3O8XC

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xC02
4Y8DC 1QRNA 2MWCA 3I84A 3EFDL 2FYYA 4EN3A 3B8SA 1LE5A 4KJPC 2DMBA 1L7TL 4K2UH 5DK3A 4HWEH 1ADQA 4YZFF 1HK6A 1QQDA 3PG2A 3QPQD 4OZHB 3MV11 2HT3C 4GAGL 3RWFA 1AD0A 1ZVHA 2GY7B 5ESAA 1RURL 4X4XA 1CFTB 2HJLB 1P2CB 3QFJD 4F8QA 2DJSA 1SHMA 4FQCL 1UYWH 4HIEB 3LKSB 2X4SA 1A9EB 3IFNL 1T5WB 4YE4H 5J8OA 3QSKB 1T66C 3O8XA 2AABH 1E27A 5C09D 1U8NB 5I0ZA 2NY7H 4JREB 5GGQL 1T1ZB 2W0PA 3QCTL 3SDYL 2AQ3A 1IL1A 2CO7B 4NKDA 3WEXA 2FO4B 2EDDA 5TQ0L 2DKMA 4PJ5A 2OK0H 3HMWL 4CKVX 2FLRT 4K8RD 4P23D 2YA1A 4OCLC 1HIMH 3DLQR 3ZTNL 3FMGH 1AR2A 3AROA 2CGRH 4O9HH 3OKMA 3CLFL 1MF2L 2YBRA 3HMXH 3ZO0A 1GHFH 1BVLB 1CD9B 1FE8H 3DROB 4PJ9C 1EEZB 3DHMA 4KUCD 3ULUL 3H7BA 2X5PA 1CE1H 4NZRH 4Y1AA 3VI3E 3DSFH 4JRXB 4UILL 4DN4H 5CKGA 2BOCA 3K2UL 4IRJC 3S35X 5BS0E 4PTTA 1IM9B 3QUYC 4GQ9L 1P4IH 3T0EE 2OTWB 5GS1B 3L95A 3QDGD 1FNFA 1IGJA 1JUFA 4OAWB 1Q9OA 2VDOH 3U0WH 4M48L 4YDKL 3LS5H 5CZXD 4EI5D 5D7JA 5GHWL 2ZOLA 1ZANH 5J0BA 3VRLE 2GJZB 1MI5B 5B39B 2CR6A 2NZ9C 4EUPB 1ZTXH 3MGOB 4KKLC 1NGZB 2VIRB 3A6CL 3GSNH 2DQUH 3VGBA 1MUJA 2HVKA 1JPTH 4OF7A 1EFXB 5HPOA 5L0QC 1BQLH 3CLEH 3EZ8A 5HI3C 5CAYB 2JB5H 5FDWA 5LCVH 4UT7H 1YNLL 4OD1H 2AJZB 1MRFH 2Z4QB 5HVFB 1M71B 1QOKA 2DRUA 1TJGH 3FQWB 4ZO6A 1UG9A 4Z7NF 3BP5B 3U0PA 5AYQA 5IEHB 5SWQB 3HC3H 5E9DE 5BZDA 2VDRL 4WO4B 2VDNH 3O6FB 3P9WB 1JYWA 3QO0A 3IDMA 3HE6C 3NN8B 2VJXA 4G9FB 1F4XH 1OL0A 4P46B 3FO1A 3NIGE 3QZWB 1URLA 4G6JL 5HYEA 4RISL 4J3SA 5LXGH 2NY4C 4EVNA 3CXHJ 3EOBA 4J4PD 4XAKE 5T3ZD 1I7TB 1DVFC 1TETL 3Q0HA 1OB1B 3O81A 3K46A 4NNYA 4OTXL 3MBEB 3QNZA 3HG1D 1U95A 3FFDB 3BGFC 1HQ4A 1TNMA 5FGBA 1KB9K 3KVQA 1BD2B 4W4OA 1X6NA 1I8KA 4PRNA 3KYMB 1KTRL 4JJ5B 3KLAB 3KPRD 4P3CL 2BOBA 2AK4E 2X44D 1T2QH 5IFAH 1PYWA 3GHEL 2VAJA 2IQAB 5DHVH 1VGEH 4ELKB 2HTLC 5IB1A 5ALCH 4HUWB 4X80L 3RDTB 4CVWA 5IESL 3UAJC 3RJDA 4XMLH 3DIFB 5HDOA 5ALBH 5A43C 5GJSL 5ETUA 3PP4L 1FNEA 5F9WC 4AIOA 5FHAH 2EDTA 3WKNA 2YZ1A 3DO7B 1MWAB 2BFVL 2Q76A 3T3PE 3MA9H 4M1GL 3NFSL 4HWNA 4LLWA 4Y0GA 2H3NB 2XQYG 4OM0L 4UTBH 5IB3B 1GGBL 2EH8H 3TP4A 1QSVA 1XF3A 2CH8A 1G7JA 4AZ8A 2EDJA 3KR3H 4F33A 3JV6A 1NGWB 4P5TB 4UOW1 1UH3A 1XF1A 1GGYA 5IT2H 1ZSDA 4U3HA 1V3LA 1BOGB 4NJAH 3O3DA 3VGAB 4JQIH 5C0IB 1YMMA 3W9EB 3ZTJG 1KLUB 2E7LA 3V9FA 3ROLB 4BH7B 5J13B 1CBVL 4FNLH 3ARZA 3N1QC 4K7PH 1N6QL 1LK3L 3F7YB 5EU4A 3UO1H 4J3VA 5KVFH 3M1BA 4WI5A 4ORGB 4XB7A 2Z8SA 4JM2C 3IDYC 4HG4K 2BDNH 3IF1B 3IJYB 4YDLC 2GFBB 1KLGA 1EV2E 4GJTB 1P5UA 4YFEA 4P59H 5E94B 5GGRA 3P40A 3MNVB 1J0KA 1RD6A 1RVFL 2FJHB 1RIHL 5FCUH 4X6FA 3RWGA 5C7XL 4CVZA 5EZLA 4WW1A 4RFEB 2CUIA 3TWCH 3VJ6B 1S7XB 5MI0B 1D5MB 3QJHA 1FL6B 4DKEH 4LSPL 5IQ7L 1R6VA 4DGYL 3DNKA 3B2UD 5T33L 2NXYB 3KPSD 3D9AH 5DK2B 1BFSA 4KTDL 3NFPA 2ERJC 3L3KB 4ONFL 1DN0B 4OFYA 4UINH 4YHKL 2W9DH 3ZE0E 2V5YA 5TH2B 3GHBL 4CNIA 3L9RB 2AJSL 1EMTL 1ED3B 4U49A 4M5ZH 4JZOB 4R4FH 4YQXL 1QKZH 1J0IA 2OJEB 3DJ9A 1GC1H 3T2PA 4F58H 4Y4FC 2Q6WB 2E27H 1OLLA 3O0RH 3U0TA 5JPMB 1KPVA 2R2EA 1I7ZA 3VG9C 4LSRH 2DLGA 1IAIH 1X4YA 1XGUB 3T09A 4ZFFB 4FTVA 1H8OA 1UB5A 4XVTL 5KW9H 2HT4C 4ONHA 1AHWB 2R9HC 3BPLB 5LAXB 3AM8A 4X4YA 3TIDB 5C0RH 4OCWH 5CINH 4PJFF 3ARBB 1NGPH 3QQNA 4EIGB 3IDIB 3GMLB 2WWKT 1QHPA 1NGYA 4QRQB 5IB2A 4EUPH 2XTJD 1Y18A 3CDYA 3TN0A 1A6VH 4NOBA 3KPNA 3LN9A 4JQXA 5DJ2B 4XP6L 1AJ7L 4W6XB 1RZJH 2ED9A 2KPNA 3DYOA 3HAEA 1J1PH 1SJEA 2UY6A 2FJGA 3K80A 5A2LH 2R69L 2WQ8A 4RGOL 1R24B 2R1WB 1TJIH 2VXTH 1YN7A 5D1QD 5CBAB 4JY6B 5E5UB 3UDWC 4JKMA 4KHXH 5I1KL 4K3HA 4QTIH 4JLRA 4PJ7B 2X4QA 2P7TB 3EOAA 3MR9B 5ICXB 4K2UL 3RWHB 2IAMB 4Y4KD 5JDJA 2Y25A 1YNKH 3SDDB 1HDMB 3LKNA 1QSEE 1T7ZA 4JGMA 4YIQA 1KT2A 3VFOA 4XNZC 2YC1B 4HXBH 3P77A 3PIQA 3WNMA 5J9PA 4P5KA 1RHFA 2FX8H 4NCDA 4NWTH 1WBZB 1S7RB 3GIVA 1UYWL 2UZXB 5CGYD 5T3XL 3Q6GL 5DSCA 4JG1H 2ZSVB 4HMEA 2W92A 4PRIE 2OS7A 3NPSC 3EKCA 2NY7L 4TNVK 4NUJA 2OMNA 5HGBA 1KN2H 1JK8B 4KQ3H 3KPLA 4L4VD 4V1DE 3VFTA 1NQBA 1JPSL 3W39A 1RZ8A 2OK0L 5EIQA 3MV7D 3LQAL 2EDNA 1QBBA 1YEHH 5FUCC 2Z91B 5BW7A 1KTKE 3GBMH 1U0QA 2D7TH 5EBLA 5C0BD 3HMXL 1JV5A 3H3PL 3GMQB 5IIEB 2KZ1B 5I15L 4NC0B 4PJIA 4HQQH 2JCCA 4MNGE 2NY5L 5C09A 2GHWB 3DSFL 4N0UB 1AD9A 4DN4L 1OGTB 3ARPA 3PWUA 4Q9QL 1P4IL 3BPCA 4L4TA 4NKIL 4OCNC 4Q7DA 5J12C 5HHMB 1YEDB 3IDXL 1G1CA 5GQBA 4PR5A 3U0WL 3LQZB 5JXAH 4M5YL 3LV3B 2Z31C 1G6RA 2QTEA 1ZANL 2FH8A 1IEHA 2CO6B 3IGAB 1ZGLA 3UYPA 1ZTXL 3UTSD 3S9DB 4PLOB 5T1DH 1OQOA 32C2A 1T7WA 3GSNL 3CDCA 3FOLA 4HFWB 2DQUL 3WS3B 4IRJB 5KBNC 1AQDB 3KYAA 3QUYB 4M6MH 1RZKH 1BQLL 3MBXH 3U4EB 4P2RE 5CILL 2JB5L 1FVDB 3B9EA 4ZUTB 4UT7L 1FQ9C 3CX5K 4MJ5B 4OD1L 2AXJA 1MRFL 3RVTC 4U2YA 4LSVH 4X7TB 2FBJH 4U1LA 1QG3A 4K3GA 4BQ8A 5MEOB 3DV6B 1PQZB 2MJWA 3ARUA 5EC1A 1FG9C 2OYPA 5KVEH 2QSVA 5C0NC 5L0QB 2YD5A 4U7SA 5JHDE 4CVXB 4ETYA 4S1QH 1BLNB 1F4XL 1ACZA 1I3UA 2DBLH 4HC1H 1IC7L 2GK2A 5L6YH 5HHOE 3TT3H 5JA9A 1HSBB 3GM0A 1UEMA 3GK8L 2GCYB 4LCIH 5DO2D 4U1IB 3HE6B 1MREH 4XGZA 3IXTB 2Y23A 3P4OA 3TV3L 3PJSB 1YEEH 3C5JA 2J5LC 1IFHL 1C08B 5IFAL 3JUZA 4PB0H 1R5WB 2F54E 2NY4B 5ACZB 1KCUH 4TPRH 2AJVH 2EDWA 1DVFB 5K9KB 1YYMH 2VRAA 3Q48A 3IDNB 1KTDB 1R3IH 4RFOL 4ELMA 4XMLL 3BGFB 3EJYD 5BCAA 3OZ9H 5ANMA 3WCYA 3WXWH 4R0LC 43C9A 5JNYB 1B0RA 2CK0L 4P2QA 1DQDL 4IMLA 3DTXB 1EXUB 3J8F7 3U79A 3HG1A 4GKNA 4D9QE 1FRGH 5FECA 1MHEA 5MEQB 3T8XB 3RWCA 2X4RB 1VKXB 5EO1A 4ZFZB 1UXSA 4UQ3B 1N7ML 2IH3A 4HKXB 4UTBL 4JEGB 1FDLL 2IEPA 2EH8L 5FA3A 3KPRA 2W60B 3C60A 2R23A 3AXLB 1U3HA 4LLDB 5I8EB 1JWUA 2DQDH 1FZKA 5F9WB 4Y5YC 3QEUA 4ZNEA 3ARFD 1GYAA 4F3FA 2I07B 4NJAL 2R0WH 4H0HB 4JQIL 2HMID 5H2BA 2PKDA 1EAPA 5KSBA 3D2UD 1MHCA 1YJDH 3VXSD 2CLVA 3LB6D 1A14L 5F7YC 5ABDE 5KSUB 4K7PL 2EDOA 5H94B 4EBQH 5FA4B 4L3EE 3CGTA 3DARA 5DTFB 4NQEB 5T5NF 3RZCA 3D18B 2DD8L 2Z93A 3S5LB 2GSIA 4HH9B 4P59L 4YAQA 5DMYA 2XN9D 3JSSA 3BGMB 4MQ7B 5EG6C 3MUJA 2YD3A 1Z9OA 1D5IH 4W4OC 1F13A 3UZEA 1P7HL 3PQYE 5KSAC 2DYPD 5HBBA 4CU7A 2BNQE 1WVZA 3TWCL 4DKEL 4O51A 1R5IB 5FDYA 4JM2B 1OP5H 3IDYB 2ARJA 4YDLB 4GOSA 1W72B 3VWJA 5T1KD 5HGDA 3MRHA 1LO0H 2HLFD 2ZG3A 4FHBD 1LK2A 3FQTB 4ZPTA 5IJKC 1BHGA 3W0WE 3G6JE 4QHUB 3PDGA 4GG8B 4Y16C 3BUYB 2D7PA 4M5ZL 2NY0D 4R4FL 4WHYH 2C3WA 5GRJH 2YMXL 2P8LA 4NC1C 1K3ZA 3VA2C 4YHNB 4HK0A 4F58L 4C56E 3O0RL 3D85B 4WEBH 4UIMB 5CHNA 2ERJB 4PRPD 5KW9L 1KEML 4KI5F 3ULUE 4JAMB 3EYFB 3OR6B 3RHWK 1U42A 3KPSA 1QFUH 3V8CA 4G6ML 2EO1A 5C0RL 4NKQB 2JELL 1BREA 5F1SA 3UJIH 5BOPA 4KZDH 1X5JA 2BMKA 3F7VB 3V0AC 4MCYA 5HHQA 5TGBB 4UNVA 1OVZA 2GYSA 4Y4FB 4IDJH 2ZCLL 1NH6A 5GSRA 1A6VL 2EYRB 3VG9B 4A6YA 1OGAB 4L8CB 3QI9A 3KG5A 4CGTA 3TBTB 1I8MB 3HR6A 3RX7A 1J1PL 2HJKB 1JHKL 3MV8D 1CTNA 4ZUVA 1EEYB 4QF1A 2RQ8A 4F37K 5EOCJ 1BIIA 1SQ2N 2ATKA 1HHIA 5CEXB 2DDQL 4DWHA 5I8CA 4QYOB 2AQ2A 1ERNA 2YKLL 4Y4HA 2HFGL 2UUDH 1OTSD 2JLLA 4MB5A 4Y88A 3RKPA 2C26A 1FIEA 1EH9A 3WFDL 3TJEH 3AU1B 5IBLD 1ONQB 3QDGE 3IETB 4PV9B 1AGBB 1O5DT 5SWSD 3MLPA 5AG8A 3V6BR 1YEKH 2FX8L 4NQSA 3B3IB 4ONGH 2ICEB 4XPFH 2VLKE 5EN2B 5DEFA 1II4E 2YD6A 4JFPA 2VLJB 3BKYL 2OTPA 3RAJH 1L7IH 1ZXQA 3AMLA 5D9SB 1KC5H 4XAWH 4M9PA 3VA6A 2IH1B 4JHAL 3EYOA 4PJDE 2V2TB 5LWYL 3KLSA 1QO3A 3MRQA 3IJHB 5DMKB 3BEWA 1JGDB 4XNZB 2XFXB 4YBQD 5IW6B 5FM8A 5DURB 4Y4KA 3U7YH 5GRVK 4K23L 3KWWA 4LSQH 4Y7MA 1N5AB 4MAYC 4RGND 1OF2A 2LQRA 3BE1H 3PWLA 4Z7QE 3FB8A 1EHXA 5DJDA 4LBEB 4HUVB 1T20B 1LP9E 3NPSB 3ULVD 1UADC 3FT3B 5C6PB 1K2DA 5DRXA 4WI9A 3V4VL 4QY8A 4LFHD 4XWGH 3H3KA 1NAKH 1MRDH 4LCWB 5TDPB 1DQJA 3V0VA 3DSNA 4PP1D 1MWAL 4PGCB 1RK0B 2MMXA 3C87A 3AUVA 5DD1L 1HOCB 4PG9B 1P5VA 2EDHA 4NFCA 3V6OC 5C6TL 4R8WH 1K8DA 4Q6IC 2IADB 3GNMH 1T21A 3ARGC 5FYLD 2FX7H 1JZ5A 3MV7A 2KDGA 4XBGA 3HC0B 2H2SD 2AV1A 1KYOJ 2VKWA 4JQVC 2PCPA 3EO1B 5AD0B 3AS2A 5T1DL 2Y06L 1J1XH 4PJGF 4AEHH 4OIBA 3LD8C 4U1HB 4JO2H 2ZUVA 1RZKL 1KJVB 3MBXL 4WCYH 1FFPA 5J12B 1MQKH 3FN0H 4ZAKC 1QZ1A 1D5ZB 3TYGH 2Z31B 1PEZA 3ZYOA 3ZDYE 1HHHB 5HYSG 4WVRA 2FBJL 4QNPE 4P57B 2VXSH 4QKXB 4ODWB 2H8PA 4CN4A 1FYTD 4BSWB 3DUSA 1AXTL 4EJ1C 2MHAB 3O4LB 1F4YH 4O00A 3SJVE 5KVEL 4M61A 4S1QL 5KVDL 2NY3C 1N0LA 3VXUD 2WBJC 3WJJA 1D5BA 3UEZA 2GTZA 2GQHA 3OKYA 4HC1L 1QPPA 3BXNB 4PRHB 4JN2A 3O11A 4HW6A 4OIIH 4LVOC 4TTDD 4OCYH 3CUPB 5ESQB 3DVGB 2CRZA 5ERWB 1KIQB 4RMRA 2ESVE 1J12A 4HBQA 4JO3L 3QUKB 4JG0H 4OBSA 4WDIB 2R0LH 5D1XA 1SBSL 5FFLA 4M1DL 1RUMH 4LEOB 3S36H 3QPXH 5EBMA 3EGSA 2RIKA 4QRPE 3GJEA 3BP6B 4PB0L 3UTPE 1KCUL 2AJVL 3RTQC 1YYML 4P2OA 4PBXA 5FO8B 4PGBB 5CJ8A 2MQ3A 1R3IL 4WTXA 4FQXD 3UTZA 5HYJD 3LSOB 3WXWL 3LDBC 2NLJA 4PD4J 4HS6B 1XIWD 4IOSD 3U7WH 4D9RE 1GOFA 3H0TB 1GJIA 3QHFH 5EB9A 2J5LB 5GS0C 1ZT4A 4LEXH 3QDJA 3FZUD 2O5YL 4Z0BH 2A6DB 4LCUB 4R7NB 3FAWA 3RY6C 3WUWA 5BXFA 1F90L 2MKLC 2HT2D 1QLRB 3N85H 5I1GL 2CJUL 5C0GA 1KB5H 1PKQB 4R0LB 5EFIA 4PRDB 1F97A 3GI8H 4L3CA 2DQDL 5DLML 4LCCA 5K33A 1H3UA 4HEME 3N0PB 2F8OA 1WBXA 4FQHA 3PNWA 2XKNB 3QIWC 4BELD 4PPTA 1LO2L 2ICWJ 1CK0L 3RUGB 3TZVD 4ZTOH 1XGTA 4W70A 4FFYH 3UJJH 4H26A 3WLWC 3ZKXC 2DM7A 3U48A 2VERN 1CL7L 4OCXH 3GMPA 4Y5YB 4PP2A 3SQOL 4HZLA 4PJHB 1FJ1B 4KPHH 4DGIL 1RZIA 1EO5A 1NAMB 3BW9B 5C3TA 4N0RA 3SKUD 1D5IL 3MSPA 2EIZB 4GKSB 1MNUL 3KPQB 5D71H 3P73A 4G43A 5DJYA 2D0GA 3KYNB 1YNTB 5E0QA 4ZD3L 1T0NA 3MUY1 2GJ6D 3CFJB 5BOZG 5T3XE 1RU9H 1I1YA 3CCHB 4GW5B 4F2MB 5MEND 3CZFA 2H32B 1LO0L 1PG7L 2B1AH 5EIIA 3V79C 4X6CB 2DKUA 1F2QA 1INDH 5KSAB 1OAXH 2R0ZH 2Y1VA 4X4ZA 4U1GC 1RULL 4J23A 1D5XB 1RIVH 4KK5C 3EFFB 1FZMB 1A64A 3PP3K 4GH7B 4E9LA 1A1MB 1M7IB 4OGAD 4FQ2H 4AEFA 2P8PB 4HBCH 3UTTE 3CNKA 2OQJB 4W4NA 1Q9LA 5BV7H 4Q74A 3HNVH 1FL3B 3PWNA 4YZFE 4Y16B 1XFPA 3MGAA 5CUSL 3QXWA 3UJIL 2ARWA 5FUOH 3S37H 4QRSB 4AYFA 1CLZL 1JPFB 5ICZB 2F58L 3D39D 3CXDL 2X05A 4DW2H 2V2XA 2D7MA 4NNXB 5T1MB 4YGVA 5AYUH 1JBJA 2OP4H 3QQ4A 5E9DA 5C0BE 3REVA 5F7KC 4ODTL 2H26A 3VFGH 5LQBH 3QG6B 2UZIL 1G7LA 2J6EH 4KI5D 4F7MB 2XZAH 4PRBA 1PAMA 3IFOB 3T0BA 1UM5L 3HI1A 3I6KB 5D7KE 3MACL 3WHE1 5C0FA 2BY0A 5D5MF 2I9LB 1MHPL 2F53D 4YEFA 5JIIA 1HI6B 1AGFB 2O5ZH 3NCYP 3SCMC 3SE9H 1KUMA 4JFFE 1YEKL 3SDCC 3U30C 2YWZA 3ET9F 1CICA 2D9CA 1PFCA 4XPFL 1CFQB 5EU5A 2AK4A 1ZVYA 1WFNA 2WWMC 3DRQA 3PWPB 1L7IL 3D3VE 1FG2B 4KJQC 1J18A 5E5RB 4YHPA 4XCNB 1I1CA 3GBNH 2FHCA 3QH3B 3H9SE 2WBKA 2CLZB 4P4KD 4BJLA 3DI2B 1QHOA 5JPNB 3BDXA 3VFWB 4OCRL 1ND0A 5DUMH 3U7YL 3TNMB 1S7UB 2C3HA 1NCDH 1CGYA 2ICWA 1NBQA 4NO5A 2W1NA 3AAZA 2PR4H 1FGNH 2B2XH 1IAKA 1LQSR 4YHMH 4MCZB 4PJHF 4K7PX 5JUEH 4R97B 4WV1A 4AT6A 4TQEH 1CGTA 1X5FA 2W91A 4N9GA 4QWWD 4XWGL 4TSBL 2VC2H 4NQDB 5FOBA 3PL6C 3WMSA 1HSAA 5D7LD 1RJLA 4ZSOE 1KJMA 5EOTB 4MAYB 4POYA 2A6KB 4JPKH 3GSVB 4Z7NE 3EDFA 2QR0A 1BFOA 5E5MB 2X4TB 3OB0H 4R8WL 5JZ7D 3ELAT 3Q5YA 1NCAL 1QYGH 4UOW0 3MOQA 5DC0A 4JDVA 5IK3A 4CJ1A 1Q0YH 3T0AA 4X6CF 5EU3A 3WFZA 2A0LD 3L3JA 3G5ZB 5J6HA 1CI5A 2XRAH 3CVIH 1K5NB 2ZCKL 3JWOH 5EC2B 2VDPL 2XI9A 4JO2L 5J56B 1BPVA 4FOMA 4Q6IB 1NBYA 4WCYL 5F1IB 2YPVH 4JFEB 2DQJL 4PLKC 3ARGB 5BO1H 3HNSL 4BQ6A 3KLDA 1MQKL 1P1ZA 3FB6B 4J8RA 4ZDHB 4KVNL 5EZIH 3DYMA 6CGTA 2VXSL 1F3JB 1UA6H 3CIQA 3VH8B 2RBLA 1NBZB 2UVFA 3G6AA 5BVJA 2SEBB 3LD8B 3GSUB 1JZ4A 1BVZA 2B7DT 3MRMB 4YWGH 5I1AA 1DE4A 3S4SA 1VESA 2PF6A 4FXGA 3TFKD 3O9WA 1C7SA 3SKOB 2M8XA 4OFIA 5EOTA 4ZAKB 4PJBF 2FSEA 1W72L 3HUJF 4UI2A 4NRZA 3MNZA 3L5IA 4KRLB 1A47A 5GS2H 4QT5B 4K55A 3VXSE 3MRGB 1L0QA 1K8IA 1KPRA 4J3TA 3OAUH 2GI7A 4MB4A 2ADIA 2YSSA 3KYOB 4RMTA 1B6UA 1U6AH 4N8VB 3MRNA 1C5DA 3LPWA 1DBMH 2NY3B 2OL3A 1BEYL 3VFMB 3NZ8B 5BVPL 2WBJB 1F45A 3ES6B 3QPXL 2XN9E 3FT4A 1FAIH 2UV3A 3P4MB 4LVOB 4UV4L 5TDOA 3MOBH 4Z18A 4PBVC 1G7IB 1N8ZB 2EC9U 1LNUB 2B1HH 3O3UN 5DJXA 3W2DH 4JRXE 4BZ2L 5FKAA 3LPFA 1T0MB 1I1AD 2V2WB 1IZKA 5I8OL 1XR8A 4F7CB 4CN1A 2PTVA 5GGUB 3R06B 3DI3B 4KDWA 2B20A 1DBAH 5EDXA 1FFRA 1X5AA 3WHXB 3RTQB 4KY1H 1CD1A 4WU7A 1AFVL 3QUXA 1PW3A 5I1LB 4ZXBC 3KHOA 5I1IH 5SWZA 3QWQB 5FYJH 4MWFA 3Q5TA 1BFVH 2IAND 5A3ID 3K4DA 3LDBB 3WNNA 4TNWF 3IJSB 4OCSH 1W0WA 5CBEB 1OT1A 4G9DA 4OF6A 1FFNA 4KAQH 3JVGA 3L1OH 6FABL 4ODVH 3EJZC 3FB7B 4LOUD 2C1PA 1CLCA 4OUUB 4FQ1H 1D9KC 2RFXA 4PRIA 5F3HB 4FFYL 3UJJL 2QKIA 5HGAB 3BHBB 4OCXL 2BVUA 4V1DA 5F1KC 4OF8A 4I0PA 4WY7L 3QEQA 4XP4H 4ZOCA 2I9TA 4OJFH 1T1XB 3QIWB 3MV8E 1W8OA 4F15C 4ZUWA 4U6YA 4UT6H 3M17A 2HVJB 2XWBA 1BMGA 3MRJA 4X5WB 3SO5A 5HDQH 1QLFB 2J1KA 1HXMB 25C8L 1XGRA 4D9LH 1KGCD 5C0AD 1ZGLP 4F8TA 3NABH 4MNGA 1BD2E 4O4YH 5KS9F 5GJTH 2K9UA 4PJEB 2YRLA 4Q0XL 1X7QA 3MA7A 3BVNB 4GXUM 2C7UB 4R2GD 2X40A 3MV9D 4G6FD 4MD5A 5CZKA 4HV8A 4NZDA 4RRPA 1RIVL 1I3RB 3K81A 2JJSC 2A74B 2VITA 4HMCA 4I18A 4UIKH 4M7LT 3TCLA 4DUVA 2OR8A 1DDHA 2VMFA 2VAAB 3FCTB 3S4SG 5HY9A 2GJ6A 3MXWH 1CLYH 3OKOA 1MLBB 4HUUA 1IGMH 3IRPX 1WWAX 3LKOB 3QYCA 1LO5B 4U1GB 2V7HA 1C12A 3BKMH 4S10A 3BDYL 4BSVB 1IM3B 5FUOL 3RWDB 4X9IA 4Q9RH 1QSFE 3AGVA 1EJOH 1YPZF 4X9BA 1C5CL 3MYJB 5DJZB 3QHTC 3ARSA 2IF7A 1MCJA 5FHBH 5EZJA 4XP1L 1YYLL 4TSCH 1LO3L 5K93A 5INDA 1KYOK 3VFGL 5LQBL 1I8IA 3B5TA 2J6EL 5JHDA 5C9JA 5IVZA 3A0OA 3G08B 1R3JA 2YPLD 4HHAA 4PG2C 4I5BB 2CLRA 4KJWD 4XNYL 4XP9H 3UJTL 1BZ7B 4LU5L 2O5ZL 5F1NA 3QNXB 2XWTA 3SE9L 4OI8A 5DHYB 4F7PB 2V17L 4LASH 5D6DC 3OXRA 2CIIA 3BN3B 2AKRA 4JGJA 5IMLB 2D03H 1WC7A 2NX5B 4RCAA 3OG6B 1BFTA 1QNZL 2RJMA 1MSPA 2F54A 3T0EC 3MJGX 4P49A 4IS6A 1PZ5B 5C0EB 4YJZL 3NH7H 3VD9A 3SCMB 5D1ZA 1JPGA 4CMMA 1N64L 3SDCB 1BJMA 3U30B 5DUML 5L9DH 3MODL 3BOVA 1J05A 1U91A 1YEGL 1NCDL 3V7AE 1QFOA 1A6WH 3IKKA 4BM7A 1S9VA 3MRRB 3N1MC 4FABH 5C8JB 1JRHI 2F74A 3LAFA 3RVXC 2DQEL 2PR4L 4FS0A 5C07D 1G7HA 4YHML 2HWZH 1S5HA 5F7FA 4FZEL 4G7VL 1BX2B 3VRIA 4NKMB 4HKBB 5EPMB 5J11C 2VC2L 3C6SA 4NRXA 1CD8A 1ORSB 4QRRE 4LMQE 3O6LH 5HYSB 4HKZB 4K7FB 1MCOH 3WLBB 1R0AL 3PGDB 4IHOB 5AUMA 3FQUB 4RFNC 2B4CH 5LGHH 3NVQA 3K1KC 1F5WA 5K9OB 1QFWI 1QYGL 4YNYB 3ARED 4JZNA 4MA8H 1GGCH 1G0YR 2FL5A 2R4SH 5IWLC 4MQXD 4RWYH 5MHSD 1T2JA 1A6ZA 2WQRA 2XRAL 3U9PH 1I3VA 3PL6B 5BJTB 1U8LB 5CJ5A 1ZEAH 1DP0A 2ZOKB 4U6VH 1ZLVH 5DJAA 3PQYA 1KIRA 4OF5A 3RL1B 2BNQA 5HHPB 4U0RC 3E6FB 4YR6B 4Q97A 4GUPB 3C5ZA 4M6OH 5EZIL 3VXNB 2O61A 5EBGA 3V4PH 4PLNC 1HHJA 3UTQB 1EBPA 4MQSB 1NAML 3BZEA 3MJ7B 2HJFA 4DTGL 2DI9A 2VLRD 1TTGA 4FN0A 1WJ3A 5CSZA 1I3GH 1CDGA 5GGSA 4WW2F 2A83B 2BXYA 3G6JA 4JE4B 4PY7B 4XPAH 3B9KA 1EEUA 4HJGA 4ZQKA 4MSWA 3THML 4NKOA 1T4KB 4HIXL 2XKUA 4RX4D 1XCTA 4AY0A 1CFVH 5E8NB 3ARDA 3SPVB 4Z5RA 1JE6A 2FHBA 3PWVB 2DIJA 1R5VB 2ICWI 3RVVD 3VMPA 2R1YA 4C56A 3ORJA 4Z77A 1CZ8L 1IKNA 4RIRB 3ROOB 1U6AL 1ORQA 3ALPA 1VFBB 3DX6B 3CFDA 1S8DA 4TSAH 2VUOA 4MA1C 4YH6A 2PYEB 3OR7A 1I4FB 3EJJX 2APXA 2GTWB 4MJ4A 4CDHA 1MHHB 2V9TA 3MOBL 4HGKC 2BNUB 12E8L 3OKDB 3P4LA 3BP4B 4EKXA 4HIJA 3ZLQC 3TBVB 4HS8H 3OMZA 4N0UE 1PX3A 5I66B 1CYGA 1CDYA 5BQ7A 5MENE 5IEKA 3QWOB 1E28B 4UDTA 5DGQA 4KY1L 1NMCC 2NMSA 5HHME 2Z92A 3MRPA 5I1IL 2VL4A 1JMXA 4OLXL 1E4KA 4HIIB 1BFVL 1OTTC 4O2EB 2ENSA 2EDXA 2X89A 1U8IB 4RA0C 4G6AC 4IMKC 4JN1H 1J8HB 4OCSL 1BZ9A 4U6HA 3OV6A 1GGIL 5CKAA 2VB5A 4X9HA 3UROR 3L1OL 3ARQA 4GRMA 3BYYA 4HDIA 1JZ2A 2JIXA 4R90H 1SEBB 4ZXBB 1QBML 3EAKA 4JM4H 1JGLH 3GMMA 1QEWA 4F7TB 5IOPB 1T7YA 4H5SB 4OQTH 3BIBX 2Q8BH 3T2NH 4PJDA 2HLAB 2OTUA 4M8QB 1DQML 4J1UA 3FQNA 3QIBC 4XP4L 1Z3GL 1S9WB 1IGCH 2JKXA 4NQVA 2IANA 1P84K 3FFCD 2EYTA 4D0BA 3VFRA 2ILLA 2QADD 3C8HA 1D9KB 5IG7B 2VQ1B 4NIKB 4Z7VB 4F57H 1LP9A 4L8SC 3TVMC 3UPCA 5HDQL 4P4RB 5EUOB 4D9LL 4XRCB 4FRWA 4PV8A 2X4OA 3OQ3B 2Z35B 4OD3H 1M7DA 3BZ4A 3VCLA 1XF2A 1ZA6A 5ESVA 3OJVC 1NCUA 1ZHNA 4F15B 4KK6D 4YHIA 4PJ8C 4PTUB 5DC4B 3QDAA 1KBGH 3SDAD 4NT6B 1DBKL 2NY6D 5HI4D 4CL7A 5E6IA 1AE6H 2VXQH 2F9BT 1TQCC 3MZTA 1YA5A 3MUGA 2C5DC 3GMNB 5INCB 3VE0B 3VGFA 4NJ9H 3T4YA 4JZJA 2P44B 4UBDD 3EYQC 3H42H 4XI5D 3ZDZF 1X5GA 4J3XA 1GRWA 2P5EE 1UGNA 4LF3B 1AO7E 4KKAC 2Y36H 2NY2D 2A9MH 4Y2DC 1DLHA 3Q6FB 2EXWC 1FFQA 3F5WB 4R4ND 3RNKA 1CG9B 1JNNL 3WSQH 2Q86A 3QIUC 4A6YH 3P9MA 1BQHA 4H1LG 1UZ6F 3LMJH 2DMCA 3MJ6A 3VI4F 4JY5H 4DK3A 4EXPX 4KRPD 4KROC 1F3RB 1C5BL 2X9YA 4OZIF 1SYSB 3LKRB 1JNHA 3L3GA 3EO0B 3U1SH 5TF1L 2HG5B 3QNYA 4TSCL 3UPAA 3SY0A 2OMBA 5H35B 4U7KA 3SJVA 2M1KA 1HHGB 4D0CB 3INUH 4G8IB 2XA8H 3LS4H 1T03H 3EO9L 5D7LE 1VADA 2MCPH 3S36X 3H8NA 4P2YA 3L5WA 2DQGH 3TO2A 4KKCD 4LPCA 3S7GA 1FZJB 1KCVL 5CMAB 2JK5B 4GG6A 1S9XB 4ZYKA 3UYRH 4NQEE 4PGEB 4OSUH 4XP9L 2QQLH 1ZLWK 1F42A 2ESVA 3RNQA 3GSQA 5LGJA 1OCWL 3VWKA 4ODHH 3VGHA 4JFDB 2YXMA 2H45A 3WJLA 5KSVB 5CWSA 2OSLA 2D03L 1HILA 2X1PA 4XPTH 5I17B 3DX8A 2GT9A 1NC2B 4L9DA 4QRPA 2ZG2A 3CFCH 4JHBA 1AI1L 4K71C 4JY4B 4OZ4A 5IW1B 5I16A 3DMMD 4RAHA 3F12B 3ZKQD 4N5ED 1ODAA 3NH7L 3NAAH 3QA3B 2YPLA 4UTAH 5ADOH 3WNOA 1K6QL 5L9DL 2FRGP 1CDHA 2BNRB 4I3SH 3ARRA 4K9EC 1TLKA 2ADGA 4APQC 3TT1L 1P9MC 5BS0B 1A2YB 1A9BB 4PJGE 3SGEH 3T0EB 5KN5B 1AR1D 2CRIA 5KZCB 3GI9H 4RDQF 4F80A 3MCKB 4TUOB 2HWZL 4MDIA 4H88L 4MA7H 3TO4C 1I7RA 4N90D 4YGAB 3MLZL 5CD5C 3ARVA 1R3HB 3QCUH 3S8WA 1NDGB 3Q5OA 1PBYA 5H37G 4Z7VF 1CN4A 1CFNA 4M1CD 4XCEB 4LSDA 2LU4A 2HKFL 3MRIB 1YEIL 5EUOF 1TVBA 2AXHA 4GBXA 4HK3N 1R3LA 2C3XA 4YLQT 2IMNA 4MMZC 4PS4H 1T3FA 5F9OL 4MA8L 1GGCL 2AEPH 1OGAE 5J11B 4IOFC 1SM3H 5KANI 4R7DB 5GS0L 3U9PL 3RKDC 2G75A 3QG7H 5HGHA 1ZEAL 1AXSA 4NO2A 4GRLA 5I9QC 4RFNB 3MOAH 4U6VL 4X7FC 3VW3L 3RPKA 1TZHB 3E8UH 4U05A 4ZUUB 4MXVE 4WI6A 3C2SA 5JORA 5KTEH 1P6AB 5HHVH 1NKRA 2A73A 2PTTB 3C8KB 5ITFB 4KK8C 3KYKL 3FQXA 3NOIA 3CSPA 1HH6B 1UC6A 2EE2A 3TH3T 3BESR 2AXFB 5DEGA 3PV6A 1WZLA 1QD0A 2DBJA 2PXYA 1P53A 4D8PA 1I3GL 1BQHG 2QSQA 3BH9B 3F6LA 5DDHB 3STBA 5HI5D 5E2UH 2PO6C 2VLJE 4U0RB 4LDEB 2P8MB 3S37X 4GRWF 4MA3B 4XVUD 4E42B 5I19L 4A2LA 2BSTB 1SJHB 5EOCH 2FEDD 3V8OA 4FXKA 3JTSB 3S88L 5IHZB 4XPBH 3HMXA 2EDFA 5I30L 3UTTA 2X1QA 4GW1A 1P7KA 1TZIB 3HS0B 1XZ0A 4GKZB 3KXFD 4ODXB 1ZLUK 3ZMRA 2HFEA 1U8PB 4WWKC 4JB9H 4NQTA 1TCRA 2C9AA 3TA3A 2Q8AL 3WD5H 5C0JB 2A77H 2Z9TA 3MO1A 4U1KB 5FGCB 1GCFA 4PJAA 8FABA 3BWUC 1IGTB 4K07A 4Y19A 3FJTA 4M7JL 5F89A 2E5EA 4QOKD 4MD0A 2CIKB 3VXMB 1JGEA 3L7FA 3FHAA 4HS8L 2FATH 4DKDC 4U6XA 3HPJB 2DWDB 5I0DA 2BVPB 2C1OB 1HHKA 1HCFX 1KIPB 1XGQB 4B41A 1U8MA 5L2JA 4DFHA 4E0RB 4MA1B 3GSNA 2DM4A 5E8DH 3KPMA 3I6GB 4LHUD 1PKOA 2IALB 3BDBA 3BQUC 5JXED 3PV7A 2IPKA 4DCQA 1JN6B 3L5JA 1AKJD 4GW4B 5I1JL 3MRKB 1MEXL 1Y6KR 1VFOA 3BT2H 4MXWH 1FHGA 3I6LD 2FD6H 4JN1L 3WHE0 3VGGA 2DQTH 3P0YH 4XVSH 1S3KL 5EU6D 4JFQB 2OZ4L 3V5DA 3QPQC 1FGVH 4DOHB 3JTTB 3DX7B 4ZO8A 4BFIA 1FO0B 1NMCB 4G8GB 1G7QB 2G60H 3QULA 1CTOA 4I48A 1U92A 1IQDA 2OLDA 5DQJB 3R4DA 3CH1B 2W9EH 3W5MA 4OQTL 4LQFH 2Q8BL 1B90A 3I02B 3H9SA 5IMKB 3G5YB 2BHUA 3WEXB 5JMRA 4FQQB 1Q9WA 4QRUB 2CDEB 2N1KA 2GSGA 4YHZH 4FA8A 3ETBF 3HE7C 1ZE3C 1ZK9A 3W81A 3BIKB 2QQNH 3O6KH 4PRHE 3RWIA 2AV7B 3QQ3A 1VEOA 3WO3B 2EYSB 3ZYZA 4K8RC 4P23C 5FIEA 1RJZA 4TVPL 3TBSA 2X6MA 4E41B 4JFOB 3JBG7 3QIBB 4HPOL 5FGRA 1J10A 3C08L 4QRTB 3VXOA 4ZSOA 1RZGA 1ZLSL 2IAMD 4Z7UB 4H0GA 4TN9A 4ZNCD 4OZFB 4ZTPH 3BWAA 5DI8B 1LEKA 1KBGL 1WCBB 2V6HA 4L8SB 3TVMB 3VMOA 2V5SA 1AE6L 1JRHH 4NQCB 3GSRB 4KDTC 5I1CH 4L29A 1JI2A 4LHJB 4NJ9L 4PRAB 5IV2B 1U8OB 1FN4A 5ENWB 3ILPB 4UDUB 4EDXA 1UXWB 1MCLA 1U9KA 5D5ME 2A9ML 3MJ9H 4W6YB 2QL1A 4R96A 2FWOB 5CZXC 4EI5C 1A21A 4PJ8B 1Z9MA 3HI5H 4LKCA 2YEZA 4UMGA 5ID0B 3WSQL 1TQCB 1Q1JL 4TNVF 3MNWB 1MCHA 4JY5L 1I1FA 1KELH 1QFWH 1PKQE 4OZHA 4NNPL 4HUKB 3FOMB 1QSEB 2WM0A 1CFTA 2HJLA 1P2CA 5A16B 3X3GH 5CGMA 3NCMA 1KXVC 2KQMA 5C9KA 5IBTH 3PWJB 3QIUB 4HIEA 3LKSA 1A9EA 1OD7A 1WT5A 1X5XA 4XXCA 1T5WA 3O2DH 4MGXA 4WFHE 1U8HB 4KROB 1MVUB 1U8NA 5MP6L 3ZKMD 4NO3B 1T1ZA 3UYRL 1C7TA 1M7XA 2X4PB 3AB0C 5L88L 4AG4H 4U33A 1JL8A 3ZL4H 4PJXB 4PJHE 2FO4A 2J88H 4ODHL 1AIFB 3QWRD 4J4PC 5MHSE 3ZT5A 3ZSTA 2G5RA 4PJ9D 5HDBF 5T1LB 2RCSH 3F58H 2XKSA 2PNDA 3QQ9D 4QTHB 4RNRB 4XPTL 3TESA 1I8LA 4FFVD 1U2HA 2AJ3B 4HSQA 1YQVH 1MCKA 3MZGB 1BVLA 5IFJB 3DROA 1RFDL 3RA7L 1T6VN 1S7SB 1EEZA 3NAAL 5DWUH 1CT8B 3C6LD 3GJFB 4DUWA 4JRXA 4KTYA 4X6CE 4V2CB 4MNQB 4NOFA 4I3SL 2BCKB 1IM9A 4K3EH 4WUUB 1H3TA 4L8BB 2OTWA 1DQLH 1WUNT 2JF1A 3BKJH 5GS1A 1OAYH 2CRMA 4K71B 4OAWA 3UPRB 1X3DA 1K9TA 2OR9L 4WUKL 1IBGH 1VPOH 1F2XK 5KG9B 5C2UB 2GJZA 1MI5A 5B39A 4EUPA 5HSFA 3MGOA 3QCUL 1NGZA 2VIRA 2JJUA 5F7DB 5GXBB 3B83A 2IFFH 2WINB 2Z8RA 4APQB 2AEQL 1JZ7A 5F97E 2I25N 1E6JH 4P2RB 4J3OC 1FNGB 4NC1E 1HE7A 4IRZL 5DQDH 1S7TB 4X8JB 1OARL 2AJZA 2Z4QA 3HE6D 5C08E 3U4BH 1M71A 4AL8H 3FQWA 3TO4B 2CRYA 3BP5A 1NC4B 2XZCH 4Z7UF 5GISH 1SM3L 5SWQA 5IEHA 4PJBE 2DL9A 4WO4A 5IFHH 5K9QG 3O6FA 5EUKB 3HUJE 3EOYG 1OSPH 5EZOH 1FO0H 2NY4D 4O2FB 4OB5H 3NN8A 3VXRD 3MOAL 4G9FA 4NDMB 1OLZA 4P46A 3QZWA 4QGYA 5HHVL 4GT7A 5C0CD 5IMOB 3VFNB 3V5KB 1I7TA 5HHOB 1OB1A 4X7SH 1PZUB 1BF8A 3MBEA 1VERA 4OV5B 1Z6JT 3FFDA 1A7RL 2Y6SD 4B7LA 5FUZL 5I9QB 2HTLD 1BD2A 3U82B 3KYMA 5IHUL 3N1PC 2EDEA 3B2UC 4HGWB 1KOAA 4JJ5A 1FL5B 3KLAA 5E2UL 1GAFH 4R26H 5TE6H 3PWPE 4M6NH 1ITCA 4U3XA 2MTPA 2IQAA 3O2WH 4S1SH 4ELKA 3ARYA 1K4CB 4LVEA 4HUWA 3RDTA 3LH2H 3BEVB 3DIFA 4I3RL 1A7BA 1SBBA 2D7QA 4TOYH 5DRNB 4NO0B 1PSKL 4DEPC 3UXFA 1YZZA 1RUQL 3DO7A 1MWAA 4P48A 2PO6B 3T2OA 5AWNH 3QDMD 3L3OB 2LVCA 2EDLA 3S34H 3IAQA 3B5GA 5EO9B 2YPKB 4JB9L 4PJXF 1TPXC 2H3NA 3H9ZA 1SJXA 4K3JH 4J12A 4LRIA 1XAUA 2VSCA 4JJHA 5HHXH 1NGWA 4P5TA 3HAEB 3BZFB 2FATL 4YUEH 1BOGA 2AW2A 3B43A 4F9LA 3WDIA 5C0IA 5CIPB 4WWKB 3W9EA 1IAOB 5E8DL 1KLUA 2IG2H 3ROLA 4BH7A 4NN7C 1HQRB 2VDML 2Q7YB 3BO8B 4BUHA 3F7YA 1JMZA 3KXFA 5BRZD 4ORGA 5D1QC 4L3EB 4ZFGH 5F7HA 4MXWL 3BT2L 3IJYA 3IF1A 2EDBA 2FD6L 3MLVL 2GFBA 2J2ZA 5E94A 3V6OE 4AEEA 4XVSL 3MNVA 1W0YT 4U0QB 1PEWA 2W0FB 2FJHA 4IRSB 5HTSA 4NM8L 1MY5A 3BQUB 5ISZB 4RFEA 4AMKH 4Z0XB 2G60L 5KS9E 3VJ6A 1S7XA 1C8PA 1D5MA 1FL6A 4XNQB 5L8JB 5JW4R 1WTGT 4YXKL 4HC1A 3G04B 1D6VL 5DK2A 2QHRL 4ODUB 5CGYC 3O6ML 4HJ0D 4I0KA 2VABB 3ZKSD 4X98B 5AZ2H 3L3KA 1DN0A 1NL0L 4XC1H 2D2OA 3MX0A 5B4MD 5TH2A 3RHWF 4HKJB 4Y4FD 3L9RA 3SGDI 2J12B 3M8OH 3GSOB 1ED3A 3LHPL 1UEYA 4NHCH 4FP8H 4JZOA 1MCFA 2OJEA 3QFJB 1EVUA 4LPYA 4WFGD 1H3WM 1DANU 2Q6WA 1MCPH 3GJFH 1LDPH 5JPMA 2N7BA 1FORH 4XZUB 3WKMH 4H1LB 1XGUA 4CADB 1YPZE 4ZFFA 2Q3AA 1K3IA 1AHWA 3HE7B 5LAXA 1REIA 3TIDA 2Z0BA 3V5HB 5LJYH 3FB5B 2WZPD 4JKPL 4LRNH 3ARBA 5J89A 3IDIA 1NCNA 4NRYB 3OL2A 3GMLA 4TUJB 4Q6YA 4QRQA 2QV2A 3BFOA 1JRHL 3MUHL 4P23B 1MFDL 4K9EH 5DJ2A 1RUAL 3VD5A 1H9VA 3QP3A 4Q2ZB 1T89A 1OAUH 2DN7A 2OXGA 2AJYL 3FOLB 4PFEA 1ZVSB 1PGRB 3MJ9L 3JWDC 1R24A 2R1WA 5CBAA 5DJ0B 2HFFB 1OHQA 4JY6A 3H7LA 5IBUB 1CGUA 3ALXA 4PJ7A 1QLEH 5JIPA 2P7TA 2VZ3A 3MR9A 5ICXA 3RWHA 5GGVH 2GUOB 2IAMA 7CGTA 1ZT1B 3SDDA 1HDMA 1WIOA 4F9PC 3FO0L 3QDGB 5DZOA 4FZ8H 3BH8B 4EI5B 2YC1A 4MX7B 2NCMA 5GRZA 4HXAH 5GGRY 1WBZA 1S7RA 1ZA3B 5B22A 2VLKB 3GB7B 1IT9H 2D7NA 4FFZL 4LCWD 2ZSVA 4LPTA 3O2DL 4TRPL 4JRYE 4LDOB 5E8EB 2D4DA 2R2HB 2DTMH 2EIDA 1JK8A 2CXKA 2DQHH 2VZUA 1OAKH 4TUKH 2NPLX 4AJ0A 4XGZB 1WAAF 2DOCA 1CCZA 5I1DB 5DO2C 2Z91A 4WFED 5DD5L 3BJ91 1YQVL 3GMQA 4XVJH 3UTOA 3AB0B 5K9QI 3X14B 1G0DA 3BJLA 2R0KH 1A3LL 3MQIA 3PE9A 3NIFE 5DWUL 1QRKA 2P5WD 2FLBT 2P1YA 2ZG1A 1QRND 4N0UA 4EN3D 1GPOL 3NGBC 2WW8A 2Y5EA 4NYLB 4OZGB 1OGTA 2YXFA 1G84A 2VL5B 3EJYC 3PGCB 1DQLL 3BKJL 3L7EB 3P9LB 1YEDA 2LV4A 3FN9A 3LQZA 1Y6MR 4PGDB 1EHLH 4PYHA 1IBGL 2EH7H 4ZFOB 1VPOL 4P9MH 3IGAA 4Z7WB 3A67L 4HFWA 1JIBA 2AJUH 3HI6H 5SX5H 3WS3A 4IRJA 2BX5A 1AQDA 3KJ6H 3QUYA 4WFFD 2IPUK 3RPIB 1EAPB 1B0WA 3U4EA 1N6UA 1FVDA 4ZUTA 5DQDL 3GO1H 3EFDH 4MJ5A 1DJSA 3ARFC 4ZO9A 2WANA 4X7TA 3L3HB 4MZ3A 4PJ5D 5MEOA 3DV6A 1TDQA 3G5XB 3KLHD 4GAGH 5E03A 35C8L 4OLYH 1RURH 1FO0L 1C16B 3RGVC 4CVXA 1E4XL 4QOKE 1BLNA 1VDGA 4JPWL 5F44A 2V5RA 4FQCH 4KQ4L 4L3AA 5DGRA 1UH4A 5IR1B 2DKSA 3IFNH 5IKCB 3E0GA 4RAUB 4Y1AD 3TPUB 1HSBA 4X7SL 4Z7OF 5GGQH 2JJTC 4KUCF 3SDYH 2GCYA 3EZJB 3HE6A 1UWGL 3IXTA 5TQ0H 1ES0B 3HMWH 4I4WB 1TTFA 3PJSA 4X7EC 2J7LA 4EIZC 5D7JD 2R1XB 4R26L 1C08A 5ACZA 1R5WA 4CBPA 2HLFC 1UJ3C 4S1SL 5EO0B 3DXAE 5EU6E 3I2CL 1DVFA 1Y6NR 1MF2H 3CLFH 4H1LH 5K9KA 4XC3H 3ZKND 1UKTA 1YN6B 4KRNA 3IDNA 2DTSA 1KTDA 1TVHB 4F7EB 1W0VB 4L8DB 1KG0B 3ULUH 4TVPE 1X5IA 2IPTH 5JNYA 1NGQH 1MCWM 1B3JA 1EXUA 3DTXA 3NCBB 3K2UH 4GQ9H 5D2NC 1NFDB 2YWYA 3T8XA 1VKXA 4ZFZA 2I60H 3RL2B 4G5ZL 4UQ3A 1NDMB 4HKXA 4K3JL 4I2XB 1MAKA 4YDKH 3FHQA 4M00A 5GHWH 5GSRB 3P4NB 2W60A 4KKBD 3AXLA 4V2BA 2BRRH 3K7UA 4LLDA 5I8EA 1DZBA 3CFBB 4DEPB 3A6CH 4YUEL 3O6FC 2I07A 1RIUL 5HGGS 4NZUL 5ID1B 5FO7B 5CSBA 4UNUA 5ILTL 3B8YA 1D6EB 4ELMF 1TPXB 1YNLH 5KSUA 1PX4A 3QHZL 3OKNB 5FYKL 5GS2D 5H94A 5FA4A 5DTFA 4OZGF 4ZFGL 4NQEA 1AC6A 5KSAD 2Y9RT 3D18A 3FL7A 2BSED 2VDRH 2EE3A 2CSPA 5T5NG 3S5LA 4C58B 4HH9A 4PJCB 2C4FU 5B38B 3BGMA 4MQ7A 4LKXB 1WWCA 5IBLC 4NN7B 3EDEA 1B4JH 2B0SH 3GEWB 4Z7WF 5TDNB 1R5IA 5D1QB 3IVKB 4JM2A 1TETH 1T22B 4OTXH 2E6QA 3D25B 1JTTA 3T4AB 3MFFB 3SGJC 3IDGB 3FQTA 4XC1L 5H37H 4QHUA 3M8OL 4GG8A 4H8WL 1P4BL 3BUYA 4P3CH 4XCYB 4ZS6C 4NHCL 4FP8L 4YBQC 3GHEH 3KNBB 5FYJD 2AVGA 5DRZB 5FYKU 4YHNA 3OKEB 4RGNC 4X80H 1MCPL 1BM3H 1FC1A 4S1DC 2CUMA 1FORL 3V52L 3WKML 1YMMD 4UIMA 4JANB 5GJSH 1UZ6E 4JFXB 2FIKB 1QVOA 2GEEA 4YDJB 4JAMA 3EYFA 3OR6A 4L4VB 1GVIA 4OZIE 4X6DB 3X12B 4M1GH 2PYEE 1TIUA 4MJIE 2I24N 1NLBH 3F7VA 4NP4L 1T21B 1X5LA 5TGBA 4Y4FA 1GGBH 3I9GH 2EYRA 1OGAA 4L8CA 2CKBB 5IVXB 4JFHD 1AGEA 3TBTA 2BVOB 1I8MA 1MFCH 2HJKA 2XXCB 1OAUL 3IXAB 5C0BB 3X3FH 2VYRE 1EEYA 1KB5A 2H2SC 5J3HD 1WCQA 3KDMB 3SE8H 5CEXA 5A2KH 2CPCA 4RQQB 4QYOA 5T5FL 1QLEL 3U46B 1LK3H 2ZWLT 1J86A 3FO9B 4GS7C 1N6VA 3AU1A 1ONQA 1NFDF 3IETA 4FZ8L 1J8HE 4PV9A 1AGBA 4B5EA 3OGOE 1ETZB 2EO9A 4JFFB 1JPST 4WGWB 43CAB 3B3IA 3UDWA 2ICEA 1RVFH 5EN2A 3UTSB 4YFLF 1NCBL 2VLJA 1Q8MA 2XZZA 5D9SA 4LSPH 3D3VB 4FTVD 2RR3A 3DX9B 4DGYH 1W8NA 1YECH 1FSKC 1OSZB 4HUMB 2V2TA 3IJHA 5DMKA 4KTDH 2VLME 1JGDA 2XFXA 5IW6A 5ITBL 1FVEB 4ONFH 4YHKH 3GHBH 1N5AA 4WHTA 4Y5VC 4TTDC 1CXFA 2FH6A 2BC4B 4IEFB 1EMTH 3D0LB 4UB0H 3GJEB 4YQXH 1ZOXA 2NXZD 4LBEA 4Z7VE 5FGSA 1YEJL 2PYFB 4HUVA 1T20A 4PJCF 2XWJB 3FT3A 1F6LL 3S5LG 5EUOE 5FK9B 1CQYA 5HD8C 5TDPA 4LCWA 5C0CE 4JFED 4ZODA 3L5XH 4PGCA 1RK0A 4XVTH 1IC5H 1HOCA 4PG9A 4BKLB 5JW3H 4MYWB 1N4XH 5GRVL 3LEVH 4OT1L 4FQXC 3DUUB 1MLCB 2IADA 4M62L 3K8KA 2YOCA 5CEZL 1XIWC 1X44A 5F7WC 2B39A 2R2BB 3DV4B 5DJ6B 1WICA 1ULVA 1MJUH 1AJ7H 1V3KA 1HH9B 3EO1A 2OX5A 3FZUC 3SDDC 5AD0A 2W38A 1I7UB 4WI7A 4U1HA 3NGBB 4ZAKD 2AJUL 5F93C 3HI6L 3AC0A 4J3WA 1I9JL 2R69H 3KPOB 2HT2C 3KJ6L 4JFZL 4RGOH 1KJVA 4MXQD 2P5WA 5I1KH 2J6EA 3GO1L 5DVLA 1PLGL 1D5ZA 3IT8D 2Z31A 3QDME 4W68A 1CL7I 2H9GB 1HHHA 5CJXC 4P57A 2ZUQC 1YY9C 4ODWA 4PYGA 5AG9A 4X6DF 1AXIB 4GRWE 4BSWA 3ECBB 2MHAA 3O4LA 3TZVC 2ZJSL 4OLYL 4O2CB 5IVXF 1QFHA 3O3BB 1JGUL 5MERB 5T3XH 5L2KE 3ARFB 3BXNA 3Q6GH 1JF6A 3EYSH 4PRHA 5B3NA 3UZQA 1XF4B 4QHMB 5E95B 1O7SA 4HEPG 3D2UB 4WIQA 4YHLL 1M6OB 3CUPA 5ESQA 3DVGA 3VXSB 5ERWA 1KIQA 2ED8A 3QUKA 4L4TD 1JPSH 4JFDE 4WDIA 3RGVB 2XQBL 4AK1A 3LQAH 1Y0LB 2WK2A 1IGYB 4KMLB 1IKFL 1WITA 1X5KA 4LEOA 4LK4A 1FH5L 1HYRC 1SYVB 3BP6A 3OKLB 1T7XA 3SGDH 1U8JB 5L7XH 2XN9B 2P47B 5I76B 5L8KB 3DUHA 4XC3L 5FO8A 3H3PH 4L1DA 4PGBA 1MAML 3EOTH 3C5SB 2DYPB 5I15H 3LRHA 1WZMA 1RUKH 1F8TH 3LSOA 5TQ2L 2NY5H 2IPTL 2VDKH 1YY8B 1NGQL 4HS6A 2BNRE 4CJ0A 3H0TA 2FB4L 3ESVF 4JHWL 1MVFA 5E8PB 4M03A 5T1KB 4Q9QH 4K8RL 5IVNA 4NKIH 3W9DB 1SVCP 1UJ3B 1G6RL 2I60L 2A6DA 1PJ9A 2CKBH 5GGTH 4LCUA 4R7NA 1P4LB 3IDXH 4M5YH 1JWMB 1QLRA 1PKQA 4R0LA 3QUMB 2BRRL 2MPAH 4PRDA 2FGZA 4H20H 4OD2B 3WUZA 3WLWD 5D2NB 2R2CA 4OBRA 4GSDL 4QCIB 2XKNA 1NEUA 3MRBB 5CILH 4PRPB 5DD6B 5TPWH 1MCQA 3MXVL 3RUGA 3OAZH 2EDKA 4KI5C 3TH4T 2CR3A 5LKNA 1HCVA 3JWDH 4U1SB 4X0KB 1NCTA 5LG1A 1UQSB 4Y5YA 3F8UB 4MNHB 4PJHA 1FJ1A 2KKQA 5AAMA 1U3YA 1NAMA 3BW9A 1NSNH 4IOIB 4Z78B 4PGZA 2EIZA 4GKSA 2FGWL 3KPQA 4DVBB 3FAXA 3MV8B 3W11D 3EW3B 2WAHA 1B4JL 2B0SL 3MPCA 4PBWD 3KYNA 1IC7H 1YNTA 4HF5H 3T65B 2CXGA 4C83B 3CFJA 3MRFB 4UZGA 5JTWA 4P2QD 3CCHA 4GW5A 4OF0A 4PJFB 4F2MA 3GK8H 3D48R 2H32A 1V7NL 1GXEA 1JNLL 4LLUB 4X6CA 4EI6B 3H9YA 3TV3H 3CC5B 4KDVA 5KSAA 3RP1A 1EO8L 1U8QB 1UM4L 4P4KC 3C60D 1IFHH 5SWSB 3L3DB 5CP7B 1QR1B 1WTLA 1U3HD 1D5XA 3EFFA 3DGGB 2IQ9H 1FZMA 5JW4N 1A1MA 1BM3L 4LSUL 2WLZA 4RFOH 1M7IA 5T3ZL 2P8PA 1RJCA 2OQJA 5I1EL 5IJKA 2ADJA 3FQRB 5E7FA 3OKKB 1A8JH 1KJMB 1FL3A 2CK0H 1DQDH 4Y16A 4ZS7L 3WFHB 4QWWC 4HULB 4QRSA 4IDLA 4ZFOL 1XF5B 1NLBL 5EA0H 1N7MH 1JPFA 3RZCD 1QSFB 5ICZA 3I9GL 1FDLH 4RGNB 5FGCE 5BMFL 1LILA 4NNXA 4PB9H 5T1MA 5JZ7C 3VXME 1MFCL 4HJJL 2NX5D 3X3FL 1MOEA 1CXIA 3QG6A 3DOSA 2ADFL 4F7MA 3CU1A 4O58H 3SE8L 2A0LC 5DF0A 3IFOA 2E3VA 2NNAB 1FCGA 1GGTA 3I6KA 3UBXB 3MRCB 1A14H 3VWJD 1CFBA 3SDCD 1NANI 3D0VB 2I9LA 3IAPA 4Z76B 3NA4A 5HDBE 3OGCB 4I0CC 1FNAA 5D6CB 1RZFL 1DUYB 5F1OB 3SBWC 1HI6A 1AGFA 1BIHA 2DD8H 4MS8D 3VRJB 4DK6A 2LAAA 4EZMA 3MLYL 1CFQA 4DOHE 4G8GE 5E00B 4FQIH 1U2CA 1FG2A 2PUQT 3X11B 1BGXL 4GS7B 4UUJB 2WSKA 4XCNA 1YECL 3TFKC 1L6ZA 3QH3A 2CLZA 2R8SH 4HX1B 5JPNA 3VFWA 3MCLL 3QFDB 2WNGA 4LIQE 3TNMA 1S7UA 2M26A 5EORH 1FYTB 4XNXL 3QI9D 1WWWX 4UB0L 3GMRB 4NM4L 3H9HB 4RZCB 2VSDA 4MCZA 2YMXH 1FSKB 1AP2B 1FVCB 3NCYS 5F96L 1QFWM 3VXUB 2OJZH 2H1PL 1KULA 4OFKA 4E41E 2E6JA 4NQDA 1MCWW 4YDVB 3L5XL 4QRRB 1BZQK 1IC5L 1NUNB 4MAYA 4Y5VB 1ACYH 1KEMH 1AY1L 5DFVD 2A6KA 2BVYA 3GSVA 4Y4HD 3WYRA 7FABL 5JW3L 1N4XL 4Z7UE 5E5MA 2X4TA 3LEVL 4G6MH 2FZ3B 2JELH 3EHBC 5J1AB 2V7NB 4U6TA 4NQCE 1C1EL 1I1AC 1T1WB 2VO5A 2ZCLH 3O3EB 3G5ZA 1UFUA 1MJUL 3A6BL 3AS1A 5IJVB 5SX4I 5JMOC 1JHKH 4OKDA 1K5NA 5EC2A 3B2VL 3V6OA 1PY9A 4FQXB 1FFNB 4Q6IA 5F1IA 5HYJB 2DDQH 4JFEA 5E1AB 3ARGA 3GMOB 3FB6A 4P5MB 1XIWB 2L4OA 2YKLH 3ZYJA 4ZDHA 2HFGH 5JOPD 3LEXB 4JQVA 1F3JA 3WFDH 3VH8A 5FYKE 1MCSA 1A6AB 1NBZA 5JR1H 2SEBA 5BZWB 4LOUC 3GSUA 4UNTA 5C0DB 2EDQA 3MRMA 2OBGA 3C2AL 3T0WA 5J57B 3SKOA 2EEBA 2I26N 1TENA 4ZAKA 3RY4A 3BKYH 3EYSL 2XWBB 3ULVF 1JP5A 2FDBP 2ZUQB 4DVRL 4QXUH 4QT5A 4JHAH 3H2WA 3MRGA 4XP5L 5LWYH 3FTGB 3RVWD 4PJXE 3KYOA 2X1OA 3TZVB 2F5AL 4N8VA 5JDSB 1BBDL 4K23H 3WNKA 5I18L 3VFMA 3NZ8A 2WBJA 3ES6A 1WISA 3BI9X 4C59B 4OGXL 4XBPB 1RJYB 5L7XL 4MD5B 2X42A 3P4MA 3OTTA 4OLWL 4FQPA 3EOTL 3V4VH 1G7IA 1N8ZA 4G8EB 1RUKL 3HZYB 1F8TL 1LNUA 4R2GC 1MWAH 2VZTA 3G5VB 3G6DL 2VDKL 5DD1H 4MNQE 1T0MA 2V2WA 1XH3B 4F7CA 4XBEH 3H6JA 1JGVL 2V5MA 4WUUE 5C6TH 3VG0L 5GGUA 3R06A 5MENB 1SMAA 2OM5A 3PXHA 3WHXA 1JJUA 5HVGB 3RTQA 3ZE2E 2CKBL 2ZUXA 5GGTL 2G5BB 1CE6B 5I1LA 4NFBA 2FECI 1BAFL 3CFKB 4D0DB 2G2RB 3HR5B 2F19H 1IEAB 2YK1L 3IJSA 2MPAL 4HT1H 4OLUL 5FF6B 2Y06H 1AGCB 1D9KD 5CBEA 4H20L 1YMME 3P2TA 5JO5B 5DUBB 3FB7A 5DVMA 3ZT7A 3RY6A 5TPWL 4OUUA 2XQYK 4ZOEA 3WL9B 2CLRB 5F3HA 1YC7A 5D1XD 3GRWH 1UH2A 4HH8A 5HGAA 3JWDL 3TJHD 3BHBA 4WEUD 4QHNB 1EX0A 1AXTH 3WE6B 3D39B 3QUZC 4RA3A 4HWBH 2YN5A 5IQ9B 1DLFH 1NSNL 1B88A 5DQ9B 1T1XA 1N26A 4P2OD 4I9WE 5KVDH 4KJWC 3QIWA 1NEZB 1MJJB 4MLIA 1IC4L 5GZNC 3LN5B 2HVJA 4HF5L 2Q87A 4X5WA 3KAAA 2DLTA 4WGVB 4YBHA 1QLFA 3NCFB 4NQXB 1HXMA 1AQKL 4YPGB 5E99L 1YUHB 3OJDB 2E8YA 3QDJD 4JO3H 4HGMA 1MCBA 5DUPL 3DVIA 4MVBC 1SBSH 3OB0K 2F53B 4PJEA 4RAVB 4M1DH 3BVNA 1F58L 2C7UA 1JF1B 5MEPB 4ZMAT 1ZMYA 1CDBA 3VH8G 1KJ2B 4ALAL 3MYZA 2HAZA 5GSVB 1H15B 3WS6C 2D4FA 1I3RA 2VWEE 2IQ9L 2A74A 3NCCB 4NWUL 4YX2L 2VR9A 3QRGL 2VAAA 3FCTA 3BMVA 1MLBA 2P5EB 3LKOA 1AO7B 1LO5A 4P4KB 3VFSB 4BSVA 4AIXA 2WIIB 1IM3A 5JQHC 3RWDA 2O5YH 2ZUSA 5EA0L 3MYJA 5DJZA 1F90H 2YD2A 3HCVB 3PGFH 5GRWA 3TBWB 4N8VG 3IFLH 4S11A 5I1GH 2CJUH 3TYFB 5CEZE 3B6SB 4PB9L 2W0LA 4KUZL 1BOYA 5DLMH 3GBLA 3F6IA 1NC2D 4LPUA 2ITDB 3AREC 3LZFL 1IVLA 1YMHB 2W9LA 4JR9H 2EZ0C 4O58L 1UVQB 3D6GA 1F00I 3G08A 1WIUA 5D7LB 4TULL 1LO2H 1WAAE 1CK0H 1A3QA 2OZ4A 3MLRH 1EEQA 4I5BA 3BSZH 5M95B 2MOVA 1UB6B 3SKMB 3NZHL 4XWOD 1BZ7A 1V3MA 3SKJL 1CL7H 3DBXB 5BS0D 3QNXA 3SQOH 4OQTA 4Y2OA 5DHYA 3T0ED 1OTUD 4F7PA 4DGIH 2ED7A 5EOQL 5D93C 4QHLB 4MJ6B 5IMLA 5D7SH 5ISZE 1MNUH 2NX5A 4FQIL 4I77L 4LGPB 2Y72A 1G0XA 4ZD3H 2QEJA 2WUBL 2BY2A 1ZV5A 1SEQL 1PZ5A 5C0EA 4KGJA 2R8SL 3SCMA 2EKJA 3R1GH 3SDCA 1PG7H 3ARXA 4M7KH 5D8JL 2VE6B 1IGFL 1F4WL 1BP3B 3V4UH 3MRRA 5EORL 5C8JA 3RVVC 2VZOA 2RGSA 3DURB 3HFMH 4C54A 1G9NL 1UKQA 2XY1A 1RULH 5F21B 8CGTA 5DJ8B 4PJGB 3QFJE 5E9DD 2ZUYA 1RAMA 1IEBB 2OJZL 1BX2A 4DZBB 4NKMA 4HKBA 5EPMA 4DKFL 4X6BA 1KCSH 2I5YH 3KPPB 1DFBH 2DI8A 1ORSA 3O4OC 5C09E 4HCRH 1EERB 4OCMC 4HKZA 2X9WA 4K7FA 5HYSA 3WLBA 3PGDA 1ACYL 4IHOA 3FQUA 1VSCA 5CUSH 1VEMA 3SN6N 5K9OA 3T08A 1CLZH 5D7IB 3QUML 2F58H 2A6IB 3CXDH 4I3GA 4KTEH 1NFKA 1CICD 1UWEL 2YD9A 3WFBL 3PL6A 5BJTA 2VLLB 4W6WB 1P69B 1U8LA 2ICCA 4GAJH 5GGVY 3AMKA 3RZWA 1ITBB 2AK4D 5DA4A 2DICA 4ODTH 3REWA 2ZOKA 2ZSWB 2UZIH 4Z7OE 2X1XR 3S35L 5DEZA 3D1MC 1J9CT 1V7MH 4UQ2B 1UM5H 3RL1A 4JPIB 1I1AB 3MACH 2V9RA 3E6FA 5E2WL 4YR6A 5HHPA 3MLXL 4GUPA 3LRSB 1LE9B 3VXNA 1U3ZA 1MHPH 1DUZB 4LVNC 2O26U 5JR1L 3MJ7A 4K94C 4U4BA 4XPHL 5LBSH 1H0DA 3OF6D 1OY3B 3WIFB 2A83A 3HB3D 2AGJH 2OI9C 4PY7A 5GPRA 3UX9B 3B9AA 5IMMB 1T4KA 1TITA 4LVHC 1A7QH 5E8NA 5ACLA 2YRPA 4QXUL 3PWVA 2HP4A 4R97C 1R5VA 1INQB 3RBGA 5A40E 3MRDB 4PV8B 2QADC 4M8VA 3DETD 4OCRH 4RIRA 5IHLB 3ROOA 3CXHK 3ZYIA 2HA1A 3C9NB 1ZT7B 4KJYB 2A38A 1VFBA 4H25B 1MAJA 2GIYA 1KJ2H 3DX6A 3MGTB 4JKKA 1QBLH 2QQQA 4XCCL 2PYEA 5E6ZA 1I4FA 2GTWA 1MHHA 3BYTA 5K9JH 4NHUB 2XV6B 3RWEB 1KCLA 2BNUA 3MUGB 2NY1D 2WBWB 4ELME 5DA0B 3OKDA 4KK6C 4TSBH 5ANME 3BP4A 3SDAC 3TBVA 1A4JB 2NY6C 2D3VA 5HI4C 1KENH 4M93C 5T3ZE 3UYOD 5I66A 3HPLB 4OZGE 4XBEL 3HG1E 3QXTA 5C0AB 1VACB 2WIMA 1O0VA 4GXVH 3TBYB 1GOHA 4UBDC 1TMCB 3PHQB 3QWOA 4BSJA 4XI5C 1E28A 4HG4J 1NCAH 1QA9B 5F9AC 3VFPB 3HRZB 4JGUA 1S9KC 1K4DB 1L0XA 2FJFB 3KPRE 4P0DA 1T1YB 4HIIA 4R4NC 5A2FA 3B4NA 4O2EA 4R2GB 1P7QB 1U8IA 2F19L 3MV9B 1MJ7L 2DLFH 3NPZB 4G6FB 3O9WD 4Z7WE 4HT1L 3ZHKA 1IC1A 3CH8A 3VD4A 1J8HA 2F5BH 3NCJH 2WMPA 2ZCKH 3BRDA 2VDPH 3GM8A 5JHLL 2DQJH 1MY7A 4X7DC 2DLHA 1A6PA 1VGKB 3HNSH 1HINL 4HLZG 1SEBA 5IB5B 4ZXBA 1BJ1J 4KVNH 4POZC 4F7TA 2E8ZA 5IOPA 4LARH 4H5SA 3GRWL 5KVMC 2HLAA 4KFZC 4M8QA 4XPGH 3TM6A 1NANH 3M45A 1GC1C 5F71A 4KKCC 4HWBL 1S9WA 5D7IF 1DLFL 5GGSY 3CSYB 4HIHB 1DQTA 1D9KA 3HZKB 3UZVB 2VQ1A 5IG7A 2M2DA 4Z7VA 1W72H 1S78C 4AENB 5J6GA 4P4RA 5EUOA 4XRCA 2B8OT 2YPLB 3QUZB 2Z35A 3GUTB 1SVZA 2LABA 4S1RL 4AEIL 3QUXD 3DMMC 2GK0B 1BEYH 1JZ8A 4NCC1 1RZJC 5SWZD 3VXTB 3N9GL 1NCCL 5BVPH 4PTUA 1FV1B 1TFHA 4M7ZC 3WN5C 1H5BC 3T2QA 3O45B 4PUBH 4Y2DD 4UV4H 3BN9D 4Y5XC 4OI7A 15C8L 1NFIB 3GMNA 5INCA 1EK3A 3VE0A 5HYQB 4ETQB 2N4IA 5E2TL 5FCSH 2YA2A 2D31B 4LF3A 3U2SA 3PDOB 4BZ2H 1UZ8B 5D5MB 5I8OH 5TJWK 5DJCB 3B9DA 3KPSE 3Q6FA 1ZLVK 4HS3B 1G9MC 1ZKAA 4PRID 1NFDE 1CG9A 3HZMB 1F4HA 4NSKB 4V1DD 1AFVH 4I2XE 2JJSA 3PDDA 4I0PD 3QO1B 3PGFL 3GGWB 3QEQD 2CDGB 3IFLL 2BERA 1SYSA 5C07B 3LKRA 4RGMC 3EO0A 1A0QL 2HG5A 4JPVL 1S7VB 5H35A 1HHGA 2APBA 4D0CA 4WU5B 4JR9L 1NMBH 1S9YB 5SX4H 2Q1EA 4G8IA 6FABH 1ZHKA 1UWXK 1UCTA 3KGRA 4ONOA 3MLRL 1FZJA 3BSZL 2C3VB 1RHHB 2JK5A 1S9XA 5DS8B 4MD4B 2DS4A 4PGEA 1LGVA 4WTWA 1IQWL 4UV7H 2XTJE 1TZGL 4PJCE 4WY7H 3AREB 1GSMA 4JFDA 2P46B 3S3PA 4KC3B 5FB8B 5KSVA 4J2XA 1XGYL 4XNMA 5E2VL 5D72L 5D7SL 4C57C 1JYXA 4S2SB 5I17A 2ZCHL 4XX1E 4PG2A 1NC2A 3R0MA 5IP4A 4JY4A 5IW1A 3KJ4C 2HTKD 3FRPA 25C8H 4LSTH 3O41B 3OAYH 3NIDF 5HI5C 1RK1B 3F12A 3QA3A 3FT2B 5JOPE 3R1GL 2VR4A 1Q72L 1OW0C 2KUTA 3BRGC 4KV5F 4XVUC 4M7KL 3SO3C 1KSRA 5D6DA 4JDTL 2BNRA 5D93B 4EOWL 3V4UL 1QTYT 5DD0L 4GG6F 4JDZA 4Q0XH 4ERSH 1A1OB 2X09A 3HFML 5BS0A 4XMPL 5CD5D 2NYYC 5CEYB 1CGSH 1A2YA 1A9BA 5KN5A 2VLRB 1PDKA 4P99A 3T0EA 1B2WL 4N1CA 3SE4C 3MCKA 4TUOA 5CLWA 4RDQG 2QBWA 1KIUA 3HLAB 4WW2C 3RU8L 1KCSL 2I5YL 1R3HA 5JHDD 1DFBL 1NDGA 4HCRL 4L9LC 3CX5J 4XCEA 1FFOB 4L4VE 1DSFH 2BSRA 3MRIA 4LAQL 4DAGH 4X6DE 3BDYH 3JV0A 3U9UB 2O5XH 2X7LB 5K59F 1LEGB 3MJ9A 2Z8VC 2GITB 3MV7E 4NBZB 2NTFB 4X8XA 1C5CH 3CVHB 3V6FB 5C08B 3LN4B 4FQLH 4HZAA 4KTEL 5IVXE 3O4OB 4OLVH 4XHJC 4R7DA 4PJBB 1EO7A 4GAJL 5D96C 5JXEC 4XP1H 1YYLH 3HUJB 1LO3H 5IROC 4GAYB 2F54D 1X5YA 3U6RB 2B5IC 1TZHA 4ZUUA 1V7ML 2MNUA 3QBTB 4JVPA 4AH2B 3QULB 4AM0B 1U92B 1O7VA 2PTTA 3PHOB 3C8KA 5D1ZD 4P3DB 5ITFA 5IWLA 2R56L 1DBJL 2J8HA 4XNYH 3UJTH 4LU5H 3O2DA 1HH6A 1WIPA 2AXFA 4D9QD 1MPAH 5LBSL 4DZ8B 2V17H 3VXPB 3BH9A 3W82A 2NW3B 5DDHA 5I8KL 3UTSE 2AGJL 2P8MA 5CJQL 4MA3A 4S0SD 1A7QL 1QNZH 4E42A 2BVQB 1BBJB 3SHSA 3ULSB 2BSTA 2FNBA 1SJHA 2J4WH 3RY5A 4EDWH 4LP4A 3JTSA 4LVNB 5DHVB 1VFAB 5IHZA 1FC2D 1N64H 2PN5A 4KK9D 1TZIA 4XNUL 3CSGA 3HS0A 5EBWB 3MODH 2OI9B 2NR6D 1YEGH 4GKZA 1KJ2L 5DK0B 4ODXA 2Y5TB 1QBLL 4L3ED 2VR5A 1U8PA 4LVHB 2DQEH 5F9JB 3BRFA 4OKVB 2P45B 3OF6A 3L3IB 5K9JL 1FPTH 4G42B 4S0TD 3ZE1F 5C0JA 4OGYL 4U1KA 3FFCB 4FZEH 4G7VH 1IGTA 2KH2B 2QADB 2QSCH 1DCLA 3QXAB 5DT1H 2CIKA 3VXMA 3JV4B 3PQYD 1KENL 3ME0A 1HXYB 1R0AH 2BNQD 3HPJA 2DWDA 4K3DH 5F7MC 2BVPA 2C1OA 1KIPA 1CQKA 1XGQA 4JVUA 3C5ZD 4E0RA 1KPUB 4GXVL 4XXDB 3FRPG 3GSWB 3I6GA 5EU7E 3OB8A 2IALA 2EE6A 1CLOL 4N0FB 4B50A 1JN6A 2KL6A 1DQQB 1JZ6A 1I1FB 4GW4A 5GRUL 3MRKA 2NW2B 3SDAB 3W0WD 2DLFL 2NY6B 4M93B 5DMGC 3B9KD 2R29L 1MQ8A 2F5BL 3NCJL 5E08L 3N06B 3VDCA 1J5OL 4JFQA 3ARDD 4PJAF 4FFWC 3JTTA 1FNHA 3DX7A 1FO0A 4G8GA 5DZNA 4C56D 1G7QA 2NY2B 5KS9B 3VFVB 4D94A 1PD6A 2AK1L 5DQJA 3CH1A 4LARL 1MIML 3HE7D 1KXTB 2K3TA 3ULUD 3I02A 5IMKA 4IMKA 1CDCA 3G5YA 4XPGL 1NAMH 4DTGH 5TFSL 4FQQA 4QRUA 2CDEA 4LNVA 4KRPB 3ZKMC 4ZUSB 3BIKA 4X99B 3WNPA 3THMH 4UU9B 4HIXH 4R3SB 2AV7A 4JVWA 1X4XA 2EYSA 4LCYB 4ZG1A 2H32H 3OXSB 1TXKA 3PABB 4E41A 1DL7H 3QQ9C 1ZHLB 4JFOA 3QIBA 1CZ8H 1YPZB 4FFVC 5KJRH 4QRTA 2YA0A 3BGAA 5JOFB 4UT9H 1T5XB 4Z7UA 3UC0H 4OZFA 4DFIA 5DI8A 3SQBA 1WCBA 2X89D 3WXVL 4L8SA 3TVMA 2UY7A 3C6LC 2X41A 1N5YL 4NQCA 3GSRA 4PUBL 4X83A 2X70B 2DQCL 12E8H 3EYVB 4WNQB 4PRAA 4N1EA 1I85C 3CAFA 5IV2A 1U8OA 2VLKD 3OJ2C 5ENWA 3ILPA 2JIXD 4UDUA 4D2NA 1VCAA 1UXWA 4NPYB 1B4RA 4DGVH 5AZEL 3DMMB 2FWOA 2EKSB 4PJ8A 3CVHH 4M7ZB 5C2BL 2ZPKL 5FAAA 2XOTA 5GIRB 3WN5B 5ID0A 1H5BB 1R3KB 3MRLB 4Y5XB 1EHAA 3MNWA 4HAFA 4OLXH 4O5LH 4XTRD 3ESUF 3F7QA 1CXHA 5J7CC 3FOMA 4NZJA 1QSEA 4PLJD 1YEFL 4Y2DA 4JCMA 1FIGH 4N8CH 5A16A 1GGIH 5D2NE 5FO9B 1NMBL 1CXEA 1GZPB 1T2XA 5IB4B 5HDLA 3PWJA 3QIUA 4PRPE 2BSSB 1BWMA 1J87A 4OLZH 4RBPH 2HRPH 2VQTA 1QBMH 1KTLB 4GO6B 4HWZB 1U8HA 2X2YA 1MVUA 4JRYB 4NO3A 2X4PA 4RGMB 4XH2B 4UV7L 2H6PB 4PJXA 1DQMH 1CFSB 1E6OH 2CUHA 2HFTA 1AIFA 1Z3GH 5E6ID 5JIHA 4CRPA 3QEHB 5ADPH 3LKQB 3DRTB 5T1LA 1CVRA 4Y89A 4OZHF 4QTHA 3RRQA 4RNRA 2Y6SC 1Z2KA 4ENEC 2AJ3A 4K94H 1I9IH 4CMHC 2Y7QB 1SY6L 5IFJA 4PJFE 4LSTL 1KCRL 5B3JF 5JLZB 3QAZC 1NBVH 1S7SA 1X5HA 1CIUA 4D3CL 1CT8A 4N8PA 1T83C 3GJFA 3LKPB 4MNQA 1FLTX 2VH5H 3K3QA 3RVUC 2BCKA 2Y07L 1HEZB 4ERSL 4WUUA 5KAQF 5SWSE 2XG5A 4L8BA 3MLTB 1CGSL 5IGXL 1DBKH 1KJ3L 3KJ4B 3UPRA 2XYCA 2JTDA 3SJVD 5KG9A 1KN4L 3BX7C 4O02H 2VDQL 4YHYC 3QXDB 1XR9B 4URTB 5F7DA 3SO3B 1BVKB 1A1NB 4ODSL 5CFHA 2WINA 4APQA 1DSFL 1A7NL 1P9MA 5CJOH 3P30L 4DAGL 1JNNH 2O5XL 2ORBL 4P9HL 1T80A 1OP3H 3LIZL 1KXQE 4P2RA 1FNGA 2IJ0C 1S7TA 4X8JA 2DJ4A 2ESVD 4RGNE 3KXFB 3VWKD 1N0XH 4WW2B 3TO4A 4FQLL 1CDUA 1NC4A 2P42B 1C5BH 4OLVL 4K7PY 2FECL 3V95A 2XA3A 4L9LB 4GMTL 5EUKA 3ULVE 1WLHA 2EDYA 4OZFG 5TF1H 1XCQB 4O2FA 4QRPD 3MJ8B 3UTPD 4NDMA 4QOKB 3SDXB 5F88B 3EO9H 4NUGL 5IMOA 3VFNA 3V5KA 1KCVH 5HHOA 4D9RD 4LHUB 3QISA 5JQ6H 5FYLE 5IM7B 3TGXA 4OV5A 5CCKH 2A1WL 5D96B 4BH8B 3OX8B 1MPAL 2APVA 1U8KB 1OCWH 2B5IB 1WBYB 4ZPVB 1AKJB 3AY4C 3JXAA 4HGWA 4B7IA 1FL5A 1OM3L 4QLRA 1EGJH 1E0OB 3K8MA 4HJ0C 4OFDA 3X13B 4G80B 2YUWA 1GL4B 3IRZA 1JHTB 1K4CA 4M43H 5EU6B 1AI1H 3DXAB 5B4MC 3V2AR 2J4WL 3BEVA 4EDWL 3ILQD 1I9RL 2EXYC 1J8KA 5DRNA 4NO0A 1K6QH 2ATPB 4GBXD 1G7MB 2QSTA 1WV7T 4Z95L 1J0HA 1JFQL 2PO6A 1FYTE 1RUPL 3L3OA 3ZDXF 3TT1H 5DYOB 2MFNA 2YN3A 5EO9A 2YPKA 1WSST 4CAGA 1NLDH 1KNOB 5E56A 1FPTL 2JB6B 3WFCH 2GAZB 3VXUE 4H88H 5CS7A 4GRLD 5DD3H 2QSCL 4DKAA 3MLZH 2XPGB 5DT1L 5CZVL 5ACMA 3I75B 3BZFA 3IFPB 1FNLA 2DWEB 4K3DL 4J3UA 3WIHL 2HKFH 1YEIH 4IIQC 1LD9B 5CIPA 4WWKA 1IAOA 4N9OB 5T3XD 1YDPB 3V6ZB 4U1MB 4PD4K 1HQRA 2Q7YA 3BO8A 4HWUA 1WAAA 3MMEB 5SWZE 5F9OH 2PXYD 3WNLA 4RSVA 4WI8A 3MREA 4HWEL 4M9OA 4L3EA 1V8HA 5F6IC 1U58B 1G9MH 5GS0H 1H3VA 1G7PB 2UWEB 1CXKA 1PG7X 3SGKC 3VW3H 5HYJE 2W0FA 4IRSA 1FAKT 3F7RA 5ISZA 3BQUA 4Z0XA 1UCBH 5CP3A 4YE4L 1Z5LB 4XNQA 3UTTD 2H41A 2QJDA 3STZB 2AS5M 2AABL 3AS3A 5E7BA 1EA9C 3T3MF 3KYKH 4FG6D 3G04A 3CPLB 4ODUA 2VABA 4X98A 3QEQE 5D2LB 4LAJH 1AGDB 1A6TB 4HKJA 3TA3D 3B5HA 3W0WA 3FO2B 2CDFB 3GSOA 1HIML 1X9QA 3FMGL 5HPMB 4Y19D 1JWSB 5BV7C 2CGRL 4O9HL 3QFJA 2DM2A 1NGXB 2Q3ZA 3U36A 5I19H 1GHFL 1FE8L 3SDXF 4XZUA 4QXGH 3S88H 3VXQB 1DL7L 4H1LA 4CADA 5I30H 1Q94B 2A6JB 1CE1L 4NZRL 5KANG 5KJRL 1OWWA 1S7QB 4CU6A 3CFEB 2A2QT 3HE7A 5D7KD 5B8CC 1NJ9B 4UT9L 3V5HA 3U7AA 3FB5A 5FKPB 3UC0L 4OZIB 3K4ZA 2W65B 1M05B 3SE3C 1WFOA 4NRYA 4TUJA 4MJIB 3JWNC 5E70A 3OHXB 2VDOL 2GY5A 2Q8AH 1SMOA 4P23A 4EN3C 3LS5L 1FZOB 4PJ9B