3O8XC

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xC02
1AGEA 4JFFB 4PR5B 1HQ4B 2EYRB 3B9AA 4APQD 2BNRD 4NM4H 4NZJA 5IFHH 5AAMA 1NGYB 3SQOL 3LHPH 4NUGL 2IAMB 2QSTA 1MHEA 4YHZH 3NCMA 3BPOB 2VLKD 4PJXF 3BAEH 3MOAL 3FO2B 3NVQA 1AO7A 4HWUA 5EU7E 3EIFA 3DVIA 6FABL 4HKJA 4IRSA 4GS7B 4GRMA 4P2RD 8FABA 2XQYG 3HE6C 3A6BL 4D0CA 2MNUA 2HLAB 1K85A 3S34H 2RQ8A 4BZ1H 2R39A 5EZLA 4F2MA 3IU4H 4PYGA 1UEYA 1CK0L 1CXEA 4FS0A 5B8CA 1YY9C 4OCNC 4MAYA 3FO9A 2M26A 5IOPB 1GOHA 4WEUD 4OCSL 4Z7QE 3NCJH 2YUXA 3M45A 1NAMB 1BLNB 3RJQB 4UQ3A 1JZ3A 2FR4A 3JWNC 4XP9H 1YPZF 2A6DA 2YPVL 3MODL 5HGDB 3QUYC 5HD8D 4DK6A 1N8ZA 3CDFA 1EFXD 1IAOB 3D85B 1ZGLB 1CTOA 1TVBB 4LLDB 5IMKA 4ZUTB 3F58H 1GJIA 2HT2C 3RNQA 1R3IL 3TO4B 4EJ1C 4KC3B 4JPKL 5DYOB 1ZANH 5HHOA 4CN4A 4GRLC 5DF0A 4RISL 1RPQA 4L8CB 2YXFA 4W81A 3WFZA 5DURD 4KROD 1V05A 4WWKC 2C3GA 2J8UB 4YPJA 1OAZH 4WI3A 3NCYP 2GTZA 1XAUA 4JCLA 2CMRL 1HHHA 3TT3L 3B8SA 1L4IA 1WV7T 3ZE2E 4PRBB 2IEPA 2DF3A 2PW2B 3OPZL 5IMOA 3Q0HA 1JGVH 5J13B 4C59B 1HHGA 2VISA 1C5CL 3LPFA 3EZ8A 4KFZC 5KVMC 5D1ZA 4HBQA 5FAAA 2VN4A 1N5YL 1UM6L 3RWFB 1MLBA 2PTVA 3BISA 1I3UA 2GJ6D 4NUJB 1KJMA 4G8GA 2RJMA 3MLWL 3EYOB 1IGFL 3DBXB 1R3LB 1BF8A 5KVGL 4D9RD 3WFDL 3J7HA 4HIXL 3O9WA 3D3VA 3OTTA 3P0YH 1JV5A 4BK5A 4G6FD 3HUJA 2YD4A 5ALCL 4UOW1 4BK4A 2NY5C 3H7LA 3TBVA 2JTDA 5B38G 4E42A 5M95B 2D31A 4HUUA 3WE6B 1VGEH 2BJML 3L7EA 3CFBA 1NFDF 2AQ1A 5E08L 5E4EC 3JV5A 1HEZB 1CGSL 5F9OL 3BUYB 4HS8H 4GW5A 2VXTL 5T5FL 4Y2DD 2JELH 1AQKL 2XFXB 1QFPA 5BOPA 1MUJB 4QRRB 2D2OA 2E7HA 4LIQL 3OR7A 2F19H 2O93L 1OOAA 4QRPD 5CGYD 2NW2B 1I1AC 3O45B 4XNYL 5GGRY 4OF6A 4BUGA 1CE1H 2RB8A 4PPTA 1U8HB 3QJHB 4NKIL 3GSNB 4M5YH 2QBWA 4PJ8D 1V5JA 3NGBB 3QQ9C 5HHXL 4LLAA 3FO1B 3NIFF 1MHCB 3HI5L 4GAFB 4RAVA 3PV6A 4PY7A 3IDYB 3T2NL 5EO1A 1PX3A 5HGBA 2P5WA 1ZVSA 4N9GA 1JL8A 2VXVL 2DQEL 4WO4C 1S7WB 5FCSH 4DKEL 4BZ2H 4IOSD 1UVQB 5DQDL 5FFLA 1HCFX 4RGNE 2ZUUA 4PRPA 3VD3A 3CFIC 3C08H 5DJ0A 1HSAB 1ZS8A 4L4TB 3WDJA 2EKSB 5BZWB 4MD0A 3WS6A 4MQSB 1V3MA 4XXCA 5CZKA 1MJJB 1T80A 4FQ1H 3LOWA 4XBPB 3HZKA 4NWUH 1J0IA 1LEIB 4LVHB 5F97E 4EUPG 4XP4H 3QDMB 3T0EB 3MCKA 3LSOA 4A6YA 1VGKA 2XZZA 3OAUH 5ITBH 4MAYC 4V1DE 5I1JL 5B4MC 1AI1H 3BP7B 2N4IA 2VXSL 4KI5D 5EBLA 4E9LA 4LPUA 3MRHB 4HCRA 3RY6C 4HKBA 5H94B 1FBIH 5BVPL 5DD5L 3WUWB 3I3EA 4UIMA 5FYKD 2X1XR 3UTPE 3LKSB 2J5LC 2IFGA 1UACL 4LLVA 3BFOA 1WTLA 4H25B 3U83A 4OFKA 3Q6GH 2AJYH 4QOKA 3CMOL 4YHOH 1BD2A 4KV5F 2GFBB 5JW3L 4OLZL 5CFHA 4B53A 2E7MA 4F3FA 1JWUB 1A6AA 3FB7A 4UU9B 5JMOC 2B5IB 1FE8H 3MACH 2DMKA 3VE0A 1VACB 4BJLA 3A6CL 1X4ZA 5ISZE 5ANMA 3TBSA 4NQED 3VGFA 1J8HB 2P5EA 5CEXA 1YEJL 4L8BA 3UTTD 1NCWH 3LMJH 4ZUVB 2XACC 1MREL 1F8TH 1NCDH 3FQTB 3F12B 1R3KB 5D1ZC 4XT1C 1R0AL 4CMHC 1EHNA 5D93B 4ONHA 2NLJB 2Q87A 3BDYL 4PJDA 4X8JB 4RRPA 1SJEB 2G60L 2AW2A 5CSZB 1W0YT 3VFGH 1MLCA 4Y8DC 2VLRE 3MJ9L 2BSRB 4G6ML 5AYQA 5JPNB 5KVDL 2M2DA 1FH5L 2OM5A 4W4NA 3TIEB 4H88H 3BWAB 3SDXF 3IFLH 1VENA 4N8VB 3KYAA 5T3ZE 1IE5A 3ABZA 1TPXC 5HI4C 5DRNB 5DMGD 4DOHB 3GBML 5IBTL 5DD1H 4NNPH 4YHMH 5M94B 3U7YH 2V17H 5DZLA 4PJAF 4BQBA 3CFDA 3AAZB 5IEHA 4I5BA 1QSFB 3V0VB 4RGMC 4JFED 4ZFGL 1IGYB 2A38A 5DJ8A 1XF3A 4P99A 3QULA 3GMRB 5HYJA 1EIBA 1FNEB 5IVZB 4HV8B 4OZFG 3LEXA 4YDIL 2XOTA 3N1PC 2DI8A 4QHMB 1EEUA 5C0DA 3TA3D 1EPFA 5E5MA 2GJJA 2UWEF 4HIEA 1JVKA 4HIJA 1MCNA 3L5HA 4JB9H 4LVNC 5LGHH 4JG1H 1A9BA 4YHKL 5FYKL 4C58B 2FJFB 4P2OB 1X7QB 5BS0D 3DO7B 2FEDC 1M7IA 4WUKL 4LSQH 1OVZA 2HAZA 5TGBB 1K5NA 1TZGH 4U6YB 4IRJA 4GRWB 2VUYA 3QP3A 2O5ZH 4KJYA 4MA1B 1EVTC 4Y4KB 1RIUL 3TJEH 2KH2B 3FONB 1G7LA 4FFVC 4RBPH 4CBPA 5DEZA 3SO5A 4J6RH 4PJ7E 4YFLF 5MHSD 4Z5RA 5DFVC 2IC2A 4Y7MA 1OM3H 4YXKH 4YNYA 5IR1B 3G6JB 3RIFK 5K9KB 4JO1H 5HHPB 3WS6C 4XXCC 3RVTC 2Y6SC 3MV9D 4OM1H 3ROLB 5IFAH 2XTLA 1H3GA 2F58H 3MUZ1 2ATKA 5TF1L 3DV6A 5DR5H 1DUYA 1CDJA 2R2BB 4ZTPH 1DSFH 3MFFB 2IJ0C 5JHLH 4N0RA 3RIFF 2CLRB 1IBGH 2R1YB 3E0GA 5C2BL 1AD0A 4OZHE 2X4SA 2MQ0A 4L29A 5B38B 5A2KH 5C08B 3GSVA 4JFXB 4R3SA 1VFMA 2B2XL 2HRPH 5IHBA 1SEBB 3UBXG 3HZMB 3TWCL 4G7YL 4M00A 1OSPL 4U1IA 3K81A 5JW4Q 2ITDA 3P0GB 5DRXB 4RIRA 4M1GH 5LBSH 1HQRA 1XF5B 1ES0A 4JVPA 4P4RB 5FM5O 2G9HB 2AV7A 2KKQA 4LAQH 4WW1A 4Y16D 3SE4A 1JMXA 2XTJD 5TDPA 4X5XA 4KKLD 2DQGH 2ZOKB 4AQ1B 3OR6A 4YFLI 1IC7L 1YN7B 1I7ZA 1LGVA 2EICA 5IQ7L 4ZAKB 4HXBL 4CU6A 4WEBH 2YUWA 3TPUB 3NFSL 5DZNA 2DM4A 4QRQA 1NC2B 4O2CB 3HNSH 3DUSB 1LO3L 1RUAH 4WJ5B 1Q1JH 3PJSA 2OQJA 3DV4B 3DMMA 4KDTA 4QO1A 5E8PB 1J1PL 5EU3B 5IBLC 2VKWA 3KPPA 3OGCA 4LCYB 4A6YH 1FZKB 5DD6A 1AJ7H 3SBWA 4MA3B 4JLRB 4Z77A 1IC1A 2GSGA 4F7MA 2AS5M 2W0KA 1G6RL 3TF7C 4R90H 1DBAL 4DN4L 5DTFB 3VA2C 3ARVA 4PB0H 4XPFL 1KT2A 2OP4H 2FX8H 3GMOB 3VFMA 3F5WB 3ARGA 4WUUA 4OFYA 3G5YA 3LD8C 1KLFA 2VAJA 3UAJC 3IDUA 4NOBA 1JZ2A 1CGYA 4EUPB 4NZDA 1G0XA 4J3WA 4PJEF 3QCVL 4U2YA 3ARBD 2D0GA 1I9EA 1BZ7A 1S7QB 2F5BH 3WUZA 4DGIH 1MCRA 5HDOA 1T5XB 2AV1B 2NY6D 3QHFH 1KSRA 1A6ZB 1XGUB 1CZ8H 1KXVC 3MRPA 5IVXA 3PWPD 4M1CC 4DWHA 2WM0A 3S96A 5GS0H 1CLCA 1N2RA 4N1CA 5F3BA 1LO5A 2A0LC 2DQJH 4OV5B 4M1DL 3L3GB 2UZIH 2NY0C 1K3IA 4XAWL 4Y5YB 1A1NB 5DK0B 3DWTA 2ERJC 4JGMA 4MDJA 4S2SB 4J2XA 4F7EB 2ZG1A 3B43A 4K23H 3U4BH 3O6KL 2OL3L 4FQPA 4IRJC 1NGQH 3ZDZF 2EDBA 3BH9A 1FRGH 4GW1A 3MA7A 2AABH 1J0YA 1DEDA 4XP5H 2EDEA 5GSVA 3VXRD 1I1FA 4HMCA 3U7AA 3NN8A 1QFWI 1SJVA 4ZFOA 1OTTC 1P7QD 5DDHA 1RK1B 4HUVB 4MAUH 4XPGH 1XCQB 1BOGB 4BQ9A 2UZXB 2Z92A 1NFKA 3W9EB 2V5MA 3C5JA 1CL7L 5H2BB 3PHQA 2FJGB 3D9AL 2XIDA 1VFBA 5I74B 4JM2A 3KYOA 3ARFA 3P30H 4DFHA 3SGDH 3C6LB 3MRDB 3EO1A 5JQHC 4CVZB 3GRWL 1OARL 3BGMA 4WFFE 5ID1A 5JLZA 5IUSA 2YZ8A 3MZGB 5ICYA 1UXSA 5FXCH 2QLVB 3GBLA 4HFUH 5TH2A 2N7BA 1OGAD 2BNRA 1AGDB 3S37L 1S9XA 12E8L 4LPCA 3SKOA 4KI1A 1B0RB 4EOWL 4R4ND 3VFOA 4AG4L 1HH6A 1VEPA 1OAXL 4XVSL 2JJWA 5GS1C 5EIVA 3UYOD 4JFFD 4JHZA 5LXGL 1JNJA 2VLKA 4XVUC 1T03H 3SKMB 1JRHL 4ORZC 4HK3N 4JCMA 1KJ2A 3QWRD 3SE4C 5I8OH 2IAMD 4DZ8B 5F7WC 3LN5A 5F1IA 4Q74A 4P2RA 4Z7WE 3MLVH 4FQ2L 1JBJA 4UT9L 4RGNB 5E2UH 1TTUA 1EEQA 1BM3L 3DETD 3M17B 4M6OL 3ORJA 3P73B 5BJTB 2CPCA 5D1XB 1I1RA 5L88H 1BWWA 5C9KA 4XCCH 4KDTC 4BYHA 5KAQF 3EYQD 5F88B 3O3DB 2R2HB 4HJ0C 2HJLB 1MIEH 3DVFA 1FSKC 4HGMA 1EFXA 2CIIA 1YECH 4V1DB 2C4FU 5BW7A 4FQJH 2PTTA 5GHWL 2OS7A 3UC0H 3ARGC 1TJGH 1A4JB 3RPIA 3NFPB 5C0FB 1GCFA 1JYNA 3R0NA 5ECJE 5BVJB 1QR4A 1FLRH 5GGSB 3WIHH 1ZLSH 3D85D 2D03H 1P84K 3LQZB 3SN6N 2WIMA 2BY1A 3TO4D 3F62A 5HVHC 5J9PB 1WEJH 2V5TA 2Z91A 1F5WA 3QZWA 3HG1E 25C8H 3BMWA 3SPVB 1TQBC 4XPHL 3UBXB 4LLUA 4K3DH 4MJIA 4GAJH 2CIKA 3OB0K 4X98B 1ZHLB 4GT7A 5CJQH 4YBQD 3IDMA 4H20L 2GJ6A 1CWVA 3GIZL 5ISZB 1F6AB 4C56E 4L9LB 1OY3B 4G8IB 2EE6A 3HLAA 1NCBH 1E4XI 4PRNB 4H1LA 2XG5A 4D8PB 3FMGL 1EGJH 1Z0NA 3MLXL 2WWKT 1MNUL 4U1NB 1MIML 1S78C 1EZVX 2GQHA 2WLZA 1X9QA 1KYOK 4CW1B 1VFAB 3LKOB 4R4FL 3PWNA 4MVBC 5ACMA 2YN5A 4NNXB 2NZ9C 4P9MH 3LKRA 4YUEH 4U1HB 2A73B 1KJ3H 1U8QB 4OLUL 3W2DL 5L8KB 4GH7B 1FC2D 5GPRA 3U6RB 4YXLL 3RWHA 1INQA 4RA3A 3VMNA 4KHXH 1JGLH 1QA9A 2ZSVA 1WFUA 4C54A 1BF2A 2BVQB 3P0VL 1XR8B 4GG6E 4QRPA 4HWNA 4JM2C 1RHFA 2L0DA 5DVMA 3ARFC 4HXAH 4Z95H 4KXZH 1ORSA 2YXMA 3MRKA 4GUPB 4MNGA 5AD0A 4Q9QH 4QRRD 3EHBC 1QFHA 5F7EH 1Z9LA 4PJ8A 4APQC 1NAML 3AGVA 3MFGB 1ND0A 1QSVA 2GYSA 4M9OA 1KPUA 1U95B 1S5IL 4X80L 4XC1H 1IKFH 2VDKH 4M3KB 4PTUA 4HZAA 1A3RL 1V7ML 4NN7B 4FG6D 1NBYA 2MHAB 3VRJA 1Q9LA 1JPFA 1G7PB 2XWJA 4UQ2A 5IV2B 4OD2B 1WZMA 2BSTA 4PJ7B 3TBWB 3O4OC 1B2WL 2L7JA 4NRYA 3CX5J 1Y6MR 2ICCA 1TTFA 4YC2B 1UXWB 3PGCA 3FB6B 3LEYL 4LSPL 2VH5L 4L4TD 3GMLB 5DFTA 4LASH 3TJHD 5EO9B 3Q5YA 2P4AB 2BXYA 1RIVL 3MXVH 2ORBH 4JG0L 1KB9J 2RBLA 4KKAD 3DRQA 3WL9B 1P4BH 1Q38A 1J0JA 1I8KA 2FX7L 3CUPB 3R1GL 1XH3B 2G75A 3PDGA 3QDMD 3L9RB 1G1YA 3QDHA 5HD8C 1T04B 2AJZB 2APTA 3LKNB 4G3YH 3RGVB 4OZHB 5JQ6L 2RFXB 5BW7C 4YE4L 2WWMC 1RU9L 1UM4L 3IDIB 1H3WM 4OIIL 3N1MC 1L7TH 3P4MB 4TPRL 3BPLB 4LRNL 4NO2A 1RJZB 2NTFA 3X14B 5F8QC 1IEAB 4UNUA 4NDMA 4KROC 4AEEA 1GSMA 5DUBA 1MQKL 1RK0B 3DRTB 1KJ2H 3FQUB 2VDQH 1ZVYA 4XRCB 3RAJL 4NQEA 2JK5A 1H5BB 3QCUL 1IC5L 3UTTA 3ZDYE 2FB4H 4NZUH 4ALAH 4DAGH 4YIQB 4OSUL 4BA8A 1U6AL 4TOYL 1NCAH 2XN9E 4C83B 2EE3A 1P2CA 5GS3A 1JHKL 1KPVB 4XPTH 4FZ8L 1J8HD 1KCLA 3U9PL 1NANI 1WIUA 4PP2B 3AC0A 4HX1A 3V5KB 1FFOB 1I7RA 5IJVA 2WINB 3H6JA 4QRSB 2JIXB 5I6XB 3U4EA 4NBZB 3IU3B 3GSNL 5DI8B 3BVNA 4PRDB 2NY3B 2W9EH 4GKNB 2G2RA 3HZYB 4ACPA 1Q0XL 2DQIH 3RL2A 2IPKA 4R96B 4L8SB 1VKXA 3PWJA 1NGZA 4K71C 1BVZA 2ZUQB 2ADJA 2HJKB 5FUZL 4XNZB 1JHLH 4XCFL 5E1HB 4QTIH 5F21B 1B9ZA 1RZKH 4GFTB 4Y2DC 1KCSL 1WZ1H 1A7OH 5J6HA 2YWZA 3BSZH 1QQDA 4PUBH 1TTGA 3MCLL 4BFIB 4KU1A 1AC0A 3KJ4C 3TA3A 5CGYC 3WKML 1KELH 4WI5A 1HKLL 3ETBF 4JFDE 1QSFD 3I85A 3P9LB 4WI7A 3TNNA 1LHZA 4OF5A 1JI2A 3FQWA 5IGXL 3CK0H 1I3GL 5BS0A 4PJ8C 5I30H 3B5GA 1WISA 4PJGB 1FNSL 1G6RA 4H1LH 2W1NA 1DVFB 4X6DF 4F7TA 2XZQL 3KYMA 3MA9H 1WBZB 1NUFA 5CP3A 2BRRL 4P2OD 3SKNA 3BZEA 1CFNB 1BVLB 2VABB 4P3WA 4XAKE 3U9UA 2I9TA 2P8PB 3PDOB 2KPNA 5L8LB 4LQ1A 3MV9A 1I9IH 4Y4KD 5JOFA 2YKLL 2Z93A 1JZ6A 2FSEB 3BJ91 1KBGH 3QR2A 3QRGL 3O6FC 1I8MA 3BQUB 5TE7H 2I07A 2A77H 5JZ7D 4KJPD 2VDPH 2DLEA 5DLMH 5F7FA 3VFUB 4XXDA 1JYXA 3BI9X 5E99L 4F8QA 35C8H 1QUNA 5BCAA 3BMVA 1J05A 3D87B 4KI5C 5C0GA 5E7FA 1Z2KA 1G7HB 3ES6A 4YDVA 1LILA 4U3XA 5CP7B 4XNQB 3STZA 3GKZA 3L7FA 1JYWA 1GOGA 1WUNT 1JPGA 3I02A 1EEZA 3BE1H 3O3BB 1N3NB 3HA0A 4DTGL 2E3VA 2ZOLA 4H5SB 5C08D 5C92A 4PJ5D 4Y16A 2Q7YB 4I1NB 1LDPL 3QCTH 2DQHH 4PV8B 4OZGE 3D39E 3M1BA 4KHTL 4PJHA 4JFYB 3QEUB 1U3JA 5IMLA 1QFOA 1OP5H 4I48A 5ADPL 1Z5LB 4M5ZH 3SGEH 4N0UE 3KGRA 4JJ5A 1YMMB 3QXAA 4JPVH 2CO7B 4LKXB 4NCC2 2VDRL 4Z7WB 1PQZA 1MRFH 4RFEB 4ZAKD 1D5IL 1SMAA 2CUHA 43C9A 4PJBE 1SJHA 3FQNA 1K4DA 1J86A 2X4UB 5E5RB 3GRWA 5EBWB 1NC2D 3R4DA 3MV7E 4KY1H 3VXTB 4CNIA 4XBEH 4P2YA 2RIKA 4NOFA 5I2IB 5JR1L 5D70H 3O41B 5FCUH 2C4XA 3PABA 4UDTB 2AXHA 5DUML 3IJYA 1T83C 1N4XH 5A2FA 4ZO7A 2VDML 3U7WH 1OAKL 4TUKH 4N68A 1ZA3B 3ZDXE 1WWAX 3MLSH 1C7SA 3ARBA 5DMGC 3V5HB 4F15B 2OTUB 4HPYH 4JZOB 4NKOA 5DC0A 1UWXH 3RL1B 3H7BA 1C08A 4UMGA 1KTLB 1A14H 3KPOB 4OZIE 2B1AL 1T66D 1C16A 4HWBH 3PWPA 2BMKA 4J8RA 3RA7L 4EVNA 4EQ3A 3TIDB 4G8EA 4ZD3L 2PR4L 1KLGB 1T1ZB 3MREB 2Q86A 3C8KA 3HG1B 3MRGA 2X7LB 3ARDB 4KMQA 4DKAA 3PWLA 5MENE 1JNNH 5IQ9B 1YNTA 3QIWB 4ORGA 3DX9B 1OGTB 4JY5L 3NTCH 1RZGA 4ODXA 4BKLA 4OCXH 1JFQH 3BP5A 3ULUE 5FKAA 4C56B 3U30C 1F6FB 4Q6IC 4ZQKA 2E27L 3HR5A 3MJ8B 5FM4A 2NZIA 5AYUH 1QO3A 4TYUA 3VXRA 4AIOA 1UCTA 3B9DA 1QFWH 1FVCB 1T5WA 1P7QA 1QSEA 3OSKA 4YQXH 2FIKB 2E7LC 3P9MB 1RZJL 2BHYA 3UJJH 4BSVA 1SEQL 1U91B 5F7UA 5KVFL 2MMXA 4F9PA 3RWEA 1CU4L 2EEDA 4KRPB 4KDWA 1GGBH 1JMZA 1M7XA 2YD2A 1JNLL 4M7ZC 4AMKH 3EO9L 3WYRA 4GG6B 3HN3A 1NCCH 1I8IA 3UZVB 1OGAA 1FGVH 3QHZH 3GSRB 2ZCLH 3DNKA 5D71H 4JM4L 3RWGB 3VD4A 5INCB 3WBDA 3MR9A 3BPCA 5CEZE 3VG9B 1ZLUK 4WTWA 5F8RC 1CICB 3K8KA 4JFFA 2ZKHL 4PR5A 1HQ4A 2DLIA 4KPHL 1NGYA 1N6QH 3QWRA 4Y16C 2OJZH 3HZVB 1O7SA 2XTJC 2XY1A 5CP3H 4KKLC 1LVEA 3IJHB 2Y06L 1KJVB 4U0QB 5T3XL 1YNLH 4XNXL 3EYUH 4P48A 3T2OA 3FO2A 4GMTH 4PGDB 3RTQD 1NCNA 3PIQA 1R5IB 1SY6L 2DAVA 4QRUB 2HMID 5JXAL 2D9QB 3UMTA 3U0PA 1D6VH 1JGUL 4DW2L 4LSDA 4RGND 4LKCB 2HLAA 4XVTH 5LGKA 2GHWB 5AAWA 3RX5A 5D1XD 5IB1B 1VESA 5IOPA 3EOAB 4PYHA 4UAOC 2ZSWB 1CD0A 5CD5D 3LDBB 4HPOL 2A9NL 4FQHB 3D6GA 1NAMA 4U49A 3MRNB 5DEGB 3X3FH 2RAMA 4X99B 3QFJE 1BFSA 3P4NB 5HGDA 2J4WL 3OKDB 1J1XL 1IAOA 3D85A 4V1DD 5D2LE 2NCMA 4ONGH 1ZGLA 2HWZL 3ARBC 4LLDA 2X41A 4ZUTA 3HPJB 4J4PD 3TO4A 1UA6H 4QF1B 1CI5A 4Q9RH 4S1DC 3VD7A 1AFVL 4PLOB 1KCRH 4JM2F 2W60B 5D8JH 4L8CA 2NY6C 3UTPD 3OG6B 2QR0B 1N59A 3MLUH 2J8UA 4XH2A 4MQXD 1HXYB 3O2VH 4ODHL 5DD3H 4JKKA 4PRBA 2PW2A 5I1CL 3PXJA 4OKVB 5GGUB 2AEWA 1DFBH 5DD0L 4JGJA 5E6IB 2FATL 4TSAL 5GJTH 2XN9B 4XPAH 1MRDH 1ZHBB 3RWFA 3WNKA 1YEGL 5EU6B 3BEWB 1M6OB 1MF2L 4NN5B 5ISZD 4NUJA 2GAZB 4DUVA 3EYOA 3DBXA 5DMIL 1R3LA 1KEMH 5E94B 3CFCL 1TCMA 2A83B 1DN0B 2X9WA 4K8RH 2BP3A 4IIQB 2X1QA 4HF5H 4JKLA 5IT2L 1EHLH 1D3CA 1A7NL 3S36L 1XZ0A 1CFVL 2GJZB 3MV01 4G8GE 4W6WB 4NZTL 5EUOB 3WE6A 2OTWB 1YEFH 2VLRD 4RWYL 4HAGA 1CLOL 3BUYA 2YK1H 2OCFD 2P43B 2JLLA 1RZIB 2XFXA 1MUJA 4QRRA 5T3ZD 3RFZC 1MAKA 1QLRB 1IM3A 3T65A 5C7XL 2VQ1A 3V6OE 5FYJU 1CBVH 3HAEG 3O45A 4JFDB 4YEFA 4ZDHB 2NPLX 3C9NB 2DQCH 1QBML 1U8HA 2YBRB 2IALA 3QJHA 4FP8H 1YDPB 5T5NG 3GSNA 5J11B 2AK1H 5F6HJ 4FQXB 2JB5L 2FX9L 1O0VA 1MWAH 2F5AH 1MHCA 3STLB 3CJJA 4HQQH 3UTSB 2VL4A 3FT2B 5INDB 3CFJB 1A1MA 3VXPA 5DRZB 5EZIH 2IAMC 2DQFA 1S7WA 4ZODA 1OW0A 1YEHL 1UVQA 1CR9H 2NYYC 1UJ3B 3S5LG 2GI7A 1ZK9A 3MJGX 5EN2B 3BPOC 3T8XB 3V0WL 3DETC 1X5LA 2W0LA 1HSAA 5DRWB 4L4TA 1T2QL 5BZWA 1HI6B 4HFWB 1MJJA 1J0KA 4OLWH 2ZJSH 5HDQL 2LAGB 3B2UD 4PREB 1XGPA 1ORQB 1Q72H 2UUDH 3ULVL 4GS7C 1LEIA 3EYQC 3U82B 3L5XL 1MAML 3DX8B 4P5TB 4S1QL 5SX5K 1A7QL 2MPAH 3QDMA 2QL1A 4W68A 4X6FB 2OTPA 4F58H 5F9WB 2VC2H 1EJOH 3E3QC 3BP7A 3MMEA 3FT3B 4OCRH 3MRHA 3I9GL 1HHJB 3CXDH 4MNQE 4D9LH 3WUWA 4DKFL 5KN5A 2VZUA 3QXTA 3P4OB 4XMLL 1Q94A 5IVNA 2EIZB 3NH7L 3JUYA 4MXWL 3BKMH 3LKSA 4M43H 3RGVD 3O3UN 3FOLB 4QHUB 4H25A 4S0SD 3TO4C 2GFBA 1U8JB 3CU1A 1FFNB 3WFEL 1DDHA 5L9DH 1VPOH 1EX0A 4OCYL 1MOEA 3QG7H 5JDSB 4OZGB 3D39B 5HDBF 2BZDA 4UT7H 2AJUL 2XWTB 4JQIH 1PKQB 4L1HA 1VACA 3PL6B 2WP3T 4YBQC 1NDMB 4BH7A 1CD8A 4N0UB 4KJQD 5D96B 3S7GA 4XP1L 1NAKL 1CDYA 1J8HA 5I73B 5J06A 5FUCC 1GYAA 4R8WH 3GHEL 5J13C 4ZXBB 2HKHL 3OKLB 3MBXH 4WU5B 4PJBB 4JPIB 1MAJA 4PB9L 4NQCE 2MCPL 3MV7B 4Z76B 3RJDA 1OWRM 1QHPA 2NLJA 3DHJA 1HILB 1SJEA 2V2TB 1E27B 3LRHA 5IG7B 3T2PA 1MQ8A 3CSPA 3DVGB 2IG2L 2JIXD 3PGDB 5L7XL 2BSRA 5JPNA 2NY3D 2GW5A 3D0VA 5D7JB 3UYPA 3BWAA 4HT1H 2VIRB 5JW5A 3OKOA 4M62L 2FCBA 5FKPB 1ZMYA 1IM9B 3BESR 1A6VH 3WHXB 4B41A 1RJCA 1IQWH 2VLLB 1FZOB 3B9KB 2CKBH 2AP2A 4G6AD 3VGHA 3TV3L 1QSFA 3V0VA 4KI5F 1MJ8H 2FRGP 3BKCH 3MXWH 2EZ0D 1DQLH 1KIUA 1IGYA 3VGAB 3TP4A 3GMRA 1FNEA 5IVZA 4HV8A 3TZVB 4PJ9D 4JDTH 4M4PA 3KAAA 4MB5A 2B39A 5DA4A 3V4UH 2RR3A 4X4XA 1EUTA 5MENB 2P7TA 1WCBA 3MRLB 2FJFA 4P2OA 1X7QA 4YBHA 3DO7A 3OAYH 2XQBL 1TITA 2B0SH 3NGBC 3VH8G 1TJHH 3GK8H 4OUOA 5ABDE 4FG6C 1U8OA 4RMUA 4OLXL 3GNML 3IDYC 1HINH 4LHJB 1KENH 1RY7B 4P5KB 1DVFD 4Y4KA 3FONA 4ONFL 2BDNH 1KTKE 3I6GA 1NCUA 3OF6D 1JCKA 1OW0C 3MROB 4LQFL 5HHVH 5BZDA 5J57B 3O2WL 1KFAH 4M8QB 5IR1A 2A74B 3G6JA 5GRJL 1OAYH 3W81A 5HHPA 5KVEH 4AJ0A 3TJHC 1GAFH 2P8LB 1LEGA 4G6JL 3ROLA 3KVQA 3GJFH 1LD9B 5HSFA 4JVUA 4KKAC 1XT5A 5JOEA 3GZKA 4LVHC 2R2BA 3SGJA 3MFFA 1OTUD 5FV2A 3MV11 3BW9B 3BQUD 3T0EC 1MFCL 2CLRA 3GI9L 2R1YA 1KB5H 4LCUB 1W0WB 4U6TA 5C6TH 5D6CB 2H32H 4MJ6B 1S7RB 1WJ3A 5F89B 5B38A 4FTVE 4NQVB 2X44D 2XRAH 4JFXA 4PJ5A 5AZ2L 2ICWJ 2ICES 1SEBA 3HZMA 3ME0A 1WC7B 5AEAA 4WFFD 1Y18B 4TRPH 5FGRA 1LP9E 5F1KC 3L3HB 5DRXA 2FIRT 1J5OL 5SWSB 5A3IC 1XF5A 1IGTB 4HH9A 4P4RA 3LVEA 8CGTA 3MJ7B 4WDIB 2H2SD 5EZOL 1MCPH 3LKQB 3MRFB 5K9QG 2G5BA 2YA2A 3W11D 5FO9B 3GB7B 4GW4B 1YN7A 4OGXH 5I19L 2IQAB 3K2UH 4OI8A 4ZAKA 4NRXB 3V4VH 2B5IC 4YFDB 1EMTL 3TPUA 3CDYA 4FQCH 5BRZE 5IP4A 1NC2A 4O2CA 4PJFE 3DUSA 2D4DA 2A2QT 3WXVH 4WJ5A 5E70A 1MHEB 5E8PA 3Q48A 1HWGB 5EU3A 3Q3GB 3GSXB 3LB6D 5D5ME 4LCYA 3WXWL 3VI3F 1MCWW 1KPRB 3UDWC 3BXNB 1FZKA 4YEEA 4MA3A 4JLRA 3S5LB 3RVVD 5JUEH 5D93C 1EBPA 3VDCA 2VDLL 1XCTB 1FFQA 5DTFA 2I24N 2QADB 3GMOA 3F5WA 3V4PL 3CLEH 3OX8B 5B8CB 2XA8L 4I9WE 4EUPA 3MLZH 15C8H 2XXCB 4JJHA 4POZD 5D2LB 5F6IB 4XNUH 3UYRH 3MLRL 1FIGH 5KS9E 1KC5H 5CINL 1G9EA 3IDGB 4OUUB 1SY6A 1S7QA 1T7ZA 3FN0H 1N8ZB 1T5XA 2AV1A 5D1QB 1OCWL 1A6ZA 1XGUA 4H8WL 1LQSR 2PUQT 5D72L 4YDJB 2QHRH 3TYGH 5GGTH 3HG1D 4WIQA 1B6UA 1ZEAH 4O2FB 3ARDD 4KUZL 1ULVA 2D7QA 3RVWD 5E24E 3QIWD 1A1NA 5DK0A 1BQHG 3S88H 5KG9B 2HTLC 4P2OC 3RX7A 4FZEL 4S2SA 4F7EA 4XVJH 4C56D 3E8UH 1NQBA 1UKQA 4KK9D 4MA1C 1H9VA 4KKCC 5DVLA 4LSRH 4P0DA 4Y4KC 4UTBL 3QEGH 4Z7UA 1KG0B 5C6PB 4UILL 1MLBB 5LKNA 4HUVA 2Y4SA 5SX4H 4G8GB 1XCQA 5DT1H 1JJUA 2DICA 4Y4HB 1ZT7B 3W9EA 5JZ7C 2W9DH 5H2BA 2FJGA 4KK5D 4KJPC 1G7IB 4J3SA 4NZRH 2DB8A 1A3LH 1T6VN 3HUJB 4LL9A 4KRPD 3EDKA 1JE6A 3SGJC 1NFIB 3TBVB 4CVZA 4U6VH 1MJUL 1S7XB 3THML 5TQ2H 4GBXB 3L7EB 4WHDA 1EAPB 4JFHE 3PP3H 1WGOA 3WNMA 3BT2L 1AGDA 4N9OB 2VDOH 3H42L 3MC0A 4I77H 1B0RA 2BVPA 4P3DB 3I2CL 1A4KA 3C5ZB 1AH1A 1W72L 3GKWH 1CICD 3QNZB 5AZEL 4GRWH 4LHQB 4PLNC 4JHBA 4KTDH 3SKMA 1VEMA 1PG7H 2OI9B 3RTQA 2CR3A 4OZFA 5DWUH 4DZBB 1I9JH 3ZKND 1S3KH 4DZ8A 4ODSH 1RZJC 4Z7NE 5EIQA 3NBNA 1UJTA 1CL7I 4PGEB 3JV0A 4ZAKC 3M17A 4LPYA 3P73A 5BJTA 1X5XA 1S5HB 4ODVH 5D1XA 1HXMA 3VH8B 5EO1B 4M7JH 1FL3B 1VCAA 5FM5M 1U3ZA 3LH2L 1JYVA 5EU7C 2IBZY 1E4WH 3LPGA 1PY9A 1MFAH 5F88A 2R2HA 2FYYB 4PY8J 2HJLA 5KOVC 2ZWLT 1HIMH 1ZS8B 3W5MA 1DQML 3RU8H 3RWDB 3GMMB 1CDGA 5I1GL 3ROOB 5L6YH 1WVZA 4V1DA 5DFWH 4MHHI 1CXIA 5JIHA 4J4PA 4MNQB 3WV0A 1JRHI 1OB1B 3WN5B 1QBBA 1A4JA 1UWGL 1HSBB 1X5AA 5C0FA 3R0MA 5DZOA 5GGSA 4NGHL 5KJRH 2I9LB 1T66C 6FABH 5C3TA 5C0ND 4LEOB 3EYVB 5J9PA 1HNFA 4KV5E 2H41A 2RHEA 1XF1A 2JCCF 4NM8L 3SPVA 5TFSL 2A9MH 2A1WL 3UBXA 4P59L 2H9GA 2YA0A 1CN4A 2QQQA 3BDBA 3ESVF 1ZHLA 5FYKU 1TJIL 1L7IH 4N8CL 4X7FC 5E5UB 5ISZA 4I18A 1XEDA 1F6AA 2KQNA 4L9LA 2ADGB 4UV7H 1HH9A 3MODH 3LPWA 2DOCA 4G8IA 2O5XL 4F3FB 2VDNL 1MELA 4PRNA 4MJIE 2Z8RA 2FGWL 5E6ID 3L3DB 4D8PA 1ZLVH 4JKMA 2AGJH 1QKZL 4Y5YC 3VFWA 1JTPA 4CU7A 1NBZB 2XN9D 3KPQB 1S7TB 2XI9A 4CW1A 3LKOA 1F58L 2IFFL 1XF2B 4NNXA 4P9HL 3RZWA 3C2AH 4U1HA 2A73A 3DSFL 3FL7A 2VLRA 4GXVL 4ELKB 4HC1L 2VR9A 3PV7A 2CMRH 3FN9A 2X10A 4KZEL 3X17A 4EBQH 4OGYH 4OCLC 5GRUH 1GGIH 1FGNL 3C60B 4N0CD 4PJDB 3SDXE 3W9DA 3SCMB 5GGQH 1MJ7H 2DLHA 3T4AA 2BVQA 5I74C 2DJUA 3CXHJ 1MFDL 5DJDA 1G9MH 1CGUA 2C3WA 3C6LC 5HYSG 3WIIH 3CFEB 2ZZUT 3D5OF 1X5JA 3ARYA 1T1WB 2E9WA 2O5YH 1L6ZA 5BXFB 1IQDA 3IRZA 5EA0H 2IH3B 5DHYB 1P4IH 4FFZL 1CD1B 4JFDD 5IEHB 2Q8AL 2Q8BL 4YHPB 2UWEE 4FFWD 3MUY1 1U95A 2P49B 3BKJH 4TTDD 5F93C 4ODTH 1H8OA 2ID5A 4FQXD 1MCQA 1F00I 4M7LL 2J8UF 2I5YH 1OHQA 2MHAA 2DRUA 2HMIC 4O2EB 1CGWA 5BO1H 1NEUA 1A9BB 1CGTA 3PDDA 1G7PA 2IPTL 3F65A 5IV2A 3V8OA 3IXAA 4OD2A 4PJ7A 4LLMB 3TBWA 3QIBB 3T1WA 4L4VE 5I71B 4DGYH 2X4OB 4XAKD 4RGNC 1UXWA 3ZYJA 3FB6A 4UTAH 1BQHB 1SBSH 5I16A 4KZDH 3TESA 3OKEB 3JWDL 5D1XC 5EO9A 4F80A 3G9AB 1CG9B 2PKDA 3K7UA 1EDQA 5CKGA 5CD5C 1PZ5B 2IGFL 4QNPF 3WL9A 3WO4B 4P5TD 4WCYH 3CUPA 4EI5B 1XH3A 4NJ9H 3L9RA 4G43A 3T2NH 3QXUA 4HIIB 1T04A 2AJZA 3U36A 5T1LB 3LKNA 4KRLB 5TE4H 3RGVA 4OZHA 2R15A 4ZFZA 2RFXA 2ICWB 3RDTB 4FTVB 2ATKB 2HTKD 3IDIA 4J4PC 1BBJB 3P4MA 1WAAE 3UTZB 3L6FB 1U8NB 5I9QB 1RJZA 1LP9B 3QEHB 1IEAA 3VFNA 1B4JL 1RK0A 4MQXC 4OZFH 3F7VB 5FUOL 3FQUA 3GSVB 4UUJB 4XRCA 5JA8B 5GGVH 5DC4B 4OLVH 4MXQD 1OF2A 1T2XA 4OD3H 3D39D 3KYKL 4Y1AE 5I1JH 5CILL 3ULVC 4ERSH 2UZYB 1UKSA 2AV7B 1A5FH 3PL6D 4C83A 4PJFB 1KPVA 4MSWB 5DQ9B 2ZG2A 4KK8D 5TDPB 5ALBH 5H35B 4L9LC 1X4YA 5I18H 2XT1B 1E6JH 4PP2A 2AJSH 3V5KA 3K74B 1FFOA 1IZKA 2WINA 5I8CB 4ZXBD 1T1YA 2JIXA 5D5MB 4CKVX 4PBVC 5DI8A 4WENB 4GKNA 5I1KH 1UG9A 4QRQB 3S3JA 3HZYA 2R8SL 1A7RL 3VG0H 3MV7D 3TCLB 4YWGL 3OKMB 3VXNA 4R96A 1BFVH 4AL8L 3DMMB 3X12B 2HP4A 3ZKSD 2Z8SA 3KPPB 2HJKA 3JVGA 1PJ9A 4Z77B 1XGYL 3QQ4B 3TBTB 4JO4L 2BX5A 5D7JD 4F7MB 4N5UA 1T2JA 4NM4L 5IFHL 5KS9B 1IM9D 1PX4A 3LHPL 1KT2B 2WQ8A 4QXGH 4BFIA 4TVPH 3G5XB 3VFMB 4PJ9A 3EBAA 5JA9A 4YHZL 3B9KD 1I85A 3W5NA 1K4CB 1S9VB 3P9LA 3BAEL 4YLQT 3MNZA 1HZHH 5I66B 2D7NA 4RSVA 3TZVD 2DBJA 3C8HA 1KOAA 4XI5D 1GGUA 4JFOB 4RDQF 1DVFA 1UFUA 5MEND 2DBLH 3MRPB 3WHE0 4BZ1L 3IU4L 4I3RH 1WBZA 3OF6A 2APFA 1CFNA 3MGTB 2ZNXA 1BVLA 1RUQH 2VABA 3FTGB 4KKBD 5ID0B 2Y72A 5FV1L 5HGAB 1JNHB 1P9MA 3S35H 3ULUD 4NN7C 3WNOA 3PDOA 3NCJL 1U58B 4GQ9H 1FIEA 1A6UH 4XP9L 2EEAA 2KL6A 3B2UC 2X05A 4JN2B 4YHIB 3IAPA 5T3ZH 2FSEA 2IADB 5J1SC 4YC2C 3BQUA 3GSQB 4RGOH 4K7PH 4UV4H 1R24B 1T0PB 3X3GH 3F58L 5ESQB 5E0QA 1ZANL 1AC6A 3VFUA 1MVUB 2EDKA 4G7VH 2XQYK 1I1FB 5GSVB 4HK0B 1OP3K 4JHAH 4UDUB 3V7AE 1A02N 4U7SA 3PQYE 5TF0A 5CP7A 4HBCH 4XNQA 3FAXA 1OAZL 5F96H 5KOMC 2VXUH 4UIKH 3MRQB 3KYNA 4GAYB 3RGVC 1N3NA 3RKPA 2AEIT 1JGVL 1CYGA 4H5SA 2R0KH 2Q7YA 5H8DA 5CEZD 4FQLH 3BPLC 3IVKB 3WMSA 1IKNA 4U7MA 4FMFA 5HYSB 5HI3D 2KDGA 3IT8D 5J0BA 3O3EB 3WFBH 1Z5LA 1XR9B 3DGGB 2DWEB 4KJQC 3VFOB 3AM8A 3P0YL 4ENED 1WWWX 2FD6H 1H5BC 5J6GB 5J56B 4LKXA 4Z7WA 5EC2A 4AEIH 4R2GB 2XXMB 3EAKA 3MBEA 4RFEA 1NJ9B 1WIOA 2LABA 1OD7A 4HD9A 2X4UA 3OAZK 5EBWA 1VGEL 1HOCB 3O6LH 3VXTA 5KSBF 4HS8L 1P6AB 2Q7NA 5I2IA 1ZGLM 2JELL 3O41A 3KPRE 4UDTA 4Z18A 5I6XC 3HNVH 2LV4A 1E0OB 1FYTE 1QACA 4XPBH 2NY3C 4URTB 3RBSA 2F19L 1EO8H 1RZFH 3K4ZA 1WFNA 2VAAB 1ZA3A 4OI9A 4D94A 4L3EE 3L3OB 4L8SC 1CE1L 5LWYH 3G6JF 1PKOA 3V5HA 5TE6H 2OTUA 5I1LB 4JZOA 2ZUQC 2QADD 3RL1A 1E28B 4XNZC 3JVGC 4OKDA 2Y1VA 3I84A 4P3CH 1RFDL 3VMPA 1KTLA 5SWZE 3KPOA 3V6ZA 1QEWB 2EZ0C 3TNMA 1HDMB 3TIDA 2DTSA 5A2IH 1KLGA 1T1ZA 4XZUA 1LMKA 3MREA 3HG1A 4S10A 5HXMA 3ARDA 1I85C 4BZ2L 2EIBA 4DCQB 5D1QD 3C08L 5IROA 3QIWA 1OGTA 3CU7A 3VRLF 2V2WB 2C3VB 2Z91B 3QZWB 1BQLH 1LNUB 4FQ1L 4OV6F 3HR6A 5CWSB 4C56A 4BH8B 3MJ8A 4NWUL 1JF1B 2CGRH 1WIPA 5DMKB 1DVFC 4MJIB 4XP4L 4ZOAA 5CJOH 3AFLA 4NSKA 2QKIB 3ILPA 3KPMB 5DS8A 3OAUL 1BJ1H 4NQUA 5ITBL 2CR6A 1C5DB 2VSDA 4MGXA 1AI1L 1LWRA 2EC9U 3NIGE 2IH1B 3V7AG 3P9MA 1FBIL 2D7TH 5GGRB 5FHAH 5I76B 3VFSB 1A3QA 1U91A 4Z0BH 2DDQH 2J88H 4XMKH 1D6EB 3EDJA 3TT1H 4G8GD 1OTUC 3SDXB 3BQUC 3Q6GL 5ITFB 4O9HH 4Y4HD 3V52H 4TSCH 3LKRB 2AJYL 4LRIC 4YHOL 4GG6A 1CFTA 4WFEE 3SKJL 3X11B 3RWGA 1CT8A 2CXGA 1FE8L 3MACL 3S37X 4LGPB 4GBXD 2HH0H 1NL0H 4JO2H 2F15A 2F8VA 4JQXA 5IB3A 1NCWL 3G08B 3LMJL 2LVEA 2UWEB 3HZVA 1F8TL 1NCDL 1P5UA 1FVEA 1PSKH 3C5ZD 3IJHA 3RRQA 1KJVA 1JTOA 2DQUH 5CIPA 1A6WH 1VERA 2PNDA 3O81A 5FO8B 4DJMA 3VFGL 4QRUA 4OF0A 2NXYB 1KPUB 3ZKMD 4H88L 5C09E 3WFCH 4LSTH 3IFLL 4L4VB 3LB6C 5CS7A 4GKOA 4LKCA 1LE5B 4LF3B 1LK2B 2DM7A 2CXKA 4HUMB 1VB9A 4NKMA 5E8EB 3RVVC 5DD1L 4NNPL 5IB1A 3U7YL 4PBWD 2HT3D 2W9LA 2XWJB 1P5VA 3EOAA 2F8XC 5TPWH 2ZSWA 1S7SB 3PGFL 5DVKA 2D7MA 4FQHA 4NRYB 1JP5A 2GEEA 2XZCH 3MRNA 5GZND 4P4KB 1UT9A 3IB4A 3OQ3B 4X99A 3UPAA 1JIBA 5IHLB 3LAFA 5EOCH 1FFPB 2JKXA 2XWBB 1I8LA 2AEPH 4B5EA 32C2B 4JB9L 4F15C 3MX0A 5LGHL 3INUH 4JG1L 5AUMB 4MNQD 1BMGA 4YO0B 4M02A 2G75B 1SVCP 3IKCB 3K1DA 2W60A 4ZTOH 2Y9RT 4LSQL 1YNKH 1R3JB 4CVXB 2HG5B 2V7HB 2QR0A 4IMKA 1TZGL 4AH2B 1IGIH 2O5ZL 1HXYA 3DROB 4ZYKB 3SOBH 2IMMA 3U0WH 3TJEL 5A2LH 4NO2B 4J6RL 3ARDC 4OKVA 4HLZG 5GGUA 2FJHB 2FHBA 1RZ8A 3D18A 2NY7H 4R97B 5EB9A 3HC0B 3MRRB 4Y1AB 3RVWC 1E6OH 2XZAH 1OM3L 4YXKL 5E6IA 5IROC 5J1AB 3QIWC 4JO1L 1H0DB 2XN9A 3WNLA 1A64A 1ZHBA 3CH8A 1M6OA 4MA8H 4OM1L 5IFAL 1JN6B 2EEBA 2GAZA 2GITB 2F58L 3I6KA 2JK5B 2K7PA 5E94A 1ZXQA 4KK9C 5DR5L 2MKWA 1CDCA 4ZTPL 3QUKB 1DSFL 4IIQA 4YZFE 4W4OC 1B3JA 1MCHA 1ZVHA 2J6EA 5KSVA 2QV2A 4PBXA 1IBGL 5JO5B 1OSZB 1RSFA 2DD8H 5GS0D 1IGMH 5JPMB 2VO5A 1EV2E 1F4WH 4RMTA 1TVDA 2HRPL 3O6MH 2R23B 2OTWA 1JGDB 1EVUA 3RQ3A 4NRZB 5ELIA 3A0OA 4KRPC 2O26U 1RZIA 2E5EA 4M1GL 5LBSL 3C60D 3ARXA 3SCMD 3RPKA 3PWJB 1NGZB 5CJ5A 1NGPH 2V9RA 4LAQL 4WY7H 1ZLWK 2HVKA 1X4XA 2DQGL 4JFDA 4XX1E 4XCNA 4ZDHA 4Y8AA 1NBVH 4D9QE 1F4XH 3AVEA 5FK9A 3C9NA 5J6HB 5T1KA 2MOVA 5C07E 3VG9C 4WEBL 4U6XB 2YBRA 4NYLA 1D5BB 1YDPA 3HNSL 4ZO9A 1CICC 4F8TA 4FQXA 3TA3B 4EZMA 1RUAL 4M6MH 1Q1JL 2UY6A 3STLA 4YFEA 1RUKH 1D9KC 1EEYA 4JQXC 3FT2A 5C8JB 5INDA 3CFJA 1FO0H 3EOBB 2EO9A 3ZKNC 4A6YL 5DRZA 5IJKA 4FXKB 4X6DE 1AJ7L 3HMWH 1U8KB 3FQWB 3UCRA 2FEEL 3T08A 4NC1C 2NXZB 3BZDA 1L9NA 5EN2A 4RZCB 3ULVF 1H3PH 5DRWA 2F54E 5JMRA 1E4KA 2EE9A 1HI6A 3H3BC 4PB0L 4HFWA 2OP4L 1G9NC 3SDAB 2FX8L 3ARUA 3GMNB 3KYMB 1EH9A 4PREA 1Z0MA 1ORQA 2NX5E 3QIBD 2FLBT 1J1OH 3BYYA 4DQOH 3DX8A 4P5TA 3HS0A 3NACH 4MQ7B 5F9JA 3T0XA 4KQ4H 4G8FB 4LAJH 4XC3H 3RNKB 5JOFB 2F5BL 4DGIL 3FT3A 3LDBC 3QHFL 2H26B 1HHJA 4F7PA 1IJ9A 2YUVA 3PQYB 3UPRB 1CZ8L 2EH8H 1I8MB 5CBAB 4C4KO 3L3JB 4HZLB 4EI5D 5GS0L 2EIZA 3SE9H 3VXOB 4PV9B 5T1LD 1I8LC 3FOLA 3DTXB 2FWOB 1NUNB 4QHUA 1NBQA 3RDTD 5C0NC 1X5KA 4FTVD 5C0GB 2DQJL 1RULH 2UZIL 2F53E 3VXQB 5JIIA 3L7FB 1FFNA 4ESKA 5CIPH 4PG9B 5JDSA 3D39A 4K23L 3LQMA 5GJSH 3U4BL 2W91A 3KJ6H 5GRZA 3UBXI 2XWTA 1NLBH 4U1JB 1NGQL 1PYWB 1FRGL 3PL6A 1GGCH 2AABL 1NDMA 4MB3A 4XP5L 3R1GH 1OWWA 4N0UA 3JWDC 1FP5A 3B4NA 4ZXBA 4PJHB 4MAUL 2BVTA 4XPGL 1U3HB 5E6IC 4WU5A 4PJBA 1MHPH 4JPIA 3QT2A 4LRNH 3MV7A 1INDH 1IGJB 4NN5C 1FCCA 2YC1A 2XG4A 1HILA 3P30L 4X9IA 2V2TA 1E27A 5IG7A 1TVHB 3X13B 3DVGA 1K8DB 3BKYH 4EEEA 3KPRB 4IIQC 4QXUH 4PJCA 4PLKD 1UWEH 1FYTB 4M93B 2BY2A 4PGBB 2XA3A 5D7JA 3RAJH 3KLAA 3DO3A 1AGBB 2VIRA 3VWJB 4HFUL 4N0CC 3R8BB 5F7YC 4L3EB 5FKPA 4O51B 3DMMD 5BOZG 1IM9A 4XX1G 3WHXA 5FA3A 1C1EH 3KS0H 4Q2ZB 2QSVA 1FZOA 3B9KA 1VDGA 2AJXL 5SWZB 3ARRA 3OHXB 4HKZB 4I9WD 1MFBH 5MEQB 4OZIA 3JSSA 1T03L 3LS5H 3QUZB 2P8MB 1LE9A 4NQDE 1WITA 1P7HL 5I1DB 1RZ7H 3TZVA 3DUHA 5I8OL 1E4JA 1DBKH 3CIQA 1C08B 3T3PE 3H3PH 4OZHF 1UKTA 1DE4B 1EBAA 3MLVL 4MA7H 3N9GH 1WZKA 1H8SA 5E2UL 1SHMA 5MENA 4FFWC 3IXTB 4ZS6D 2KUTA 4JO3H 3MRLA 2VE6B 2LVCA 4TTDC 3SHSA 5J11C 5L88L 5K9JL 5CCKH 3DGCR 4FQXC 1ACYH 2XNAB 4XCCL 3K3QA 2VITB 3U79A 1JPSL 2QSCL 3G9VA 2J6EH 4P5KA 4LLWB 1GZPA 2C1OB 5IJKC 2ED7A 1MIEL 4Z0XB 1S9YB 4ORGB 4Y5XB 3LQAC 2LFGA 4XGZA 2Z4QB 3MROA 4I3SH 5EOQH 3NAAH 1UJ3C 1YECL 5FKAB 2X1PA 1HN1A 1N64H 4FQJL 2A74A 4M8QA 4PRIE 1MWAB 3HR5B 1AXSB 2ATPA 1E4KC 3VI4F 3UC0L 1TJGL 1FNFA 4G80B 3MYZA 4XHJD 1OT2A 1IL1B 1QSEB 4F9LA 2N56A 1ZLSL 4WU7B 4P5TC 1HKFA 1V3JA 2M1KA 2OR7A 3BW9A 3T3MF 3N1FC 2D03L 3CLFH 4LCUA 2Q76A 1WEJL 1ZTXH 5F9WC 3P4LA 1W0WA 3HCVB 3ULSB 5D6CA 25C8L 1YJDH 4MJ6A 2UY7A 1S7RA 5HVGB 3REWB 5F89A 4Z7OE 5D7LE 5DO2D 4NQVA 4OGZA 1AY1H 2HTKC 3H2WA 2IBBA 3BP6A 4K3DL 1NMAH 4WHYH 1G0YR 4GAJL 1NH6A 1WC7A 1W8NA 3ZL4H 4ZS7H 1Y18A 5CJQL 3U46B 1M71B 3AY4C 3NCYS 1QD0A 4JFHD 4R7DB 2EYTB 3JV4B 3QUMB 1TCRB 3BO8B 4KTYA 1IGTA 3MOBH 3MJ7A 4WDIA 1NCBL 3BPCB 3LKQA 3MRFA 3V0AC 3LQAH 1EGJL 2D7OA 2YPLE 3WJJA 4MXQC 1WZLA 4U2ZA 5FO9A 2YOCA 4PGJA 2BVUA 3GB7A 1KCKA 4XCEB 4GW4A 4ODUA 4HG4J 2IQAA 2WBKA 2AKRB 2YHGA 1AGFA 1KIPB 4RFNB 4NRXA 4PIRF 5AG8A 3OB8A 3C87A 4P9ML 3PL6C 4YUEL 4F7CB 1KJ3L 3NZHH 4M8VA 4KK8C 1YYLH 5D96C 5I73C 1PEZA 4PJGF 5C09B 2P44B 3Q3GA 5DJYB 3JZ7A 1F3DH 4ZXBC 3GSXA 4R2GD 4KHXL 1JGLL 1KPRA 3BXNA 4ISVA 1QBAA 4I4WB 1YEKH 1UCBH 3PIQB 3S5LA 1F4HA 3QPXH 3BIKA 3U0PB 4F33B 1XCTA 4Z95L 1DANU 3VWKB 1CVSC 1GPOH 1FZMB 3OX8A 3UX9B 1QRKA 4NQSB 3QFJA 3PWUB 5F7EL 4LCCA 3WCYA 5D7JC 5EOTB 4FQIL 3VXME 1KXQE 4LARH 1GL4B 5D2LA 1BBDH 4S11A 2Y07H 2WUBH 1N0XH 1NMCB 3IDGA 3GI8H 4OUUA 3B9KC 4XC1L 1IKFL 1GIGH 2VDKL 1Q9OB 5D1QA 3KPSE 3HRPA 3PP4H 3AUVA 4NCDA 3VGAC 1TXKA 5CD3B 1UYWH 4YDJA 3TZVC 3CC5A 4ZFOL 4O2FA 4XI5C 3T09A 2X89D 4QXTA 2AQ3A 2CKBB 3N1QC 1N59B 4XH2B 4LASL 5KG9A 2DL9A 3RIAK 3TM6A 4KKBC 4ZG1A 3MXVL 2D7PA 3ULUC 2ORBL 5F7HA 1JZ7A 1NUDA 4GMSL 4IHOB 3T0WA 4AT6A 5EORH 1P4BL 5LJYH 4XTRD 4MJID 4X4ZA 1KG0A 4EDWH 4KGLA 4GG8B 1BREA 3WJLA 1MCSA 3I3BA 4Q9BA 4G3YL 2VRAA 4Z7WF 1DQJB 1INEH 3LZFH 2WANA 1JK8B 4Y4HA 3UTQB 2CRIA 1ZT7A 5KSAA 1L7TL 5FGBC 4Z7UE 1G7IA 5C0CE 1QNZH 2C4FT 2VOTA 5JIKA 1XZ0B 3M07A 1FAIH 4F9LC 1ZHKB 1NFIA 3FN3A 2E9JA 5KW9H 2IQ9H 1KJ2L 4LPXA 1S7XA 4P2QE 2VDQL 4GBXA 5DJXB 1EAPA 3AMKA 1G84A 3EFDH 4MZ3A 3V6OA 1OQOA 4WFGE 2ZCHH 3I75B 3WLBA 2FB4L 4NZUL 3GJFB 4ALAL 4DAGL 4NFBA 4P3DA 5C07B 5CLTA 5FGCE 3C5ZA 2NY1B 1IM3B 1SEQH 5CHNB 2E7BA 3T65B 5CKAA 1PY4A 4J7RA 3QNZA 3ULUH 4XPTL 3MV8E 5HI3C 5T33H 1KB5B 2VQ1B 2H32B 2X4RB 4K9EH 4YBLB 5A43C 4DZBA 1PLGH 2H8PB 2IALB 2W9EL 1FN4B 3WJJC 4ENEC 3FRUB 4PGEA 1F90H 2DQIL 5FM8A 5D7SH 1LO0L 5I1HH 4G6KH 2F54B 3H8NA 1S5HA 5IW3A 3VA6A 3VH8A 1A1MB 1FL3A 3VXPB 1JHLL 2NXYD 3EW3B 4MD4B 4QTIL 2DQFB 1RZKL 3BIBX 2VN7A 1WZ1L 4L4VD 1A7OL 2B7DT 2FYYA 5C0IB 5J89A 3HB3D 3BSZL 4PUBL 3UJIH 2BK8A 3RWDA 3GMMA 1U2CA 4JGUA 4JPWH 3ROOA 2Q20A 2B1HH 4AK1A 3D48R 1XGPB 4IRSC 5CEZH 5MEPB 2NY2B 4MNQA 2QADC 5E2TH 1OB1A 1T7XA 3WN5A 4P4KD 1HSBA 3CK0L 2H1PH 5I30L 5B8CC 1FDLH 1XGTB 1Q8MA 2I9LA 4X6BA 3EJZD 3BP4B 5F6IC 3MMEB 3OKNB 4DVRH 4LEOA 2OJEA 3EYVA 4AZ8A 3CVIH 2F53B 3HAEH 3NIDF 3MA9L 2X2YA 5KN5B 4GG6F 1Q94B 2QSQA 1WCQA 4Z7VE 4POUB 1C12B 1VFOA 3L3IB 1IT9H 3C09B 3TGXA 3NCFB 1I9IL 4QGYA 4TVPE 2ADGA 1DDHB 4J3UA 1PZUB 1YC8A 1KBGL 5LAXB 4Y1AD 5MERA 1CLYH 1ODAA 3L3DA 4NP4H 5TE7L 4AM0A 2A77L 3NA4A 1NBZA 3CX5K 3KPQA 4NQCA 2VDPL 5DLML 4PRHE 1S7TA 4BH7B 2OMBA 35C8L 1XF2A 3FO0H 4B7LA 9CGTA 3UEZA 4NO5B 4FNLH 4ELKA 4MJ4A 1AD9B 2LTQB 1KB9K 3B3IB 3WJLC 4PJIA 3WDHA 1QR1B 5TQ0L 1QPXA 3BE1L 2MKLC 3C60A 4H26B 3SCMA 3JWOH 3GIVB 4Y4HC 1O5DT 4O00A 1FL5B 2EDFA 3O9WC 3WFHB 1KIRA 1RMFH 3QEQE 3QCTL 2DQHL 3D0VB 1YEGH 1F3JA 4U1LA 1KLUA 4YXHH 2OXGA 5C71A 3OKOB 3CFEA 5JW5B 5DMIH 4JKPH 3P11H 1T1WA 4NQDB 5IF0B 5BXFA 4GBXC 1PD6A 4M5ZL 2IH3A 1UM5H 5DHYA 1UC6A 3V6OC 1A7NH 1CD1A 4JPVL 4OLEA 4MB4A 4YHPA 2WW8A 2BNQE 1MRFL 3KPLB 3V8CA 4AENB 4KY1L 4EI6B 4LP5A 4HUNB 2H6PB 4JE4B 1DBBH 1D5XB 4XBEL 4X4XB 3LS4H 2OI9C 5D70L 2HT4D 5FCUL 1BPVA 4O2EA 4HK3J 2P7TB 1T7VA 4OQTH 1WCBB 2F9BT 2YWYA 1BZQK 3ZKMC 3MUGB 4PLJD 3HC4H 1N4XL 4LLMA 3GUTA 3QIBA 3U7WL 1T0MB 2NXZD 4TUKL 1DZBA 3ZDYF 2X4OA 3MLSL 4NHUB 2E8YA 4PRIB 3KPTA 1U8OB 1BQHA 3OKEA 2P1YA 4HPYL 1YEDB 3SDAD 1CG9A 2HT3C 3I6GB 5CGMA 1A14L 1PZ5A 2FX9H 5BZDB 1RUPL 3GMQB 4LOUD 4KAQH 5GZNC 4HWBL 3HI1B 4EI5A 4OTXH 4LPVA 4HIIA 3N0PB 5T1LA 2P24B 1LEGB 4IOIB 4ZNEE 3AS0A 5D7LB 2ICWA 3RDTA 4FTVA 1X5YA 4N1EA 4BSWA 2R56H 4XWGH 3UJTH 1BBJA 1JNNL 3UTZA 3L6FA 1BX2B 3PQYD 5E8DH 5EUOF 5ACLA 1U8NA 3WN5C 1CFSB 1A1OB 3NTCL 4GOSA 3ZYZA 1Z6JT 4G5ZH 1LP9A 3QUXB 4OCXL 3QEHA 1OQXA 5CEYB 2HVJA 4HWEH 3F7VA 4JFEE 4PJ5B 5AYUL 4UUJA 3GMPB 4UT6H 2YPLB 1QFWL 1UB5A 3ARZA 4LDOB 4YQXL 3EDEA 3QH3B 5CLWA 3WIHA 2VLJE 1DBMH 4HH9B 5BRZA 3UJJL 4GKZB 4PJFA 5DQ9A 4MSWA 4NT6B 4X4YA 2G5BB 5H35A 4U0RB 2FBJH 4XNMB 2XYCA 3QYCA 2ED9A 5I8CA 1GGBL 2HA1A 3IFPB 5D5MA 1U3HD 3PF2A 4AMKL 3QI9B 5F44A 5F1NB 3TCLA 5GS0C 1NCCL 3OKMA 1MCKA 1EA9C 3TO2A 1FGVL 3QHZL 2ZCLL 1A8JH 1ED3B 5D71L 3J8F7 3TH4T 3X12A 1AQDB 2AJUH 3GHBH 3KPRD 4CN6A 5GS2D 1FYTD 1BIIA 2VJXA 3MLYH 3QQ4A 3TBTA 4NKQB 4BUHA 1EGJA 5MI0B 1C5BH 3VWJD 5TDOB 2VZOA 3C60C 4OBSA 4XWOD 4L3ED 3SCMC 3FFDB 1BJ1J 5KS9A 4X5WB 1N6QL 3HHRB 5SV4A 2OJZL 5EUKB 1U8IB 3G5XA 4K8RD 1ADQH 5GRYA 3PE9A 4ZMAT 1MVFA 5E9DE 1TZHA 1K4CA 4F57H 4Z78B 4OFPA 1MRCH 1YNLL 3KPSB 5SWZD 3MTRA 1S9VA 4J3OC 4YHLH 3EYUL 3QUZD 4GMTL 2WAHA 5I66A 4HGKC 4IRZH 4X7DC 1X44A 4QWWD 1D6VL 1Q9KB 5K9OA 1RHHB 4JFOA 4YHNB 5I0DA 4XVTL 1DN2A 5IKCA 5IB4A 3WLWD 3F7PC 1ZGLP 3MGTA 1RV6X 3FTGA 5ID0A 5EPMA 5ACZB 4OZGF 5HGAA 2PW1B 1JNHA 3QQ9D 1EFQA 3ZE0E 1U58A 4K94H 2HKFH 5B3NA 3X3FL 4K3HA 5I75B 2BSED 2HN7B 1D5MA 4JN2A 4YHIA 3QRFM 3NPZB 3QIBC 4LHUG 5E95B 1SYVB 2IADA 5I71C 4ONGL 4WO4D 1V7NH 3GSQA 1W2KT 1R24A 4W6XB 3GO1H 5ESQA 1HWHB 1UA6L 4Q9RL 5KTEH 1MVUA 4Z7UB 2VZTA 5C0CB 4DGVH 4HK0A 1AE6H 1KCRL 2HRLA 2UYLB 4UDUA 5D8JL 4WNQB 5HHME 1QSED 3N50A 3WO4C 3MLUL 3KHQA 1H3TA 4EI5C 3O2VL 4P2QB 5IFJB 5DD3L 3MRQA 5A16B 2P45B 4UNTA 1F97A 4GAYA 3GBNH 3B2VH 4WFED 4R0LB 4RNRB 3ZDXF 3RDTC 3VW3H 1U41A 3D0LB 3QAZB 3QQ3B 3O2WH 1DFBL 5FGCB 4QKXB 3IVKA 3V7MA 1I7UB 5GJTL 4KTEH 4X4ME 4XPAL 1MRDL 3IFNH 4O58H 1QYGH 3QJFB 5HYSA 4NKDB 3MV8B 4MJ5B 4YDLB 1CFQB 2EXYD 3MRIB 5EOCJ 3IGAB 3N85H 3O3EA 4K8RL 4NHCH 1XR9A 2BVPB 3DGGA 2DWEA 4HF5L 2OX5A 1EHLL 1A4KB 5E56A 3TVMA 2VUOA 5C0BE 5J6GA 4HS3B 1DQTA 5JW4R 2DI9A 1FJ1B 2BFVH 2V5RA 1NJ9A 5SWQB 3RWJB 3RTQB 4OZFB 4X5LA 5I15H 1HOCA 1YEFL 3EOTH 2CSPA 4OJFH 1YUHA 1VADB 4EXPX 5C09D 2YK1L 4MCYA 4Z8FL 4LEXH 4PLKC 3GSWB 4I0CC 5CJXA 4ZOEA 5E6ZA 3UO1H 1G7QA 1HXMB 1REIA 3KPNB 4AEHH 2VAAA 4HJJH 1QG3A 1BFTA 4K2UH 1CBVL 1QRNA 3BPNB 3L3OA 3DMMC 2SEBB 4MXVF 4B7IA 3VWKD 5I1LA 2DQCL 1AHWA 1TLKA 1E28A 3VFTB 4FP8L 3SBWC 1OPGH 2AK1L 1MWAL 1QEWA 2F5AL 1HDMA 4CGTA 5EZIL 5I8KH 3MZTA 3SDYH 4NIKB 2X89A 1CR9L 4XMPH 4DCQA 2JCCE 4Z7VB 4LP4A 1BHGA 5DC9B 4ZS6C 2DN7A 2V2WA 2C3VA 4OLWL 2ZJSL 5FGSA 2XPGB 1LNUA 7FABH 3HFMH 3LRSA 5CWSA 4NCC1 3CAFA 1FORH 1Q72L 4MX7A 4BH8A 4OLYH 3GFUA 1JF1A 3S98A 2VSCA 5DMKA 5IK3B 2ZNWA 2MPAL 2H9GB 5I1AB 3IF1B 3CDGB 4UOJA 3KWWB 1RI8A 2QKIA 3KPMA 1D7FA 5CUSH 4X6CE 4F58L 3HI6H 5CINH 4PRHB 1C5DA 1TETH 2EKJA 1EJOL 2VC2L 4I18B 5IHUH 5IIEB 1HH9B 4LLYB 1QTYT 2IH1A 4OCRL 4MMXC 4QY8B 3CXDL 4M48H 4D9LL 3DHMA 5GGRA 5I76A 3VFSA 3FJTA 2WBJB 3VFWB 2B8OT 4UOW0 4XHJC 5DJ2B 4CJ1A 1D6EA 3EGSB 1L0XA 1DLFH 3BKML 3DYOA 3L3KB 4FFVD 3QNYB 4M43L 2VR4A 4C4KT 3SDXA 4WRLA 4X9BA 3VGDA 3NMEA 5ITFA 4MHHG 2Y36H 1MEXH 2VLRB 4KQ3H 1FVDB 3QEQB 4G9FE 5E8NB 1IVLA 4TUJB 2CJUH 5L9DL 5DO2C 1VPOL 3X11A 3QG7L 3RVTD 5I17A 3SDCB 4UT7L 3W9DB 4QHLB 1AXTH 5D9SB 3T4AB 1MCLA 2R0ZH 3Q6FB 2Z8VC 3UZQA 3MNWB 5DHVH 2HFGH 4IMLB 5MP6H 4GAGH 1BJMA 4JZJA 3CFKB 4R8WL 5DJDB 5D2LF 3G08A 4D9QD 2UWEA 2BNQB 3LIZH 3FZUD 5C07D 1T1XB 3MBXL 3IJSA 1UEMA 3P77B 3QWQB 1NEZG 5HY9B 3FKUS 2J2ZA 2NY1D 5K33A 5KANG 1IQDB 2V6HA 4OI7A 3DX6B 4U7KA 4JANB 3Q1SH 4KVCL 2Y23A 5FO8A 1A22B 1QLFB 4KMTH 2DTMH 2QJDA 4O02H 5LQBH 4L4VA 4R2GC 3D69A 1LE5A 1X5ZA 4LF3A 3JTTA 1LK2A 2ENSA 4PP1D 5E2WH 2F54D 1A6VL 5E8EA 1GC1H 1IFHH 1IQWL 2F74B 3IXAB 3DIFB 1I1YB 2CKBL 1S7SA 5FYLH 2NX5D 2HFFB 1MJ8L 3BKCL 4P49A 3MXWL 1DQLL 5JTWA 4P4KA 5CJXC 4QNPE 4J23A 4XBGB 2V9TA 3DUUB 4JY4B 5I16B 5HYQB 3BD5A 1T0NB 4RAUB 4RBPK 4M7KH 4LHUB 43CAB 1FFPA 1N26A 2XWBA 4JDTL 1YY8A 3U1SH 3V4UL 32C2A 4M61B 2WIIB 2NY2D 5AUMA 1WAAA 5HGHA 4YO0A 2J8OA 4ZNCD 1XIWA 4G43B 3IKCA 3U36B 1WWBX 4U1KB 2B0SL 1R3JA 3HUJF 4CVXA 2HG5A 2VQUA 1TJHL 2V7HA 3OJ2C 4PS4H 3GK8L 2ZG3A 4ZFZB 4AH2A 4CMMB 3DROA 3QISA 4ZYKA 1HINL 3BHBB 1W0VB 1KENL 1JZ4A 2F53D 3HMXH 2BDNL 5T1DH 4M3JA 4KDVA 2EDNA 2FJHA 5HHVL 3AB0B 3BJLA 4HGWB 5BMFH 3HC0A 3MRRA 4Y1AA 5M7QA 1RZKC 3VFNB 1KFAL 5F70A 5ADOH 5J1AA 2VLJB 4RWHA 1OAYL 5KVEL 1QFUL 1ZA6A 4LMQI 4HWBA 1H0DA 2FZ3B 2YD8A 3EJYD 1GAFL 4Y4FB 1RQ5A 1JN6A 4QYOB 2GITA 4WWID 3JXAA 3V6BR 1OF2B 2UV3A 1ZT1B 3QUKA 4XTRC 4O5LH 2WUCH 1T3FA 1KB5L 5JO5A 1OSZA 2Z8WC 3FFCE 5C6TL 1IAIL 4LGRB 1GGTA 3L5WB 5HHQB 5JPMA 4CRPA 2XRAL 4WW2B 1T1YB 1PBYA 4Y19E 2R23A 5IESH 1JGDA 4NRZA 2AJVH 4TRPL 3QXDB 2YEZB 3OGOE 1YQVH 3VXNB 3E2HB 2WWKO 3FOMB 1OTTD 3C6SB 2DWDB 2EIEA 4IEFB 1MCPL 3OV6A 1I9RH 3EYFB 3HNTH 3T0EE 5HJ3B 2ZUTA 1K8IA 1R3HB 3RWIB 1LEKB 4CL7A 4JAMB 5E9DB 4OGXL 2VXQH 3T4YB 3WS3B 2YR3A 3F7QA 3V4VL 4U6XA 4N0YH 5E8OA 4FQCL 1D5BA 1SM3H 4NQDD 2OXHA 1JWSB 4M6NH 1JPST 2A6IA 3WXVL 4PJ9B 1U3YA 1KCUH 3OJMB 3T0DA 5HHNB 4LPTA 3R8QA 1FGNH 5ESAA 5C8JA 1A7PH 4L3CB 3EOBA 4JN1H 1MCOH 2DYPB 3MNZB 4FXKA 2BY0A 1U8KA 1YYMH 5JUEL 2MTPA 3RI5K 3HE7B 4RZCA 5DJZB 1MFDH 5AWNH 2QTEA 1ITCA 1I3VA 3SDAA 2ESVE 4UZGA 3CDCA 2NXYC 3GMNA 2CK0H 4OT1H 2X4TB 3L5JA 4MJ2A 2XICA 3HPLB 3MLZL 15C8L 3V2AR 3HB3C 4XNUL 1G7JB 3MGOB 4MQ7A 4PRID 4V2BA 3RI5F 1FIGL 1CD9B 3UYRL 3ZT7A 1KC5L 3HE6A 3M8OH 2CDGB 3CZFB 4G8FA 4LGSB 2W92A 1T21A 3ELAT 1ACZA 3OXSB 3RNKA 1HHIB 3FN0L 1UZ6F 5HHMB 3PWVB 2BVOB 2H26A 1MCJA 3UPRA 3PQYA 5CBAA 3DVNB 3L3JA 4P4KC 4HZLA 5BV7H 1F3DJ 2FBOJ 1Q0YH 1KCVH 2QHRL 3TYGL 2ZCKH 3VXOA 4PV9A 5GGTL 5D7IE 2FEEI 3ZTJG 1LDSA 1NC4A 3DTXA 3EJZC 2FWOA 5D7LD 3IRPX 3B5HA 1KUMA 4PJDF 2ADIB 1R6VA 3CVHH 3RWCB 3VXQA 3ZKQD 4UINH 4JY6B 4DOHE 1IGCH 3ISWA 1WLHA 3S88L 4PG9A 3G04B 3QUXD 3KYNB 4TQEH 2AXJA 4S0TD 3ZT6A 3E8UL 4U1JA 1PYWA 4MD5B 1W8OA 4OD1H 4LSRL 4XP6H 5CSBA 3QEGL 2DJSA 2YPLD 4QCIA 2JF1A 2QQLH 5C0BB 4R97C 1L0QA 2PYFA 4FFYH 5DT1L 1U3HA 3E6HB 1P53A 1WK0A 1NEZB 5K9QI 3L1OH 2W9DL 4O4YH 1IGJA 4NZRL 5EO0B 4K7FB 5F9DC 1RIHH 4S1SH 5KSBE 5EC2B 1TVHA 3IDXL 3X13A 1K8DA 1P4LB 2MWCA 2WZPD 1LK3H 1R5WB 3KPRA 3KLHD 3MBEB 1VSCA 1FYTA 4U6VL 4PGBA 1G7MB 2GUOB 3P40A 3QI9D 1AGBA 3DOSA 4NJAH 3VWJA 5IB5B 4IOFD 2EDWA 4L3EA 1NSNH 4O51A 1I4FB 1DQDH 2VDOL 1LO2H 3TN0B 4I77L 5EFIB 3NA9H 1GGYA 4PJCE 4Q2ZA 5E00B 1BFOB 3GKWL 3G6DH 2R4RH 4P5MB 2OZ4H 4HKZA 3OHXA 5SWZA 5MEQA 3VXMD 1BIHA 4KTDL 2CRYA 5IBUG 4R4BA 3QUZA 2P8MA 1PG7L 1RUMH 3BGFB 3VJ6B 5E2JA 5DWUL 5I1DA 1I9JL 4ZUUA 4MS8D 4ODSL 1EZVY 3F6LA 4WHYG 4Z6AT 4RDQG 1CDIA 1DE4A 5HYEA 2CD0A 2G5RA 4A2LA 2JCCB 3KPSD 3V6ZB 3IXTA 3SGDI 4X6EB 4FXGB 3TNMB 1DBJH 4ODVL 2VE6A 3G5ZB 4CVUA 4M7JL 1S7VA 2X70A 4XZUB 3VRLE 1LP9F 5DK2B 3TA3C 1T4KB 3ALWA 5J8OA 1F4YH 2XNAA 3A67H 3T1FA 1E4WL 2VITA 4HEPG 5JOPE 1MFAL 3FQRB 2FLRT 2HT4C 2AI0H 3MO1B 4BSJA 4LLWA 2C1OA 4K3EH 4Z0XA 1S9YA 1HIML 1X6LA 4PLJC 4Y5XA 3RU8L 4X6CB 1M4KA 2NXZC 2Z4QA 3BEVB 2L4OA 5L6YL 4WO4A 1MWAA 1AXSA 5KZCB 2DQTH 4WEMB 3SDAC 4KKNA 4PJFF 2BSSB 4NSKB 1FO0B 3ILPB 4G80A 5DS8B 3BZ4B 1IL1A 5KJRL 4LPWA 4WU7A 4LOUC 5D5MF 3VFVB 2EDLA 4LSSH 2QQNH 4KJWD 5DA0B 4MMZC 4N8VG 4DVBB 3HCVA 3ULSA 3REWA 4G9FB 5C0CD 1NGWA 3KDMB 3FHAA 2A9ML 3MRJB 2ICWI 4NN6B 2K9UA 3RY6A 3IDJB 1L7IL 4P2QD 3U46A 1M71A 4DK3A 5EULV 4LSVH 5HYFA 3AS1A 1MI5E 5I1EH 4R7DA 2EYTA 3JV4A 4UV7L 1CFTB 1J87A 1TCRA 3BO8A 3QUMA 4WFGD 3WSQH 1F2XK 1CT8B 2LQRA 5T3XE 5KS9F 2BCKB 2WWMD 5F7KC 2AGJL 5FHBH 4S1RH 3JTSB 3ARWA 4XCEA 2XKNB 2R69H 3MV8D 2AKRA 4JZNA 1KIPA 2YPKB 5IB3B 2XKSA 3C2AL 1U8MB 4F7CA 3AS3A 4MWFA 1FVEB 3QFDB 1SJXA 5B39G 1T7YA 4EBQL 4OGYL 2JE8A 5C09A 5GRUL 1A2YB 4CU8A 5DJYA 2YSSB 1GGIL 5CIPB 1TIUA 1U3HC 5GGQL 1MJ7L 4I4WA 5IVXF 1DL7H 3VGGA 3BDXA 4M6AA 3MSPA 3SE3A 2W38A 4F33A 1G9ML 3SE8H 3O8XB 3REVB 3VWKA 1KTRL 4NNYB 1CIDA 3WIIL 4OIBA 1FPTH 1FZMA 2Q3AA 1KEGH 2RCSH 4HKXB 4IS6B 4M93C 4NQSA 2E9IA 3PWUA 4OB5H 4NKMB 2O5YL 4HAFA 5EOTA 4TUOA 5EA0L 2LE9A 3LRGA 1WBXB 4QEGA 3VWJC 1UH3A 1P4IL 4XWOC 3RUGE 2F8OA 4DUWA 3H9SE 2CKNA 1VFUA 4K8RC 2R29H 2A6JB 3BKJL 5DUPH 1T7WA 4ODTL 1Q9OA 1FLTX 4AY0A 4Q97A 3EO0B 1NLDL 1Q9WB 4JFPA 3NPSB 2I5YL 3QUZC 5CD3A 5BO1L 2Q3ZA 3ESUF 3QDJE 1YMHA 4QWWC 3ZLQC 5L2KE 3HC3H 1KACB 1K2DB 2CKBA 3MGAA 4DGYL 4ZPVA 4UTAL 5IEKB 4KXZI 1SBSL 4ONOA 4KZDL 3WLWC 3HRZA 4X0KB 1TZIB 4Q58C 4TVPD 1RFDH 3RY5A 1RZ8B 3D18B 4IHOA 4XCYB 4JFZH 5GS2H 1E4XH 4NO3A 2EDOA 5FECB 4WCYL 3KXFE 2PYEE 5L8JB 3O2DH 1BZ9B 4NJ9L 4GG8A 1GOFA 4Y5XC 4Z7NF 4LSUH 3H0TB 3K2MC 5TE4L 4PRHD 3FFCB 5DJ6B 1DQJA 3I6KB 2NY5H 1JK8A 3UTQA 4E0RB 4D3CH 4R26H 4Y19B 5C2UB 4TSBL 4TULH 3WDIA 4J1UB 1UH2A 3AXLB 3WD5H 5KSVB 4C55A 3RZCB 2WBJD 1H15B 1YEEH 3NZ8B 5F7DA 1N6VA 4IDJH 1ZHKA 1DJSA 1ROWA 2AVGA 1V8HA 3NABH 3O6FD 2E7CA 2MQCA 5DJXA 1A6TA 5GGVL 5GISH 2Y5TB 4OLVL 3QEQD 5E2VH 4JFQB 4F9PC 1S8DB 3I75A 3S9DB 3GJFA 4OD3L 5FO7B 3S3SA 1NMBH 3O0RL 3SDCD 4ERSL 5C07A 1A9EB 3GSUB 4RMVA 5JDJA 3NCEB 4YJZL 4TNVK 3ZTNH 4DEPB 1PG7W 1A5FL 5CHNA 2ZPKH 1U93B 2D4FA 2YD7A 2YRZA 3MUJA 2HVKB 1JI1A 2KBGA 4JRXE 5ALBL 1KB5A 3JV6A 5I18L 2EXYC 1E6JL 5IBUB 2AJSL 2H32A 4XCNB 3K4AA 3T0BA 1TENA 2X4RA 5FK9B 1CLZH 2BNQD 5T1KB 5I1IH 4HLZH 2H8PA 4R4NC 5C1MB 4FABH 4X6DA 1FN4A 5I1KL 4NYLB 3FRUA 1P1ZB 3OB0H 4TNVF 1ZV5A 1A0QH 3VG0L 4GXUM 4LCIH 3O4LE 3SKJH 1BFVL 4RFNC 1EEYB 2F54A 3U4AA 3ULVE 2X1OA 1N7MH 1J9CT 2EH7H 2ESVB 3DXAE 4ZSOE 5L0QB 4MD4A 2FHCA 4HWZA 2NX5A 4MNHA 3ECBB 1B0WA 4PY8I 5C0IA 1OP9A 1AP2B 1UQSB 4QXGL 2C1PB 2B4CC 4TVPL 3SE3C 5H37H 5CGTA 3B9VA 1BAFH 4NFDA 1AIFB 5HPMB 3V79C 3FHQA 5MEPA 1MCEA 1KGCE 3UPCA 3VWKC 4U3HA 3CXHK 1SVZA 5CZXD 1F6LL 3HS0B 5DVOA 3MOQA 3EFFB 1HZHL 1P6FA 2CLVA 4HS6A 2ITCA 5DJAB 5F9JB 3VRIB 4Z9KB 2Y25A 4D0DA 3IYLW 3QUMH 4LHUD 5D7IB 1XGTA 1JZ8A 4U1MB 4PRAB 4KGJA 3BP4A 4OCWH 3OKNA 4I3GA 4F7PB 1JPTH 2E8ZA 2F53A 1ETZA 5DXWA 2DBLL 5KSUB 1NMCC 3RP1A 1K6QH 3FB5A 4I3RL 1NKRA 4OM0H 4ZOBA 1RUQL 4UB0L 5ICZB 1C12A 3S35L 3L3IA 5B3JF 3PGFH 2VZ1A 1WTGT 2CDEB 1YA5A 4GQ9L 4GLRI 1A6UL 1WBYB 4L5FH 2AEQH 4Q9CA 4P46B 3U0TA 5T3ZL 5LAXA 4YX2H 4RGOL 1DUZA 2VLJD 4K7PL 4UV4L 2B4CH 1A47A 1LO4H 4JREB 1B0GA 3X3GL 1CQYA 4Y4FD 4G7VL 4NWTH 3QA3B 5GGTA 3B6SB 4JHAL 1NANH 5CBEB 5KSBB 4NO5A 1OP5K 2BNUB 1J11A 2K7QA 3SGKA 4HBCL 4K3JH 5B39B 1AD9A 5F96L 3B3IA 2VXUL 4UIKL 1QR1A 2YC1B 4N5ED 1MH5B 4H26A 4P2CG 3GIVA 1V3KA 4FOMA 3RY4A 3FT4B 2R0KL 1RURH 1FL5A 4FQLL 4PJCB 1KN2H 3WFHA 1P69B 1TQCB 2HFEB 3TFKD 5DSCB 3QPQD 4PJIE 3KLAB 1XGQB 4ELME 1KULA 5JORB 3MNVB 1QLEL 4RMWA 2C7UA 2R1XA 3WFBL 4NQDA 4I0PB 5IF0A 5FA3B 4HH8A 3C5SB 3BH8B 3VCLB 4K07A 5LCVH 2FD6L 4HJGB 5E9DD 4PGCB 2WK2A 2IMNA 4AEIL 4OZIB 3FZUC 3PXHA 3KPLA 1WAAF 4LCWE 2VL5B 4HMDA 5LG1A 1LE9B 4ODBD 1UWXK 1T89A 2NY1C 1ZKAA 4AENA 2X4NB 2Q6WA 1OAUH 4EI6A 2L7UA 3WIFB 1FNGB 1OAQH 2H6PA 2IPUG 3O6LL 5GS1A 4CDGC 1D5XA 4TN9A 4JQVA 4YBLC 5IW6A 2APWA 3HNVL 2ED8A 2PXYB 4XPBL 5FF6A 4LDLB 3QHTC 2DYPD 3TCXA 3TYFB 4J3VA 1QZ1A 3MUGA 2XV6B 1EO8L 1RZFL 4K3GA 1T0MA 5ILTH 7CGTA 3HE7D 4NHUA 1M7DB 4PRIA 4PP1C 1A7BA 5LWYL 1S9WB 2GT9B 3AMLA 5TE6L 1YEDA 1GZPB 4EQ2A 3VI4E 4X7SH 4YDKH 4P3CL 3RGHA 5DHXB 5EU4B 3SGEI 1CDUA 2HJFB 4XGZB 2R0WH 3GMQA 1OTSD 3HI1A 3TC9A 5IB2B 2ATPB 5BQ7A 3K8MA 3T3ME 5C0JB 2P24A 4IOIA 4OAWB 5D6DA 5D7LA 2VWEE 5HHMD 2FNBA