3M7FB

Crystal structure of the nedd4 c2/grb10 sh2 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
176
structure length
135
Chain Sequence
b'ELHNDDTRVVRVKVIAGIGLAILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENDDFLGQVDVPLYPLPTEPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPTHLPHPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 10
publication title Structural Basis for the Interaction between the Growth Factor-binding Protein GRB10 and the E3 Ubiquitin Ligase NEDD4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/ligase
total genus 25
structure length 135
sequence length 176
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3m7fB00
2WXFA 2FK9A 2K3HA 2WXLA 4NPJA 2Q0ZX 4BGDA 3ENEA 2K4AA 4PS8A 5CCJA 3R7RA 2DMHA 4XX5A 4EZKA 2ZKMX 2DMGA 4L1LA 1WFJA 1RH8A 2R83A 1UGKA 2Y3AA 3L13A 4FADA 1E8XA 3L4CA 4KZ0A 1DJYA 1YRKA 2NQ3A 3FBKA 3QJZA 2A5UA 4WWNA 3W57A 3DPDA 3PRZA 4FJYA 4ICXA 5EDSA 3P2BA 1DJXA 3F00A 4EZJA 1QASA 3L9BA 3QAQA 3ZW3A 1UOVA 4QJ5B 1E8WA 4URKA 5T8IA 4FULA 2QZ5A 3L54A 4TV3A 4ANVA 3GPEA 2QZQA 5KJ7E 4OVUA 2WXRA 1RSYA 1WFMA 5CCGE 1A25A 4F93B 2Q3XA 3F04A 2RD0A 2BWQA 1E90A 4A55A 4WAFA 2CJSA 2ENPA 2YOAA 4WWOA 1BYNA 3PS6A 2WXMA 3F01A 2WXGA 3OAWA 3QARA 4IQHA 1W16A 3NZUA 3PYCA 1DSYA 4GNKB 4Y1SA 3QK0A 2YRBA 4QAMB 4F1SA 1GMIA 2JQZA 4NPKA 3N5AA 2A4ZA 4F92B 5JHBA 3MJWA 3KWUA 1DJGA 4PS3A 3NSJA 4FHKA 2EP6A 3FDWA 3HHMA 1DJWA 3APCA 3SD5A 4L1BA 1V27A 3QR1A 4Y1TA 4KZCA 3DBSA 4QJ4B 4TS6A 1K5WA 3CSFA 3QR0A 3RPBA 4V11A 3HIZA 1DJHA 1BCIA 1E8ZA 3KWTA 3ML9A 4XZ4A 2CHDA 2FJUB 2NSQA 4DNLA 2CM6A 3ML8A 3NZSA 5G55A 3HN8A 4PS7A 4WWPA 5JHAA 2LHAA 2V4LA 5H4YA 2ISDA 3APFA 3T8MA 1UOWA 4QJ3B 3F05A 3S2AA 2WXIA 1DJZA 2CM5A 4LCVA 4FHJA 2WXQA 4FJZA 4XE0A 1TJXA 1W15A 4BFRA 3IBEA 4OVVA 4ANXA 3LJ3A 2NCEA 4KITB 2UZPA 2Z0UA 4TUUA 2WXHA 3TJPA 1DJIA 5CCHE 4EZLA 5H4ZA 3CSTA 3M7FB 4F91B 4FA6A 2K45A 4ICWA 4FLHA 3APDA 3RDJA 3TWYA 4LDCA 1QATA 1E7VA 1BDYA 2ENJA 4LT7A 4HLEA 1RLWA 4ANWA 2WXJA 3R7QA 1HE8A 4GB9A 2K8MA 3OHMB 2CJTA 1E7UA 4NP9A 4J6IA 2D8KA 4NS0A 3IM1A 2CHZA 2WXKA 3L17A 4MJJA 4JPSA 4AOFA 2CHXA 4WEEA 4ANUA 4IHBA 1DQVA 3JZYA 2WXOA 2B3RA 2X38A 1TJMA 4L2YA 1CJYA 2N1TE 4G11A 4DK5A 4HVBA 2WXNA 2KI6A 3L08A 3PREA 5G2NA 2CHWA 4AJWA 1E8YA 4L23A 3TL5A 2WXPA 3PFQA 2ENQA 3L16A 3ZVVA 3ZIMA 3W56A 3B7YA
chains in the Genus database with same CATH superfamily
5HGHB 5BQ7A 1H6TA 2H3XC 5C3TA 3MXVH 4MYWB 1J9TA 1PDKA 1DVTA 3FQRB 3K1KC 4NUGH 5FYJH 3OWRA 4FKEA 4FN0A 2X40A 4R97B 5D4HA 5HGBA 1IBDA 1H3WM 2CALA 3VJ6A 4ZUWB 1ACYH 2ZPKL 3IXAB 3NTCL 2IF7A 5HY9B 1ZLVK 2ZSWB 2EEAA 4YGVB 2E7BA 5LCVH 4EI5A 4R3SB 2EAEA 2YOCA 3ZYJA 4HWZA 3DX6A 4OCXH 1S9WB 4RESB 2AC0A 2N4IA 4I0PD 2EIBA 4ODHL 1FYHB 3H42L 5HHOE 4OKVA 4CSSA 3MR9A 1WDAA 2B9BA 5GSRB 2VDNL 4G7SB 3X1GA 1PL3A 3D9AH 5F21B 1H3PH 3NPZB 2KZWA 2EYTB 4TNVK 3WMPA 1U8HB 2APWA 3SE6A 4UM9B 5FDWB 2DIJA 1PD0A 1MWAL 2RAMA 5IJCC 5CJBA 2RJMA 4W9EC 1KWKA 3NIFB 2PW2B 5A6LA 2RHEA 2PR4L 5EN2A 3IVKB 3MA9H 4KKAD 1AQ8A 1V7NL 5GZOC 2IEPA 2F1BA 3MLSH 2IWEA 4HD5A 3BVNB 4ISVA 3RPBA 3ZQXA 3ABMB 3F62A 5D71H 4A6YL 5KS9A 2EZ0C 4ZS7H 4NKQB 4Y4HA 4G8GA 4NBYB 1CK0H 1D7DA 1P7QA 1V3KA 1ZANH 2NDFA 3FU3A 3HN8A 3CFKB 4GAYB 4G5ZH 4P5RA 2WBKA 4FL4B 4JQVC 4I48B 4MCYA 1IVLA 4P5TB 4WENB 3FCTB 4MSWB 3LRLA 3IS1X 5I1KH 4KRPD 1IAKB 2WLHA 1ID5I 2R4SL 2VM3A 2HRPL 3DMMB 2FO4B 4YDKL 1C5DB 4IK7A 4X6CA 4N2MA 1XEDA 1HE8A 2F2HA 4W68A 1BFSA 4FQ2H 1L6XA 1PZDA 1X6NA 4N8PA 4OZIB 4OFYA 3QNZB 4OQTL 1PAZA 2JLLA 2CLRB 4BQBA 4I0PC 1CDCA 3V5DA 5JXAL 3AXLA 1R5VB 4FXKB 2BP0A 4WUKL 4YDIH 5IR1B 3QIUA 3MLTB 2OQJB 4LCIL 4M5YL 3STBA 4F37F 2PCPB 2WLNA 1I8UA 3AY2A 5DF0A 1SY6L 1IGTB 1YSOA 2J8UA 3J07A 3MCLH 2VC2H 2NW3A 5DGQA 4LSPH 2C3HA 2DH3A 4JG0H 4IJ3C 5EUOE 1XVSA 1J1PL 2OTWB 5JOFA 3PY9A 5L6YL 1TYRA 2DYPD 1UD4A 3WKYA 2XKNA 5DRXA 1FL5B 3UBXG 1G9EA 3QEUB 4ZPTB 4KKAC 1JDAA 1NAML 2R4RL 2EUXA 4FA7B 2WQWA 2W9EH 1ZA6A 2Q86A 4PIRF 2C1PA 2GCYB 2XRAH 4I77L 3KYOB 4GFXA 4XN5A 3WO4B 2OJEA 1GJIA 1Q4NX 2VITB 2X3AA 5TQ0L 2L4OA 3BEWB 3HAEH 3BHBA 2VXQA 4R26L 1IKNC 4KH2A 2O6CA 4NKIH 4EUPB 1E4XI 1ND0B 2IC2A 2VR7A 3C8KB 4WGKA 1S7UA 4JO2H 4Q4IA 1MIEL 2X4OA 4URTB 4CL7A 1I9EA 2XG5B 5D7IA 2OJ1A 2P24B 4AW7A 3FBQA 5IESH 3OAWA 1MLCA 2BW5A 3CN1A 5T3XD 5I1IH 2VDRB 4YO0B 4KZDH 2WUBL 3ZDZB 1F56A 2FQFA 4KRPC 1NC4B 1Q38A 2JK5B 1UKTA 3D33A 4OZFB 3WIAA 1HFUA 1GVIA 2ZUQC 3G5VB 1RUAL 2C7FA 4E9TA 3U9PH 3QVAA 1CO1A 3WFEH 3HUJA 3U2JA 3QPXH 1EK3A 3PGFL 3T77B 4XGZB 2FHFA 4M6OL 4JAMB 2D3JA 4AE0A 1JN6B 2WKOA 4XZ4A 2XG4A 2EDNA 5CLZA 5FIEA 2AABL 4Z8FL 1BVOA 4RAUA 4PN6A 4EE2A 5IEHB 5J4MA 1KT2A 3M1BA 3MV8D 4RGNE 5GHWH 2ISDA 1BJ1H 5GGRY 5MI0C 1J86A 4YDVA 3ZK0A 3P4OB 4B5EA 1RZQA 4KITB 5CZKA 1SEQL 3QEGL 1RZKH 3GMPA 3FQXA 4NN5C 2QHRL 4E9XA 3LD8C 4APXB 4ODXA 2CZNA 3X11B 4AVJA 1CLOL 2BNQD 4X6DF 2BPBA 4G82A 2NY5C 1MJUH 4K5LA 3IMWA 3TCTA 2GBUA 4XI5D 2P48B 4L0PB 2CUMA 3OM3B 2N01B 2PPFA 3O11B 5JW4Q 1GCFA 2H45A 2ARJQ 3B9VA 3JV4A 2H6PB 3VD3A 1BEYH 4DEPB 2W07B 4G7YL 2BSTB 4JJHA 5F1IA 5FCSH 5I1DA 4NPYA 3UTSD 4HV8A 5ALCH 2CHWA 3GSNH 5CSZB 3NCXA 2MOQA 3EYVA 4J3OG 2A83B 3ULVD 2BFGA 4DVBB 1U8KB 2ZKMX 1MSPA 3P9LA 3RJDA 3ZTCC 4NCC2 5EWIH 5KVMC 2EDXA 2R69H 2IFFL 3QORA 1A2YB 4EI6A 4MNQB 2A38A 1JHTA 4J1UB 5B3NA 4M5TA 4FFTA 4ONOA 4E36A 5IVXB 3VM5A 4G6KH 4L8SC 4K2UL 1TVHB 1ML0A 5H37H 2WGNB 3LKPA 5ID1A 1HHHB 4QXTB 1GW0A 1CGXA 1ZOXA 4YK4C 2G0KA 5I0WA 3IJ7A 1GHFH 1Q9LB 3BT0A 3OC5A 3KEHA 1M9WA 1B2YA 1P9MA 4JFED 2BM3A 1YMMA 5LAXA 1DDTA 2C1OA 4FQIL 4ZOAA 1ORSB 3MOBL 1YO4A 1K4DA 2G3MA 2CG9X 3T0XA 1TDQA 1FL3B 1ZHNB 1D5IL 4O02A 3MUZ1 4MA8L 2AMUA 2QSCL 4J2QA 4N5UA 4ZUTA 2NUPA 3WJJC 1AZNA 4K9EH 2OYKA 4JS7A 1UWGH 2BIQA 3VD4A 4N8UA 3CN3A 4XI5C 4N3TA 1N70A 3V4PA 1PKQA 5HI3D 4JO8A 1T1XA 2VRKA 4WHTA 1RXLA 5I6NA 3O2WL 1S7WB 2BOLA 2EILB 4TNEA 1GZHA 4CSPA 4OFIA 5JR1H 5INDA 1J7VR 2HJLB 4E5XA 2D4FA 4ETQA 3PDDA 3TBCA 1MVFA 5JXED 3MRLA 4HKJA 4HIQA 3ZZ1A 4POYA 3SZKC 2YPKB 1BW8A 2DL2A 1DJZA 3KLDA 2RACA 4OZGB 4Y2NA 3VFRB 1TVDA 1G5GA 1WICA 3FU6A 3PUUA 3ULVC 1IIIA 1UM6L 1V54B 3AJ7A 4ZTOH 5B1AB 1ID2A 4HX1B 4OCSH 4R5VA 1E4XH 3OV6A 5E4IA 3VFPA 1FFNB 4UMGA 1ACXA 1MQKH 35C8H 3I85A 2AQSA 4G9FD 4B6ZA 4GMSL 2BC4B 3DUUA 4I0PB 2PPEA 3NT0A 4Y5YA 4HUWB 4JN2B 1ZDQA 2J25A 5CEYA 4GIAA 1F1DA 1ZLVH 2LAAA 3OHMB 1CURA 1MCBA 3NCEB 4AM0Q 4LCWD 4IBVA 5I23A 1TXKA 4CC1A 1G7QB 3O3EA 4BFIA 1PX4A 5FYJU 1CIUA 4XP9H 3CCHB 3QG7L 4ZDHB 3ZDZE 1J8HA 4KK5D 3QUYD 4IJ3B 4JHAH 4X9HA 5HD8D 1J0HA 3LH2L 3ZPDA 3O6MH 3R4DA 4PRHE 2YGQA 2YAFA 4BA0A 3MNVB 1XZWA 3QFJA 3D51A 1YAZA 5J6HA 4GUQA 1FF5A 2FECI 5F7EH 4N85A 4XTRD 5DHEA 2ZUVA 3KBEA 4RFEB 3TF4A 1BZEA 3U7YH 4HETA 1I82A 4K3DL 1QABA 3P02A 4HK0B 1MJ7L 1X5MA 1FO0L 2FJFB 5E2UH 4I9XA 2ZXEB 5D7LE 5HI3C 1NGWB 3MU3A 5G4OA 4Y0GA 2DQEH 1P5UC 4H0IA 2OMUA 4NQSA 4KK6D 4FQXD 4G43A 5D1ZD 3WO3B 4KO5A 3QDHA 4GSXA 2A9NL 4J6RH 4N6QA 4P23D 1HAUA 3JVGA 3TT1H 1I1RA 5JXEC 3WTSA 1PU0A 4MXWH 2R0KH 2WO3B 3N9GH 3HG1A 3P3RA 4K3EL 5J0BA 2FH6A 4ERSL 1J8SA 4Y1AD 4NC1E 4MBRA 4XBEL 4WO0A 1HJBC 1P6FA 5SV3A 5I73B 2EQDA 5EU4A 2NW2A 4PRBA 2OPCA 2W59A 4WSGA 2R8SL 2ZUQB 3GBEA 4QF1B 1UGNA 1M7UA 3HC2A 3N1MC 4OSUH 1INEH 4LU5H 5T1LD 5D93B 4ODUB 4NO5A 1NLDL 4BCYA 1KXVA 1TLMA 5BV7C 3HG3A 4A7GF 3OXSB 1X9UA 3NCYP 4A1RA 4AY0A 1MJ8L 1OO2A 3L5WB 4XN8A 2FX7H 2JKRM 1CE6A 3HCVB 5DVKA 4NT6B 5EU3B 3Q9PA 1JTOA 4PGCB 4PJFB 4Y4FA 5K9QG 4JM2D 3SODB 1SMOA 3CVIL 2OZ4A 4LGPB 1CF8H 2X5PA 4KK5C 1OAJA 2HX8A 2JVUA 4NQCE 4D9LH 3JWOL 3QUYC 4XRCB 4NN5B 5CGMA 3D8MA 5HD8C 5AVQB 2WXQA 5HVFB 5L9DH 2AJUH 4Z7NE 3MNZA 2XNAB 2ICCA 2XXCB 2R59A 2M26A 1OARL 3HNVH 2HVBA 4IU3A 3WUZA 5BVJA 5I6MA 4ZMYA 4AV4A 5A16A 5F0PB 3FQNA 5IQMA 4XTRC 4FLHA 1IFHH 2ED6A 3SDXF 1SGKA 2ROYA 3GYRA 3N1FC 3P4NA 2P5WD 3ATFA 5B38G 1I8LA 3GRBA 5F9WC 5I6PA 5L8KB 4TL5A 3MRBA 5CSGA 4MJ5B 3TZVA 4UWQB 3CHOA 1KCRH 1YEHH 1UACL 1P4BH 4AOFA 1KPRA 4KK6C 4FQXC 4DZ8A 3A0OA 5D1ZC 2IAMD 1MELA 3QQDB 4YBLC 4P23C 3W56A 2VXVL 2WN3A 4UT6A 4F8QA 3GF8A 3LZQA 5DC9B 3QXDB 4H25B 4LSSH 1EFXD 4EUPG 2APBA 3N0AA 4MAUH 3V6OA 3LRSB 2K4AA 2E47A 3ARED 3R7RA 4PB0H 5KVDL 2DWEA 2Y69B 3RWCA 4AYEC 4LKCA 2J88H 1AJ7H 3FTXA 4L8SB 4MB3A 5DGRA 5PCYA 4DP0X 4UQBA 5F9AC 5T5FA 4U1NA 1WT5C 4JHUA 4MKMA 3BVWA 4YHKL 2FDBP 2QSTA 5FEBA 3OR6A 4UQAA 3GSRB 2M1KA 2VXSH 1ED3B 1MHPL 3WHE1 1DQLH 3TURA 2VKWA 1ROCA 3QNXB 3RZWA 3MV8B 4M1DH 2WAHA 2VO5A 4MHHI 2ATKB 4JM2C 2F53E 3TEZA 5E1AA 3T4AA 1FAIH 3N85L 1OQOA 3PQYD 3RL1B 2C4FT 3IFLH 1KGIA 4UU9B 1ORQA 3GMMB 3LPFA 5E8NB 1ONQA 5DMKA 4LF3B 5C0DB 4G8FA 5IT2L 2EUWA 4R90H 4W9GC 4YXHL 5F3BA 5BJTA 3OGCB 3SPIA 3VAEA 5AYTA 3BEVB 3NSXA 2PCFB 4PJDF 3ZE1E 4WQOA 3NJNA 2BWDA 3CD4A 4MD4A 2A9ML 2VXQL 4TS6A 3UTSB 1WAAF 2IALB 1AY1L 1LP9E 4QRSB 4TLUA 5J1SC 5EF0A 1B2WH 2EIDA 3HZVB 3JSSA 2IAMC 2ZP9A 2FLBT 2NOYA 3S37X 1KIPB 5DK3A 2UUDH 5AZEL 4O51A 1T4KB 5IJDC 1R3LA 1J87A 2H41A 3NJHA 3Q1EA 5IV2B 2XN2A 5JUEL 3AREC 4ZQTA 3SDCA 1DFXA 3SDYH 3UTTD 3WEMA 4BKSC 5C9KA 1TFPA 3QSKB 4LBAA 5H4ZA 2OTUA 1R3IH 2MIZA 1MKFA 4YPJA 1XBDA 3V0FA 4ELMB 1VACB 2X3BA 3MRMA 4OH2A 4ATWA 1K85A 4DP6X 4ONGH 3ALXA 2HKHH 4NIYE 3ZR6A 2QJDA 3DYPA 1UZ6E 4NM8L 5CD3B 3L17A 3KAAA 4JPSA 3RZCD 3UYRH 4MXVE 4JFEB 3U36B 2ZP8A 4LIQH 1QO3A 4UTBH 3VXTB 3EOBB 5TPWH 2ADGA 1I9RL 2F15A 3WS6C 1IGYB 2MCPL 1Z1WA 5F1NA 3UJTL 5FLVA 1ZE3H 3BGMB 3KL3A 4KDTA 4MWFA 1WAEA 4LESA 4YH6A 1UOKA 4P9ML 4Y8AA 1M3IA 4P2RB 5F9JB 4EZKA 4I2XE 5EA0H 3WXVL 2F9BT 2H7WA 1DANT 3VX1A 1QOKA 3NZ8A 2HRHA 1ZVNA 1NCDH 3B9EA 2ED7A 2VDQB 2AJZB 5KJRL 3SKMA 3MBEA 2OTPA 3QUXA 4XNYH 4XWGL 2C9AA 1T0MA 3AAZB 3S97C 1ZK9A 4CC0A 3C75A 3APMA 4F7TB 3IDGB 3MXWH 4WU5A 2Z6FA 1AGEB 1EHLL 5FUZH 1OPGL 2FLMA 1RZIA 4PJEA 1KBBA 4F7PB 1FFTB 4O2FA 1KPVB 3BI9X 3LS5L 1B4JL 1H0DA 3VI4B 4KWUA 3MRRB 3IJ8A 4ZSOE 5DC2A 4A37A 4G9FB 3F12A 5C6TL 3PAZA 5TE7L 4PJ5A 1N68A 4U6VH 6PCYA 5BV7B 4OJAA 5FO8B 3MJWA 4QXUH 2VLME 3KYNB 3N1PC 1PZ5B 2D2OA 1W72H 5EIIB 3VCLA 1OVZA 4LCWB 3V5KB 3MNDA 5EO0B 3R19A 4P2OA 2OMWA 4KROD 1KG0B 5CBEA 2WINB 3LN5A 4WW2B 4JFXB 5HYJD 3P2TA 1KJMA 3RZCC 2G9HB 2Z8VC 3BPCA 2R23B 2ZCKL 1NIBA 4ODWB 3QUYB 3WFCH 3RLSA 4ECNA 4PRIE 4KY1L 1NCNA 4NM4H 1P4LB 4JDEB 5KUKA 4O02L 1OW0A 2B3IA 4BK8A 2X1XR 1OCWH 1HDMA 1ETZA 4JUSA 3WN6A 1BVZA 3FN0H 2VXUL 5HDQH 1OSPL 3SKJH 4N2GA 4DGYL 4Z7VE 1RPQA 3I6SA 5DZJA 5F9WB 2R69A 4X6BA 2I27N 5SV4A 2ESVA 3ARGD 5E2TL 2P47B 1L4IA 3TPKA 2P46B 3V4PL 5C86A 1A66A 2DB8A 4DO6A 4J3OH 3RUGB 5CMAB 2NY3D 3I6KB 5DO2D 4AG4H 2ENJA 1IC4L 1ADQH 4XBPB 5E99H 5F1OB 4GQQA 4PGJA 4FQXB 4C4BA 5D1ZB 2E74C 1F4YH 2WLLA 5K9QI 3RWIB 4JCWA 4OY9A 4IEFA 2V5RA 4IRJA 1T7ZA 1TKWA 3FB6A 5ICZA 1VSCA 1INDL 3KLQA 4Y1AB 4Y19E 1CU4H 3GTTA 2IV9A 1S5IL 1MCOL 2JV6A 2V2XA 1DO5A 2XZQH 2DTMH 3KW7A 5JZ7D 4EVNA 1N2RA 2DRUA 2EECA 5L2KE 1DEEA 4OBRA 5D72H 4BSWB 1L6ZA 4NHUB 2YQ3A 3DJ9A 2Y1ZA 5KYWB 4NZ8A 5T1LB 1A6UL 4E68A 5CGTA 2P8PA 5KOMC 4Z7WF 2E7LA 2UX7A 2EH8H 1I7ZA 1NKOA 1QSED 4DW2H 1EXUA 2C9PA 2Q76B 4KROC 3P2BA 3T0AA 5EDSA 5AOKA 1LMIA 1AD0B 5EZIL 4Z7UF 5I30H 3V8OA 5B39G 4OGYL 4X4XB 2WAQA 1T22B 1NCIA 4WI8A 1J05A 4TNGA 1U6AL 2FWOB 1JZ5A 1CLZH 5I74C 4MYPA 2LR4A 4PMFA 1MY5A 3WTTA 1N64H 3FL7A 3IU3A 5TH2A 3VB8A 4LLMB 1JGDB 2B0SL 4N90D 1O9WA 2WLZA 4OFVA 2AK4D 4W81A 2FQGA 1B0RA 2N56A 4N8VB 1W16A 3JWNC 5AENA 1G9MC 3ZL4H 2P5WB 3HEIB 3O6KL 4N5ED 2RALA 3S4SA 2E27L 1WIUA 5I15H 3ARGC 4YVNA 1GAFL 1TYJA 2BP5M 3Q44A 4GSQA 3QUML 1ZT4B 4D2NA 5J6GA 3QJQB 4CILA 1FLRL 2NY3C 3TX4A 5DO2C 3VNZA 1ZJBA 5CFAA 5DR5H 2A9DA 5J9PB 4HEMA 2BNRE 3KGSA 4HUMB 4P0DA 2D7TH 2IAMB 2JB6A 3TC9A 3QQXA 1T20A 5BZWA 3VXUD 2VDOL 4P57A 1VFMA 3NFSH 3SQRA 5CS7A 2XWEA 2IADB 4UV7L 1EFXB 5DJ6A 1RP9A 4ZFZB 3DX8B 3AREB 3VFWB 2KDYA 5JZ7C 1GPOH 5ESAA 1TR7A 1EHKB 4S1SL 4FKKA 4GG6E 2R2CA 4LLYB 1RZ8B 1S5HB 4KU1A 2DLEA 2GBTA 3B2PA 2I5YL 3ZTDC 3RFZB 4A7GA 3L81A 5FFGA 2X28A 1KLUB 5L88L 4TKWA 3N1QC 5F3FA 2EVIA 2VH5H 2F58H 4POZD 1ZAGA 4M5SA 4M9OA 3LV3A 1IEHA 1H8NA 2E9GA 2WQRA 4JJOA 2OMYB 4NJ9L 3D3VE 4HJTA 2OZ4L 3LEXB 1E4JA 2E7MA 5DRZA 5C7XH 1JVLA 4JLRB 3SDDD 3NIDB 3V55A 1DSFL 4AZUA 4ZZKA 1G7MB 1UZGA 5C0AA 5I66B 2H2SD 2CK2A 2R29A 4AYMC 4BYHA 3AM8C 3MLXH 4RISH 1BM3H 4NUQA 4N68A 4F7CA 1HWWA 2NY7L 4PGBB 1TPXC 4HHWA 1KBWA 2KKQA 1KN4L 2X41A 3GMQB 4B27A 2HFEA 4F33A 1QR4A 3CLWA 2G9KA 4N5EC 1L7IH 4F2ME 4ENED 1JBJA 1KEMH 1E30A 2OMTB 4Q9RL 4S10A 5E2WH 1QBLL 4M29A 5IHWA 2R51A 2R56L 3DIFB 4DP5X 25C8H 4PJAF 1MCJA 2N7AA 2HX7A 4PJGF 5HJ3A 4OTXL 3JTTB 1HVXA 2YQBA 1OLZA 3F00A 4UB0L 4NI6A 3U4EB 3I9GH 1M2VA 1YN6B 1UOVA 3O6FD 4QJ5B 5T8IA 1RJYB 3GLEA 4UT6L 5C0GB 3EFFB 4OGXH 3JT2A 1SXAA 4FQJL 4WV1A 1GRWA 2P5ED 3OX8B 4B7IA 3L9YA 4GRWE 5D2NA 1KCSL 2WM0A 2LLNA 4XNQA 3UL4A 1U92B 5J7CC 2EDWA 3QDJB 3O8XD 3NJJA 4Z0BL 2Y7OA 2ZCLL 4L3EE 1TTFA 3OLDA 1RFDH 4KQ4L 2BZCA 1HXYA 3MBXL 1MJJB 1OOAA 2R7EB 1XF3A 2H8PA 1PYWB 1A6ZB 3LH9A 4KUZL 4HJUA 2P49B 5T5FL 5K9OB 2X2IA 4CGUB 4PRNA 3K4DA 5F7KC 3VXME 5ALBH 5I1EH 3O0RL 3Q05A 1QNIA 4ZNCD 2JTDA 1DANU 2X2HA 3BVUA 3U48A 4POZC 5IWLA 3RZCB 4JVWA 4ZUUA 2XPGA 1BM7A 4KZCA 5IB5A 3HE6A 2CLVA 2Y7QA 1IGIL 2W91A 1LXMA 1IIKA 3SDDC 3Q8BA 3Q6FA 3ARUA 3HRZA 3O4OB 3GXIA 4MJ2A 1DLHB 1R4XA 1JCKA 2XFGB 4Y8DC 1G7IA 4WW1A 3PAUA 2H2SC 1A0QL 2WZAA 4GKZA 3CPLB 3DI3B 3BGAA 1XSOA 3FQUA 1XL4A 3UAJD 3U7WL 4PJDA 1BFOB 3AS0A 3VWKB 3QYNA 2V9QA 2FHCA 5D70H 3VGHA 4J7RA 4N22A 2YIHA 3NJKA 5ANMB 1O5DT 4PJ7E 4ENEC 2CUIA 1X5JA 4JPWL 5DJZB 3L3OC 4EUPH 3ISWA 2GITB 2A3TA 1HHGA 4JZJA 3EGSB 1CBVH 1D5ZB 1XCTA 2A7BA 4JKNA 4IBZA 4G1EB 3RY6A 3A4AA 3O6FC 3HNSL 3MJ8A 2VDRH 4OJFH 2C7UA 2OSYA 2Y25A 2RCSL 5I82A 4GT0A 2B16A 1DUZB 1JI1A 4AMKH 3FSOA 4I5BB 4OZFH 5EORH 3OPUA 2NX5E 3O8XC 3CZFB 3L1FA 4NKMB 5L2JB 3B7YA 2BVPA 3LIZA 2BMKB 4FERA 4OZ4B 4M8RA 2CJUH 4WEBL 5GISH 5B3JF 5ITBH 1HXMA 3KPSE 3UJJL 4D9QD 1XB8A 2WLIB 1N5YL 4ODVH 3IWVA 4PFEA 2EVFA 4TUKL 2PTTB 4KROB 1OF2B 2K7PA 1BWMA 5GS0D 1IAIM 3EG9B 1MRCL 1NC2D 2VLKD 2B39A 4HKBB 4BXVA 3BCDA 1U8PA 4LQ1A 3SGKA 1KENL 3KPLA 4YNYA 3D0LA 3GMRB 5EIIG 2YMOA 5I74B 3IMUA 1KTKE 5A2FA 1AKJD 2W60A 2DQTL 5T33H 1PFOA 1H3TA 4K8RH 4UAOC 4MJ4A 1NWOA 3GJEB 5EFIB 2BIMA 4YBQD 3UAJC 1C16B 1H3VA 3CZKA 4GXUN 4HBQA 3ARGB 4W9IC 1CDHA 5FCUH 3EGXA 1DSYA 4JB9H 2NY3B 4OLWH 2N59A 1JHLL 3BZFB 4AGNA 3FRUA 5KWYC 1XGPA 1CE1H 4I3SH 2QV4A 4BXSV 4EIZC 4EXPX 1LEIB 2PYEA 1K5NA 1GC1C 5AVYB 3M7OA 5E6IA 1LLAA 1S7RB 3HVDA 1NSNL 4PVMA 2F1AA 3UBXA 4MKTA 4RMUA 1DHKA 4XPBH 3EHBD 3VFGL 1ZGLP 4NBXB 5B1CA 5ESVA 4UTBA 5IMOB 2DQUL 3OB8A 4QRRA 1ZGLM 2FJUB 5EBGA 3BO8A 2Y6SD 2MKLC 4IM8A 4OD2B 2WYHA 4R6UA 2GY7B 2KHAA 2HPOA 1ASQA 4N3UA 4RMQA 4O2EB 2HT4D 1TETL 1DVXA 1TJHL 3OJ2C 3KWWA 4O2CB 3GT6A 3WFDL 4I13B 3D4ZA 1AH1A 3KM2A 1BF2A 4FP8H 3D18A 1QSEB 2CDFB 2BVQA 2O6EA 2ZX9A 3FB7B 4JDTH 5BS0A 1HN1A 2OSWA 5GS0C 1HL9A 1QKZL 5DT1L 1KB5B 1GJWA 3BVTA 4KKPA 2FZ3A 3RX9A 4CNIB 4UUJA 2VLRA 4GRLA 5DJ2A 3MV7E 4OZHB 4UILL 5KBPA 4HF5H 1I4FA 1YECL 3EO9H 3HTLX 2VISA 5LVEA 3BAJA 3DSFL 2AJSH 3H9HB 2QMKA 3NRFA 1TPXB 3BP5A 4DH2A 2AK4B 3LNEA 4OJDH 4N9OB 3ZDYB 3E6HA 1CT8B 4YBQC 1Q0XL 1KTDB 4UIMB 1ESOA 1G7JA 2AF2A 5D1QA 3WUWG 1SDDA 4AENB 5J89A 2X4RA 4G6MH 4CMMA 3T3PF 4M03A 3MLRL 3CVCA 1TNMA 4EKXA 2BXZA 2W9DH 3LKNB 2CRIA 1X5YA 5F1SA 3KPOB 4GAFB 1T83C 3NJXA 2XUWA 3QUZD 5I6OA 4WY7L 5LXGH 2V6HA 3VXUB 1NUDA 1IM3D 2TRYA 3BN3B 3QWRA 5F3HA 5LG1A 3RFRA 3FN3A 3F64A 4H0LC 3EHBC 3HC3L 3FH8A 4U6HB 1BA9A 3IU4H 4J8RB 4NIKB 4OF6A 3N3EA 2Y6SC 3MGAA 2M2DA 4OIIL 1LDPH 1QHOA 4M6ML 1WS8A 5EEUA 2XQYG 1CFNA 4NZUL 4RBPK 1U0QA 5FHAL 3VYPA 3MGOA 4JRXE 4DKDC 2EINB 4HIHB 5FM8A 2HT4C 2OXHA 4BSVB 1BVNP 3VGEA 2O5YH 2YRBA 2JSFA 3SKNA 1J48A 2COQA 4FNLL 4PG9A 1WK0A 4DEWA 1M1XB 2VXTH 4PRHD 5IY5B 5LUMA 3NJLA 4Z7UA 4WFFD 4NNYB 4NC2B 1KXQA 5FA4A 2YMXL 1UD6A 4QHLB 3SDDB 5JHDA 3TFBA 1K8IB 3BZ4A 5AOMA 3EFOB 2GIYA 1CVSC 1S9YB 1BBJB 2OMXB 2GTQA 4AYDC 4R4FL 3SPVB 3TWCL 2DDQL 1MCCA 3CFDA 3IFNL 1YJDC 3GSWB 2WWKT 3UC2A 5HJBA 1ES0B 4RA3A 4I3RH 1QMUA 2V33A 3KR3H 5A2KH 4NO0D 1SQMA 2IIJA 3H2QA 4MB1A 2HN7B 3RVVD 4Q9QH 2ZKYA 1KLGB 5J8OA 5B21A 1F11A 2JNZA 3L3OB 1MRFL 1JNLL 3OKMB 3V4VB 1ZIAA 3KPMA 3VFNA 1SOKA 3TIEA 3VA6A 1NIFA 4X99A 2DBLH 3FQ4A 1JV2A 3QUZC 4YE4L 3O6FB 3WIHH 3HW7A 4FYRA 3H9SD 1UXWA 2FR4B 4KUCD 4X0KB 3LKOA 2HT2D 2H9GB 2P5EB 4N0FB 2UXFA 3S37L 3G04A 1JFQL 2JIXA 4TNWK 1XIWB 5CJ8A 5DD1L 4UCFA 1KGXA 3VXQB 2WNWA 1F6AB 3UIYA 4YEFA 3SCMD 5FYLE 4C8XA 3U79A 4NP4L 3EADA 4RAVA 1PZSA 1U8CA 3LCYA 4PRDB 4WNJA 2WXLA 2WKLA 3PHOB 4JO4L 4N0CD 3DRTA 2APXA 3U6XS 3FULA 2XWTA 2WQSA 4RSYA 3QZNA 3MKGA 1UQSB 4HS6A 1UYWL 4XP5L 3IDJB 3RI5K 5ILTH 1I8IB 3LIUA 4GP5B 4YWGL 4C56A 4MS8D 1A6AB 1N0XL 3PWJA 4WGWB 3C60A 1NGYB 1FYTA 2BSBA 2R29L 3BP7B 4N86A 5EZJB 4CW1A 4UAOB 4I4WB 4MJIA 4DERA 2GTWB 3MLUL 1M6UA 4OAWB 3V95A 3VXPB 1E50A 1JZFA 4LOUD 1OGSA 2EE3A 1A1OB 3N2JA 3RVVC 5BCAA 4LSTL 4PJAA 5C0ND 1NL0H 3FCBA 3MI6A 2LU4A 5IF0A 1KY7A 4UV4L 4GS7B 4BQ8A 3B2VH 8FABA 4HS8L 2VQUA 2HMID 3MUUA 4IBSA 4XMLL 5T3XH 1OV8A 4JY5L 4L3CA 4CADB 1RJCA 4DQAA 1BZ9A 3MOAH 2QPFA 3KXFE 4TPRL 1XGYH 4DF9A 1QPPA 2HT2C 1O6SB 1A1NA 5HPMA 3F6LA 1BHGA 2VLJA 1T5KA 3JUZA 2QVFB 3WNJA 2X6AA 4UDTB 2Z35B 4IIQC 3NGBC 4ZX5A 5E4EC 4ZMNA 3FT2B 1J9QA 1WIOA 3SCMC 7CGTA 4ORGA 1H8LA 3T0VA 4W4OC 3QEQD 3JZ7A 2ZG2A 3VXRE 1JZ6A 3DX4A 5EU6D 4N0CC 2VRAA 1KYUA 2OP4L 3H85A 2VLKB 4WKXA 3TPUB 1ZDSA 2Z91A 4LSVH 3TEWA 2UXGA 3HZYB 4HPOL 3BWAB 3LNFA 1IBZA 1VCBC 2BXYA 3PUCA 3PWVA 4MS8C 5MEPA 4R0LC 3BX7C 3PP4H 1NCWH 5FYKL 2R1WA 2B4CL 3UZVA 5KBMA 1F97A 2Y72A 4KXCA 1R5IB 3CC5B 2HXAA 4PJBF 3HRPA 4WNQA 2J1KA 3K5RA 2WIIA 3OKDB 4XXCC 2XWCA 5D1ZI 4IOSA 4C4KT 5GSVA 1AFVH 4B53A 1D5RA 2EYRB 3EJTA 3WKMH 5F7UA 3K6IA 5FO7A 1CZ8H 4LOUC 3EGDB 2Q7AA 4DP9X 3FYIB 2G2NA 3QDMA 4GXUM 4G72B 1PLBA 2IQ9H 1NAKL 4RZCB 5KVFL 2X3CA 4PVNA 3MRPA 5C0NC 2DWXA 1LO0L 4FXKA 5EO9B 4B9YA 3D50A 3MLTA 4L1LA 4PBWD 1RJZB 1RZ7L 2OSXA 3ASNB 3CQPA 1T2QH 2HMIC 2BVUA 3QDGD 1IGTA 4XC3H 2Q9OA 3HR5A 3WTXA 4HQQL 1VFUA 5C3LD 3EHBB 3FH7A 2G60L 4LKXB 1EEYA 2YD8A 1DUYA 1SJEA 3AS2A 3O4LB 3T6ZA 5I1AB 3K6SA 4DP4X 3L1OL 5DJ0A 3WFBH 5B38A 5HHNA 1OSZA 2GJ6A 1BAFL 4BKTC 5IB4B 3IGAB 1WFTA 4DTGL 1AD9B 5EZOH 1J9CT 4X4MA 3TBVB 3GPEA 4ANVA 4E9WA 2WZ6A 3LIZL 3MROA 5D96C 2NTFA 2B20A 1GOFA 1U8JB 1YEJH 2YHGA 3NQIA 3OKLB 3WE6B 5B3SB 2OMVB 3JV6A 2YPLD 1JZ8A 3ZHFA 1A3RH 4R7NB 1M05A 3ROOB 3LKSA 3HS0C 1VGEL 5BRZA 3RAJH 3DX9B 5IHUH 5KYNA 3QK0A 3T2NL 1WLHA 3ZKND 3ZDXF 1FN4B 3F3HA 1Z9OA 4PRAA 2VLLA 5FO9B 3H1ZA 3NAAL 4ZQKB 3MCYA 2ADFH 4JFZH 1TCRB 1S8DA 1PQZA 2X6BA 5LGJA 2Q8AL 3GSQA 3CSFA 3P0YH 4ODTL 1HQ4B 1I1FA 3UYPB 1KCVL 1T7WA 4L8BA 1OM3H 3SHSA 4LP8A 4PI0A 2VDQH 3L3JB 5CNHA 1G9NL 5MP6H 3BD5A 1JPEA 2HKAA 2Z92B 3QQ4B 1EJ8A 1OY3B 1UOWA 2FBJL 3HC0A 2IG2H 3QNFA 1Q9OA 4AYSA 3I3BA 2AMGA 1DLFH 1BG1A 3QUZB 1S6NA 2IBGA 4NJAH 1FRGH 1IM3B 1XB3A 5CGBA 3APDA 5CWSB 2X9XA 4F1ZA 3BKYL 4I0KA 1A7NH 5BPPA 2A6IA 1CICA 1M71A 4LNRB 3H3KA 1E2ZA 2FE0A 2VLMD 4HSAC 4APXA 4E41A 4EAEA 4A2GA 2XWZA 3HI5L 5C97A 3FUIA 4WFHD 3E38A 4HJGA 3TYFB 5BV7H 2X4TA 4NKOB 4L2YA 1N8ZB 1CD8A 1A21A 5IBUG 4CKQA 1BXUA 2BH0A 2HVKA 3HZKB 1GS8A 2BLFA 2VTFA 1IM9D 1YPZB 2CU9A 4B9IA 3RPKA 4RBPH 1JXFA 1DR9A 1SLUA 5T1DH 4JQIA 5EOCL 5AVXB 1TTUA 3I9IA 1RPUA 4KZEL 1KIQB 1NEZB 5HHXH 4X5QA 4D0DB 2J56A 2IDUA 4BZ1H 4HG4K 1CDIA 2OSLB 2V7NB 3QJZA 2K6WA 3VGAB 2A83A 1UEYA 2AQ3A 3GC3A 4ZMAT 3X3FH 5C0EB 1ZGLA 4UZSA 4OCWL 3SSGA 4NO0B 3TH4T 2QGEA 4L29A 4MJ6A 5F96H 4JG1L 43C9B 2EIZB 2DBJA 3A6CH 4PB9L 3V8CA 4N8CL 4PV8A 3ESPA 3WLBA 1MVYA 1BD2A 3CPUA 3MRJB 2ZJSL 1P53A 2N7BA 4Z76B 1AE6H 1MNUL 1JK8A 5IIEB 1X5HA 2JCWA 4ONFH 4U4BA 1D2OA 3FF7A 1UT1A 4Z7OB 1MI5D 1VJSA 4XO5A 3UTZB 1IT9H 2VZSA 3MA7B 4YC2B 3VG9C 3H9SB 2AJYL 2A6DA 2JKIS 3KYMA 4TQ8A 4DN4L 1JMXA 1EZVX 2H3NB 1HSBB 2W65A 4OLVL 5F1KC 2WOYA 5AWNL 4XMTA 5GJTH 2VQ4A 4R8WH 3EO1A 4KTEL 4QTFA 4PRPA 1H6UA 2PWEA 5CAYB 4ABWA 4IIQB 4XN1A 5DHYA 3NGBB 3PWNA 5E4EB 4V11A 2YUZA 3SCMB 5GZOA 1WIPA 1ZWIB 3BSZL 3OLIA 4XX1E 2HG5B 1T0OA 2J2ZB 3NJFA 4KC3B 1A9VA 4OLZH 4HC1L 3NZSA 3A6BH 3GI8H 1JAEA 3NH7H 3S96B 2EDJA 4RFOH 3AY4A 2AGJH 4X6DE 4HIIA 3AGVA 1HHJA 5FUOL 2YA0A 4PH8A 4WJ5B 2B1AH 1FZOB 5GGTH 5GZND 1M6OB 4GSDL 1H15B 1KBVA 4MNHA 4QRTB 2YMTA 1IC1A 3ECVA 3U0PB 3KH4A 4F3FA 1LHZA 4F58L 2ILLA 1WGOA 4LHJB 4MQSB 4R0LB 1JPFB 1DE4B 1MCRA 5LDUA 2K6YA 1IV8A 1JGUH 5DEFA 3D0VB 3MBWA 5AYUL 4XVTH 1IBGL 4LBEB 4QO1A 2XSKA 2EXWD 2E5EA 3EJJX 4PP1D 1YMHA 1YY8A 5DMIH 3WHE0 5D7JC 2Z8WC 4GPVA 4UDUB 4KI5E 3GD1C 4L1DA 1C1EL 3CU7A 1XGRB 4NENB 2EACA 4Y7OC 5JO5A 4MAZA 2XWBA 4TF4A 5AW2B 1FA4A 3B8SA 2DYRB 4XVJL 4QRUB 5KUMA 4OV5B 2PP9A 2HB0A 1RZJH 3RWGB 5AB2A 4R4ND 4BGDA 3L9RB 4FEIA 1MFMA 5DTFA 1A4JA 2FTAA 3GDBA 4HHGA 1URZA 5AW8B 1MUJB 2XY1A 5DQ9B 5AYQA 5C09D 1QFUL 3X3GL 4XAWH 1ZK5A 3IMVA 4P4RA 3BXNA 4PS4H 3RWJB 1HZHH 5KYYA 4Y2OB 2Y5TB 3Q2CA 3IYLW 2QR0A 1PLGH 4P4KB 3EJCA 5D96B 4FKHA 2HJFB 5BVPL 3QJFB 4XNUL 4BFOA 1M7IB 3BAXA 3LVEA 4JFQB 3D3VD 3T4YA 1RP8A 1KC5H 3KH3A 3QEQB 3T6QC 2OX5B 3BPNC 3BUYB 5EU6B 3HS0B 2MTAA 2DQGL 4OD3L 4XC1L 1IKNA 4JFDE 3EH4B 5E5RB 4AQEB 2WXGA 5GZNC 1J1XL 1QLRA 3NFNA 1TT6A 2XXMB 4DOHB 2K3TA 3VSUA 1RUQH 4NQEA 6TAAA 3VFMB 5J6SA 5JPMC 3N5AA 3WIHA 3OAUH 2EYSA 5IMMB 5ERWA 5KBLA 2YAHA 2EXWC 3VI3E 4PP1C 4PLJD 4V33A 4JFPB 5T1MB 5C0BA 3A4FA 3OSVA 3KPTA 1ZT7B 3CVBA 1E4WL 2EDHA 1FFPB 4QRPE 1D5MA 1BOGB 1DQJB 3CUPA 4E42B 2YAPA 5B39A 1IGML 3DO7A 9CGTA 2YC1B 4WK4B 1JDDA 1OEZW 3RGVA 5CZVL 1B0WA 1KGCE 2VDNB 5DWPA 2UVFA 4PJFA 3L3IB 2AV1A 4WNSA 1DBBL 4MTMA 3QDGB 5MENA 1NANI 3BKMH 4L3ED 2DKSA 2ITDA 2D03H 1PG7X 4PJIB 1IAOA 1YUKB 2OMZA 1UWEH 3MUGB 3SY0A 4OLEA 3T0DA 3MRHA 4F8OA 4M7KL 2BSCA 5DUBB 1CXIA 1EEZB 2DYPA 2RBLA 5LNGA 1YEWA 4FRWA 1AG6A 2ZTBA 3FO0L 4Z7OE 1AO7A 1MW1A 1YNTF 4HWEL 4QRAA 2F0CA 4A6YB 5JIHA 3ZSTA 2OA9A 2YPLB 2YS4A 1RJLA 1CJYA 1NOFA 3HA0A 2RH0A 4NOFA 4XHJD 1R24B 3PWUA 2DYSB 1UWFA 1FC2D 4LDLB 2Q3AA 5TFSH 3ISYA 5TDPA 2Q0ZX 3SE9L 1VAHA 5CEZL 1KF9B 5D7EA 4U1HB 2YRZA 3CHPA 1HSAB 4PJ6A 1YYCA 5ICXB 1NDGB 4XE5B 1SXSA 1EO8H 3RTQB 5C2BH 1UGKA 3DGGA 4PJBA 2BS8A 3M17A 4YAQA 4K0OA 3Q2LA 4FTVE 5AW5B 3ZHDA 2E9IA 4EN3A 1I3UA 5CP3A 3GRWH 1OB1A 3PU7A 4P59L 4PLJC 1MFAH 4P8QA 5SWSD 3TJEL 3UTPE 5I75C 4Q56A 4X8CA 4EI5D 5ADPL 5CIPA 4GP4B 5E6UB 5IZ7A 4X98A 3W9EB 2BVOA 3DV4A 4YHNB 3IJHB 1WFOA 2QZ5A 5LWYH 1LL1A 4OVUA 2QGBA 3LH8A 3AG4B 3G08B 2IAAC 4V2BA 5J1TC 3L4YA 2AXJA 4OCRH 1XGUB 3MCG1 4FQCH 4PJHB 1XO8A 2HVJA 4Q6YA 1E28A 4M8VA 3TTYA 3MX0B 4PCYA 3VG9B 4UIKH 2D73A 1BZ7B 4UOJA 2NX5D 3K0WA 4GMTH 4J27A 3WD5H 1QFHA 4KDWA 1GGIL 4X5WA 1D5BB 3VACA 1TLKA 4KY2A 3KCPA 2ZKHH 1SFDA 3ELAT 1M57B 1WBXB 3KPSD 3CX2A 3GMMA 5T1JA 5FA3A 3HFFA 5TDOA 3SO5A 4JR9L 3KWVA 5DD3H 3WJJA 4X5XA 2BNQA 3F5WB 1JUFA 1NAMB 1E5YA 1BPLB 1Y6KR 3E6FA 4WCYL 4P5MA 4HPHA 5I8CB 1YNLL 5AL0A 4NWUH 2YEVB 3JV0A 2Q87A 4JRLA 3E3QC 5DJXA 1AGFB 1JWMB 2HPTA 1IM9B 2C3WA 1E9QA 2NSQA 4Y4HD 4XHJC 5L0QB 2GFBA 4WWPA 3SDXE 4X4YB 3RX7A 2DLFL 3IKCA 3QZWG 3ETBJ 4Y16A 4IDJH 3WMQA 4EQ2A 2JELH 4JJ5A 4GUCA 1XMWA 1BLNA 4DVRL 2FATH 4YHLH 3UZQB 3NACH 1WGVA 2EDBA 2Z93B 4JCMA 4FA6A 3GSOB 4TVPL 2YSSA 1XGZA 5KW9L 3JWNH 3N50A 1G9MH 1MCPL 5GGSB 5C0JB 3DYOA 1CPUA 1Z66A 4I1RA 4EI5C 3BCFA 2BSSA 2L04A 1PW3A 2FYVA 4KTGA 3MJ9L 5ES4B 2ADIA 3FO2B 3DURB 3W0WE 3Q8CA 3BMVA 3MLYH 2ZG1A 1MI5B 2E76C 2Q2LA 3W3BA 3QIUD 1PCXA 2X1PA 1WCQA 2K70A 4AYID 5KSBB 3G6AA 2NNFA 2YAOA 1DL7H 3C08H 4H8WH 4QHUA 2ZOOA 4NDMA 4NXKA 3JWOC 4E9RA 1WFJA 2Y3AA 4N1EA 4ZD3H 1MCNA 2FT8A 2FUQA 3PXJA 3ULAB 3KW8A 1TQVA 2YD3A 4KZ0A 4FFYA 3RL2A 2VOTA 2YKKA 2EDFA 3A24A 4WLCA 1RI8A 5F44A 5D4QA 5J56B 1E9OB 1NANH 2AK1H 3FCSA 2XA8L 5KAQG 1D5XB 1MCWM 3VVWA 1SJMA 1CFVL 3HPLA 3S98A 4BBWA 3D25A 1MCHA 5F2FA 2JXMB 1TVBB 4X9IA 4YUEH 5T5NF 3GBML 5EULV 4XVSL 4Q0XL 1QBAA 2ZWLT 3MV7D 1P5UA 4Y4HC 3C5SA 3DX3A 2V9UA 2J6EH 4L1HA 4JQIL 5K69A 1RVFL 4XP4L 4GAGL 4U3XA 1E3FA 1UD3A 1F8TL 1KB5H 1U95A 3EO0B 4P46A 3ULUF 1FNSL 5DJCA 1U8QB 3WBDA 1PFCA 3F7RA 3FFCA 5JPMB 1PD1A 3N41B 2XFXB 1AXTL 1WAAE 2BIIA 1KXTB 3WNPA 5GGVH 3IFOB 3FTUA 2XN9E 3MNWA 4NZRL 3L95A 2ZOTA 2YKLL 5SWQA 3NSJA 3RBSA 4LRIC 3FDWA 4BD4A 3Q2WA 1TNNA 4JDZA 3IDMA 4KVCL 5J57B 5AW3B 2JJTC 1MDAA 4XPAL 1A6PA 1A1MB 5ISZE 1T1ZB 32C2A 1JYWA 1F90L 1TZAA 1ZPUA 2QQKL 3PWLA 2B2XH 5HHMD 1T3FB 2EE6A 1GCYA 1C5CL 1YAIA 3ECBA 4JFYA 3VFSB 1F4WH 3QIUC 1OP3K 1PS3A 4MVBD 2WINA 1WE5A 3FFOA 3QZMA 2NZ1A 4GSRA 5IFJA 4O00A 2GEQA 5C09B 2FBOJ 1T80A 2BFVH 2X1OA 1YEGH 4FXGA 2V2WB 4XMKH 4ZO6A 5INCB 3ZKXC 5A1AA 4JFTA 1Q72H 5D9SA 2XIBA 2IANA 4G6JL 3Q5OA 1OPOA 3GIVA 2K45A 1V8HA 4IS6A 4NERA 1SJHA 4H1LG 2VDKL 5CBAB 2FGZA 3FOMB 3CSGA 3IMSA 2WXJA 2YXVA 1EA9C 4FYSA 4LVEA 1SPDA 2Q1EA 2RA1A 1KYOJ 5FOBB 3G6JB 3QHFL 3JXAA 1SM3H 1YQVL 4J8QA 4P05A 4IDLA 3FOLB 3B3IB 4UM8B 3BQVA 3ES6B 4OCNC 3ARYA 4FQXA 4G42B 5ID0A 1HU8A 4BWWA 5AD0A 2CGRH 2BOBB 3ASOB 4HULB 2H1LM 4P23A 4UQDA 3DHJA 2R1XA 4GQ9L 2O5NA 4ZMVA 4FFZH 3SYQA 3EZJB 2YD5A 3DDFA 2V3FA 4AGPA 2GPZA 3A22A 4ZJ9A 2D7NA 5F89B 3VUAA 5I75B 4X7TB 3U25A 2J4WH 2ZSVA 1DJYA 1ZXKA 3BUTA 4QHNB 5GRYA 5BO1L 4L5FL 1YCSA 2DWDB 3QORD 3U4KA 3UACA 1UJ3B 3CFJB 4EDWH 1NINA 1SYSB 4QHMA 5EF1A 3AU0A 4E9LA 1P6AB 3PDOB 2CUHA 2R2HA 2Z64C 5DS8A 3V4VH 1KBPA 3WNMA 4XAKE 5TE4H 5AUMA 3O2VL 2K9UA 1AZUA 5IVZA 3LRKA 4A2MA 4JM2A 1T5WA 2YD2A 5C07B 3KPNB 4FZEL 4MVBC 4CJ0A 3KS0J 5I1JH 2EC8A 2GSMB 3GXMA 1BOYA 5HHVL 5GXBB 1YMMD 2OMNA 3FSAA 4E0RB 2PW1A 1CGSH 2HWZL 4ZFQA 1A4KA 3HMXL 3WUWA 3LTVA 1BJ8A 5T3ZL 1OT2A 4JZNA 2Z9TA 4F80A 2YN3A 4MCZB 1EAPB 1Q0YL 4PR5B 2CDEA 5JHBA 1O9ZA 1EPFA 2AJVL 2CK0H 4NQDB 1M7DA 1UT2A 3VFOB 1ZRUA 5CHNA 3EXJA 1MH5B 1MFUA 3U4BH 4M4RB 2AVGA 4XCFL 3V79C 1L9PA 5L4IA 1LD9A 1NPNA 3IJYA 3VQMA 4YDZA 3DKHA 4N2LA 1AAJA 1Q1JL 1X4YA 3MRCB 1A3LL 5IVOA 4AL8L 4QYOB 3DX7A 3GMNA 4AEFA 5B7EA 4RQQA 2YD6A 4D8OA 1JF1A 3T65A 4AXWB 2B1HH 5BQ7B 1MIML 4NFCA 3KPRE 4NLAA 1PDKB 4PMEA 1I8MA 4NGHH 2XQYA 3PG2A 5HGBB 1H5BC 4KHXL 1MZZA 1YEDA 2IADA 1UA6L 3VJ6B 2FYYA 1RUPL 2FJHA 4JRYA 1DVFD 3ARSA 5AOIA 5SWSB 4JK0D 2CKNA 3W37A 1YA5A 4EI5B 3ORJA 1W91A 1GR7A 3I50H 3QORC 3DX6B 4HWZB 2C3XA 4I9WE 3L2NA 2ERJC 3OJDA 1XX9C 3AABA 4F7MA 3S88H 1G7LA 1ZTXL 2C9VA 4OB5L 1KTBA 4Z7QE 1HT6A 1HS6A 4HPYH 4GAAA 4BJLA 3KLKA 4OKVB 3VD9A 3MR9B 2XY2A 4XMPH 1CD1A 2E8ZA 2WJ7A 5KYXA 2N1TE 2ZYSA 4JO5A 3QCTL 4FNQA 1FL6A 4Z7WE 1F58L 5EUOF 1IGCH 2YK1L 3W9DA 3VXNA 3PQYA 4F2FA 3JWDL 4F24A 1P9MC 2VE6A 3LPPA 4X4KA 4DO4A 5D5ME 1YEEL 3SBPA 3UMNA 3ZX1A 1RPKA 5EN2B 4X5LA 4P06A 1D9KD 2HJKA 3EDKA 2DF3A 4BK4A 4JM4L 1YNTA 5MERA 5BXFA 1JNHA 3GSUA 2BIOA 4ISVB 3T9WA 1QFWI 3RWEA 3CHSA 5KS9B 2XZAL 4Y4HB 3BIKA 3BOVA 5GS0H 1P7QB 1FIGH 4N0UA 4NX0A 2ZOUA 1J1OL 1W8NA 3JBG7 3QHTC 1IQWH 4U3SA 5DVNA 4UQ3A 1FBIL 2PCXA 3CLEL 3QFDA 5F7NC 4MCYB 1IKFH 4M1CD 2CBMA 3ZE0B 5C0GA 4YX2L 2AEQL 2NCMA 3HG1D 4KHTL 4KPHH 3KHOA 4QR7A 5DDHA 4HU8A 4QD2E 4GNKB 3IEAA 5EEXA 2K4WA 5DMGD 2V17L 3UMTA 2OBGA 1DVFC 5FKPA 3UTTA 1KCLA 3MXVL 4X6CB 4X2UA 1JWUA 2DMBA 2EP6A 5KVEE 1N6QL 3VQ1C 5C0CD 3QXWA 2VW6A 2XBTA 2H2PD 4W9ZA 1AANA 3P77A 4Y5YC 3V5DB 1QNZL 3NQKA 1HOCA 3AXLB 2BP0B 3IPFA 3QIUB 5FKAA 2JKSA 2QV2A 3W11D 3RX5A 1G6VK 1XDTT 5K9KB 2J8UB 4GW4A 3ZKXB 3SE8L 2AEWA 2NW3B 4MMXA 2WXIA 3JTSA 4A67A 1DBAL 3KDPB 5JOFB 1F4XH 4RRPG 4K5MA 3MLVH 5AZ2H 5DZ9A 4K55A 5I6KA 2XKNB 2YZ8A 5DRXB 1D9KC 2X05A 3FC8A 4LDCA 1ZA6B 4O58H 2Q86B 4XB7A 2GQHA 2C1PB 1AXSA 1J0KA 2BHYA 4GKLA 4B9GA 2K8MA 1OE2A 1EHXA 3NIFF 3QXAA 4FLQA 1G43A 4K23L 1BECA 4DGVH 4LO9A 3BHBB 2ZOLA 3GHEL 5DJZA 1A9EA 4PJCE 1F3DH 1SMAA 4O4YH 1CD9B 1S7UB 2LFEA 3T3MB 2X4OB 5D71L 5D7IB 2CO6A 1UM4L 5MEQA 4M1CC 1MLCB 4ENZA 2H6OA 1YJDH 1U8IB 3LNDA 1KYDA 1ZANL 4PJGE 4Y88A 1LE5A 3DPBA 4G5ZL 3DOIA 1QD0A 3VU1A 5DMGC 1ACCA 3FT0A 1RERA 1G87A 1YVLA 3CTTA 4KKQA 4WI2A 3GM0A 3HPJA 3U83A 3HUJB 1MVUA 1WBYA 2QGCA 1A3QA 1HCVA 1C5BL 2PWFA 2H2PC 4JANA 3RILA 4GI6A 4YXKH 1KXVC 5HHMB 1DJXA 2XA3A 5FWRA 3TT3H 1JYVA 5I1CL 2XG4B 3ESOA 5CP7A 4PTUA 4LPCA 3RVXD 2APSA 2OKMA 3IF1A 4RAUB 4OLUL 1KT2B 3M1BB 2H1PL 5HYJA 2VRQA 3W11C 1QHPA 2O6FA 2Y07H 4LGRB 4XOAA 4ZTPL 2WLYA 4YIQA 4YDVB 4DK3A 5FB8A 1D6VH 1U30A 1GGCH 3LNIA 2R1YA 3GMPB 3FQXB 3BE1H 5KOVC 1OP3H 2AXHA 1TSHA 1TZGH 3SDAA 4ODXB 1HI6A 4HUVA 2B5IC 3HMWL 3GKWH 3LDBC 4FFYL 1NKRA 2MH4A 4ABUA 2JJWA 3FAXA 4G71B 3MCLL 3NIGB 1QUNA 5EFIA 3N43B 2WCGA 4LSPL 3CN0A 4JG0L 3ZMRA 4L9LA 2JQAA 4KVNH 4KX8A 4ZK8A 3GIZL 2UY7A 1DSWA 2NTSP 3QXVA 4QLRA 3JV4B 3WELA 5ACLA 4LEOA 5F1IB 2F1EA 4JZOA 2UYLA 4HWUA 5I1DB 1DJHA 3P9MB 1DBMH 4NPYB 1F13A 4L8CA 4AEIL 3BDYL 4HV8B 2W9EL 1FI8C 1QFWH 4KNSA 4JM0A 5KYUA 4GINA 1DCEA 1H5BB 4XN7A 3L3DA 5JMRA 3EYVB 1HIML 5F72S 2DQIH 5DVOA 1EHNA 3P69A 4GKNA 4B7LA 3P9LB 4JO2L 4EOWH 1JD7A 1CBJA 2X0WA 4G8GE 5AKRA 3QORB 1GTFA 4EI6B 1MZYA 1HKLH 4XNXH 1JHTB 2DWYA 5EIVA 3V4LA 1A5FL 4EQ3A 4X7CC 2IGTA 5DI8A 1EQWA 1KELL 4LT7A 4X0NA 3K2UL 3ZDZF 2ROXA 3DRQA 3LKPB 5EZLA 4D8PA 5ID1B 3NP4A 2ICES 2J5LB 2CDFA 4WK2B 3RVXC 5FR3A 4ANUA 1OAZH 2P26A 2Z0BA 3STZA 5K59E 3U1SH 4OM0H 2B3RA 1I9JL 4QY8A 5DO8A 2ETWA 1OE1A 1YMMB 5LAXB 4ZMQA 3T4AC 4J2XA 2C1OB 2JTYA 4P2CG 1PG7L 1K4DB 1T1WA 3MDJA 3OBAA 4O02B 1AACA 5ECJE 4ZUTB 2NNXA 2NUPB 3GHBH 2BOCA 3ILEA 3ZE2E 1MRDL 1LNUA 4RFNC 1RH8A 4ZW6A 5IOPA 1B0GA 5CEXA 1QRNE 3CGTA 2HUHA 4M6NL 2DMKA 4W6YB 3V4PB 5C8JA 1PKQB 1SVZA 1ZHKA 5I0XA 4FZ8L 4ZFOA 1T1XB 5ESQA 1VDGA 3QUXD 5DZAA 2GBVA 3PXLA 3GBNH 5INDB 4U33A 3O6LL 1E27A 1THAA 4ETQB 4Z78A 1EBPA 2QT6A 1HHKA 1Z9LA 4HKJB 4AV5A 4FTDA 5EF3A 5SWZE 1SJVA 4TRPH 1BEYL 3QCVH 1A6WL 3QDAA 4J8RA 3BAEH 3E2HB 3VFPB 5HHOA 3CK0H 4GUPA 4ZZFA 3AUVA 2VZOA 5K9JH 5F7LB 2A4ZA 3DUUB 4Y5YB 1G1OA 5CEYB 1MHEA 5L4JA 3LZNA 3A6OA 4JFWA 4AIOA 4QLWA 5TE6H 1CI5A 4ATTA 1CQYA 3O3EB 4P2OD 4BFIB 3ROLA 3ZTJH 3Q13A 2MCAA 5A40E 4Z7NF 2RQ8A 1J8HB 3FF8A 3D4YA 2AVFA 3NCFB 2J55A 3EFOA 5DUMH 1SLXA 1QEXA 5H8DA 3FU7A 1UVQA 3BT2L 1AYOA 3J2PA 2YD7A 3LS4H 3AW5A 3QFJB 1D9KB 4L4VE 1KCKA 5J6HB 3N42B 3CFQA 4U2YA 1UWYA 4JFDD 3L2LA 3GGWA 4WKZA 1OAQH 4V1DE 4YL4A 3UOAB 3VYNA 1XH2A 2ESVD 2XBDA 1OAUL 2W95A 2XWJA 4ZUSB 2FB4H 3QUMB 5F6IC 1PY9A 2Z4TA 2FNBA 2VSDA 1BX2A 2FAUA 4MQ7A 3QUXC 5H94A 1DQMH 4FMFA 2OMUB 1UWGL 1TF4A 3DO4A 3HJEA 4G43B 4NQSB 3U4AA 6PAZA 1MAKA 2RB8A 4HK3N 5E9DE 3T3PE 5I24A 3DGDA 3OLGA 1OCZB 3IJSA 2VDOB 4Z18A 4QI3A 4XNBA 2KMWA 5C6WH 1G84A 3UAFA 4G11A 3HG1B 4G70B 5HHPB 2MMXA 4M5ZL 4QRPD 3IE4A 3ARTA 1CXLA 2ZPKH 2I24N 4M4PA 2NW2B 4PRBB 5EU4B 2KQMA 4D3CL 4M6AA 1CGUA 3T1FA 4AJ0A 3S0PA 2I69A 1JGVL 3O8XA 4N2FA 1UCBL 3HHSA 2A99A 1BVKA 1SBSL 4WHCA 3V0JA 5AOZA 2HLAA 4ODHH 1G0XA 4NO5B 4OT1L 4QRFA 1Q94A 3H42H 1MN4A 3QHZL 2D7MA 4IKNA 3E8UL 2Q7YA 3V0GA 4AIZA 2YWZA 4LARL 2VDNH 1A4AA 1CE6B 5EUOA 5DD0H 1R6VA 1MQKL 3B1UA 4P2OC 4Y4FB 2WMPA 2F5AL 4UT9A 4U1LA 2VWEE 1FNLA 5KSVA 4UBDD 1A6AA 1HL4A 1RSYA 4OJEH 3NA9L 1NFDE 2B5IB 2PR4H 3MNZB 3LDBB 3OC8A 4MRBA 1MHHA 4ZOCA 5BVJB 2YEZA 2VR9A 3VA2C 4XP9L 2A9CA 1OW0C 4DJMA 5A16B 4BH7A 1V7NH 3QARA 5KSAD 2Z31A 1IEBB 3UAJA 3VO0A 3QA3A 3FQNB 1R17A 3MKKA 4A6YH 3P4NB 4FG4A 1IEAA 2ZUUA 4R5XA 1LP9F 1A1OA 1YYML 2WNKA 1MOEA 3FUNA 4GI9A 3MRBB 4XCNA 3QQ3A 5TF1L 1N59A 2VL5A 5DJDA 3TZVB 1Q9WA 2PETA 3CVHA 5HSFA 4L1BA 1KPRB 1NGQL 1ZVSA 1JGLL 4HOMA 4FTVD 4XOCA 5GGUA 4JL2A 4DZ8B 5CINL 3UTPD 1EAQA 1RKRA 2G5UA 4X9FA 3PAVA 3QEHA 5ADOL 3X14A 3V0IA 1WQVT 3L1GA 2YRLA 1KIUA 2DQEL 2R4SH 4JNXA 4XXDA 2Y23A 3V7AE 4AEEA 2HRPH 5HI5D 1C08B 3WIFB 3K71A 4HUNB 1WFUA 1L3NA 3TBBA 3GINA 1OGTA 2XV2A 4UNTA 1ERNA 1KB9J 1GIGL 2DWEB 3U0WL 3RWCB 2O72A 2DIAA 4LKCB 2YUXA 4OQTH 4MNGE 1SFHA 2J1YA 1E6OL 4U1NB 1F02I 3AG2B 3RDJA 4HKZA 5JXAH 1KOAA 2TRHA 4FNTA 5HPOA 3OR6B 3PWPE 1KACB 4WUKH 4JCLA 3S3PA 2E7LC 4LCIH 1QZ1A 4M5YH 3ALWA 3IRCA 3TGXA 1JNJA 1P1ZA 1NC2A 4LU5L 5E1AB 3T4AB 3HZYA 3OZLA 4U2ZA 1QBML 5JQ6H 4KKZA 4UBDC 1ZT1A 1AKJA 1J1PH 5L6YH 1ORQB 5EC2A 1NCHA 3GUFA 3NFPA 3DTXA 1ONQB 3ZGHA 5DMKB 2WXPA 4KXAA 4G8FB 2HAZA 2UXVA 1NAMH 5E7FA 4RFNB 5F3BB 5GJSL 4LCUA 5BJTB 5KSAC 5DC4B 3J8F7 4I77H 5JPNA 3R0MA 5TQ0H 4A7VA 4ZYKA 4UOZA 4KDVA 4MD4B 4CBZA 1HK6A 3ZYOA 1H6FA 4NN6B 5HBBA 2EUVA 1QSFE 3DPDA 1NCOA 5I19L 4UT7H 1MIEH 4E9QA 1MNNA 3NCCB 3C09B 3JQOB 3X1NA 4B0MB 5KJ7E 4D7PA 3OB0K 4LKXA 4O51B 2CDGA 3L3HA 1KCRL 1R3LB 1YEHL 1XHHA 5E8EA 2E7CA 2JKNA 5HI5C 3HKZA 1RUAH 3SDCB 1J88A 2O26U 3IGAA 4I1NB 4WWKD 8PAZA 3PGFH 3H6JA 4NZFA 5E8DL 2NSMA 4M6OH 4LSSL 3MRMB 4H8QA 1P7BA 4OI7A 4R83A 1QRKA 2AABH 2MCG1 3VE0A 4RRPM 4Z8FH 4IMKA 5LDSA 4PB0L 4KMLB 3OXRA 4XHQA 5I8EA 2QEJA 2J88L 2AZAA 3U30B 1XXDC 4AZ8A 3ATBA 1QO3B 2ZCHL 3BJLA 1LQBC 3HE6D 4M3JA 2ADGB 1CTNA 1SEQH 1TENA 1IARB 3ATDA 1EV2E 4PAZA 3HHRB 1A4BA 4GG8A 1NJ9A 5F1NB 2CM6A 5FYKD 5IM7A 1N67A 2XX0A 1CLOH 3FJTA 4MWFB 1A22B 5LGHH 5GRVK 4W4NA 1ZSHA 5CJOH 3NZ8B 4IJTA 3FN9A 3REWA 5F6IB 5F71A 4HCRH 2XV0A 3SKMB 2F19L 3QUXB 4G7YH 1T0MB 4R90L 3B7UX 3ULUL 2P5PA 1IC5L 12E8L 3H7BA 4WU5B 4P5SA 4YHYC 5FYJE 3DWTA 3Q8AA 3SBWA 5JLZA 1QWUA 4F2EA 1IM3A 3EYSL 4NS0A 4IBTA 1RZIB 4KMTL 3K2KA 4PJEB 5CWSA 3L1EA 2HUEA 2HCZX 5PAZA 4O2FB 4WV1C 3SN6N 4IW4C 2JF1A 5ISZD 5B1BB 4ZO8A 5FV1L 4X8XA 1H0DB 1XCQA 4HJJL 2MSPA 5D1XE 3GUTA 3S8GB 1B2WL 5KANI 4CMHC 2BHFA 2X1WL 3RHWK 3RVTD 2X6CA 3CXDL 3F12B 1LMKA 4LPTA 4WWKC 3OKNA 4PJ5B 3QZWA 3BAIA 4K2UH 3FUDA 2LVCA 2CBPA 2VJ8A 3VCLB 3GK8H 2X53A 5IROD 2A4CA 2YXFA 4Z77A 2WVUA 3ARRA 4PBDA 4QTIH 4MB4A 3AZUA 4P2OB 2OMWB 4PRHA 3SDYL 1N6UA 5CBEB 1PX8A 2XVKA 3LN5B 5D55A 4ICXA 1KJMB 3IAPA 5IWLC 3BPCB 3ILQD 4FQIH 2UZIH 3MOBH 3HE6C 4NQUA 2BW4A 3MRKA 3VMOA 2AXWA 1D5IH 2HKHL 4MA8H 2QSCH 5J12C 3BZEA 1WFMA 3GSVA 3ZKQD 4ACPA 5ACZA 1DQQA 1RMFL 2B4CC 5IB3A 1HDMB 5D7LA 1I8AA 3AUWB 2UZXA 3UYRL 4WRLA 3CC1A 4WHYG 5CUSL 3EF7A 3VD2A 1G5AA 4OW6A 1IGJA 2EE0A 4AC2A 4X6BB 4M9PA 2ESVB 4B60A 4WTWA 1PNDA 2EEXA 1V05A 5DLLA 4M48L 3W2DL 4ZFOL 1X7QA 5HVHC 1ET5A 4FCHA 1FG9C 2DM3A 4OD1H 2NY6D 1T03H 4P9HL 43CAA 2PYED 4JZJC 5E6ID 2WLLB 2JI1A 3QR1A 1NCDL 4IEFB 4IRJB 4KNUA 3FB6B 2NXYD 5ICZB 4QUOA 3RY6C 2NR6D 5JMOC 4XNYL 3BJ91 4PWIA 1UM6H 4GG6F 1UB5A 2V2XB 4QRRD 4NRXA 3MXWL 4EVNB 1N2RB 5I8KL 4XAKD 4NWTL 5C08D 1DEEB 3LZPA 5FUZL 3RVTC 2CKBA 2ZX8A 3GMLB 2G2RA 3O2DA 3UH8A 4H88L 4CRPA 1A7OL 4W4OA 2P8PB 4IRSD 1OCCB 4Z95L 2V37A 3VTAA 5IROC 4NQCA 1PMYA 4D7BA 1I7ZB 2DD8L 4OR1A 3VI4F 4I87A 1EXUB 3D7PA 4IOIA 1UADC 5CZXD 3QG7H 4M56A 4PGDA 5BS0D 1L5GA 3IFPA 1Y07A 3GKZA 3ILQC 4QXUL 1J05B 3LH2H 3QH3A 5I5MA 2VLRD 4GRLD 5HDWA 4XNAA 3EOYG 2CBTA 3QAZC 3CE1A 3TVMD 1QHQA 3IU3B 5TH2B 4HVBA 3KDMB 2YLKA 4WW2F 4KKCD 2XXGA 1RK7A 3NSFA 3DXAE 5HGDA 3Q8EA 1EJFA 4HXBL 2BK8A 3EFDL 1JFHA 1MJ7H 5AB0A 2P8LA 3GZKA 5J6GB 3KPRD 2AQRA 2BDNL 3ZGIA 1G9NC 1WSST 3VD5A 3W1ZA 1F86A 1OCWL 3IETA 5D7SL 5DFWH 4LLUA 1L9OA 2PXYD 4KRNA 4MS6A 1EUUA 2NY6C 4H0GA 4JY4A 2A9NH 4EDXA 2JB6B 2R9HD 3S34L 1T20B 1VZGA 3B3BA 3PJSA 4H1LA 5E6IC 2Z34A 5DUJA 5H2BB 5IB1A 4K3EH 5BZWB 3QWRD 2NXYC 4AG4L 3EDEA 4XBEH 4URKA 2EDMA 2NR6C 3H55A 3JYBA 4I9WD 1JYXA 1O5PA 2VO8A 3WG7B 3EJUA 5DJ6B 2ZOKA 1RK1A 3FH5A 2R8SH 2ZUSA 3WDIA 3IPBA 3ME0A 1E6JL 4LGSB 2DW5A 4XH2A 1CYGA 1WV7T 4G5AA 5D2LE 5ESAB 1VGKA 1UWXK 3GHPA 1NMAH 3CZJA 3AGWA 1NLDH 1OB0A 2F53A 3PYCA 1GS6X 3GEWB 4IRSC 1MJ8H 1U8NA 2UZYA 5DUPL 2JCCE 2COVD 4MA3A 4AQEA 3CVIH 1R33A 5CZXC 1XGQA 2QSQA 5ITFA 4UT9L 5DRZB 1XV8A 3BGFC 5CCKL 1KJVB 3JWOH 2EH7L 2A73A 4TNWF 1BF5A 2FL5B 4JDVA 4AKOA 5JYLA 3V0AC 5C0AB 2BVEA 1NBVL 4GRLC 4XP6L 1OARH 4JBSA 2CQVA 4NCDA 3TVMC 2NPLX 3BYTA 4F7CB 1MF2H 3GSXA 4AYFA 2FSDA 2L3BA 5I30L 3UBGA 2RGSA 4KKCC 4PJ7F 4L1TA 1SLVA 1EO7A 2Z7YA 1LP9A 2HFEB 2V9TA 2VDMB 4F33B 3CFCL 3HI1A 4M8UA 1CLZL 3BH9A 2X4QA 4BEIA 2LV4A 5MHSD 4XN9A 1UHVA 3CVHL 3CSTA 3H9YA 2PXYC 3THML 4LVNC 1RIVL 4QOKE 5HJ3B 3J7HA 1JERA 5IBLD 2VXVH 1E5UI 2FUTA 2R9HC 1M2VB 5AVVB 1AHKA 4YZFE 5I15L 3CFTA 5E51A 2IWKA 4WV1B 3BUQA 2IPUG 1MWAA 1IE4A 1QFOA 5DR5L 4PD4K 4DKTA 5GRWA 2JIXD 2MEJB 3F85A 2QDVA 4OU3A 4XNQB 3NA4A 4CMHB 3K0YA 1NBYA 4LVHC 5KVDH 3BWSA 2VIRA 4L1SA 4DK5A 2G3NA 3OB0H 1ETB1 2CJ3A 3BAWA 1HXYB 1XF3B 2DAVA 3P3YA 3L4TA 2FK9A 1WCBA 4PRNB 1UG9A 2B59A 2L7JA 2OR8A 4Z0XA 1MHPH 4P2QE 2EE2A 4RGOH 5IVNA 2IPTL 4ZX6A 3A67L 4OGQC 5DEJA 3K6FA 3V9FA 2ZP0T 5L7XL 4N2IA 2XPGB 4M1GH 4ZUUB 3N85H 2NQ3A 5JW4M 3HE6B 2ZAGA 3EAKA 3Q6FB 4K94H 3HRZB 2G4EA 4I2XA 4JO1L 4HUXA 3C60D 1G7IB 2JKJA 4XWOD 5J12B 2VH5L 3BWUF 1FYTD 2CXKA 5A6IA 2B15A 2GC4C 5T1KA 3ZZSA 5IT2H 4GKZB 1D7BA 4LASH 2AEPH 4MJID 3FQUB 5C7XL 3S8WA 2YAEA 5CXPA 3HZ3A 4PJDB 1E67A 5I1HL 2IH1A 5C0RL 1CF1A 3DV6A 4N0YL 1NFIA 1ANUA 4JRFA 1SDAB 3MLXL 4RSVA 2YXMA 1WFIA 4FXLA 2EO7A 4GQRA 2VXQH 5E4OA 3FONB 4TTDD 1TCMA 1AY1H 1NOAA 3HB3B 3GPSA 4D0BA 1HHGB 4JZJB 1FH5L 3FU0A 4HWNA 1VEMA 3W81A 1XCTB 9PCYA 2WWOA 5IBLC 4BFEA 1AZBA 1SY6A 4ZSOA 5LBGA 3S5LG 2RQEA 5AZEH 3MJ8B 3SJVE 2WNXA 1WEJH 2C7UB 1QLEL 5G5DA 4Q74A 5AVZB 2BHUA 1II4E 1CS6A 3C2AL 5E6RB 5JUEH 5IHZA 4X42A 1UD2A 1Q90A 4OI9A 5CR8A 3AB0B 2CHDA 1G6RL 3POHA 3AG3B 2BVPB 3BH8A 2GYSA 5BOJA 3I6LD 1HXMB 3VXSE 1AHWC 5EV7A 1AI1H 3ZMNA 2I7SA 4A7UA 4PRIA 2H32A 3AC0A 4NM8H 1M2OA 2BIHA 4X4YA 5KEZA 4JRWA 5KSUA 3EUUA 1A9BA 1U8PB 3KPLB 4YNYB 3TV3L 4YSRA 5CEZD 4PWHA 3KCWA 1I9RH 3V0WH 5I1EL 5ALBL 3UJTH 2MCPH 3C5JA 1J5IA 5DQDL 4Z7VA 1B0IA 2W60B 4MD0A 1O75A 4X8GA 4AGOA 3C60C 4XWOC 2KT6A 2VB5A 2E9JA 5D7JA 3P54A 4P9MH 4YSAA 1GZPA 1KDIA 4JEGB 4FQHA 4IOSD 3MUY1 3WXVH 5KTEL 4H8PA 3G7TA 5FF6A 4AEHL 2ALAA 3EGXB 2ENQA 5GS3A 5KJRH 1I8KA 4RWYL 2ZAHA 2DI8A 4G7QB 5E6ZA 4PM1A 3QDMD 4XWGH 3FRUB 4ESKA 3FO2A 4Y19A 1P4UA 2NY6B 1MHCA 1FJ1A 2NNAA 4TTDC 1S4IA 2PYEB 1K5NB 5C0AE 4RRPA 5E6IB 1EHLH 2VN5A 4Y7MA 4MFHA 5M7QA 1OPGH 2NXYB 3UGEA 5L2KA 4X6EB 1Z0MA 3UBXB 3NCBB 4WI4A 2DLGA 1B4JH 1T04A 4KKRA 5ESVB 5L8LB 4QRRB 4PJXE 3BO8B 4MZIA 2FX8H 4FULA 3AS1A 2GJ6D 2QTEA 5GGQL 5C08B 3DROA 1RURL 4X5PA 3A4EA 3LHPL 5TE7H 3LPOA 1HCYA 1X9RA 3U7AA 2YOAA 1NMCB 3OPZH 3KWWB 3RKPA 2ZUTA 2N3JA 3D18B 2BVQB 4QAMB 4WUUE 5BRZD 5BS0B 3B9DA 3T08A 2JQZA 1ZLWK 2D7OA 2ZCKH 2WTRA 3EO0A 3EOTL 3Q7JA 5D2NE 5ITBL 5C9JA 1BQUA 4LL9A 3TBWA 3VDBA 2FZ3B 2DM4A 4LAQL 4UUJB 1FCGA 2VLRB 4GRLB 5DJ2B 4KY1H 1UM5H 3E1ZA 3EH5B 1KEGL 3VU2A 1I4FB 2WQXA 4JKKA 4O02H 3TVMB 1QRND 2O5XL 4D9RD 2C9SA 2B9AA 1YN7A 2VISB 3QE5A 4TVPD 2Y22A 2ZAIA 3BP5B 3WL9A 3GXNA 3Q5YA 2VXUH 3ZN6A 3LXUX 1OSPH 4DGYH 4ADIA 2AW2A 2BNRA 3E6HB 5DYOA 5E2TH 3AT8A 1IJNA 3LPWA 1G7JB 5D1QB 3V4PH 1SDDB 2X4RB 3S5ZA 1LEKA 4CMMB 1N5AA 4CVXA 1IC4H 2XETA 4ANXA 2A6KA 2QADD 4LVNB 3LZFH 3KJ6L 4RX4A 1TMQA 4EZLA 1BBDL 1BQ5A 1RUKL 2G5BA 1FNFA 5AOLA 2ZCZA 2VZVA 1ZHBA 4BHUA 1INDH 5F3HB 4GG6A 1JD9A 2HX9A 1S5IH 4WVRA 1MCOH 1MFEL 4Y5XC 4I3SL 1CE1L 1CICD 4OLYL 1FP5A 4K3JL 4LVHB 4R84A 1MWOA 1C7TA 1DVYA 3SKOA 4Z7IA 2VM4A 3KLSA 1CI3M 3AMLA 4XMXA 1CFNB 3TP4A 2WXOA 2V5SA 4L2LA 3UERA 2CKBL 1A6UH 5EH1A 4ADGA 3MGOB 4CVZA 3WDHA 3O2DL 5JORB 3VD1A 3D3VA 2YGOA 3DC0A 5GS2D 4K7PY 1Z6JT 1E8YA 2OXHB 4HIEA 1FHGA 1M7XA 4J12A 3S5YA 3SKNB 1UWXH 1MCLA 4PG9B 4XNMA 1SHWA 3FUEA 2BS9A 1I1AD 3N04A 1JNNH 4Z7UB 5EZIH 2VDLL 1TQBC 5FA4B 1KSRA 4OGYH 5JHDB 1IO4C 2K7QA 2XVLA 4WHYH 1TQTA 2BOBA 3BZ4B 5GGRB 1QW8A 1YRKA 5FUCC 2F8VA 5IKCA 3FBKA 1NLBL 2FCBA 1USZA 5AVTB 4F2MA 1PSKL 3CFDB 3PV6A 3H3PL 4JDTL 1BXXA 2B0SH 4AYBA 4HFUL 1IFRA 2CA4A 4UTAA 3RP1A 1OWRM 3QIWD 4DCQA 2WXRA 4JW3A 2E27H 2W9LA 3L3GA 3VQLA 4HKXA 4YDNA 3TLRA 3QUMH 1AGDA 4HF5L 4KJQD 4OM1L 1JL8A 5E94A 1KCBA 3EO9L 1F11B 1FLRH 3LKQA 1BD2D 1OF0A 4U1SA 4FI6A 5K33A 1R3JA 4XPHL 3VFNB 2QADC 5FGCB 1Q8MA 3TIEB 2AJXL 1JF6A 4PV1C 3QWOA 3A21A 3U9UA 1FGNL 4X99B 5DURD 1JV2B 1Z3GL 1GMIA 4YLBA 2VDOH 4JX0A 2IGFL 4N6RA 1I3VA 1AS6A 4L3EA 3D08A 3BP6A 1UXWB 4G83A 1UH2A 2DLHA 3LKOB 3DYMA 4EIUA 1ZSDA 3FMGL 3MHZA 3P0VH 2Y5EA 1I31A 3DOSA 3G04B 2AANA 2JIXB 4Z3HA 1CICC 1OHZA 4U6YA 3SYCA 3BVVA 4PRPD 3V6FA 3QQ9D 3VXMA 4S1SH 3MUJA 4MCZA 3F84A 1PIFA 1VADA 5M95B 2PLTA 2HTKD 2I5YH 1QUPA 2YWYA 3ARQA 2VGLM 4RMVA 3T1WA 1F3DJ 4RAVB 4A63A 1AHWB 1U8CB 4KQ3L 5L88H 2LE9A 4JMNA 4ZPVA 4PLNC 1FO0A 3O9WD 4PSPA 1WTLA 1IL1A 5CJQL 4CUCA 1OD9A 3DRTB 4AVHA 1I1AC 4NJ9H 4MQTB 2XWTB 2OZ4H 4LIQE 4HS6B 5DVPA 2OM5A 1DN0A 2FBRA 1DSFH 3M7FB 4C56B 4WFGE 5HDBB 3UTQA 1UZ8A 4X7DC 3PWJB 1NIEA 1BMWA 1P5VA 3K81A 3C60B 3A23A 4B9CA 1OK8A 4FQPA 2AERT 1FYTB 3X13A 2WQUA 3KBPA 1NCBL 4CW1B 4MZ3A 2NY7H 4BQ9A 2J43A 1KJ2A 1HNFA 4MJIB 3SGJA 5SWSA 3AQXA 1KN4H 1LO3H 3QO0A 3GBDA 4C4UA 3QIWC 1IC7L 1RUMH 1S7VA 2O93L 3IDXL 5FFOA 1AS7A 1X7SA 3QP3A 5F0JB 1XGTA 4Q9RH 1QBLH 3KYAA 2GJZA 4KJQC 3VGGA 3BQUA 5JA8B 4PJAB 2R56H 3TU6A 5JQIB 1OGAE 5IF0B 3CFMA 2EDTA 3HE7D 4OTXH 8FABB 5JOPE 4J28A 4UB0H 2H47C 1DP0A 1MXDA 4HAKA 2NX5A 5AG9A 4L3CB 4LQFH 4UT6H 1VHPA 1BZ9B 1HHIA 2GAZA 4WFED 1KCUL 2L7QA 3MV9E 4J3WA 1M53A 3SEPA 1A1NB 5DWUL 1AC6A 5HPMB 1LM8V 2W80C 4E9YA 3NDYE 4W6XB 3F7VA 1KCSH 3KPSA 4MA1C 4L4TE 1TO4A 2VLJB 2AQNA 2A5UA 3QB7C 3PHQA 4Z7AA 4Z0BH 4LE8A 2ZX5A 2ZCLH 5T3ZD 4NHCL 1PEWA 1Y6NR 2DBLL 1D7FA 1OT4A 3QQ9C 4W9FC 4F9LC 2CH8A 4BA8A 4PYHA 4KQ4H 3MBXH 4AQ1A 1DBKL 2V5YA 2HTKC 2NY2B 5T5FH 4KUZH 1WH0A 1ZLSL 4ORGB 5JDSA 2KL6A 1IKOP 3FTWA 3O0RH 3ULSA 2AQ1A 1X5GA 1OZTG 4BH8A 1ZLUK 2WB7A 3O9WC 3AY4C 2F54E 2XTJD 3DSNA 1SXBA 3SQOL 1LK2A 3QJTB 2Z91B 3O41A 3AWGA 1IGIH 3QULA 2ZWYA 1EJOL 1OAXH 3PWVB 4NQED 1WISA 4RNRA 4FD0A 5MEPB 4F92B 1DJGA 2R2EA 1D6EA 3UO1H 2PR9A 1DO6A 3MNMA 4WSKA 3VFVA 4IBWA 2R1WB 3UZVB 1Y7VA 1BGXL 2D2CC 4MD5A 1JG9A 4Z5RA 4WNQB 4LRIA 2WIIB 3U7WH 1U93A 5D8JL 3N44F 1CB4A 4PWGA 5GSVB 5C0BD 3MO1A 4B96A 1JVOA 3H0TB 4DP7X 2JJTA 5FO7B 4LDOB 2P7TA 3QDMB 4U7KA 2OFQA