 3L3OB 3O6LL 1QEWB 2BMKB 4G8GD 1TJGH 4OFYD 4XXCA 5DMIH 3CLEL 3PXHA 1B2WL 2FSEA 3RWFB 3MMEA 3OKDA 2ITDA 3WFCH 4XVJL 4LF3B 4N0YL 2QBWA 2OJZL 2PO6A 1MCQA 2EDLA 5C0CA 8CGTA 4RBPH 4K55A 1WAAA 3WJLC 2VWEC 4PJFE 1RSFA 3MCKB 4LCWA 3WDIA 3E8UH 3T4AA 3CUPB 3NCYS 3W9DB 3G5ZB 2GFBB 1JHKH 4R97C 3QWRA 4QTHB 1CR9H 5IJKC 4NQVB 2OZ4A 4ZAKA 3GJFA 4PYHA 4L3EB 3WEXB 4H1LH 4N0YH 3ET9F 1MRCH 3RWEB 5C9KA 1ZHBB 3BP6B 3KHOA 2PYED 4ERSL 3P0VL 3PGCB 3PWNA 1A6ZB 3FT3A 4PY7A 2R1XA 5HHNB 5LBSH 4PJIF 1KTLB 1NCTA 1INDL 1MH5B 1I3UA 3CSYB 1E4KC 1EFXB 3HG1A 3WE6A 2GK0A 1SM3H 1UWXH 5EO9A 4GAFB 1X9QA 1S5IH 5ACMA 1QKZH 1S3KH 2YUVA 4P5KB 4HIHB 5C6WH 4UT6L 3PWPE 4DZBA 3UO1H 2WLZA 3RRQA 3K8KA 5T3XH 3O6FD 3SBWC 3A6BL 2B1HH 2H9GA 5D2LB 3VI4F 1W0WA 3RVUD 3PDOA 5E8EA 3X12B 4KK6D 4TN9A 1KXTB 1FIEA 3DX6B 4JFDD 4OLZL 1KTRL 5EOCJ 3OKEA 4FFYH 3NAAL 4G43B 1CFQB 2IAND 3B9KA 2A9NL 2EKSB 1KCKA 4N68A 3MUGA 4U2YA 4N8VB 5C7XH 3ULUH 1L7IL 4ZUWB 4NUJA 2VL5B 5FKPB 1A6UL 5F21B 2BNRE 3T77B 4ZTPH 5J57B 5I1IL 1MHHB 4QRPE 5DRXB 4NN7B 2VL4A 5DK2A 3ARFD 4H20L 1ES0A 1RK0A 4PTUA 4FNLH 4MHHG 2XZZA 4Z7WB 2HT2D 4UNUA 3NN8B 3UTPE 3U0PB 1F6LL 1J1OL 1BD2D 4IDJH 4LSPL 3A0OA 3UYOD 3WKMH 5FYLH 1F02I 1KT2B 4OJFL 5C2BH 2D7TL 1RUKH 5TE7H 4UDUA 2DQIL 2MWCA 1BVLA 3UYPA 1VSCA 1FH5L 4HS8H 3UCRA 2HFTA 5E6IC 5JIPA 2NLJA 5TE6H 3AUVA 4L4TB 4YHIA 4GG8B 3OKLB 4YQXL 1VESA 1G6RL 1T2XA 1LEGA 4L8SC 1IM9A 2AJYL 3MUHL 2X1OA 5I8KL 4MSWB 1Q72L 1KLGA 1FN4B 2CK0L 4JDTL 3C2AL 3RJQB 3B2VL 4L4JA 3EZJB 1TPXB 3IKKA 5HI4D 2LU3A 1FZJB 1H3PL 1ZS8A 4CDHA 5I0ZA 3DETC 3DARA 4ELMF 1VEOA 1NC4A 4G6KL 4L3CA 1MJ7L 3HZMB 2FL5B 4M1GL 1FYTA 3MLXL 3N9GH 1ZTXL 4LSDA 1O7VA 3OKOA 4WHCA 5BV7H 4RMWA 4ZPTB 3U1SH 3SO3B 1IM9B 1ZK9A 3Q6FA 2ED9A 5CSGA 1YEFL 2IPUK 2YWZA 5HJ3B 1OSZB 1MWAA 1WEJL 1BD2A 1T0MB 4RGND 4UOW1 5JUEL 1PFCA 1IGCL 3MLVL 2F9BT 2AQ3A 5ISZB 1I8MB 1KFAH 5E08L 3FTGA 5DGRA 1YJDC 3RX5A 1A6PA 5BOZG 4KDWA 3VXQA 2YKLH 4G9FA 1KTDB 5E5MA 4QHKJ 5FYKU 1DANU 2A77L 5I1AB 1FGVL 3AAZB 3EYQC 4JQIH 5FXCH 4J23A 3I85A 4BFIA 2FL5A 3ZSTA 4D8PA 3U0TB 5K33A 3T0EE 1SMAA 1T5WB 3VJ6B 1AGEA 4YHLL 3R1GL 3NH7H 4K23H 4NHCH 3QFJE 3HUJA 4R90L 1DEEB 2B2XH 1QBML 4Y5XA 2P1YA 2VLLA 4NUGH 4HG4J 2XWTB 3IGAB 3QZWG 2OTWA 4ONOA 3QQ9C 3MZTA 1T1ZB 2W9DL 3K4AA 2UV3A 4AG4H 2XFXA 4XPBH 5D8JH 1BOYA 2EDKA 2B20A 5IFAL 4MD0B 2R0WL 3KXFD 4J3VA 4JAMB 4YDKL 4U1NB 1XIWD 2NY7L 4H5SB 2CSPA 1DFBH 5EA0H 1NMBH 3KAAA 1QOKA 3QPQC 1D9KC 3LKSB 1MFCH 5EU6B 3CXDH 4ONGH 4AT6B 2CQVA 5IROC 4NCDA 4RGNB 4PJ8B 4U6HB 5CD5C 5BV7B 1A1NB 1CGSH 1X4XA 4M8QA 4MX7A 1K2DA 1F4WL 1TDQA 4I1NB 4XTRD 1FP5A 1WAAE 2B5IC 3EGSB 3HB3C 4L9DA 3FL7A 2ZCHL 5DQ9B 3RWGB 2OQJB 3CSYA 1MAML 2A9MH 3GI9H 1Q94A 3VWKC 5BMFL 2H32H 4WHYG 1T7ZA 1DFBL 1U8QB 1ZOXA 5GGVH 5F93C 5H94A 5D1ZD 4R8WH 1YPZF 2X4NA 4AIOA 4PJHB 4PJDA 4NCC1 1NUNB 4Z78A 4EUPH 1K6QH 1D5IL 3DECA 2ORBL 2OI9C 4GRWF 5JZ7C 3AAZA 4OLEA 3OR6A 4HKJA 4LASL 1X5LA 5EIIA 4NNYB 1T89C 2AI0H 4I5BA 4HUUB 3S88H 3RTQC 3S3SA 3JTSA 2C5DC 4YXHH 5DJ8A 4HGWB 1UKSA 4YWGL 1OP5H 3VFPA 5GZNC 1CE1L 3KYMA 4F3FB 4R0LC 1MCPH 2R4RL 5F88B 3DX8B 4G7VL 4YDLC 1HZHH 4P2RD 4POZD 3O2DL 5SWZA 1S9YA 2G75B 1N5YL 2FSEB 2ZNWA 4NKDA 4KK9D 1BOGA 2FDBP 3FQRA 3LH2L 3MJ7B 3UPAA 2YRLA 1RIHL 4XPFL 4IRJC 3LV3A 4DGVH 1U8HA 3MNWB 1HZHL 4YO0A 3EOTH 1QBBA 5E6ZA 3O2VL 3VXRB 4OZIF 3CPLA 3ILPA 4BSVA 2BRRL 4I2XB 1CLCA 1FZOB 3VFOB 3MRPB 3V4PL 1U8JA 2BJML 1I1AC 3GJFB 5D1XD 3QO0A 3QB7C 2CR6A 2Y4SA 2O5YL 3QULB 2H2SD 2P5EA 1FFOB 2IBBA 3BSZH 3QA3A 1HHGA 5D72L 3O81A 3I75A 4N0UA 2ZOKA 3H2WA 3ULUC 5EU6E 1WUNT 3C8HA 3VMNA 1I3VA 2NY2D 4HD9A 4FABH 3MROB 4U1MA 3X3FH 5I1JH 5D2NE 5IFHL 3ZDZE 4P5TA 5JNYA 1NFDA 5FA3B 1SEBB 5LVEA 4EZMA 5I8KH 1IC4L 4P2RA 4NQEB 3O45A 5EPMB 3FQTB 4X5XB 3R8QA 4M43L 3P40A 1BAFL 4NO5A 2VDMH 4K7PH 2F53B 2VQUA 4PJCB 5DZLA 1CDHA 2IBZY 3VXMA 1OAUL 2AV1B 3EO9L 3V0WH 1UQSA 1IEAB 2AK1H 3Q5OA 3TYGL 1U3ZA 1MVFA 1C5CL 5IFAH 1HINL 3GMPB 5EO0A 3T8XB 5E8OA 4PRHB 5BW7A 1ZSDB 1YN6A 1FC1A 4WW2B 3FFCE 3MNZB 4FRWA 5HVGB 4NRZB 1AGBB 4IRSD 2Q8BH 3RIFF 5ESVB 5CEYB 3VG9B 1HINH 2P5ED 3C2SA 1FNSL 4F9PC 3DX6A 4EXPX 2AK1L 5JW4M 4M48L 5C0NC 4H88L 3OAZK 1A7QL 2YPKA 3MGTB 1AFVH 3MRJB 1JMXA 3FQRB 4WI4A 4Z7VB 2GSGB 2VDKH 5F44A 5B8CC 2OR8A 3L5XH 5ICZA 2BC4A 3O4LA 3GJFH 4PV8A 3WLWC 5I8EB 4KH2A 4CVUA 4L8DA 3I3BA 3UYRH 3U7WH 3QIWC 3QO1B 3J8F7 1A6WH 1IEAA 4ODTH 3D3VD 4PP2B 2PF6A 5MP6L 4O58L 3WJLA 3C5JB 5CUSL 1QLEL 1FG9C 4GS7C 3VU2A 4JRXB 4KKAC 5JDSB 1U91B 3PF2A 4JRXE 2D3VA 3PHSA 4O02H 2E9WA 2XZCL 5T1DH 3L5IA 1CICC 3MJ7A 4J8RB 3ULVH 3BP5A 5KANG 3BH8B 4C56B 2H2PD 4J12A 1KLFA 1OAZH 3RFZC 1FVDA 5IW1B 1FGNL 1S8DB 4EUPA 2MOVA 5JW4Q 4Z7VE 3KG5A 5L2JA 3KLHD 1C8PA 4TSCH 1IL1B 4IRSA 4P99A 4Q9QL 5I1GH 5LGKA 4DWHA 4WV1C 4OUOA 4JDZA 5JW4R 4L4VB 1JGDB 1MCSA 4OQ1A 4X6DF 2BY2A 5LCVH 3K1KC 1E4XH 3KPOB 2PO6B 1DBMH 3I3DA 1CFSA 1FFNB 2FIRT 5K59E 1JNLL 2GUOA 2XKSA 3NA9H 2Q8AL 3THMH 4PR5A 2DQTL 3VFUA 1ORQB 5DUPH 3GIVB 4NJAH 4WV1B 4LPXA 1IAKB 2QV2A 3OJDA 3BQUB 5IR1A 1EJ6A 1Z9LA 4JHBA 5TE6L 1L4IA 2BNRA 2XZQH 3U36A 4KJWC 1UG9A 3I6GB 1LO3L 1Z9OA 2F74A 2EEBA 1A8JH 1CTOA 1U8KA 4NKMA 2VR5A 2IQAA 2VERN 3CFDB 3E6FA 1I8LC 2EXWC 5DQJA 4KKNA 5JHDE 3TWCL 4IHOB 1Y6MR 4FG6C 2R56L 2GYSA 3LCYA 4QXTA 1X44A 1RZKL 4KK6C 1MFDH 3HLAB 5GIRA 2P4AB 5DHYB 1INEL 1DQML 1RURL 4P23A 1KG0A 3MRKA 2AABH 4OLXH 2VABB 5F6HJ 2J1KA 2V7HA 4ORZC 1R3JB 1J8KA 4KUZL 1IVLA 4OCXL 2V9TA 1BEYL 4UTAL 1J7VR 5FDWA 5IBLD 2HTLC 1UYWL 3RTQB 3B2UC 1EZVX 4RFNB 1GOHA 3I9GH 1EMTH 3O3DA 3BH8A 1PKQE 5DRZB 2O5XL 5K59F 5BOPA 2OL3B 4PJHA 3TBTB 1AKJD 2MTPA 5I76B 2PYEA 4UAOB 4U1KB 5J3HD 1PEZA 1QSFE 4YPJA 4OZHA 4KHTL 2YOCA 3DYMA 3ARWA 1NMBL 5F9OH 3L7EA 4D9RE 3CCHA 1P4IH 4JJ5B 2AJSH 3TCXA 4F57L 3P77A 1S7QA 4L4TD 5F1SA 3U46A 1B4RA 5I1CL 4AL8H 4CW1B 1KJ2A 4V2CB 4KRPC 1JTTA 3MRFB 4BSWB 3IU3A 3OKKB 3U0WL 5C9JB 1RZ8A 1YMME 2YBRB 1LMKA 4U1NA 2W60B 5D71H 1OP5K 2CO7B 1ITCA 4O2FA 1NLBL 4QYOB 4RMQA 5IBUG 4JHAH 4XHQA 1HCVA 4OCWL 3PNWB 2OMNA 4W6YB 1HHJA 4Q9BA 1CLZL 3AREC 3JUZA 3T4AB 1TETH 2VZUA 2NY3D 2ZKHL 3P4NA 1NCCL 4K94H 4ZFZA 5KG9A 3IYLW 2IFFH 4NQCE 3MRCA 2CR3A 1JHKL 5GGRY 1VFBA 1AE6H 2CDGB 3O6KL 3QQNA 5CBAB 1MI5A 2APFA 2QTEA 3EYUH 4P2RE 3QFJB 1MCPL 1UCBL 2Z35A 3ULVC 2PW2B 4JY6B 4K94L 3BP7B 4P9HL 4YUEH 4KMTL 3IDNA 4ZUUA 1KYOK 5HGAA 2EC9T 1BOGB 4PRID 3V5DA 2BVQA 4D9LH 4L4TA 3LKPB 4H8WC 1TENA 3CLEH 4GQ9H 5F7MC 1W8OA 5IB5A 3U82B 5HHOD 4YPGA 5HGDB 3QIBD 1JWMA 2A6JB 5J6GA 1R0AH 3PWPA 3FFCA 2Y7QA 2O5ZH 3L3HB 1A3LL 4MNQA 4ZG1A 3MLTB 2NY5C 4JZJC 2I5YL 1LO2L 3QA3B 2VR4A 4ZO6A 4M8VA 3LPWA 2P47B 1DE4A 2I27N 1RFDH 4FQQB 4W70A 3CVHL 1JGVL 2HLFD 5AD0A 1YPZE 4JDVB 1HSAA 5IGXH 5ID1A 2OR9L 4WY7H 5F9OL 3IAGC 4GW1B 1U3HC 3IDJB 2V2XA 4H1LA 4PBVC 3RVTD 2G60L 2VWEE 3CPLB 3ZTNL 4OZGB 1DQTA 3MUGB 4ZPVA 3UTSB 1CZ8H 3ZE2F 2A2QT 4GRMB 1GOGA 1TQBC 1LILA 2FH8A 4I8DA 4YHOH 4LLYA 5J9PB 3P11L 4WFEE 1AD9A 1J87A 35C8L 3IU3B 1JCKA 1SBBA 1B0GB 3IXAA 3HZKB 1X5GA 1XGYL 3DX7A 5F96L 4PLNC 1XGRA 4OD1L 1RZIB 2H3NB 5HSFA 3RIFK 3RAJH 2CLVA 3EOAA 1EHNA 3PGCA 3V0VB 4M6MH 4JN2A 1RZJC 5DMJB 3NCFB 1H5BC 4E0RA 5HHOA 4CN6A 4DKAA 1WICA 1A6UH 3QIBA 1HEZA 4PJFB 5DEGB 4NQVA 3PQYA 3U0WH 2XY2A 3GGWB 4NKOB 2UUDK 4DUWA 3LN9A 4UBDC 3DO7A 2UWEA 3CSGA 4M9OA 5DJ0B 1LO3H 5L8JB 3IJSA 5T1LD 2G5BB 3BKCL 3RKDD 4PJGF 2E7BA 3VD3A 1KCRL 4NDMB 3FMGL 4NGHL 4WCYH 4QTIH 3F7VB 4M6AA 4PJ5D 1O5DT 2ICWJ 1YEGL 3G9VA 1NAMH 1S5HA 2PO6C 4JRWA 4ZD3L 3H6JA 1ZV5A 3KWWA 4PTTA 3J7HA 3QEUB 4CVXB 3AS1A 3I50L 2Y07L 1S78C 4J3UA 1NCWH 4LMQE 3WSQH 4F80A 4LCIH 4DVBA 1D5MB 3QDJA 3IAPA 5AYUL 1MHPL 4NM4L 2JIXD 3FCTB 3QEHA 5KVMC 3SGKC 2WUCH 4NQDA 1TZGH 4G6KH 3WS3B 2BJMH 4LSTH 2Q86B 1KN4L 4HDIA 4K3EL 4WJ5B 3GSVB 4F9LA 2HFFB 3C6LC 2GT9A 2BNQE 3QEUA 4HJGB 3W9DA 1X6LA 4H0HB 2UYLB 4KZEL 2BOBB 3C2AH 1FLRL 1N6QH 5DWUL 1IAOA 4XZUB 3TH2T 3TO4D 2ATPA 1OLLA 4XBPB 1PKQA 1SY6L 2OI9B 3KLDA 4DN4H 4RAUB 1X5YA 3ORJA 2A6KA 4GUPB 4WUUD 3WEXA 4Z0XA 4WO4A 4FFVC 1QFWL 4NRYA 1KTKE 2RHEA 1TVHB 1NAKL 3UPRB 4NKOA 4UIKL 2C3XA 1YNTB 4R4FH 1N6QL 5E70A 1LEGB 1W0YT 4LNRA 1S9WA 4XMPL 3NABL 1TJGL 2IJ0C 1OSZA 2MSPA 3FN0L 5DMIL 4PRPB 5B38A 3NCJH 3HZYA 5DRWB 5ID0B 3QIUC 1DL7H 1R3LA 3V52H 1LK3H 1B0GA 3QWQB 5DI8A 3CC5B 3JTTA 1ADQL 4Z95L 5K9KA 2AJVL 4G8IB 5E2VL 2EE2A 3WL9B 4R26H 4PPTA 1JK8B 5C3TA 4IRJD 3CZFB 3MRRA 1CDIA 4F58H 2BVEA 2VLRA 3RZCC 5CAYB 1S7UB 5EC1A 5I6XC 1XEDA 3RZCD 4QOKB 1N3NA 3WSQL 4N8VA 3MLRH 3C5SA 5DJ0A 3LKNA 5EZOL 3MBXH 4JLRA 5KTEL 2ZP0T 4LOUD 3VGGA 4XVSL 1TQCB 3ZKNC 4U1SB 2DQGH 4P46D 5K9KB 2QSCL 3ARBB 3DNKA 4LDOB 2IH1A 1KCRH 2DIBA 4MZ3A 5DJCA 1WCQA 3GBLA 4GBXD 2UZIH 5HYJD 4OM0L 3KS0H 3VI3F 3ESVF 1GC1H 3NIGF 2BNQA 1L6XA 3KYAA 1EXUB 3X12A 3MLPA 4UT6H 5EPMA 5SWSB 2GSIB 3EYFA 3X11B 2I60L 4KROB 1DBAL 4HX1A 4U05A 5F9JB 3BN3B 3GRWH 2AXGB 1EEQA 3RGVC 4X6EB 2MPAH 1CLOH 2A38A 1Z9SA 3VMPA 3FB8B 1YMMD 2EIDA 2PW2A 2PKDA 4XXCC 4LSVH 2BY0A 4YHZL 3IVKA 1CXFA 5DA4A 1T6WA 1MFNA 2BNQB 3WIHA 2VIRB 2BRQA 1RD6A 1AQDB 3BUTA 4A2MA 4DAGL 4DKFL 5BS0B 3O8XA 1VGKA 1FZOA 5D1QC 5GHWH 1EV2E 1TQCC 2R4SL 5D1QD 4QTHA 3LPGA 5A43C 1Z0NA 3W2DL 3U79A 2QHRL 4X6CA 3RNKB 3V6OE 2MMXA 4YWGH 5B38B 1SMOA 2I9LB 2ENYA 2EYTB 5I18H 3V8CA 4QOKA 1G9ML 4MMZC 4EDXB 4Y4HD 4S1SH 4NC2B 3ZE0E 3O3BB 1T21B 1SY6A 1Q0XH 5D9SB 2KH2B 2KZ1B 1U8NB 4I4WA 5I17B 1NGZA 2C1OA 5SWZB 3U9UA 1P5VA 4XP6H 1AP2A 5TH2B 3U4BL 6FABL 3MSPA 3CX5K 2VXTL 3IDNB 5EU7E 3BKML 4X7DC 3S3PA 3U30C 3HI5L 4TNWK 1UZ6E 3D18B 2GK0B 3AREB 3BISA 3LQZA 3S35X 4HMEA 2Y36H 5EIQA 4OGZA 2DWDA 4JKPL 1OTTD 1M6OA 4AM0A 2LTQB 5FGCE 2D7NA 5IMOB 3WIHH 2JCCB 1OTTC 4S11A 4M9PA 3FQWA 2CK0H 4JDTH 2VXUH 2XA8H 5C0DB 4HH9B 1YEIL 3EOTL 1G7MA 2X9WA 4EDXA 3SGDH 1HI6A 5D7IE 4CJ1A 4X7CC 3JV0A 4JM2D 4Y4KD 3T0ED 5CHNA 3N85L 4MDIB 5DJ2A 5EUOA 1HNGA 4G42A 4RISH 1P5UA 2JJTA 4JGUA 3CZJA 5A16A 4PJIB 1RUKL 5TE7L 1A7PH 5EA0L 1DR9A 3BEVB 3GZKA 1TCRA 3L3DB 3BD5A 5J11B 3UX9B 3LB6C 4A6YH 3OJ2C 1XH3B 4NN6C 2NX5B 5EOTB 1N8ZA 4JB9L 2XNAA 4NNPL 2CRZA 4OZHF 2MPAL 1JGLH 2SEBB 3MUZ1 4I3GA 1MCOH 1HILB 3OB8A 4JY5H 3W0WA 1RZIA 5CCKL 4P59L 3E6HB 5LQBH 2AJUL 4KMLB 5IHZB 3IXAB 2YMXH 4POUB 2VZ3A 3H7BB 1QTYT 4J6RH 1C5DB 5KOVC 3VXRD 2A6IA 5IFJA 4QO1A 4WO4D 2ICEA 4AIZA 4XNYL 1K2DB 4M62L 3EUUA 1GC1L 4LLVA 2NY5L 1TVBA 3NIFE 4X83A 1YN7A 1R5WB 5JR1L 4FS0A 4NQDE 1T0PB 4NWUL 3BQUA 2L7JA 5IR1B 2AKRB 1JZ8A 4MJ4A 3WV0A 4D0BB 4LSQH 1KGCE 4X80L 3BDYL 3HPJB 5ESAB 3VXTA 2IALA 3GKZA 1ZVYA 3DVGB 1UA6H 1U3YA 4OAWB 4FQHB 3LRSB 4UIMB 4AEHH 1IZJA 4OT1H 3ARDC 1F90H 4NSKA 2EH8H 4PJAF 1NBVH 3NPSB 4GRMA 3BYYA 4S0SD 4WW2C 2FX8H 2W9LA 2Z91B 4LSRH 4MJIE 5TPWL 3VFGL 2F58H 5KBNC 3V95A 3D39E 1KNOA 2BFVL 4LARL 1WVZA 3JWOC 5MHSD 2PR4L 4HBQA 1E4KA 2A74B 4JFHD