3O8XC

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xC02
3ZL4H 5JOPD 1X5AA 1I3RA 3N50A 1DBBL 2AS5M 2OX5A 1MCLA 3RA7L 3BEVB 5IW6B 3H2WA 1X5IA 5K33A 4NUJB 1UH2A 5F9OH 2CMRL 1IC5H 1AO7A 1AJ7L 5MENB 1EFXB 5KZCB 4UU9B 3TO2A 3D85A 1AGCA 1ZSDB 3EOAA 2D31B 3VDAA 5F6IB 15C8H 3BOVA 3QJHA 4CDGC 4LSVH 1ED3A 1FC2D 1YNTB 2DQGH 4DUXA 3WDIA 2WAHA 1BHGA 3E1F1 4NNPL 3IFLL 4HK0B 5CD3B 2Z93A 3DSFL 5DMYA 3ARBD 2CRIA 5IM7B 5FYJD 3T08A 3JVGA 3AB0B 4IRSA 3IJSA 3L3HB 5IKCA 5K9JL 1UXSA 4UNTA 1DE4B 4LCWB 3V0VB 3VWJA 2JCCE 4BKLB 3GBLA 1RZFH 1D5IL 5FM5M 5HGBA 1BBJB 3W39B 2P8MB 3X3GL 3E2HC 2A83A 5D7IB 5DQ9B 2NPLX 5T5FH 3WLWC 3UTSA 5CCKH 4HQQH 4OCWL 4DWHA 2E6QA 5A2IH 3TPKA 5B38A 2ICWI 3WIFA 1T5XA 5I8OL 1BIIA 4S11A 5GGQL 5TFSL 4ZUTB 3CVHL 4Y1AD 4RA3A 2VXQH 1H3XA 1WBZA 5F96H 4AIOA 4R0LB 4ZFZB 1L6XA 4GBXB 4OUUA 4JO4H 1YYML 3V4UL 2VIRB 4ODHH 3UC0L 3TN0C 5JA8B 2A73B 3QWRA 4H26A 3QFDB 3VA6A 1A9BA 2A77H 5B3NA 3IYLW 3OKNA 2D0FA 5DJ2A 3O6ML 2YR3A 1C16A 3VMPA 5JXED 1ZTXH 3QUZA 2J8HA 4JY6A 4PJ5B 5DD3H 5T3XD 4QT5A 1IQWH 1N7ML 3VRIB 2GSIA 1I9RL 5IMKB 1JZ6A 3DYPA 5KSVA 1KPRB 4RMQA 4BQ8A 1YEJL 3MLVL 4TTDD 4X5WB 5HDQH 3QUYC 1U3ZA 3NIDF 5TF1L 1CGSL 4M62H 2JJWA 2Y06H 1FO0A 4Y16B 5KSBB 5HJ3A 5LWYH 2B4CH 2OP4L 3VFNB 3L3JB 1PG7L 5DD5L 4YZFF 4H0GA 1B4RA 3UXFA 3DRQB 1R3KB 2YWZA 3ARYA 2BC4A 2C3VA 1Q9KA 4XP6L 5FFLA 4OM0L 4JG1L 5ALBH 3ECBA 1OTUD 4G3YH 3O6FC 1B2WH 5ITFA 4ERSL 4MNHB 5C08D 2IQ9H 3VG0L 5EWIL 3ZDZE 1T5WB 2DJSA 4WUUD 3WHE1 2FCBA 1VFAB 3MBXH 3F65A 4GG8A 5FM4A 5E5MA 3RWIA 5D2NC 1LEKB 3RKDC 5E6ID 4NQED 3OF6D 2M2DA 5I66B 3BVNB 1KB5H 1T6WA 5D72L 5FYLL 1CFBA 1M6OB 2X4TA 1I7UB 4EN3D 4NQCA 5EC2B 1S7QB 1TTGA 5BMFH 1KF9B 5C71A 1IL1A 1BBDL 3E6FB 3KPPA 3MGTB 3LMJL 1U92B 4ODSL 3VFTB 1AD0B 2HWZL 4JPKL 2YPLE 5I1JH 3HPJB 1MWAH 3WO3B 2JIXA 4FHBD 5HYJE 3L9RB 4EDXB 3IFPA 1TZIA 1X5ZA 4K3EL 4OD1L 5IHUL 4O58L 3UTZB 1DQLH 5CJBA 3BESR 5HHNA 3WFZA 3O3DA 4NZRH 5FKPA 4PBVC 5D1ZB 4KVNH 1AGDA 4WI6A 5EH1A 2X70B 3VG9B 4NBYB 3W11D 5DD1L 3IU3A 4AENB 3TBTB 1IILE 1A7PH 1OGAB 4OJFH 2AABL 1NCDH 1I1YA 1NBYB 4HKXB 4WU5A 5LCVL 1CXIA 3GMRB 5LBSL 3X17A 5F3BB 3DMMC 2ZCKH 4UV4L 4OZIA 3GNMH 2DOCA 3DVFA 1HI6B 3JWDH 5E8EA 1SMOA 3MRJA 2W9DH 4RISH 2FEEI 1G1YA 1QBLL 5IW1B 1BOYA 1A1OA 2EDYA 2YA0A 2HG5A 3DXAB 3QEHB 3LN4A 4JJ5A 3TN0A 4BJLA 3MV8B 2G60H 1KACB 1J8HE 4HIIA 2A6IA 1YNKL 3GSRB 1UA6L 4AMKH 5JORB 4HEPG 4YWGH 5I6XC 1N4XH 1BJ1H 5ESQB 3BP5B 3FO1A 3T0XA 4QOKD 4ZO7A 1CBVH 3FOMB 5T1LA 1EAJA 1NKRA 5JXAH 2W65A 3GEWB 4PRPE 3FB7A 1MCQA 1CF8L 3GSWA 4KMQA 1DL7H 4FQLH 5SWZD 3C6LD 5EN2A 1A1MA 4OAWB 5CJ8A 3QUYA 2Y7QB 4WFEE 4A2LA 4KJPD 5KJRH 4KHTH 3IDXL 3GKWL 4W6WB 2HMIC 2H6PB 2WBKA 5CSGA 4ORGA 3BDYH 3CH1A 1BD2B 3FRPG 4RFEB 2YKLH 4FZ8L 2ICEA 3O11A 1JPTH 2ERJC 2EE9A 1OTSC 4MHHG 3WXVH 2FBJL 4LNRA 1IGYB 2BRRL 3P0GB 2Q76A 4CVXA 4WTXA 2AGJH 3O6FA 4HWBA 2AK4B 2A6KA 3WBDA 1FGNL 3DV6B 4BQ9A 3BRDA 4JFXA 1FO0L 1BOGB 3PHOA 4KJYA 5JOEA 1GZPB 4JPVL 4M3KB 4J1UA 4FQJL 4ESKA 3QH3A 2QADB 4H0IA 1DEEA 1MQ8A 1FYTA 5D2NA 1J0IA 3MV01 1M7DA 4P2RA 3MRHA 1D5MA 2QTEA 5I1LB 4IDLA 4P2QA 3GI8H 2DQDH 4P59L 2RHEA 4N8VB 4LPUA 4GRLC 3EYUH 3LHPH 4YC2B 1A6TA 1BF2A 2E7BA 5IMMB 3UJJL 3ALPA 2R4SL 1ZLWK 4JN2B 4G7VL 4JKWA 5IFHL 3MA7B 1I7RB 2A0LD 4PP1D 3TV3L 3WFEH 2XTJE 4OCMC 3I2CL 3ULSB 3GHBH 2F53B 1N6UA 1SQ2N 1U8OB 4LRNH 3EDDA 1N6QL 3QISA 4XP1H 4XGZA 4GJTB 5IVXB 2A9MH 2IAMB 4TVPH 4WNQB 3SE8H 3KPNA 4AEFA 2YN3A 4S1QH 2IQAA 4MNQE 2D7MA 5GRVL 2BY1A 5E6ZA 3WIIL 1T2XA 1GXEA 5IBLC 3NZ8B 2A6JB 4JRWA 4N0YH 3QXVA 4ETYA 2L0DA 4G8FB 3V6ZB 1YEKL 3RNKB 3FT3A 3DMMA 3RGVC 1NDMA 3H9HA 1AY1L 3TBSA 2VH5L 3T0EC 1ORSB 4YHNB 3KYMA 4PJEF 2VISA 5GGUA 2FDBP 2YZ8A 3QQ4A 4P49A 1MFAL 1S7SA 3LS5L 3QDMB 5IVZB 4KK6D 2RJMA 1FZOA 1OCWH 3WYRA 2QHLA 4XH2A 2DYPA 3ULVE 1CZ8H 1DQJA 3H3BC 4M1GH 2X4PA 4Z7UB 2Q7YA 5GS2H 3ZYIA 4D0CB 4JFEE 2IBGA 2P7TB 2QV2A 1KCRL 4MQXC 2C7UB 1HH6A 3MRFA 2GQHA 1CICC 1MCPL 1XCQA 3QIUC 4F7EA 1ZEAL 5FK9B 2OZ4A 1HKLH 32C2A 4PP2B 5L7XL 3DO7A 3QO0A 4QNPF 2AW2A 3GSQB 2J5LB 3ES6A 4DGVL 3SKJH 3WL9A 2HP4A 2NZ9D 3D69B 3OAUL 1LWRA 1DBMH 1ADQH 1U3JA 4MCZA 3OKLB 1I8IA 3GJFA 4AM0B 5D7LD 5A1AA 1G9NC 4QRRE 4DZBB 1JRHH 5FIEA 4DAGH 2R15A 1HWHB 3SDCC 2F74B 1K5NB 2D0HA 3GSVA 3HZMA 3KLDA 4HJGA 4UT9H 3SE9H 3V52L 5H37H 5BO1L 4FA8A 3O2WH 4GAYB 3JTTB 3MRMA 3LRSB 2EZ0D 4FXKB 1UM6L 3PQYD 3NA9H 4HZLB 1X4XA 2FGWH 3P4OA 2CUIA 3UTQA 3QIBB 3RDTC 3MUGB 1P7QB 3FZUD 3LN9A 4P4KB 3MJ7B 2MMXA 4PBXA 1P1ZA 2UVFA 5C07A 5E8OA 1KIPA 4XNZC 5LG1A 3KLHD 1TPXC 3HC0A 3QCTH 1F4YH 2DI7A 4L29A 1CXHA 5IK3B 2D4DA 1NGXA 1Z5LA 4ZFGL 4NOFA 1OTTD 4LHUA 2NY4B 4YQXL 3ZE1F 4J4PC 2FHFA 4HWBL 2CLZB 4U7KA 5DHVB 4YHYB 4I0CC 4GRLA 1I7TA 3C5ZB 4DCQA 4GO6B 4MDIA 4MZ2A 4NQSA 3EO0A 3H8NA 1YN6B 1OSPL 1MFBL 5DJYB 1FVCA 3TJHD 1EEYB 4OD2A 5C09E 2YPLD 1BQHG 1D5XA 1MHHB 3W9DB 3TNNB 5HYJD 5D2LB 2PW2A 1PYWA 3WDHA 4N0FA 5F97E 3GDBA 5SV4A 3SDYL 1KJ2L 1Q72H 2BSRA 3CZJA 1NL0H 1ZT4A 5EU3A 4YX2L 5AAWA 2X09A 5GHWL 5FYKL 4PJCA 2YMXH 2IH1B 4HCRA 2QKIA 3FO0L 4EBQL 2ID5A 1FDLH 5BJTB 5C0BA 4LVHC 3RGVA 2APWA 2ED8A 1MCDA 1C5CH 4OLZH 3T0EA 2VLKA 2NZIA 2HJKA 1S9VA 1TNNA 4Q2ZA 4X99A 5E9DD 3TWCL 3WE6B 3LKQA 4MWFA 1IGTB 1OAZH 2YBRA 1P7HL 3H9YA 2F5AH 3BQUD 1R3HA 3MBEB 2CIKA 1WC7B 3QSKB 4C59B 1DTUA 4KVCL 1RIHL 1I3GL 2OMBA 1J8HD 3PWJA 2QSCL 4LARH 4HBQA 3KPSD 5ID0B 3O3BA 3D39D 3OGCB 4ZODA 5J0BA 4QHNB 1CICA 3LQZA 4PJ7A 2R2HB 3QIUA 5ESVB 4BH7B 1U3YA 4IHOB 4QRQB 2BOCA 3OPZL 1NUDA 4PRPD 1C5BL 3CJJA 2GAZB 4O02L 3CFKB 5H35A 3FHAA 5E8DL 5ETUA 1V3LA 1FNHA 4TULH 4CRPA 1A2YB 4M7JH 3VDCA 2VDNH 1T2QL 4TNVF 4WFED 3KPRB 4Q9QL 4XAWH 5FOJA 1N3NA 4XBGA 3NABH 5CHNB 1QVOB 3IFOB 3L5HA 4KUZL 3VFVB 5DEFA 3D9AH 2C1OB 2QHRL 1JGLH 3SDCA 2OZ4L 1EXUB 4ONOA 3X14B 4YBLC 3ILQC 1MPAL 1RJZB 3P2TA 1GGBH 1FCGA 1ZLSH 3LVEA 4DKDC 4P48A 4RDQF 3OXSB 3TC9A 2ZSVA 3ZTNL 4Y2DD 3FN3A 5GQBA 3ALWA 3BW9A 3QO1B 2QSQA 5EU5A 1F2QA 1K8DB 3LDBB 1UB5A 2DLHA 3WS6C 5IG7A 4GKSA 1U91B 1NCUA 3QULA 1E4XH 4X7FC 2FX9L 4PRHB 5FO7A 4RZCA 3BKJL 4PGZA 3VXMD 3M07A 3SDXA 3CK0L 3VXTA 5HHQB 4J4PA 2N1KA 3MRLA 4P3CL 2GT9B 2PN5A 4PJFB 4EXPX 3R0NA 4A6YA 1LEIA 5IB1A 4OCXL 1NAMH 3QIWC 3KG5A 5HHPB 4PJBE 3VD3A 3NTCL 4DVBB 5I1GH 1A5FL 1LO0H 2UYLB 3QA3B 3TESA 5BS0B 4XPGL 2B1HL 4KZDL 3NCYP 1WWCA 4HBCH 3CMOH 5B4MC 4FP8H 3HUJE 3C8DA 3WLBA 4ODUB 4UQ3A 1ETZA 2XTJD 1T0MA 3D18B 4JZOB 5CUSH 5C6WH 3IB4A 2HRPH 4KXZH 4WENB 5IF0A 2V5TA 5FOBB 3BP4B 2AKRA 3KPOB 1RQ5A 4L8BB 1HYRC 1NGPL 1T1XB 4U7MA 4JGJA 2H32A 3IAPA 4XCYB 4HXBH 2BHYA 3NN8A 4J7RA 4Y19A 4HH9B 5CWSB 2H2SC 3WEXA 1RURH 4QEGA 4BSWA 4F58H 4ZFOB 3SY0B 1S9XB 3MFGB 2JJSC 2EEDA 2RCSH 1NLDL 3CXHK 3V4VL 1S9YB 5E8NB 3SJVB 3OZ9L 3PWNA 4P46B 4YXLL 4P3DA 2P1YA 4E9LA 3FN0H 5LXGL 2VR4A 3REVB 3MJ9H 3Q6FB 4JZNA 4NO2B 3RWDA 3DECA 3RKPA 2FB4H 4JKPH 1J05B 4HCRL 4IRZH 3PWUA 4PJ9B 5E4IA 5C0RH 3A6BL 1ZHNB 1UWEL 5DUMH 2IH3A 1T4KB 3QEUB 3IDGA 4KK9C 3H9SD 5LAXA 4KK8D 3QEQB 1MCNA 5I17B 3QG6A 1QFWI 4EUPH 4OGZA 3C60D 5HPMA 1MAKA 3H3PL 2VUOA 2UY7A 1ZGLM 4MJ4A 1DBBH 3RA7H 4U6YB 4C58B 4WTWA 3H9ZA 3P77B 4LVOB 3KS0H 4YDVB 1AJ7H 1NC4B 3U82B 3G5YA 3GM8A 4OCSL 4WU7B 4XPTL 3SO3C 3BSZH 2XFXB 3Q1SL 1T66C 5LGKA 1X5LA 3AU1A 1KBGH 3M1BA 3WXWL 2X7LB 3HR5B 3BGMA 4QRSB 5FYKU 3RWGA 1T04A 3GSNA 4NNPH 3IFLH 4OZFH 3DSFH 4PLKD 5K93A 2QR0B 3W9EA 5ESAB 3VXSB 1CDHA 1FV1A 1YEFH 4K7PX 4FQXB 1Z6JT 1G9NL 1JV5B 1QEWA 1S7WB 1SYSB 5FUCE 3FO2B 5C8JA 1MLBA 4LFHD 1GVIA 4Y88A 3LKRA 5EUOF 5F1IA 3VGAC 3SO5A 3LCYA 2JB6B 1D5IH 5KAQG 1A22B 2NX5E 2HFEB 5FUOH 1T1ZA 1BJ1J 1U93A 4ZDHB 1KT2B 5BRZE 4LLUA 4PRAA 1XR8A 2VE6A 4Q7DA 2Z31D 1OQOA 3P3YA 3QIWA 3WN5A 2B2XL 4JFHD 2HFFB 3CUPB 4GLRH 4HLZH 5GGVL 5GGQH 3BIKB 5FECB 5TFSH 4J3XA 1F90L 1KIRA 1U8MB 4P4RA 4UBDC 4E5XA 4O4YL 2F5BH 4LLYB 5HHVH 3BPCA 3DUHA 1JMXA 1KG0B 4AJ0A 3P30L 2LU7A 3RPIB 5A40E 3LEXA 1YYMH 1K2DA 3O4OC 3UC0H 5DSCB 2Z92A 1NMBH 2A6DB 4H1LH 1KXQE 1PAMA 2Q8AH 2FECI 4A6YL 3ZE2E 1EPFA 1N6VA 3IKCB 4FTVE 1GHFL 4QF1B 1IZJA 2JJSA 5GXBB 1OP5H 3DHMA 3VGEA 1I9RH 4R90L 4YHLL 1AR1C 4R4ND 5TE6L 1U95A 2PNDA 3HMXA 1YEJH 3MLVH 3TPUB 5T3ZE 5TF1H 1CGSH 4F7PB 5ISZE 2NNAA 5D7JD 2AVGA 4RMTA 2UWEA 2OP4H 2DAVA 4MVBC 3SCMB 1PG7H 2ATKB 3QUXA 2KH2B 5K9KA 1UCBL 2F58L 4WDIB 1D5BA 3G5VB 4N5UA 1MFDH 2D7NA 1MCBA 4XP6H 3B5GA 3K3QA 4OQ1A 3DGCR 4OM0H 1UFUA 4JG1H 3RUGB 3RWEA 3BXNA 4I5BB 3QEGL 3U1SH 2R0KL 4OF8A 4UOW1 1DVFB 4ERSH 5E70A 3QHTC 3CCHA 1RI8A 4OZGB 4Q6YA 5E99L 3LS4L 3VG0H 1G1CA 3BWAA 2IFFL 3OKKA 5EWIH 1BZQK 5FO9B 5LVEA 1H3VA 2OSLA 5IQ9A 4Z7VA 1XGTA 4CUCA 3L5XL 5MENE 4HKBA 2HJLB 5D72H 1A9EA 4Y5XA 3O41A 2V2WB 4UQ2A 5F9WC 4CW1B 3PABB 3UTOA 1A6AA 5F44A 2CQVA 3ZTJG 5IGXL 1BBDH 3K2UL 4ODSH 4CMHB 3CFEB 4O5LL 3MLTA 4JPKH 3ZDYF 1CXKA 3B83A 3WNNA 1EHAA 3BYYA 5T1KD 4LSQL 2YSSB 2W92A 1M7IA 4K3EH 4OD1H 4PJGB 5IHUH 5BW7C 5EO9A 5IHZB 3QFJB 3GSNL 4O58H 4WEBH 1P84J 4PLOB 5JHDB 5CZXD 5EA0L 4MS8C 1M7XA 4PR5B 3PGDA 1BEYL 2R4RL 2LVEA 5D7IE 1WJ3A 3LPWA 3IF1B 5DD1H 4AK1A 4RMVA 1AHWB 2P4AB 2AABH 5LCVH 1X5KA 4K23H 2XWBA 2Z91A 4UV4H 4AIXA 3UZEA 4ZFFA 1MCIA 4PJHF 1QFUL 3KXFD 3BKML 4M7LL 3RZCA 5K9OA 4N8PA 2X89A 3WUWB 3VD7A 4MQ7B 2P24A 5IOPA 4PUBL 4QHLA 4S2SA 3IAQA 3UJIL 1YNKH 4WHDA 3MREB 4F57L 1FORL 1MIEH 3HZVA 3MLUL 2V2XB 4OZHB 3GJEB 4OZ4A 2ZNWA 5JXEC 3MRDB 1G7IA 1MAMH 4NO3B 5GGVY 4APQB 5FHAL 2P43B 3B9KA 3C2AL 4X7TB 1RZ7L 3L3OA 1JTOA 4PJ5E 4QXUL 4GQ9L 4ZUWA 3OKYA 3AS0A 4R97C 3L1OL 1DN0B 3M17B 1LGVA 2PKDA 1PKQB 1L0XA 3MCLL 3GKWH 4JFOB 2Q86A 2XN9B 4U3CA 1G7QB 2VJXA 5CJXC 4ZG1A 1I8MA 2AQ3A 3RVTD 3N1GC 1RZGA 4FZ8H 3EFFA 3NIFF 2OTUB 2PYEA 5HGGS 2WIIB 1H3WM 1CFNA 3S96A 3MR9A 1IGCL 2FBJH 2G5BB 4KKLC 1OTUC 3V4PL 3HMXL 2I9TB 1G7HA 1B4JL 3GBNL 1JF1B 1FGNH 3TLRA 2NR6D 1FO0H 3RL2A 3VWKB 4F9LC 4NKMA 2NY1D 4N8CL 4JPVH 2LE9A 2YC1B 4FQJH 3GSOA 1KV3A 4LMQI 4JPWL 3QI9B 3LD8C 4UV7H 3KPMA 1JNNL 3H7BB 5E6IC 4HXAL 5KVDL 1NC2A 5E7FA 1XGUA 5HHOE 3T0DA 1INDH 1SYVA 4EVNB 1MFCL 2DLIA 3ARFD 4EN3C 4P59H 3D87B 2FYYB 5C0FB 2ORBH 5T33H 4KRPD 2DWDB 4P23D 1G7JA 3T04D 4B7IA 1FNEB 4YDIL 3IAGC 2R4SH 3TT1H 5ICYA 4G7VH 1PKOA 3TBYB 3BPNB 1ACYL 4QGYA 4AL8H 2FRGP 2XI9A 4N0UA 3TV3H 3FQUA 1AR2A 5BW7A 1JZ8A 2AJSL 2CLVA 3I2CH 3QXAB 4RWHA 1BQUA 4W4OC 1G9MH 3FQXB 5DS8B 4E41A 1MCSA 1RPQA 5HYSB 3ARED 4K3GA 4WO4B 2NX5D 3CSYA 4L8DB 3STLA 4M61B 5BV7C 4N1EA 3W11C 5JZ7D 2F19H 4J3TA 4F80A 1KN4L 5J4MA 2OXGA 1SJHA 1H0DA 3CSGA 3FOLB 3GK8H 2FL5B 4Y1AA 4ZUVB 1AKJD 1AY1H 3ARGC 3FFDB 1HSBA 2VH5H 4MZ3A 1PEZA 1KTLA 3D3VD 3K7UA 1ZT1A 3QNZA 3DBXB 2GCYA 3CGTA 1CE6B 3V7AE 3I3DA 1MFAH 1WCQA 5A2JH 3EYOB 2DBLH 5C0CB 3FB6B 1R5VA 2JJTC 5DQJA 3DRTB 1CTNA 4X5XB 5MEQA 3B6SA 4RGOL 4RA0C 3AXLA 2GSGB 3P4NA 4I13B 3NCMA 1TDQA 4LPXA 1T1YB 1KIQA 5JIKA 2P8PB 5JXEA 1B6DA 2WBJD 4UDTA 5K9QI 3ROLB 1MCPH 1MQKL 2GTWB 2O61B 1ZEAH 2KL6A 43C9A 4BSJA 5L7XH 3EGSA 4KQ3H 2OR7A 5I9QC 4DGVH 3O45B 1CGUA 5E24E 3R1GL 4L1HA 2Y23A 1MIML 2E27H 3OAUH 1JHLL 2J8UA 5SX4H 1OOAA 1IGJA 5ADPL 1HXMA 5T3ZD 1V3MA 5CEZH 4UOW0 4Z0XA 1YZZA 5ISZD 3S97C 1L6ZA 4O2EB 4LSPL 1UZ8B 5CJXA 4KV5F 1N5YL 3FRPA 4OFDA 1MHPL 2GUOA 1AQDB 2PW1B 3REWA 3V52H 1BD2E 1CLYL 3SEPA 4NYLA 1UM6H 5CJ5A 2BSTA 1HK6A 3RPKA 5AD0A 2NW3B 3EYQD 1DCLA 1XF1A 2CDEA 4F37F 3TBWB 1GGTA 1QZ1A 2X4NB 4M93B 1JGVH 4PJ8B 4F9LA 1Z9MA 5C0AA 2AK4E 3I6GA 2LTQB 3GMPA 3I3BA 3T2QA 2XQYK 4KJQC 4LLDB 2EDEA 5E6IA 4NQEA 3BI9X 4EXKA 1XIWB 3UBXB 5MEND 1EFXD 5CSZB 5CGMA 5KZCD 4EN3A 4XXDB 5DO2C 4YQXH 4HWBH 2X4OB 4X6EB 5D5ME 3UP1A 5JPNA 1T22B 1HKFA 2Y5TB 4U1JA 2V7HB 4LCCC 2BSED 3TM6A 1M4KA 5DEGA 4BZ1L 1OSPH 8CGTA 1MFBH 1FFNA 4UNUA 1JHKH 5D4QA 5KS9B 3SOBL 5HGHA 4LCUB 1I1RA 3GGWA 3SDYH 4Y4KB 4QRTB 1G7PA 5D1QB 2HVKA 4KJWD 4HFWB 4LMQE 5D6CB 3T4AB 1MI5A 4LCWD 4UB0L 3CDFA 4XNXL 4JPIB 4YX2H 2F53E 5GHWH 4KTEL 5I15L 3X13B 4YHKL 4HS3A 3IXTB 5IVXE 5FYKH 4TYUA 4RRPG 3OKOA 1F02I 3HN3A 3FO0H 3BUYB 4JFFB 4GAFB 4JQXA 5EBLA 5IB4A 4RAVA 2YD8A 3RIFK 3IDIB 4U0RB 4YK4C 4LAQH 4HV8B 5CEXB 1IARB 3LKOB 1K8IB 5FA3B 3KLAA 4BK5A 1YQ2A 2J4WH 3IJYB 5IB2A 3ARGA 1U8KA 1YUHB 4IDJL 4HS8L 2Y6SD 4N5EC 3JTSA 3KS0J 5IB5A 1XCTB 5GS0D 3FB8A 3HZKB 4IMLB 4KDWA 3IDJA 4PJAE 4NWTL 2AJVL 2JJTA 4TSCL 2OQJA 4KVCH 1OAYL 1RIHH 1QHPA 1I3GH 3DETC 4PJEA 4GBXD 3QDME 3G6AA 4PY7A 3EJZD 2PTVA 3LRGA 2X1XR 5D7KD 4PLNC 5HHXH 2ARJA 4Z7UE 5L2KE 2MCPL 3BEWA 3O3EA 4LLQA 3OPZH 2FJFB 2OR9H 5BOPA 1U42A 1C5BH 4KC3B 3CAFA 4O02H 3T8XB 2NZ9C 1D9KB 2VLLB 3QAZC 5E8DH 3MJ8B 4KROB 4PJ5D 3VRLE 1NAMB 1A7OL 2HH0L 3W5NA 2FHCA 3Q6GH 4LP5A 5JHLL 1T2QH 5JLZB 4Q9QH 3KPLA 1AD9A 3S37L 4ODBD 3TA3B 4R7NB 1JGDB 3F7YB 4KUZH 4M8VA 1WFTA 4CNIA 2X4UB 3BN3B 1GH7A 3H3KA 3RVWC 1B6UA 2OZ4H 5T3XL 2MSPA 1E4WL 4Y16D 2O26U 2C5DC 2EZ0C 1IKFH 4FFZL 3G5XA 4U6VL 4XCNA 3F12A 4I48A 5DD6B 4FFVC 2E9IA 3GI9L 3FZUC 3ZTNH 2UUDH 4C56E 5D96B 1NAKL 3D25A 1G7LB 4GG6B 1VPOL 4JAMA 3GJFH 1SY6A 5T1MA 5E8PB 3HNVL 4JN1L 4M7LT 1G6RA 2HTKD 4QXWA 3KLHC 5BZDB 3V7MA 4UAOC 5DZNA 5IESL 4PJIE 4U1KB 2FX9H 3MOBH 1FNLA 2CUHA 3NACL 4K8RD 1PQZB 3TIEB 4KUCF 2B7DT 2R1YB 3CK0H 5I76A 4XX1E 4GRWB 1N0XL 4LGRB 2QEJA 3BP7B 3FFCB 3O3AA 5DRWB 3HC4L 1QR4A 2Z8VC 1QSFA 1E27B 4LCCA 4P3CH 2XKUA 4HK3N 3K4ZA 1JGUL 4QCIB 3RWJB 4OCXH 3TJHC 4MNGB 1RULH 3PGCB 3NTCH 2FEDD 1PY9A 1A5FH 4JE4B 5FA4B 1LP9F 3VGBA 4XPGH 4MQTB 4OFPA 4KZDH 1FSKC 1BQHA 4Y89A 1JIBA 1FZMA 5AZ2L 1T6VN 1OB1A 1PW3A 2AQ1A 2BNQA 3NPSC 5E94B 4X7SL 5EZJB 2IC2A 5D2LE 4XWOD 4YFLI 2JB5H 3FN9A 4I3SL 4ONFL 2ICES 4OGYH 5TDOA 1FZKB 2O5YL 3QXUA 1SJEB 5J3HC 5FM8A 2XOTA 3D2UB 1MHEB 5I0ZA 4U49A 4ZD3H 5IJVB 3L3GA 1NLDH 4X9IA 5D1ZD 2X1PA 4JANA 3ZKXC 4OF6A 2H9GB 2CLRA 4MD4A 2VL5B 4CN1A 3VFUA 2VQ1B 4YXLH 4XMLL 4YPGB 1D6EA 1MCEA 1OGAD 1QLFB 3BQUC 3VI3F 1T0NB 1Q9WB 3V6OE 5ERWA 5ICZB 5BV7L 5DFTA 4Z8FL 4EI5B 5IFJB 2BFVL 1YY9D 5EZIH 3RRQA 4ZPTA 1YY8B 3TNMA 3PHSA 2CIIB 3A6BH 5E00A 3DTXA 3DXAD 1DFBL 5EOTA 1S5IL 4ZTPH 1TQCB 3MV8D 1KTRL 3UJTL 1HHGA 4MCYA 3BDXA 1RK1A 2VUYA 2ZZUT 1S5HA 2PXYB 1MHCA 1DQML 3H3PH 1CU4H 3GMMA 4U1SB 3AAZA 4YO0A 4I4WB 1TFHA 2J8OA 3CVHB 3MRPA 4OCSH 3HPLA 2P45B 4XPTH 5FYJU 3KPRE 3BZEB 4ELKB 3C09B 3V6FB 3WXWH 5JW4Q 5F1NA 4IJ3C 1JVKA 1MY5A 3TFKC 3BH9A 1BD2D 3D0VB 1LO5A 3FTGB 3IDYC 1IC4L 3MV7A 4OFKA 1FFOA 4PGEB 2RQ8A 2XXCB 4AEHL 1E4KC 3VW3L 3O2VL 4KY1L 3CC5A 3W0WE 3KWWA 2VMFA 4UOJA 1RUKL 2EDJA 1PBYA 4IRJC 2AK4D 3D0LB 3PG2A 4NGHH 1P4IL 3OMZA 5DXWA 1GPOL 4BQBA 3W5MA 3H0TB 2Z4QB 3QNXA 3VXOA 2QADD 1IKNC 5L0QB 3BD4A 4JHAL 3NIGF 2A38A 3KGRA 4PRIB 4PRHE 3SQBA 1WIOA 2JK5B 3B9EA 3ULUE 1RUQH 4ZUUA 3P0YH 3VE0B 3GMOB 3G04A 4DTGL 1SY6L 5IIEB 2FIRT 1GAFL 3TVMB 1AC0A 2P5EE 1G6RL 2APXA 3CFJB 2F8XC 2YPLA 5GGVH 4PJFE 5AZEL 4X80L 1IGFH 2XTJC 4O4YH 1JF5A 1TETL 1UZ6E 3IXAA 1W8OA 3P30H 3L6FB 5BS0E 1BJMA 4WJ5A 3T65B 3RNQB 3KYOA 3BAEL 4BFIB 4L3CB 2IG2L 2QBWA 1NGQL 1KSRA 1AGFA 4JM4L 5KG9A 3Q3GA 2F53D 4RAHA 5EIIA 5KW9L 4A6YH 1LDPH 3K74B 3TH2T 2IAMD 3IRPX 5GRJL 4G7YL 1GHFH 1RAMA 2ZSWB 3C5SB 4XMPL 2V5SA 4NSKA 4WI5A 4Z7WF 1D6VH 5HY9B 5CKGA 4Y0GA 4UIKL 1I3RB 5GJSL 4OBSA 5ENWA 5TE6H 2DD8L 4YGVA 4MA3A 2VC2L 3V7AG 3BQUA 2DL2A 2YS4A 2F15A 4NNYA 4TNWK 3SJVE 1YDPA 2Q8BL 4OCRL 2VWEE 1KLUA 4M7ZB 3B9VA 1AGCB 3EOAB 4CJ1A 3ULVC 3BRGC 1F6LL 1UCBH 2F58H 3QDMD 3CPLA 5F1OB 5IR1A 5I1CL 3SGDI 4KK8C 5HHME 1A6PA 1BAFL 2FD6L 4R2GB 3NZHL 1HINL 5EIQA 2EKSA 4K07A 5KSAC 4PRPA 5L2JA 3VFGL 4J8RA 3L7EB 1FVEA 1QPPA 4IRSB 3QEQE 5B39G 3IJSB 3QEGH 1FCCA 4RMWA 5DUPL 2R0KH 3VI4E 5IKCB 1F00I 3NOIA 3OKMA 5E99H 2BP3A 1KTDA 5HVGB 5B8CC 2IFFH 2PCPA 4I18C 1RK0A 5JO5B 1MF2L 2COQA 2HN7A 3WFHB 4JKLA 3NH7L 1UM5L 4L4TD 3IGAB 3EW3B 5MP6L 3FT2B 1IAIH 1T03L 1DZBA 2A83B 5INDA 2X9XA 3F7RA 4KHXH 3UTSB 5EG6C 4PLKC 3ABZA 3EAKA 1CVSC 4TPRH 1WAAF 2AK1L 2AERT 4JJHA 4TRPH 1MRFL 1F8TL 4TUOA 5B38B 2D7QA 1BIIB 1E4KA 2JELL 5IGXH 3ZE0E 1FFPA 4HG4J 3QG7L 3VXSE 4O5LH 3VXRE 4JFPA 4ETQB 4YHMH 2CKBA 2DKSA 4IRJA 2V2TA 2ESVA 4FFYL 2NXYB 3QIBD 5KN5A 5D5MF 3DX9B 1P7QD 5ALCL 2DTSA 4P4KD 4L8CA 4LCYA 4M7KH 3GSNH 4GSDL 1IKNA 4X6DF 4I9WD 2R0WL 5EA0H 1NBQA 3RWHA 4H26B 4WFHD 4JVPA 4N9GA 2NY2B 5EUOA 1A9BB 2Z31C 4Z78A 3OKNB 5DJ2B 1C16B 3KYKL 1I8LC 3QUZB 3JUZA 2I60L 3JSSA 5HI3C 2NY4D 4QT5B 3L7FA 1D3CA 2GSIB 3INUL 3C5ZD 4OZFG 4NN6C 1BQLH 5KSVB 4NZJA 1PVHA 4F2MB 1CFSA 2B5IB 1QFUH 3MUY1 1CR9L 3SDDB 2CRZA 1T80A 4M7LH 3KDMB 1IQDA 2KDGA 3QHZL 4WGVB 4KZEL 5EOCH 1NKOA 4PB0L 4XHJD 1PSKL 5C0IA 4PUBH 5DFVD 1F3RB 1FZJA 1R3IL 4MNQA 2ADJA 1KULA 2OI9C 3B8YA 2BC4B 3MLUH 1Q9KB 2NTFA 3GMLA 4PJAF 4KTYA 5FV2A 4R4NC 4XNMA 3C2AH 5ITFB 1RZ7H 2IBZX 4XB7A 3SGKC 2HKHL 3CFDB 4M1CC 4GQ9H 1ZMYA 3L1OH 4IOIA 2IPUK 4C83B 1CFTA 5D7JC 5D1XC 2EIZA 3MCLH 4Y5YC 2J6EH 3OKDB 4NJAL 5IBTL 5F9DC 3ISWA 3QRGL 4DGYL 1NFDF 1LE5B 4JFEA 3MBED 1HWGB 2CJUL 4NC1E 2V17L 1JK8A 1H15B 4LOUD 5KSAA 1I85C 2DKMA 1IGCH 5EU7E 2EDBA 4XPBL 1X6LA 4H1LG 4EEEA 1R0AL 5KOMC 4LSDA 3IKKA 1IL1B 3CZFA 3KPPB 1B4JH 3GBNH 5EC1A 3RUGE 2EXWD 4XNYL 1YEIL 3KPTA 4N8CH 4NKQB 5B8CA 2FGZA 1BM3L 1TZIB 4D3CL 3K8KA 3KPQB 3RI5F 3FO9A 2I5YL 4I18A 2VXVH 4QRRA 4OZGE 4JPWH 5C3TA 3RL1A 4JM2F 3LEYL 2O5XL 4HXAH 5HHNB 2YUWA 3KPRD 5KVDH 4FOMA 1A3LL 3PP4L 3O3DB 2VLRB 5DRZB 5K9QG 2CKNA 4ISVA 3G6JF 3GRWH 4PJDF 1UB6A 4JGMA 1FL3A 2FX7L 4R9HA 4NPYB 3IU3B 2MQCA 1ZLVH 1BFOA 1I1YB 3R06A 4PJIF 1FL5A 4YDIH 2D0GA 5HDLA 4LCIH 1ACYH 5E8EB 1CE1L 4EJ1C 4KK5C 3ZYZA 1YMMB 3ARTA 4QYOA 3ARDA 2HG5B 5CP7A 3FAXA 3LKNA 5CZXC 4JJ5B 3TN0B 5MI0C 2Y4SA 4QHMB 4PJGE 4XX1G 3QFJE 1FFQA 1JMZA 3KJ4C 4I0PA 4X6CE 5JHDE 4PRHD 3B4NA 1DANT 2Z31A 3FO1B 3UPRA 1KN4H 3OSKA 4YDLC 1FVDB 5T1LB 1I8LA 3ULUD 2CKBL 3FB7B 3VD5A 3JWOC 2ZKHL 4P9HH 4ELME 1CD1A 4XI5D 1P6AB 5C09A 3GSWB 43CAB 2DB8A 3DV4B 1A1MB 4TTGA 2BNUA 4X4XA 1T3FB 3JZ7A 5BS0D 1U8PB 1FIEA 2WV3A 2HA1A 2CR3A 4ORGB 2R56H 3CH1B 3KHOA 4PJHA 4OI7A 4RQQA 4RGOH 4ZS7L 2AI0H 4OF3A 4RAUB 2ICEB 3O11B 1V7MH 4DN3L 5DVLA 4P2OB 1Y0LA 2LABA 2R0LL 3DIFA 4LNRB 1WEJH 3O6FB 3PDDA 4OZHE 4OD3H 2A6KB 4ONHA 3SGKA 3R1GH 1FRGL 4IMKA 3ARXA 1MIMH 5FO8A 3ZYJA 1CD8A 2VABA 4B53A 1JHLH 4LASL 3QH3B 5D1XA 3SJVD 1DEEB 4XMKL 1EBPA 4P46D 3I6LE 1WZ1L 3CXDL 4Y5YA 3T2OA 1FYTB 5HGAB 2APFA 5F88A 1YPZF 3LOWA 1N5YH 4P2RB 1D5MB 1KJ2B 3CLEH 4LKCB 1MHPH 4X8JA 3S5LB 4F33B 3C9NA 4ODVL 2XN9E 5BVJB 2VXUL 1I85A 4PJ9D 4WHYG 3UBXI 3QWQB 3UYRL 1TCRB 1DBKL 5H94A 1A6TB 4HW6A 1ZAGA 4TUJB 3QEQD 3TCLB 2NR6C 5D8JH 4CU6A 3Q5TA 2DF3A 2R2CA 5AUMB 1JBJA 1SEQL 3EYVB 3ULVL 2RR3A 4X4YA 1KYOK 1P5UA 1J7VR 3IU4H 3MLWL 5E6YA 1MCFA 2PO6B 3GMQB 1S9KC 4P57A 3PWLB 4NWUH 1OP3K 1S7VA 3EKCA 4V1DB 4M9PA 4ZSOA 3KPNB 2YK1L 1NCWL 4OV5A 3UO1L 1S7RA 1RFDL 4YHOL 2BVYA 3ARFC 4GKNA 4QTIH 1PG7W 1NC4D 4AIZA 1U8NA 4F7TB 2D4FA 1R5WA 2GITA 4KRPC 2HLAA 1WICA 4P23C 3SE3C 2FEEL 1I75A 1DUYA 3FT3B 3DMMB 4AZ8A 1NDMB 2B1AH 3TBSB 2R29L 4HHAA 3KYMB 1A6WH 5T1KA 1I9JH 2VISB 3VXSD 2R69L 3BX7C 3SOBH 5FUCC 3QQ4B 1F58L 1U41A 3WKNA 1S7SB 4FQXD 4LU5H 3AREC 3I84A 1KLGA 3QDJE 5DD0L 4XH2B 2DYPB 1JZ5A 5FYJH 1RZIB 4XNXH 1DQJB 4F7MB 3MJ6A 2X4PB 4MJ5A 3FONA 2Q7YB 4KTEH 5I6XB 5CKAA 2BOBB 4YHKH 4FMFA 4IEFB 3DWTA 4LVNB 1XGRA 5JZ7C 1HH6B 2XNAB 3MRFB 1TQBC 4F7EB 1EX0A 3F6LA 32C2B 3DO7B 5F6HJ 4PJBA 3ES6B 1Q1JH 3WL9B 4FXGB 3OB0K 1F4WL 5J12C 2C3WA 1HOCA 1A7QL 3HUJA 4PRDB 1HQRA 1DQQA 4HS8H 5C9JA 4KAQL 4LQ1A 1Y6KR 2XYCA 1I8IB 3GJFB 4NWTH 3UROR 3HAEG 4XVSL 1OAYH 2DQUL 1MSPA 1TVHA 2W0LA 3VGHA 3GSVB 3HZMB 3NFNB 2ADFL 2HT2D 5C0CE 3HCVB 4JHWH 5F7DA 2ERJB 4LSVL 1H3TA 4Q9BA 1HHJA 2VDOL 5CMAA 3MRMB 5LGJA 1EZVX 1FPTH 4Q74A 3K2MC 4MJIB 1UEYA 5FGSA 3P4OB 4L3EE 4HULB 3HI6L 1J1XL 1OAKL 2I07A 1IAKB 3EYSL 1SJVA 3EO1B 1A7OH 5C07B 2HH0H 5JHLH 1KIPB 1RUMH 4XWGL 1EHXA 1YEDB 1UJ3C 4L29B 1R24A 5IHLB 4PGBA 2EYSA 3ZT7A 4RX4D 2FNBA 1NGXB 1Z5LB 5T3XH 3FMGL 1WIPA 3U0PA 3S35L 3VJ6A 3SCMD 2FIKA 4FFZH 3OG4B 4GRLB 4DCQB 4OZIF 4MDIB 4G9FE 4MDJA 2GJ6A 3EYQC 4HQQL 3C6SA 3GI9H 4YNYB 5I73C 2YD3A 1LK2B 4DUVA 1FVCB 1NAKH 4Z7QF 4M5YL 5FDWA 1Q94B 1VPOH 4OD2B 4D8PA 3PWPA 3HNVH 1BLNA 1PYWB 2EC8A 5CZVL 4N0FB 5GGRA 4U33A 3CFCL 2R1WA 1DVFD 2ZUQC 3IETA 1AP2A 1ZT4B 5EU3B 5IESH 1CDBA 2YOCA 3NPZB 2MKLC 3BH8B 4MLIA 3ARFA 3HG1A 3JWNC 3SGJC 1MAJA 1QFOA 3MFFA 3QXDB 1HCFX 4YH6A 2QKIB 3HC4H 3SE3A 4NM8L 4OLWL 4NKIL 1JGUH 5F9JA 5DD3L 1IQWL 4IS6A 4X99B 4X7DC 3LKQB 4MWFB 2YBRB 2EDHA 1R3HB 2VYRE 4JGUA 5BZWA 5AZ2H 1GCFA 5TQ2L 4X7EC 4M62L 4ODWA 2NX5A 5EULV 4X7SH 2Y06L 1QD0A 4ONFH 1KXVC 1P53A 1QSVA 2DIJA 3QFJD 4PS4H 2W0KA 3CDCA 5BRZA 5JHDD 4RRPA 3LQZB 5B3JE 5TDNB 1H9VA 3QIUB 5FM5O 4M03A 5TGBA 3TO4C 2BOCB 1UG9A 2IBBA 1XF5A 5ANMB 2AV7B 2BJML 5FGBC 5H35B 2Y6SC 5SV3A 1XZ0B 4XMLH 5GS0C 2BY2A 1IAIM 3EYFA 4BUGA 3L5WA 1OL0A 5BV7H 4R0LC 4WRLA 4GBXC 4NZTH 5DVOA 4L4JA 3SDCB 3EJZC 4G5ZL 5ICXB 1L0YA 4TNVK 1WITA 1A6UL 1DFBH 2ZUYA 3LEVL 1S5IH 3JWOL 4GXVL 1TJIH 5CGYD 3LSOB 4FTVA 3UJTH 35C8L 1U9KA 4XPAH 4Z0BL 5E1AA 1OM3H 3FHQA 4YE4L 1JPGA 4LGPB 3L3KB 3VFSA 4YDJA 3BN9D 1DQMH 4ZXBC 4YHIA 2PR4L 5J1SC 3S4SA 5BMFL 3M45A 1UQSB 4APQD 1OQXA 4GW1A 1I4FA 1T21B 5EU5B 1A14L 2CDGA 5CBEA 1X44A 4PJXF 5I1JL 2MPAH 1TZHB 5IG7B 4H20L 4GKSB 4J12A 3BZ4B 1UJ3A 1LE9A 5FO7B 2KZ1B 3WNMA 4Y16C 5D93C 3SDXB 1DQLL 1F11B 1NLBL 2BXYA 3OQ3B 3VXTB 5DJXB 2XN9D 2IANB 1YMHA 4KVNL 4ZAKC 6CGTA 4XPFL 1IC4H 2AQ2A 1LEIB 1EEZA 5DHYB 4TVPD 4ODXB 1A7PL 1VGEH 4OJFL 4AEHH 4AH2A 1NCDL 3BD3A 4KY1H 5T5NF 2EYTA 2NW2A 2ZCKL 1RUKH 3GNML 3BPLC 3TZVB 3OAYH 1E4JA 1T0MB 4GG6E 2W9DL 4RISL 1P4IH 3PXJA 1GPOH 2BNRB 4NUJA 4PTUA 5EOCJ 5IF0B 3EOBA 3VWKD 4K8RC 3UPAA 4LSRL 4JHAH 2G75A 1ADQA 2H32B 4WTZA 3SGJA 3QI9D 3NN8B 2OYPA 1KTKE 3WEXB 5DC9B 1S7UA 2X05A 1N4XL 4BSWB 4IOFD 1N64L 4HK0A 4UUJB 2W9LA 5AG8A 4GRWE 1CBVL 1GAFH 3FFCE 5IM7A 2A74A 1Q8MA 1G6RH 2FEDC 3HZYA 1OSZA 3PWNB 4P3DB 5C0EA 5AZEH 3L3HA 4X80H 4X6CF 1X5XA 2MQ0A 3JXAA 4G8EB 1NGWA 1TETH 4JZNB 4J3WA 2X1OA 1DE4A 3V0VA 3BAEH 4OLXL 4BKLA 4KHTL 3R0MA 4XTRD 1NGQH 3PWUB 5HYEA 4ELMF 5KTEL 1BBJA 4D9RE 2P8MA 4X4ZA 2OTPA 5KW9H 5F7UA 4KH2A 1VFBA 5LAXB 5D7IA 4P0DA 1EAPA 5DQ9A 5FDYA 3QG6B 3TO4A 1JPTL 5GRJH 3BIBX 4NFBA 2GK2A 2ZUVA 5HPMB 3FKUS 3IRZA 1NMCB 5FGBA 4KI5E 1IAOB 2DD8H 3FCTA 2VC2H 2FJHB 4ZUTA 3VXPB 1AGEB 4XRCB 3BGFC 3LZFL 4R0LA 4OCRH 2Q8BH 4ZFZA 4ZNCD 3G5YB 4GBXA 2PF6A 4MQSB 3AU1B 4YBLB 1CIDA 3BGMB 5C86A 3RWGB 5DYOB 1CDUA 3PNWA 2HLFD 1T04B 3GSNB 3OHXB 4CJ0A 5C0CD 5I1CH 1BAFH 3QFDA 3NZHH 1HINH 5JNYB 4Y4FC 4KFZC 4DKEL 2DQDL 4M6OH 4JFYA 1OARL 3VFGH 3EYUL 4DW2L 4ZXBA 3RX8A 5HTSA 4Q0XL 3HE7B 3LV3A 1KPRA 4O2FB 4HWZA 5C8JB 1MLBB 1OD9A 2WK2A 3WFEL 4X5WA 5F1IB 2E7CA 3RIAF 2HTLC 4PJCF 1CLZL 3NH7H 1UM5H 2XKNB 2XY1A 4Y16A 5MP6H 3T3PE 4DKFL 2A9ML 2H45A 4LDOB 4QRPE 1TVDA 4K7PY 1GGCL 4ZAKA 2AK1H 4LLUB 1XR8B 2OTWB 1F8TH 1QBAA 5T3ZL 3QIWB 4TQEH 4N0YL 3WN5B 2JELH 2EICA 5I0DA 1KGCE 5IJKC 3QG7H 4CAGA 4J23A 2WMPA 4XP4H 4BSVA 5C9KA 2Y1VA 4E5XB 1CG9A 3P9LA 4HGWB 4MAYC 5GISH 4JHZA 5HYFA 2MHAA 2CO7B 3O6KL 3WV0A 3OAZK 5F7MC 3LEXB 3K8LA 1K2DB 4RFNB 4PJ8D 1T5WA 4GSDH 4OCLC 5HHOA 4PJ7F 3HNSL 1BJ8A 4K55A 4M48L 2VN4A 4PV8B 2R0WH 1B0GB 4H25A 1K4CB 2ZOKA 5HDBE 1LEKA 2ZUXA 4LGSB 3BVNA 5JQ6H 1XIWD 1WSST 5D6DA 2WINB 1KPVA 1J18A 1M6OA 4PRIE 2I60H 3DGGA 1RZ8A 1VADA 3INUH 1H3PL 5HYIA 2IF7A 3BZFB 5JOPE 3EDKA 1U95B 3SKJL 2N7BA 2W60B 2XY2A 5CBAA 5IB3A 1U92A 1H8OA 2G5RA 1JUFB 3NFPB 5I1EH 3QHZH 3U7WL 4Z95L 1NUNB 1ADQL 2FO1A 2NNAB 4KZEH 3L9RA 3O8XC 4F7CA 4PYHA 4PB0H 2W1NA 3HLAB 2EDDA 1PSKH 3QUXB 2Z8SA 5K9KB 2OL3B 3HI1A 4Y4KD 1QFWL 5HYSG 5D1QD 4DAGL 2IAMC 3ZSSA 1DUZA 1EFQA 1OAUH 3DROA 4HS6A 1E0OB 4HUNB 5DJCA 3RWEB 4KRMB 4GW4B 5DZLA 3NA9L 5ADOL 2XPGB 4JFFD 5DK3A 4WWKC 3UCRA 1NJ9B 1UADC 1ZHBB 1BP3B 2HKHH 3GMRA 5F3BA 3PP3K 4D9QD 5FYLE 1ZOXA 3BWAB 3MYZA 4P2YA 1T7WA 2FBOJ 3AGVA 3OKKB 1N26A 1HI6A 2WWMD 4LEXL 5IW1A 4FQCH 2OSLB 5IQ9B 4NJAH 2AXGA 5IBTH 3QEHA 3WIHH 4DGYH 3OX8A 2MQ3A 5CJOL 3MYJA 1IT9L 2CJUH 1BX2A 4HKBB 3QQNA 1KPUA 3BHBA 5I1KH 5J89A 4Y4FA 4Y5XB 3MRRB 3O41B 5L6YL 1K9TA 1Q9OB 2GK0A 5ESQA 1KFAH 3BP5A 2XQBH 4MMZC 2R1XA 1R0AH 3QP3A 5B39A 5TH2B 3FQTB 4NHCH 3B5HA 1N8ZB 3CFIC 4XNYH 1K3ZA 1YEIH 1WBYA 4CL7A 3QPQD 4D3CH 3VGAB 2I25N 3J7HA 1D9KD 5EO9B 2Y7QA 1W72B 4KROD 1ZGLP 3I6KB 1F3JB 5DJDA 2O5XH 4PLJD 1KJ3H 2SEBA 1A3LH 1KJVA 3PP4H 3TA3D 2DJ4A 1BD2A 1TIUA 3HB3C 1SM3H 3PGDB 1PG7X 3L3DA 4HGMA 2R8SH 5JW5A 2GTZB 3TYGL 4JM2C 2CSPA 3T0WA 3ZO0A 2W38A 4EI6B 5E1HB 1IGYA 5GZND 4BQ6A 3MRCB 2Z91B 5IJKA 5K59F 1GOGA 4ZFFB 2EDOA 3MLZL 4M3JA 1FQ9C 2AK4A 4BYHA 5BXFA 3QIBC 1N59B 3SQOL 2CUMA 1CE1H 2XKSA 4MAYA 1GYAA 1WQVT 1BOGA 2C26A 3RZCB 4P4KC 3THML 4RBPH 3O4OB 1D7FA 2FECL 5SX5H 4QHKI 2BVQB 4U2ZA 2P24B 3MUHL 3GO1H 4KGLA 2VZSA 4QHLB 3T0VA 3F7VB 4JY4A 5D5MA 3UBXG 3HZVB 1CXLA 2O93L 1BVKB 3GSUB 5MEPB 1KEGL 2W91A 5JIIA 3C5ZC 1YQVL 1WV7T 2OMNA 4R8WH 3T09A 3FFCD 1WWWX 3B9KB 5IMMA 4OZFA 1E6OL 3S7GA 3L3OB 4K8RL 1H3GA 4JN2A 4W4NA 3RWCA 4WGWB 4Z7NE 3T2NL 3O8XA 4HIXL 4XHJC 4WUUE 4XAWL 1YEHL 2P47B 4OGAD 5DFVC 3NABL 2YD4A 1I8MB 2YUZA 5IVXA 4ZS7H 1GJIA 4N9OB 5E95B 3U9UA 2PYEB 3HE6B 3MR9B 2R0LH 1O5DT 3BRFA 1X7QA 2XWTA 3MJGX 3NZ8A 3E6HA 1G7HB 3V6ZA 4WWKA 3D2UD 5IWLA 1CGWA 3LAFA 1FRGH 2V7NA 1C7SA 4NKMB 4B7LA 5DR5L 2YHGA 4LASH 3V6OC 3GSOB 4R4BA 2EXYC 1EJOH 3CX5J 4PJAA 3BJ91 1MCRA 1AXTL 4XMKH 1NBZA 1WZ1H 3X12A 4ONGH 3KPMB 5GSVA 1VESA 3DX7A 3OJDB 1KEML 3MLRL 3DJ9A 3MV9A 1E4XL 1NC2B 4FFWD 1XGUB 4BQCA 4EI5D 3F6IA 2BHUA 4Z7UA 1U8JA 5L2KA 2VXUH 4D0CA 2P7TA 3SGEI 5DMKA 4AQOA 1G7JB 4H1LA 1Z9OA 3QR2A 5HGDA 4K71C 1RIUL 1SEQH 2PXYD 4Z7OF 5I1GL 1LO0L 4N0UB 3ULVH 3MLWH 1CD9B 5GZOD 4HBCL 3CMOL 4KI1A 2ITCA 4E41B 5CUSL 2YK1H 4DZBA 4YHOH 3STLB 2WBWB 3L5JA 1HCVA 1U8IA 2G9HA 5KOVC 2VDPL 2DTML 4L9LC 3CIQA 3T4YB 1YNLH 3HS0B 4HXBL 5EUKB 1AGBA 2VLRE 2YUXA 4JM2A 3UPCA 3JTTA 4C56A 1MH5A 1H0DB 4FXKA 1MCKA 5JA9A 3MACH 1IEBA 3FRUB 1HSBB 1KGCD 3QIBA 2UWEF 2XZCL 4WV1B 2R69H 1ZT1B 4G80A 5E4EB 4IOSD 3SDAC 4P4KA 5EORH 3WS3B 1F58H 1N2RA 2WANA 4PJIA 4W70A 3ZHKA 5DQJB 5DD0H 3LDBC 5DEZA 4YR6A 1FFRA 5MEQB 1YMME 3B6SB 1JYXA 3AXLB 1U58B 3P4NB 4IRZL 1U0QA 3P0VL 5C0RL 5IK3A 4KKCC 5DUML 4JDVB 1JZ2A 3ZTJH 3ULUC 3IJHB 1INEH 5DGQA 4KKAC 43C9B 1MCWM 5IEHA 4Y4HA 3C5ZA 3EGSB 4PRID 4XI5C 2QSVA 1VB9A 2JJUA 1F4WH 4F9PC 3UTTB 3VDBA 1A7QH 1BFVL 1P69B 4R97B 4D9LL 4E42B 4Z7VF 3TVMD 1OF2A 2J8UB 1RJLB 4KAQH 4OLUL 2HAZA 3QPXH 4XVSH 2D9CA 2DQUH 4HMCA 4HH8A 5DA0B 3OR7B 1K4DA 3BSZL 2GUOB 1MCOL 1KBGL 2ADFH 3REWB 4BFEA 1NGZB 4POZC 4TSBH 2VDOH 4TOYL 1G9MC 2DM3A 4I3GA 4NYLB 2RFXA 2IH1A 2GY7B 5AD0B 1QO3A 4PB9H 1A4KB 5FV1L 3RWFA 2EYRB 2NXZC 2CDEB 1LILA 1A1NA 1J1XH 1OAKH 3HI6H 3Q2CA 5HI4D 1A6VL 3EYSH 2XXMB 5CEYA 1YEFL 1NEUA 2XRAL 5C0AB 3V6OA 5FYLD 4U1LA 1TJHL 2VWEC 3WHXB 3NCJL 3WE6A 3HTLX 4JRYB 4XWGH 4JCLA 4H8WC 1YYLH 3PHQB 1WC7A 1TVBA 4GXUN 1OPGL 2V5MA 1Y18A 4NT6A 3FMGH 3Q0HA 4WFFE 3ZHDA 3S35H 1HE7A 5FUOL 3LPFA 3VMOA 5JW3L 4U1GC 1HZHL 1YPZA 1Q38A 1FNFA 5DEGB 2X42A 4R2GD 5AYQA 4RSVA 1OT1A 4M5YH 5HD8D 5HGHB 3CFKA 4IRSD 3OR6B 5DK0A 4JFQA 4IBLT 1IM9B 4I1NB 1NUFA 3GGWB 5CZVH 3CFCH 2F5BL 1G7PB 2HVKB 5HHVL 3TYFA 3S36L 5J7CC 1CDYA 5I16B 1MFNA 1MI5B 4L8SC 1HH9B 5CHNA 1QVOA 3IFOA 4M4RA 3VFVA 5BV7B 3NBNA 1DBAL 1NMBL 5EBWA 4HS3B 4V1DE 3E0GA 4L9LA 2Q8AL 1AE6H 2DI9A 5EBLB 2AXJA 3SKOB 3U48A 4RAVB 4ZO8A 4R3SA 4RCAA 4NM8H 4OLWH 4NO5A 5GGTH 3UTSD 5TQ0H 4NKIH 1JHTA 3KLAB 1J11A 1QSEA 5IFAL 3VCLB 5IB2B 3W0WA 3ARGB 3OXSA 1OAXL 1U8KB 1QKZL 3MZTA 3SDAA 3QO1A 2H3NB 4FQXC 5IB5B 4X98A 2AAVA 3FB8B 2FX8L 4X9GA 1EUUA 5TQ2H 5EO0B 4U31A 5IVOA 2OQJB 5D7LE 2NXYD 2FO4A 4PJEB 3V5KA 1VFMA 3G6AB 4PRHA 3TIDA 1MFDL 3QWRD 5HHQA 2P5EA 3BEWB 3O3EB 5D71L 4LLQB 4L1DA 1UVQB 3PQYE 2NY2D 2GT9A 2Q3AA 4NOBA 4PJFA 2BJMH 4HPOL 4M4PA 4F9PA 1KJMB 5E2WL 4GMTL 3U1SL 3QUZD 2EEBA 3PV7A 1CQKA 2KQMA 3WJJC 4DVBA 1LHZA 5BOZG 5F8QC 3KPLB 1MUJB 1OY3B 4ODUA 3B2VH 3HAEA 4JZOA 4CNIB 3SDDD 1SEBA 1BMGA 4G5ZH 3SKMB 1A6UH 4Y8AA 3LEVH 3IS1X 3JWOH 3N85H 2GEEA 4GXVH 1P84K 2K7QA 3G5XB 1JN6B 35C8H 4XCYA 4Z0BH 4G8GB 3F12B 4I48B 4YE4H 4PRBB 3MOQA 4K7PH 1S9XA 5F7LB 1S7TA 2PR4H 3D25B 2NY6B 1JI1A 4MJIE 4I3RL 4DEPB 3SJVA 5T1MB 1GGYA 1A14H 3AUVA 2VZUA 3DVIA 2X9WA 3QWOB 5J1AA 4H20H 3F7QA 3Q6FA 2JLLA 1RV6X 2DQIL 5C07E 1UH4A 4WEBL 4NC1C 1NLBH 1HILA 1JPFA 3SCMC 1KCSH 5I76B 2B0SL 1ZHNA 4HSQA 1Z3GH 3QEUA 4NZUL 5EU7C 5FCSH 1QSFB 3QEQA 1BFTA 2BRQA 4LIQE 4XPFH 5FF6A 4UZGA 3C8HA 3RVVD 5GRYA 4M8QA 3VXQB 4K23L 2V5YA 1ERNA 3BE1L 3SBWC 4F3FA 1QR1A 5E9DE 4U6YA 1FZMB 4LAJH 2BNQB 4XC3L 4L8SA 4YDVA 4LSRH 5TDOB 5CIPB 2DQCL 4POUB 3KPSE 4P5TB 3HR5A 3D39E 1MIEL 1U8QB 2VLRD 4HKZB 1N64H 2FLBT 3WLWD 4XAKE 3BPOC 3L3GB 4KU1A 4YK4B 1MAML 1U3HB 2J8UF 2QR0A 3I75B 4QLRA 5B38G 2I9LA 3VXSA 2CLRB 3VXRA 4F15B 2Q1EA 4LF3A 4ZOBA 3ARPA 3VFUB 4BZ2L 2YPVH 1JV5A 2FSEA 2W0FA 1VCAA 4JVWA 5ERWB 5A16A 1SMAA 3FO2A 4OLXH 4W81A 3FAWA 3VFMB 3TNMB 1YMMD 3MOAL 2JB6A 5E00B 5KTEH 1JJUA 5EOTB 5I1IH 2RGSA 2HFEA 3TN0D 5AG9A 4MCYB 4OFYD 1S5HB 1MHCB 3P73B 1L7TL 1JF6A 3R8QA 2DIBA 3PV6A 3U46A 4DN4L 4O51A 4NCDA 5T1LD 1Y6NR 3GMMB 3CUPA 4GRMB 3AAZB 5EIVA 3WJJA 5FECA 1RZJC 5ANME 2WUBL 4MJ6A 3LZFH 3MRPB 4LLYA 1CGTA 4H5SA 3V2AR 2DLTA 1ZHKB 4J6RL 3L3IB 3O3UN 3ULUL 3QQ3A 1MFEH 4UV7L 4Y2OA 4HUXA 5F1NB 4MYWB 2ICWJ 4W6XB 2C9AA 5CGYC 1N5AA 4U4BA 1TLKA 3VXME 2A6DA 1INDL 3WJLC 4X8XA 5F1SA 1LO5B 3N1QC 4DKEH 1OARH 1I1AB 4RGNB 3MV7B 2BY0A 3BN9C 3IKCA 2ORBL 4P2OD 4QF1A 5T33L 4DW2H 5DMGD 2WSKA 1I7ZA 2UVEA 3CC5B 4RGMB 3TT1L 5IVNA 3KWWB 2DQTL 4Q0XH 5DDHA 3O6FD 3F7PC 4AL8L 2E6PA 4U3HA 3TJEH 2WM0A 2ZOLB 3QNXB 2AXFA 3TF7C 1CLZH 4F7PA 1G9ML 1JL8A 3VXOB 1XF4B 4DKFH 1H5BB 3SCMA 2WQ8A 2ATKA 4PJXA 1FYTD 4WFFD 3I02A 2X4QB 3G5VA 1GGCH 4P2RD 3SDXE 4ZUUB 2UZYB 2F19L 2ITDB 2BX5A 1UYWL 2EDXA 5T3ZH 2VXSH 4P99A 2IANE 3VD4A 1P2CA 3V8CA 2R39A 3GK8L 1QFHA 3O4LB 4H8WL 3SBWA 3VH8B 4Z77A 5FYKD 2X4RA 4NRZB 1EO8H 1R3LB 3IDUA 2YPKA 4PGCB 4S0TD 2ADGA 5FGCB 3T0AA 5F93C 4V2CB 4OZGA 4G6KL 5D7SL 3VWKC 3O6KH 4WJ5B 5DJZA 1RIVL 1EJ6A 2AEWA 3MO1B 5FO9A 2DBLL 3MNWB 5DURB 1DQDH 3HNSH 4FG6D 4M48H 3QI9C 2PO6D 5KG9B 1EHLL 2BNRE 4HK3J 2GJZA 4V1DD 1DDHB 3CSBA 3O0RH 3H9SE 5DF0A 3PL6C 4S1SL 2D2OA 3ZZ1A 4LLMA 2NYYD 4NSKB 4CW1A 4KQ3L 1H3PH 3QXWA 5ENWB 3MMEA 1P7KA 4YGVB 3MA9H 4NNYB 1NGYA 5IP4A 1L7IH 3DMMD 1RUPH 3BPNC 2E27L 3U7WH 2CRMA 4DGIL 4L4TB 4R7DA 4Z95H 2XZAH 4XTRC 5CEZL 2YSSA 4PJGA 5IHZA 4X6CA 3CPLB 1I3VA 1QFWH 5JHDA 1DN2A 5IR1B 4FZEL 3WHE0 1UWXH 2H26A 4WO4C 3MNZB 4HUMB 2DYPD 5GRWA 2YN5A 1UEMA 2EKSB 1J1PH 4GAJH 4PR5A 3F5WA 4ELMA 4J8RB 1FVEB 1ORQA 1XF2A 5ADOH 2ARWA 4QWWC 2CK2A 1FAIL 3AMLA 1KTDB 1MRDL 1JGVL 4B50A 1EVTC 2RIKA 4LEXH 5FAAA 2PCPB 4YHZL 1XGQB 1RK0B 2OBGA 4WW1B 1A21A 1UM4L 2HN7B 2AV1A 4PD4J 3ESVF 5DI8B 1VKXB 5F3HB 4MQ7A 5CJOH 5INDB 1IT9H 4IJ3B 2HMID 4G43A 1MRCL 3WJLA 3IDYB 5L6YH 4TUOB 4OZHA 5EBMA 5GS0H 1G0YR 5DK2A 2JCCF 4N90D 1K6QH 2I26N 4R96A 3MPCA 1FFPB 1B0RA 3ZKMC 4JFHE 5B22A 4MJID 2BVPA 4JFPB 3NFSL 4XVUC 2CKBB 4IRJB 4X7TA 2ESVB 2XG4A 4CADB 1JHKL 1CVRA 5KN5B 4F8QA 2PTUA 4HMEA 1DN0A 3M17A 3WD5L 4L8CB 4LCYB 5E08L 1BPVA 1JNHA 4MSWA 5CAYB 2ZJSH 5CGTA 2J2ZA 2MTPA 5C07D 3RWHB 4JFOA 2WLYA 1WBXB 2XN9A 1PLGL 2YRPA 4N9GB 5EUOB 1FNGB 3S5LG 3Q48A 4Z78B 1WFNA 5C7XL 3TYGH 2OTUA 5IEKB 1AIFB 3GSXA 2G5BA 3QQ9D 3L7FB 1PD6A 4GRLD 4X7CC 4LAQL 2N4IA 4WY7L 1QOKA 1MOEA 2I9TA 3MLZH 2J4WL 4NNXB 1U2HA 3SQOH 1AI1L 4XCFL 2X4SA 3QUMB 1IQDB 2VZTA 4M93C 3THMH 1RVFL 4PJ8C 2YC1A 4N1CA 3AS1A 5C0IB 3QI9A 3IFNL 1FZJB 4MNQB 2ADJB 2WIMA 4OT1L 3NMEA 4MD0A 1XIWC 4JLRB 2YA1A 3PL6A 1KB9J 5F71A 4EVNA 3GMLB 4XNQA 5DJ8A 4YLQT 1KEGH 3FB5A 4WW2F 4XAKD 5HHXL 1YQVH 5C0FA 1SBSL 4MX7B 4XNMB 2VQTA 5IBLD 2OR9L 5GSRA 1E6OH 3EOYG 1FNEA 2OJZL 4K8RH 4XCCL 2DLGA 2VZ1A 4IOIB 2P42B 4QY8A 3MRKB 1R3JA 3TBYA 2CGRH 2ICCA 3QDJA 3A0OA 3T2NH 1KELH 2P5WB 3Q6GL 4HIXH 1YEHH 4LQFL 3QCUL 5JDSA 3U4EB 1XT5A 4Y4KC 4PY8I 5D1QC 2P8LB 1QA9B 4JFEB 5DS8A 4JB9L 4WO4A 1SBBA 5I8CA 4Q6IC 1ODAA 5KSAB 4M61A 1N0LA 4GMSL 3PF2A 4NFDA 4LSUL 1IKFL 1LMKA 3ZDZF 1DSFH 5C0DB 2APBA 1UKQA 3PDOB 3QIUD 3CZFB 4U0RC 3ZKND 3FOLA 1FG2B 2DKUA 2FL5A 3RDTA 3MGAA 4ZUVA 1OP5K 4OKVA 2WWMC 5DR5H 5B8CB 2F8VA 5DHXB 3FO9B 1AXTH 4QRRB 3MRBA 4PGDA 1F6AA 4G9DA 1CE6A 3V9FA 4FQQA 3I9GL 1PEWA 1KEMH 3MLRH 3WCYA 3V8OA 1ZWIA 1VFUA 3MOBL 3RI5K 4X5XA 5KVMC 1RJYA 3ZDXE 4ISVB 1F97A 2P48B 4GT7A 4ORZC 1FL3B 1S8DB 1ZLUH 3SDCD 1T1YA 4Z5RB 4XBEL 3N06B 1XH3B 4L3EA 1RZJL 3ROLA 1BFOB 3R06B 2O61A 4YBQC 4G42A 5IHBA 1RZKC 4RWYL 2VTFA 1RULL 1RIUH 2CDFB 3BO8A 3SKUD 3QPQC 2VDKL 2FR4A 2EC9U 4LNVA 3KXFE 4QYOB 3ARDB 5CP7B 4KROC 5HVHC 3HRZA 3LKNB 25C8L 3LN5A 1CI5A 3JV4B 1FYHB 3TA3C 4O2EA 1FH5L 4HLJA 2JB5L 1UZ8A 4I0PB 3LKPB 3B5TA 4JQVC 4OGYL 4UMGA 2EIEA 2VDPH 2DTMH 4O9HL 1INQB 4HGKC 1AQDA 2YEZA 4G9FA 1NPUA 3UPRB 3LKSB 3WDJA 1EUTA 4XBPA 3OXRB 4U1HA 4M1DL 4ZD3L 2IAND 3OJVC 5C09B 3WMSA 4NN6B 2GIYA 1PDKA 1I9EA 2NW3A 2W59A 2XZCH 5D96C 1CD0A 3VFRA 4X4XB 4DOHB 4PJ8A 4HIEA 1MJUL 1ZS8A 2XQYG 3TZVD 4PJHB 5EZIL 2BNRD 3P0VH 3N9GL 1NCNA 1OD7A 3MNVA 1XIWA 4NHUB 1T20A 3U83A 1Y0LB 2HRLA 1LEGB 4ZTPL 4PIRF 2X4OA 4X6EA 2XT1B 2BMKA 4D0DB 3AVEA 2Y5TA 2V7HA 2K3TA 3IDNB 3HR6A 1BFVH 4L4VA 5FO8B 4D9LH 1CU4L 4UILL 5JMRA 3AROA 3P4MB 4P3WA 1HHIB 2BERA 5D1XB 2K9UA 5ITBH 4OLUH 4LCUA 3O9WC 4Y5YB 3STZA 4NKDB 2VLJB 3MV11 5F88B 5DWUL 5EZLB 4HFWA 4OI9A 3DNKA 1MCOH 2VDLL 1Z0MA 4Q6IA 1XGYH 3RIFF 3P11L 2Y25A 4TOYH 5I2IB 3NIDE 4JR9L 4HAFA 5H94B 2GYSA 4KI5C 5IT2L 2GFBB 3ARUA 4UI2A 4YZFE 4HV8A 5CEXA 3LKOA 1A6VH 2J12B 1T0PB 5FA3A 1T1WA 4P5KA 4X4YB 1BWWA 2XRAH 2VKWA 5KAQF 1BVLA 4FQ1L 1C5DB 5EZOL 2CR6A 1TJHH 1JWMA 3NCJH 4U3XA 4P9HC 5AYUL 4IIQB 1S7VB 5INCA 1U8LA 3F8UB 1XCTA 1VDGA 4ENEC 4NGHL 3WS6A 4KDTC 1FC1A 4ZSOB 4YUEL 1OPGH 1VGKB 1G0XA 1S7RB 2XACC 4EI5C 4GKNB 1RY7B 2HT3C 1BIHA 1GIGH 2E8YA 3CDGB 4LDEB 5H2BA 4MA1B 2VZOA 3Q5YA 2HLAB 1TQCC 5JW3H 5EFIB 1HZHH 5EU4B 1Q0XL 3LH2L 4PGJA 5A3IC 1RUQL 3P0YL 2VAAA 1DUYB 4LVEA 2PXYC 2FJFA 5DRNA 4HHAB 1F4XL 4EIGB 4BFGA 2DLEA 3EFDL 4MXQC 2EC9T 1F5WA 3TT3H 5JPMA 3D3VE 1IGFL 4U05A 2R9HC 4N0UE 3S36H 1KLGB 1D5ZB 2DM4A 2NY0B 3HE7D 3TA3A 5GS1C 4R7NA 1JGDA 3F7YA 3RTQC 2J3SA 1UWGL 4O2CB 4MJ5B 4FN0A 3QDAA 4JQVA 1DBAH 1FL6B 4LK4A 2NY3B 1PZ5A 3O81A 2J6EA 1LDPL 1P6FA 1VSCA 3KYNA 3MLYL 4QKXB 9CGTA 5IMLA 2Y9RT 1KB5B 5IFAH 1D6VL 1HOCB 1OAXH 1GZQA 1QKZH 1HQRB 1DQQB 3QIWD 5C9JB 3ULVF 4GG6A 4Y5VB 2FX8H 3GHEL 5E8PA 4S1DC 3VFWA 2QLVB 1MJ7H 4OFIA 1ZT7A 2NLJA 3WFDH 1CDGA 3RQ3A 1MWAB 1TVHB 3RHWF 5LGHL 4X9HA 2NCMA 2BK8A 1IRAY 4GS7B 5FUZH 1ZGLB 1HHJB 2B39A 1QLEL 5LGJB 1DR9A 4M5ZL 3BP7A 3FFCA 5D71H 3HFMH 4JFDA 5GRVK 3GRWA 2I07B 4HPOH 3TVMC 2PETA 5E2WH 4GMTH 2WLZA 5I1AB 3F58L 4CVZA 1NEZG 3O9WA 2J1KA 5DLML 3UTTE 4HG4K 4BH8B 1RJCA 2D03L 2BY3A 2DMBA 3RAJH 5E94A 2F54A 4NQDB 1IAIL 3U0PB 4S1RL 2FIKB 3BKYL 4KHXL 3QUXD 3ARBC 4HUVB 4MDJB 3QT2A 2GJ6B 4KK9D 4TPRL 5F89B 5I74B 4NP4H 3L95A 4TRPL 5HI4C 3V0WH 4MAUL 2EIDA 4Z6AT 4I3RH 4D8PB 3OB8A 3PWPB 2VL5A 3CU7A 1AQKL 1CDCA 4YHML 4NRYB 5GGRB 1JYNA 4LFHG 3G08A 2R1WB 1QLFA 1T0NA 3IETB 1Q9WA 4KDTA 3KLSA 4JQIL 2DDQL 2DQIH 4G6AD 5ICZA 4EI5A 4M7KL 4M7ZC 6FABL 3K1DA 4LCWE 3DHJA 4JRYE 3HG1B 3DVGA 1M71B 3S3JA 1YY8A 1WIUA 2B0SH 4TUKL 1T66D 4NZUH 1KC5L 2R0ZL 1EH9A 5HXMA 3S3PA 5F9JB 3HHRB 3MXWH 2PXYA 3U0TB 4IS6B 4M43H 1NDGA 2V5RA 1Y6MR 3BE1H 1BQLL 2NMSA 4LHJB 1KENL 2DRUA 1QFWM 3DX6B 5BZWB 4HUWA 5DUBA 2D9QB 4XC3H 4ODWB 5KANI 2ED9A 5GS1A 1A4JA 3RTQA 1S9WA 5EOCL 5SWSB 4PYGA 2LU3A 3O6LH 3S37X 4QRPA 4WHYH 2BVUA 2YRZA 3OV6A 2DQCH 5BRZB 4LSTH 1RZKL 3T1FA 5D7KE 5TPWH 5TGBB 4HX1B 2G2RA 5LQBL 1PY4A 1ZV5A 5GRZA 5JMOC 4U1MB 4OCYH 4LBEA 5J12B 4JRXA 4PGEA 2PTTA 4DK3A 4TTDC 4BZ2H 3EYFB 2OJEB 3TBVA 4HIJA 5I75C 2NXYC 1BGXL 2HJFA 3DUSA 3DURA 3RZCD 2J6EL 3MOAH 3U7AA 2X89D 2Z4QA 1ITBB 2YD2A 3U79A 1R5IB 3LIZL 2EE2A 4FTVB 5KSBE 4Q9CA 4MJ2A 4WI2A 1VA9A 1Z2KA 3ZT5A 3QCVH 4FQPA 4QXGL 1JI2A 5C0GA 1JPGB 1L7TH 4FQHA 4YDJB 4ALAL 4TSAL 3GMOA 3DPBA 4YHIB 1WLHA 5IIEA 4DN4H 3S4SB 5AEAA 3TVMA 2YD6A 3ZHLA 1RMFL 2DL9A 1I4FB 4GW1B 4KPHL 3CFJA 4HKJB 2CDGB 1JZ7A 3B9KD 2WUBH 1AR1D 4H88L 1CS6A 2B5IC 5F7EL 5MEOB 2O5ZH 3SDDC 1UJ3B 3L6FA 4J6RH 2VXVL 1H8SA 5SWQB 1LE9B 3F62A 3MSPA 3ULUH 3MC0A 5FKAA 2HT4D 4GQPH 1NANI 3RY5A 3IVKA 4LRIC 1ZA6A 2D7TL 3MRNB 1YMHB 3ARBA 3GRWL 4B5EA 3ME0A 3K8MA 2X41A 2PYED 5I73B 3HE6D 1ZHLB 3WKML 1CT8B 1CLCA 4TNWF 3C5SA 3MXVL 4G8GE 5HY9A 4FS0A 2EYTB 1QACA 5IMOB 2DQTH 2NW2B 1YN7A 3ZDXF 3HAEH 1DEDA 4LCIL 4NC2B 1KXTB 4OI8A 2ZUQB 4K3JL 4PTUB 1F3DH 3PJSA 3EOBB 2QSTA 1AC6A 4Q97A 1G6VK 2ED7A 5M94B 1JPSL 3BD5A 1ZVSB 5J8OA 2G75B 2AJZB 3C08L 2VL4A 1W2KT 3B2UD 2AJYL 4KKNA 4J3SA 1VACA 3N1FC 2YD9A 4ZTOL 4PJBF 3VXUB 1S7UB 1NC2D 4AG4L 5D70L 3HUJF 5KBNC 1UYWH 3RVVC 4YAQA 2A74B 2R2BA 3HZYB 3VFOA 3S98A 1QSFE 5F8RC 5I8KH 1OSZB 4P9HL 3L7EA 5C0EB 4H8WH 1NGWB 1OGAE 1DLHB 3ZE1E 4G6KH 2UUDK 5D7SH 4OIAA 4GUPB 4Z76B 1RIVH 3CLFL 4RIRA 1CL7I 3GJFK 1LP9B 4RNRB 2AXHA 5JO5A 3M8OL 3WFHA 1CYGA 4XZUB 2R56L 1EHLH 2BNQE 3IGAA 4JZJC 1W0WB 3FT2A 4E41D 1VFBB 3DXAE 2AI0L 5L8LB 3ORJA 1EAPB 2AEPH 2C3HA 3T3ME 3MRGA 1V7ML 3MV8E 3TO4B 4MS8D 4S1SH 4DKAA 1NCCH 4XVTL 4JREB 5HI5D 3D5OF 3ESUF 1EHNA 1WEJL 4OD3L 1FNAA 3FCTB 3WUZA 3C6LC 2I24N 1Q0YH 3LB6D 4ETQA 2C4FU 4KJPC 4PV9A 4DGIH 3GBML 4R26L 3C8KA 3DX9A 1E6JL 4CN6A 4DJMA 2C1PA 1QRNB 2DQHH 1T2JA 3PNWB 4FZEH 1A3RL 2OCFD 3J8F7 1BZ7A 1G7MA 3CLEL 4PREB 4G8IA 4JFYB 4OUOA 4CMMA 2X1QA 4G6JH 4HD9A 1W0VA 2BCKA 4ZXBB 1ZA3A 1M05B 3MRIA 1MNUL 1FAIH 5C08A 3OKEA 5D8JL 3LV3B 1MRDH 4HWZB 4F2MA 4WUUA 1QRKA 1SHMA 3IU4L 4YHZH 3V5DA 3SDDA 1HXYA 4ZPVA 3UTTD 1UM4H 3C87A 3KDMA 4P2CG 4NWUL 3VU2A 5GIRA 1JGEB 5D93B 3OF6A 4LRIA 3DX8B 5J6HA 1BREA 1HHKB 1MRCH 3RIAK 4QTIL 4ZOEA 4ZAKB 2DQJL 4P2OC 4OSUH 3QNYB 4NIKB 5DMGC 3OGOE 4KKLD 2EE3A 4RGNE 3MV7E 2EEAA 2B1AL 3NFSH 4BSVB 1CG9B 3P9LB 3BPLB 3LRHA 2A0LC 4PP1C 1A6WL 1I9JL 2MHAB 3CFDA 2XA8H 3WD5H 4C83A 3U9PL 5E08H 2IPUG 2FWOA 4W4OA 5C0AD 5HHOB 4LU5L 1WFUA 3TGXA 1OGTA 3HNTH 4H25B 3OKDA 1EVUA 1TENA 5I19H 2ZOKB 2VOTA 4JRYD 4NC0B 5FYJL 2HKFH 1PLGH 3ARVA 1LE5A 1IC7L 3GUTB 5C7XH 5FB8A 1H15A 5EB9A 1KPVB 5I71C 3RGHA 3DGGB 1J1OL 4FXLA 1RZ8B 1VADB 5D9SB 5L9DH 3V6BR 4NKOB 3NGBC 1A6ZA 4WY7H 2IALA 1Q1JL 4AY0A 1J88A 2K7PA 2F8OA 5CBAB 5IB3B 1AI1H 4XCFH 2J88L 1A02N 3VFPB 1RVFH 4ZOAA 3O4LE 3ZE2F 1XFPA 4KK6C 4F7CB 3KPQA 4FG6C 4NN7C 4DUWA 4D94A 4JO2H 2PO6C 5FGCE 2CD0A 1IM9D 3PIQB 3IFNH 1P4BL 1CGYA 3HI1B 4JZJA 1QQDB 1WZKA 4OT1H 1DUZB 3SE4C 1MI5D 3ZYOA 2VLRA 4OIIL 4JHWL 5DRZA 4QOKA 3DROB 2NYYC 4HS6B 1MREH 5DJCB 1FPTL 3EJJX 4HEME 4NPYA 4QTHA 1SBSH 2FJGB 2RBLA 1T89C 5SWZA 2OJZH 3C6LA 4QGTA 4XCCH 3BGFB 4D0BA 2C4FT 2ZPKH 4WW2C 3ARGD 3SGDH 4Z7WB 5HYQA 1XF3B 1YMMA 4DZ8A 1RUML 4C54A 1MVUA 1V05A 4LQFH 2AXGB 3QCUH 3MROA 3FQNA 3OX8B 5J9PA 4L4TE 3MYJB 1BX2B 1GRWA 4JB9H 4QHMA 4OFYA 5A2LH 3MGOA 1KPUB 2KPNA 2ZCLL 3BHBB 3X3FL 4Y4FB 1JFQH 3B8SA 4GMSH 1KOAA 3IDMB 4LVNC 4LSUH 5DVMA 2GK0B 1IBGL 3CD4A 3U36B 2R1XB 3SKNB 1FVDA 5B39B 1FLTX 1VFOA 1V5JA 2EDNA 3ARRA 4LLWA 1XR9A 4LPWA 2H8PA 3U2SA 1E28A 43CAA 1WBYB 2IGFH 3DV4A 1ZE3C 2KQNA 4POYA 4JO1L 4X4ME 4OQTH 1I1FA 1NSNH 2ATPB 2XZQH 5DJDB 1T3FA 3I9GH 1U8PA 1CWVA 1FE8H 1HNFA 1JWUB 5ACMA 5JUEL 2SEBB 1PZUB 1KJVB 3GIVB 4I9WE 4WFHE 3L3DB 1OTTC 4NO0B 3DYMA 3DUUA 2AJUH 4U0QB 4RAUA 4LHQB 5JW5B 4CN4A 3MQIA 1AFVL 4P2OA 4XBEH 3G6DL 2Y07L 1RZJH 4MXWL 4RWYH 5DJAB 5DVNA 3V5HA 4G8GD 5BXFB 1IEHA 5J56B 3MCKA 4MAYB 2VDKH 5BQ7A 3O2DA 1FGVH 4EUPB 3QDGB 2JCCA 2NY6D 5F7WC 3FJTA 4OTXL 25C8H 2ESVE 5DQDL 2AJ3A 3P4LA 5D7IF 4L5FL 1XAUA 2HVJA 4X6FB 1EGJH 4U2YA 4KJQD 5DTFB 5HGAA 3V79C 1JNJA 1FH5H 5I18L 1KNOB 1HHHB 4JY4B 5D5MB 5JTWA 4NZDA 1KJ2A 4O9HH 4LKCA 3S5LA 4PS4L 4F33A 5BVJA 3QQ9C 4X6DB 1LNUA 4YIQB 1U36A 5DO2D 5EUOE 1NH6A 4AEEA 1TCRA 4M1DH 4J3OC 4PTTB 1QSFD 4OZFB 2EIBA 4TUJA 3TCLA 4CU8A 1V8HA 3EZJB 3RWCB 5AUMA 4BFBD 3EYVA 1REIA 4MD5A 1IM3A 3O8XB 5J6GA 1MJUH 2PO6A 3GMQA 3AMKA 4EOWL 3PWLA 2QL1A 5HPOA 4V1DA 4NZTL 1NUGA 3W2DL 3NAAL 4CGTA 2BNQD 3N9GH 3SE4A 5J13B 3U9UB 2BSSB 3UZVB 1RHHB 1TJIL 2VITA 1AXSB 4F7TA 1X7QB 2Y36L 2XWTB 1C08A 4XPAL 3WFCL 4P5TD 4BUHA 1OM3L 1MJJB 3E6HB 3QZWB 4WWKB 1T89A 2YD1A 2V7NB 3EOTL 2NY7H 4GOSA 1U3HD 4UILH 3SPVB 1YA5A 4R4BB 4PJAB 4WW2A 1OHQA 5KSBF 5IV2B 1NBZB 1IGIL 2KBGA 1CXFA 4NCC2 1OT2A 3X12B 5JR1L 2MPAL 5D7LA 5GSVB 4N5ED 3DX7B 4Q9RL 1KCVL 1JPST 5DWUH 3MV9B 2IADB 2ADIB 3NCBB 2P5WE 3ZLQC 3PGFL 3MTRA 1RZIA 2VDLH 2IPKA 4F7MA 5A2KH 4EQ2A 3P11H 2HFGL 1U8JB 3DETD 4LEOB 5CLTA 3RBSA 5L2KB 1Z9LA 2BOBA 2EH7L 2XNAA 5DMKB 3PQYA 2VDQH 4JR9H 1NFDB 4JY5L 4NRXA 4H1LB 5C0JA 2Z35A 4WI7A 3ZKNC 1HYSD 5HGDB 3DI2B 4LDLB 5IT2H 2A2QT 4Y2DC 4PFEA 3RY4A 5I1HL 1IJ9A 5EU6B 4UT6H 3JV6B 1VGEL 4FXGA 3HMWL 1ONQA 4FQ1H 5EZOH 4PRDA 1MCCA 4M02A 1ZVHA 5AYUH 1JNLH 2ITCB 3WO4B 4X6BA 3KYAA 3EO9L 4G6ML 4YUEH 1KCUH 3GMNA 4NQUA 3S9DB 4LSSL 2G9HB 1U8IB 1ZXQA 3NFNA 4I77H 3HCVA 3RVWD 1AGBB 1HDMA 1FNSL 3QUKB 4JM2B 1Q0XH 3LH2H 4C56B