3M7FB

Crystal structure of the nedd4 c2/grb10 sh2 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
176
structure length
135
Chain Sequence
ELHNDDTRVVRVKVIAGIGLAILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENDDFLGQVDVPLYPLPTEPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPTHLPHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/ligase
molecule keywords Growth factor receptor-bound protein 10
publication title Structural Basis for the Interaction between the Growth Factor-binding Protein GRB10 and the E3 Ubiquitin Ligase NEDD4.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 135
sequence length 176
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3m7fB00
2D8KA 4F1SA 2CHXA 4QJ4B 3R7RA 4ANVA 1YRKA 3QR0A 4FJYA 2DMHA 3NZUA 5H4YA 4FULA 2A4ZA 3HIZA 4FLHA 3ZW3A 3F05A 3B7YA 4KITB 3CSTA 4ICWA 4WWOA 3GPEA 4NPJA 4V11A 4XX5A 1UOVA 4XE0A 3W56A 2ZKMX 4FJZA 3F04A 2ENPA 3L08A 1WFMA 4G11A 4IQHA 2DMGA 1RSYA 1QASA 1V27A 3APCA 4LCVA 3W57A 2BWQA 1DQVA 3CSFA 2WXKA 1CJYA 3HN8A 2JQZA 4HVBA 2K3HA 4URKA 3MJWA 2CM5A 2CM6A 2LHAA 1E7UA 2WXPA 3PS6A 3RPBA 3F01A 2EP6A 1BCIA 3KWUA 3RDJA 3L16A 3NSJA 3QK0A 4J6IA 1RH8A 4FA6A 2WXMA 1QATA 5JHAA 2CHDA 3TJPA 4EZJA 2FK9A 1E8XA 1DJIA 3PYCA 4QAMB 4L23A 1DJGA 4L1LA 4WAFA 3PRZA 4F93B 1TJMA 4IHBA 3PFQA 2Q0ZX 4ICXA 4MJJA 4Y1TA 5H4ZA 2A5UA 3NZSA 1E8WA 4DK5A 1E90A 4FHJA 4DNLA 1UOWA 2WXNA 5KJ7E 1E8ZA 1BDYA 3QJZA 2FJUB 4ANWA 3PREA 4AOFA 4KZ0A 4L2YA 3FBKA 3JZYA 1GMIA 3N5AA 2Z0UA 3FDWA 4EZLA 4ANUA 4AJWA 4Y1SA 3S2AA 4TS6A 3P2BA 1DJHA 4F91B 2CJTA 4GB9A 2NQ3A 4BGDA 3R7QA 4F92B 4TV3A 3HHMA 1W16A 3L4CA 3KWTA 1E8YA 3DPDA 1DJWA 2WXIA 2CHWA 1WFJA 4TUUA 2N1TE 2ISDA 4HLEA 4BFRA 2WXQA 4PS7A 4QJ5B 3F00A 3IM1A 2ENJA 4LT7A 4FHKA 4WEEA 2WXHA 4WWPA 2UZPA 2CJSA 2B3RA 2QZQA 3QARA 2WXLA 3OAWA 4JPSA 4PS8A 2WXOA 1K5WA 1DJXA 1HE8A 3ENEA 3DBSA 5EDSA 5JHBA 4OVUA 2R83A 2X38A 2NSQA 3TWYA 3ML9A 2WXRA 1DSYA 2V4LA 4L1BA 5T8IA 2WXGA 1RLWA 3L13A 3QR1A 4A55A 3APDA 2QZ5A 1DJZA 3QAQA 3T8MA 2NCEA 3IBEA 3SD5A 2K45A 2K8MA 2Y3AA 1E7VA 2YOAA 3APFA 2CHZA 2K4AA 3TL5A 4PS3A 4ANXA 1UGKA 1W15A 4WWNA 4EZKA 2Q3XA 5G55A 3ZVVA 3L17A 1A25A 3M7FB 3L54A 4LDCA 5CCJA 2WXJA 4GNKB 1BYNA 4QJ3B 1DJYA 3LJ3A 4NPKA 4KZCA 3ML8A 2YRBA 3ZIMA 4NP9A 5CCHE 3L9BA 4NS0A 5CCGE 2KI6A 4XZ4A 3OHMB 4OVVA 1TJXA 2RD0A 5G2NA 4FADA 2ENQA 2WXFA
chains in the Genus database with same CATH superfamily
4LCIL 1TU2A 3SZKC 2PTTA 1FYTE 3KCPB 1TO4A 1Q94A 1ZK9A 3F5WB 2I60H 5DC9B 4G6JH 3KPPB 3KYMA 4J27A 3T3PE 4PG2A 5CJ8A 4AEEA 3AMKA 3AWEA 4XZUA 3T2PA 1PSKH 4XMWA 1CE1H 4U2ZA 1S7QA 3NJMA 3VXME 1WA2X 4XX5A 2ENPA 3ABKB 2VXSL 1U3HD 4HKJB 1DE4B 1IAIH 1JXDA 4UT9H 1JXFA 4MMZB 3FF8A 2OSLB 4KKQA 3OPZH 4RX4D 4APXB 3PXJA 1LK3H 3TJEL 1YEGL 5GS1C 4N3TA 1ZA6B 1S7VB 4MS8C 4MNGE 3GK8H 2UWEB 2OI9B 2BS71 1YNTF 3BXNA 3PDOA 4QRPB 5DZLA 2JLPA 3KDMA 1OSPH 5HI4C 2YGVA 3ARGD 1G1CA 3MLYL 4GSDH 5HVHB 5KVFH 2UWEE 1PYWB 1INEH 2R0WL 3ETSA 4QRPE 2ZCLH 3NFSL 3PL6D 5IBTL 3C6EA 2Z31D 2VJXA 1CDUA 2JI2A 2YK1H 2DQJL 3JZYA 4K3JL 3RURA 5B8CB 3MPCA 3AROA 1EZVX 3UBFA 3T0BA 3LPFA 3F7RA 5EFIA 1M05B 5D4QA 3BSZA 3VI4B 4FXKA 3ROOB 4F91B 5E6IA 3LRSA 4UT7L 1W0VA 4WDIB 4JDVA 4PJHF 3ZDYF 1RZJL 3VI4E 1IGTB 2CLVA 2OR9L 5IB5A 3DX7A 3GM8A 3GI9L 4LPYA 3CFNA 2H0EA 2IBBA 3EO9L 4XCEA 1WZAA 1Y6NR 4HS8L 3SDCB 4BUHA 2WCSA 1UM4H 4HS6A 4KUZH 4TSAL 2D7TH 1PJ9A 2DQIL 3BUIA 4XRCB 4YLBA 1K5NB 3RKDD 4ENZA 4W4OC 2M26A 1G6RA 1MCPH 1M3JA 4OVUA 4U3CA 4Y19A 1LP9B 5JYLA 2OCCB 2JIXD 1WIOA 2V4LA 2DQFA 3ULVC 4KK8C 1TQUA 1K3IA 2B1AL 5JIMA 5BV7B 2ZOWA 1LP9E 3FU5A 3UBXI 4KX9A 3MCLH 3BP5B 5FDYA 1F4WL 3ARFB 2QFRA 2CHZA 1IBGL 3LQZB 1UGKA 3QFDB 4PUBL 3WNMA 1I7UA 1VZHA 3GHEH 4QXGL 3B7SA 2C1OB 4ZPTB 5C08D 2R0ZL 3REVA 3X13B 4P2OC 2W65B 3LKPA 2NNRA 3E8VA 5TFSL 4NZTH 4X0KB 1OXYA 4QRUB 3CZSA 3G5YB 3L2LA 5HYJB 1TVBA 2HYMA 1BVZA 1X3DA 5GRJH 4HG4K 4YFDB 3FSAA 4IBVA 4G2AA 3L1OL 1QAWA 1E6OL 3IEAA 4JO5A 2H7WA 5B38G 2XBZA 4WU5A 1JZ6A 2BNQB 5LWYL 4KGLA 5DJ0B 4FXGA 1BFVL 1TDQA 5TE7L 1CFNA 4OLWL 4Y9EA 4CN6A 15C8H 4L9LC 2N59A 3D9AL 3VXPB 2OMZB 3L1FA 4BZ2A 3LCYA 3TU6A 1DQVA 3HBQA 4URKA 2C3WA 1FV1B 3RWFA 2E9WA 1NJ9A 3S88L 4Y9CA 1CZ8L 1DJSA 1TG8A 1MOEA 1SBSL 3MJ8B 1WE5A 2AEWA 4BCXA 3FN0H 1E2VA 4Y7OC 1KDJA 2HKHL 1GGUA 4UYPA 3TV3L 4LSSL 4CAGA 4ELDA 3F3HA 1UVQA 2VZ1A 3N42F 5E4EC 5E51A 1BQHG 3M45A 4K8RC 3QXTA 1ZHBB 2ETWA 1OGSA 3PP3H 3DVNB 1R17A 4KV5E 4PJGE 5TF0A 4ES9A 3QRGH 4HAFA 5CNHA 3ULUC 2KS0A 2PUQT 2FEDD 5KG9B 2EDEA 2PW1B 3L7EB 3TEXA 2ZWKA 1A1NA 1KBGL 1GRWA 1T4WA 5DWUH 1LILA 5LHDA 3UAJA 2YD4A 3QEUB 4PGDA 4C83A 1JYVA 5KS9A 3MOBL 4MDRA 4P9HL 2JE8A 4XNAA 1J9TA 3H42H 3TBYA 3IDNB 5FYKD 2P48B 3W0WB 4W9ZA 1C08A 3NN8B 1B2WH 4FEMA 1V7NH 1WBYA 1RZKC 4HALA 3EG9A 2APVA 5DYOB 5DZNA 5ETUB 3MRJA 1ETJA 1UACL 3LEVH 4GRWB 4RESB 4ZSOA 1EZUA 1CLCA 5IOKA 1EJOH 3LH2L 5A43C 3ESOA 5LQBL 5FKAB 1GY2A 2J88H 1QNIA 2NZ9C 4IMLA 5G4NA 4Y4HD 4KI5D 4YSOA 2HTLD 3PNWB 1AZBA 4DP5X 1KTDB 1EEYA 2AJZA 3QO1B 3MLWH 4HXAL 5IROC 4A37A 3MJGX 1UFGA 5KSUA 2C34A 3F7YB 2WKGA 4R96B 4XNYL 4YSDA 1EFQA 3FB8B 2G5RA 4K7PL 4PVNA 4KQ0A 1ZV9A 2GW5A 3T0EB 1YN7A 5EBWB 1KLGB 1PLBA 1ZAGA 2FJGB 1PW3A 4YZWA 1AKJA 1L0YA 3T0EE 2PYED 1HL9A 1XGZA 5FX3A 3RE0A 3X1FA 3KEHA 3MBXH 3MXVH 4FTVE 4XOAA 2ROYA 1F1DA 3KD4A 4JKPH 5I0DA 1Q9KA 2QQNL 1FORH 3L3JB 4UBDD 2FECI 4R0LB 1DCEA 3COOA 3CVHH 1XXDC 4D0CB 5J6HA 1T7ZA 1B4TA 4R4NC 1YEDA 2HJLB 1Q0XL 4YHOL 3WE6B 2OJZL 3UPCA 2HPTA 3DVGB 1E9QB 4MQ7B 3I6LD 1FNHA 3EXJA 5IEKB 3HFML 1ZHLB 3FO1B 5FOBA 3ZDXF 4HUNB 2A4CA 2HCZX 3KBEA 2BXZA 2GI0A 5DQJA 5BV7H 3F01A 1F3JB 3AY4A 2WTPA 3BJ91 3F58H 4Y5XA 4MA1B 1DQDL 1SEBA 3ILPB 2KLSA 2F53D 2WWKO 4Y1AD 1PD0A 3HE6A 4PRIA 5DRNA 1LE5A 3QI9C 2B4CC 2ZG3A 1JFQL 3S3DB 1WRFA 2IQ9L 1AO7B 3BPNC 1NBZA 1WZKA 4P5TC 2D3LA 1LO0L 1U41A 4F7MB 2AQTA 1WWBX 1KN4H 3JTSB 3N2JA 3APNA 3U4BL 4YE0A 3H56A 5AAWC 1ASQA 2G30A 2VDOH 3VTMA 4OZFG 3MYJB 5EUOB 2VSMB 4NYLB 2GSIB 5GHWL 3BRDA 4JZJA 1ES0A 4YR6A 1T2QL 3D2UD 2NX5D 5JIQA 5EORL 5JPNC 3OC5A 3F7LA 1JRHL 4KJYA 4U7SA 4UNUA 5EUOE 1OANA 5F1OB 2HPOA 2P5EB 4YAQA 3IFOA 4ONOA 5AALA 3P69A 1BD2B 1RK0A 1MHHB 3G9AB 4DCQB 3VFMA 2E76C 4M8UA 3NCCB 2NZIA 5BVPH 5F1NB 3D09A 1IJNA 4G9FA 1CXHA 3EJUA 5JW4M 5EF1A 4ZAKA 3UG4A 3TOPA 4LIQL 5AW8B 5JTWA 3F8UB 3OXSA 3NA9H 5BJTB 3ATDA 2HT4C 1BFOB 2ADFL 2OQJA 2Y25A 1T1ZA 3ZQXA 3S37H 4LSQH 5CD5D 1ZRUA 3ILQC 1EUTA 3MA7B 3N91A 1OPOA 3IJ8A 4N1CA 4QHKJ 4X8GA 1TR7A 3BQUA 1OALA 1KACB 3ZTNH 1EX0A 5HGBA 2XZAL 3HMWH 1LD9B 4Y19D 4B0MM 3QZMA 2VR4A 4B53A 4PCKA 2DQEH 2XA8L 2VLJB 3K72A 1T80A 1H15B 2HP4A 1EFXA 3IAQA 3VRLF 3Q5TA 2ADGA 1FHNA 3BT2L 4WEBL 4Z7UB 2DKSA 2VLJE 1WZMA 2EINB 4FZEH 3NIDB 2FO1A 1E5CA 3ERXA 4J5VA 2EYRA 1OT4A 1MCOH 2YEZB 3NIDE 4OLUL 1R34A 4Q14A 2YD2A 2NUPA 4OJYA 4BK4A 4P05A 4JFPB 3VG0H 1SLXA 3R0MA 3BFWA 3VMOA 4X6DA 2BW4A 1OF0A 5F3BB 3HIZA 3ZR6A 4U1NA 2CDFB 2DLTA 2GK0B 2D03H 2WO3B 3EHBB 5I30H 4JPVH 2QPDB 5GPRA 1FFPA 4HDIA 2YPKA 1IM3B 5F8QC 4PRHA 3HNSH 5CP7A 2EYSB 1P4IL 4HMCA 1BVNT 2KHAA 1DZ0A 2OS7A 4JLRA 5E2JA 2VDLL 5ICYA 2HFTA 4PJEF 1XL4A 2ZPKH 3WFBH 2VKWA 3VWJB 3ZYZA 4YOKA 4JW3A 2WZPA 2APTA 2J21A 5IJVA 1VERA 2VZSA 4XXCA 3L5HA 1JGUH 5LCVH 2X2JA 4F58H 3ZGIA 3VRIB 2R0KH 1THCA 5KN5A 3A6OA 4MA7L 2XV2A 1AGEB 4XMKL 1GCFA 1J1PL 5EZLA 3SDYL 3TO4B 1PD6A 4L8DA 2A6DB 3ECQA 1TLKA 1BBJA 1EHAA 4KRPB 5F1KC 3TO2B 1B4LA 4XNDA 1QTPA 5I66A 1LTXA 2GIXA 2H6UA 3NZSA 1CD9B 3EGXB 4AQ1A 2WK2A 4Z7WA 2GFBA 3DGGB 3T2LA 4CBZA 5DR5H 1I8AA 2OL3H 2WINB 5AKTA 3TA3A 5JHLL 3VSQA 4PR5B 3IJYA 1J05B 3P54A 1OGAB 4OZIA 2XQBH 1J5OL 1RK1A 4QHMB 2C9VA 2QGCA 3NCBB 3HI5L 1HEJC 2E5EA 4JFOA 4F9PA 4Z8FL 1D5RA 5D7IA 1DVTA 1DJHA 1DVFB 4IIQC 3GT6A 3EJCA 3IXAB 4TLKA 1P1VA 4PMEA 5DUBA 1LNUA 2WBJA 4CSPA 4NN7C 1SOXA 2F18A 3OVUB 4M00A 2J6EH 4GKNB 3NJHA 4ELME 3ABGA 4FXLA 4I4WA 1YEKL 2ILLA 4JPSA 5DJCA 1LE9B 3MRLA 3QJSB 2FUQA 3VXMA 4NJ9H 5FO7A 5GGSY 2A77H 3GZKA 5KANG 1IEBB 1F3RB 4GJTB 3SE4A 1U8CA 4PJ8D 3C75A 3GBLA 4XWOC 1R75A 3WNLA 1KJ2A 4DH2A 3NESA 5I8EB 2DQUL 4I87A 3T2NL 4OCRH 2Z7UA 5HGDA 1MAJA 3QVAA 4RETB 1YJDH 3N1MC 4O2CB 1JSYA 2PCFB 3TEZA 2V8LA 2HT2C 1F1GA 5DDHB 5JORA 1F11A 3RWIA 3RL2B 1KCSH 2Y6TE 5EHFA 5DGRA 5GGVH 3L5IA 2IWGA 4LVEA 3RG1C 4NO5A 1A1MB 5CJBA 2H2PC 3I9PA 2BSTB 3M8OH 3L7FA 3QNXA 4DUWA 1N64L 4PP2B 4HLJA 1RZFH 4N6QA 2F1AA 1HT6A 2DLHA 4RQQB 5CSZB 4AGLA 3RFZC 4UDUB 1UWXK 5IGXH 1WWAX 2EYTB 4LDOB 1PY0A 1CLOH 1A4CA 2A7BA 1XF4A 2UYLB 1CTMA 1N59A 3R06B 5EZJA 1RMFH 3IETB 5KSVB 1V8HA 1G7JA 4LLWB 1XSOA 1VFBA 1G4RA 3GSVB 1SQ2N 3KAAA 3CSYB 4IQHA 5E9DD 1K8IA 1T04B 3VO0A 5IWLC 4OD1H 2R2HB 1S7TB 3WDIA 3Q6GL 1EUUA 4NX0A 3KWUA 3AAZB 4BSWA 4UTAL 5D1XC 3L3IB 2LV4A 2VXUL 4NQXB 2CHDA 1TJGL 1HILB 4ONGH 2I9LB 4QAMB 5KAQG 3K46A 5AOMA 1FIEA 3FT4A 3IBOA 3EO0B 3SCMA 3LKOB 2BHUA 5DS2A 2AXFA 4PRID 2DAVA 4HD9A 1QNZL 3V5DB 2R1WB 1JWSB 4NT6B 2WBKA 4MB4A 3NJIA 3ZMEA 5DMYA 1WICA 4GQ9H 4AK1A 4P2RD 4QGYA 1MVFA 2HSIA 2VKXA 5IV2B 3QXAB 1P4UA 5CU9A 4K9EC 1FZJB 2Q8BL 2VAAB 4Y4FD 2AFNA 1E3XA 5EWIL 2FD6L 5JZ7D 4APQC 3TP4A 2D3VA 3EYSL 2BY1A 3P30L 2B0SL 3VB8A 1QWNA 1WBXB 1S9WA 4JFDE 5JXAH 1FLRL 4G8GA 3KMDA 5DHVB 2KQNA 1PX4A 2H26B 2AW2A 3U0WL 1PNDA 1OIOA 4JHWH 1MF2L 3LKQA 4PIBA 3I6SA 3HFFA 4ZAKD 2WXLA 5AQ0A 4TPRL 1KCBA 3TT3L 5D2NC 1OD9A 4Z7VB 3QCTH 4PJ5D 5T1KA 1AP2A 4ZUSB 5GXBB 1K2DB 4RFNB 1T7YA 1BZ9B 1YQVH 2CUIA 1AGBA 5FECB 3PP4H 4PJDF 4WWKA 3QUZB 3P3SA 3T1FB 4YHZH 2K8QA 3T3MB 2DQCH 2G4GA 2BSDA 4M7ZB 1G1KA 3W9DB 3IU3A 3C5ZC 2MPVA 3AB0C 2YZ8A 3CLEL 2AJXH 3OAZH 4L0PB 3X1NA 2NY0B 4EN3A 1EFXD 3T3ME 3QYMA 1JNHB 4JFXB 2Z34A 3U0PA 3U6RA 5FYKU 3WJLA 1BWWA 2VQ4A 5C6TL 1TQBC 3MUGA 4JAMA 3BD4A 2G0LA 3F84A 4ORZC 3ZZSA 3Q6FA 3ZHNA 4ODWA 3U9PH 1A6AB 1LEKB 1AIFA 4OM0H 2VH5H 1BZ8A 4NENA 4OIIL 2EVHA 2W92A 4JZOA 4PWFA 3ZW3A 2N7BA 1K4CB 2YGNA 3OKMA 1KCRL 4FQXD 5CR8A 4C47A 5FGSA 1S3KH 2IPTH 5IT2H 4LCCB 4UQAA 3MNVA 1VF5C 5EO1B 1CCZA 5AVZB 4QKTA 4JNXA 4PRPB 3AS3A 4C4BA 4HKZA 2PP9A 4PRHD 2WXPA 4MS6A 3CZGA 2ZYHA 4P9ML 5IB4B 3IDJB 4PRPE 2QKIB 3U7WH 3N41B 1M53A 1GSKA 2CSPA 3O3BB 3IT8D 1PLCA 3KYAA 3CCHB 2IXQA 2WZPD 3EKCA 3IDYC 5AW3B 1KJVB 3OKLA 3RZCD 2Y2YA 1U8QA 3TCTA 2DBJA 3FUJA 3R4RA 4MXWL 4Q56A 3CSPA 3DO7A 2XBTA 2DQ6A 3RWCA 1B0RB 1HX0A 2HG0A 3MRQB 4LLYA 1ZD6A 4H8QA 5E8DH 3MCKB 2ADJB 5CZVL 4X9BA 3ISYA 1H6TA 2MTAA 3T04D 4AOFA 1WZLA 1GOHA 4NN6C 3TJHC 4EI5D 2AERT 4Z0XA 3N1PC 3Q5YA 3TA3D 4M5YL 3MLUH 3ULSA 1KUMA 1K72A 4KO9A 3MCG1 1K6QH 4AL8L 4F2EA 5DUPH 4LSPL 2YUZA 1O75A 1QSFA 5C0BD 3WEAA 2JELH 1F3DJ 4IDLA 2FWOB 2R0LL 4L4VB 3ALPA 1J1OL 5BMFL 1NL0L 1MXDA 3BSHA 3BUTA 5FUCC 3RDTB 2FRGP 3TX4A 4L4VE 1ORQB 4ZPVA 1NCIA 1JHTA 2UUDK 4WHTA 1M1XB 4FMFA 2VDKB 3NSFA 4GP4B 4MCNA 1QX1A 3QG6B 4WK0B 1OL0A 3ZSTA 4WEUD 3VQLA 3LPWA 1FNEB 1MREL 4IGBB 1URZA 2OMVB 3BKML 2ESVA 5ENWB 3PAZA 3SBQA 2QADC 2E4FA 4L3EB 4QD2E 3IJHA 1F41A 4ZFFA 4RAUA 3QPQD 4MSWB 4XVTH 1QFUH 1G9MH 2XACC 5JOFA 4PLKC 4PGZA 1F1AA 1UURA 1JE6A 2X4QA 3FB6B 3BUBA 4L3EE 2ICEA 3JWDL 4Q9QH 4XBEH 5BXFB 1EAOA 2Q3ZA 3OG4B 4X7FC 2FYVA 2NY2D 2LGNA 1DBBL 4M7KH 5I73C 2KKQA 3CZFB 4HUWB 3PGFH 4MASA 4Y7MA 4XOCA 3DUHA 1S8DB 4YHKH 3GXNA 3MRBA 1A7QL 4MRCA 4MQXC 5C2BH 4G6MH 2KPWA 5C09D 1WUNT 4Q4EA 3SHSA 1RY7B 1U8PB 4Z7AA 2E6JA 3QG7L 3S9DB 4FNSA 4QT5B 4X8CA 3EFDL 3V55A 4QAWA 1HNYA 4ODVL 2ZXDA 5TQ0L 4D9RD 2AI0L 1C5CH 1OAZH 2LLNA 3U4EA 4Y4KA 4YC2B 4LAQL 5KYWA 3L5WB 1HAWA 3QEQD 2GBAA 2DM7A 3C8HA 2Q7AA 5E00A 5F9JA 4BSVA 4F93B 3WFCL 3NA4A 4FG0A 4ODTH 1YUHA 3LMJL 4AV0A 1AS6A 4KJWD 4UUJA 3V0WH 2NY6B 5F7YC 1DBJH 4YHLH 3MMEA 2QGEA 5BNXD 3T65B 2A38A 2AXGB 1H9VA 3QNFA 4KY1L 5TE6H 1UB5A 5EU6D 5HD8C 1FNFA 2UZYA 3GJFH 5B7MA 4LASH 4AQAB 2X44D 3PWUB 1F58H 4P4KD 4PJBE 1NAMB 3E2HC 2WQ8A 3TS8A 1CI5A 3MFGB 2VM4A 4LVOC 3JTTA 4PJFA 3HMXA 3I6KB 1ZTXE 1LYQA 4ZMYA 1IGYA 3SDAB 1CDHA 3RIKA 2Y7SA 2W60B 1XD0A 2Z8SA 5JLZB 3OJDB 4NOBA 1PTZA 4DKAA 1BZ7A 4YIQB 1Z3GL 1NCWL 2DWYA 5C70A 2EAEA 1W80A 2F6AA 5C0ND 4OW6A 5DHYA 4G8GD 1RIUH 3FT1A 4S0SD 5D7LE 5AAMC 5JW5B 3HI1A 3V6ZB 1G5AA 1C1EL 1ODAA 4G6FD 4AG4L 2GJZB 4AMKH 4JJHA 3KPLA 3MRCA 4N2OA 1A7PH 3I50L 4TRPL 2VDPB 1JPSL 3OWEA 1PY4A 1X5HA 3HLAB 2G60L 2ZCHH 3OXRB 5I75B 3D4ZA 5EOCH 4A7TA 3GUTA 4LOFA 43C9B 4HH8A 3QDGB 1SM3H 1ILSA 4EUPH 4F8PA 5T1LA 3L54A 3SKNB 4JFED 1F4YH 3D12B 4U1LA 1NDMB 4FQIL 2JI3A 3LNEA 5E08H 1FWXA 3VXOB 1TJIH 2O5XH 1HFUA 3V0AC 4CN4A 3W1ZA 3C8KA 5EMYA 1E6JH 4EN3D 1FBIL 3LEYL 3FTYA 3GHBL 4OFYA 3R7RA 4ANVA 4NPYA 3KDPB 3T4AA 2VDRH 1GIGL 4UDTA 1DQTA 4JG5A 2NZ1A 3GSNB 3O3EA 3FQXB 5MI0C 4I0PA 3PWPD 1TSHA 3SQOH 4LB8A 3CFIC 3HG2A 5JR1L 1T2XA 4JCWA 1E9OA 1HINH 2CBTA 2X4RA 5ESAA 1DSFL 5AZEL 3OGCB 1E5ZA 2IH1A 3EF7A 4ZMVA 4ETYA 1OARH 1WH0A 3PHOB 1W6LA 1F90L 1LDPL 1PF3A 4ELMA 5IUCA 4PCSA 5I6XB 3RY4A 2ZKWA 2UY6A 4PY8I 4U6HA 2NW2A 4ZOEA 2BOCB 2MOGA 4MDJB 4BM7A 4P3DB 3SDDC 1UM6H 5KSBA 1ETZA 4NQVB 1GYWA 4MX7B 4KKAD 4YXKL 2H8PA 1UWYA 3DROB 2MQCA 2ATAA 3EGDA 3IXTB 4QRRD 4KK5D 4ZXBD 5DD6A 1ZXQA 35C8L 3ARWA 2R1YB 5FO8B 2XXMB 4BZYA 1W6WA 4EIUA 3S4SA 3NTCL 3I02A 4JFSA 3ZXAC 4XXWA 5K1JA 3FQWA 1AS8A 3S4SG 2X4UA 2Y6SC 1I8IA 4P46A 3RNQA 4KJQC 4TTGA 2QVIA 1JZ5A 4P2QA 4U33A 1JL8A 3L9EA 2UXFA 3SEPA 2ZOOA 3WJJC 2FEEL 4PVBA 1S9YB 2GQHA 4ODHL 5E5MB 3ZDZE 3QIWB 3QQ3B 4DVRH 4GXFA 3R8QA 5FM5O 4JFHE 1ILUA 2YBGA 1NIDA 4YVNA 3O81A 3O8XA 3A47A 1IKOP 5E2WL 4N8VG 5FA3B 4PCTA 3VNZA 2HN7A 4WGWB 5GZNC 5ID0A 1GZPA 4TQEL 5IG7B 4IKIA 4L1DA 5KUMA 2IPKA 2VW4A 1UCBL 1T3FB 3T6ZA 4D0DA 5AYUH 2HUHA 4ENED 3Q3GA 1CXLA 1E4XI 4JN2B 3NSYA 4XGZB 3WIHL 4EDXB 2YZ1A 5G55A 2ESVD 3VFNA 1GY1A 5I76A 1X4ZA 3FFOA 3I6GB 3RWGB 4IBWA 1HDMA 4R26L 4ZS7L 2VR6A 1UOKA 4QTHA 1SEQL 2PO6B 2CDEA 1KCUL 4UIMA 2BSCA 1X5IA 4ZW7A 3LB6D 1CE6B 4PD4J 5E8OA 3QRLA 1M6OA 4ZD3L 2GCYB 4WFFD 2B39A 3OPUA 1FO0L 4OZ4A 3FU8A 1YEGH 1KV3A 3TJEH 3KYOA 3IRZA 4PFEA 1UA7A 3C60A 1UZ6F 4MNHB 1MJJA 3D69A 3S36X 2WVVA 3M1CA 3QQXA 3MLYH 1QTSA 3O2WL 5ISZA 3G5XB 1E7UA 3RPBA 1L5GB 2PPCA 1HEZB 5EF2A 3MREB 3FH7A 3B1TA 3NFSH 5FF6A 2WBWB 3BISA 2WIIA 2Q8AL 1AQMA 2UXVA 1FL6A 1MEXL 1S5IH 3PYCA 1EGJL 1FO0A 1GYVA 5CF3A 4K3JH 2GVYA 2XETA 3QUXA 2W59A 5E6UB 4P5MA 3WS6A 3U7YL 3A6CL 3QXDB 2X4SA 2D31A 4XMZA 1WT5A 4YDNA 3QGVA 3VXSE 5IEHB 4G1EB 2A3TA 1QFHA 4HP5A 4P4RB 4NNYA 4M61A 1SXZA 5INCA 4FQHB 2ZUWA 2OR9H 2GJRA 3EDKA 5AENA 3GI9H 1XF3A 3EO9H 1I1YB 3MLXL 5KZCB 5DO2D 2Y1AA 3MRMB 5D71L 2LW3A 2F58L 2NY1C 5I5RA 4HS8H 4O9HH 5EB9A 4TSAH 4BKLB 2DQIH 4F1ZA 3AUVA 4Z3JA 1N68A 4ZMLA 1BF2A 2VM3A 4PRDB 4G8AC 4M6OH 5E24E 2Y2TA 2YA1A 4YEFA 3K0WA 4WTXA 1ADQL 2XV3A 5ALBL 3ZE1F 3HPLB 1XGUA 2B1OA 4KFMA 2YAEA 1F4WH 2EXYD 2FZ3B 1SGKA 1IBGH 4DW2L 4QXGH 2WSPA 5JIPA 1QOKA 2R0ZH 4HXBH 4MCYB 3DMMD 1J9QA 2G5BB 4AMWA 2H1XA 4P8QA 5H2BA 1U4FA 4MXQC 4BZ2H 3LN5B 2GIMA 5IVXA 5F70A 3NJNA 3T6XA 4HBCH 3W81A 1OZUA 1IGJB 2FE0A 5L88L 1PU0A 1CICB 2HJFB 1I85A 3S37X 1I3RB 3POCA 1ADQA 2NNCA 1XD1A 3A23A 4OZHB 4FFWC 4X9IA 1BYNA 1A8JH 4RGOL 2NUTB 1X5GA 2VE6A 3IKCA 3NCMA 5C0EB 3HI6H 1BFVH 1E2WA 4OLWH 4OZHE 5T1LD 3L9BA 3X3GH 3D9AH 4B60A 3I3EA 5GGTL 1TETL 4U1KA 2G3MA 2ZG2A 4RGNC 1JWUA 4KUCF 3DYMA 3MRRB 5GSVB 1RUQL 2CK0L 1CZ8H 2GPZA 2HLFC 3F83A 1SBSH 1BGXL 1CR9L 4R7VA 4WO4B 3RX8A 1UWEL 3W39B 4Y2OA 2WLIB 1G7QB 2HKHH 5I74C 3GLDA 4NPJA 1KGWA 2IQAA 1NANH 1WFNA 2XN2A 1ECZA 1TENA 3MBEB 4QNPE 4I3SL 5EC1B 4LLMA 4N85A 2ZSVB 4EAEA 2G5UA 1IT9H 1AHWC 3L4XA 3BE1L 2VDKL 2PCPB 4YHIB 4AQEA 1TCMA 4S2SA 1C9SA 5ALCL 1Q9LA 2VC2H 3EJYC 3O4OC 4IHOB 3F7VA 3PWLB 3FU7B 1AFVL 4HWZA 4JKKA 4P2AA 1KBGH 1DQMH 2ZOLA 1OAXL 1HTYA 2B59B 2EXSA 3WN5B 3EDEA 5E56A 2Q7YB 2YXVA 5L2JA 2C26A 4IOIA 4OJDH 3Q1SL 4XPAL 5DLML 2VDQL 4LAJH 5H94A 1XDTT 3QW9A 2OMWA 1BDYA 1KTRL 4WTZG 3QNZA 5E8PB 2G9KA 3SGJC 2K4WA 3C08L 1NGZA 3ECBA 2ODIA 4L8CB 1AGCB 2CMRL 4PJ9B 5IMOA 2X89A 3U9UA 2IWEA 1QRNE 1CLVA 5F6HI 4PJIE 5BW7A 1JYNA 1QBLH 3IGUA 3QHZL 4EIBA 4IM8A 4AIXA 5DMIH 1NGXB 1Z5YD 4FZ8H 3LH2H 4WFHE 1J0JA 3RZWA 5C0CE 5LQBH 1OM3L 4LKXA 4N68A 5J13C 1IIIA 2GJ6E 4M6AA 1NFDB 1NH6A 4ETQA 4HIHB 4KH9A 1U8KB 4QHLA 4G42B 2IIJA 1MWAB 4J3WA 1D5XA 1U95B 3HJ0A 4LOUC 3TBWA 1RULL 3PIQB 4K7PH 2C9UA 1E4KC 3HW7A 3O2DA 3VM7A 1HCVA 3G5ZA 2CKBL 3O11A 4P23C 5SWQA 5KBDA 4LCUA 1NSNL 3UAAA 3H2WA 3I3DA 3APDA 2IGLA 3BVNA 1IRAY 3RIAF 1JMXA 5LGKA 5DSCA 4HFUL 4X7SH 5F93C 2LFEA 2O30A 2JQAA 3GMNB 2C9AA 2UXGA 4XBGB 1U8LB 2QQNH 5DJ8A 3G6DH 5F2FA 3ZL4L 4FKEA 5L2KB 4JKLA 5BQ7B 3BW9A 1BECA 1ZTXL 3RGVC 2VUYA 2LQRA 2LLGA 5GRYA 1KTLB 4M7LL 1U58A 4GBXA 4YHOH 2OJZH 5E03A 3RTQC 5L2KE 3OHXC 3QUYD 1YECL 3L16A 2R27A 2OR8A 2YKLL 3HFMH 1G1OA 4OZFH 5FHBH 4A6YL 4BQBA 6CGTA 3BPLC 2D73A 4M7JL 4EI6B 5I6NA 1NQBA 3O9WA 4R9HA 1L9NA 2WLLA 4DK6A 5C86A 1A6UH 4AE1A 1SJMA 2R7EA 3CMOL 4IRSB 2ITEA 2EZ0C 4OFKA 5E7BA 3UJIL 3VE0A 2ZWZA 1JFQH 2HMIC 2B5IB 2C8NA 2P5WA 2WXKA 2FGWH 2GT9B 4MD0B 1LO0H 3T71A 1E67A 2VDPL 3CFCL 4A6YA 1M2OA 4ZQKA 3HAEG 5CEZE 3JTBA 1KWGA 1LDSA 2GY5A 5D7LA 2F7OA 4PRAB 5GHWH 1FA4A 2EIMB 2EIJB 1N6UA 2V17H 1DJGA 3MGAA 3KPNA 3MV9A 5EORH 5MEQB 4FQLL 2A6JA 2CCVA 4FEIA 4LPCA 1T20B 2ZF8A 2BFGA 32C2B 4DK5A 1NCNA 3DJRA 3MGTB 4YSAA 4HGMA 1XH3B 3MUJA 3V6FB 3AG1B 3C2AH 4ZUVA 4JBSA 3BZFA 1WAAF 4JDEA 2O6DA 3HS8A 3WXWH 4LIQH 4N5ED 1J8SA 3PUCA 5EC2A 2JTDA 3X12A 3MRIA 3VFRB 1NIBA 4YPGB 4OCLC 3LKNB 4F2MB 2ADFH 5I1EL 2LT9A 5D1QD 4BEIA 1OSZA 1JF1B 1SVZA 4NM4L 4BUQA 3ARBD 4N0FA 5DVOA 1QHQA 1DVZA 2CJ3A 1TLMA 2ZTBA 3HG1A 4H0HB 2JCWA 1CVRA 4XAWL 3G5WA 2XA8H 4N0YL 5IB2B 2QV4A 5I1JH 5ID1B 5IJBC 1ZA3A 3UTZB 5IW6B 3IF1A 4DWHA 3QIBD 2WYTA 2WO4A 4FQ2L 1JYXA 2Y72A 2A99A 3X14A 3TZVA 5JIIA 1RIVL 2OMYB 1BX2B 2V9RA 4QRQB 2QZ5A 4A7SA 3NJFA 4PJCB 3ROLA 5KTEH 3VI3A 4H8WH 1NLBL 2J4WL 4GW4B 5K9OA 4PJ6A 2CO4A 4KUCD 5D93B 1U0QA 3WGUB 2PN5A 1P2CA 3GRWA 2QJDA 3L45A 3U9WA 1TTCA 4JJ5A 2FSEB 4K71C 5BZWA 3QZWA 5BVJB 2YPLA 1MCCA 3WTTA 3B7TA 5C6PB 3KWVA 3LD8C 1A9EA 4J6RL 3QZWG 3WNIA 3GZPA 1J18A 5AOKA 2IADB 1P4IH 4UAHA 1R3IL 5HPMA 4M3KB 4HJTA 1T6BX 1VRSA 4EDWL 5T3ZE 2VDLH 3RHWK 4G5AA 3FH5A 1LEGB 5H4YA 5AD0A 1XMWA 1TFHA 4FG2A 3UO1H 2PYFA 5HHPA 4GP5B 4YBQD 3MV11 4X4ME 5ESQA 1TYEB 4N9GA 1AQDB 2BJML 2IH9A 4MA7H 4FFVD 4XMKH 3WHXB 1T03H 4LHQB 5DEGB 1J1PH 5KUKA 5D7JB 3SDYH 3QFJA 3CG8A 1QBAA 2WOYA 2ZKHL 3KPRE 1BG9A 1IGML 1J9SA 2NTFB 2EIZA 3S3PA 4AZ8A 1BPVA 3CXHJ 4NWUL 2XRAL 2X12A 1AYOA 2AJYL 1OQXA 4NZFA 5GRVL 1H3WM 1T1YA 3VACA 1NZRA 5AB0A 1ACCA 1J5OH 3S5LB 2WYIA 2F08A 3OAUH 3HBZA 1KYOJ 2LOEA 2YIHA 3Q0HA 4HGKC 4IRZL 1N6QL 4L4TD 2YD1A 1LO5B 1I9JH 1FQ9C 1KJ2H 3H55A 4WW2B 1CDCA 4UB0L 4Z7IA 4AYDC 3ZT5A 3D0LB 1NMBL 3ZJAA 1MLBB 3TN0B 5I15L 5JQHC 4RWYL 3DI3B 5EU4B 1YNLL 4CNIA 5GGRB 5DJXB 2OMNA 2AK1L 2W9DL 1LO2H 4BFIA 1DQJA 3DA0A 2HKAA 4DGVH 1JWMB 3DTXB 3MA9L 3UC2A 1QWUA 2B9BA 4IRZA 4KTYA 3OM3B 1S7UB 1J8HB 4HEMA 2N1TE 3EW3B 3UTSD 5AWNL 1DEEA 5E9AA 5FAAA 5HVGB 3T2NH 1U91B 2A9ML 5LXGL 1J8HE 3H6AA 5DJ2A 2PWGA 4HJUA 3HB3B 2DDQL 5CLWA 5LGJB 3W5MA 5IB3A 3ZZLA 4S1RH 4V1DD 4M4RB 1U30A 4BFFA 1BFSA 3EOAA 4O51A 3NEEA 2GEQA 1AD0A 2NXZB 3O3DA 4PJXE 1BVKB 1FLTX 4N22A 2X4TB 3RB7A 2Z35B 1DJZA 5JA8B 1NTDA 1NIFA 4UM9D 1EHXA 4DFHA 1OTUD 3BDYL 5EEYA 1SOKA 1KOAA 2DI8A 2ZXCA 3QDMD 4QRBA 3G6JB 4UZUA 3SYQA 2EDFA 4DAGL 2Y5EA 2ZX6A 5CCJA 1UYWH 1P7BA 3JV6A 1ORSB 4LCYA 4NDMB 3BEVB 4ZFOA 3G6JE 5F0PB 3SO3C 3ZTCC 3MI6A 3CZNA 3EYOA 3QEHA 1BAGA 1KBKA 5L8KB 4XZ4A 5CEYB 4Y8DC 2WUCL 1ANUA 4JO3L 3G6AA 4LU5H 5D96C 1TTFA 5J56B 1M71A 5JUEL 2VLKD 5K39B 1DP0A 3FCGA 2EEAA 4PH8A 4YLCA 1FZMA 4UTAH 1DN0B 2W0FA 1N9PA 2DWDA 1TJGH 1AR1C 3BZEA 2WN3A 4GIOA 2X4PB 1WGVA 4X6CA 1Q72H 1X5JA 1PG7L 2OXHA 3DKHA 1QNZH 5GS1A 3FT3A 2WOBA 4J23A 1QSEB 4CDHA 1N2RA 3C5SA 3IWVA 4PJ7A 2NOYA 4HJGB 3HE7B 3K4ZA 5DHXB 3AXHA 4DO6A 1KULA 5E9NA 2K70A 5C97A 1QSEE 4L23A 5K59E 1X5LA 5KSAB 4ELKA 5D1ZA 1KB5L 3EBAA 1SHWA 2Q8BH 5BS0B 4CW1B 4U3HA 1A65A 3QIUD 2AV7A 1TZOA 3DX2A 2X0VA 5KYYA 2J8UF 5F88A 1KBWA 4LHJB 1JZIA 2WQRA 5BS0E 3EYSH 3PPSA 4PLNC 5A2JH 3WBDA 3L5JA 1KPVB 1A7RL 1HNGA 5TE4H 1FF5A 3MVSA 5FOJA 2AXWA 2YEQA 4ZMWA 5D5ME 5F96L 3SOBH 4JX0A 4PW3A 3IWUA 3U0WH 1MF2H 1RQ5A 1MCFA 1JNNH 1YMMA 1OM9A 3TBVB 3TIEB 2V2WA 5E1GA 3NCXA 2EDXA 3SDXB 3TT3H 5E6YA 1OP3K 3ZKNC 2F5AL 4OZGF 2B16A 3M17B 2BSRA 4KXZH 2LVEA 2WXIA 1EZSA 1YNTB 3SDXE 5AW9B 3CXDL 5IVOA 4W4OA 2WNXA 4KROB 4HV8B 4I3GA 1JK9B 1SJEA 2DRUA 1PL3A 1H9DA 3NEXA 1CFBA 4K7FA 3TH3T 4XMPL 4QRSB 3HRZC 5CSBA 3J27A 3L3KB 3HZ3A 4AVKA 4JO8A 3BAEL 3CLEH 1P5UC 3GSQB 3TVMC 1D5ZA 4XCYA 5CFAA 4PN6A 3AZUA 4W1TA 4K2UL 2BNRA 3RWEA 1GAFL 1JV2A 1TVHB 4LDLB 1BQSA 5B3JE 1MHCA 7PAZA 1GKOA 2AEIT 5MP6H 4F3FB 4P2OA 1GJUA 3QBTB 5CIPA 5DFVD 5J57B 1HH6B 2DTML 4JVWA 2AHIA 2NY5H 2R2EA 4IIZA 1M7IA 4HEPA 2J8OA 2OTUA 1Z0MA 2IDTA 3QE5A 1T1XB 3CFDA 1HNFA 3BP4A 2I26N 2IALA 4OIIH 4I18A 1P4LB 4YDJB 1O7DC 1U3HC 5ANME 4UTBA 4JRYB 3ATFA 1ZHNA 5DXWA 1KCRH 3DECA 1U93A 2E6QA 2NY4D 5DYFA 3P0VL 5TF1L 3SGEI 1UADC 3NIFF 1CQYA 4JRYE 4A39A 2PPDA 3V8OA 5EUKB 1TT6A 4K8RL 5D2NE 4EPSA 4KZDL 3GSRA 3BH9A 3EFOB 1QRNA 4PJIA 1G9HA 4JO1H 2IC2A 3ARGC 5EZOL 4JR9H 1WYJA 1A3QA 3S35X 2FB4L 4UQ2B 4XP5L 2R4SL 1U8MA 5J6GA 4FJZA 1ZLVH 3PL6C 2XG5B 2X42A 2AITA 4MXWH 5FA4A 2Z31C 1G5GA 2HJKB 3WLWD 1ET7A 3ARSA 4HKBA 1N12A 2CM6A 3V4PA 1MKFA 1ZT1B 5JOPD 5KW9L 4OKVA 3T9WA 3NDZE 3GS4A 1UB6B 3G04B 5CZVH 3DO3A 4BH8B 3QRFM 1RZKL 3DJTA 4IBSA 4NQEA 4O2FA 3RP1A 1A5FL 2J71A 1RVFL 3N9GL 4XVUD 3DOSB 4M5YH 2CBMA 1I8MB 1Q1PA 2F15A 5JDSB 3GSWA 1QMUA 4DVBA 1P5VB 2X9WA 3T8XB 3TASA 4YSSA 4HK0A 2FJUB 2XX0A 1XR9A 3IJSA 4WI8A 3WKNA 4RGMC 2OX5B 2XWJA 3RKDC 2M8XA 4U1IB 2VIRB 2R0LH 4MWFB 2G4EA 2GSMB 2ITDA 3SJVA 2P45B 4BXSV 1BVNP 2A9AA 2O6FA 1J1OH 1NL0H 5FR3A 3RA7L 4WWID 2RCSL 1R4XA 1ET8A 4XHQA 4YE4L 4IRJA 4WRLA 4PU2A 1S7SB 4XNXL 2VZUA 3OB8A 1VKXB 4D0BB 5CEZL 1RJYB 1MREH 4GW5A 1QQDB 4UTCA 2BZ7A 4Q0XL 2XNAB 3FONB 2Y1YA 3N0PB 1UZGA 1KNOB 2R4RL 3MRKA 1DYZA 5EDSA 3QRBA 2FQGA 2AK4A 5EG6C 2EO1A 5K9KA 3ETBF 5L0QC 1UZ8B 1YN6B 1TZIB 3BYYA 2WN2A 4TUKL 3UDWC 4ATWA 4LVHB 2WCGA 5IFJA 4MMXA 4NHCH 4C56D 3OD3A 3N40P 4MYPA 3C09B 4LCWA 2QLYA 4NLHA 4DSYA 3VXRA 4JPQA 4B96A 4JY5L 4HMDA 4ZYKA 4YDZA 5ES4B 3C6LB 3B56A 3IRCA 4PB9L 4TVPE 2JXMA 4ZUWB 5DC2A 1NCDL 1H6UA 5CUSL 2B4CL 3OWRA 4EOWL 5I1HH 3QG7H 4KPHL 1UH4A 3EFDH 4KHXL 1WIPA 2D7QA 2Y0SA 4ORGA 5AW2B 4CN1A 5TQ0H 3M86A 1UUSA 2FYYB 2OMXA 2AI0H 3D3VE 3FOMA 4XP6L 4AM0B 2D0FA 5IIEB 1UXWB 5LO7A 2NYZA 1H19A 5DMKB 3KVPA 4X7DC 3NGBC 1NCOA 2IAMD 4LHUG 4W9DC 1SOQA 4LCVA 2FEDC 3IYLW 2YD6A 3WFCH 2AV1A 5D7KD 4CJ1A 5LGHL 3BUYA 2CM5A 3QI9A 4ZMOA 1IKFL 3SE8H 1QFWL 3D39D 3DUUA 4W9EC 2BERA 3GC3A 2KZWA 1QBML 3QORB 3E6FB 1SXSA 1EEQA 2HRHA 1OLZA 5AAWA 2MMXA 1TZHB 3QJQB 4GRLD 4M3JA 4HKJA 5TDOA 1DE4A 3I9AA 5D1ZD 1HQ4B 3QDJA 4XNQB 5C0FB 3FT2B 5T3ZL 5JPNA 1SLVA 3T3PF 5A7EA 3S96B 4NN5C 4OGQC 4Q9RH 3KL5A 3W82A 2OTWB 3B9VA 3IU4L 3RWHA 4KVPA 1VGKA 1ZA6A 2EDHA 5SWSD 4NO0A 3U25A 3U1SL 2D0HA 4NWTL 2VWEC 3F7KA 1YEIL 3QHTC 4U1HA 3O45B 2ICWA 4Y4HC 4KI5C 2HTLC 3VGHA 4DZBA 3X3FH 3LRHA 1MRDL 5DRZB 1XR8A 4GMSL 1BFTA 4A63A 4AG4H 7PCYA 1JCVA 2ICCA 3VFPA 4PW4A 2F54A 2EDKA 2G60H 1O6SA 3BVDB 4L2LA 3CN2A 4ONFL 5B8CA 4AYBA 4TSCH 1M7UA 4X8XA 2WZ5A 1M05A 3FFCB 1G7LB 4GS7C 1XCQB 2CPCA 2ZONA 2CUMA 2R39A 2UWEF 2CUAA 1Y18B 1HWWA 4G1MB 4ODXB 4RSVA 4XPFH 4FQIH 3HS0C 3FFCE 4BH7A 4W9GC 3L13A 1KXTA 4XBMA 5E6RB 2VN5A 2BP0B 2Y1ZA 4UBDC 4FYRA 5F9WC 3W9EB 5IJKA 1UTDA 3GBML 4MYWB 3ABZA 4XRCA 3H0TB 4F7KA 2KC0A 3DIFB 5C07D 1IZKA 1UH3A 1AACA 3LIZA 3AGVA 2CKNA 3VI4F 3RUGB 3DBXA 1KPUB 5GRXG 4NQDA 1A1OA 1M7DB 3BVTA 3JT0A 5KAQF 2IBGA 3PWVA 3RUGE 3QFDA 1AOHA 1N8ZB 1WBZB 1DSFH 2GSGB 4XCFL 5AZEH 2HFEB 2IEPA 4NZUL 1MI5B 2C1OA 3RY5A 3IRPX 5HDRA 2W65A 1BREA 3LH9A 3V4UH 2OJ1A 4KITB 4CDGC 2VMFA 4OCWL 3UJTL 1LDPH 2XPGB 4X0KA 1HCYA 4QRUA 5DJDA 4KXAA 5HYJA 3MNMA 3MOQA 5IHZB 1JN6A 1LP9F 3UMTA 1QEWB 1MSPA 4M5ZL 4TYUA 5EBLA 1UJTA 4YXKH 4MJIE 1OK8A 4TTDD 3EJRA 5I6OA 2NSMA 3GEWB 4U6VH 3QUMA 5HGAB 4MXVE 5FPIA 3QK0A 1LQBC 2BNQA 3C5JB 4XVJL 3PXLA 3VNYA 2D7OA 3VRJA 4WFGD 2J43A 3VXPA 2OMZA 3NTCH 3FUNA 1H8OA 4QRTB 1NEZA 1F18A 4NQED 1KEMH 3VA2C 2ZT9C 4BCZA 1NEZG 2E47A 2FWLB 3MJ8A 4MNQA 2YA2A 5HDOA 3VFVB 4F2FA 1BZQK 4QY8B 3U2SA 5CD5C 4IIQA 1XGPB 1J86A 2EEXA 3GMMA 4XN2A 1YEJL 1OD7A 1HU8A 3STLB 4PJEB 5DRXA 3P4NA 5CZKA 5ABDE 5EEXA 2ZXAA 1PG7W 1J0ZA 1MIML 1WDAA 5DK2B 3DVNA 3NQKA 4F15C 1RZPA 1A6ZA 4G8FA 1WPCA 3CSGA 4TQEH 4GW1B 2WAHA 1ITBB 1T21B 4OCXL 4F24A 2K1MA 5KG9A 2WKOA 2P5PA 2PW1A 2PLTA 3L95B 4IRJD 1UCBH 4LMQE 4PWEA 5AW5B 4NQCE 3ARVA 3FQTA 3CC5A 4PGBB 5H35A 3MODH 2XN9B 1EDQA 4WJKB 2X4OB 3FSOA 4PS8A 2WD0A 1S9XB 2CPUA 3OX8B 1K8DA 1U92B 4KV5F 4PJGF 1TKWB 1YDPA 3W0WA 2JB6A 1SOSA 4ZS7H 2W0LA 4R26H 1UJ3B 2XCMC 4X42A 1MCBA 4PS4L 1SEQH 2AK4D 3T2OA 2MFNA 3V5HA 1MCLA 5ETUA 1RUPL 1X9LA 2YOAA 5I82A 4BZ1L 3BKJL 4KHTL 1D6EA 2AEQL 2H41A 4NQUA 3WUWA 3L3HA 1Z9MA 5LB1A 3RI5F 1ZEAL 1XIWB 2F19L 4FHBD 1ONQA 3U46B 2P3YA 4ZD3H 3AU1B 4FXGC 4BRJA 2LR4A 3HJEA 4HHWA 4JO2L 4N24A 3RFZA 1Z5HA 3GJEB 1FO0H 4W9HC 4JM0A 3PE9A 4H7VA 1MFNA 1NCAL 2IFFL 1J11A 4G8IB 2DD8L 2AKRA 4QOKB 1Q8MA 4F5CE 3QO1A 1XEDA 5HHOB 2GUOA 3F7YA 5ABZA 1JBJA 3O2WH 2GITB 4OY9A 4QOKE 3SGDH 1F4HA 3GMRB 2A1WL 2Q76B 4KJPD 4GRWF 5D5MA 3QDHA 1KGIA 4YL9A 1GVIA 5HHOE 3UEZA 5K1VA 3P3UA 2QGBA 3SKMA 3SKJL 3CH1B 5IWLA 2OZ4A 3MV7B 2E86A 1FYHB 1CFMA 1V7ML 2FJGA 3QZLA 3T2QA 1T5WB 4WU7B 1VDGA 1JV5B 1JZHA 1FFOB 3QEGH 2ADIB 4K9EL 1ZANL 5D1XA 2VR3A 5F8RC 4HVBA 3U7YH 3OMZA 1JUFB 2QHLA 5DD5L 5GS0L 4TSBL 2JKIS 4S1SH 3B2DC 3GXDA 4HAKA 2A9DA 3DV4A 3PP3K 4J6IA 4D0CA 2PF6A 5C0RL 3KCWA 5J12C 4IBLT 1EIBA 3FUKA 2BP8B 3GS7A 3QUHA 3DVGA 3MLXH 4DQOL 2B2XH 1KLFA 1IC0A 4N8CL 4UQ3A 4FQPA 5D71H 1ZHLA 5LG1A 5IEKA 4EQ3A 5ACMA 1R6VA 2GTZB 2BOBB 2YGQA 2WXNA 2QR0B 4UWQB 3V7AE 1JXGA 1F3JA 5MEPA 4M3HA 1XCTB 4KOBA 3SO5A 3ILPA 4PTUB 3UYPB 3H85A 4APQA 1Q9OB 4XH2B 1N19A 4TQPA 1RL1A 4PJ8C 1ADQH 2ZAGA 3UTTB 1AO7A 4HSAC 1PEZA 1BWMA 4MJHA 2XWRA 4DW2H 5J4MA 1HC1A 4QRPD 1Z3RA 2AP2A 1YMHB 4IOSA 4W68A 1BXUA 2LFGA 2GSIA 12E8L 3X11A 5I1LB 3P73A 2HVJB 5CINL 5EU5B 3MO1B 3Q8FA 5FC9A 4GAFB 2P5EA 3AXIA 5GJTL 2DW5A 4ZMQA 2WYZA 2FT7A 3QZPA 1FNLA 1MHHA 3U36B 5F7FA 4RGOH 1KYUA 1B6UA 3H53A 5F1NA 3CFJB 5H37G 4CKVX 2XG4B 1SFDA 1ZE3C 3C5ZA 1TNNA 2DJ4A 4RCAA 4FG6D 3QJRB 2QQQA 1TETH 2WWMD 5AYTA 5EUOF 2Q3XA 3TIDB 3KHOA 1HHJB 3M7FB 1RUQH 1L9RA 4RNRB 3SDCD 1CR9H 1E3ZA 1MFDH 1UWEH 4K5MA 3NPSC 1VCBC 3QT2A 3BWSA 4ABQA 2DKMA 2APFA 1GYUA 4I3SH 1U3YA 3I75B 1NCCL 1H15A 4J3OF 1LXMA 4R90L 4YHPB 3BE1H 2GG1A 1AI1L 2AQPA 4Z7UA 1C12B 3ARFD 4MB3A 5AL0A 5TDPA 4PJDB 2H3NA 1AFVH 2OYKA 2ZKMX 1OAXH 1QUNB 1QASA 1JPTH 3EFFB 4A68A 1A3RL 1QO3B 4O4YL 4P5KA 4PVLA 4H25B 3QJFA 1GL4B 3FO0L 3TFKD 4QYOB 4ZTPH 4OUUB 2VDQH 5DLMH 1G0XA 1VPOL 4M03A 5A6LA 1NUGA 4PI0A 4WI5A 5IW1B 5E4OA 5F3BA 4Y4FC 2YXWA 4JZJC 4DT2A 4WGVB 5JZ7C 1N5YL 2VSCA 3L3GB 2CMRH 3NRQA 2BNQD 2EYSA 4RLDA 3FMGH 4ABVA 1CT8B 3NIDF 4TVPL 3AS2A 3QHZH 2EABA 3TT1L 4J2QA 2NY7L 3OG6B 1XH2A 5FYJH 4XBPB 4WJ5B 3CK0L 5DJ6A 3H9SA 4A7GF 5D2LE 7TAAA 1DCLA 4ZAKC 3F7PC 3KPSB 1LO4L 1FVCA 4XO3A 3VRIA 2W1NA 3K80A 2WLHA 1AGEA 5J5EA 2IGFH 4XNMB 3CVHB 3HZMB 4XCCL 3TO4A 4BFJA 3KPSE 4ZNEE 2DM4A 3P0GB 4HUMB 5F97E 1AH1A 2A6DA 1RULH 2OYMA 5C3TA 2CE6A 2XZQL 4NI6A 1CURA 3EGXA 4QXTA 1D9KB 5ACZA 2VERN 2CKBH 3DGGA 4FRWA 4IK7A 2IPUK 2KLRA 3FQUB 4PR5A 2XTJB 2YAMA 1N7MH 4ADJA 2J2ZB 1OGAA 3B9KB 4C58B 4HFUH 2XBDA 1FN4B 4RISH 5E0FA 4DKEH 4U7MA 2CXGA 4HJJH 1ZLSH 2XTJE 1BM3L 1V3JA 3MTRA 4B7IA 4GMTH 1DVFA 4X9FA 4HCGA 2EE6A 4FI6A 2R2BB 2JLLA 4E0RB 5JHDA 1GOFA 4M7LH 2HFGL 4DJMA 3OB0K 2OW6A 1SXNA 3B83A 3QAQA 5IW3A 3W0WD 2K3TA 4PI2A 3HAEH 1YECH 3OKDA 4X7CC 2VDOB 1WFOA 4PGEB 4A6YH 4FQXC 4PTTB 2EE2A 4M7JH 4NKIL 4BDVB 1LE9A 3SZ6A 3H9YA 2BO0A 3LPPA 4MB5A 4X6BB 3FCTB 3R8BB 4AUYA 5G5DB 3CMOH 5I8EA 1OVZA 1OP9A 3UJIH 4JG1H 3WY2A 5I9QC 4AYFB 5AVRB 4XNZC 4BE5A 4Z1PA 4O2CA 2PCFA 1LK2B 1ND0A 2J57A 3PAYA 4KMTH 3RZCC 4K4KA 5IJKC 3RL2A 2PR9A 3CFCH 4E5XA 4XXCC 1TTAA 3OJMB 4IK6A 3N85L 4QDGA 3FHEA 5I0YA 4E5XG 4H20L 3T4YB 5F89B 3T0ED 4QI3A 1WEJL 4ZS6D 2BWQA 4FQLH 4X9GA 4AT6B 3FRPA 2EXWD 2GY7B 4EI5C 1AGDB 3KNBB 3PQYE 3TA3C 5A3ID 5D6CB 5IHLB 4NSKB 3MGOB 2W80C 4GI8A 5FKPA 1DJIA 5KSVA 4LLWA 1N0LA 4JRXA 2EECA 1IO4C 1UXSB 5GS3A 3EYFA 1CYXA 3CSYA 3ECWA 3HZKB 4BD4A 3HG4A 4HCRL 3ARQA 1U4EA 5I1EH 1FAKT 2BVPA 2P7TB 3GLEA 4B9FA 1S7TA 1UATA 3VA6A 1QABA 4HIJB 4N2IA 4HJSA 3IFLL 4U49A 1LWRA 2W95A 5FYLD 1KWKA 1JRHI 1HILA 3H9HB 3IDIB 1FVEA 1I8KB 3JXAA 3OSKA 1QYGH 4TQHA 1HWGB 3K6SA 1KLUB 3GRWH 2F1EA 3EO0A 4OUOA 2Y5TB 4U31A 4N0YH 3LKOA 4A2LA 4CRPA 3V5DA 1GS6X 4FQJH 4U7KA 5E23A 3S34L 4FQ2H 4NT6A 4JFZL 1JTTA 3O3AB 3ZN6A 4K94C 5CFHA 1YAZA 2KZKA 2YD8A 3MXWL 3CX5K 3CFQA 4WI9A 4B9IA 3UTQB 5AAMA 5EPMB 1E28B 3QPQC 4GSUA 1CF8H 1CD1A 3KH4A 4UT6L 1JPGA 3RTLA 2D4DA 4FHKA 2J4WH 5E8EB 5KJRH 4C4KT 4JQIL 1MFAL 1SVBA 5DMJB 2XXFA 1PZCA 4U1GC 2NY2C 3AT9A 4U6YA 5FM4A 3FTVA 4AGMA 2MEJB 2HA1A 2P5ED 2QEJA 1SF5A 2OP4H 5JIKA 2GUYA 3E6HA 3H3PH 1BD2D 1VFMA 4OAWA 4R8WH 2FR4B 2IJ0C 3PWNB 4MJIA 1LWJA 3NCEB 2IDFA 2CD0A 3WEXB 4UT6A 1R3IH 3MRFA 3ATBA 4J3OD 4EDWH 3VW3H 2OL3B 2CR0A 5HHMB 5ITFB 4H1LA 3UEQA 4NB7A 1XXFC 4QJ3B 1MHPL 3QUGA 4E9QA 2ZX9A 3PHAA 2PABA 4NKMA 4Z7VA 4ZO7A 2J1KA 4H1LG 4X6EA 1OZTG 3CLWA 5HHME 2EEDA 3SKOA 5TGBB 2BJMH 4OVVA 3U6XA 1CE1L 3JWOH 3R4DA 3K8MA 2E9BA 2BFVH 3T1FA 1P1ZB 3WOVA 3QJHA 2IBZY 3LS5H 2GTWB 1IGMH 1T0NB 3UTPD 2E9GA 2X3BA 3EIFA 4NRXA 1IAIL 2VLJD 2VW6A 5BRZE 1ZDSA 1XWVA 2VLRE 4KJWC 3GPEA 1MCKA 3OPZL 2CH8A 2FX7L 1KELL 3SCMC 1LK3L 2BK8A 2J6WA 5IK3A 1TUPA 3GK8L 1KZQA 5DLLA 3ZTEA 3GIVA 1A6AA 3B9EA 2Y2WA 4GYBA 4YDLC 5F3HB 4IRZH 3UOAB 3ES6A 5EU3A 1OSPL 2AJ3B 4P4KC 5BZZA 3WMSA 4UB0H 2VXQL 1INEL 3SDDA 1JPFB 3T3MF 4PWIA 4MGXA 3FB5B 5I15H 4JFQB 4R5VA 4X99A 1GSMA 4JRFA 4LCCA 3KLSA 5EO1A 2RQ8A 2YK1L 3EHBD 2X9XA 5CZXD 2AK1H 2W9DH 2EUXA 1OEZW 3DUSA 1IM3D 4LP8A 5FEBA 3MA9H 3MLTB 2ZD0A 4ZOBA 3AREB 3IDJA 5C0NC 2QKIA 2X28A 3TBTA 4TLUA 3U30C 3SQRA 1W8OA 3EDDA 1U33A 3VWJD 1E50A 3DX8B 1C16B 4HX1B 3S8GB 4ALAC 4A66A 2CJTA 1B0RA 3G5VB 3TO4D 3WJJA 3LN4B 4KUZL 2BVYA 5F1SA 2P28B 2ADJA 2KZBA 1W2KT 4K15A 4KRPD 4UV4H 4E41B 1TQVA 4G7VH 1KYFA 5GZNA 4Z76B 1YSOA 4LT7A 4Q2ZA 3N41F 5DHEA 4CGUB 2AJUH 2IAAC 4E41E 2Z8RA 4N0RA 4AEIL 3RX7A 2GC7C 3MRNA 1OGAD 5GS2D 2ZXGA 3MCLL 4DAGH 4EN3C 4LVNB 5JPMB 5IJCC 2WJ7A 5SWZB 2NYKA 2Z6FA 3DGDA 1QD0A 4G83A 1DVFD 1HXMB 1FI8C 1Z9SA 1ZDQA 5SWZE 3P2TA 2DF3A 4ERSL 2CXKA 2FWOA 3BD3A 1XTLA 5J9PB 4NZTL 1OV8A 2ZNXA 4PS3A 3WLBB 2NW3B 4YS4A 3CDGB 3NJJA 5JUEH 1AG0A 1RZQA 5CGYD 1I8LA 3K1KC 4R3SB 4DIXA 5CCHE 4CU6A 4FNPA 4KK6D 3QG6A 3ZUCA 5E1HB 3B43A 4N20A 5I71B 1ZSDB 2CO6B 2DLIA 2QPEB 3BGMB 5E0QA 4Q9BA 2FT6A 1UQSA 1BF8A 4L8BB 3HR5B 4AJ0A 3PWJA 4I3RH 1C5BH 2XZZA 3CQPA 1NGYB 5F7BA 1NC4B 3TNMA 1YG9A 4OV5A 2V2XA 1HZKA 3IMBA 5TDNB 2FIKA 3S6CA 2NNFA 1UKTA 4OF3A 4KKAC 5I8OH 3T0XA 4FFZA 1RJLA 2GKIA 2X0UA 4JCMA 4KK5C 1KB5H 4ZXBC 4YLQT 4U0QB 1G7PB 4NC1E 1EO8H 2OCJA 4EO5A 4J3SA 4HUWA 3LX9A 1U8IA 4Y16B 4JFFB 1SZNA 5D55A 1DDHB 1OO2A 1XZ0A 2ZNWA 3CZUB 3P02A 3ARUA 1MW1A 4IKLA 1A7RH 4NP4H 4PG9A 5EO0B 4MZRA 2XVBA 2YN5A 4JFFE 2I25N 5F96H 1AMXA 2A74C 3V10A 4YHNB 1HJBC 3P2DA 4NKOA 1U8PA 5T5FA 5DWUL 4CC0A 3TM6A 4G7QB 4QT5A 2WTRA 4DNLA 3VM5A 4R7NB 1AC0A 2JCCA 1KJMA 1IFHL 1MFUA 3H42L 2WUBL 4U0RB 4WTQA 2JKWA 3B37A 1SUJA 3VTAA 2CGZA 3L5WA 3Q43A 3VU2A 3CXDH 5CM1A 4P49A 2W38A 4HIEB 5M7QA 4D94A 4ZX6A 4AIZB 3TNNA 2XWTB 3FQNB 4A7QA 1OB1B 5K1NA 3U79A 1PZAA 3JV0A 4F27A 4ENEC 3UZEC 1EJOL 3BAEH 4WUUB 4AIEA 3FH8A 2A73B 3TURA 3HC0B 1MFBL 4LL4A 2OYLA 4BFRA 4NQTA 4AQAA 3M6DA 5EBMA 4MJ4A 1ZCRA 2DTMH 1NAMA 1UCTA 4HYTB 4LGRB 4WNSA 2CIKA 1MNUL 3MLWL 3QXWA 3VFWB 3BFQG 4UQIM 5FB8B 2ICEC 1CC3A 2F8IA 2X38A 4QF1B 3LB6C 1S9VB 4JFDD 3WKYA 2W60A 4CMHB 1JZ2A 4HUVB 1ZHKB 3DX6A 4ZTOL 1FZOB 1R3HB 3MU3A 5TF1H 5I2IA 1V3KA 4D9QD 3KPOB 1J10A 5GGRY 2DEYX 4NZRH 5AVYB 1R33A 1RHHB 3MZGB 2J12B 4PJBF 4JFYA 1MCWM 5JW5A 4L05A 1WITA 4K8RH 4N0UB 5HXMA 3O4LE 3ZHLA 4AKQA 2RAMA 3MUUA 3ARDB 3KXFA 3MBXL 2GJZA 1ZLWK 4Z95L 1SPDA 5EZOH 5CBEA 2J7LA 4BV1A 5BUAA 3CVHL 3ULUH 3KGRA 5IBUB 2OAAA 4PPTA 2CO7A 1CBJA 5E5LA 1PKQB 1DLHA 4BFEA 3MX0A 1A4KB 43C9A 2H1LM 3T5WA 3VGAC 1IBYA 3QDGA 4UZSA 5KW9H 4WIQA 3QUZD 5TH2A 3SKNA 2FLMA 5DD0H 5EIIB 1PKQE 1CXKA 1H5BB 1T1WB 1AHWA 3F58L 3VXOA 4CVZB 1L9TA 4GUPB 3QO0A 2SEBA 4XN7A 2NY0D 1RZKH 1U8OB 4WW1B 3RVTD 1QLEH 2V2TB 5C8JB 1BVLB 5C0DB 2KT6A 1JZ3A 4FNTA 4KK9D 1LMKA 4Y5YB 4FL4B 2IANA 3B6SB 1YPZA 5DO2C 3TLRA 1ZPUA 4S1QH 4AC2A 1KB9K 1RUKL 2ZWNA 4WNQA 1PZBA 2WQXA 2J5LB 3GSNA 1JD9A 3RGHA 3PV6A 3VJ6B 2R23A 4MB1A 4HD5A 5DEJA 3VXUA 3RJQB 3NT0A 4HZ1A 3VUAA 5LKNA 1JF6A 2Q86B 1DQQB 2RCSH 3N1GC 3OKEB 4WF7A 5EEUA 4PGCB 4XE5B 5KBMA 1DUZB 1R5VA 2AABH 4NO3B 4PRPD 2EXYC 2ARJB 4XNXH 3DRQA 4FFYL 3KPMB 1AANA 2VMJA 3MLZL 2FIRT 4JCLA 5AL8A 4MTMA 4QO1B 5BVPL 1A9BA 1FC1A 1RZ7H 3QAZC 1OK0A 1YQ2A 2XQYG 2W9EH 1AVAA 3DMMC 4MDJA 5E2UL 4P3DA 5E94B 4FDWA 3KGUA 4TQ8A 3AABA 4O02A 4R4BB 4ZMXA 4LRIC 4MX7A 4PY7B 5D7HA 3RIAK 2R4RH 2JV6A 3IXTA 3MLVL 1UEMA 3QXUA 4MAYD 4LEXH 3ZKXC 3S37L 4LSQL 4TUKH 5CD3A 4L8SB 3PUUA 1WFJA 4FYTA 2BVOA 2XPZA 3K8KA 1QHPA 5FO8A 4FFYA 4IMKC 3ZTNL 1HSBA 4P23A 3LNFA 2VL5B 3HMWL 3VCLB 4QHKI 4WV1B 1IM9A 2GHWB 5T3XD 4NFCA 5CEXA 2BH0A 2P42B 4BA0A 4JY5H 2YUVA 3DXAB 2OMUB 2WP3T 4PB9H 4FZEL 3QZBA 2BVQA 1IE5A 4OFVA 2DTSA 4I1PA 4RDQG 2P8LA 3RGVA 5E5MA 3TL5A 3DXAE 5CUSH 3QIWA 2B4CH 4V2CB 4W9FC 4KPHH 4GKZA 4KHXH 3RTQA 1J87A 4L4VD 3GJFB 3OHXA 1U36A 5FA3A 1B90A 1JIBA 3SPGA 5DJAB 4XP6H 2G2RB 1IAKB 3RDTD 2AJSH 5IG7A 1A3LH 1C5DB 5C08E 4QLRA 3VWKB 2EDBA 1KCLA 3A4DA 1CDJA 4JPVL 5I30L 1BV8A 4FYQA 1A4AA 4WQOA 5GGUB 3ZDZF 3HNSL 2I9TA 3K6DA 4IGBD 4XGZA 5ICUA 1CK0H 3STZB 1EJ8A 1IKFH 4A2MA 4XO8A 5DEFA 1QFWH 4G8EB 2X88A 3WMQA 2ZPKL 2XPYA 3II3A 4L3ED 5BOJA 2DJUA 1QBMH 2YMOA 5IVZB 1D7FA 1JZDC 3WJMA 3CFBB 3I6GA 4GFTB 5IVNA 5B39A 1IARB 1A2YB 2O6CA 3MQIA 1KT2B 3VB9A 1UT2A 4ABUA 1IBBA 1HSAB 1RZIB 4X5XA 1RFDH 5LCVL 2FO8A 5B39G 3CSFA 2R0KL 4XN1A 1TMCB 3FF7A 4AE0A 3KWWA 4YO0A 4ZW6A 4LPWA 4AKOA 2C3XA 3VGGA 4HWBA 1DDTA 3C6SB 3D25B 4IS6B 1BIIA 3IVKB 2Z93B 3PGDA 1FFNB 3DHJA 4NBXB 3UBXA 1LGVA 1MCNA 2OL3L 3U1SH 3BYTA 3IE9A 4AITA 4EUPB 4GI6A 4NWTH 1VENA 4MNHA 4ZUUB 4X6FB 3RWJA 1YEIH 2H9GA 3UBXG 4J12A 5BOZG 6TAAA 5B1KA 4NHUA 3G5XA 4GG6E 43CAA 3VD2A 1QLRB 1SJXA 1BA9A 2VT0A 3MREA 1JOIA 1XL6A 4JM2F 3S7GA 3TCLB 4JGNA 3DJSA 3KJ6L 4ONFH 3GMOB 2VDRB 4F57L 3Q06A 3B2MA 2V7HA 4HFWB 4BQCA 1OTTD 3HUJE 4XB8A 1NCTA 2IOOA 4QMEA 6FABL 3ORJA 2BCKB 4J4PD 4H4NA 5IEHA 5EOQL 3ZKSD 4HOZA 5FDWA 4NJ9L 2A77L 2NY6D 5FYKE 3SQBA 4HLEA 3VTTA 3O3UN 2YS4A 5T5NG 5C9KA 1I1YA 1I7RB 2XWBA 4N2EA 3MV8B 3WN6A 5C3IA 4OCRL 1K5WA 4JE4B 1BPLB 1HAUA 2YQ3A 3QUYC 4X5WB 5E2VH 2R83A 3FFDA 2IDUA 5EOCJ 5HY9B 4JUTA 3MV8E 1ERNA 1KCSL 2XVGA 5SX5H 1RZ8B 5HYFA 4GLRH 3SDAD 1CFQB 3VD3A 3UZQA 5JQ6H 2NNAB 4YPJA 1RZFL 2NNXA 1IL1B 2DS4A 4B0MB 3QUMH 2A6KB 1VSCA 4XCFH 1DR9A 4XR8C 4YBLB 1OSEA 2Q1EA 4NZUH 3BMVA 3ZE2B 4DERA 5BZDB 5IGXL 3CFEB 4MCYA 1R3KA 1CLOL 2HFFB 3Q1EA 3C60C 2G5BA 3FYIB 4JANB 3ZE2E 3TF7C 1RMFL 1XGRB 4N87A 4LEOB 1IGJA 2HVKB 4X4KA 1IFRA 1I3RA 4GAYA 3C5XA 1A4BA 2D9QB 2P80A 4QPEA 3NZHL 2YFOA 1E5YA 1OPGL 3II2A 2PTTB 4OD1L 3QDGD 4XVJH 4HU8A 1MJ7H 3AGWA 3KYMB 3LV3A 3NRFA 1WFMA 3WS6C 5I1IL 1OWWA 3FTXA 2R8SL 4XZUB 2H4EA 5F7MC 2W94A 1WT5C 3EXLA 2P46B 3TEWA 1GMEA 3ZRCC 1I75A 3I6LE 1S7XA 3MRRA 4N5EC 2XOTA 3O0LA 4WKZA 4P06A 1RAMA 4WO4A 3W39A 2FK9A 2WLIA 4PLJD 4FERA 5LAPA 4OZHF 5D1QC 1NDTA 1YYCA 2HTKD 4LLDB 1YEJH 3OR7B 3ARBC 3MBEA 4HIPA 5HJGA 3ZPDA 1AQHA 1IU1A 1CGXA 3CDCA 4HWNA 3BXNB 3PDOB 2Y3NA 5D4JA 4P04A 3H54A 4XMVA 2J3SA 4Z3HA 3IS1X 3DC0A 2DWSA 4N26A 4OCXH 5TQ2L 3PWLA 3MNZB 5IFHH 3CD4A 3QIBC 4BWTA 4IU3A 5HHVH 2O26U 3WN5A 5BZXA 2B59A 1K4DB 4AJWA 3V5KA 4B9KC 4QNPF 4LGPB 4HC1A 4JHWL 2O1AA 4WI0A 1FNGB 1J0YA 2RR3A 4B9JA 5EFIB 2JNZA 4AVIA 1E8YA 1RP9A 5E8PA 3KYNA 4FXKB 5E6IB 2FEEI 3LRSB 4Y9BA 1XCXA 1W0VB 2C9SA 4XNBA 3VFOA 5LNDA 1AGCA 3DX9A 1FL5A 1YQVL 2UY7A 1KXQA 4BZ1H 4ISVB 5IB5B 2E59A 3DX7B 2AEQH 2BWDA 2R56H 3OAWA 3TBBA 3IPEA 1DJXA 1NGXA 1PJWA 3AQYA 4XCEB 1T6WA 3ISRA 1K85A 4QUOA 4JO2H 2OZ4H 1N3NA 4HS6B 2MSPA 5FLUA 1V55B 4K3HA 1NFDA 1NCAH 2JJUA 2RFXA 3O2VH 5E5UB 3WTVA 2DD8H 2R1XB 4G42A 1MWAA 2ZUSA 3SPJA 4YBQC 4JFHD 4PHZA 2CHNA 3OGOE 1Z1WA 4Y19E 4FFVC 2A1WH 3WO4B 3QIWD 2VH5L 3L3DB 3V7MA 1I7UB 1PFCA 2H3KA 3REVB 3MUHL 3LKPB 1V7MH 4AK2A 1RIHL 5D6DC 1HYRC 2CHXA 3OR6A 4K9EH 3N04A 1TVBB 2VOTA 4NCC2 2VISA 2DZEA 3GMQA 4OJFH 5DD5H 5B38B 2CGYA 4TSBH 1G9NC 2YQ2A 3Q9PA 4N86A 3I74A 4OIAA 4G7RB 5C0RH 4JGJA 5J0BA 1KTLA 3CVBA 1IGFH 4WU5B 3U7WL 3QZNA 2R69A 2YKKA 4L37A 4N8CH 4X8JB 3D8MA 4JUSA 2PO6D 4XC1H 3K6IA 5F21B 3LVEA 5DS8A 4EI6A 2FNWA 1GW0A 5ILTL 5KVDE 1KIRB 3BWAA 4K0OA 5C0AB 4QCIA 3GO1L 4XP1H 3RWFB 5I8CB 3PPEA 5I1AA 3NBNA 5E8DL 2K6YA 2C1PA 2WQUA 4OQTL 4C56B 1Y1UA 2E75C 2XQ0A 3S5YA 1BQHB 3TA4D 1ZIBA 4JY4A 1PIGA 3MLUL 2HLEB 3UPRA 2QL1A 5CP3A 3ZLQC 3OKOA 4X50A 1AMYA 4NRYB 4N1EA 4Z3EA 5B1CA 5CINH 2JMRA 1CBVL 3S2AA 5MEQA 1IC7L 2Q10A 1A1NB 1VEOA 2CO1A 4Y5VC 5GJTH 4H8UA 4WK4B 1E4WL 4RFEA 4HZAA 4PGDB 4C83B 2C7UA 1OTUC 5KS9B 1WS7A 2GAZB 4BELD 1XH3A 3B2PA 5DI8A 1FVDB 1HI6B 3F65A 3HRZA 1D3CA 2D7PA 2PMZA 5KS9E 3OMAB 2RQEA 1MVUA 2BVUA 1P5UA 1WBYB 3NYKA 4XCNA 1UKQA 2VC2B 3EG9B 3WTSA 4B27A 3VFRA 1G87A 1IJ9A 4DP9X 3D39B 3MRJB 3PDDA 4F2MA 5KBPA 5KZCD 2FCBA 2NT1A 2CUHA 2BY3A 4R83A 2FH6A 4XVTL 1JF1A 3MJ9A 4UOQA 1QFUL 2GB2A 4UYQA 4ZSOE 1MFMA 4NC2B 4JFTA 3B2VL 1ACXA 4G7SB 2VXVH 3I2CL 4MD5B 2K4AA 4IMLB 1U3HA 2O93L 3CDFA 3UG3A 4PJAA 3NAAL 3VG9B 2AJZB 1W72A 5ID1A 1TQCB 2HKFH 3UTZA 5IW6A 5KSUB 4RX4A 3GTNA 1MCIA 4OF8A 5DO8A 3JV4B 1O5DT 4FKKA 2RJMA 2ED9A 4G6ML 4PJCA 2VUOA 3LDBB 1T89A 3BRFA 2V5MA 2B1HL 3FCSA 4GW4A 2ED8A 4JHVA 1AKJB 3FO0H 2LTQB 2B9AA 1VPOH 3PL6A 1CICD 1YZZA 1HL4A 2FSEA 2Z31A 3QIUC 4GUOA 4ZRGA 5BVJA 4LXFA 1Q9KB 4RMVA 4WWOA 5ADOL 3AFLA 1N5YH 1OAZL 3EOBA 2YWYA 2AF2A 3WDJA 1AQKL 3CNKA 4MVBD 1YEDB 2WWNA 2IADA 4DETA 3WIIH 4FE9A 4TVPH 3TT1H 4CC4A 1CGYA 4LPUA 4LSVL 2D2CC 1NMCC 4MBOA 4CADA 1DBJL 4B5ZA 4YHLL 2BLFA 5B21A 5DQJB 3F85A 5CLYA 1LO4H 3NIFB 3AXLA 3DV6B 4Y5XB 3WEBA 1SEBB 3E7JA 4WO4D 5DEGA 5HDWA 2BP3A 3HE6B 4XCCH 5D7JA 5DRNB 5IQNA 1LE5B 3QZOA 3FO2A 4H2CA 2Q3AA 2O6PA 1HHIA 1WISA 2NTFA 3JBG7 3BEWB 2OMBA 1OAUL 2COVD 5L4MA 1NBZB 4PRIE 2HVBA 2JIXA 1M56B 1T66D 4UQEA 4OZFB 2EDNA 2Y7MA 2YJLA 3FKUS 4M93C 4LRNH 1RJZA 3ZYOA 1XF2B 1FJ1A 5CWSB 3PXHA 4TS6A 5D72L 3S5LA 1R5WA 4YR6B 4HCFA 1KGUA 1BM3H 5C08A 2D7NA 3N44B 3L4VA 4KJYB 1RIUL 4BXVA 4WW2A 4GAJL 4YAQB 4I77L 4HH9A 1MHEA 5F3FA 3D0LA 3FAXA 1EBPA 2HFGH 3VFMB 4JMXA 1LL1A 3F00A 3BIBX 3ECVA 4G9FB 3D4GA 3UDWA 5EOCL 2NY4C 4PJ9D 4WFHD 4NKIH 3OXSB 3DTXA 4G9FE 1BG1A 4TM9A 3B5GA 5C1MB 1ROWA 1TIUA 2C9XA 3E1F1 2W88A 1V5JA 3IN0A 5E08L 1CDGA 3BQUB 3L48A 1U91A 2YD0A 4C55A 2I7SA 4MA3B 1IAOB 4XPBL 3HZVA 3S35L 1L0XA 3K72B 5JW4N 1J0KA 4CVXB 3RIFF 4N2HA 3WLWC 1F13A 1P7QB 3CX2A 1BVKA 2ADGB 2FO4B 1KFAL 2WWKT 2BX5A 4GG6A 1GPOH 4R7DB 5FYKL 2BS9A 3VXTB 3GIZL 4A1RA 1EERB 3VYNA 2EYRB 4GUCA 4HKXB 2EE9A 4Q97A 4AZUA 4XVUC 3B7YA 2TAAA 3F64A 4ZO9A 3RQ3A 1KENH 4P59L 4E68A 1DQIA 4X6DB 1ECYA 2QT6A 2DWXA 4M02A 4PJXF 5FV2A 3F04A 1RZJC 1HHKA 5L2KD 3B2UD 5IBLC 4XTRD 3W57A 4X6DE 3VD7A 1XTMA 1FFPB 3K71B 4HDIB 5DJYB 2YPKB 2QGDA 4IJ3C 5IHBA 4AQZA 5HYQB 1QSZA 1WZ1L 1TMQA 4JLRB 2VCOA 5K39A 2RB8A 5FO2A 5DCCA 4PRHE 3IFLH 4EZJA 4JK0D 1K3ZA 3G6JF 5IJVB 3HHRB 4XI5D 2EO9A 2ZP0T 3F6LA 2X4PA 4WO0A 3K2KA 3WEOA 3MN8A 1D7BA 1P4BL 2H5UA 4IRSD 2H3XC 1UWXH 3ESVF 3S34H 1XGQB 4L8DB 5CEZD 3GBDA 3MXWH 1O7SA 4WTWA 4Y2NA 2P4AB 3LXCA 4HJGA 1HKLL 3HE7A 4YL4A 4AQ1B 4YSEA 2VDLB 1EEZB 1RPQA 4UT6H 2VITA 3V0VB 5KSAA 3BPCB 4HOXA 5DFTA 4CW1A 4H1LH 5BUGA 2H32A 2ZZUT 4JQIH 7CGTA 1NOLA 4Z7WE 1RK1B 4DVRL 4GAAA 1KYAA 4KQ4L 5MENB 2HG5A 4JFOB 3NOIA 2LABA 4UAOC 3L4UA 5D7IB 4LOEA 4G6AD 3UBHA 4OZIE 1TPXB 4KO7A 5ECJE 3KLAA 2PYEA 4H0IA 4GAGL 5K59F 1LNUB 2WBJB 3PHQB 5D7IE 3BCDA 1FYTB 3KBPA 3HS0A 3DJ9A 2GBTA 3T3PB 4N6RA 5DZOA 3DBSA 3TBVA 3TIEA 1BBDL 1JVOA 2COQA 3FPYA 5HDBB 1MHPH 4I4WB 5DJCB 1UWFA 3MRLB 3VXMB 3M17A 5FO7B 2W07A 3MNWA 3R1GL 1YNTA 3IPFA 1UT9A 2K45A 5HDBE 3UCRA 3SYCA 1X6LA 1KJ2B 1T5KA 1IVLA 3R19A 4WWNA 2I69A 3GEFA 5D4HA 3QR2A 1I1RA 5CHNB 4D3CL 3X17A 2IAMC 4YHYB 4QHNB 4RZCB 1XBRA 5JORB 3GSQA 3RWIB 2F53A 2XWEA 4NZJA 4Y1AA 2VTFA 4MNGB 1V10A 3FTGA 5I5MA 3SY0B 2FX7H 1KELH 3SDXF 1VFAA 4NO5B 4L0ZA 4NAJA 3TBCA 4OIFA 3VSUA 3L7FB 1F56A 1PMYA 1UA6L 2DQDL 3O41A 4FJYA 4DEWA 2HT3D 3BSZL 1OCZB 4P9HC 4PJHA 2O72A 1VHPA 2PR4L 2VXQH 4GRLC 3GINA 2DMCA 4QRAA 2MWCA 4H40A 4YDJA 4FA8A 1ZT4A 1M9WA 1XF4B 5D1ZC 3D2UA 3QYCA 5B3JF 2NX5A 2I7OA 3FZUD 1N59B 4OV6F 4EBQH 3OKKB 1S5IL 3HHSA 1VFBB 5T3ZD 4LDEB 1N5AA 5C09E 5EUKA 1ZLUK 3D33A 4GO8A 3EFOA 1G6RL 2JK5A 1R46A 4LF3B 1I3VA 3UABA 1INQA 4UQ2A 3EUUA 4BSWB 1NFAA 4D9RE 1I7ZA 5A16A 2XG5A 2BP5M 3STBA 3FQ1A 2HJKA 2AXJA 3KPRD 5CLXA 4WLCA 4PRBB 3D4CA 4DTGL 1ZT1A 1PBYA 5D7JD 4QXVA 2AXFB 4U6XB 2XFXB 4O9HL 1ZIAA 3QB7C 1LMIA 1CLYH 3EYVA 1UB6A 3G04A 2YD9A 3L3OC 4FLSA 2VXTH 2FJSA 2QPUA 3O6FB 4M6OL 1XF1A 2VLLB 3BGFC 2EVIA 1JERA 1U2HA 3DOSA 1ED3A 4RDBA 4AEIH 2ZUQB 1NM9A 3AY2A 3MRPA 4HLZG 3BKYL 1YEEH 3DDFA 1JFHA 3WFHA 1QHOA 3ZX1A 1XB8A 3L6FA 4HXBL 3LSOB 1IEAA 5KVDL 3RI5K 4UNVA 3EUDA 3MAWA 4ERSH 2VIRA 3K2IA 1GGIL 1YVLA 1BJ1H 4BZ2L 1GA2A 3K6FA 4Y2DB 4HBCL 3NK3A 3TN0D 5AUMB 2KBGA 1JPST