3B9VA

Crystal structure of an autonomous vh domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIGWVRRAPGKGEEWVASIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWGGDGFYAMDYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords heavy chain variable domain
publication title Comprehensive Analysis of the Factors Contributing to the Stability and Solubility of Autonomous Human VH Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b9vA00
3HCVB 3O2WH 3ARFD 2AABL 5BV7B 1FNSH 3RGVA 2DMCA 3DIFB 4JZOB 3QQ3A 3WUWA 3O6FC 4XH2B 3P4OA 3HUJF 3QNZA 3JV0A 4NQCA 3IDGA 4UZGA 4G8FB 4QXTA 4F3FA 3LRSA 1LQSR 2ORBH 2PTTA 4L3AA 5HGAB 2FX7L 3O3AB 3CCHA 3BPCB 1J12A 4DZ8A 4E42A 4CVUA 4Y4FB 1VESA 5DEGA 4L3CB 3WO4C 4L9LB 2CKBL 4OAWA 3ROOA 3KPQA 2F53A 3QB7C 4DUWA 3AS1A 3I50L 4K23L 4HIIB 4P5MB 4IMLA 1IGFL 5ACZB 3JSSA 4Q9QL 2ZUYA 3SBWC 1BQLH 1AGEA 1BEYH 1LHZA 2UY7A 2W38A 3BKJH 2PYEE 4MXVE 5C07D 1PSKL 5DHYA 1EZVX 3O2DL 3QULA 4W81A 2JTDA 1MFDL 2AJUL 4WUUD 5IKCA 3ELAT 8FABA 1X5FA 4J7RA 5F9WB 5BCAA 2VLKB 2QJDA 3TCLB 3TVMD 4WEBH 5AZ2L 5GRXG 3SKJL 1FNFA 5CP3H 4K2UL 1N6UA 3QIUA 3INUH 5IHLB 2F54D 3H9ZA 5T3ZD 3RVTC 4OZGB 5D7SL 3HKFA 1NQBA 5FKAB 3WN5A 3RVWD 4UT6L 1FORL 5K59E 5MEQB 2YA0A 5I75B 2DLFH 2JIXD 4XNYH 4OLWH 1AGBB 3LPWA 2DBLL 5J7CC 4L8BB 2IH3A 3U4EB 3MLUL 3QFDA 1KJMB 1XGUB 4KZEH 4GW1A 1FRGL 2BSRA 5EUOE 1CXEA 4KVCH 4B0MM 3QXAB 3K8LA 5CKGA 4I48B 3V4PL 3ABZA 5TGBB 1RZJC 1XGYH 4JREC 4XGZA 4M7KH 3S97C 3U9PL 3QG7L 2DQEH 4GBXD 4PJIA 1ZV5A 1VFBB 5FO9A 2GJ6A 3QJFB 4DKFH 4Y19A 5CD5C 3S8WA 1J0IA 3LDBB 3HG1E 4U05A 4Z8FL 3SCMA 2XZQL 3JWOH 3VG0L 3WCYA 3T4AA 2Y72A 1MCSA 4HIXH 5C0JB 4J3VA 1WZ1H 2H3NA 4ONFL 2BVOB 5C0DB 3C5ZA 5FO7A 3O0RH 2ZOLB 5HY9B 1X5YA 3CDGB 3O4LE 5E5RB 1NC4D 3FN0H 4GMSL 5T3XD 5KANG 3WJJA 2W9EL 4ZOBA 5CCKL 4AIZB 1MI5A 3QRGL 4YFLI 4ELMB 1PG7W 5DFVD 2CKNA 1A7RH 2I24N 3ECBA 4NGHL 1ETZB 4RFOH 3EJYC 2RQ8A 4ONGH 3GDBA 4HULB 4OM0L 2ZSVB 3T0EC 4EDWL 1I8IB 4KKNA 4JO4L 1RHHB 3RA7H 5I76A 5L6YH 1KACB 4FQQA 2X7LA 4NO0A 5C2BH 3Q0HA 4JVUA 2X10A 1FFRA 1NMBH 3L3GB 1IC7H 4PJGA 5EZLB 5HGBB 2YD4A 5BJTB 4UAOB 4Y16A 2G9HA 4P2OD 2NY3C 3DV6A 1G9NL 1GAFL 3DX8A 3PV6B 4HKBB 1NCUA 2P5WA 5DZOA 5FOBA 2WV3A 3CSPA 1D9KB 3BRGC 2EO1A 1J10A 4OFPA 1NGPL 3WNOA 4XBEH 4BK4A 3DOSA 3P11H 3B9VA 1EERB 4D9RD 5DVMA 1FL6A 2DRUA 5KN5A 1V05A 1G1YA 2AJZA 5D5MF 2V6HA 3KXFE 5J0BA 4QYOB 4HIEB 3LRHA 4PRPA 3VXSE 4DFIA 4OIIL 3K2UL 4GMTL 5CJOL 1S7TA 4OZ4A 3L7EA 1NAKL 3E8UL 4LGPB 4WY7H 1D5MB 4LVEA 4QHKJ 3RZCC 5C6TH 4JZNB 5E2TL 3PWPE 5GGSA 3MOBH 2FSEB 1H8OA 3EZJB 1G7LA 2BP3A 3MLTB 5IVXF 3B9EA 3P9MB 4FRWA 5CMAA 1LO5A 5E5UB 1CI5A 5FM8A 3GM0A 5BMFL 3CXDL 1C7SA 4YDJB 5F6IB 3VFUA 3O9WD 1LVEA 1ODAA 4LAJH 4PRID 3TZVD 1O0VA 3SJVD 1LO3L 1QLRB 3SDDC 3D69B 3FT3A 4Y2OA 3HFMH 3QIWB 1DANT 3D25B 5C0AE 4JFDD 3E6HA 3GUTA 3FAWA 4EBQL 3CSBA 3MODH 4EI6B 5HTSA 3O6FA 2EIZB 4FFZL 5GJSH 4MA8H 5F7KC 3SGKA 3ZE1E 3MXVH 5SWSA 3EFFA 1DZBA 2ICWJ 2WWMC 4YE4L 2IANE 4D3CL 4JKMA 4YDIH 1YEGL 1Z5LA 2P7TB 4LCIL 5GS1B 2EDBA 1PKOA 4KRPC 4NQEE 2VZSA 3KDMA 4NKIH 2K7PA 3MRHA 4U3CA 3VE0B 2BVPA 2MPAH 1G7JA 3MRIA 5I0DA 5B8CC 3I6GA 5DDHA 1FZMA 1YNKL 4NC0B 5IV2B 1ZTXL 2YC1B 4JFPB 4F33B 3BIAX 3BKCL 5T5NF 2IMNA 2Z31A 2Q20A 5I15L 2J8UE 1U8PA 3H3PH 1I4FB 5KW9H 1LEIA 1MRFH 1F00I 3DECA 4KMTH 5C0EB 5KSAA 1F4WH 4OZHB 4X6FA 1RVFH 5D2NA 5E4IA 4Z7OF 1A3RL 5ID1B 1HQRA 3C08L 4KUZL 2V5RA 3MRFB 4YX2L 4WVRA 3HPLA 4BSWA 4CMHC 1N59B 5T1LA 1JWSB 3RDTB 5HHME 5M94B 5F7EL 2ZJSH 3PQYA 4GS7C 3WKML 3V5KB 4WDIB 1UEMA 3C8KA 4PTTA 5D6DA 1T66C 5AAMA 5LQBL 4WTXA 4NBYB 4WFED 4MQSB 5GRZA 3V6ZB 3GBMH 3FQXB 5JNYB 3DUUA 4U1GB 1UT9A 4XBGB 3MRPB 4S1SL 4P2YA 1XT5A 1QBAA 3KPOB 1RIHH 1LNUB 1JGVH 1OAKL 2A9ML 4PREA 5EPMA 2L7JA 2XWTA 4GOSA 4OT1H 3HAEA 1TDQA 5JXAL 1KJ3L 2VNCA 5JW4M 1NMCB 3VXNB 1AY1H 1BBDH 2JJWA 3L5XL 4ALAL 1U3HD 2OZ4A 3QO1B 1MREL 2ICWI 4KI5F 3C5JB 3PDOB 3ZT5A 5HSFA 1DL7H 1A8JH 1U93A 4NBZB 2FBJL 1UVQB 2K3TA 3RWJB 3QXUA 2YS4A 3FN3A 2COQA 3FRPG 3DBXB 3EUUA 4Y5YB 3RWCA 5F9DC 5J11B 5BW7A 5C0BA 1DN0A 5FHAH 4WI8A 4C83A 4IJ3B 4JRYB 4PGEA 3ZE2E 3NBNA 4XBPB 2AVGA 1MCPH 3K1KC 1F3RB 4M03A 4WTZA 4DW2L 3PGFL 3GMMA 2B2XL 5DQJB 2BVQB 4JFFA 4LPYA 1OSPL 2NTFB 3LIZH 1DEEB 3O3EB 2HG5A 1A7PH 2EIBA 3OMZA 4XP5H 3AU1B 1ZVYA 4DGYL 5DJCB 4I3SL 5C0IB 1IM9A 4H25A 4PUBH 2PCPB 4BKLA 4XAKD 2H2PD 3EYFA 5CFHA 5FO8B 2VZUA 2BNQD 3IF1A 3KYMB 2MTPA 1P9MA 2CDGA 1WZLA 2BVUA 1CXFA 1NUGA 1F02I 1GHFL 4CU6A 3REWB 2FDBP 4JN1H 43C9A 1AGDA 1ZT4A 1YEDA 5HI3C 1TTUA 2P4AB 2R69H 3F6LA 3U36B 1KEGH 3VW3H 1FLRL 5C3LD 1MQ8A 1VFAA 1Z3GL 3V6OE 5KBNC 2QSCH 4JFEE 3VXUE 4GKOA 1KULA 4Y2DB 4X80L 1I9IL 3RTQC 1AQDA 1EFXD 4YGAB 4LCUB 3WS6C 1RHFA 1OP5H 4QLRA 1NGWA 2G60L 2X4NA 5DGQA 2DI8A 3P0YL 5I16B 1AGCB 2BSED 4LF3A 4FP8L 3LKNA 1IC4L 5I1IH 2Y4SA 1KEML 4H26B 1KB5H 4F2MB 2RJMA 1QLEH 1UACL 5E2VL 2FATH 4LDLB 5CJ8A 3ARGB 1RZ8B 5DJ2A 5FYKD 5E1AA 1MAML 1XF5A 2QSVA 3FL7A 3HE6B 3QFJB 5EOQH 4WWKC 1MIEL 1AKJA 5EBMA 3LMJL 4OZFA 3GGWA 5DHXB 5GISL 3MV9A 3HI1A 1QR1A 2PXYA 1IKFH 4UIKL 1BM3H 4R3SA 3QWOA 5EU6A 2WP3O 4MJIB 3IJSA 4IRJC 3CK0H 5E94A 2EXWC 2C4FT 4XNMA 4BZ1H 2YEZA 2C1OB 4JG0H 1BQSA 1G7QB 1I1AD 2HT4D 2Z92A 4JFOB 1TXKA 4ZQKA 2VQUA 4Q7DA 4F7PB 1FFNA 3KLAA 1NUFA 5CBAA 2PYFA 4X83A 4KGLA 3EYOB 5EOTB 1MCHA 2Z8WC 1PEZA 1QSEA 5FKPB 2W0PA 4EQ2A 4MAYD 2NY0B 2WZPD 1PLGL 3DHMA 3MJ6A 5CGTA 3VA2C 1K5NA 3OB0K 4LGRB 4TSCH 5HDOA 5BQ7A 3MLWL 1CD9B 3LV3B 4ZPTA 1OSZB 1CGYA 4UTBH 2OI9C 1A6PA 4OV6F 4JPKL 4J3UA 5DK2B 4Q2ZB 4KTEL 4UT7H 5F7MC 1OLLA 2O26U 4PJCA 3X11A 1SY6H 3UTTE 5E6IB 4FFWD 4X5WA 3UPRB 1TMCB 4ZAKA 4AZ8A 1KIPA 4DGVL 2MSPA 4EUPG 3HHRB 1YZZA 2FGWL 5IROA 1IQDA 5DK0B 5HPMA 4H1LH 1BJMA 2VC2L 3TIEB 3GSWA 5ICZB 3TBTB 3CH1A 3V0WL 5IG7A 4UT9L 1K2DA 1IILE 5HYQB 5E9DB 3CFEB 5CZVH 1NANI 5EUKA 1ZXQA 3VGBA 4P3CH 2MCG1 1UM5L 4PJDA 4LGSB 4PBXA 5C8JB 5TH2A 3O6ML 4LCWD 1RIUL 1KNOB 3X13A 3DMMC 3BZDA 1NBYA 3LQMA 3MRBB 3H3BC 4WO4B 1NDGA 2ZPKL 1WFUA 2FO4A 3CGTA 5FCUL 5IBUB 5HVHC 5K9QI 1L7TH 5F89B 4K9EL 1PG7H 2J88H 3LKPB 3V5HA 5I1LA 3QH3B 1YC8A 3SQOH 4L4TE 3FONA 3VDBA 3S5LB 1TCRA 1BP3B 1H5BC 3MLVH 4I2XB 2XQYK 2XFXB 3DO3A 3UAJD 4WV1C 1JPGB 4R7DB 1C5BL 1V7NH 2CMRL 4MJ4A 5L0QC 1JZ2A 1A7OH 5CIPA 1TNMA 1JPFB 4X4YA 4B7LA 4KVNL 1LDPH 1QSFE 3TP4A 32C2A 4C56B 3S34H 5C09A 2VIRB 5E7BA 5D7LE 1WITA 4KJYB 2VXVH 4FNLH 1RZKC 2ADIB 4MCZB 5DXWA 3WD5L 5AWNH 5DJAA 3RQ3A 4DVRH 4LCCA 3L3KA 4AMKH 4APQB 2CDEB 1ZHNB 4LHUA 1DQJB 1KJ2B 1IRAY 3X3FL 3P73A 3KYKH 2AXFB 1ZVHA 2CDFB 1UB6B 2J12B 4KJPC 5IB4B 2RCSL 5KAQG 3BT2H 3G6JF 3I3DA 3RPKA 1N5AB 5DMKB 2NW2A 5EOCJ 5JIHA 2BNUA 4U1LA 5FF6B 2ZSWA 4I18B 2CXKA 2A6KA 2C3WA 2ZUXA 5TDPB 4BA8A 1UWXK 5E0QA 2MCPH 1AE6H 1V3KA 2CJUH 4YUEL 3VXRE 4FQJL 3MUGB 4NQDE 1P5VA 4UUJB 1KCRH 3JVGA 4QRQB 4HXAL 3RIAF 3N9GL 4XXDB 4G9DA 4JM2D 1A7BA 2C5DC 1OHQA 1IGCL 4O58L 1MUJA 1P4LB 3NTCH 1PEWA 1CGSL 1Q1JL 3OG6B 3L3DA 4PRNA 3WIIL 4XP6H 2VDQH 3D39A 3T4YB 1LEKA 3KNBB 3L7FB 1AD0B 2E8ZA 5ITFA 3UJIL 3NH7L 5F88B 1T89C 2ENYA 1FNEA 5KJRH 5D7IA 4X98A 5MP6H 4NQCE 1ED3A 1W0WA 4HX1B 2ID5A 5DVLA 1FZJA 4IOFC 1J0KA 1JHKH 1WV7T 3QUZC 2YSSB 4V2CB 2WW8A 3JUZA 4K8RH 2Z4QB 1ZA3A 2W0KA 1VEMA 2YPVH 3VFNA 2NTSP 3WDJA 2OCFD 3OF6D 4JDTL 4JGMA 5ISZA 2FECI 2Z93B 4DEPC 4ZS7L 2F53E 1MCFA 3A67L 3AM8C 2OSLB 1AI1H 2IPUG 4NRXA 3L95B 1F11A 3DROA 5DJ0B 1KIRA 1YECL 3I75A 1JHTA 2EH8H 4QTIL 3EDKA 3RU8L 4J3XA 5IIEB 4XPAL 2BSSA 4RQQB 3MLYH 3IJYB 5LJYH 1OD7A 4FQLL 3VFTA 1RK1B 3MRQA 2E3VA 5DD5H 4LL9A 2PW1B 3MRNB 3GJFK 1JZ8A 4UNUA 5DRWB 4U6YA 1OAXL 4X6BB 2DQTH 4GQPH 4FOMA 4GKNA 4KKCD 4PRHB 3DXAB 1CIUA 1HNGA 3QXDA 1HIML 3C6LC 1ZWIA 2V17L 1I1RA 5D1QA 1E4KC 3ULUC 2VLLB 3V6BR 2FCBA 3GMPA 4MXQC 3NZ8A 5K9OA 2BOCA 5C08B 4M3KB 1CICA 1ZS8B 1FL3B 3CVHB 3JV4B 4XXCC 2DWEB 4U6HB 2YA1A 3IDIA 4JREB 3S4SG 5JMOC 4U1KA 2ZG2A 4X6CA 2FJHA 4XCNB 2FD6H 3O8XB 4JHBA 4PS4H 4ZUWA 3WJLA 3AS3A 2UWEF 3HPJB 5IHUL 1OPGH 4Z9KB 5I18H 1DANU 3FJTA 3TPUA 3MO1B 3EDJA 3PL6D 4Y4KA 4G8EB 3LEVH 4J8RB 5FECA 4IMKA 1FO0A 1ZLVK 1N7ML 1VPOL 2FJFB 2DWDA 2GJ6E 4I5BA 3AVEA 2OZ4L 1I85C 3PNWB 4Y19E 2Z8SA 3CVHH 4JM2F 5F1IA 3HZMA 1U91A 1UWGH 5IVNA 2YXFA 3CXHJ 5FYJH 3P77A 4XPFH 4ZTPL 4MXVF 4PJEA 1VB9A 5B3NA 3AS0A 3OKNB 2OR9H 2AGJH 3ROLB 1RU9L 3QHFL 4NNPH 1AXTH 5IP4A 5SV3A 3WFEH 4P23A 2J1KA 4GLRH 5KSVA 1CQKA 2XV6B 3CVIH 4TULL 3C60C 1NMAH 1UB5B 1DLFL 1ZA6B 5FUOH 2ESVA 1J1OL 3DRQB 2GJJA 1MI5E 3ZSSA 1EMTH 3T0EB 4N0CC 3RAJL 1GIGH 2C7UB 1DVFD 1ZK9A 1T3FA 1R3IL 2NCMA 2R0WH 2IBZY 4P57A 3TYFA 5KVDL 1ZLSH 5BRZB 1A7NL 5DMGD 5GS0D 4KY1H 5IW1B 1JNNH 2CLZA 4M43H 1OTTD 4RGMC 2NPLX 1GGBH 3SDCA 4N0FB 1T21B 1JWUB 2NY3B 4HEME 3SN6N 4WV1A 5J13C 1KTDA 3RX5A 2NR6C 1TVBB 1NANH 4PJGE 1U95A 5FIEA 3LQAL 5EU3B 1NAMA 2VLME 3L1OH 2HRPL 4LFHD 2BC4B 2P5WE 4HAGA 1HHGB 1DQQA 2X4UB 3MOAH 5KS9B 2G5BA 5HHPB 5TPWL 1CLOH 2X4SA 4OQ1A 3ZDYE 2VQ1B 5DD3H 1A14H 3BW9B 1FNGA 1NCWH 2GTWA 2IG2L 3W9DA 4OZIB 5EU4B 1KENH 3PGDB 3THMH 4PRPE 3VCLB 3ILQD 1Y18A 3WHXB 4EIGB 4HDIB 3EDFA 3WDIA 3U7WH 4NP4L 2FHFA 1M05B 1KN4H 5F7DA 3GMNA 4X6EB 2BNRB 1NCDL 4GKZB 4KRNA 3EYQD 1JGDA 4XPTH 5D6CB 1G6RA 1B88A 3MNVA 5IFJB 3VWJC 4K7PX 2R15A 1MJ7H 3SDDB 1M6OB 4WW1A 1MVUA 3U9UA 4M62H 2H8PB 2RB8A 3EHBD 3ZKNC 4UOW0 2AKRB 3Q6GH 2X09A 2X4OB 2D3VA 4M5ZL 3G5VB 1T4KB 5SWZB 2R9HC 5I1CH 1F58L 4U0QB 1DDHA 5DJZB 2D03L 1EH9A 3NCJH 2LVCA 1S7SB 1HI6A 4G5ZL 5T5FL 1RUPL 4PBWD 3L3IA 4NKDB 3UC0H 4K3EL 3HMXA 2J6EA 3EO9H 1VACA 5DTFA 4PV9A 4KRPB 1C12A 5EDXA 2I9LA 4Z7VA 5SWSE 1DBML 3BEVA 5EC1B 3F7VB 4HPYL 5EO1A 1U6AL 5DYOA 4XX1E 1JWMA 1QFUH 3FFCA 2IFFL 5IB5B 3FO1B 1U8HB 1RZ7L 1INDL 2XA3A 5SX4I 2VLKD 3WIHA 2UUDH 2YXMA 1Q72L 5BS0B 1AXIB 3RL2B 3TIDA 1ORQB 3L9RB 4PJ8C 4R6UA 3BP4A 3MNWB 5HDQH 4Y0GA 3MJ9H 1RI8A 1HKLL 4M02A 3JV5A 3EOBB 2CXGA 2QR0B 4P46C 3BGAA 4ODBD 4HJ0D 4ZNEA 1YN7B 2XOTA 4YPGB 1X5JA 4LNRA 3QBTB 5D8JH 1IGYA 1P6FA 1QBMH 4G6MH 3F5WA 5L7XH 3TFKD 5C0CA 4GRLC 4OSUL 3OJDB 4JKWA 4NRYB 1FAIH 4JPWH 4UTAL 1D5XB 4KK8D 2PTVA 3O11A 25C8H 5FGCE 4L5FL 1ZKAA 4X7TB 3D9AH 3GMQA 2P8LB 1J88A 4FTVA 2A0LD 3RWDB 4IOIB 3TH4T 4LDEB 2AQ1A 3PQYE 4PIRF 2M1KA 2R23B 2J8HA 1KLFA 1FGNL 1T20A 5DQ9A 2YPLA 2VLJA 5GHWL 4OFKA 5JHDB 1LK2B 1ZHBB 5IHZB 5DD6A 5HYEA 1FH5H 3OKMA 2YUVA 5HGDA 4QRRA 1SVCP 4XCYA 5JUEH 3HR5B 1D6VL 1HINL 5T33H 2GK0B 5J56B 2DQIH 3BD5A 4FFVD 3BP7A 3BWUC 1VEOA 2AERT 2ATKB 4LKCA 2JF1A 4KK6C 5AYUL 3BGMB 1LE9A 1EEYB 2C4FU 4WFGD 3WHE0 1H3TA 5B39A 5EOCH 3UTQA 2CSPA 4EXKA 2XZCH 6FABH 4IHOA 5J6HA 1M7IA 3G5YA 3MACL 1LO2H 1ZEAL 2ZUQB 1BAFH 2A77L 3CFDB 3BPNC 3GSVB 5I1AB 4GW5B 2HA1A 2A9NH 2J8UF 4M5YH 2BJMH 2YN5A 5HGHB 2G2RA 4KDTC 1YNTB 1VFUA 4LEOA 5C0BE 5H94B 5GIRB 1Q9WA 3FTGA 3VD7A 4P2RB 4V1DA 1XR8B 2D2OA 4N8CH 4PYGA 3QZWG 4L29B 3LKOB 3RNKB 1DE4B 4JFFE 1T1YB 2I5YH 2X40A 2CKBB 2OX5A 1KG0B 4Z76A 4AL8L 1U2CA 4PJBA 1G7PB 1IGJB 4D0CA 3OJMB 1TJIL 2AABH 3VD9A 1D9KD 2P42B 4XMLL 5DUBB 1IKNC 4MGXA 2VXSL 3QAZC 2CUIA 1G6VK 3UJTL 4OLUH 4DVBB 3BH8B 3DUSA 4H5SB 1FG2B 2GTZA 4Z7WA 3IXTB 2FX7H 4J23A 3IDYC 2CUMA 1HK6A 5EWIL 3GI9L 5DJ8B 1HNFA 4ZFZA 1K4CA 3KR3L 2CKBH 5CSZA 4HWBA 5MENB 1OAZL 4YDKL 4N5EC 4ODWA 4O4YL 3EJJX 1JJUA 2KH2B 1C1EH 3I50H 4K23H 2HKFH 2VZ1A 3ZE0E 3MRLB 3L3JA 3OGCA 1IGFH 1S5IL 4Q9QH 4AEEA 4PJ9A 1UWEL 3LB6D 1MVFA 2F8XC 4JRWA 1C5DA 1AR2A 1PSKH 2VWEC 1S9XB 1KGCE 4YHYC 1TETH 4R2GD 1MFDH 1PVHA 2AJUH 4U1MB 3BPLB 3JBG7 3QIWD 2QQLL 3FB6A 4GXUN 4WW2C 4WWKB 5L9DL 1RMFL 5F7HA 2GFBB 5E2UH 4XVTH 5AZ2H 3SKJH 1JIBA 4K2UH 4AEHL 5B4MC 1QFPA 5I74C 1WTGT 3AXLB 1YY9C 1MY7A 5MEOA 2VL5A 3I02B 5E4EC 5EN2B 3PGCA 1RURL 4UT6H 1FORH 2F19L 2RFXA 4NQVB 1JRHI 3PABB 1KPUA 4JFQA 2Y23A 4IRJB 3W0WB 1FZKB 1NCCL 3MV9E 4KJQC 5KAQF 4LEXL 5C9JA 4H88L 2D9QB 4ELMF 5J12B 2A38A 3DGGB 5ETUA 3QUXA 5EU6E 2QL1A 1U8KB 5FUZL 1DTUA 3MLUH 3TA3C 4HFUL 4FXKA 2KKQA 2BK8A 5L8JB 1AD9A 4M8VA 1X6LA 4ODHL 3ULVL 4KJWC 4K7FA 3DRTB 3V4PH 1UJ3C 4U1NB 4KK5D 4XX1G 1T5WA 5DSCB 1LP9A 2JB5L 4JPIB 2IAMC 4FXGA 2AJVL 3QG7H 3TBSB 4HXBL 3KHQA 1WAAA 4X9BA 2BXZA 2IMMA 4LLQB 4KI1A 4TUJB 1G9ML 1JTOA 3QPQD 1QSEE 5IM7B 5JQ6L 4PJAB 2WQRA 1MH5A 5EO9A 3G6AA 2OI9B 2APXA 4GRWB 4HV8B 1RJZA 4Z8FH 1DBBL 4ETQB 2XZQH 3VG0H 1OAQH 1T1ZA 1BZ9A 4ODSL 4WHTB 1PJ9A 2P5ED 3LHPL 3T77B 3W39B 4UQ2B 2DKSA 3OAZK 3RDTD 4H0IA 4LLDB 3B9KA 2H26A 3BJLA 5I2IA 3QIBB 3Q2CA 3VFVA 4I4WA 1J5OL 4IIQC 4PJCE 1J8HD 2XWBB 4XNXL 4GMSH 5IQ9A 3OAYK 4EVNA 1F97A 1CFQA 5ERWA 2W9EH 5GZNC 3MXWL 5CCKH 5DFTA 4U1JA 1JGEA 3IAPA 1FO0L 5GJTL 2OMBA 3MV7A 3MREA 3RIAK 1Q0XL 4F9LC 1AO7B 1U8MB 3EJZD 5C3TA 5EO0A 3BQUA 4JFEB 1NJ9B 4H8WL 4HJJL 3H9SB 3NIFF 5IF0A 4OM0H 5HHVL 3T0BA 5B22A 5BVPL 4EDWH 5FXCH 5SX4H 4U1HA 1BQHB 1N4XL 1J0JA 5D71L 3U46A 2AXJA 4YHOL 4W6YB 4I13B 4PJDE 2R2EA 3AAZA 5H37H 1WTLA 5HVHB 1DUZB 2OR8A 1OTSD 4KH2A 1CTOA 3RY4A 4DKEL 1YY8A 4JLRA 2VO5A 4L8SC 4CVWA 1G9NH 1GAFH 3HUJA 4PJFB 4NM4H 5JW5B 3HAEG 2GI7A 2WBJB 2FHBA 2NZ9D 5M95B 4HWZB 3ILPB 1NGPH 1MFBL 4JRYD 4BFBD 3SGDI 4CVXA 5JDSA 3LKQA 1MCOH 5L0QB 1R5VA 4ORGA 3CPLB 5HD8C 3NFNA 5ENWB 3ZKMC 1FE8H 1ZHKA 3CIQA 4IOSD 2ILLA 2XXCB 4HWNA 3ARRA 4OIIH 2ADGA 3K2UH 4GMTH 5CJOH 1F5WA 3B83A 1NAKH 2MQ0A 3E8UH 2GK2A 3FQTB 3QDJA 3ULVE 2EE2A 3V95A 2OTWB 2WLYA 5E2TH 1NAML 3DETC 3QDGA 1HKFA 2OL3L 4LLYA 3GM8A 2D7QA 3EAKA 3VWKB 4OLYH 5ADPH 5BMFH 3CXDH 3SE9L 4OLZH 4NNXA 2E7HA 4O2EA 5EIIA 1FNHA 1X5XA 4QGTA 2XN9B 3UPCA 1NFIA 3M17B 4UIMA 1LO3H 2R0LH 2FEDD 3GMOA 3WLWD 1NGZB 3I85A 1P7KA 3DTXA 4EBQH 3E6FB 3NGBC 4ISVB 4FFZH 3U4AA 3PIQB 2W91A 1S7QA 1II4E 4KKAC 1A4JB 1IM3A 4U1SB 3PWVA 4YE4H 4D3CH 2XNAA 1YEGH 5FYJU 4LCIH 2DYPB 2HLAA 5DJDB 4KKLD 2ENSA 1S8DB 1HCFX 1XF3B 4R7NB 3MRDA 1OL0A 1VKXA 5CBEA 2EC8A 3B4NA 4E5XA 5EBWA 3ARGD 2XA8L 4C55A 4P5TA 1YNKH 4PLJC 3ULSA 1ZTXH 3HE6D 4JCMA 4OCRL 5B38A 3BKCH 1R3JB 4OKVB 1FL5B 2N7BA 5I15H 1DR9A 3LRGA 5D7IE 1FYTA 4WCYL 3HMXL 2J6EL 1DQLL 1A21A 2DKUA 2M8XA 1NGYA 1JK8B 4DEPB 2MWCA 4YNYB 1DQML 1A3RH 4MJID 5TQ2L 4QHMA 1Q94A 1CDBA 3ARFA 1I1YA 5A1AA 4YX2H 3EIFA 3HLAB 3HC0A 2XPGA 4D0DB 2Y25A 4Y5XC 5ISZE 5E8NA 3EFDL 4OZFG 1H8SA 1SEBA 3WKNA 5F7EH 3WKMH 4A2MA 3QDAA 1SVZA 1AJ7L 4FQ1H 2NY0D 5AZEL 1TQBB 4CMMA 5LQBH 1JZ6A 3SO5A 4MNHA 2HT3C 1IBGL 4LVHC 3O6KL 3DI3B 4MAUH 1NBVL 3EDDA 5CEZD 2J5LB 4JY4A 2EH7L 5DQDL 5I17B 2HFEB 4F8TA 4A6YA 4S1SH 3DYOA 1PX4A 1WBZB 3BDYL 4MNGB 4QT5B 5F7YC 1J7VR 1QZ1A 2A9MH 3ARZA 4ZFGL 1JFQL 1VGKA 5H35A 1MHEA 3C6LB 1X4ZA 4B53A 5JXAH 5C07A 2JK5B 5E6ID 3RKDD 1UZ8A 3ZKXC 3GBNH 4LKXA 3CZFA 3R1GL 3L5XH 4ALAH 1OB1B 1MREH 1H3WM 2IFGA 4GRMB 1S9VB 3ULUL 1RJYA 3ZYOA 3TVMA 4WU5A 5EBLB 2X4TB 3TNNB 4XHJC 1P1ZB 3G9VA 5DLMH 4JQXA 4ESKA 3LN5B 4WNQB 1IL1A 1N2RA 2F54A 2NY6C 1QLFA 2R1XB 3BH9B 5E9DD 4ZFOA 4X6CE 4YBLB 3RWHB 1T22B 3QEHB 5D5MA 2X6MA 1EO8L 2JIXA 5GZOC 3GSUA 3KPRE 1T83A 5E8OB 2DQUL 3PGFH 4DW2H 2B2XH 3FT4A 3U0TA 1QSZA 1CXIA 1OSPH 4HS3B 2FB4L 1NGXA 3MA9L 3RNQA 2HTKD 1JF1B 4WO4D 3MGOB 4LRNL 4YO0B 4HFWB 3ARDD 4U3XA 4DGYH 2NY5C 4I3SH 5HDBE 5IVXA 1B0RA 4AM0B 1GPOL 1WF5A 3RGVB 3KVQA 3JTSA 3QQ3B 4GBXA 4PJEE 3WUWB 3C60B 1WT5A 3P4OB 4Q0XL 4F3FB 3LRSB 2PTTB 1K6QL 2OQJB 3CCHB 3RY5A 4E42B 1X5AA 2ESVE 1FLRH 5KOVC 2IGFL 1U3JA 4C56D 2BFVL 3ROOB 1I3RA 3FT2B 3KPQB 5E8PB 4APQD 4X80H 1I9IH 1X5IA 1MCCA 5JW3L 1NC4A 1CT8A 5J13B 1R0AL 1JYNA 1GXEA 3LPFA 2IADB 2G60H 1AGEB 3JWDC 1JV5B 5GSVA 4FQHA 5L8KB 2VXQL 3P0YH 3IFPB 5C0RL 1IC4H 1T7YA 1CDCA 3QULB 2NY4B 4OGAD 1KEMH 5IKCB 4D0BA 1GGTA 1F3DJ 4G6FB 1UACH 5E2VH 3VRLF 1BGXL 4LHUG 3PWJA 2W59A 1MAMH 1YPZB 35C8L 1MNUL 3WFCL 5DWUL 3LMJH 1FVCA 2HMIC 1UKQA 1Q9KB 3GI8L 4MA7L 4NHUA 4NKMA 4UIKH 4P2OA 4G9FB 3U83A 3SGDH 4QRSB 4OD1L 1BWWA 1KLGB 3EOTL 5ILTL 1CXHA 1UCBL 2AI0L 1YYML 3MRKA 1XAUA 3VWJB 1I8LA 3BZ4A 4Y8DC 3PG2A 5IMLA 3QFDB 4L8CA 4N1HB 3RWFA 4BK5A 4EKXA 2VZTA 4U4BA 1KXVC 1OGAB 1U8IB 1GZQB 3C6SB 4XTRD 1PW3A 1K4DA 1OLZA 1NPUA 3IGAA 4PJIB 4G42A 1AP2B 1CG9A 1PLGH 5JW4R 2BRQA 3LVEA 2GJ6B 3BVNB 3JTTA 3ZDXE 1KTLA 2D4DA 1NL0L 4L1DA 2HWZH 4YWGH 3MLWH 2DTML 4JQIL 4ZTOL 3CD4A 3VXTA 3DNKA 4JPKH 5EU7C 5IK3B 1RQ5A 3V6FA 4BH7B 2H3NB 1KYOJ 3ARVA 1RD6A 3C5ZB 4ZODA 5TE6L 4EDXB 3RIFK 2EKJA 4BM7A 2IJ0C 3O45A 3O9WA 4P3DB 4PRIA 1TVHA 3B3IB 5DHVA 3TZVA 1KLUA 3SJVA 4DGVH 4NZTL 4RAVB 4ELKB 3MFFA 4HBQA 2FGWH 1SYVA 3FFCE 3DI2B 4OCNC 5JOEA 4JFDA 4IRSC 2DI9A 3RVTD 3OR6A 3X3GL 4PD4J 2VC2H 2DQDL 1I1AC 3ECBB 4RRPA 1JUFA 4P46B 5E56A 1CE6B 3V0WH 3HE7C 4AH2B 4UT9H 3MA7A 5ICYB 3KHOA 1SJHA 1F4AA 4PPTA 3G08B 3DXAD 1UM5H 3AB0C 4YDVB 5E00A 5LVEA 3RI5F 1A2YA 2VL4A 1CDUA 4I9WD 4ZNEE 4N1CA 3FFDA 1CFSA 1NUNB 3QI9C 5H2BA 5C08D 1RK0A 2X70A 2QHLA 4YHML 4DJMA 4G6KL 2ZPKH 3KPLA 5MERB 2XTJC 3VFRA 5C0CE 4QY8B 1FFOB 4Y16B 1RUML 2OYPA 3DV6B 3O8XD 5F9JA 3DX8B 3KPTA 1EV2E 4M7JH 2P5WB 4GXUM 4QCIA 4K9EH 4AK1A 5CD5D 4HIHB 4RMWA 3FCTA 1VSCA 3DO7B 2Q3ZA 3U4BL 1ZGLP 4FTVE 1KJVA 1BBJB 4URTB 2F5BH 4G3YL 4X4XA 5E1HB 2EDJA 1MHCA 3H42H 3ARYA 5CHNA 2ED7A 3ULUE 3OBAA 3BXNB 1FL6B 1J0YA 1C5BH 2CMRH 2YPLE 4WFFD 2VLJE 3FHQA 4X7SL 2AJXL 1MLCA 2A74B 3QDME 2R56L 1WWWX 4QRRE 4QNPF 1ACZA 4LSUL 2P8MB 4IS6A 4HZLB 3WD5H 2C3VA 3MUJA 3AREC 4HHAA 3WLBA 3X3FH 2AQ3A 3DURA 4KQ4L 4JHZA 4JKKA 3LSOA 3BPNB 3GSOA 4R0LC 5CMAB 3VFPA 3WFHB 3EJYD 3NAAL 4XMKL 3NIDE 4M6AA 3T0ED 3H9HA 5AAWA 3WXWL 3T0WA 4OCMC 2AXGA 3FT3B 2DLTA 3FB7B 3LN9A 1E4XL 4CNIA 1OAUH 5BRZD 3MX0A 5BO1L 1FCGA 4YUEH 3UROR 3WE6A 5DRNB 5AUMA 4Y1AB 5IJKC 2BVTA 1MWAB 4MQ7B 1U3HA 2NY3D 5SWSB 4HXAH 3N9GH 4V1DE 2DICA 2A6JA 2EDHA 1HSAB 3G6DL 3GSQA 2VYRE 5DRXA 1IGML 1IGCH 1FPTL 2Z0BA 4O58H 3QAZB 1CGSH 1Q1JH 1W0YT 1AFVL 3FOMB 5D7JC 3MRHB 1CDYA 3WIIH 5L2KB 4PJBE 1F6AB 3T65A 2DIAA 1WK0A 5IB3A 2ADJA 3L5WA 3UJIH 3NH7H 4HUVA 1JBJA 3IDYB 4MJ2A 5KSBF 1M7DA 4ONHB 1D5BB 3LKSB 3GNML 4PB9L 4FQ2L 2Z31B 5D2LE 3EO0A 2VZVA 5E5MA 1P84K 1LE5B 4YDLC 4Z7WE 4MSWA 4PRDB 3QQ4A 4G8GB 2DQJL 3QQ9C 4UDUA 1OWWA 3E3QC 5D2NB 3CUPA 3D18B 1O7VA 4JDTH 1YC7A 2EDXA 5I8KL 3UX9B 4ZS7H 1RZIB 2ARJA 2BNRD 2BNQA 4BSWB 1XCQB 2LU4A 4HQQL 3TBYB 3GSRB 2VXUL 3SDDD 3GIVA 3T8XA 4YGVA 1LD9A 3SDXA 1YECH 3EYVA 4WW2B 3RU8H 1CDJA 5AD0A 4XPAH 3EOAA 3C8KB 4PTTB 5SWZD 1CXKA 1G0XA 2V7NB 4ZSOA 1Q9LA 4FQLH 5GGUA 1CU4L 1YMMD 3GIZL 2ZUVA 5I74B 1E4WL 2C1PA 3FQWB 1TLKA 5E4EB 8CGTA 4RMTA 2WWMD 1HSBA 3UYOD 2NX5B 1OAXH 2EC9T 1Q9OA 5EPMB 4KRPD 1OAYL 4PJHB 4F7EA 1CGWA 3DX6B 3HZYA 2R2HB 4XZUA 2YRPA 4RMRA 2V17H 3JWNC 3TA3B 5HVWA 2GJZA 4G8IB 1A9BB 4PGDB 1GSMA 4ACPA 1N3NB 5BS0D 3S36L 3VI3F 5FHBL 1UJ3B 1WC7A 1TZGL 4LAQL 3P9LB 5TFSL 3PHOA 4Q58C 4A6YL 5JOPD 4Z78A 5IBLC 3TN0C 1QBLL 3N1MC 5IHUH 4MLSA 1F6LL 5C0BB 5C0NC 2KQNA 3G5XB 1LP9E 1MFEL 3HAEH 3MRCB 4HPOL 3AROA 1WAAE 1NCAL 5KVGL 1PKQA 1N7MH 1VPOH 4X5XA 3GMMB 5IW3A 4JFFB 2OZ4H 5J9PB 3T1FA 4D9QD 3VFMB 3FQNA 5I8OL 1A1NA 3PHQB 5GGTA 4IIQB 5F3HA 2WMPA 1HZHH 2BVEA 4TNWK 1T66D 4ZTPH 1IM9B 1E4JA 3JUYA 3ZDZF 3TJHC 1BLNB 1RU9H 5T3ZL 3EYFB 4ZFOL 3QHFH 3G6JA 5KS9F 4MAYA 3IF1B 4D9LH 1VFMA 4LASL 1NFDA 1UKTA 1J87A 3UCRA 2XG5A 4TULH 5JHDD 1J1OH 43C9B 3WIFA 4OZIF 5IMOA 3MJ7B 4RNRB 3RAJH 3V79C 3MV7E 1R3IH 2WK2A 1P6AB 5KVDH 1A7NH 1LEGB 4LSRH 1MCBA 2E7LA 2DDQL 2ZUWA 3PL6C 1NEZA 3HS0B 5CZXC 4L8SB 2B1HL 1CZ8L 1RSFA 1BX2A 1CTNA 3MOQA 1NGWB 3DLQR 5LGKA 2ITCA 4ZO9A 3GSXB 5HHXL 1T0MA 1B2WL 4YIQB 4YAQB 5FA4A 4ODUA 1KFAL 3LQAH 5A43C 4OTXL 4NDMA 4X99A 3OKLA 3HUJE 5B39G 5INDB 1KIQB 1X5KA 2DLIA 1QOKA 2UY6A 3BPOC 5DI8A 3V4VL 1BVLB 2OMNA 4PTUA 4L4VB 5E1AB 5TPWH 4P2RD 2R29L 1HXMA 4LCWA 4PJ7B 1JMZA 3FN9A 3GHBL 2QV2A 4MMZC 5T3XL 1WUNT 1MFCL 3MYZA 4GW4A 4PJXB 3ZHKA 2R0KL 3HI1B 3IS1X 2PXYB 1NLDL 5EIVA 3N0PB 4R3SB 2EKSB 3QWOB 5I66A 1S78C 2AEWA 1HDMB 4NP4H 4NKOA 3IJSB 1HOCB 1S5HB 1TJHL 4LQFL 5HYSB 5DMGC 3QDJE 4M9PA 2YEZB 1NCDH 1SJVA 2EDEA 5T1KB 5HI3D 2DQCL 1OTTC 1T04B 4Z6AT 5CBAB 5HYJA 1A7QL 2PYFB 3QDGE 1CLZH 1F3JA 1FN4A 4JDZA 4OZFH 3N06B 4M1GH 2Q7YA 1MFNA 1HQ4B 2ERJC 4OKDA 4M5ZH 5I1KL 3NGBB 5MEND 1EDQA 1OP5K 1F58H 1LO0L 2D03H 2BCKB 5GGVL 4M7LL 5GRWA 3AC0A 5BQ7B 3FAXA 1PFCA 1CXLA 1RIVL 5T5FH 4Q6YA 4HS8H 1T1WA 1E27A 4K3EH 4NHCL 3QO0B 2DLGA 2GT9B 1XGTB 1DBMH 1YEJL 3GK8L 4HPYH 1U6AH 3RWGA 2IFFH 1NLBL 4ZAKB 3ILQC 1RZ7H 1INDH 1DQTA 2NNAB 5CD3B 4WWKD 4I3RL 3FRUA 1Q72H 2UWEA 3DSFL 4HLJA 1NUDA 1PYWA 4PY7A 3SE3A 1EAPA 5SWQA 1HKLH 4CADA 4U31A 1ZGLM 2R1WB 4IRZL 3K46A 5FDWA 1ZT1A 5CJQL 4Y4FC 4IRJD 3EHBC 4BELD 5KG9B 4JM2A 3W0WD 1FYTE 5CJXA 4JO2L 3R06B 4Y5XB 1JL8A 1QPPA 2E6QA 3Q5OA 15C8H 1C08B 4UTAH 4LSTL 1NDGB 4MMXC 4RDQF 1HHIA 4L5FH 4OJFL 1VHPA 4ZUSA 3MFGB 4EI5C 1A1MA 3T08A 2GKIA 3NN8A 4YZFF 1Z9OA 1T1XB 1EEZA 5IWLA 3ESUF 1EA9C 1FGNH 1N5YL 1TCRB 1H3GA 4YBHA 5GHWH 3OF6A 1GGCL 3WEXA 1PX3A 2YN3A 2F8VA 4JO3L 1D6VH 4NOBA 5IOPA 4FQXA 3ZKXB 2KUTA 4AENA 1ITBB 3QIBD 1YEHL 1R3KA 2QQNL 5C09B 4Y4HC 2Z35B 1P7HL 5KTEL 3L3KB 5C07E 4HKZB 1BWMA 3P73B 3C09B 4WUUE 5MHSD 3JWOC 2A73B 3FO9A 3PWLB 1FNAA 2NY6B 3GJEA 4O2CB 3MACH 3PDGA 3D0VB 2A77H 1AO7D 1G7HA 4NYLA 2CLRA 3H7BB 3LEXA 5D9SA 5CIPH 1JN6A 2SEBA 3H9SD 4U7MA 5JO5A 2ZSWB 1FQ9C 1PD6A 2A6KB 2O93L 2W0FA 1VFOA 2DM2A 4ZYKB 4RWYL 4G7YH 1KPRA 3C5SA 2F54E 5T3ZE 4L4JA 2FO1A 1KCLA 1URLA 1S7WB 3DMMD 2BOBB 2J2ZA 5D5ME 2NXZC 1I7RA 2PW2B 5C0FB 3CMOL 4NPYA 4P4RA 3DX7B 1I8MA 1R3LA 3SKMA 3UTSD 1YEKL 4M7ZC 4R9HA 4HMCA 1E6OL 4MDJB 4AL8H 5F1NA 3BAEL 2V9RA 1HH6A 2JJSA 1MUJB 1D5ZA 1TJIH 2W60B 5A40E 3GO1L 4XMLH 4X7FC 5IVXE 4WI6A 2VXSH 5J1TC 4WU7A 3D39B 3UJTH 3U2SB 3G5ZB 4O9HL 1KCSL 2OK0L 3MBEC 4YHZH 4X98B 3P40A 1W0WB 1I1FA 1WISA 5EWIH 1WEJL 1FZJB 4JY6A 3GI9H 2YD8A 4YEFA 3KR3H 3O41B 3OXRA 3QUKB 4QHLA 1QVOB 2H32B 1OAZH 4O4YH 1GVIA 4HK3N 3W81A 2N7AA 3TO4C 4KJPD 1S5IH 2O5ZL 4WWID 5TE4L 3VWKD 1UWEH 4FQCL 2GQHA 4NQSA 5T3XE 2FX8L 2XN9D 5IR1B 3BOVA 1U8JA 1F11B 2XQYG 5FGRA 1DBAL 2CO6B 5TJWK 4FQIL 3I75B 5E6YA 1YJDL 2Y5TA 3B2VL 1FLTX 4GRWF 2QQLH 3DUHA 4KQ3L 1DVFA 2GW5A 5KSUB 1CVSC 2QADC 5L9DH 1LWRA 1D9KC 1RMFH 4MVBC 4HH9A 4HZAA 1X9QA 4Q6IA 3NIGF 4ZOEA 3JWDH 5TQ0L 4AEHH 3V0VB 4KDVA 3QUYC 1NEUA 1AH1A 5F3BA 4NO3B 2GUOA 1RURH 4MD0A 2F19H 3BWAB 5D1ZC 4MD5A 4JDVA 2DYPD 1XMWA 1NCCH 4LEXH 4FG6C 4PGBB 4UV7L 4H88H 3KPMB 3SGJA 2PKDA 1FC2D 2H1PL 3GMPB 5K9OB 3NZ8B 2BOCB 5FUZH 4Z0XB 1CICB 3FQUA 5ADOL 4HFUH 1KOAA 3TCXA 3S37X 1IEBA 4ODHH 4IOFD 1CGVA 3ULVH 1SYSA 4P0DA 4N8VG 4X6CB 2JB5H 1S7RB 3VXMB 3P4MA 3HZKA 2DQHL 4HKXA 3LKRB 1ORSB 4HXBH 5F6IC 5ACLA 3QUMB 1XH3A 4D9RE 1G9MH 1MJ8L 2UYLA 4HMEA 3O81A 3IDXH 3STLA 1W8NA 3TWCL 3VI4E 5FECB 3MQIA 4P5KB 1AXSB 3KPNA 3NCMA 3EGSA 1FO0B 3HCVA 1DBBH 1SJEB 4JZOA 5B38G 4R4NC 5LAXB 3U6RB 4XH2A 3LHPH 1JGUL 4KHTL 2WINB 3GSNA 1U91B 4F57L 5FYKL 5E2JA 2R39A 1EVTC 5EFIB 3FZUC 4W4OA 5HGAA 5ID0A 4PJEB 1KPVB 3TT1L 4XNXH 5GS1C 1HWHB 4L3CA 1MPAL 5ICXB 4L9LA 1H15A 4F15C 2O5YL 3MXWH 4PRIE 3SJVE 2J8UA 1FO0H 3M07A 3HE7B 4WGVB 5GJTH 4XCEA 5IGXL 4HIIA 4M6OL 4P5MA 3LZFL 1MRCL 1Q0XH 4JFDE 3L5JA 5ACZA 4H8WH 4HJJH 3C6LD 5IB1B 5HHVH 5GGTL 4Y88A 1V3LA 3KPSA 1QKZL 3WFDL 4CGTA 1N4XH 5D71H 4L8DA 4EUPA 3F58L 4YHOH 4IDJL 2CLZB 2XTJB 2ATPA 3D2UB 3TBWB 2VLKA 1F4YL 1MQKL 1TNNA 3QXWA 4HUKB 1KTDB 3VG9C 4MNQB 5IESL 1NCBL 5HGGS 4OZGA 2OP4L 2VR4A 3QYCA 5FKAA 1MFBH 2WSKA 4ZPVA 5DZLA 3OKKB 1MIML 1DQQB 2QQKL 2V5SA 4KUCD 5KVFH 2G5BB 3ZDXF 1AGBA 3B5GA 2X4SB 4L8BA 2EC9U 1FNGB 1U58B 4MS8C 1SBSL 2BERA 1XGUA 1MEXL 5I19L 5I8CB 3W9DB 2XRAL 2EIEA 3LQZA 3AREB 4I48A 1Y18B 4LHQB 3PDDA 5DUPL 5JOFB 5TGBA 5BZDB 3RGVD 1HYRC 1M71A 3MMEA 3C60D 1FJ1B 5C2UB 1KTKE 5I71B 2X9WA 1JGDB 1KXQE 1G6RB 1UG9A 4N0CD 2MJWA 5DC9B 3DPBA 3RVVC 4WFEE 1MVUB 1XR9B 1OW0C 3PWUA 4HIJB 2BVOA 3SDAA 2HJFB 4KKBC 5C0DA 2YPKB 3EYSL 4CW1A 2X89D 1MRDH 4LLVB 4BFGA 5TF1L 3ARBC 4OCSL 4IJ3C 2ZOLA 4ODTH 5HY9A 3CDGA 2AJYL 2R2BA 3AY4A 2BMKB 1HI6B 2NR6D 3LS4L 3L3IB 1TENA 5EULV 1G6RH 3CC5B 4XWGL 4AIZA 2WANA 4ELMA 5I1HL 4PV9B 2F74A 1C12B 5D7JB 1J1XL 4Z7VB 2GY7B 2VITB 2NY4D 1ETZA 4ZUVA 2XZZA 3DVIA 1S7XB 5C7XL 4OLEA 4O02L 2J4WL 3KYOA 3I6KB 4TTDC 1OQOA 4JFHD 4OCRH 1CFTA 1QFOA 3HZVB 3ALXA 3MNZB 2APWA 1RHHA 3BKYH 1UXSB 4CRPA 3ULUF 4LLWB 3L3GA 4WCYH 3HMXH 2J6EH 5HGBA 5D96C 2YKLL 5BJTA 3F7YB 4G9FD 3PV6A 1TIUA 4HKBA 3H8NA 1DQMH 1KTRL 1VEPA 5ESAB 3WLWC 2ZOKB 2DMBA 1M1SA 5TQ2H 5EU5A 1YQVL 3VWJD 5C0CB 3ES6A 4Y2DC 4GQ9L 5SV4A 4K3HA 4RMUA 3WIHH 4RIRA 2MOVA 4JZJA 4XAKE 4OCWL 3EFDH 4BFEA 3ARQA 1OGAD 3ZKND 4Q9CA 2BNQE 3GKWL 1CE1L 4XCFL 3RL1A 1A6ZB 1H3PH 2UZYB 3GMQB 2R9HD 1F13A 4P9ML 1AJ7H 1X5ZA 2BDNL 4FTVB 4QYOA 5AZEH 3ESVF 4KKLC 3SDXE 4KUCF 1IBGH 3O6KH 5CINL 2GJ6D 1NBVH 4M00A 5IEKB 4Z5RB 2EDOA 2EH7H 1D5MA 5DQDH 5A2FA 2YPLB 4PY8I 4ZSOE 4FN0A 5DD6B 3ARWA 2FSEA 4TVPH 3BDYH 4MB5A 4QRRB 3BN9D 4ZFGH 1JFQH 2RBLA 2O5XH 4FFYL 2Z9TA 3C5ZD 5BOPA 1RULL 4CU7A 2UUDK 2YRZA 2Q6WA 5GXBB 4C58B 1EAJA 3D3VA 3WBDA 4XPBL 3SE4A 1E4XI 1R5IB 1QLRA 1UENA 4S2SB 1MSPA 5LCVL 3PHSA 3UTQB 4DZBB 4JJHA 3QIWA 3V0AC 3D25A 3TN0B 2VDLL 1IMHC 2BVYA 5EBGA 2ED8A 2YUXA 4EI6A 4NN7C 1HCVA 4P46D 2EYRA 3LY6A 5FYKE 4Z77B 4KZDL 5D2LF 1IARB 4UINL 4Z7WF 2G2RB 4P2QB 5ANMB 3U0WL 3C87A 2P7TA 2VSDA 4LEOB 1EO8H 5D7KD 4F7TA 1PY9A 3ZTNL 1MCLA 2DQUH 1Q9WB 3S98A 2AK1H 3FTGB 3LS5L 3VE0A 4ZUTA 2VLRB 4DCQB 3MA9H 4YFDB 4QOKB 1PKQE 1Z0NA 3Q6FB 4RRPG 3S4SA 3RUGB 4LRNH 1WFOA 4XVUC 4J6RH 4Y16D 4ZDHA 4HUXB 4JFPA 4N0UB 2VLMD 2D31B 4AEFA 2ADFL 1JMXA 1X7QA 2AEPL 1CLYL 4PJBB 4TSAL 2P5WD 4D0CB 3IU3A 1GPOH 2LE9A 4M6NL 3QJHA 4LPCA 1IZJA 5C0EA 3G6JE 4Q0XH 3DUSB 3SKUD 1NFDE 4JVPA 1TZIB 2GTZB 1W72B 2OJZL 4ZO8A 5IVZB 2DBJA 2P5EA 1N59A 1KT2B 1JWSA 4ZFZB 2AK4B 5FCSH 4M6ML 3RDTA 2BFVH 3V7MA 1T5XA 1JP5A 4WFHD 3BD4A 5JW3H 1J8HA 3OGCB 2GAZA 2IQAB 3FQXA 3SKNB 5JNYA 1INQB 4JG1H 4MDIB 4PJ9B 3SOBL 2FJGB 5JLZA 1NGQL 1WGOA 2VXQH 2QEJA 3MRPA 4NNYB 3S35X 4CDGC 5C0RH 3KPOA 3P0VL 2I60L 5GRYA 3H3KA 1LNUA 2DLHA 5K9KB 3EOYG 5D72L 1RFDL 4JM4L 4P4KC 1UZ6F 3WL9B 1BGXH 1U8NB 4HWBH 1H3UA 1LP9F 4BQ9A 4FMFA 4YHLL 1MNUH 4Y1AD 4MA1B 3WFCH 5DWUH 3QO1A 4Q74A 1RZGA 4ENEC 5HXMA 3C5JA 3PDOA 2VL5B 4HKJB 3PGCB 3GI8H 4LCWE 3IDUA 3UDWA 4MA7H 4PR5B 4JRXB 1UVQA 3RWJA 4OI9A 4OD1H 2XKSA 3EOTH 1LDSA 2UV3A 3DBXA 4Y5YA 5ILTH 1DSFL 1UCBH 2QBWA 4BQCA 4JFZH 5L2KD 4B41A 3Q5YA 2AI0H 1EEQA 1YYMH 2JCCB 3HN3A 5ETUB 2A6DB 4JRYA 1CFVL 5JMRA 4XBPA 3D48R 5GS0L 1AD9B 5FM4A 1KCUL 1DN2A 3UYRL 4KHXL 1V3JA 5DQJA 2BVQA 2NTFA 1T5WB 1BIIB 3DYPA 2MHAA 4U2ZA 4JCLA 5HYJE 4N5ED 4OFVA 3MLZL 5HHQB 1E0OB 4G8GD 1MCKA 2D7NA 2VTFA 3TNMB 3UO1L 5DJCA 4C57C 2PCPA 1NL0H 3G6AB 2DTMH 1RJZB 4JQIH 4ZTOH 1HEZA 4JAMB 4K94H 2XWJB 3KYMA 4MJ6A 3WFZA 4XVSL 2N56A 3MV8D 4RGNC 4X4MA 3B9KB 4PRAA 5JZ7C 5GS2H 5TE6H 4I4WB 2X1PA 5EZJB 4K8RC 2PO6C 1U8OB 3U36A 4NZTH 3VH8G 5I0ZA 1MCNA 2EIDA 2YD1A 4Q9BA 2Y06H 3KWWB 1CFQB 1A6TB 5B4MD 4N9GA 4F9PC 2J8OA 5FYLD 4I0PB 1JGEB 1YY9D 4G80B 3X3GH 3IJHB 4NKQB 4EZMA 5BV7L 1GC1L 2DQDH 3MV7B 4R26L 2UWEE 3MREB 2NX5D 4LCUA 4XMPL 4K7PL 5JIKA 3TYGL 4L3ED 5EO0B 4KJQD 4XTRC 3GSNL 1A1OA 2IPKB 5JDJA 5I16A 1AGCA 1TCMA 2P1YA 3TA3D 4YXHL 3S36X 4H26A 4F2MA 2IBZX 4KJWD 1DLHB 4DOHB 4LPUA 4PRBA 2R2EB 4G6KH 4QRUA 3ARGA 2IAMD 4EI5B 1RZ8A 1YY8B 3QR2A 3HE6A 1RUMH 3X12B 4CJ0A 3RPIA 1A3QA 3CLFL 1CGXA 3FO2A 5C0BD 3O6LH 3U4BH 3RHWK 4JQVC 3VFSB 1I7TB 4YHNA 4CVXB 5TDOB 4G3YH 1TZHB 4MJIA 1R5VB 4K7PY 1BD2D 3ZMRA 3QEQB 2C1OA 2EDRA 4X7SH 1G7QA 2AJXH 2R56H 4Y4HB 4F7PA 2R8SL 3EYOA 3OZ9L 5EOTA 4LSUH 4PFEA 5LGHL 4ODXB 4R4FL 3QDJB 5FKPA 5GZND 3PXJA 5JPNB 3B5HA 2I25N 3VMPA 2VERN 4LLYB 3G9AB 1O5DT 2FLBT 4JPVL 3UBXB 3P3YA 1JZ7A 4OM1L 3NAAH 3LV3A 1OSZA 4O2EB 5EIIB 4XMKH 5DS8B 3Q3GB 5DK2A 4Q2ZA 1WZ1L 3GMOB 3O8XC 3NA9L 4M4RA 5DD0L 1E4XH 3VFWB 1MELA 2VDKL 4O51B 3D0LB 1Z0MA 2NXZB 3DTXB 3QCVL 5E6IA 4IM8A 2OR7A 4JJ5B 4XI5C 2AV7B 3UPRA 3DWTA 1IEHA 2DLEA 5IFAL 1OVZA 4M7ZB 1GZPB 1KGCD 3OWEA 2ZUTA 1P4IL 2LAGB 3G6DH 5DK0A 4WW2F 4PV8B 4GG8A 5DJ6A 2XNAB 4FZEL 3K4ZA 4MJ5A 3B43A 4GKSB 5ICZA 3TBTA 1IGMH 1FPTH 3KG5A 4RFOL 1AFVH 5D1XC 1J18A 1AIFA 5CBEB 5HYQA 5E9DA 5BXFB 1JNLL 5BVJB 2WUBL 3CFEA 5HYIA 1K9TA 5HD8D 3MBEB 1NEZG 2HJKB 3ZKMD 4L4VD 4P5TB 3T09A 2PTUA 5C8JA 3ULSB 1A4KB 1ZMYA 3NZHL 3GNMH 3QZWA 4M48L 4PB9H 1ONQA 4FQ2H 4PJHF 1CDIA 4LSPL 1NDMA 3MRBA 4WO4A 3ZTJH 2PXYD 1WIUA 2DQJH 2QKIA 2VR5A 4WJ5A 3ARDA 3OR7B 3TO4B 5ECJE 3FB5A 3DETD 3OL2A 4NQXB 5F89A 4QHMB 1Q94B 5I8KH 3TV3L 3LKPA 4KROC 2IPUK 3QH3A 1RAMA 3BD3A 5T1KD 5IMKB 1K3IA 3S5LA 3DV4B 5E8NB 4HQQH 2VXUH 4I2XA 3AGVA 4NN6B 4QEGA 2VISA 4KV5F 3VJ6A 3M1BB 2QADB 1BECA 1JPFA 4F7MB 4GG6B 1FVDB 4MNHB 1J86A 4BQ8A 5I1JH 1IAKB 1CU4H 4KKAD 4TNVF 4C56A 3QUYB 2VIRA 3GIZH 4BSVB 1E4WH 4KJYA 1S9WB 4MCZA 1ZSDA 1K8IB 5D1ZB 4APQA 2CDEA 1DQJA 1CCZA 1KJ2A 3MOBL 5H35B 1AC6A 1VGKB 1MHEB 2AXFA 1M7XA 5J1AA 1OAYH 2CDFA 2Q3AA 1UB6A 5IB4A 2X5PA 3TM6A 4UBDC 4S1DC 5DMKA 1N5AA 3KLHC 4ZAKD 3CZFB 1XGPB 5FF6A 4PLJD 4I18A 1I9RL 5TDPA 5HJ3A 2E8YA 5FHBH 4KAQL 2YHGA 4JR9L 1TZGH 3AS2A 1RJYB 4LAQH 1PZUB 3UJJL 4P9HH 5TFSH 1L0QA 4A6YH 3VXPB 2UZIH 5DJXB 3RY6C 4HUNB 4UDTB 1KB9J 1QBLH 1N2RB 1S9KC 4NUGL 4X9IA 1QLFB 1S3KL 1HILB 1UQSA 4MHHG 3CAFA 4ZFOB 2Y07L 4U2YA 4XXDA 4MWFA 3BIBX 1MFEH 1YNLL 1PZ5A 3BX7C 4HPOH 5D5MB 2F5AL 4LNVA 3I2CL 5KVGH 1P4LA 1FYHB 2X4QB 1B4JL 4E0RB 5LG1A 1NGXB 3T4YA 3KNBA 1AD0A 5I8OH 4MD4B 4QRTB 5F88A 4U0RC 4ZNCD 2IPTL 1I1CA 4J4PC 2HT3D 1CF8L 4YFEA 1B0RB 4F15B 1IAOB 5T3ZH 4Y5VC 2HVKA 2FH6A 3JTSB 5BOZG 4GBXB 5KW9L 2YSSA 4LASH 3HNSL 1CR9L 4PJ7F 4DAGL 2HVJA 1CFBA 3SBWA 3OXSB 4PJXF 2Z93A 4Z7UB 4ORZC 1A9EB 3K7UA 4NZJA 4QGYA 4HJGA 4J3TA 2OSLA 4UMGA 1B0GA 1Y6NR 2NXYC 4LRIC 5C09D 1J05B 5DJ0A 1E6JL 1QD0A 2CD0A 1XGRB 2DDQH 1XCTA 4XPHL 3KPSE 4HGKC 5DEFB 4ZO7A 4RQQA 1NC4B 2B1HH 1CZ8H 3IJYA 4XHJD 3VG9B 2VR9A 3PF2A 2ZP0T 4OFYD 1RK1A 5GSVB 4CBPA 4FQHB 4QHKI 2NY6D 1IGTB 1LGVA 2D7OA 5FM5O 5HHXH 2F9BT 3UZEA 2VLKE 2PW1A 4V2BA 1B2WH 2ZUSA 1KFAH 5DRWA 4WHYG 3U48A 5KSBA 5GZOD 4D0BB 1PQZA 4X6BA 1G7MB 5CGMA 1KN2L 2CR6A 4J3WA 1I3UA 2YD3A 4OZGE 2B1AL 2EYSB 2YZ8A 5DR5L 3PWJB 3V4VH 3BKML 5C0GA 1OM3L 3DXAA 2R29H 3VI4F 4N0YL 1KSRA 5I30L 4OIAA 1AQKL 2VLLA 5DUMH 3GHBH 5INCB 1BFVL 1PY4A 1SMAA 3C9NB 5T3XH 1JHLL 5C08A 4UILH 1ZS8A 1FL3A 3JV4A 1MFCH 4PG2C 2DWEA 4AEIL 3QEGH 4U6HA 5E2WL 1KCVL 2R0KH 2VUOA 3LEYL 1NLDH 4FA8A 1XIWB 4NHUB 2BY0A 1CYGA 4XCNA 5JA8B 2N1KA 1TJHH 4LQFH 4IDLA 1F4XH 3D39D 3I6LD 3MO1A 1JYXA 4ZUUA 5IMLB 4G8EA 2DQCH 2V9QA 3X14A 4YXKL 4J8RA 3N1PC 3IRPX 2ZKHL 3IVKB 1A7QH 3FHAA 3HB3C 3B5TA 3PNWA 2VDOL 2ZUQC 4G42B 3ARBB 4PJ5A 5I1KH 1MFAL 1CG9B 1N8ZB 2E7MA 4PYHA 1LILA 4OD2A 4RSVA 1LO0H 2HJLA 5GGVH 4J1UA 1OP3H 3OKNA 3NPZB 1H0DB 3ROLA 3QWQB 4M7LT 3VXTB 5ALBL 4CVZB 1RIVH 4NZUH 3ZSTA 3ALPA 2MNUA 4WFGE 5GRVL 3T3MF 3CSYA 2LVEA 4YR6B 1ZA6A 3GK8H 1YEJH 3S6CA 5TE7L 3DRQA 5HHNB 4ELME 3OKDA 3T0EA 2A6IB 2C7UA 3JXAA 1NLBH 2MMXA 1TVHB 4FZ8L 2L0DA 3G04B 5DRZB 5F1SA 3GBLA 4WGWB 4I3RH 3TESA 4XRCB 3WFBL 5BRZA 4JFDB 3DSFH 1J11A 2X05A 2HMID 2UVFA 3NPSB 1ITCA 5IW1A 5FM5M 1JF5A 5D96B 4JKPL 3VGEA 4N0FA 4QHNB 1T21A 1JWUA 1KB5B 1FV1B 4IRZH 5CJQH 3M45A 1TVBA 4JO2H 5E00B 4BQBA 3ETBF 3MCLL 5DHVH 4ZXBC 4EN3C 2B4CL 5H2BB 2BC4A 2X70B 1HHGA 5IUSA 2X4UA 3KPLB 5KANI 3OKEB 5JHLL 5KS9A 4XVJL 4TSBL 2CLVB 5HHPA 1QRKA 4OJFH 1ADQA 2VQ1A 4E41B 3VXMD 1KBGL 2QSTA 3P0GB 1JPST 4LU5L 1ZHLB 4KRMB 5T1MB 3WNLA 2ZCKL 2ZCHH 1NBZB 4OZIA 3I9GH 3RZCA 3BPLC 5EU4A 2OTUB 3PGDA 2EECA 4LFHG 1KJVB 3PJSA 3WHXA 1N5YH 4POZD 1I75A 3F7QA 1DQDL 5HDLA 3C2AL 3R4DA 4GFTB 4GO6B 4YHPB 1M05A 3KS0J 3SO3B 3VGAB 1GGCH 3MCKB 2R4SL 1CL7L 1CD1A 4X6EA 3NIFE 2BNRA 4JO3H 4N5UA 3SGEH 1EFQA 3WNKA 1YQ2A 4ZG1A 5D6CA 4NO2A 4OGXL 2HKHL 4OUUB 5J3HC 1YEHH 3SDDA 2QQNH 1M6OA 2C3VB 3TPKA 1JNHA 3BIKB 4IRSD 2AKRA 2PNDA 4JANA 5KTEH 2X4OA 3WLBB 3D3VE 4NN7B 3G5VA 1T4KA 1NCNA 2HRLA 3CFBB 5SWZA 5J12C 4I77H 5DJZA 3HE7D 1KXTB 1YMMA 3VFPB 2DAVA 2DOCA 2FIKA 5JXEC 3MLSL 5E03A 2LABA 4UTBL 4NKDA 2AXGB 4N68A 4CNIB 4RWYH 4AT6B 3QI9D 1SY6L 5CUSL 4OGYH 3F7VA 3ME0A 5EC1A 5HBBA 4H1LB 5B8CA 3QNXB 4JB9L 4LLMA 2XTJD 4HC1A 4GLRI 3H0TB 1U8HA 2F58L 3D2UD 4RMQA 2K7QA 2V2WB 3CMOH 5FB8A 1JNJA 1F45A 5BS0A 2E7BA 3RL2A 5J6GB 4D8PB 3U7YL 1ORQA 3L9RA 5CEZL 2A6JB 4MNQD 1E6OH 2VDPL 1QSVA 3GSQB 2YBRA 1RUKL 2DM3A 2Z91B 3BAEH 4LVOC 3QIBC 3EOBA 3GO1H 3KPPB 4MHHI 3SDXF 4YPGA 1L6XA 4HUVB 4P3CL 4K3JL 4O9HH 1KCSH 3ARSA 3V5DB 1MAKA 1OGTA 4OZHE 2X41A 2DL2A 1QO3A 1WEJH 5JPMB 2IH1A 4O00A 3EO0B 5DC0A 1G9NC 5E5MB 3VFOB 1XGQA 1QHOA 2J7LA 2B7DT 5CILL 1UC6A 4S1RL 4NUJA 3V6OC 3BESR 3ARED 4X7TA 2EO9A 4UDUB 2P5EE 1X3DA 1QR4A 2P8LA 4X6DB 3F12B 3VRJB 1JCKA 3GB7B 3RWDA 4IOIA 3T2NL 2GCYB 2ICEB 3RWIA 1CBVL 6CGTA 2O5ZH 5TE4H 4BYHA 1T7XA 4FQCH 1T7WA 1J8HE 3MLVL 5IB2B 4NN5C 5JHDA 2FX8H 3T8XB 4P4KB 1DBAH 4FQIH 1YJDH 3B2VH 3HR5A 1A7OL 3W5NA 1R24B 3K4AA 2AQ2A 4KQ3H 2WBJC 3MYJB 4FABL 1WJ3A 3PXHA 4ZSOB 2ATKA 4QRPA 1NH6A 2AJ3B 3BGMA 2C1PB 4NZDA 1WFNA 1B9ZA 2BHZA 1BVKA 2JLLA 1HSBB 4NRZB 4YHKL 1Q9OB 2A1WL 1UH4A 2Q76B 3IFOA 4QXGL 5D7JD 1VADB 3BT2L 4Y8AA 2ICWB 3C8HA 4O2FB 3HZYB 3CFDA 5LGJB 4LSVH 5I1AA 4UV7H 4GW5A 3FO0L 2XACC 1SM3L 1AHWC 2H1PH 5HGHA 2A83B 3IAGC 4NWTL 4NWUL 1WC7B 3QEUA 4MQXC 1AE6L 5H94A 1R3HB 3T2OA 5ITBH 3UPAA 4JRYE 4P2RA 3VWKC 1NFDF 1KJ2L 4AYFA 5GSRB 3QQ9D 4S11A 4XHQA 2DQHH 1MJUH 4FHBD 4L29A 3LKOA 3RNKA 1DE4A 1HHJB 1MJ8H 1T1YA 2CK0H 4MA3B 3IKKA 2C9AA 3TWCH 1G7PA 1IGJA 4YH6A 4M8QB 3VMNA 4RGNB 5DUBA 5IW6A 4TVPD 4XP6L 3T1FB 2Y9RT 1JGUH 5DT1L 3FQNB 4KHTH 5DVKA 1MJJB 1D7FA 4DVBA 1DUYB 3SY0A 5FYKH 4H5SA 5F3HB 1FG2A 2YD6A 2PO6B 2Y7QB 4NOFA 4X4ME 5C86A 4E9LA 3TT1H 4R90L 1MPAH 3FKUS 1OQXA 2HFFB 4TTGA 5JIPA 3OV6A 1U41A 2O5YH 5MENA 3RTQA 2YPLD 3WS6A 2V9TA 4JY5L 5IGXH 4M6OH 3B6SA 3MRLA 4HS6B 3LZFH 1MRCH 1D6EB 3MV01 3WIFB 5HHOB 1FGVL 4AIXA 4BFIA 4M1DH 5GGTH 1RJCA 1QKZH 1S9XA 3WFDH 5JTWA 2H6PB 1YN6B 4LPXA 5GGSY 4WI2A 3KYNB 3F58H 4IDJH 4U1MA 4K55A 2EH8L 1NEZB 1XEDA 3P4NB 5I8EB 3VDCA 5IBLD 1IC1A 3TN0D 1F4YH 4U6XB 4WWKA 3F6IA 1MQKH 3OKOB 5F21B 1CFNB 2GFBA 3VFGH 2WUCL 5DD5L 1IGIH 1YEIH 5C0ND 3QWRD 5IESH 1NCBH 2GITA 2Q7NA 2D0FA 5FA4B 4ODUB 3AXLA 3PP4L 3BUTA 2OP4H 3I02A 5EN2A 2X4PA 3A6CL 1BZ7A 4NQVA 4P2QD 3R0NA 5BZWB 1MIMH 2Y1VA 4U3HA 1TQBC 4IRJA 1BFOB 2QQKH 3DX9A 3W0WA 5DI8B 3W2DH 4DN3L 1A6AB 1HXMB 2YMXL 2J5LC 2VLRD 4LCWB 3QQNA 4QOKD 3DGGA 1NKOA 1U8KA 4MJIE 1EBAA 1MEXH 5I19H 3O3BA 3TJHD 1GRWA 4TOYL 4RZCB 3DRTA 1IAIL 5DSCA 4XP4L 4JPIA 5DUPH 4PS4L 3TBSA 4Z7NE 4TNVK 3BRFA 1EHXA 4B7IA 1MHHA 3LD8B 4EOWL 5LKNA 4TUJA 5IM7A 3GFUA 1QRNB 1S7VB 4RGOL 1SQ2N 3HNVH 2ICCA 2CRIA 2Y36L 5HYJB 4ETQA 1F3JB 4WHTA 5GGQL 2VJXA 4JDZB 5CEZE 3AUVA 5CLWA 2P48B 1QA9A 1P7QB 2CIIB 2AK4D 3VRLE 3KPRA 1RZJL 4LLDA 1UWGL 3EYSH 4NT6A 5LXGL 4YLQT 3QIBA 5CZXD 4YBLC 5TF1H 3TBVA 2HT2C 4OCSH 4F7CB 3MUY1 3T3PF 2XWBA 3CFJB 3H6JA 1OD9A 3LS4H 3WFEL 2BX5A 1E27B 3BGFB 4XWGH 1RPQA 5D1XB 1J1XH 1AO7A 1U8MA 3RWGB 2R1YA 3WSQL 5C7XH 4O02H 4LSQL 1GIGL 2J4WH 3H9SA 4HK0B 1U92B 1V3MA 3I3EA 3RGVC 3FRUB 4FXLA 2Y6SC 3U1SL 1BQHA 5E9DE 1ROWA 2BSTB 4R4BB 1MLBB 3DMMA 4DWHA 4KY1L 4NBXB 1R5WA 1PYWB 4UU9B 4PY7B 5SWQB 5CS7A 1DUZA 1S78D 1YUHB 2YD9A 4JRXD 2Q87A 5FDWB 5D70L 3UTSA 2ZWLT 4PJFA 4KROB 1JF6A 4HWZA 1H5BA 1YQVH 3DVGA 3L1OL 1ZLWH 2PYEB 5C71A 4GQ9H 3HMWL 1QFWL 2OXGA 3TLRA 5FK9B 2YA2A 3ZHDA 5EORL 3OAUL 1HHIB 3OTTA 1CE1H 4XCFH 2LAAA 5DD3L 1A14L 4P9MH 3KS0H 4I2XE 2VABB 5F71A 2HLFC 5HI5C 2NY4C 3NN8B 5CINH 2OL3A 1EEZB 3FQTA 3RUGF 3U7WL 3BE1L 3QRFM 3WNPA 4C56E 1KN4L 1INEL 3QIUC 5IOPB 3B9KD 4FQXB 1RULH 4AENB 1XF1A 2V2XA 1ADQL 4OF8A 3WN5C 1ZT7B 1P84J 2XN9A 4XC3L 4NC1E 3M17A 4XPBH 5EC2B 5EUOB 5LCVH 1WBXA 2VOTA 5F44A 5FUCE 3FOLB 4JFXB 4X0KB 2VDLH 4I0PD 3CU1A 1EGJA 2WQ8A 3E6FA 1E28B 5IMMB 1UGNA 4ISVA 3ZKQD 5I9QC 1TTGA 3WS3B 5B3JF 4NYLB 4Y4FD 2CLRB 3MGTB 1G84A 4KZDH 3NCEB 4U1SA 3HG1B 4UINH 1BIHA 3EO9L 3U0WH 3LH2L 4WHYH 3C5SB 1UXWB 4WRLA 2DYPA 3ZTNH 4K3DL 1S8DA 1XF3A 4XNUL 3LS5H 1QFUL 1AGFB 1XZ0B 1I7UA 4KMQA 4MZ3A 4U0RB 1T89A 4NPYB 4P4RB 3SCMC 4EI5D 4PG9B 4M61A 2H9GB 3SKMB 4QNPE 3O4LB 1R3JA 3BN9C 4Y5VB 3QUZA 1FSKC 1CLYH 4TSAH 1T2XA 4TUOB 1TQCC 2GSIB 4AQOA 3C5ZC 1FL5A 4RMSA 1HN1A 2XKNA 1JK8A 4LIQL 4UQ3B 1WWCA 4WI5A 3AM8A 3FQRA 2W65B 3WJJC 4DKDC 1Q38A 4HC1L 4RBPH 2CK2A 2NXYB 5CAYB 3QEQD 4R97C 2OJZH 1I1FB 3HLAA 2XG4A 4JPWL 3HNTL 4HMDA 4Y4HD 3QT2A 4M6MH 1FBIH 4QHLB 2JCCF 1X5HA 4K9EC 4H20L 4OB5L 2NZIA 5FV1L 4Q97A 1C5CL 2XXMB 5K9JL 4EQ3A 3WHE1 3SOBH 3FB8A 2FL5A 1U8JB 1WBZA 3MRRB 2I60H 1Q0YH 2MKLC 4Y16C 4MNGA 5D72H 5JUEL 1RFDH 4JM4H 4RWHA 1TJGL 3TJEL 3C6LA 1A3LL 4S10A 5FDYA 1E4KA 5KSBE 2NXZD 3D85B 4HH9B 2JK5A 4U1IA 3AFLA 4YHLH 3KXFB 3EO1B 3QDMA 4XXCA 3VXSB 3MRGB 1OB1A 3BHBA 3DXAE 3NA4A 1MCDA 1S9VA 4LBEB 1IEAA 3U0PB 4JDVB 5EBLA 5C08E 3TNNA 1P1ZA 3PWPB 5IJVB 1BAFL 2PR4L 3LN5A 4WNQA 1DSFH 4G6AD 2D0HA 3N50A 3ZL4L 2R1XA 3IDNB 3HRZB 3MBED 1QEWB 2BJML 1T22A 1CFVH 3FQUB 4P5TD 1IEBB 1I85A 5GS0H 1GYAA 4WI3A 5E24E 5EH1A 3VMOA 3OHXB 3PV7A 4A2LA 2KDGA 4HS3A 4K71C 1SBBA 5C0AB 4N8CL 43CAB 1JF1A 3P4MB 2VZ3A 3MLZH 1W2KT 4YO0A 3RIFF 4HFWA 1XH3B 1VENA 3TO4D 3HA0A 3UO1H 5DD1L 4WFFE 3STLB 1ZGLB 4PJ5E 3KJ6H 3EGSB 5DA0B 4LPTA 4MX7B 4AM0A 2IANB 3C60A 4XVSH 2JB6B 3V4UH 3R8BB 2AV1B 2PF6A 3BP6A 1I7ZA 4OLUL 3GSNB 4NQEB 4O5LL 3SGKC 4LARL 4KTDL 5ID0B 4X8JB 5IBUG 2DJ4A 2OQJA 5HI4C 5LWYL 2QADD 1N64L 4MVBD 1L0XA 5EG6C 3VI3E 1H15B 4HT1L 3QUYD 3T0EE 2X89A 4OZGF 5D2LA 3FT2A 2J8UB 3S5LG 1C1EL 1GC1H 5E8PA 5BV7H 4OI8A 4XCEB 5D1ZD 2HKFL 4R26H 3SKOB 5BRZE 3VGFA 4XMPH 4YXLL 4K7PH 4GSDL 3TYGH 1I8KB 2IADA 2AEIT 3GSNH 1JV5A 4FG6D 2Z31C 1YEFL 2JJVA 3KPSB 4ZXBB 4EN3B 3IFPA 4W70A 4YXHH 3IDMB 1TETL 4L8DB 5KSAC 4EUPB 2XYCA 1ZVSA 5D2NC 5GQBA 1BREA 5HHMB 2K9UA 2ATPB 5JW4Q 5CEYB 5E2UL 1VERA 4XVTL 3ZDZE 1YPZA 1HHHB 2E27L 3O2DH 4BSJA 2OS7A 5KS9E 3CLFH 1P2CA 1Q9KA 1YMHA 4ZPVB 4R4ND 1WCBB 4JGJA 5D6DC 4KC3B 4G9FA 4QRSA 3STZB 1KLGA 4EUPH 4OZIE 4PGZA 2VKWA 2BY3A 2ZG3A 1R6VA 5D7SH 3VWJA 3FZUD 4F58L 1WWAX 2VDRL 5L2JB 5T1DL 2IQ9L 1OGAA 2BNRE 1U8IA 3R8QA 2R8SH 1CD8A 1GZQA 3C6SA 3LQZB 3OZ9H 5LGHH 2YUWA 3HR6A 4R4FH 2DBLH 3L3OA 1M71B 3MMEB 1H9VA 3NFSL 1AP2A 1F8TL 1FRGH 1BPVA 2ZCLL 3BVNA 4JPVH 4G6JL 3IKCB 4GAJL 4OM1H 5SWZE 4OQTA 1OAQL 3U9PH 1YMME 5A2JH 5IK3A 1FFQA 3NA9H 3PWUB 4BH7A 4OCLC 5DD0H 2H2SC 3SDAB 5FA3B 2VDKH 4CW1B 5BW7C 3QCVH 4EDXA 3IETB 4P3DA 3B3IA 1X6NA 4LIQE 1ZANL 4OUOA 4RAVA 4ELKA 5IFAH 2R2BB 4PJ8A 2GSGA 4HGWB 4ONFH 1P4IH 2X1XR 4LVOB 5FGSA 4PP1C 2AJSL 5FYKU 4D2NA 2F74B 4FZEH 1EPFA 4GG6F 5BS0E 1NSNL 3B9AA 4P46A 4ZUVB 1CE6A 1EXUB 4HCRA 4AH2A 5I73C 3CMGA 5ICYA 4BH8B 5JOPE 1JNLH 2FYYB 2WUBH 4LOUD 3KYOB 1ND0B 4QXUL 1ZLUH 1FIGL 3G08A 2E9JA 4YDVA 3QRGH 2I07B 4GRLA 4MS8D 1P9MC 2CRZA 3NZHH 1C16B 1CFTB 4NGHH 4ZS6C 5JR1L 4M48H 2P8PB 3QA3B 1KIUA 5F7LB 4LSPH 3VXUB 2DN7A 5MERA 5EA0L 1HHKB 4QY8A 1XIWD 3LQAC 1FFOA 3X17A 3IFNL 2I9TA 4D9QE 2EYTA 3LN4B 5IQ7L 1ES0B 4QKXB 4JO4H 4NM4L 1BOYA 1XF4B 3E0GA 5EU5B 4HIHA 3TV3H 3QXVA 3DYMA 3UTOA 3DO7A 3ES6B 4NN5B 3RVVD 4QTHA 4RIRB 4JZJB 1BBJA 3VXQA 5JORA 1MCOL 1CL7I 2LU7A 2ITDA 3F7RA 3N85L 4KKBD 3RL1B 3BXNA 3IXAB 2VZOA 4I8DA 1FE8L 1HH9B 5JHDE 3RRQA 3ARBD 4R96B 4ZFFB 2A74A 2ARJQ 2IBBA 1FNLA 3BP5A 2NY1C 4GUPB 3BO8B 4I0CC 1P5UA 2DQFB 4I3GA 2P8MA 4HZLA 2APFA 4MCYA 2HTLC 5DJYA 4QRPE 2VE6B 2FIRT 2YUZA 3BDBA 4HUUB 4OLYL 3WFHA 1DBKL 1L9NA 5ADPL 4KI5D 5F70A 2Q6WB 4OLZL 4JFYA 1AHWB 3D3VB 2PXYC 4TTDD 5E7FA 3UTPD 2XT1B 4KDTA 4R2GB 1FZOB 3BZEB 1I9RH 2R0LL 1WBYA 3FB7A 1N0XL 1RZKL 4XAWL 4Z7UF 4KAQH 4JR9H 3S96B 1U3ZA 5JA9A 3UJJH 3REVA 2PUQT 1A47A 3KLDA 5DRNA 5I1DA 1OF2A 5ESQB 1FHGA 4Y1AA 5CEXA 2DJUA 1MWAA 4OZHF 4MQ7A 1K8DB 4TNWF 4NUGH 2EYRB 1S3KH 4YZFE 4P2RE 2Y07H 5E8EB 3SPVA 3UTZB 1HSAA 1GCFA 1YNLH 2HAZA 2F5AH 1BFSA 4Y2DD 4F7TB 4QXWA 1IKNA 3I2CH 2FR4A 2G5RA 3JV6B 1B4JH 3AMLA 1F2XK 3FOMA 3PWNA 3NABL 5L2KA 2W07A 1F6AA 4ZUTB 3IRZA 2LTQC 2KQMA 3UTTB 4N8VA 3S4SB 1EGJL 2X2YA 2V7HA 2EDWA 4ONHA 1D5BA 4ZDHB 2IPTH 3LKSA 4K3GA 4E41D 5K9QG 1X7QB 1CF8H 4OF5A 3BSZL 4HG4J 1Z9LA 3IU3B 1LE5A 3QJHB 4PRDA 4G8GA 3HNSH 1CR9H 3OX8B 4DAGH 4ZAKC 2BHYA 4LCYB 3QFJD 5DGRA 5MEPB 3D18A 3CZJA 1D5IL 5IROC 3S37L 5MENE 1BMGA 1RZIA 4G43B 1NC2B 2VAAA 1QUNA 2P5EB 3MV8A 5CWSB 2P24A 1XCQA 4W6WB 3TBYA 3GSRA 3T0DA 1YDPB 2WBKA 3BN3B 3VD5A 1HXYA 1J9CT 1T5XB 3BUYB 3L3HA 1E6JH 3K74B 3C08H 4KUZH 4WW2A 4XPHH 2XQBL 4FQ1L 1MCEA 1J8HB 2GAZB 3BDXA 2V7NA 3GRWA 4MAUL 4J12A 5JLZB 2ZNWA 3IS0X 3FQWA 2WIIA 1U9KA 4RFNC 4L4TB 2NX5A 4L3EA 1KN2H 3HC4L 3LPGA 4XNQB 5ABDE 4PJHA 2B1AH 5DR5H 3BKMH 3DX6A 1OM3H 3MLRL 2R2HA 4LLUB 4N0YH 3BEWB 3TA3A 5I30H 4OBSA 1AQKH 3ARXA 3GBNL 3NFPA 4G8IA 4XVUD 1A9BA 4PGDA 1BFVH 4N90D 3W0WE 4RAUB 1N3NA 1OAKH 1QSFB 1JHLH 1RZGB 3HI6L 3QCUL 4AEIH 1UJ3A 1FVEB 5E2WH 1KCVH 1GJIA 3GHEL 3P9LA 5D7LB 2IAMA 3LEYH 1J1PL 2LV4A 4U49A 4YFLF 3OJVC 4TN9A 1S7UA 4XB8A 1KJ3H 5ESVA 2NLJB 1JRHL 3GJFA 5DLML 2VRAA 5KVEL 3BZFB 4WUUA 1CIDA 2A2QT 2NYYC 5GRJL 3G5XA 1T2QL 3MJ8A 4LCCC 2FBJH 3E2HB 3MRCA 4YXKH 4X7EC 3C09C 2ZKHH 1OCWL 1EEUA 3VXOB 4PJAE 1LMKA 5J9PA 1BD2A 4GRWE 2MHAB 3O3DB 3VFMA 2VDOH 4NJ9L 1WWBX 1MFAH 3PHQA 3VXRB 4DUXA 4IIQA 2NQCA 4NQDB 2VB5A 4YC2C 5K33A 1PG7X 3NIGE 1BLNA 1HEZB 5ALBH 3ZKSD 1S9YA 3MR9A 4MJ6B 5IBTL 5J57B 1TPXC 3TGXA 3SEPA 3NCYS 4F9LA 4C54A 3JVGC 1G7IB 2FZ3B 2R0ZL 4OGZA 4PRAB 2BY2A 4NZRL 1VDGA 4P4KD 5TE7H 5MHSE 3MJ7A 4RNRA 1MCIA 4FZ8H 4LK4A 2RHEA 2OBGA 1AO7E 3WFBH 3QNZB 4NQCB 3IDGB 1IVLA 1RJLA 1GHFH 4N9GB 1LEGA 5F8QC 4QXTB 5IT2L