3M7FB

Crystal structure of the nedd4 c2/grb10 sh2 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
176
structure length
135
Chain Sequence
ELHNDDTRVVRVKVIAGIGLAILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENDDFLGQVDVPLYPLPTEPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPTHLPHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 10
publication title Structural Basis for the Interaction between the Growth Factor-binding Protein GRB10 and the E3 Ubiquitin Ligase NEDD4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/ligase
total genus 25
structure length 135
sequence length 176
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3m7fB00
2NQ3A 4PS8A 3W56A 4TUUA 4L1LA 3TWYA 4Y1SA 1A25A 1GMIA 4PS7A 4L23A 4QJ5B 1DJWA 4NP9A 4ANUA 4QAMB 4V11A 3TL5A 3ZW3A 1QASA 3OHMB 4DNLA 4FHKA 2YRBA 4OVUA 4TS6A 4PS3A 4WWOA 3ML9A 2DMGA 5H4YA 4FADA 4HLEA 3HIZA 1RH8A 2ENPA 4ANVA 3APDA 1YRKA 2UZPA 1DQVA 2RD0A 3B7YA 5EDSA 3L54A 4GNKB 3SD5A 3OAWA 4FA6A 3ZIMA 1BYNA 4FJYA 2ENJA 3ZVVA 4AOFA 5H4ZA 4WAFA 5CCHE 2K4AA 1V27A 3F04A 2WXNA 4XE0A 2X38A 2K45A 4WEEA 3M7FB 5CCGE 3T8MA 2CM5A 1E8XA 1DJZA 1E8YA 2A4ZA 3GPEA 4KZCA 4L1BA 2Q3XA 2CJSA 2WXRA 4EZLA 1DJHA 4FHJA 3W57A 1UOVA 3L08A 4BFRA 3FBKA 3N5AA 2CHZA 5G55A 3L17A 5G2NA 3QARA 3R7QA 4LT7A 3S2AA 4KZ0A 3F00A 3PFQA 2ISDA 3PREA 3IM1A 4OVVA 3F01A 1HE8A 2EP6A 3QJZA 4ICWA 2LHAA 1DSYA 2ZKMX 3QR1A 4KITB 1CJYA 2FJUB 2WXQA 4A55A 1K5WA 1RSYA 2BWQA 4DK5A 3HHMA 2WXLA 1DJXA 4IHBA 4ANXA 3DPDA 3L4CA 2K3HA 3F05A 4LCVA 4NS0A 2V4LA 4NPJA 2D8KA 2WXIA 3HN8A 2Q0ZX 3PYCA 5JHBA 2N1TE 3NZSA 4HVBA 3CSTA 3QAQA 2WXOA 4Y1TA 2B3RA 4FJZA 4ICXA 4JPSA 3APFA 3R7RA 3DBSA 5CCJA 3IBEA 4BGDA 1DJGA 1E7UA 2Z0UA 4L2YA 5T8IA 4QJ4B 4F92B 2WXPA 4G11A 2CM6A 1W15A 1WFMA 3RPBA 3TJPA 1W16A 2A5UA 4TV3A 2CHXA 1E90A 2QZ5A 4MJJA 2Y3AA 4WWNA 3KWTA 4ANWA 2FK9A 4AJWA 2JQZA 2YOAA 3RDJA 3L9BA 1E8WA 4F91B 5KJ7E 2WXMA 2NCEA 2CJTA 5JHAA 1BCIA 3FDWA 4F1SA 4URKA 2QZQA 3QK0A 1RLWA 2WXJA 2KI6A 2WXKA 3NSJA 3ENEA 1E8ZA 4IQHA 2WXFA 2K8MA 1DJIA 3NZUA 4EZKA 3L13A 1TJXA 2WXGA 3APCA 4F93B 2ENQA 4FLHA 2CHDA 4XZ4A 2NSQA 4WWPA 1WFJA 2WXHA 4QJ3B 3CSFA 4EZJA 2R83A 3KWUA 3JZYA 3LJ3A 4FULA 1E7VA 1UGKA 3ML8A 3P2BA 4NPKA 3PRZA 1BDYA 3L16A 4GB9A 1TJMA 2CHWA 3MJWA 1UOWA 2DMHA 3QR0A 3PS6A 4J6IA 4LDCA 1QATA 1DJYA 4XX5A
chains in the Genus database with same CATH superfamily
4Z76B 4DZ8A 4HG4K 1TTBA 5L4FA 3P1VA 1B6DA 3K2MC 5F9WB 1DFBH 3RIFF 2VLMD 4XXDA 4WK4B 1FVDB 3ZDZE 1TENA 1D3CA 3TCXA 3TIEA 4NM8L 3G5XA 2A0LD 3EDKA 4XO3A 5D96B 2ZYRA 2YA2A 4UIMB 1KXVC 5L7XH 1F2QA 1I7RA 3R8BB 3BT2H 2B7DT 3TBWA 1U8QA 2MHAB 4N0CD 1MQKL 4EUPA 1TCRB 5FR3A 2YN3A 1IB5A 4UM8B 2YEZB 3MXWH 3LHAA 3QIUD 5DJ6B 1KC5L 1H6UA 1EVTC 1MW2A 1XGQA 2EC8A 3FO0H 1LXMA 2G5RA 5M7QA 4JKKA 5FO8B 3KW7A 4IRZL 1ES0A 3LKNA 3Q2CA 2OL3H 1CR9L 4Q56A 4TVPL 3BHBA 3CFQA 1OK0A 5F0JB 1SLVA 2NY4B 3KBPA 4LASH 1XMEB 1B0RB 1J0ZA 2JIXD 2VDML 3ZU8A 2F08A 4KKZA 2BFVL 1MQ8A 4UQ2B 4XPHL 3DDFA 2V8LA 2ZXDA 4WEUD 3TA3D 1UATA 5IIEA 4PREB 2UXFA 3V4PB 3N1MC 3RRQA 3F05A 4TNVK 3F5WA 2WN3A 1NFDE 1F4XL 1M3IA 3MRJB 4PV9B 3ZN6A 4OZ4B 3R1GL 1S9YB 1NAKH 1PD1A 1QRNA 2BNRA 5T3XD 2WXPA 4TXVB 2EIMB 3ME0B 1T1YA 5L8LB 3FTGB 4AH2A 5FB8B 4HJGA 1MFEH 3HFFA 3GJEB 1GC1H 4MD4A 1T20A 5HDBE 1BZDA 3WYRA 4JRXE 2HT2D 3BP6A 3NA9L 4LVNC 2RMNA 3PCYA 1N4XH 2AEIT 3D0LB 4G6FD 3P9LA 2X1XR 1EGJH 5D4IA 5I18H 2J1YA 2FSEB 3O8XC 4UQAA 2OMVA 4GI6A 1CT8A 1PZ2A 2EDHA 3COOA 4FNSA 4MXQD 3EOYG 1B2YA 4PRIE 3FB5B 5KJRH 1N59A 4FI7A 4DP8X 4IU2B 3LJ3A 4MAYC 3BSZA 1XGYL 1RQ5A 5D1XD 2R0LH 5C08B 2MSPA 3DJSA 1QI3A 1X4ZA 3S34L 2X4NA 5DJDB 3BQUA 5F96L 4LSPL 5KYUB 5MERB 5C6WH 2ITCA 1F4YL 3NACL 4LEBA 1A4CA 2Z1KA 4MJIB 4OCMC 3NGBB 3IS0X 3QCVH 4PWIA 4EI6A 2WO4A 4L5FL 1C1EL 4ZG1A 1IAMA 4UTAA 4KKAD 1A4KB 4LLDA 3RJOA 5ISZE 1GY1A 3BVXA 1LEKA 3RL1A 3FTVA 5EU3B 1Z9PA 1ZVHA 4UANA 2Z8WC 4X7SH 1JERA 4ZS7L 3ML9A 4A39A 4BK4A 1TETL 5A6IA 4LOVA 1GPOH 1MWAA 3RVUC 4UMSA 2R1WA 5BW7A 2HRGA 2ETWA 4D9QD 3FQ1A 4LSTH 3OX8B 1T5WA 2OP4L 2WQXA 3QJFA 4F9LA 1ANUA 4HPOH 1CLZL 1EEQA 5KVFE 2HT3C 3U7AA 1VGEH 2BSTB 2DQTH 4PJIE 4MMZC 3MN8A 1VCAA 2BZ7A 3QPKA 5AB2A 3WAJA 4HYTB 4JCMA 3VGBA 1SF5A 3NIGE 4BE6A 4KVCH 4DZBB 1B9KA 3WFZA 1SVBA 3F00A 3NPSB 1A6TB 3OC8A 4OUOA 3A6OA 9CGTA 3VNYA 2Y7NA 5ALCL 1JZ7A 2EYTA 5HXMA 3X1EA 3N1PC 4X5WB 4P2OD 4FNTA 3QEUA 5DHYA 2GJJA 3BAWA 2A6JB 4CKQA 1L0YA 2NZ9C 4M6ML 4S0SD 1ZWIA 2APFA 1UWEL 2GK0B 2JE8A 4WY7L 4DN3L 3BKYL 3EGXA 4XNXH 4Y1TA 3RVVC 5HY9B 3EXLA 2QKIC 2C9PA 3LHPL 5DRZB 5LBGA 5JPMA 1J86A 4L3EA 1L0PA 3PPSA 4Q14A 4AYMC 4JREC 1FE8H 1LK2B 4KTDL 4H5SB 4HEPG 4EOWH 1IVTA 4WWKD 1T03H 3PUUA 4RBPK 4PGCB 5DRWA 4EPSA 4FG4A 5IR1A 3SKNA 4FQ1H 3D12B 4XO4A 1C5BH 1H5BA 4G7VL 2YXWA 3SO3C 4DN4L 1D9KC 4LL9A 3BWUC 2G4EA 1L4IA 4NJ9H 5ITBL 1HHIA 4WRLA 3UGUA 4PCSA 2P5EB 2VL4A 1BIIB 5EOTB 4FHBD 3HPLA 4PJ5B 2YEQA 1D5IH 3IETB 4Y1AB 4UT6H 3U82B 3KE0A 2YZ8A 3QUYD 3R19A 3NH7L 1GR7A 3RP1A 4AYGA 4MBOA 2PYEA 2Y5EA 4WKZA 2HRPH 3QO0B 4ZQTA 4AL8L 3QWRD 2VLKA 4PLNC 1CGWA 3WTUA 4K7FB 3IAPA 2V5MA 1L6XA 2PXYB 4PLJC 5MHSD 3PS6A 2Y5QA 1BD2E 2EO9A 3N9GL 3OJMB 3PGFH 4BH7B 4J1UA 2BY2A 3B2VL 3OKLB 4N2CA 2EZ0D 2J8UB 5I0DA 1R6VA 3Q44A 4HUNB 4GP4B 4UCFA 4PJEA 3GK8L 4WUUA 2XOTA 3BVNB 1F6FB 1KEGL 3I75B 1YEEL 3HZ3A 4NRXA 2IH8A 2FATL 1TQWA 4D0DA 4W9JC 1PQZA 1IEHA 2APTA 3DX6B 1OAJA 5CXPA 2RQEA 4CSTA 2ZJSL 1G7HA 3VXUB 2OXGB 3NFSH 5KG9B 3QCUL 1MLBB 2F0CA 4Y4HB 3AG4B 4JL1A 2Z91A 3APNA 2DQCH 5DJAB 4JM0A 2ESVD 4TPRL 3VA6A 5DMGC 2WHVA 2PO6A 3L1FA 1JZ8A 2R4SH 4G70B 4PRDA 2XUWA 5AW1B 3PWJB 4H13C 4KZ0A 2VJ0A 4I5BA 5F1NA 3UAJC 3L5JA 3LZPA 4IRJC 2A4EA 1NCAH 5LAXB 2XBDA 1UENA 3SZKC 1SHWA 5D7HA 2J4WL 5T3ZD 3BKMH 5EU6B 3LXAA 3DYPA 1CFNA 3EOBB 1MCEA 1IGFH 3QUHA 3ZTDC 2HMIC 1D6EA 2HXAA 1I9EA 1I9RL 2QSQA 1KTJA 4J3OC 4TLSA 2VABB 1OCWH 4R26H 1X5IA 4AENA 4OCRH 2Q0ZX 1W0VB 3Q8EA 3PXHA 3LB6C 4I18A 4NCDA 2YK1L 2H32A 2J7LA 4U1JA 3KL3A 4ISVB 3DI2B 5F9OH 4ZTOH 3GMPA 1VF5C 5C09D 1ECZA 1XCTA 5EUOB 4AQ1A 5M95B 3GIVB 3LNHA 4LF3A 5CU5A 3SKMB 4Y16A 4GEIA 5BRQA 4PWFA 2CHXA 4PJXE 4OLZH 1ERNA 4QI3A 3ILQC 1F45A 1E6OL 3RPIA 3VFWA 2YOAA 5IW6A 4K71C 2IXQB 4QOKB 3DSNA 1OM3H 2DV6A 4EN3B 3CFBA 3VFVB 3TESA 2YPVA 4ZW5A 1HHJB 2EEFA 2X3AA 4P5SA 4KMQA 2P80A 3ARDD 4FQCL 1OTSC 3FB7A 5BZZA 4DKDC 3BT2L 2BIQA 4JE0A 2GT9B 2XN9E 5JW4Q 1PAZA 3PL6A 1QTPA 4FFVC 3QUMB 3VI4B 3QPQC 3I85A 1T80A 4YHKL 2QPUA 3WGVB 2KBGA 1QLFB 3BMWA 4AKQA 1SLWA 2EDQA 3WN5A 5JXEC 3WFHA 3ZT7A 3MRMB 1DCLA 5LVEA 1FORL 1E9PB 3V8OA 4N90D 3CMOL 2BSEA 5EN3A 5ETUB 5GHWL 5ID1B 1FO0A 1UD8A 5HYJA 4AITA 5I9QC 2ZOOA 4MJHA 3KPNA 1IBZA 2J71A 1B90A 2Z34A 4U1HA 2P7TB 3MRFA 4YUEH 4QRQB 1W9XA 2DIAA 1AP2A 1MNUL 5EULV 4CRPA 5GGVY 3QWNA 4OZFA 2VR3A 1FA4A 4TM9A 3EFDL 3UC0L 4ZMWA 1OT4A 4U49A 5AYUL 3LS5L 2UUDK 1VAHA 2MNWA 2YJLA 1DVFC 4LOUD 2E74C 4PJ7A 4ZMLA 1CLCA 3A22A 1UC6A 1XF3B 1M71B 1CQYA 2ICEC 2I07B 3UYOD 3DGDA 2OL3B 3FH7A 3IJSA 1QYGL 3O9WB 3MV9D 3JV6B 4AQEA 4J4PC 4X7FC 1MFEL 3QARA 4WO4C 3KPQA 5J11C 3ETSA 4I85A 5CZKA 1BPVA 3KR3H 5JDSA 3F3HA 4P46A 1LO5B 5IQ7H 1XAKA 2LHAA 4OZIA 1N4XL 3KBEA 3KGSA 1P4LB 2Q5BA 3MBEC 3QORB 3QR1A 3QXAA 4JM2C 4JB9L 4PPTA 4UQIM 3VG9B 3VXRB 4G7SB 4D7PA 2RCSL 4MAUH 2KERA 3N40P 3N91A 5DS8A 2PP8A 3MBXH 4OF8A 2XT1B 4IIZA 3QIWD 4FNRA 5DUBA 5C0EA 4JVUA 1B6UA 1ZTXL 1F41A 1NAMB 4K0OA 5JQHC 3L9YA 4LVOC 3IEAA 3IBEA 3QJRB 3UBXI 4XB3A 1HINH 1QEWB 2R51A 1DCEA 2ED7A 2ZWKA 3LMJH 4H1LG 2AP2A 5AZ2H 3IGKA 2K1MA 2LT9A 4PJHA 1PW3A 5DURD 2BVPA 2H3XC 1RUPH 4MS8D 3FU9A 4A6YA 1DBKH 4HWUA 4GAYB 4K3EH 4FEMA 5IFJB 4PY8J 4YL9A 3ZTJH 3MREA 5SWSB 4OR1A 4CU7A 5B1JC 1T04A 1BPLB 2JJSA 2ERJC 3RUGF 1JZ2A 3OGCB 1KIUB 1L9SA 4Q9BA 2XV0A 4XVUC 4MA1B 4ETQA 3M17A 3FC8A 4R4BA 1E0OB 3UDWC 2GUOB 3SCMB 4E42B 1Y1DA 2DQTL 4FERA 4EZJA 5HHMB 1MVYA 3B3IA 4Z5RA 3MXVL 3EH2A 3FRPG 3VXMB 1M42A 2WWKT 3P73B 1KY6A 1CFBA 1MFMA 3GHPA 1PZBA 3D6GA 4XH2B 1P7QB 3WIHL 1PZ3A 4FQQA 4R90H 3L48A 2XWBA 3FQNA 4NQVB 3OR6A 2VDOH 4KNTA 5F7LB 4E9WA 4NQCB 4KKCD 5CLZA 4Y19D 1FC1A 1RERA 2BSDA 4R97C 1HIMH 1I1AD 5C6TH 3BLPX 2Y7MA 3HG4A 3T08A 4BRVA 3C75A 4I77H 5A2AA 5I8OH 3G08A 4Z3FA 4IEFB 1FF5A 4FKKA 1MSPA 5D7JA 3JV0A 1TYEB 2XPYA 3QFJA 4ZMYA 3QQDB 4XNXL 3WSQL 4HZAA 3SGJA 4GW5B 3L9RA 4RX4D 2XFXA 4YC2C 3JT2A 1FFOA 4P4KD 1IGCH 1ZVSA 1BWWA 2W95A 4QXTB 2HVBA 6PCYA 4J23A 3T65B 1YSOA 4FQ1L 3KYMA 1FVEA 4PRID 1JUFB 1L9TA 3QXVA 2JKJA 4GYBA 4N2BA 1KULA 1MEXH 3HNSL 4TULH 2ZUYA 1SXSA 3E2HB 4NJ9L 2UZXB 1KN2L 1WO2A 3SDDA 5E1AB 2YPKA 3LDBB 4KJQC 3FTUA 3UTSB 5B38G 3T4YA 1I3RB 1XTLA 4KO5A 4J3OG 4MFHA 4LSUL 5D5MF 4UT6L 1EHNA 1KJVA 2R2HA 2Z1PA 2Z64C 3QS2A 1CMOA 3GS4A 4UT7H 1HYSC 2XPGA 4K94L 1HXKA 4NP4L 4Y2DD 3MFGB 2OX5A 2N1KA 3KXFA 4K8RH 4LHUA 3OAZK 4AM0Q 5I6MA 1FC2D 5D7LB 4K07A 2Q6WB 4G83A 4N8CH 3DJ9A 4WU5A 2NX5A 4FXGB 4LLYB 1Q0XL 5F44A 5ESQB 4FLOA 1G7QA 4XOBA 2WB7A 4JFHE 4YO0B 4NAQA 1ZANH 4XWGH 5SWZB 3FO2B 1NCDL 3SJVA 2MH4A 1H0DA 2XWTB 4N6RA 3RJQB 1FYTA 2EIDA 3LZLA 3WLWD 1BVOA 3DV6B 4NHUA 2VW6A 2BW5A 1EO8L 3K0YA 5KVMC 2W94A 3K71A 1H3TA 3N0PB 3L6FA 4KK8D 2CBOA 2ADFH 4U1IA 2W07B 3BAEL 1IC7H 4HZ1A 4Y4KA 1SF3A 2B59A 4NSKA 1CICC 1TQBB 5KYWB 4U1GC 1EMTL 5CZXD 2X6CA 4KQ3L 3ZE2F 3ZSTA 1QKZH 4HIEB 4NPKA 1ET7A 2DQCL 2ENYA 4EKXA 4IRZA 4XBPB 1G87A 5LNEA 4PJBE 3JV5A 1KCSL 3QISA 2WWMC 2YD0A 3MMEB 3EBIA 4MRCA 2KYIA 1IFHH 5EU7C 3DPBA 3HC3H 3T77A 2ZXWB 4QO1A 5CD3B 5F88B 5IHUL 3V0VA 5D2NB 1WT5C 4Q6IB 2BDNL 3S5LG 1DHKA 1RHFA 3HC2A 2X89A 5IROD 3NJGA 2UYLA 1OCWL 3FF8A 3FU8A 3SD5A 1MNNA 4CGTA 3G04B 5BQ7A 2FQFA 4NQSB 2XVLA 4DFHA 1BYOA 3VAEA 5FWRA 4EN2A 2BWIA 3CDZA 5F9OL 4BSJA 2XWDA 5AOZA 4B27A 1E8YA 1BVLB 3IU4H 1DANT 3BXNB 3DVNA 1YC8A 3EZJB 1K2DB 3OTTA 3QEQE 5FYJH 2O5ZH 4O2EB 3SDCB 2KZBA 4HIQA 2B77A 2XU9A 5KYYB 2Z31B 1KT2A 3VGFA 1IKFL 1HILA 5DEFB 1IU1A 4WF7A 2I32A 1JYNA 1DBBL 3JVGC 3AACA 4S1SL 3US1A 2GUYA 3B9DA 3L1EA 3TEXA 4QKXB 4LIQL 4GSDL 2BP8B 3IJ9A 1PG7H 1ZLDA 3M6DA 3T6ZA 2OYLA 3U0WH 5EIVA 5AB9A 2FD6H 4AJVA 5C2BH 4CW1B 2ZP8A 3VX1A 2KQNA 4DGIH 5E00B 5DJYB 1LP9A 2NXYD 5IMLB 4K5LA 3B9KB 4NKOA 2YMTA 4Q58C 5EZIL 5HGBB 2DBLH 2DW5A 4LLMA 4LU5L 3GM0A 2A5UA 4HIJA 4JDTL 5SX5H 1UJ3C 4JKMA 4AJWA 1V3KA 2W65A 4QHKI 4K3DH 4XPBL 5KANI 1EBPA 4QHPA 1AE6H 5IBTH 2B2XL 5F3BB 1WWAX 4HS8L 2OK0L 4PTUB 2KI6A 4XN2A 5EF2A 4ONHB 5AVTB 3S8GB 4OQTH 4LOFA 2ZWZA 5EBWB 3BP5A 4GRLB 1I8LC 2NNCA 4LNRA 4P59L 4PN6A 3VD7A 3TF4A 4IMKA 5DD1L 3IJYA 4JJ5B 3E3QC 3SPVB 3V8CA 43C9A 1QD0A 3M46A 3CZFA 1QFUL 3S98A 5HHQB 2AVFA 3D2UA 2X4PB 3W9DB 5IBLD 2IBBA 1C7SA 2J21A 3V7AG 4PS4L 3UJTH 1ACYH 2E0PA 4B96A 4ZW8A 4MA3B 3SBQA 4XBEH 4Z1PA 4YX2H 3E80A 4L29B 4R84A 3J27A 5PAZA 1ZLWK 4FGMA 4H8WL 3V6ZB 2A4CA 5IQ7L 1QBLL 1H9VA 3C09C 5EO1B 2IJ0C 4UWQB 4JFEA 4Y4FB 3OM3B 2HT3D 1OZTG 4OLXH 3AREB 2QL1A 4OLVL 1G5AA 3QC6X 4IW4C 4NWUL 4DZ8B 4XNZC 1CC3A 3K7UA 5T1LD 1GGBL 4XXDB 2ZUXA 4E36A 2GVYA 1CB4A 2QQLH 4I88A 5IB2A 5D1ZB 2Y7QA 2XWCA 1HVXA 4W6XB 3LEXB 4KXAA 4W9CC 5EOQL 5T5NF 3I9PA 5L2JA 4Z7VB 3CN0A 5K9QG 1SN5A 1MVUA 2E56A 1MJ7H 1E3XA 4ZXBB 4FZ8L 4H4NA 1I7RB 3A3YB 2XVKA 1IAOB 4Y88A 4DWHA 4J28A 4NKQB 4FF9A 3WDJA 4DAGL 1EERB 4AMKH 2Q76B 2F7PA 3C2AL 3F62A 4P3CL 2Z4QA 4LSRH 2OM5A 3N43B 4XOCA 4PR5B 5JHDB 1Z3GH 3GB7A 1YUHB 1XGQB 3QEGL 2NZ9D 1AD0B 5B22A 4A7TA 4BHUA 4DQOL 1KJ2L 1LO0H 3BSGA 4BSVA 5FO9A 3RWGA 1WBZB 4JY4A 2DYRB 1S7WA 5EU7E 3B6SA 1U33A 3CZUB 3LKNB 3DETD 3ES6B 1KBBA 1AVAA 4ZS6C 4F7MA 4YHPB 2YC1A 4TNEA 4YNYB 4R96B 3UG4A 4WNSA 4GO8A 1EAOA 4J6RL 1YCSA 2W9EH 5DCCA 43CAA 4AEEA 2QVIA 3BPNB 4YL4A 4X6FA 4NYLB 3TH4T 4ATWA 3F5WB 2H7WA 3BUDA 2O72A 6PAZA 3WNNA 3WTTA 4HCFA 4RZKA 3ZL2A 1RV6X 3PJSA 4R8WH 2P46B 4X9HA 3QRLA 8FABA 3I2CL 5FYKE 5D70H 3ULUH 4AH2B 2PMZA 1OCCB 2YPLD 4U0QB 4PLJD 4JRYE 3OKDA 1T20B 2A74A 1U36A 4NN7B 3VWKB 4OLWL 5J6GA 2JI3A 4AYBA 2VXSH 1BAFL 4I13B 2E4FA 2VDOB 1TLKA 3DX3A 3ZDZF 1T5KA 2OMVB 1MEXL 4JR9H 3EFFA 3FONA 3O11A 4WI9A 3EH4B 4WW2C 1N59B 4U3SA 2BVQB 4PS3A 1OSPL 3BO8B 3FB8A 1OP3K 3BQUB 2JKRM 3AZUA 4UT7L 2VO5A 4BFKA 4DKTA 1PKQB 1GCYA 2GJZB 5TF0A 2NY6C 4I48A 3D4GA 4EI6B 2FGWH 4M61A 1JTTA 2PETA 4ZTEA 1ZHBA 5DMGD 1DJZA 1PNCA 3D4ZA 3IFNH 3RL1B 1HK6A 2FQGA 2W9LA 4XT1C 1E4WH 3UAJD 4KROD 1ZANL 4YGVA 2X4OB 5HPMB 3SPCA 1AKPA 3FT2A 1U3JA 4IRJD 1YY9C 2EVHA 4BFRA 4LXFA 5ERWB 3E3QE 5T1MA 1DLHB 3QJFB 5I0XA 5DFVD 4ADGA 5J3HD 3FUMA 2HMID 4XPTL 1Q9LB 1G7IA 3MRKB 3QJZA 1W6WA 4J3OD 4JCLA 1TJHL 1WCBA 4UILH 5DRNB 1JGUH 4FXKA 5I6PA 1FZJB 4JG1L 1BSIA 3GGWB 3R4DA 4ELMF 2WJ5A 2LW3A 3VB8A 4X7EC 3VU2A 2X2IA 5IJCC 1L3NA 2F5AH 4ES8A 3CFJB 5JHBA 4RISH 2FT8A 2VLJD 4KMLB 2OSYA 2GAZA 2K8QA 1MFDL 3QZWB 2J88L 3PHOB 5AAPA 5E9DE 3LQAL 1N10A 4G43A 1ACCA 2EYTB 1KEMH 2VITA 2CJ3A 3AC0A 3QEUB 3O6FA 2N59A 5LBSH 1NDGA 3FUIA 2PWHA 1JVOA 4P9HL 2OW7A 1BQKA 2N56A 1OTSD 4ONOA 4A2LA 1M6OA 3RIKA 5F9WC 5IVOA 4N0FA 5DJZA 3L5WA 5BO0D 5I5IA 5JPMB 4L3EB 3TZVA 2JJVA 5B39G 5C0DA 2W8CA 4K23H 1A7OL 2AJVH 3HUJB 3V0EA 1CBVH 4KXDA 1XL6A 1QWNA 4ZFZB 2PW2A 1D5BB 2IFGA 4H44C 3GZKA 3WIAA 1H5BB 3BN9C 5JXED 1CN4A 3AROA 2BOCA 4B50A 4QJ3B 3IU4L 1XXFC 1JNNL 5IZ7A 3LQMA 4HJUA 4ZMZA 4HISA 1ZLSL 3W37A 4MS6A 3WY4A 1GIGH 5C9JA 3CDGB 1NC4B 2O5ZL 3HPLB 4IRSA 4LPVA 4QLRA 4WI6A 5AYQA 2ALAA 3MLXH 2VT0A 1RUMH 2Q87A 5AOMA 1T7WA 1KGWA 2C1OB 3NSDA 2PYEB 4WKZB 4JFDB 4N2EA 3O41B 4HAKA 4I1NB 1H19A 2NY4C 2E9BA 4WWOA 4O2CA 1DE4B 2VLLB 3ZDYE 4X5RA 5DZLA 1RURH 2H4EA 1E4XH 2LABA 3QIUA 4M93C 5JIIA 1CGVA 3P2DA 1EHLH 1DVFD 3U0WL 1YNLL 3MJGX 4FA6A 4J1UB 4PJIF 3TYFA 2AFNA 3ECQA 4FG0A 2WTPA 4JG5A 4POZD 4IU3A 4FNLH 2WQSA 3V6BR 2D7OA 1DJHA 4WO4D 2CALA 4H0IA 4AKOA 4NC1C 1QSEE 2WVVB 2JIXA 2X05A 1NGWB 1PQZB 4F2MA 2B4CC 5H94A 4LAQH 5E1HB 4XHQA 4YDKL 1D6VL 2Y23A 3F58H 3SDXA 1LEIA 4OI9A 4EXPX 3B2XA 5CR1A 1KV7A 3HG3A 2Z91B 1INEL 1AZCA 3L7EA 4OQTL 1P4BH 3FQXA 4X6DF 3NTCH 4LPYA 2NNRA 1JF5A 2X2HA 2X88A 4ODWB 4ODBD 5J0BA 5KUMA 1BG1A 4FMKA 4J3WA 1CBJA 1INDH 3JVFC 4OJEH 2V9UA 1JHKL 4WJKB 4Z7QE 2CZNA 4I5BB 5F1NB 4Z6AT 1HEHC 3QDGE 4PHXA 2EIBA 3R7RA 4PVBA 3ZTCC 1A6WL 1UWGL 3O81A 5LN8A 3T6QC 3F64A 2ZXGA 4HKXA 3VH8B 2WKLA 4LSQH 1D6EB 1A6VL 4AX3A 4RAUA 4GKOA 1DFXA 4KTYA 1JWSB 4Q9RH 2AQQA 4GBXB 3VYNA 4AENB 5GS1C 4AG4L 2PWDA 4YSUA 5IEKA 3NGBC 4I18B 3U4AA 2EDMA 4KKRA 4M6NL 4U1JB 5TF1L 3RWDA 1IC5H 1WUZA 3CZNA 3QEQD 4AQ1B 4FFWD 2ZOUA 4RDQF 4YMPA 1TLMA 1R24A 2GYSA 1RZIB 1WHPA 2F54A 4NN6C 4UTBL 1YEJH 2JJTA 2Q8AL 2GPZA 3VFWB 4CL7A 1J5DA 3KPOA 2FJHA 1R3IH 4WSGA 3DSNB 4QD2E 2YUVA 4RCAA 5D5MA 1X5YA 3WTVA 3CFBB 1NCWL 3GBNH 2QPSA 3KJ4C 3FCGA 3H0TA 1OOAA 3CDFA 4D9RE 2GJ6A 3II1A 2HKHH 3CV5A 2ICWJ 1AG0A 1I1FA 4XMPL 1CDHA 5SX4H 3KLQA 4P2RA 2C7UA 4NZ8A 4RBPH 5GRJH 5JIHA 3ROLB 4X6EA 3NPSC 3TJEH 4UT9L 4LCIL 4LB8A 3X17A 2BCKB 4MZRA 1NTDA 1NGYA 1BXVA 2ZP9A 4AQAB 2GBTA 3WFHB 3I9GL 4P5KA 1BZ9B 1DZBA 2W9DH 4HU8A 1OANA 4X2UA 4WQOA 5E5MA 3FT4A 5FK9B 3KPNB 2NW3B 5TD4A 1UA3A 3A6BH 5J12B 3V6OC 4U1HB 4Q8BA 1VIWA 2NUTB 3U6XA 1PVHA 1TO5A 1Z32X 2HTLC 4KMTH 3HZKB 1P9MC 2P5WB 3KEDA 1AP2B 3W81A 4OD3L 4YHOL 3PFUA 4OGXH 5FYLL 3K1KC 1OGAE 1R3HB 4N22A 1QFWH 1J1PL 3PREA 4OT1H 2DQFB 1HDMB 4LQFL 5BJTB 1HYSD 1PZAA 4HU2A 1KZQA 5DD0L 4X8XA 1F6LL 4PJ7B 4PY8I 1RUAL 2ZCHH 4HWEL 1QUPA 4RIRA 5F0LB 4F2EA 3GTTA 3K6SA 5C7XL 1JS4A 2V5TA 2DDQH 3US0A 2Z7ZA 1RFDH 4AQEB 4Z0XA 4H25B 3LX9A 4KK9D 1S9WA 4WWKA 5CZVH 3DC0A 4M5YL 4APQA 1NBZA 4HQQL 4C59B 4V1DB 5GSVB 3Q7JA 5FO7B 3G6JB 1MZZA 4JDVB 4PJXF 1XWVA 1Q1PA 4HEME 2WQUA 4JMXA 4GQ9L 3QXAB 3NEXA 5HD8C 5DWUL 1F5WA 2ZUWA 1TUPA 2C9XA 3Q1EA 2AJYL 3D2TA 2C34A 4AVKA 2VR5A 2D31A 5I1KH 1Z5LA 5TE6L 3T0WA 2WD0A 2H41A 3MX0B 1YHPA 1FNHA 4XMVA 5DUBB 4Y5XA 5KVDL 5JHAA 5LLIC 4MD5B 3C6LC 3FAWA 4F1SA 3S3DB 4PJGB 2E7HA 1RLWA 2GBAA 4FRWA 4NQDE 2IADA 4X50A 3STBA 5F9JA 3LQZA 2G2PA 2H3NB 1CICD 2XIDA 5D7KE 1FJ1B 2R29H 3CN2A 4EVNA 1EXUA 1U3HD 5EWIH 5LNGA 3JWDL 5ICXA 3ABMB 2BVPB 3IPEA 3GSWB 2CA3A 4OW6A 3P11H 1UZ6F 3QULA 2WLYA 3Q5TA 4GAAA 4HIHA 3MREB 4PJAF 1T66D 4Y8AA 1WWWX 2GI7A 5LCVL 5I0VA 5CGYC 1KV3A 2ZOKB 4Y4HC 4ZAKA 5ESAA 2NY5C 3TLRA 1BVNT 2XJLA 3L5XL 4N2NA 4N2LA 4R4BB 4XPFH 3BQVA 3NRFA 3J8F7 1PF3A 1GHFH 2C3VA 4OD1L 4ABQA 3OMZA 1ZHLA 1RIUL 5L0QB 5I2IB 2FT7A 1V3JA 3P3SA 5K33A 1OD7A 4Z5RB 2QGCA 1ECYA 3AUWB 2E76C 4I0PB 3QEHB 1OAZH 3RGBA 2ID5A 5F7KC 2BVEA 3IRPX 2PR4H 1OEZW 3V4VL 1ZGLP 5IB4A 5I1HH 4MHHG 4YDJB 5LG1A 4WK2B 3OR6B 3BESR 1EZSA 1NKRA 2VR6A 1JV2A 2JCCB 2BNUB 3DXAE 2Y7OA 2CM5A 3GNMH 1ZLVK 3T8MA 5BO1H 3D3VB 5J6HA 3FQTA 4DKAA 1FBIH 1F1GA 2X3BA 3FFCD 1B4LA 1VERA 3LKSB 5L2KA 1JZJA 1KGIA 1KEML 3HMWH 3FS9A 4NDMA 3ZE1B 4Z3HA 1HX0A 4KJYA 4JY6A 4JRYD 3H2WA 1Z9NA 2CK0H 4KGJA 3QFJB 3LZNA 5AW6B 3KDMB 4EN3C 4PBDA 1IAIL 2DYPB 4A55A 4XO8A 2ZUUA 2AJVL 2PCPB 3JYCA 5A3ID 3V79C 1KENH 4RFNB 1O75A 1H3GA 2OCCB 3ZMRA 3WMPA 4BA8A 3OAYH 4Z7UF 1YMMA 3AS3A 3EO9L 3EZ8A 3RWHB 3FYEB 4XP5L 5FV1L 4HLZG 3D51A 3QUXB 3QZLA 4M29A 3SDDB 5EB9A 2UUDH 1QTYT 2XXGA 3HNTH 2DD8L 4EI5A 3EO1A 1T4KA 3F7QA 3HE7A 4KRPB 1PJ9A 3PP3K 3MLXL 4OBRA 2D03H 3BH9A 3QPXH 4NRYA 3KVQA 1RULH 2CA4A 4GG8A 2P8PA 1PEWA 1CGSH 2NSMA 2QZQA 4O02A 3UZEC 2WXJA 4TNVF 1XGPB 2WXKA 3MR9A 1CWVA 2NX5B 3OC5A 3Q8BA 4KK6C 3MCYA 4LDOB 5EBGA 2R7EA 1G7QB 3WFCH 3WXVH 3F7LA 3D0AA 4WFEE 3EJZC 2GTZA 3NCFB 1EHLL 1SOSA 3MLWH 2A7BA 1NGZA 1KBPA 4G8IA 4RGOL 3SJVB 3SKJH 1FNAA 4N6RB 5CWSA 4GO9A 3WUWB 4JRLA 3EADA 5IJBC 5E4EB 3K6IA 4N2HA 3T2OA 4HGMA 3RNQB 3DX7A 1UA6L 5DI8A 4YDVA 1QSFA 4KAQL 2LFGA 5B8CA 2UWEF 3ASWA 3L2NA 4Y4KB 3ZYOA 4JY5H 3CXDL 2R2BB 4YBHA 4WIQA 3TBVA 4O9HH 4NSKB 3C60B 2Z6FA 5E9DD 3SE8H 2EADA 4QTFA 2ITDA 4XMLH 5GS3A 5KBLA 2DIEA 1KJ2A 2V17H 5JTWA 4L37A 5L4MA 1ITCA 3QORC 2A6KB 2FB4H 2CIKA 3VG9C 4LEXL 4F8OA 1EAPA 2QKSA 4P5TA 3GBLA 5L9DL 3VFNB 3QXTA 1UYWL 2AAVA 2X40A 5C07E 3FO9B 3X13B 3GJFA 2R59A 3DPBB 4X7CC 3VTMA 4BKLA 2DQEH 2VXQL 2WLKA 3PDOA 5AWNH 3V0VB 1IIIA 2GTWA 4YJZL 1NC2B 4PLKD 4PY7B 2X1QA 5JO5A 1OPOA 3S5ZA 5EF1A 1WFOA 1A66A 3T0XA 3S35X 2JVUA 4ZQKA 4JAMA 5BRPA 5DU7A 2DI8A 2D4DA 3DSFL 4R7VA 4P2QD 3TVMB 4AUYA 3S37X 4BM7A 4S11A 3U30B 3GDBA 3HI5H 3QJTB 4ZS6D 1WBXA 3QWOB 5JW3H 2RGSA 2VAJA 2W38A 4CNIA 4QRPB 3RY4A 1B3IA 1WA0X 1YEJL 4GIOA 4MA1C 1SYSB 5F97E 1KTDA 4CC4C 3CX5J 2YOCA 4LBEA 4L4TA 1CGUA 3D39A 4IIQB 1G9NL 1YNKL 4P0DA 4PJ9D 1KT2B 1TJGH 3RU8H 3C8KA 4OZHE 3SCMC 1HILB 2CGRH 5BS0E 1CI3M 3UX9B 5DK2B 2ZF9A 1JHLL 1IVLA 3H9YA 3C8DA 1AGBA 1QRKA 1IM3B 4G11A 1A0QH 5GJSL 4OTXL 3L9EA 5F0MB 1WBYA 2IEPA 4K5OA 5GRJL 4YSRA 3ROOA 1DO6A 32C2A 2NYKA 3H53A 4L05A 5IVXB 1IGYA 5DJ0A 1T1ZB 5C0BB 5T3XH 1LP9B 2NY3C 1QSED 3T3MF 3TCTA 3VWJD 4YZFF 1OQOA 1YECL 1F1AA 1CVRA 4LLMB 2W9DL 3LD8C 5C3LD 1UT9A 2ADIB 4ZYKA 4M1GL 4ACTA 4FFTA 3CFTA 4XC3H 3OAZH 1SJVA 4XVOA 2VXUH 3SPJA 1NFDA 4R6UA 1BDYA 5FM4A 4ELMA 1B3JA 3C9NA 2X1OA 4KMTL 4OKVA 3NCWA 5IWLA 3S8FB 4PJ6A 3BP5B 2YA1A 5LXVA 3GRWH 4ZUTB 1DBMH 5IV2A 1EAJA 3DOIA 2WQAA 1BJMA 1IGMH 5AYTA 1EDQA 3BD3A 2MEJB 4NX0A 2XN2A 2WIIA 4HKBB 2FO4A 2D0FA 2DS4A 4JRXA 3LDBC 4XNYH 5HI3D 4DERA 5BPPA 4RX4A 3VGAC 5TK4A 2R15A 3PHAA 4MDJA 2FWOA 2ICES 2ENJA 1NJ9A 3C8HA 3N2JA 4C47A 2LVEA 4JHAH 2DM2A 4P23B 2IQ9L 1M3JA 1YY9D 5DK0A 3NDZE 1BMWA 2I25N 1J11A 5CJQL 5FIEA 3CU1A 4FXGC 3L08A 3VI3B 3LY6A 4PI0A 2NY2C 4ZOAA 3M45A 5DQJB 1HJBC 3IDIA 3CXHK 2J72A 4FNQA 3ZY7A 5GRVK 2D3JA 1BV8A 1CE6A 1YEGL 3P3UA 3LXCA 2Z7UA 4M7LH 2VSKB 3MRNB 4UB0H 5D71H 1BBDH 1OGTA 1CJYA 2X5PA 1XH1A 5L2JB 3O3BB 4QTHB 5ENWA 5GGUA 2ZKHH 5MENB 4ANKA 2GABA 4XP9H 2V3EA 5EORL 3H56A 4ERSL 4R7NA 1TQBC 1OPGH 3APFA 4QHNA 3K8LA 5E6ZA 5J13B 4PJIA 4TL4A 1I9IH 2FQEA 1NLDL 2V0AA 2IOOA 3AB0B 3FTZA 5IQ9B 1N7MH 3BUYA 3S9DB 1MCPL 4BSVB 4MJJA 4ZMVA 2OMUB 1PCSA 1YEIH 2EEBA 1NBVL 3K91A 4XPFL 3N44B 4WO0A 2KDYA 5A2CA 2P42B 4QNPE 4YDMA 1UXSB 4F7MB 3MA7A 4LL1A 3VFUA 1E8ZA 4IQHA 2FZ3A 3ZGHA 3PU7A 2HYMA 4AGLA 5D2NC 4AI7A 1NMAH 4Q6IC 4D0BA 4LCWE 1OGAD 2HN7A 3QH3A 3WHE0 5BV7L 2AAAA 3GLZA 3ZYIA 4XZ4A 1TDQA 2DQHL 3MLUL 5I15H 2OYPA 1O7DE 4QHLA 4X6DA 2XTSA 3MODH 2Q7AA 5EBMA 3OMIB 5KS9F 5KBPA 3K0WA 4BXSV 2CHWA 2YEVB 4NZRL 3TPUA 4YSAA 2WZ5A 5IHWA 3UC2A 3HMWL 1F6AA 1RJLA 3HLAA 5F89B 1JPGA 3TH3T 3PJSB 3L2LA 4HCRL 4E5XA 2HJLB 2P48B 1T3FA 2AJSH 2Q8BL 3DYMA 3WXWL 3C6EA 3Q05A 1C5DA 2ILLA 4TUUA 1NCOA 5FCUH 2GK2A 2N3JA 1NGXB 3SDCC 4NP9A 1KGYE 4QRRE 4QIRA 3OKDB 4OJDH 2A74B 2IMMA 3L95A 3NFPB 1N5YH 3B7SA 1EHAA 1WF5A 1R5VB 2OPCA 5J6GB 1R3KA 4FLQA 3IKCA 2VUOA 5B7FA 4M03A 3LIZL 1OW0C 2NNXA 1IGIH 1UWYA 3OAWA 3PLYA 1N0XH 3MRDA 2WP3O 3KGUA 3BOVA 5E24E 4AYFA 4IK7A 1LILA 4NQDD 5IESH 4N1CA 1UJTA 2DLEA 1T5XB 4KKLD 1CU4H 3LRHA 5D7KD 1NANH 5F6HJ 4KRNA 3PWPB 5HVGB 2DQUH 4EZLA 2AV7A 1KACB 2KZWA 3WFEH 3WTSA 2A6IA 1Q9WA 4WHCA 2UXGA 3GBMH 1BD2A 3R7QA 1R3LB 1ORSB 4F7CA 1RULL 1H3XA 2QSCH 2B14A 5I30H 4K2UH 2KKQA 2NXZC 4P49A 4G1MB 4RGNC 5KBMA 4G42A 4GI8A 4XWOD 2FBJL 2Y1YA 3IYLW 4KY2A 4F7TA 1G1KA 3D18B 5E6RB 3GSNL 2AC0A 3G9AB 5H35A 1QSVA 1CDJA 3S96A 2AANA 4UTBA 1VGKB 1BA9A 3MYZA 2V4LA 3WKMH 1I7ZA 5A7EA 4PJDB 2EVJA 2K6ZA 4WI4A 2FLMA 3S4SG 4WLCA 5D2LB 5KSAD 5T3ZH 2QQNH 4XNQA 4BQ8A 1TZHA 2BIIA 4JHWL 3MJ6A 3RWEA 6FABL 3IDJA 1O7SA 3WS6C 4FXKB 4GMSL 1P0SE 1OE3A 4MJID 2YAFA 3EYFB 4I3RL 4L8SC 3WJJA 1N12A 4JY5L 2MMXA 3RZCD 2X6VA 3KYNA 2C9RA 1FZOB 4O9HL 4YQXL 3EBGA 4AY0A 3UBHA 4F57L 5KJ7E 2HH0L 1E4KA 3MYJA 1E67A 1SN0A 1ZT1B 2NYYD 4UT9A 2GAZB 4XMLL 1XIWA 2FRGP 1HTYA 2V17L 3OMAB 4ZFGL 2H45A 1G1YA 4W9FC 4RWYH 1L6ZA 3ZKSD 3GLDA 1M2OA 3MFFA 1JNHA 3APMA 4G43B 4P9ML 3VXTA 3MACH 4W9ZA 5LGJA 3PPEA 4OUUA 3D85A 1OAQL 4N0YL 4NGHH 3ZDXE 1Z9SA 2HG5B 1YPZE 2IG2L 4FQLH 1HWGB 4N87A 4LQ1A 4N0FB 4PV8A 5DJZB 1YN7A 2BZCA 4K15A 2D7PA 3TZVB 2EH7H 5I6KA 4O02H 2DWYA 2NQ3A 1MH5A 4M8RA 1U0QA 3QW9A 1YNTF 2BNQE 4PJXA 1UKTA 3BEWB 2R0ZH 1N6VA 2H8PA 1Q0EA 2DF3A 4C4KO 2BOCB 1M57B 4JN1H 2QPDB 3ARGD 4HW6A 3O2DH 2BRRH 3HEIB 5D9SB 4N2GA 4RSVA 4KO6A 2WUBL 2ZX7A 4OFYA 3RVXC 5KAQF 3QVAA 4I7ZC 2BM3A 3HRPA 4NO0D 2O30A 2X38A 2XN9A 5F71A 2HTLD 3B2DC 1OAYH 2EIEA 3MLYH 2XG4A 4L8BA 1AGDA 3TTSA 4Z7OB 4YGAB 2E4TA 2DH3A 3A4DA 4WFED 5GGVH 2QPEB 4MSWA 1WQVT 1NEZB 4TQHA 3U7WL 1VACB 1XH0A 3NYKA 1QLRA 4QXGH 4CC1A 3QIUB 5GS0L 2A77H 3BPNC 4DP7X 4D3CL 3A4AA 1VZHA 4XCCH 2OMWA 1DDTA 1NKGA 4X9YA 2CLVB 4W9HC 2NY7L 1KIQB 3E0GA 3SGKC 4D8PB 3EJUA 2ZKMX 4UDTA 1K5WA 4DK5A 4Y1AD 4YHMH 1G6RH 1VCBC 2IDCA 2JIXB 1OP3H 3D1MC 3GIZH 4I2XB 4H2AA 5IGXH 5AW2B 1T22B 3OJVC 3N41B 5H94B 3TA3B 1OARH 1D7FA 1XXDC 1DLFL 1L9MA 5LCVA 2YFOA 1AIZA 4J2QA 3SDXB 1LEIB 3GI8L 2XTLA 4NN7C 3L7EB 2F74A 2XWJA 3FQXB 5DEGA 3VWKC 4NJAL 5DQ9A 1IC4L 3FQWA 3C6LD 1RPQA 3GRWL 1CLYL 3WTWA 4ZMOA 5C07D 2ICWI 2W60B 3SE4C 4JPKH 4Q2ZB 5JMRA 3IRCA 1HI6B 1A3RL 3H3BC 5F7FA 3ECVA 3P0VH 5D6DA 3KPPB 4GH7B 1H8SA 3VRJA 1S9XA 2VO8A 3EIFA 3RNKA 2GBUA 2VM3A 2VN6A 3BEVA 4AUJA 3UCQA 4JO2H 3T6WA 2CRIA 4TLKA 1EXHA 1GKEA 4HKXB 4N8VA 2ZONA 5EEWA 3GXIA 3BQUC 3MRPA 2PP9A 3MLRL 4RAUB 3BKCH 3W82A 4Z0BL 4G6FB 5IEKB 1MG2C 3V0GA 4OV6F 3VFOA 5I71C 2N4IA 4Z7UA 3MJWA 3GBEA 5FF6A 4JS7A 5LDSA 1H6EA 3RY6A 4A37A 2YIHA 3H3KA 4U1KA 1MJJB 3UTOA 5D1XB 1EO5A 4LKCA 5BW7C 3N1FC 3AY4A 1IEBA 5TGBB 4OLUL 3KPOB 4FQJH 4YEFA 1QASA 3DJTA 5D71L 1UEMA 2Y1VA 4F9LC 4WJ5A 4G8FA 1I7TA 3C5SA 2E9GA 4LSSL 2WLZA 1E5UI 4G6KH 2VAAB 4RNRA 3ULSB 3KH4A 3L2MA 4KK5C 3I50L 3RHWK 4UUJA 3TT3L 4K8RC 1Y6KR 3HJEA 4MMXA 4G9FE 5AVVB 1I8IA 4NKDA 1OPGL 5HJBA 3GXPA 1X5ZA 3L8QA 4ZW7A 4ALAH 1BOGB 4LOEA 3EKCA 1N7ML 3H2PA 1CFQA 2IV9A 3QBTB 4P07A 3IXTB 2FIKA 2A9BA 1F3DH 1A6UH 2XX0A 2ZD0A 4LCYA 1FNGA 5E5MB 5I76A 1XB8A 2UWEA 3IDNB 1KB5H 4X0KA 3VDCA 1DSYA 3ZE0E 2V2XA 4K9EC 2QLVB 4E68A 1HH9A 4Y5YA 5JPMC 5BVPL 2DRUA 3BIKB 3KW8A 4ONGH 4P57B 1KF9B 1DQML 1M7DA 4U6VH 1J5OL 1D5MA 4IHOA 2JXMA 4M6AA 3B2PA 4MWFA 3OJDA 5JQ6L 1H5BC 4JDZA 4Q4EA 1GGCH 3WEBA 5DSCA 4KZEH 4WI3A 3KBFA 1QWUA 5HVHB 4ZPVA 2Y25A 4OV5B 2APXA 4RIRB 3K6SB 3E7JA 1E4JA 3FFOA 2YGOA 2ZWYA 3QFDB 2BOLA 2ZXCA 2EIJB 1TTGA 3BVUA 1HXYA 5JOFA 1RIVH 2H6UA 2V3DA 4FEIA 4GS7B 4HUXA 3RTQA 3MRLB 5DYOA 2C7FA 3EJZD 3GSXA 4WWKB 1AHWA 1RLBA 4KI5C 4FA8A 1N5YL 1FH2A 1AKJA 1NBZB 1OGPA 2R0KH 4C56A 1HHKA 1HCFX 5K9JL 1CUOA 2YUZA 2WOYA 2LU5A 5KVFH 3D4CA 3QUZA 4DP2X 1MCRA 1JGDA 2O6PA 5HJ3B 4DUWA 3NIFE 1A65A 1GZHA 4M43H 4WFHE 1L9PA 5T33L 1XF2A 2AK1H 2D31B 2GC4C 1U92A 2Y6SD 3IS1X 4PJFE 4TN9A 3VFGL 2VXQA 3U2IA 4BZ1L 4LE8A 3LPWA 3VW3H 4YXLH 3NCYS 4DGYL 2DY2A 3QUYB 3U4BL 5F9JB 3LQZB 4U1MA 4EEEA 3CLFH 1X5XA 2BNRE 1OAUH 3QGVA 4EVNB 1CD9B 4UOW0 3MLZH 3CBRA 5ICXB 4K2UL 4XN8A 3IAQA 3W2DL 1MI5A 1TKWA 2A73B 2F8VA 5CR8A 4EUPG 4HLJA 4FKHA 2XQYA 3QULB 1CL7H 1WFIA 3EYSL 1XZWA 4XODA 5H4YA 5LGHL 3HFMH 4PGJA 2ZCKH 5KYNA 2X6BA 2YRLA 2WJ7A 5ESAB 3II3A 2DH2A 4Z7NE 5F6IC 1MF2L 4LLVA 1I8KA 2AXHA 1KTKE 5F9AC 2JQMA 4EDWH 2AQSA 4YSQA 1MCNA 3WY1A 1DUZA 1AFVH 2EVIA 1U8LA 2CHNA 4LCWD 2BZDA 2JLPA 2FJFB 4LRNH 3I3DA 2GIYA 4KX9A 2CPCA 3TONA 3IU3B 1CFVL 2BS9A 2EQDA 2VDPB 3IMUA 4OGAC 4PRAA 3UP1A 4JPIB 3OAUL 1RZFH 2EXTA 2DWEA 5CUSL 5IB4B 3IXAB 4NENB 1RIHH 5HGHB 5DA0B 1MJ8H 3HI6H 2ESVB 3QC5X 4UZSA 3OPUA 3N42F 4GBXC 2Y3NA 4FQPA 3H4FA 2EVFA 2QELA 3D69B 4I18C 5J6HB 3QHFH 3V0DA 4L1HA 2QHRL 2HLAA 4FCAA 1P69B 3U9UA 1YY8A 1AR2A 4AQ1C 5CU9A 3LKQB 2XKUA 3PF2A 1BGXH 3T0EE 4QRRD 4Y16C 2VDRL 1HZHL 5GGTL 3CFMA 1ZOXA 4YHIA 1G7MA 3O45B 1NEUA 1UACH 5T8IA 4OD2A 2QGEA 1VHPA 3EO0B 4WWID 1SVCP 1WS7A 4ZUUA 4TUOA 3DRTA 1F4WL 1KG0A 3JBG7 4MB4A 5IUSA 1YEKH 2BX5A 1J9QA 1QI5A 2DQIL 2FJSA 3MZGB 2NY3D 1S7RA 5C09B 3GTNA 4XAWH 1IL1B 5E2UH 3Q5YA 4N86A 2DLHA 35C8H 4JN1L 1M7UA 2XVGA 3O2DL 1KELL 4NBYB 2TAAA 1FLRH 3LKRB 4JZJA 3W0WE 1DQJA 4EI5B 2OJEA 3K2IA 1UM6H 2ZIDA 3UTTA 2ZZUT 1I82A 3HE7B 2JB5H 3WN5C 3MROA 3U0PA 4I1PA 1N26A 3BH9B 3RWFB 5ILTH 5HDQL 4X6CE 2VMCA 1OAYL 4W9GC 1QLEL 4XVJH 2VH5L 3ARDB 4A2HA 2IFFL 3DVFA 3K4ZA 3PWLA 2ZYSA 2P43B 4HJ0C 4O02B 4PD4J 5E4OA 1VA9A 1NPJA 1MCOL 1L0XA 2Y9RT 2ZXBA 5J12C 4WZ9A 1U91B 2GTZB 3BH8A 1TYJA 5BVJA 1ET8A 2FO8A 4U6HB 5KSUA 1NGZB 3DBXB 4NLAA 4TNGA 3CHOA 3ATFA 3DV4B 4N2DA 1N8OE 4W81A 4GQZA 3UPCA 2X4QB 3PY9A 4F7KA 2GITA 3ILPA 4MMYB 1TCMA 5GIRB 2RFXA 1A9VA 5TH2A 1G6RL 3APDA 4Z3IA 4EIBA 2NNAA 2AMUA 4B97A 3IGUA 1BXUA 1CDYA 3UBFA 1D5ZB 1W72L 4NI6A 3TBVB 2P45B 1EJOH 3ETBF 2NY2D 1HQ4B 3MCLH 3OL2A 4EO5A 3AADB 5C70A 5IFAH 2VLRE 2YXFA 4KUCF 2ZUSA 1WEJL 1PEZA 2VLKE 2WXRA 2AQRA 3C6SB 3L3IA 1FL5A 4GAJL 3T3PE 3UADA 2D7TL 5SWZD 4KHXH 3SODB 4E9QA 4P46C 1KLUA 4ORGB 5DYFA 5KS9A 1EZVY 2CIKB 3PUCA 4KDVA 1U21A 1EAPB 4L1SA 2ADGA 5FM8A 1G4MA 4PJEE 2IDQA 3BCDA 1E5ZA 3GJFB 4WUUE 2KLRA 3MV9B 4YHZL 5K39A 2ZUTA 1HE7A 5ADPL 1IMHC 2GTWB 3QAZB 3MOAH 3SY0A 1U6AL 2BNQD 4OB5H 1JOIA 5MEOA 4MNQE 3ULUC 3BKCL 1KCRH 2VUKA 3MRGA 3BI9X 4JPVL 1A5FL 3RTLA 3UGEA 5E08H 4GW4A 2EO1A 4JAMB 2X4UB 3THML 1ETZB 1F18A 4YSTA 5G5DA 2D73A 5AW7B 4DP4X 5EZLA 3OG4B 1NKOA 5EU5B 1ZLVH 4G6AD 4F7PA 3EJPA 3ATBA 3IDGB 1IJNA 4YAQA 3QIWB 2JJSC 2NUPB 4J3SA 1UM4H 3MOBH 5CINH 1BX2A 4JE4B 1EEYB 1KTDB 2P4AB 3W11C 3AWGA 1F90L 4LBEB 2JWYA 2UX6A 1U3HA 4H1LH 5I5JA 4DW2H 3C8KB 5DURB 3J7HA 1O5DT 5B4MC 4MXVF 1NGQH 1JBJA 3U7YH 4M62H 4WW1A 5L0QC 3LIZA 4K3JH 4PJCF 4JX0A 5E2VH 4NUJB 1WBYB 1YYLH 3T2LA 1QNZH 2AV1A 4OIIH 4QRUB 1PSKH 5AUMA 4H20H 1A02N 2J5LB 3FUFA 3RDTA 3MGOA 2UY6B 5DJ0B 1UOWA 3MA9L 2BS8A 3WNJA 2EDDA 2AXFB 4M8QB 4YPJA 3SDCD 1UT2A 2FWUA 1SMDA 4GUQA 3GM8A 2XETA 1UVQB 3MNVB 3PP3H 2KDGA 4WV1B 2VQTA 3DUUA 4ZYKB 2ITEA 5D7JC 4O00A 4B3EA 5IMOB 1SQ2N 4XX1G 2Q3ZA 1NFDB 1A9BA 2XICA 2AGJL 3GSNA 3QA3B 4KTEH 5CBAA 2PWGA 5D7IE 4GJTB 4RMBA 3CTTA 4XTRC 4OKVB 2RD0A 2JKXA 1MREL 4Z7WF 3DX8A 5KSVB 4JANA 4WNQA 5CNHA 1I1AB 1U42A 4RFNC 4UIKH 1OP5H 4HWZA 1HAWA 5IV2B 1A1MB 3CLWA 1SRDA 3HMXA 2IPTH 3DROA 2DTML 2QEJA 1ZXQA 3M7FB 3FMGL 2CO7A 2ROXA 5CKGA 5I73B 1R19A 5B1CA 3H1ZA 2CJSA 5I28A 4KZEL 2R2CA 3QUXC 5HDBB 1DQLH 3SDDC 2VZVA 3KL0A 5I5RA 2NXZD 3JTTB 3JUYA 4RGND 4KOBA 5DJ8B 4KRPC 4MDJB 2FWOB 4P4KB 4JEGB 1CDUA 1KB5B 1ZA3A 2EIKB 5HYJE 4PEEA 3MJ9L 4HAFA 1R5IA 2CR6A 4NNYB 4PSRA 4WGWB 2IDTA 5DK0B 4TUKH 1A1NA 2J1WA 4PRIB 4EQ2A 3V10A 4OZIB 4AZUA 1RPKA 2Z8RA 3TFBA 5T1DL 4HC1L 3WKQA 3HRZA 3BZFA 5HYSA 2QFRA 1EUUA 2VQ1A 4AEHH 3IDIB 3OR7A 2XI9A 5ITFB 3ZRCC 5LQBL 5DUMH 5GRXG 3G5VB 4J3OH 3WLBB 5EEUA 1CE6B 4B7LA 1MCJA 3D9AH 2HCZX 4YXLL 2FLBT 1XR8A 5E4EC 1M7XA 3DMMD 1W0WB 3PQYA 2X70B 3VE0A 5ISZB 1OGTB 4DO5A 2XZCL 4X4ZA 3F84A 5ENWB 3C2SA 1OB0A 3UO8B 4BK5A 5CEZE 4G9FD 5JPNA 2LR4A 4J5VA 3QG7L 2X53A 2OZ4L 3FOMB 3BPCA 3INUH 5KVEL 1QWHA 4Y4KC 2W0PA 2BP5M 1OHZA 4JZNA 1CL7L 4X83A 4R7NB 1QQDA 3PV7A 3IJEB 4JM4H 3ENEA 1CXFA 5FHAH 3BW9B 4BWUA 4XNUL 3BP4A 1AZBA 4MB3A 3UL4A 2VZOA 1RKRA 5EUKB 3BUYB 1HNYA 3CUPB 1N6UA 4C4UA 1I3UA 2WXHA 4U0RB 1HHHA 3NIGB 4YEEA 2EDBA 5F1KC 1FDLL 1IT9H 3PP4H 3L16A 4KPHH 5E8EB 2HPOA 2YR3A 4HCGA 2VDKL 3VFUB 3QRFM 5IFHH 1DO5A 2WLHA 1JN6A 2RHEA 2HJFA 5F6HI 4AEFA 5DT1H 1NDTA 4ZUSA 3FT3A 4H8HA 3QH3B 5BUAA 2F7OA 2DICA 3ZDWA 5B7MA 4OZFG 4N2IA 4YWGH 2LOEA 1RIHL 3GMOB 4PS7A 1MRFL 3NIDF 1V7NL 5FUZH 5ICZA 4MJ5A 1L7TL 1OALA 2MWCA 4JFZL 3Q8FA 1KN4L 1DEDA 2DM7A 3H54A 5DMIL 5CGBA 3RVXD 3B83A 5D72L 1CXLA 1X3DA 5JIKA 4OKDA 1KFGA 3ATDA 3N50A 4U6TA 4OJCA 1F6AB 1UFGA 1RJLB 4AJYV 3VXQB 2CIIA 4E5XB 3CHRA 1BGXL 3ZO9A 1FAKT 1BIHA 2F61A 3EW3B 1WISA 1N64L 3D08A 3HCVA 2WVUA 3OPZL 2NW2A 4FZEH 4QF1A 3FTSA 4PGEA 3A47A 3DO3A 2VN4A 2WP3T 1UACL 2G3ZA 3GHEL 4YIQB 5I6OA 2EUVA 1FL3A 4E0RA 1CXHA 2Z92A 3QQ9C 2R56L 4CSZA 2CDEA 5I26A 3I74A 3RFZA 2A6DB 5KSBF 5BOJA 1P6AB 1Z9LA 4ZFOA 1LE9B 2XPZA 3HC0A 4JHUA 3MRDB 35C8L 4X99A 3RX5A 1J1OH 3MU3A 1KB9K 4AYFB 1P84J 4N85A 1MHPH 5DQDH 2BNRD 1QRND 1VFBA 5TPWH 2OYKA 3IFLL 3NCCB 1BVNP 2EACA 2GFBB 3FYIB 2AV7B 4JCWA 4L8CA 1IV8A 1MELA 3MLVH 4JLRA 4EIZC 2XTJC 2CXKA 1Q9WB 3IFOA 1VSCA 4XVJL 2CBQA 4XCYB 4C54A 3EH5B 2NR6A 4XMXA 1U3NA 1JPSL 4K7PY 3U83A 4G42B 1U2YA 4P3DA 2EXWD 4JKWA 2Y7SA 4YE4L 3WHE1 4BZYA 1MCQA 3NABL 2V3FA 3KWTA 2D7MA 3S96B 3QRGH 2NXYB 1B2WH 4YS4A 1QSEA 5GRZA 3VWJA 2MFNA 4MCYA 5TFSH 2MOVA 2VMDA 4N0RA 1XGRB 2BCMA 3SOBH 1AI1L 3NSJA 5CILH 3B5TA 3ZL1A 4FFZL 5ACZA 3RWEB 3TV3L 3ZUCA 4HUUA 4FP8L 4G3YL 4AMXA 3FCSA 3P4NA 5D8JL 1PYWB 3FRUB 1IAKB 4HG4J 1QHQA 2JJWA 4CMMB 3MCLL 1KEGH 4Q74A 3MYJB 4BBWA 3LTVA 5H37A 1MHEA 2FLRT 1N8ZA 1I1YA 3QDGA 4YXKH 3AXHA 1F11A 2MTAA 3HR6A 1WS8A 2H0EA 1A14H 1FFNB 5FC9A 3K6NA 4LRIA 3VXTB 2NQDA 5LGJB 5AVQB 1G1OA 3C5JA 1FYTE 3MRIA 3D85B 3TL5A 4KK5D 4ESKA 4X7TA 3ZGIA 3KVDD 4MDIB 4TMPA 1ZSDB 1BQRA 4CVZA 1QR1B 2E9WA 4XOAA 5JORA 4ETYA 4C4KT 1YN7B 3GXMA 3Q8CA 4OB5L 4QT5A 1RCYA 3HR5A 4NO2B 4U1SB 2DIJA 3KLKA 3NZ8B 1E2WA 4WI8A 3PG2A 3UEQA 4M7JL 2MPAH 3KPSA 2K4AA 4H88H 1CTOA 2R4RH 4Y9BA 2QFPA 4RQQB 3ERXA 4BSWB 2H5UA 4MMZB 3D8MA 3G7TA 5J1AA 3FCTA 3O6KL 4HGWB 3GSUA 4ODUA 4RDBA 4HKZA 1HL4A 2EYSA 5T1LB 2YXVA 4K5NA 5J13C 1A6AA 5I1CL 1KPVA 4TVPE 4XP1H 5AL8A 1TEYA 1BBJB 5DLLA 3SEPA 4AYSA 5SWQA 2AKRA 4LHUG 3VYPA 2HX8A 1R33A 1JDAA 2I7SA 5C3IA 2XG4B 4L3ED 3U7YL 3PV6B 2YRPA 1ZS8A 3D7PA 3T04D 1TVBA 4O2FA 4PGBB 4PP1C 4NO5A 4MSWB 5F7EH 3QZNA 4NQQA 5E2VL 4G8GA 5FAAA 1JPFA 3RWJA 3BMVA 4TUJA 3ZKXB 5D6CB 3NRQA 2V2TA 1DVZA 1IGJA 2PYFA 2WUCH 1IQDB 3KWVA 4U33A 3RA7H 2E59A 1SXZA 4JN2A 1JE6A 4B5EA 1QFPA 5L4IA 4BZ1A 2O6DA 1GOGA 4IJ3C 1UD4A 4U1NA 1Q0YL 4L2YA 1N67A 4AXWA 1ZGLM 2BHUA 3CGTA 2QKIB 3G6AA 1XL4A 4XCNB 1MXDA 1J1XH 4QYOA 4UDTB 4QXUH 3TC9A 1GA2A 3C08H 3RVTC 2YRZA 2RIKA 3VTAA 2HT4C 3K72A 2QZ5A 3HVNA 3BWUF 5HHOA 3ZIYA 1MPAL 4AK2A 4H1LB 1UB6A 2FX7H 2PYED 3BZDA 3L9BA 1P2CA 5GPRA 2XNAA 3SO3B 4P05A 2VLKD 3AMLA 3SBRA 4FABL 2KLTA 1P6FA 3CZJA 1EZUA 2ZCLL 3CPUA 3E8UH 2A74C 4MA8H 4XB8A 3DVGA 5E5RB 4X42A 3IWVA 2B1AL 3FQWB 4BFIB 3BUQA 1TO4A 5LWYH 1A4BA 4XCEA 4WUUD 2JTDA 2FR4B 4N1EA 4GRWF 4MASA 2I60L 5CIPH 2EKSB 1JAEA 4FMVA 4IKNA 3MI6A 4OGYL 1MCWM 3VRJB 2YPLB 3X2QB 3RNKB 2XTJE 5AEAA 3FRPB 1XTMA 2AVGA 4HEMA 4ZNEE 2J6WA 3QNFA 1A25A 3MRPB 4L5FE 3C87A 1PG7X 1T4WA 2VWEE 3IMWA 4GLRH 1BF5A 1S8DA 5E51A 4JFPA 4UMGA 3RGVA 1AZUA 3TPKA 1CTMA 1JGEB 3VFOB 5KZCD 3GTVA 1IILE 2Y2WA 5DGRA 1AO7A 2PO6D 5E8DH 3WFDL 3QFGA 4YSEA 2BIPA 3DJRA 2R27A 1U8NA 3IF1B 1FV1B 5GGTA 3BZ5A 1KBGH 2WXNA 3DVIA 4LKCB 4QXWA 3KLAB 3FB6A 1IEBB 4WGKA 3UJIH 1QPKA 3ZYJA 4J2XA 4OGAD 1TSRA 4G8FB 1I7TB 3ARFA 1PU0A 3ZHLA 1KBWA 2LU4A 1DJSA 2PTTB 4FXKC 4NXKA 4RRPM 2Y36L 4LNVA 4MMXB 5HYEA 4KROB 5BZWA 1G5GA 1E5CA 1YAIA 3JWNE 4JO1L 4KQ4H 5IMKB 4J3OF 2O5XL 5FHAL 2WO3B 1Z5YD 3HMXH 4LZKA 5D93C 3O4LA 4Y16D 2DEXX 1LO2L 4JFEE 1EJ6A 3K2UH 4CILA 5KSAA 4NLHA 4N2KA 4Q52A 5B38B 1WIOA 2FYVA 1PAMA 3N85H 1JZ4A 1J9SA 5D1ZI 2IBZX 1EEUA 2FIKB 4LCYB 1A1OB 2WXOA 4QHMA 3QE5A 3O6FC 1FNGB 2GHWB 3DUSA 1C16A 3PP4L 1JRHH 5I76B 2IAMD 3RZCA 5CJXA 2JLLA 2P80D 1UUNA 1JK9B 3DXAA 2V2XB 3EH3B 1BQLL 2F68X 3QQXA 4YN3A 3F12B 2FEJA 3ESUF 4RA0C 5DT1L 5JUEL 2D2OA 3PL6D 1TZ8A 4M5ZH 4OCLC 2DMKA 4XAKE 1QFWM 3TZVC 5L6YH 4H26A 5DWPA 3SDAA 3ZZ1A 1FIGH 2IAAC 1D5MB 2WOBA 3A6CL 5HYQA 3TBYA 4MWFB 4K73A 3HS0A 4WU7A 5ALBL 3H3PH 4JDZB 1QSZA 4WI7A 3ARPA 3LEYH 4Z8FH 3LV3A 4BE5A 4EZKA 2VZSA 3ULVE 1JGLL 5ES4B 1SZNA 5KW9H 2BSED 4ZPVB 3MZTA 2VKWA 3ZPDA 1W72A 5HYJD 2YSSA 1NINA 4YBLB 4NFDA 5JOFB 3NG5A 1AYRA 4B9IA 2IPKB 3RTQB 1JGVL 2A0LC 1E7VA 3ML8A 1XAUA 4P4RA 5DYOB 2OAAA 3GSXB 1AHWB 5IG7A 4UOQA 4XMKH 4XI5D 1U8PA 2JQAA 3T8XB 4DO6A 4OIAA 3EDJA 4N0CC 3LPPA 1CIDA 2R2EB 1WFNA 2WZPA 3WG7B 4L1LA 3WNOA 4GKNB 1DP0A 2KQMA 4M5SA 4XXWA 3QIUC 1DJWA 1HYRC 3WJLA 5I9QB 4OCWH 2WKGA 2VRQA 3QZOA 4JO5A 4OI8A 4QTIH 1UM5L 5T1KA 4HLEA 1DEEA 4NO0A 5CEZD 3BWAB 4EDXA 2AEOA 4U1MB 1QABA 2VDNL 3SIKA 3ZMEA 5EDSA 2PWFA 2AJ3B 2ORBH 4KFZC 3Q3GB 3HG1E 4NZUL 3S5LB 1JK8A 5EC2B 5CLWA 1Z0MA 4J8RB 1FNEA 1UQSA 3C5ZA 5CSZA 2CAKA 4P46D 3Q6GH 5CCGE 4PJCA 4XN5A 3VG0H 25C8L 4HJIA 5I1IL 2R1YB 1DVFB 1M7IA 3EFOA 1BQHA 3ELQA 3PWUB 3EOAA 5BMFL 3P77B 4G6ML 5F7BA 2ICEB 4R0LA 3NCMA 1AQDA 3CSGA 2OMZB 4G80A 1RJYA 2X4SA 5FX3A 1TJIH 4LLVB 4AZ8A 1TQVA 1I8KB 3PFQA 4BFNA 3BUTA 4WO4B 4JM2F 1SFHA 2B0SL 1CG9A 2JF1A 2O5NA 2CLZA 4HBCH 2WQ8A 2GHZA 3T2NL 3IVKA 3PHQA 1C9SA 1DJXA 1E9QA 1SY6H 1BG9A 2EUZA 4HJJL 2I27N 1NM4A 1ZT7A 1AD9A 1QX1A 3TP4A 2D8KA 4PJBB 1TTUA 1ZVYA 2Y2YA 2LLNA 4PRAB 3SY6A 4HPHA 4DGWC 1QG3A 1MCDA 3FUHA 4GAGL 5FFGA 1ZD6A 1MUJA 2R0WL 4Z7WA 4LVOB 5KVGH 3KH3A 1BM3H 3W11D 1KYAA 3D05A 1JVKA 4HAGA 3D07A 5EEVA 5LAPA 5I1EL 4JO3H 2EEXA 2FK9A 4MXQC 2HVKA 5B4MD 2V2WB 1KYOK 4HS6A 4NFCA 4X7DC 1X5HA 2DWDB 5GGRA 1N6QL 2F19H 4R3SA 2EDRA 3NA4A 4NM4L 2NY1B 2ZCZA 3HBZA 4YHIB 1R5WB 2A9AA 3EDFA 1JFQH 3NMEA 5ISZD 4UOW1 4HIXL 4G9DA 4KNUA 4TUOB 2JB6B 1KG0B 3DRTB 1U8JA 1U93A 4IBTA 5AKRA 1BW8A 2RBLA 4AE1A 1H8OA 3F2LA 4PJFF 3ZO0A 4MXWL 1NSNH 3LEVH 1AAJA 1S7RB 3QEQB 5FUCE 5CEYB 4UNIA 5JQIB 3H7BA 1AJ7H 4KXZH 3QUKB 4OZHA 3KEHA 1ADWA 4N9OB 5BS0A 2OTWB 2ED8A 4JZJB 1KIRA 1DQJB 2GG1A 5D7JD 4F8TA 4F9PC 1HL5A 4XNMA 3U0PB 3OWRA 3AU1B 4HEPA 4NOBA 3MJ9A 4BUHA 4XCFH 1OSZA 2FECL 5B3JF 3AAZA 1P5UA 4OF6A 5E94B 4HUVA 1EH9A 1QBBA 2W92A 4FG6D 1PD6A 1J5IA 1CLVA 4IKLA 2EILB 5F7EL 4HC1A 1NMBL 5E9NA 5H37H 3VXRE 1PY9A 1LWJA 1ND0A 1YDPA 1T1WB 4K3GA 4PTTA 3UTQA 3FK3A 5DHVH 4HJTA 1I8UA 2DJMA 5KSUB 1M9WA 3Q1SL 3T0VA 1RJZA 3IWUA 3KCWA 3L3DA 3B9EA 3DIFA 1ZV9A 2G3NA 4IS6B 1RZPA 2QDVA 4CKVX 5C0RH 1J9RA 1NCHA 3WO3B 2XRAL 2GY5A 3UTPE 4N1HB 4RSYA 3C08L 4FTDA 1G9MH 4TF4A 2L4OA 3NZHH 1LWRA 2OZ4A 3KXFD 3IJHA 2G2RA 4LHUD 2ARJA 4ZW6A 3FCBA 3L3KA 4LKXA 5HVHC 3L5HA 2BIHA 1I9JL 3IM1A 4WCYL 1M1XA 1F8TH 2NX5D 4LGRB 4GS7C 3OKOB 3WI9A 3VDAA 3OGOE 5DD5H 3AY2A 3MKGA 5AAMA 4WWKC 4G6JH 4FQIL 3E9TA 1U8CB 1U8MB 1FL5B 4APQC 4AQ8A 1JF6A 3MTXA 4PYGA 4UQDA 1FP5A 5LXGH 2K9FB 1FYTD 1HS6A 2IANE 4LL4A 3UJJL 3ABGA 1QI4A 4YR6B 3SYAA 1GYAA 4Z78A 4KRLB 4HVBA 1H15B 1RZKC 1ZTXE 3RUGE 2ADGB 3STZA 3HHSA 5AD0A 2BOBB 3KCPB 4LSVH 5HHME 2Q7YB 3GLEA 3PNRB 4QCIA 3KHQA 4M5TA 5A16B 5K39B 5GZND 2O61A 1X7QA 2ZG2A 4CN1A 2AEQL 4NWTL 4JVPA 3PDDA 3QUYC 2BP0A 3SY0B 4LEOB 4PUBL 4UU9B 5KYXA 3P0GB 4OF3A 4F2ME 5I19H 5K9KA 1BZ7B 3ALWA 4LP4A 4HF5H 1JMZA 3MGTA 5AVUB 4HCIA 2IH1A 3M88A 4OGQC 5G5DB 2GCYA 3BDYL 2K8MA 5HGAB 5AFAA 5DDHA 4YAQB 3HS8A 4X6CF 2XBZA 5FKAB 3LKOA 4TVPD 1YJDL 2K7PA 2EDOA 5CIPB 3GBDA 4OCYL 2WTRB 1BX2B 1CICB 2LVCA 2X2UA 3UJIL 3VMOA 4CN4A 4MBRA 1U3HB 4HHAA 3P2BA 4R83A 3TO4D 2BJMH 3NESA 5BZDA 4P2CG 5FA4A 2MQCA 2X89D 2CMRL 3PABA 1E30A 3CVHL 3QJVB 4FQHB 5TE7L 3U1SH 3EYVB 3WEXA 4DPCX 2Y1AA 4PRBA 1NEPA 4PSPA 4HD5A 4HIIA 5FGBC 3VFPB 1CDGA 4OCXL 5I0ZA 1NFIA 3ZXAC 2AV1B 4ODHL 2BVOA 4P8QA 4OY9A 5AUMB 2EDFA 3EHBD 3JWOL 3MGOB 3F7PC 1AC0A 3OXSA 1UZ8B 4RFEB 2UXVA 5IHZA 3K5RA 3ASOB 3VMPA 3O8XA 3GMMB 2F54E 3A0OA 1KCKA 1WZKA 4TOYH 2XCMC 1JRHL 3EF4A 5IQLA 5IF0B 1RUKL 4U2ZA 2HJKB 5D5ME 5C0JB 1K4DB 5CP7B 3OZLA 4F8PA 1YEFH 3VD3A 1A9BB 4O4YH 3IMTA 2YD3A 5CBAB 2GJ6E 3BSHA 5HHVH 1KJ3H 3VSTA 3L3GA 1TTCA 1P1VA 2AEPH 1JD9A 4JANB 4XMWA 5GGQL 2Y4SA 3KM2A 4P2RE 2JNZA 4HWZB 3UIYA 3FFCB 3MV8A 4DIXA 3V0WL 3VVVA 3TN0A 3DROB 3W1ZA 5CEXA 4ICWA 1EFXD 2OXHB 5HI5C 2B4CH 2CO7B 3H3PL 2XTJD 3FT0A 4FFZA 4JRYB 1QBAA 5CAYB 1BLIA 5TDOB 4IK6A 4PRNA 4QRSB 4DP9X 4BWWA 5JHLH 3OZ9L 4EI5C 4HZLA 5ID0A 4KVNH 1KXQA 3HE7C 3FN0L 1ZA3B 4FQXA 4I9WE 5KTEL 1UCBH 3DBSA 4ODSH 2DJ4A 4H8WC 2WWKO 1A1NB 2ZKWA 1MCSA 1MHHB 2CKNA 2YQGA 4HLZH 1CGXA 3HRZB 4G5ZH 1UJ3B 3RDJA 1T0MA 3V5DA 1FVCB 2IALA 3ZRSA 5I8KH 3MLSL 4OCWL 3D2UD 4HALA 1SJEA 1SEQH 1V7ML 1S7UB 2D9CA 1Y6NR 2J1KA 2WCSA 3LRSA 3MC0A 4M02A 4Q6YA 5BZXA 2AJZB 4M7KH 1UCTA 4I1RA 3VE0B 3MNZB 2K7QA 3TNMA 3WKPA 4BCYA 3K4AA 1TTRA 2C9AA 4AC2A 1SYVB 3P4MA 5B3SB 2I24N 2DQGH 5JPNB 4XRCA 5B39B 1GMEA 2G3XA 1NCCH 1S3KH 4B60A 5B8CC 1AIFB 3BPCB 1DR9A 2K0RA 5FOJA 3UOAB 3MUJA 4JZNB 3TYGL 3PGCB 4JFED 3VXSE 3CXFA 3BRDA 2GKIA 2AZAA 3CFCH 1VFMA 3ESNA 1L7IH 4PS8A 3O3DA 3U2SB 3NCYP 1Z3RA 3GFUA 2CUIA 5EEXA 3ALPA 5D4JA 5T5FA 4F33A 2G0LA 1FGVL 4LAJH 5DJXA 4KBPA 3BPLB 1HHHB 4P5TC 5D7IF 4JJHA 1YZZA 5DRXA 4OGZA 3Q5OA 1D9KA 1LK3L 2M2DA 1IKNA 5CGTA 1C8QA 1HNGA 3G9VA 4Q9QL 1SGKA 4ZODA 3GT6A 4XAKD 1KTRL 1FL6B 1BJ1H 1J8RA 5E9DB 3GHBL 4ZUSB 4AOFA 2QR0B 2G9HB 2TSAA 1UASA 3S35L 4HPYL 5ICZB 1QUNB 3T4AA 5KVGL 3MCKA 4NZTL 4M6OL 1FLTX 2AJXL 5EU4B 3X3FH 3GYRA 2YGNA 5FHBL 2J2ZA 3L4UA 2QQKL 1GTFA 1J10A 3S2AA 4TSCH 1SJHA 3BH4A 3VQ1C 3MBWA 2DQDH 3HCVB 3IK2A 2BNQA 3RHWF 5EOCH 2XYCA 4LGSB 2X4TA 2Z92B 2IGTA 1XEDA 4LIQE 1T2QL 3GI9L 4MS8C 2CDEB 3RFZB 1Q9OA 1F42A 4ODTH 4OF7A 5C71A 4OI7A 4NPJA 1KFAL 1EDHA 4ZFOB 2N7BA 3GRGA 2Q2EB 2NDGA 4YVUA 1BZOA 2HT4D 1B4JH 1IIKA 1RP9A 3MQIA 3SQOL 4MQXD 2HFTA 1S5HB 5IQOA 2VOTA 2J5LC 5IJKA 2WYTA 4PJ9B 1N5AB 1NMCC 2XKSA 3AWEA 4L8CB 4KKNA 2VC2B 3HAEA 4JLRB 3ZDYB 8CGTA 2IH3A 4PFEA 4XCFL 5CJBA 3IFOB 3KWWA 4MJ4A 2UY7B 2DI9A 1F86A 5TE4H 4OM1L 5E6IA 3ALXA 4D8OA 2IOIA 2P5PA 3CPLA 5BRZE 2WLIA 3GF8A 1CZ8L 1ZDSA 2CRMA 2PPCA 4FQ2H 1XF4A 1BQ5A 4PIRF 2P47B 4FLSA 4Q9CA 4F93B 3ZR5A 5I6XB 2ZTBA 3RE0A 3V52H 2E6QA 3SBWC 1YMME 2J1ZA 2DWSA 4X5QA 1QSEB 1RK1A 3KGRA 5IWLC 2J6EA 4XPGL 3VWJB 2BY0A 1G0YR 1GZQA 3SE9L 2BWDA 5A2KH 3FUEA 3PRZA 4IKJA 5C0RL 1BQSA 3CIQA 3GKWH 4IBZA 4HK3N 1RI8A 2OI9C 4DKFL 2JH2A 3CSYB 3NZHL 1SEBB 1YEDA 5EFIA 2Y0SA 3HC4H 3VMNA 4Z7IA 3P4NB 3GSOA 3ZT5A 5AKVA 3TO2A 1OSYA 2JKWA 5C0CA 4NAJA 4WW2B 2VDLL 4Z7QB 5I82A 4G6JL 1HSBB 1MHEB 4M48H 3QDGB 5EC1B 4Z95H 1R47A 4FX5A 5DHVB 1GXEA 1DQVA 3HHRB 2ADYA 1MW1A 1AQKL 3UG5A 3LQAC 3WIFA 3JV4A 1ILUA 3RWIB 4APXB 1P5VB 4E9VA 4BZ2L 1ID2A 3ZR6A 3D33A 4PAZA 1ZA6B 3V4UL 3DNKA 4UV4L 3KG5A 4X7TB 2AERT 2X6UA 1BVZA 2GIXA 2CJUH 1PS3A 3S3PA 4ACPA 4B9CA 4Z77A 4NQEE 1QSFE 1OAKH 4YXHL 4JDEA 4JMNA 2YZ1A 2ZAGA 2CKBL 3L17A 5CHNA 5E6UB 3ZKMC 4Z3EA 5I19L 4XC1L 4HF5L 3G5YA 1E4XI 4FMFA 3P9MA 1KJMA 4N9GB 1CF8H 4X9GA 3DX0A 1T6VN 3O0RL 3V6FA 1J9TA 3FCTB 3O6FD 4HKZB 2WVTA 3QJQB 2YAHA 3DMMA 4TQEH 3RL2A 5ANMA 4F27A 3AQDA 4ZBJA 5SWQB 2XZAH 4X8JB 3NJLA 2L3BA 4G9FA 4U0RC 1HESA 3ZL4L 3P0YH 4F5CE 1ZRUA 5DLMH 4KK8C 2F58L 5AOIA 3O2VL 2UX7A 4GP8B 1MKFA 1QA9A 4TSAL 3MRHB 1TVBB 4O2FB 3RAJH 3HB3C 2QVKA 1NGPH 4LPUA 1E27A 3RWJB 1FPTH 1M9SA 2V2TB 5IOPA 1IGJB 1NLBH 3KPLA 4G8AC 4JN2B 1NBYA 5D7SL 2VL5A 3FU7A 2ZQKA 5MEQA 1SXNA 1JPEA 4DVBA 5B1KA 4U1NB 3B4NA 4IRSD 1C5CH 3MBEA 4QYOB 5KBNC 4A67A 1CE1H 2OMTA 2NSQA 4UBDC 1DUYA 1UB6B 1XH3B 4L4TE 3ETBJ 5GISH 3D39E 5DEJA 3NN8A 1U8HA 4U3HA 4JGUA 3V4PL 2V6HA 3G6DL 4GB9A 1OGAB 2J55A 4AIZA 3CHSA 4MCNA 4O4YL 4JGNA 3CX2A 1XR9B 1VFAA 2YS4A 1KJ3L 2WINA 4PRPA 5FUOH 5HHVL 5IROC 2OLDA 3G5ZA 1KLGA 1VADA 5DJCB 2G9KA 1AY1H 2K4WA 4XCEB 4BKSC 5IJVA 2APBA 1V8HA 1UXWA 1VKXA 5C0IB 1XSOA 2AQPA 2CDGA 3BVVA 1FRGH 5IK3B 5ESVB 5PCYA 2HRHA 5B1JA 1WZ1H 1NQBA 3TNNA 3VFMA 1WG3A 1MWOA 4W9LC 5JHLL 1E6JH 1AGCB 3HZYB 4R4ND 3CLEL 4M93B 3MNWB 1M56B 3HKFA 4IDJL 4ZFQA 4JFFE 3TM6A 2IO5A 2QVFB 4G7YH 4HUKB 1X6LA 5DUPL 1E28A 1S8DB 3E1ZA 1GL4B 5SX4I 5HHXL 1G9HA 4PJFA 4ELME 1DSFH 1UOVA 3N3EA 1LQBC 1GYVA 5F7DA 1UZGA 4G5ZL 4NQDB 1NAMH 1ZMYA 5BXFB 1U8NB 4NQXB 3WGUB 4XP4L 2FHCA 2NOYA 4DVRH 2NXYC 2Z35B 1SEQL 1WYJA 4PP2B 1IEAA 3O3EA 3TT1H 5EO9A 3OWEA 3OXRA 4M4RB 3QI9D 3OF6D 2IPUG 2ZSWA 1BFTA 3AFLA 4PH8A 1S3KL 1PLAA 4YK4C 4YFLI 5JW5A 3GZQA 1OAXL 1I8MA 4ONFH 4EBQL 3GSQA 3WJJC 1XX9C 5KBDA 3I6KB 1DSWA 3LPOA 4LARH 4FFYL 3X12A 1E4KC 2AXGB 1QFWI 1D2PA 2PCFA 3EJYC 2HUEA 4KH2A 1DBJL 2F54D 1E5YA 5KSAB 1PZSA 2CNYA 3NCJH 3MO1B 4OQ1A 3LNEA 1RUQL 1KBKA 1FWXA 2VGLM 5IVZA 3U79A 3W39A 1MW3A 4QHMB 5IBLC 3S3SA 2YAQA 3RY5A 5GS1B 1BQUA 1C16B 3U0TB 3S5YA 1IBGL 2GJ6D 1REIA 4WVRA 3RZCB 4JFDE 1DQDL 3DXAB 3DRQA 5FOBA 3P3RA 5JR1L 1UD6A 4P2RD 4DOHE 5INDB 2ENQA 3OG6B 1FFPB 4KOCA 3WU1A 3T1FA 4NN6B