3M7FB

Crystal structure of the nedd4 c2/grb10 sh2 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
176
structure length
135
Chain Sequence
ELHNDDTRVVRVKVIAGIGLAILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENDDFLGQVDVPLYPLPTEPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPTHLPHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 10
publication title Structural Basis for the Interaction between the Growth Factor-binding Protein GRB10 and the E3 Ubiquitin Ligase NEDD4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/ligase
total genus 25
structure length 135
sequence length 176
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3m7fB00
2Q0ZX 1DQVA 2Q3XA 3L16A 4LDCA 1RSYA 3ENEA 4QJ4B 5G55A 3RDJA 1YRKA 3OAWA 4PS7A 1A25A 1DSYA 1QASA 2K8MA 3R7QA 4KZ0A 1DJWA 2WXKA 3L13A 3P2BA 1E8XA 2WXOA 4A55A 4FADA 4EZLA 2WXMA 4FJYA 1RH8A 5T8IA 1E7UA 4OVUA 1WFMA 1WFJA 1DJYA 2YOAA 1E8WA 4V11A 4HLEA 2ENQA 3CSTA 3PS6A 4L1BA 5H4YA 2ISDA 2NSQA 4NP9A 3HHMA 4TS6A 2WXLA 4G11A 2CHDA 4TV3A 4WWOA 2RD0A 4XE0A 5H4ZA 1TJMA 1CJYA 4KZCA 1E90A 4BFRA 4KITB 4MJJA 4QJ5B 4WWNA 4Y1SA 1BDYA 2QZQA 4GNKB 3W56A 3KWUA 3APCA 3PRZA 3TJPA 5CCGE 3QK0A 4IQHA 4JPSA 4WEEA 3IM1A 2YRBA 2ENJA 2WXQA 1K5WA 1UOVA 5EDSA 4ANXA 3NSJA 2K4AA 2A4ZA 3DBSA 2X38A 3MJWA 3ZW3A 2QZ5A 2K45A 4F93B 4LT7A 4NPKA 4Y1TA 2DMGA 1HE8A 2FJUB 3L17A 4L1LA 2WXGA 2CHXA 4IHBA 2WXIA 5CCJA 1DJHA 2FK9A 2R83A 2WXNA 3NZUA 3PYCA 2KI6A 1BCIA 2WXPA 4HVBA 1RLWA 1W15A 5KJ7E 1W16A 4OVVA 4FULA 2Z0UA 3APFA 3TWYA 2B3RA 4ICXA 1E8ZA 2CHWA 4ICWA 4NS0A 4LCVA 4XZ4A 2DMHA 3F04A 3CSFA 2WXJA 4AOFA 1E7VA 4QJ3B 2WXRA 3GPEA 3QJZA 1UOWA 5JHBA 2BWQA 2JQZA 3TL5A 4QAMB 4FHKA 2UZPA 3F00A 1V27A 1DJZA 2NQ3A 3FDWA 3L9BA 3L08A 4F92B 1TJXA 3M7FB 4BGDA 2CJTA 2D8KA 3R7RA 4DK5A 3L54A 3N5AA 5CCHE 2V4LA 3QR1A 4ANUA 4L23A 4FA6A 1DJXA 1GMIA 3KWTA 3S2AA 3QARA 4FLHA 2ENPA 2CM6A 1QATA 3JZYA 2K3HA 3L4CA 3QR0A 3DPDA 4EZJA 4URKA 4GB9A 2EP6A 4AJWA 2ZKMX 3ML9A 3HIZA 3ZIMA 1UGKA 4FHJA 3T8MA 4ANVA 3IBEA 3FBKA 3RPBA 3HN8A 2NCEA 2WXHA 1DJGA 3PFQA 4EZKA 2CJSA 4TUUA 3APDA 4ANWA 3PREA 3ML8A 3NZSA 5JHAA 3B7YA 2N1TE 4FJZA 1BYNA 4WAFA 4WWPA 4L2YA 3ZVVA 3F01A 3OHMB 4DNLA 4F91B 2WXFA 4PS8A 3W57A 3F05A 3QAQA 4J6IA 5G2NA 2CM5A 2CHZA 4F1SA 4XX5A 4PS3A 1DJIA 4NPJA 1E8YA 3SD5A 3LJ3A 2A5UA 2Y3AA 2LHAA
chains in the Genus database with same CATH superfamily
1NUGA 4WEBH 3REWA 5DHEA 2R23A 5SX4H 4WI7A 2ICEB 4YHML 3MTRA 5CGBA 1ZANL 1UXSB 4KRPC 4KJYB 1BZ7A 3FQNB 1W91A 4F9LA 4Q9RL 2Y2WA 3RDTB 1MFDH 5FLVA 4Q9QH 4PJCB 1T7WA 5I1CL 2MQGA 3FN0H 4MWFB 4OF7A 4CBZA 1DQDH 2NLJA 1A7NH 5FGSA 1OF2B 5A3IC 2IADA 1BXVA 2HKFL 4APXA 3BSZL 2CXGA 4FD0A 4XMZA 1KIUA 3MBXL 4EIZC 3I9IA 4DW2H 4ZMQA 4DPCX 3L4WA 1TQTA 1QKZH 3V0EA 4KMLB 1CGSH 4M48L 4NN7B 3RY6A 2H6OA 2ZUTA 3U6RB 5D5MA 3T0BA 1M7XA 4YXLH 5KYXA 1E4WL 4NQDD 2MCPL 1J8RA 2GJ6D 3Q1EA 2VR7A 5IOKA 3OXRA 5LBSA 4ZMYA 4M1DL 3RWEA 2YA2A 2G9HB 1XSJA 1ZVHA 1CS6A 1FFQA 3WY2A 1HH6B 4GS7C 2B1HH 1PLCA 4AV0A 3C5JB 4U6XB 4KKLC 4PWIA 5CJXC 3MRGB 1FZJA 4LVOC 1ORQA 1J8HE 4K3EH 2P7TB 3L3JA 1KPUB 2AV1B 2QVFB 3VI3F 2P5EB 2FJGB 3EXLA 3SDAB 5I16A 4FCHA 4I1NB 4IJTA 5E9DE 3WKQA 2PWHA 4FFYL 1V7ML 4F7CB 2EYRB 4D9RD 4DKEL 2IPUK 4JFFA 4WO4B 3WU1A 5DMJB 1JK9B 4YSAA 1P84J 4FG2A 1DQKA 1AZNA 1MCFA 1LMIA 3ZHLA 1MWAL 1M71B 3BHBB 3BXNA 4M7LL 1V54B 5I8EB 1VFUA 1A6VL 3X1EA 1JF5A 2ZG1A 1JPST 5J06A 2CM6A 1CLYH 2DH2A 5TPWL 4IOFC 1XO8A 1MFCL 3ZT5A 4IRSA 4FI6A 4BK5C 5DJDB 1K5NA 2Q7AA 1OCZB 2H32B 4F7KA 3HG1A 2YUWA 2DWEB 5IMKA 1GHFH 3P3YA 1INDH 3D39D 2WOBA 1SOKA 3FQRB 1GGIL 1WPCA 4LCIL 4X5WB 4FKEA 1FNHA 3RG1C 5C6WH 1OCCB 3OHMB 2Z31A 2X1QA 2X5PA 1OL0A 5D4IA 3IFOB 1KOAA 2R69L 1LEKB 3FT9A 3MLVH 3OKEB 5LGJA 2BX5A 5F2FA 1EO8L 1MFBH 1JWSA 1T22A 1VGKB 4OKVA 4WGVB 4U7MA 4R5TA 5I6LA 1VHPA 2CLZB 5CP7B 3O9WA 1F00I 5L2JB 3SKJL 2AQPA 1OSEA 1EANA 1P4BH 2OL3H 3L7EB 1WH0A 1QNIA 4GAYB 4HFUH 4PS7A 1OT4A 4C83B 1AGCB 1F4YH 1MHPH 1DN0B 4TLSA 3ARYA 1KT2A 3QH3B 5DQJB 3EGDB 5EUOF 5A2IH 3N42F 1CK0H 5KYUA 1BSIA 1E6OL 3VI3A 3KNBB 1P9MC 1PCXA 5JHMA 5ADPL 4HWEH 3VM5A 3EYOA 5EC1A 1P4LA 3TLRA 4N68A 5JOEA 1IGYA 2XWTB 5DHXB 3O6KL 1MRFH 3LKNB 1NJ9A 4W9LC 1FCCA 5IY5B 2I24N 3DYMA 2JB5H 2YAFA 4MCNA 4GFXA 1U3HB 1DQTA 4ELKA 1GL4B 3DUSB 4I0PB 4HS3A 1TJGL 2V5RA 4FTVE 5AVRB 5DSCA 1MW2A 5FW7A 3QNYB 3DK2A 4WI6A 3TBVA 2ZXWB 2Q1EA 4J6RL 4ODTH 5F8QC 3L3KA 1XWVA 1LL1A 4GPVA 2GBUA 2X70B 2R4SH 4G59C 3BGMB 4GBXC 4GQZA 3S4SA 3UTOA 1LK3L 1N6QH 3HJEA 3W9EA 2AQTA 2AP2A 1QSFA 1PLGH 2RMNA 5CGTA 3AABA 1HXYA 1RQ5A 2WXIA 1GGCH 1MCHA 3OKLB 4PQXA 1S7TB 1N4XL 4XHQA 5ISZB 1OIOA 1DE4A 4LZKA 3O0RL 1A2YB 3HLAB 5E8PA 3AG1B 4UUJB 2Q86B 2GYSA 4HPYH 2KQNA 1Z9MA 2UZPA 4Y5XB 4L4JA 2YBGA 3EBHA 25C8H 5D5ME 4MYPA 3D6GA 5DU7A 3S36L 1XGRA 4GRLA 3C5ZD 5BW7A 2FWUA 15C8L 1QRND 5EUOA 3NJGA 1A7RL 4ZUVA 2AXJA 4FA6A 2ZOLB 4IS6A 2NY4C 1FIEA 1T1YB 1VGEL 1QSZA 3CTTA 3FUIA 3EAKA 1I9RL 1TQWA 2R39A 4G8EB 1ASQA 3VQMA 4CN4A 3EGXA 1Q90A 5JIQA 1DJGA 3V0AC 3FT3A 2OK0H 2BY2A 4QYOB 3ROOA 4Z5RB 5K9KB 3VRLE 3L8QA 1KACB 3X14B 4Z7OB 4DERA 1T7VA 5JOFB 4JG1H 4ZXBC 4LARL 4R0LB 2TRHA 2GY5A 2ZCHL 4JFFE 3KLKA 2CHZA 2QGEA 4NN6B 4ZPVA 4WU5B 1OB1B 4XNQA 1KB5L 1ECYA 3JZ7A 3WIHL 4HCIA 3ZRSA 3H2PA 4N6RB 5E2UL 3ZY7A 1A22B 2JE8A 2NXYC 1JHKL 2ZOKB 3QDJB 5HHOA 3N40P 3OG6B 3CHSA 4LEOB 5EBMB 1IL1B 4EPSA 1UD3A 1NAKH 2VRAA 4YWGL 1BAWA 1REIA 3NCEB 1AO7D 1PKQB 2CZNA 3HG1E 5KSUA 1ZT7B 4HHAB 3ZKND 2X4QB 2BDNH 1UD8A 3OKOB 1ZPLA 2Q20A 7PCYA 2GBVA 2MPVA 3IJ7A 4UT6H 3SDXF 1LWJA 1RIHH 3KL5A 1GGTA 2DLEA 3HBQA 4K71B 3HS0B 4QAWA 3RWCA 2BVEA 3W5MA 2PYED 4I87A 5H4ZA 1AKJA 2CO2A 1CXKA 3GUTA 5IQLA 4HOZA 2OMYA 4PV9A 3F8UB 1WFOA 1JZ7A 3IN2A 4Y9CA 1F2XK 4WW2C 3NK3A 4XVSH 3MR9B 1T7XA 4JO3H 4KO6A 5D6CB 4PLJC 5KG9B 1KJ3H 2FX9L 4PH8A 3KWXA 2WJ7A 1P6FA 5FO7A 5DC0A 1TQCB 1GYVA 2WINB 5GGRY 5TQ2H 3STLB 2IPTL 1T03H 5HDBB 5HYJE 4JR9L 3VI3E 2FK9A 5DGRA 4TSCH 1U2HA 3UTZB 1OTSD 2F5BL 1GKOA 3TO4D 1UA7A 2P8MA 4HWZB 1QFWM 1ZOXA 4OVVA 1W72H 4K23L 1F6LL 5MI0C 1ZA6A 3BW9B 1UVQB 2NNCA 4NLHA 5KS9F 3CSFA 3ZT7A 1DVXA 3IDYC 1SM3H 5IR1A 5FYLE 5ICUA 2HT3C 3HN5A 2DQIL 1U2YA 1FVEB 2JIXD 3X3GL 2NUPB 4N9GB 4UM8A 3QBTB 2TAAA 4N25A 3FCTA 3PXHA 4MXVF 3VXOB 4YEFA 3VXSB 2FWOA 2PR4L 3MODH 4FYQA 3OC8A 4JFDA 4XNYH 5LVEA 3JTTB 1GMIA 3BEWA 1BOGA 1DR9A 3ABKB 4LQ1A 5EEXA 5DEGB 4I3GA 3UTTB 4OGXL 8PAZA 5D1XD 1QSFE 1N18A 3QJTB 4H8UA 4DWHA 1QWNA 3SDXA 3QG7H 1X5AA 1NGZA 2NCEA 5CLXA 3RWJB 3IMVA 2VMCA 3IGLA 4Z3EA 1NSNL 4TVPE 5KVEH 3EO0A 4A7VA 1R3KA 2NY6B 1MXGA 1U8QB 1JPTH 4G7YH 3LRSB 1HKLH 3K6OA 3LH2L 1A6WL 1G7HB 4ODSH 5J1AA 4F91B 3BIBX 4Q14A 4YBLB 4HS6B 4N1HB 1BVNP 2W65A 3CH1B 4AZ8B 5DS1A 4PS3A 1BIHA 2XIIA 5I0VA 2E27H 2J1KA 3U30B 5IEHB 3QXAB 4A2HA 3P4MB 2PW2B 1DQVA 4HUMB 2DYPD 1ZTXL 5BOPA 3AM8C 3QA3A 2VLME 4TQPA 5JIHA 3B5HA 4K55A 1BZOA 3GJFB 4IGBD 2H3NB 5HI5D 4R4FL 5C7ZA 5BUPA 4XR8C 3BP7A 5KN5A 1Z0NA 2VDQL 4UNIA 4KVPA 1S3KH 2XQYK 4YDJB 2K9UA 2ENSA 9CGTA 5KS9A 2OR7A 5E2TH 4I0CC 5E5RB 2XA3A 1G6RA 3CC5B 1E43A 4WFHE 4WV1B 4RCAA 1FV1B 5D9SB 3CFUA 3ATEA 3I6KA 4QJ5B 2BFVH 1CGTA 1K8DA 2RCSH 3ECWA 1TTUA 5GRWA 2ARJA 2FSDA 5PAZA 4BYHA 3RVTD 3H9HB 3FTVA 4L9LB 2FE0A 5F0MB 1WA2X 1XF3B 4IDJL 4KWUA 1D9KA 4X99B 2VDLH 1EJFA 2ZUQC 1WGOA 4PIRF 3LKSA 5HHOE 3V4VA 3WEXB 1VA9A 2GUYA 3N41F 3MJWA 4L3CA 1IQDB 3ZXAC 3DA0A 2Z8RA 1PZCA 5IB3B 4P46B 5BO1L 4FS0A 2DTSA 2GT9A 3OX8B 5DJ6B 4OBRA 1QX1A 1E3FA 4LIQL 1DVFB 4Z7VB 3SDDA 3WGUB 2Z1PA 1KZQA 4WIQA 1ECZA 2EE6A 4G9DB 1WIPA 5IB5B 2PMZA 5JNYB 1OAUL 5D7JA 3FB7B 3CFCH 3Q1SH 2AK4B 2RBLA 3WIIH 4HJGB 3LKPB 1SF3A 2PXYA 3ULSA 5C0BA 2XHNA 4Y4KB 4ADIA 1GCYA 3WXWL 5I6MA 2BVQA 2IIJA 5MENA 2C9XA 3WDHA 3GMRA 4U2ZA 4L3EA 4ANUA 2OI9C 4BEIA 1IBDA 3VH8A 1ZVSB 5E51A 4B3VA 5MERA 2VDNH 1TIUA 2DH3A 4U1HA 3WN5C 4BBWA 1KJ2L 1KB5B 3QJFB 4JM2F 1U8LA 1XAUA 3BGFB 3RRQA 1HWGB 2WLIB 2OX5B 3OD3A 4AVKA 4AXWB 2EDJA 2V7NB 1EZLA 2QDWA 2BVOB 2YN3A 1N5AB 3FNKA 4WTQA 5E2VH 3TASA 3U7WH 4FJZA 2E46A 5E08L 3ZL1A 2OSWA 1LM8V 1RZGA 4HG4K 1AKPA 3EJYD 2DQGH 4C58B 3HNTH 1BFTA 2BC4B 2IOMA 3N43F 3D07A 4R97B 1AZZC 1HQRB 3CVHH 3ZUCA 4HUVB 1KIRB 1Q0XH 2IOIA 2VQ1B 3IJSB 5AVZB 3FOLA 3PDGA 2CO7B 1GZPA 1U8HA 2XKUA 4BZ2H 4B9IA 4JFDE 2YGNA 1CFSA 1F2QA 3ENEA 4HLZG 3ZDXB 1YG9A 3GSXB 3MRCA 4U1NA 1DUZB 4AEFA 1DSYA 5HYIA 2BVPA 2P26A 4P5MB 4MNGB 4NRXA 1ITBB 2H9GB 5DHYA 3WS6A 2J72A 3SDXE 3MLTA 3TBSB 2WBWB 1HINH 2HLAA 3TH3T 1MHEB 1MHCA 1S5HA 4HLZH 5INDA 2IQ9L 2IFFH 3N9GH 3S7GA 3HZKB 3NCMA 5LN4A 3G7TA 3RIFK 2X4RA 4WTWA 1JPSL 4MBRA 3LRMA 4FXLA 2D3NA 2GVYA 2KZWA 3FO1A 2XWXA 3JXAA 2GFBA 5BVPH 3MOAL 3CVDA 5G5DB 3TT3H 4JRYA 3QXWA 3U2JA 2PCFB 3KD4A 4YDZA 3RP1A 3CU7A 5FKPA 2VM3A 5GGSY 3C5ZC 3MC0A 4OQTA 4EI6B 4R3SB 1BD2E 1DBJL 3DDGA 3O6LL 4OCSL 2JI1A 3FMGH 1KCRL 3GHBL 4JM2A 4QXTA 5C6TL 4HYTB 4PJ5D 3V5KA 4YDMA 3PGDA 3PHAA 4OJDH 4N8PA 1FLRL 2EYSA 1NOLA 1X9QA 3T0EA 2PWGA 1X7SA 4GEJA 3QWOA 4PPTA 1HILA 5E1HB 1IFHH 4O02B 3VTTA 1AS7A 2BVTA 3IDXH 3OPZL 3QO1A 4P4KD 5DUPH 1BCIA 4IBQA 5HDOA 5E1AA 3G5YB 3FOMB 5H8DA 3V6ZA 1TTCA 3VU1A 5EC2B 3TF7C 5SX5K 2G30A 5C3IA 4HLEA 2LOEA 5I24A 2FIRT 3GQFA 4LPXA 3VG9B 4MXVE 1GC1C 2KBGA 3UZEA 1PZ2A 2XTSA 4JFXB 3IU4H 1R34A 2O1AA 1Q94B 2FVNA 2K0RA 3IFNH 4IU2B 5E9AA 5I1IH 4LDOB 1A9VA 2OTWB 4NZ8A 3DVIA 5D70H 1B9ZA 2WLLA 5IUSA 1P6AB 2C34A 1NM4A 2MIZA 4FQQB 3DJRA 4FQIH 1AHWA 4XB7A 2F53A 2I7SA 3GRWH 5CCKL 4NRZA 1XSOA 2ZIDA 1BQLH 2XNAB 3G6JF 3ZKNC 2HZHA 3TEUA 1WHPA 2JFCA 5IGXL 1UEYA 4NO0B 3IDJB 3A67H 3A6CL 2KERA 4PHXA 2IXQB 4I5BA 1U95B 3ZPDA 1MREH 2VC2L 5L88L 5KEZA 4N5UA 1AC0A 4FERA 2JK5B 5DD3L 1ZLWK 2NY5C 1HS6A 4JY5H 3MDJA 4WF7A 3BPOC 5C0BE 3BSHA 2J6WA 4K7FA 3W9DA 5TDOB 2XQBL 3EYUL 4TNWK 5K39B 5MENE 1UB5A 3MLXH 4GW4A 4L3EE 1DCEA 4PRHD 2CO1A 1MW3A 2AK1H 2DB8A 1GS7A 4P5KB 4TTDD 3L6FB 4E2OA 3QQ4A 3CPUA 3RTLA 2W59A 1M42A 4NCC1 2AS5M 1USQA 1VZGA 3MROA 2WBJB 3V6FA 1UASA 3BSZA 2VXSH 5JW3H 4JFUA 5I23A 1OTSC 3S35L 3TO4C 4PB0L 1YA5A 2HJLB 1EEUA 2ZYRA 1I3UA 3RTQB 2D0FA 2V17H 3KPNA 4FFZH 1S46A 3IAQA 4MS6A 4GIOA 3M6DA 1K72A 3A23A 2OW7A 3KH4A 4ONFL 4D0DA 1KPVB 1T2XA 1VAHA 1Z9NA 4DJMA 3KWUA 3C8KA 1FFPA 3F7KA 1F45A 5DRXA 1EO5A 1RZQA 3GSQA 2H0PA 3QIWB 5EULV 3N85H 1BYOA 4ANXA 3MLWL 3CFEB 1D7BA 3PWPE 1S7QA 3G6JA 4N0YL 3QYMA 5GIRB 4D0CB 3BIAX 1U8CB 4GY4A 3BUIA 5D1XC 5EU3A 3T9WA 1MW0A 5DUBB 5FKAB 2YHGA 1W0WB 4U1KB 1JV5B 3SY6A 5AZEL 1QFOA 3DSNA 4TNEA 5EWIH 5I0WA 1U8OB 3H3KA 2OQJB 3HI6L 3MACL 2V0AA 4F9PA 4FFYA 1O0VA 3LAFA 3FUEA 2BS9A 4YLCA 4K4KA 5AVSB 2A6KB 4XBEH 2ZT9C 4OI9A 2EXYD 3PWNB 3MLSH 4JRYE 4MJIA 1RZKC 1MWAA 5TDNA 5ECGA 3DGDA 2CRMA 3H2WA 3D0LB 3DUHA 3CDCA 1BQ5A 1VACA 2W5PA 3VI4F 3NIDF 3HPJA 1S7UA 2LFEA 2AMGA 2EO7A 4PJ8B 1BQHA 5I15L 4PREA 4IGBC 5HI5C 5JQ6L 1IC0A 3T0EE 4DGIH 2LTQC 1FHNA 5B1BB 4QNPF 5C71A 2XWDA 1EVTC 6PCYA 2DQEH 3RA7H 1YEEH 4CC4A 4YGVB 1N0XL 2G9KA 2PTUA 1SJEB 4NKOB 5B39B 1S9WA 5DJ8A 3CSBA 3BEVB 4ODXB 4Q6IC 3V0VA 3KZ8A 2VRQA 4IBTA 3WXVH 3TH4T 2YPVH 4OAWA 4E9YA 3HG5A 4XBPA 5HI3D 4K0OA 4MBOA 3BVNA 4X8JB 2YAPA 4XNBA 2CNYA 5IWLC 4NZTL 3QPXL 2JJVA 2P44B 1DBKL 4XP5L 1RZFL 2X09A 3OKDB 1PZDA 3HE6B 1RK1B 3RVTC 2VUOA 4JAMA 2ZE0A 3ZHNA 2C9VA 4HUXA 4AWJC 3QAZC 3ZYZA 3FSWA 4F7TA 3SPJA 4PV8B 2B39A 4ZDHB 4OIAA 2F53E 4XMKL 3LN5B 1AGDB 1JGDA 1LK2B 1KN2L 3RVXC 2XZAH 5KVFL 1UJ3B 3QULA 5A16A 1AJ7L 1EEYA 3W0WD 4UIMA 3H7BA 1K4DB 3MA9L 5F7UA 2XN1A 2AJUL 5LGYA 1I7UA 3UBGA 3EOBA 4HEMA 2EDBA 4L8SB 4E5XG 3KPRB 4Y2LA 3B2DC 3VFSA 4TUKH 3C60D 3QZMA 2IQAB 4DHLA 2Z8SA 2V33A 1CXFA 3RURA 1NCBH 1NMBH 3GSNB 1FNAA 3OB0K 3BDBA 5ANME 4PSPA 3CE1A 2YKKA 5F6HI 5I71C 2NXZB 2FX7H 5GS2D 5FOJA 1H5BB 3JTSB 3RVUD 4M8VA 1FN4A 5HTSA 1DVSA 3T3PF 5JW5B 1XCWA 3CPLA 5T3XL 4EUPG 1GOGA 3P4NB 4Q4EA 3X3FL 5F89A 1QA9A 3SE9H 4Z76A 4EDWL 5LDSA 4ICXA 1VERA 3ABLB 1U8KA 3ASOB 3PLYA 3NZ8B 4RNRA 1HCZA 2JKWA 1KULA 2X3AA 1N2RB 4XMLL 2DLFH 4L5FE 2HX7A 4MA8L 2UZXA 4JPQA 3VXRD 4DP1X 4EUPH 1PPIA 1OAXH 4F92B 1IRAY 5JO5A 3N5AA 3P2TA 4AX3A 1UURA 3QEQD 1DJXA 4R7DA 3G6JE 2GJZB 4AL8C 2DLTA 4MJ6A 1A8ZA 5AW5B 3PG2A 3OMZA 3S3JA 1DEDA 3D0VA 1HHJB 2F5AL 3QUXA 3LHPL 5T5FH 3HCVB 2W80C 3MXWH 5LQBH 1JWMA 4W9CC 3RGHA 4TPRL 2WUBH 3HS9A 2C9RA 4LCUB 4QOKD 4X0KA 1SLVA 1JD7A 5TE7L 1R9FA 3KPOA 1BYNA 1ZT1A 1DYZA 1GYWA 2AJ3A 4M5ZL 4OCXH 1MXDA 4S1SL 3B2PA 4B9CA 3RJOA 1X4YA 4EIBA 3NIFF 4S11A 4MJIE 3RAJL 4GIPD 3WE6A 3VA2C 2H1PH 4RAVB 4KTDH 5FYKL 2GEEA 3U2IA 3DHUA 5I5JA 1A7QH 2LGNA 2Z7WA 4GKOA 2OTPA 2R1WB 1NLDH 2I25N 4OZHB 1FJ1B 2UVEA 3LEXA 3UMTA 3LD8C 3ARUA 3B8YA 3E38A 2I9LB 5LAPA 4DN4L 5CIPH 1ML0A 2Z9TA 1J8KA 1F6FB 2Q6WB 4N3UA 2Y72A 2HVJB 4LFHG 4Y16D 3RE0A 2VXTL 4HSAC 2FYYB 2Y7NA 3MRHA 1MDTA 3EJTA 1HNYA 2H8PB 3EJJX 2GAZB 2VN3A 4M7JH 4P2AA 2DQDH 2HYMA 4BHUA 3ZQWA 5DVKA 3DMMD 3DV4A 3QYNA 1K5WA 2KHAA 1JGEA 5D55A 4G43A 4ELMB 4F8OA 2C1OA 1R4XA 5J6SA 2E9JA 2J3SA 2K45A 3DX8B 1F97A 1C7TA 5JQIB 3BKJH 1C8PA 1FYTA 3D08A 2VE6B 1BZ7B 2AXGA 4FP8H 2F2HA 5I0ZA 1FGVL 2ALAA 4QKTA 1XF5B 2Y36L 3NJVA 1T0MB 4NC1C 4YSTA 2MTPA 1PG7W 4H20L 1OM9A 3FN3A 3PDOA 4G80B 1HSAA 4C4KO 1O6VA 3GO1H 1SYVA 1PD6A 3LS5H 3NTCH 1UXWA 2IADB 2R0LL 3Q9QA 4JO5A 4CSTA 4P57A 2BP8B 3V8OA 1IKOP 4APXB 2X2IA 1EZUA 4PGBA 3L3IA 2AJYL 1TZHB 3NIDE 1YEIL 2EQDA 4FABH 3AAZA 4BA8A 3HRPA 1B0RB 2CR0A 3F6IA 3GLEA 1ZLUH 3VU2A 3TS8A 1SVCP 1T1XB 1IQWL 5K9QG 3CHOA 3K2IA 5DVOA 3KWTA 3ZL2A 3DURA 2DQTH 4TTDC 4XE5B 1UWXK 4FQLH 3VDBA 5DFAA 2XYBA 1WHOA 3K74B 1WZ1H 4L9DA 1AAJA 1MCQA 1NGXA 4LLVB 5AENA 2MH4A 4KXDA 4CVZB 3QRGH 3KLQA 1KCKA 2VLLB 3E3QE 3AZUA 2YOCA 4FYSA 4V1DD 5HVHC 4UYPA 1KSRA 1PNCA 4PRID 3QDME 3OPUA 1GAFH 3IB4A 2NYZA 4D3CH 5I16B 1D7CA 3GRGA 3R0MA 5DFVD 3Q8EA 1DTUA 1FL6B 4YDKH 3PJLA 3G04A 2BP0A 1S8DA 3CCHB 3NABL 4HCFA 1MCOL 3ILPB 3FH7A 4FJ6A 4UIKH 1P5VA 2H4EA 2ADFH 3RQ3A 1OGAD 3W82A 4A63A 1KXVA 2Z0BA 1L7IL 5GGVY 3IWVA 3VQ2C 1KXHA 4I1PA 1HQ4B 1K5NB 2CALA 1OALA 2HFEB 4HGMA 2E0PA 4GBXB 4N2HA 5IMKB 4LP8A 2QMKA 5E70A 3OWRA 3FTXA 4OZFA 1XZWA 5KBDA 5EA0H 5ITBH 3KWWB 4JKLA 4Z7IA 1NDTA 5FUOL 4I3SL 5SWQA 5B7EA 5I6PA 4CILA 4NUJA 4FXGC 1TJHH 4JFPA 2CH8A 1IBGL 5JPNA 3DPBB 4KX8A 2VLRA 1Q0YL 3LSOA 3D85A 4DP5X 5HGDB 4FEMA 5BZXA 4FN0A 4KQ3H 3FO9B 5K9JL 3T3PE 2JJSC 3D30A 3MLUL 4LLUA 2X4SA 1F3RB 5DD0H 4JY4B 4HETA 1EFXB 2NW3A 4Q89A 1CI5A 2WAQA 4R6UA 1A6UL 3EJSA 5CMAA 2CIKB 5HYJB 2NY4B 1E5UI 4RDQG 3VSTA 3Q6GL 3R06A 3GC3A 4YNYA 3ZL4L 2B3RA 3CZFB 3EYOB 3NRQA 5CJQL 5DC4B 3F7YA 4MMZB 1Y0LA 4GRMA 4LCCC 3OKNB 4N24A 5HI3C 3TM6A 4XPGL 1NJ9B 4MA7H 4UTAH 2ZUVA 3K3QA 3KYKL 4EIGB 2F1EA 2AJVH 5DVPA 1G1CA 1SUHA 5I8CB 5SWZD 4NHUA 4KH2A 3UGXA 4HV8B 4LLMA 1KJ2A 1TVBB 1KLFA 2FEJA 3TBVB 1ZKAA 2J6EL 4PJFF 1FYTE 4W1TA 5KSBF 5IW6B 2WD0A 3FQ2A 1RUAH 1PLBA 5C0IB 3TBCA 4YN3A 5A2KH 1BM3H 4UV7H 1NFDB 5CEZE 2D4FA 4L1DA 5F1IB 3S4SB 1CLCA 2FYVA 2ZICA 5FDYA 1BZQK 2C9SA 2B14A 3PXLA 3RB5A 3NIFE 2EACA 4PJEB 4B9KC 2A73B 2R29L 3DBXB 5I5RA 2BCMA 1CICB 5K59F 3WO4B 1AVAA 1FORL 3GINA 3NSDA 5F7KC 2PUQT 4F24A 3PWUB 5IB1A 1L4IA 2AAVA 2B1AH 1I1YA 3B5TA 4LO9A 2XLLA 5CILH 5LG6A 1L9MA 1B2YA 1YEFL 5I9QC 2ITCA 2ZUYA 3C60C 4UB0L 3GXTA 2YD1A 1F3DJ 2PWDA 3H3PH 3LNDA 1IM3D 2OZ4A 1TETH 2X10A 2XVBA 4HKZB 5H37A 3VWKD 5KYWB 1LMKA 4PTTB 5HY9B 4KJWD 3R7QA 4M62H 3DSFH 4GAFB 4TSBH 1BAFH 1DBAL 1U92A 4UQ9A 4ZUVB 3TYFB 1BA9A 3SDYH 5A2AA 3ZBMA 2VGLM 4YC2C 1RK7A 3QXDA 3RVUC 5BV7C 4CNIA 5FECA 2GPZA 2Q7YB 1SBSL 4HKJB 3P9MB 3JWOH 4NERA 4Y2OB 1JCKA 1RUQL 3TIEA 1DDHB 1HAWA 1LQSR 3TBYB 5EIQA 1FC2D 4JUTA 3LZRA 1ACXA 2Y7SA 2Z92A 4XNXH 4RGMC 5MEQA 4OM1H 5K93A 1UH2A 3LDBB 4ZODA 3PNWA 4HIIB 1MOEA 5J5EA 5CWSA 3HJ0A 4LKXB 1EAJA 2X53A 2RQEA 1QEWB 3HPLB 3Q6FA 2QADD 1YMHA 4XNQB 2ED6A 1BX2A 3IDYB 3MRFB 4PJFA 5KSBA 1OE3A 2X6UA 4DQOH 5C0AD 1ET7A 1T83C 1FG9C 4QF1A 1HSBA 1XCXA 3ARBA 2J8UB 5J1TC 1ZT4A 1T0OA 5IW1B 5CLWA 3V9FA 4N4YB 4NIYE 4HJ1A 4ICWA 4S1RL 1QR1B 1I1CA 2W92A 1GC1L 4OW6A 4F2MA 2L4OA 1TZ8A 3RIFF 3L1EA 3CNKA 1YUHA 4XNAA 5E4IA 2R51A 3QDGA 1S9KC 1Q9LB 2BIMA 1LO4H 2ITDA 2M83A 4PMFA 4OV6F 4UT9H 1AKJB 4CMHB 4DKTA 4ZMPA 2BOBB 7CGTA 3GUTB 2EDYA 2VLRE 5JXAL 3POHA 4JVUA 4QUOA 5I8OL 1EGJL 1O9VA 2C9AA 4JL1A 4X6FA 5T1JA 3UO1H 4QO1A 1RURH 1DSFH 1I1AB 1E4KA 4X6EA 1VPOL 1HN1A 3OAYH 4GW5A 4U3HA 5I1JH 1KELL 3C9NA 5CJ8A 4FHBD 1H9VA 2OP4L 3B5GA 4XBMA 4OTXL 3O2VL 4CJ0A 1P1ZA 4I3RH 2JB6B 4G8GB 3T8VA 1UZ6F 4XX1E 1NANH 4MAUL 3DHMA 2VMFA 2DAVA 2NY5L 3HNVL 4M5TA 1KNOA 4X9BA 4Y16C 1JFQL 2H32H 2ZWLT 3GYRA 5IR1B 1MJJB 2WN2A 1MELA 1NWPA 1JHTB 2X3CA 4NKMB 4YSUA 4BFBD 4UM8B 4PJDE 1ZHNA 2GSGB 5DZJA 4FQXD 1F90L 1O9WA 3DMMC 4GFTB 5FO2A 3ZYJA 4A68A 5I0DA 1YRKA 2O72A 4XN9A 2DIAA 2W60B 4LMQI 1CFNA 1AXSB 3BVDB 4PCYA 4D9LL 2ESVB 1DDTA 1QLEL 3M86A 3T04D 5IB2A 4GKNA 4YHNA 1BOGB 4KDTC 5AW3B 1I1FA 4JZJC 3BH9B 1YVLA 2ZUQB 1SXBA 1WFMA 5DHDA 5BS0A 2WLZA 1XQ4A 1IAII 4APQA 1VFOA 3GMPA 3N1QC 2N4IA 4RX4D 3EO0B 1KGJA 1JFHA 1R3KB 3N50A 4HKXA 4MCZB 3ZE1F 4FQ2H 2XWJA 3C6LD 3EH2A 4HOXA 2NOYA 4JN2B 3O45A 5B1KA 5C8JB 5IVNA 1MEXL 4Z7QB 1Z9SB 2QKSA 1FNLA 5G4NA 5I1AA 1IIIA 4Q56A 4JQXC 3TT1L 4MCMA 4G5ZL 3MRPA 3LQZB 1T2QL 3TEWA 1BBJB 2F7RA 2ZKHL 5BUGA 1IZJA 1JXJA 3K91A 2QEJA 2NYYD 3V6OC 1YPZF 4YFLI 5CJXA 1BD2B 1OT1A 3ISYA 3QJHA 1YYLH 3TNMA 4L1LA 4EDXA 1TQBC 1KEML 2P47B 3NFNB 4JO4L 1IGMH 2O6CA 4MCYA 3S6CA 2QGCA 1CTOA 3NPZB 5B1CA 3HBZA 4G83A 4NO5B 1W16A 3WN5B 5FYKU 1V5JA 3STBA 1G6RB 3T4AC 3NEEA 4NT6A 3NCYS 5T33H 4KHTL 5DT1H 3BAKA 2X6MA 1XF2A 4WLCA 1NPUA 5DWUL 1RKRA 1RZKL 4WKXA 3FDWA 3LYRA 3KXFA 3T0DA 4FXKB 3VRIB 3H55A 4HIHA 5DFVC 2AERT 1GGYA 3OF6A 3I6KB 4BGDA 2HX8A 4PJFE 1K8DB 3QQDA 5KSBE 4IRJA 2EE9A 3U1SH 4F8QA 5IJDC 5IT2H 1HJBC 4K5OA 2FGZA 4IK7A 4E41A 2FUQA 4X6CF 1FO0B 1AR1B 2BW5A 4JG9A 1VFBA 4JM4L 2H0FA 2XN9A 3HE7C 4JQIL 3LKSB 3V4VB 1ZS2A 2VSDA 4OJFL 4P2RA 1U33A 2XKNA 4GMTH 3CAFA 3IBEA 3CK0H 2Y7LA 3H54A 5A6LA 4N2CA 1DANT 1DP0A 1A3RL 2DKUA 4MJ5A 3SKUD 3WIFB 2ARJQ 3UTQB 1J5DA 5KSAB 3SDDB 4Y7OC 3TP4A 3U4AA 4HXAL 4ZFZA 1A7PH 2P80D 3ZN6A 5I74C 4ZFOL 2C3HA 3BZ4A 3ETSA 4HX1B 4XP1H 2VYRE 3ARPA 1BXUA 5KAQG 1BZ8A 2ADYA 1DJIA 5DEJA 4OZ4A 2YAHA 3QWRA 2X05A 3FUKA 4UMSA 5JQHC 3HA0A 3K72A 3S97C 3ULSB 4IK6A 4S1QL 3DRTA 3S37H 4J5VA 3SQRA 3ARVA 4NBZB 4YHPA 2FT6A 5DQDL 5E5LA 4X7FC 1J1XH 3VFRA 5I0XA 3U36B 4EKJA 5I1CH 5K5YA 1P9MA 2MEJB 3FPXA 4X5XA 4Q9CA 3UBXI 5L8KB 5EUKB 3WSQL 2JLLA 4TOYL 1JPEA 5DJYA 2ZYSA 4XXWC 2IF7A 2YMOA 3IGAA 2XUWA 1E4HA 1J48A 5HHNA 3RGBA 3K2UL 2XPYA 4LGPB 1YC7A 1BGXL 1TTAA 5IF0A 4YXKL 4R5XA 3RZCD 5H2BA 4YMPA 1BLNA 4M48H 4OUOA 1AZUA 1RPKA 1OPGL 1PX3A 2ZKYA 3IETA 2CJ3A 4RGND 5FDWB 3MOBL 3ZTEA 4E0RB 3TN0D 4L2LA 1I1RA 2HAZA 5I6XC 2MCPH 3U2SA 3UAAA 3VYOA 4KXZI 1Y18B 2IDUA 4PU2A 4X6CA 4M1DH 2EC9U 2IWGA 5AZ2H 2K6ZA 1M6OA 2VZOA 4OLZL 4JRXA 2D4DA 5EDSA 3W11D 1BBDH 3QEGL 1LDPL 1A65A 1IC4L 1Y1DA 2EIZA 4IBSA 4HBCL 1XGTA 3PWLA 4LT7A 3QNFA 3PWPB 3UAJD 2I07A 3EOYG 3UPCA 5BS0E 3GTTA 4OCLC 5IMOA 1NCUA 4U4BA 5F6IB 1CE6A 3CDYA 1XV8A 3DO7A 4ZYKA 4FULA 2ZF8A 1Z5YD 3MZGB 3QZBA 4H8WC 4JANB 4NPYA 3TNNA 4AH2B 4DO4A 1N26A 5LN8A 5EHFA 4KOCA 2F8VA 3BLPX 2V2TA 3EJZD 3QR2A 4UU9B 2H26A 2J1ZA 2Y07L 3KYMA 3SGEI 3U6XA 1A6VH 1TITA 4OD3L 3MUGA 3BFQG 4WW2F 1MQ8A 4UINL 2K7QA 4IMKC 3E6HB 4A2GA 1X7QB 1GH7A 4ES8A 4JRYB 3NFPA 4NM8L 3VWKC 2B08A 2FQEA 2PYEB 3I6SA 3NJJA 4DPBX 2YPLA 5I6OA 4KJWC 3DRQA 3FFDB 1FIGH 1SEBA 2EEDA 2FHBA 1E27B 1X5MA 4QXTB 5D71H 1OY3B 3E8UL 3LV3A 4ZNCD 4CU6A 2EYSB 3G9VA 4G7RB 1MCWW 4I9WD 3T0EB 2OMXB 4ZXBA 1CF8H 1N64H 4TUUA 3DARA 4XP6L 5D1ZA 1G7MB 5GQBA 3B7YA 2R69H 5DLLA 1HK6A 4RFOH 3A3YB 4LDLB 3F01A 3VD0A 1BVLB 2HUHA 3CDFA 5ESQA 1EO8H 3CHPA 2E7HA 3VTMA 4CMMA 4EI5D 5LJYH 4ZUSB 1WYJA 1KYUA 2Y4SA 3KXFE 4K3GA 4Y19B 5I75C 2QHRH 4W9FC 4NQCA 5FOBA 3VACA 2SODB 2JXMA 2CCLA 1BZ9B 2AI0H 2QADC 3EZJB 4Z7NF 2V2WB 3VXUA 4AYFB 4E41E 1KBBA 4NNXB 2ERJB 4D2NA 4YO0A 5F1KC 2B0SL 3DNKA 3CMOL 2XN9E 4NNPL 2B1OA 3RJQB 4P2RE 3SOTA 2GITB 1CQYA 2NY0B 4MHHG 2KYIA 4H0IA 2E9BA 4L4VB 3VXMA 1AHWB 3QEHA 3TESA 3QNXA 4HS8H 5IUCA 4MMYA 3ZE1E 4IOSA 4NP9A 3CSYB 3GJFH 4PVLA 5ID0A 2GC4C 2VERN 1H3UA 4GKLA 5CN3A 4WW2A 2VSKB 3GM8A 5DZVA 4MNQA 4ONOA 3QIBC 3IDGA 1I8MA 3SKNB 3MV8B 4O2FB 1AS8A 3B6SB 2DQHH 3O4LE 4DAGL 6TAAA 3IGUA 1H8SA 3QK0A 5GRXG 3R1GH 3D3VD 1HHHB 4HT1L 2MKLC 5DHVB 2DEXX 1PTZA 4PMEA 1FFNB 4OM0L 4F33B 4DZ8A 1KCWA 2VERA 5ANMB 1JGVL 3Q8FA 2XZCL 4LRIA 4OLYL 2D0GA 4WUUA 4LHUB 4G9FA 3W37A 3VDCA 4QCIA 4N2LA 5ADOL 2P5PA 4WENB 4RMQA 3O0RH 1WTLA 5KW9H 1A14H 5I18H 4Z7WE 4GKSB 4PM1A 3AUVA 4OCRL 3P3RA 4AQAA 4OGYL 1HX0A 2NCMA 3ULUE 1AZRA 3MLZL 3GPEA 5F7DA 4MD4A 5HDQH 4PTUB 5TFSL 2IWKA 1KB9K 4PG9A 4BH8B 4KX7A 4X6CE 3KPPA 5FF6A 1BPLB 4D0DB 4G3YL 5JPMB 2DQCL 3C8KB 1FFPB 4JRXE 4YBQD 4W9JC 2OTUA 4ZFOB 1FDLL 2O5XL 2FR4A 1D2PA 4G7VL 3DPDA 3LEVL 5DMKA 1NGQH 1S7QB 4OZGE 2PPEA 2Q2EB 4N6QA 3IDMB 3LH8A 3S3SA 1KN4H 3MJ9L 4ZRGA 4AG4H 2D31B 3TBWA 1VKXA 2ZCHH 2JI2A 1IAIL 5DD5L 1GGUA 1JYWA 4ODWB 4YQXL 1XBRA 4LSQH 1KB5H 2CBTA 3IKCA 3JWDH 4LSVL 4X9FA 3BPLC 3OBAA 2ENYA 4J6IA 3WIHH 2EXWD 3AM8A 3C6LC 4NQDA 3D48R 4U3SA 4QRSA 4ZOEA 1DLFH 5E2UH 1JTTA 4UOW1 4HJ0D 1JHKH 2PWEA 4AUJA 2Y3AA 2WQVA 5ESAA 4GSXA 3NBNA 3PJSA 3GDBA 5J1SC 1KENL 3VGBA 2ZP8A 2YPLE 1VACB 2FJFB 1DUYB 2EJ1A 5EZJB 5INCB 4N8VA 3KGSA 4AEHH 2NYYC 4BSWB 3KW8A 3I2CL 4F57L 3TV3H 1A4CA 1OGTB 1DFBL 4ZQKB 1YDPB 2R0ZL 1ODUA 4B50A 4E9WA 2Z91B 5JHDD 5I71B 3C8HA 5DD1L 4YLQT 3ZMNA 3WLWD 3MX0B 3QWNA 4RAUA 4B7IA 2YFOA 4JQVA 2C9UA 4WI3A 4FTDA 1KTLB 4ZW8A 1XGUA 1TJMA 4K7PX 1NTDA 2VLJD 4NQCE 5DTFA 4DGWC 1QLRA 3J2PA 4MDIA 4QHNB 1INEL 5F0PB 1FNFA 2A6DA 4RMSA 4U49A 4PBVC 3INOA 2IPTH 5AUMA 1QFUH 4QRAA 2E7BA 1BAGA 3O2DH 4IBWA 4TYUA 5HGBA 4HUXB 3RL2A 1UZ8A 3ZLQC 3FS9A 1PG7X 2FTAA 3W2DH 3D39A 4OLXL 4XCEA 1RZ8A 3VXME 4K23H 4Y0GA 3B2VL 3ZJAA 3T2NH 1JGDB 5AD0B 1KCUH 3AY4C 3D69A 3AWFA 4NUPA 2ADGA 5JHLL 2QBWA 2DQIH 1M1XA 4XP9L 4HC1L 3GMMA 3H7BB 4XN8A 5B1JA 4DTGH 4GG6F 4MNQE 2QLVB 2XVKA 3MRRB 2Q8AL 1SYSA 4O02H 1O7VA 4LOEA 4YDLB 5MP6L 3O3DA 3NJLA 1ITCA 3M7FB 1MZYA 3GSWA 1YYML 5DRZB 3EH5B 1KPRB 2Y7MA 3RNKB 3D06A 1IBFA 4YDVA 5C2UB 3HVNA 4WUUE 1H3WM 2H7WA 1SXZA 5FCSH 1C5DA 1SRDA 5T3ZE 2CG9X 4G9FE 2H41A 5J13B 1DCLA 1NSNH 2E8YA 3SZ6A 5IV2A 1UACL 5ENWB 5EFIA 3X13A 4M1CD 4L37B 3RFZC 1YECL 2YSSB 4ZQTA 5C08B 4RFNB 2AQ1A 2DF3A 2OSLA 5HVFB 2IVFC 3RZCC 2EKSA 2ODHA 4OD1L 5HGHB 3NJFA 4NO3B 1F3DH 4NI3A 3W57A 4D7BA 2EICA 5DDHB 3RFRA 3TN0C 1HESA 3N44B 1ZRUA 1A9BB 2VM4A 1SEQL 3QPKA 3QDMB 4JN1L 2EEAA 2ZAHA 3BD3A 3P4LA 2UZXB 4YK4C 4XZUB 1LWHA 2WN3A 3D50A 4Z3JA 4AEIL 2CDEA 3RDJA 1FE8L 5KVGL 3MXVL 4NQSA 1I9IH 5CR8A 5BV7L 1IEAA 1MHHA 2DWDA 3G6AB 4ZPTB 3H85A 1FYHB 2V5MA 1KXTB 5DVMA 4JHZA 1L3NA 2NSMA 3UAJC 1MPAL 1XXDC 5KVDL 5J12B 2J73A 1NMCC 1Z7JA 2DDQL 1JWMB 4BDVA 2GQHA 4GG6A 1FNSL 3H4FA 4Z95H 4R2GD 1BFOB 2XICA 3WELA 1SMDA 3BKML 4ADJA 2VT0A 4XVJH 3C5ZA 4XPFL 4NQDE 4BFRA 2K6WA 1QRNA 5CEYA 2XPGA 1R47A 1MF2H 4IDJH 4GRWF 1U8NB 2AJSL 2WM0A 1OP9A 4NKDA 5AAMC 4LU5L 4JFWA 4LXFA 4F7PA 2XACC 4UTBH 5E6SB 4F3FA 2YRBA 1CTNA 2OMZA 4LL4A 1G9NC 5C07D 4Q2ZB 5IBTH 3CHXA 4OIBA 3RLSA 3VWJA 2FB4H 3MLRL 4ABUA 5LB1A 1M9WA 3OR6A 3O8XD 3OGOE 1WS8A 3EGSA 3NZUA 1RJZA 5BPPA 3DX3A 4LSRL 4A7UA 1SJMA 3UJTL 4IOIA 2XU9A 3AJ7A 4P9HL 1NCCL 4NS0A 4LKCA 1KIQB 1J0ZA 4UCFA 1M3JA 4A6YL 4EI5C 4P3WA 5HYSB 1IAOB 2JQZA 4B9YA 4WJKB 4EVNB 5BUAA 3BDYL 3EO9H 4D0BB 4PBDA 1EK3A 3WNJA 4O9HH 3KW7A 3NAAH 1EXHA 1H15B 3WFHA 1AS6A 3EADA 1CB4A 2QPEB 1G4RA 2Q9OA 3KYOB 3KYAA 3RX5A 2CAKA 5TGBA 4J3TA 1EUTA 2W0FA 3S2AA 1HOCA 2NNAB 3QDHA 1RUMH 3VXTA 1Z9LA 3D39E 4Y88A 1J0HA 2CLRA 4W4OC 2Z34A 1IM9A 1FYTB 5E08H 2VUYA 1SNRA 3GGWB 5B39G 2IH1A 4F15B 4FFTA 5IVZB 1RIVL 3T1FA 3C2AL 3ZVVA 5ABDE 5JOPE 5TE6H 4EKXA 1SYVB 1MI5D 2VISA 3EYSL 1WA0X 4DFHA 4BZ1H 2EH8L 1IAKB 1UXWB 3RY4A 1IUZA 4P57B 1L9TA 4M5YL 3AU1A 4ZTPL 5I1LA 3FQXB 5D1QD 3MLYH 1AXIB 3WTTA 5BZDA 4NDMB 4XN7A 5EBLA 1JP5A 1JZFA 2YQGA 3U4EA 1E9OA 2X1OA 5GRJL 3VXPA 2C7FA 5I26A 3ISWA 1VFAA 1PW3A 4Z3HA 4BFIB 1N9PA 1NC2D 4UQEA 1VEPA 1UM4L 3Q01A 4K5PA 2D7TL 2Y7QA 4GUOA 5ICZB 3AFLA 2DOCA 2IGFH 4G8IB 4KKPA 2F7QA 2ZWSA 4ZO9A 1QTYT 2JIXA 5BCAA 3MOAH 1EZVX 3U4KA 3QUZA 3Q0HA 4FOMA 2RAMA 2VXQL 1IBBA 1WV7T 2HN7A 1JK8A 4ZD3H 2NY1B 4OCSH 3O6LH 4MLSA 2X9YA 3GHBH 3EDEA 1CL7H 1UM6L 5F96H 2QR0B 5C6TH 3NZHL 2BNRB 3IJ8A 2O4EA 4IHOA 5D1XA 3GS4A 4M8QB 5IROD 4LCCB 4YBQC 2JQAA 3G04B 4XXDB 5D2LB 1CVSC 5GGUA 1FAIH 4GP5B 3LVEA 5KJ4A 4P04A 1NCDL 3HI5L 2YMXH 3OB8A 1W0VB 4Z6AT 5CBAB 1JVLA 5IBLD 1T20A 2CA4A 3NH7L 4RIRB 2NY3C 3DOIA 4LCYB 3GSNH 4GG6E 1QSED 2Z7ZA 3JVGA 3FYEB 3PL6D 4WO0A 1IVTA 4LFHD 4W9DC 3MJ8A 1G7QA 2Z93A 1IC5L 1WICA 5JUEL 4YPGA 3QNZB 4U33A 4RSVA 5A6MA 3U0WH 4RVBA 3C12A 3H7LA 4KPHL 1RZ7L 3PGCB 2DYPA 3BAXA 2EXWC 4F2FA 4ZZFA 5SWQB 4WWKA 4HJ0C 2F8IA 4NUJB 5BQDA 4TM9A 2A1WH 4IGBA 2C8NA 2NW2A 5JPNB 2VLRB 5CCKH 1G0YR 1OW0A 1I9JH 2YMTA 1QATA 1GZQA 1G4MA 2A74B 5IGXH 3MREA 2WP3O 3I6GB 3HNTL 4U1IA 4WSKA 5JIMA 5C0FB 4Q6IA 3T8MA 3MCLH 4YPJA 4DCQA 5I19L 4KGJA 5L88H 4YE4H 4DP6X 4I89A 4ANWA 5TD4A 3RB7A 4UDUA 4WJ5A 5SWSA 2CDFB 3WLWC 4YC2B 2Y1ZA 5BV7B 2EUWA 4K7PY 4AMKL 5IWLA 2XQBH 3P73A 1OK0A 1ZK9A 3EYUH 1MFDL 4AYMC 4Q9QL 4PGDB 4XO4A 3FN0L 4F1SA 2AITA 1Y0LB 2ICWB 3QXTA 1KBVA 2YJLA 4L1SA 2UWEB 4M02A 1NGYA 2AQ3A 3QCVH 3SKMB 1J9TA 4X98A 1OAKL 5D2NC 2XG5B 2C7UA 1Z9PA 1UG9A 1G7LA 3QI9C 4GKZA 2W07A 4NHUB 3HG3A 3BKYL 4PJDB 1AMXA 4YSRA 2J12B 3VXRB 3DTXB 2VDRL 4GUQA 3ZKXC 1CGSL 4P2QB 3S35H 4PB0H 1CXIA 1HU8A 4YXLL 1MG2C 3P9LA 5TDPA 2E7CA 1MAMH 2VN6A 4YOKA 3B2MA 1UFGA 2R1YB 3OGCA 1MNUH 3ATAA 4GRWE 4ONFH 4TSAL 1LO3H 5C0EA 3UYRL 1KTBA 4NC2B 3NEXA 1MKFA 4DVBB 1A7BA 2MNWA 3MLWH 4GJTB 4B9FA 3QZWG 4LPYA 2XXGA 3AT8A 4N2BA 3B3BA 4OU3A 1A4JB 3BIKB 3P3TA 4NIKB 2J71A 2WCPA 4X42A 3UIYA 1ZD6A 3FU8A 3DGGA 5FCUH 2BIOA 5I17B 2ZG3A 3EH3B 4OF6A 3FUDA 5JLZA 3L17A 3HI6H 3MACH 2CO4A 1O7DE 4M1CC 3L1OH 4CNIB 3R18A 2A4EA 4UQAA 4HIPA 5FLUA 3MVSA 1KTCA 4YGAB 1ADQH 2NTFA 5I30H 4H8WL 1CLYL 1ZGLB 3ZRFC 2EC8A 4GP4B 3CZSA 3MBEA 4FLSA 1JMZA 4PJBF 3WTVA 2AANA 2VMEA 2UZYB 4QWWD 1ORSB 3ARED 2PP7A 5GZND 5MEQB 2IAND 4Y4HB 1BWMA 4PS4L 1CGYA 1INDL 1O5DT 1KTDA 2NY7L 4OUUB 1TJIH 3UDWA 1D7FA 2OSXA 3F64A 5D1XE 3E6FB 4Y16B 5JQ6H 3RHWF 4ALAC 1MFNA 4X2UA 4M93B 1YMHB 2D2OA 3PHOA 5DRWA 3F6LA 1NEZB 1WWBX 4QRPD 3QO0A 1A1OB 3V6BR 5GSVA 1HSBB 32C2A 4XC3H 1AD9B 1WCBA 2X44D 1P2CB 3FU7B 2ATKB 1P4BL 2OL3L 3PQYD 4HFUL 4H13C 3SBPA 1MHPL 4PY7A 5C0DB 3DOSA 4WHYG 3D33A 4HULB 4L29A 5JA9A 3TO2B 1WWAX 1HI6A 1NBCA 3LKOB 4IKKA 5JORB 3AT9A 2ITDB 4KGLA 4PJ5A 5GXBB 3SOBH 2N01B 3HZVB 4AENA 2J8HA 3QFDA 3D0AA 2VQ4A 1IU1A 4M6AA 1MRFL 4WHYH 4XMKH 2PNDA 3GJEA 3O3EB 3F3HA 4UQ2A 3VFWB 1AR2A 2JB5L 1K3IA 5GGRB 3PHQA 4P4KA 2QGDA 1AJ7H 2KZKA 3E1ZA 1GOHA 1FL5B 4LLYA 4G6AD 3UX9B 3UPRA 1WA1X 3O8XC 1H6EA 4L8DA 3MA9H 4P5TA 5L2KD 3UTSD 2DLGA 2YLKA 2WVVA 4J8RA 4PJBA 5CU5A 5E8DH 3TPKA 5SWSE 3VW3H 2VXVH 3B9AA 1CYGA 2R4SL 3JV0A 3ARFD 2YGQA 4F8PA 3LNGA 4JFOB 2X2JA 1XEUA 2P48B 4WWOA 2EDWA 1PLGL 3OMAB 2RFXA 5DYOB 1OP4A 4DN3H 1ZE3H 3MRKA 1GGCL 1H6UA 3K2KA 3U1QA 3CN0A 4AIZB 1XIWA 1JF6A 2AAAA 2LU4A 4HIJB 2F15A 3S9DB 5FGCE 2IALA 4HPYL 3FSAA 2FSEB 5T3XH 4ZAKB 3IPBA 3VGFA 2PO6C 3ES6A 3ZOAA 25C8L 1CFNB 3VE0A 1HE8A 5CN2A 1WBYA 4KDVA 4FNSA 3DXAA 4XH2B 3UFIA 4EDWH 1UOLA 4HIXL 5IB2B 5DQ9B 1FG2A 4X4MA 5D7LE 1I1FB 1RLWA 3UC0L 4LL9A 2WMPA 3HE7B 5EG6C 5J6GA 4XMLH 2BW4A 2YZ1A 3WJMB 4OT1H 3B1UA 3VD4A 3V9EA 1LE5A 4UOJA 1WS7A 2Y2TA 2UY6B 4CVXA 1DJZA 4P2OB 1K2DB 4PRHA 5DYFA 5D1QC 1PZBA 4QHUA 3MCYA 3VSUA 4NQED 1IO4C 4Y4FA 3VFNA 4NUMA 5I74B 2D9CA 4JG1L 3LHPH 4QDGA 4KHXH 4BZYA 4B27A 3MRPB 2R2BA 1S7WA 1L6ZA 2PCPB 5KYNA 1DANU 3RPBA 3QJHB 1QOKA 4FFWD 3KPMB 4EDXB 2P5ED 2B8OT 2WB7A 4NGHH 1NDMB 3RWFB 4FMFA 3WTXA 2SEBB 5H35B 1JXDA 4JO8A 1HHKB 1V3LA 3MUUA 2VDRB 3NJKA 3B9KA 1NAKL 1RJYB 4XGZA 2JJTA 4WO4D 3MRNA 2PTTB 3WHE1 4GI8A 2K7PA 2XTJB 4BELD 5EBWB 4MD0B 3DX1A 5FYKH 2BDNL 3TEYA 4GUPB 2XFGB 1UCTA 3O3AA 3KXFB 4UT6L 1OV8A 1YEJH 3X2QB 4KC3B 1A1MA 1NOAA 3MNWA 4MXWH 5IROC 1OD7A 4KMQA 2KT6A 2J21A 1DEEB 1MH5B 2DMCA 3A6OA 3IXAB 3MJ6A 4FYRA 4LCWA 1CD1A 2Z8VC 1IIKA 2NT0A 2NR6D 1AQKL 1HE7A 5KSVB 2BOLA 2WXMA 3UBFA 4DN4H 4XVSL 1WUZA 4JY6B 2PP9A 3LN9A 5HHVH 1BVZA 4KVNH 1RHHB 5ACMA 2WNKA 3MRMB 5LG1A 2B20A 3PL6C 1KJ3L 2VXTH 3F7VA 4ZI8A 3F12A 4UOW0 1OLZA 1JPFA 4AGQA 4WU7B 4FXGA 4ZO7A 5F71A 4BFJA 1M7IB 5TQ2L 1T03L 3P3SA 2ZYHA 4TNGA 3C75A 5D96C 3UYPA 4QGYA 4MVBC 4TVSa 5D4HA 3PIQA 2F7IA 4X4XA 1H3TA 1PZAA 1IGTB 1MQKL 1YYCA 3MGOB 4PJ5E 4ORGA 3D8MA 3AS2A 3D09A 4WEEA 5ITFA 5ACLA 3FCSB 3O4LB 3K72B 3RUGB 3ECBB 4OD2A 3DRTB 1SM3L 4A67A 3R4DA 4JZNA 3U9PL 3QUYB 3CHRA 4KUCF 5E6IB 4XNZC 2Y36H 2VH5L 4X9GA 2ORBH 4ZJ9A 3D12B 4H20H 1SJHB 4KKNA 5C2BL 5JHLA 3NJMA 3VWKB 3KJ4C 1PZUB 3HG2A 4HC1A 3P77A 4PJBE 3RILA 5C3LD 2XN2A 3QEUB 5FGRA 5HHXH 3HAEA 2A83B 2ODIA 1U3HD 3H53A 4Z7WB 5H2BB 2ZXEB 4I0PD 4KKQA 3EFFA 1BLNB 4RMBA 4UYQA 1KLUA 3K6IA 3L08A 1IQWH 5DI8B 4KTEL 1OPOA 3DX9A 1U91A 4G7YL 3HHSA 2Z4QB 5F44A 2G2NA 1HKLL 4H25A 3NIGF 5F3FA 5GJSH 3E8VA 1EZSA 4M4RB 5CP3A 4JRXB 3FHQA 2CBPA 3W0WA 1RJLA 1SHXA 2E27L 4PB9L 3DXAE 1OP3H 2C3GA 1FH2A 5ISZD 4X4ME 4WTZA 4DKDC 1IGFH 4CGTA 4OZGB 1G43A 2CA3A 3LTVA 3M46A 4HD9A 1DVZA 4N26A 3ZZQA 3L3OC 3V9CA 2YUZA 2XWEA 4ZYKB 2R27A 1EHLH 3C60A 4PJ7F 1YO4A 2MWCA 4NO2A 4BIKA 1JWUA 3BH8B 1EEZA 3ETTA 4NPYB 4PRHE 1SDDB 4ODVL 4HF5L 1NBZA 1UWGL 2H26B 3BD5A 3WL9B 2UY7A 2LU5A 2X89D 1JNLL 1MG3C 3HKZA 1AE6H 5DZPA 3QIBB 1E5YA 1T1ZB 3EOTH 1L7IH 3NFPB 1X3DA 5EMYA 5F7NC 2HT2D 2KZ1B 4PCTA 4YDIH 2RCSL 3FF8A 2VXUH 2JCCF 1N6UA 5DJCB 1AI1L 4X5PA 3BZFB 4X7TA 2VDLL 5MEOA 1CFVL 3SY0B 4DPAX 1O75A 2R2HB 3H6JA 4P4RB 5D1ZB 3ARDD 5E8NA 5GRUH 4WKZB 3EXJA 2ZXCA 4XVOA 1AFVH 4QWWC 5ESQB 1OARH 3AREC 3QEQA 4M6OH 1W0YT 1WE5A 2WYZA 3U9UB 2DQ6A 4NQCB 1T83A 3QDJD 4MNHA 5I76B 3EF4A 3CFCL 4I18C 1YY8B 5DJXA 3RI5K 4LCWE 1G9NL 4GSRA 4QD2E 2X9ZA 1L0YA 1R1CA 1HHIB 4I88A 5IMLB 3CX5K 4NQXA 4PIBA 4QOKA 5BZWB 3Q6GH 1ONQB 2HH0L 3NJXA 1OAZH 1R5WB 4LNVA 1KB3A 5SV3A 1OM3L 2ETWA 5CJQH 1TKWB 1X5YA 4NCC2 1KJVA 1EDYA 3N40F 4PJ7A 4A6YA 2GIXA 3IJEA 2QELA 5HPMA 2IH8A 5AVTB 2WXJA 3CFIC 4ZUWA 1FZMB 3SPIA 4WY7L 1RULL 1ND0B 5FC9A 3RVWD 4CN1A 1XF4A 4Y5VC 4AZUA 1OZUA 3BQUA 4XNMB 4KI5D 3GK8H 5E2VL 1NBVL 1N0LA 1OAYL 2J6EH 1NAMA 2XIBA 5J6HB 3Q8AA 4NM4H 4B9ZA 3M1OA 1YNKH 1CBJA 2ID5A 2WANA 2JCCA 4Q97A 1G5GA 5IQ9B 5LXGL 5DC9B 3AWGA 4G6AC 1U58B 2APSA 3AROA 2QT6A 2R29H 4ZX3A 1Z9OA 2CE6A 4HK3J 2BLFA 4QCIB 4NQTA 3OXSA 2FQGA 1FO0H 4H4NA 4NSKA 3HRZC 3IE9A 3MGTA 2Q2LA 3ARFC 3D2UB 2YEZA 2W38A 3B2XA 3DIVA 3T2QA 4UB0H 5D7SH 3GXPA 3ILQD 4K9JA 4ELDA 1HINL 5KVMC 3VXSD 4NN6C 3DMMA 5AW7B 4XX5A 1DL7L 4MD4B 3JWOC 4JFHD 2IFFL 4L8BA 4UM9B 5AW8B 4NQVA 1LTXA 2ICEC 1XR9A 3KPPB 2JNZA 4UZGA 4KDTA 3ULAB 3UTTD 3IXTA 3T1WA 3FQUA 3FFCB 4K07A 4NAMA 1CDYA 3BPCB 1QPXA 2DD8L 4G42B 1PAMA 4JZJA 6CGTA 3NQIA 1ETB1 5BVPL 3RWHA 3W0WE 2D9QB 3TT3L 1XCQA 3I02A 1AZVA 2ZSWA 4TUJB 2WYHA 2Y6TE 5HDLA 2ZZUT 5F93C 1DQQA 3TA3B 2NY6D 5C0JA 2OXGB 4KXCA 3FMGL 3QC5X 1OKEA 2ICWJ 1SMAA 2X4UA 5I28A 4KNTA 3OKKA 1SBBA 4LEXL 2Y5TA 4CA4A 5K9OA 3LRLA 4OFVA 5CZRA 4FQ1H 3K8LA 4NN7C 3WHXB 3IDXL 5DUPL 3S2CA 2RGSA 5DD6A 4TLTA 3ATDA 1P84K 3V6OA 3DK0A 1AP2A 4U3SB 2WVUA 1XB8A 1L0PA 2XY2A 3IFPB 2CK2A 5CZVH 1ZSDA 3PJSB 4NAJA 1UHVA 4MMXA 2JJUA 5KVDE 3K71A 3BZ5A 4Y1TA 4A37A 3IFNL 3QFJA 2WXNA 3BAJA 3I85A 4I8DA 4MAZA 1QPKA 4S1RH 3P0VH 4XPTH 4FFWC 3CXFA 4V1DA 4N2EA 4PRIA 4PGJA 2EDOA 1D5IH 1NL0H 4FQIL 5M7QA 1ZAGA 3EJUA 1TCRB 3GRWL 1J05A 1XGQA 4WO4C 5JXAH 4D9QD 1BQLL 5I8OH 4TF4A 1NIAA 5K1JA 1A66A 1QYGL 1EGJH 1F4WH 1U41A 1J1PH 3K5RA 1CWVA 1NCTA 3A67L 3KL0A 5DTFB 3RZCB 3BP5A 2P49B 1X9RA 2QPSA 2BXYA 1OGAA 3GKZA 4FF9A 3G5XA 2UYLA 2FHCA 1YAZA 1MREL 3KE0A 2JQMA 2CO6A 5K69A 1Y6KR 4KY1H 4P46D 2OP4H 4JY5L 2IDSA 1AZBA 1B88A 5GS1A 3FONB 4OTXH 2CKBL 4QOKE 1RVFL 3NACL 3NJIA 5L7XH 1DVFD 4YK4B 1I8UA 3OHXA 1D5BB 1IAMA 3MLXL 1E50A 5EU7E 3UG4A 3WY4A 3UGUA 3BAEH 3EG9B 5CHNB 2XFXA 1KV7A 1CFQB 2EIMB 1JFQH 2AK4D 4EO5A 2E3VA 3ZZSA 2BNQA 2N1TE 5K1NA 4PJAB 3JWNG 1OTUC 2ADGB 4Y1AB 4DIXA 2V3DA 5B1AB 4Y4KD 3BWUC 4XWGL 1DSWA 5JW3L 1F90H 4W6WB 4X9HA 3A4EA 3SEPA 4JHWL 1KY6A 5GGVL 4D9LH 4XT1C 2C4FU 3JWNH 5F3HA 4C4UA 4KNUA 2JCCE 4NRYB 2CBOA 4W9GC 2V17L 4ONHA 2ZXDA 4G1EB 1DLHA 4HXBL 3SJVB 1KBPA 1OANA 3GZPA 4YDVB 4HZLB 1B4JL 1PY0A 3T6XA 3MKKA 4HCRL 3CHQA 1KFAH 1FFOB 5C7XL 2VLKA 4NBYB 4X6BB 4AGNA 4QLWA 3LIZL 4TRPH 3U7YL 5ICYA 3OMIB 3FQTB 3X13B 5LNGA 1CIUA 1I8LC 4KRMB 3QPQD 5GHWH 2GI7A 1U3HC 1RU9L 2W81C 1OCRB 4BRVA 3KAAA 2EKSB 3AXLA 2GSIA 4X8XA 5SWZA 2MCAA 4HH9B 4G5ZH 1ACZA 3SE6A 1T2QH 5EWIL 4XCNA 3V52L 3F62A 1YNTB 2HJKB 4Y5YA 1J5IA 1N10A 1PQZA 2AZAA 2D7PA 2E7DA 3FTWA 1P5UA 4MXQD 4XCYA 4EI5B 3APMA 4JZOB 4ZMVA 3WGVB 1HFUA 2KQMA 4TN9A 4JO4H 1F3JB 2FZ3B 4XBEL 1UZGA 1A1NA 2VCOA 3MLSL 4XWOD 4LHUG 3DVFA 3ZRCC 3KPSE 2ADIB 3FTYA 4ZMOA 4PEEA 1RP9A 3GNMH 4N2FA 1BWWA 4MDJB 4B95C 1R24A 4HG4J 1HNGA 4P48A 5DHVH 2V2XB 4KHTH 2CGRL 2DYSB 3MYJA 4Z0XA 1HHGB 2VL5A 1BJ8A 2NTSP 3BP4B 4X6DB 5EPMA 3CLFL 2CGYA 4MASA 2NUTA 3HLKA 4L8CA 3QUKB 4H1LB 4DGIL 4Y5XC 1SJXA 1ILSA 3AITA 3IF1A 4DP4X 1IM3A 1YEEL 3MRLA 3ULVH 2EVIA 1HEZA 5IJCC 5CEYB 2D8KA 4ALAL 3T6QC 2VNCA 4JQIH 4PRDB 5IM7B 3VCLB 2YUVA 2VZ3A 4ODHL 1YN6B 2HT2C 4JFYB 1H8OA 4MZ3A 4B9JA 1A3RH 3WS3B 2R1XA 3IS0X 1VDGA 2I7OA 3QFJE 4QHKJ 5D93C 2OL3A 1OCWH 3HZ3A 2H1XA 2WBXA 4V1DE 3U1PA 1IFGA 4GINA 4HXAH 3SPVB 3OR6B 4PRIE 3EGSB 3PREA 4KQ0A 4TMPA 4S2SB 1T5WB 1P7BA 1TSHA 1X5HA 4UDTA 3ZKQD 3ARDC 1M53A 4TQEL 4S1QH 3SDCB 3ZDZF 4KBPA 3QHTC 1MAKA 3PY9A 3GI9L 1OGAE 3GBEA 3APNA 1JNJA 5DWPA 3WSQH 4QEGA 2VR8A 1T04A 2J56A 4BQ8A 5DURB 4AC4A 3K2UH 2W0FB 1FZKB 3VYNA 4TUKL 3C8DA 4JKWA 3GSOB 1I7RB 4RDBA 1CU4H 4U6VH 4GO6B 5BRZB 1NCBL 1J11A 1E8WA 3V10A 1OPGH 2XC8A 3MOBH 2BNQE 1AY1H 4K71C 3HS0C 5IVXF 4UWQB 2FX7L 1Q8MA 3TU6A 2EEBA 3CFKA 4A38A 2Y23A 5HHQB 1THCA 1RMFL 3CVBA 2NY3B 2PCYA 3RGVB 4JKMA 3RVWC 4KOBA 4HKBA 4OLZH 3O6ML 4DPRA 4KI5C 3AU1B 3SE9L 1BJMA 3QEGH 1LDPH 1OGSA 4KFMA 5JXED 8CGTA 3ARWA 1J9QA 4HJTA 4HBCH 4W70A 5GZOA 2EE0A 3MJ7B 1TQCC 3GMQA 3U4EB 3JBG7 2WBJD 2R8SL 4Y2DC 2Q3ZA 1JHLL 4QRQA 1ZLUK 1OAXL 1A9EB 4Q74A 1FL3A 5C1MB 3S88H 2VLKE 2LR4A 3UMNA 4NZDA 4HSQA 2D73A 1H8NA 3CH8A 4UQDA 3ZZLA 1U8MB 4C56A 2CKBB 1HT6A 2Y07H 1ZCRA 2CLVB 2FLBT 5EH1A 5LQBL 5SWZE 4IBVA 1QHQA 1RZPA 2QGBA 2WUBL 3HZMB 3ILQC 2Y25A 2ZCLH 3D34A 4FQXA 4NM8H 4UQBA 5M94B 1MLBA 3QIWD 4HFWA 2CJTA 2HN7B 3ZTJG 2HSIA 3LZOA 5CEXA 2RIKA 4G8FA 4HH8A 4OCXL 4YUEH 3E8UH 4PRNA 2EEFA 4IHOB 4ISVB 5KJRL 3OLGA 5FB8A 1TYRA 3ZTJH 2WLKA 3QHZH 1EHXA 1IGCL 3QI9B 1E40A 3FN9A 1A3LL 4N22A 5IVXA 4J39A 4PHZA 3PFQA 2NY6C 4J4PD 5F1OB 2BSBA 4X4YA 3NZSA 1ZWIA 4PCKA 3MLPA 3L7FA 2WZ5A 3C6LA 4FQCL 4XO3A 3ZKXB 1NLDL 4YBLC 3MZTA 1CXHA 43CAB 1U8PB 3PHSA 4IW4C 1HOEA 1F58L 1KGCD 3Q48A 1SHWA 4UT6A 3U30C 2Q76A 3ASWA 4XO9A 3U0TB 2C3VB 2B0SH 1XR8A 3CMOH 4PJ8D 5IIEB 5LDUA 3Q2CA 3VJ6A 5IJVA 1B0GA 1S9XB 1SY6L 4XI5D 1U8JA 2DJ4A 3W38A 3AQYA 1H0DA 1AIFA 5E24E 1XH3B 1I7TA 4LK4A 2GSMB 2XKSA 4M6NH 3GI8H 2BP5M 5IEKA 2DQDL 3VXNA 5DJ0A 4BGLA 4LBEA 1LDSA 2LAGB 1ZHKB 4DCQB 4WV1C 1EJOL 3OZKA 4BCYA 2NSQA 4Y2NA 2YA0A 5F9WB 3P0YL 4KU1A 2XZQH 3BKJL 4NFCA 1D6VH 4QLRA 3FB5A 5SWSB 3VG0H 2HX9A 1PYWA 4FP8L 4Z78A 2G2RA 4FG0A 3CZLA 1W72A 1WAEA 4Y89A 1W9XA 4HT1H 3HE6D 5C86A 5IHBA 2WQUA 4MSWB 4FMKA 1B6DA 5CU9A 5ACZA 4OM0H 3R4RA 5FM4A 1JGVH 3LS5L 2XZCH 4OLYH 3NTCL 4FXTA 4IEFB 2D7OA 3FT4A 4XHJD 4N2DA 1UOVA 3T65A 4M8RA 3ZZ1A 4LOVA 4X98B 3KG5A 1BIIB 2OJ1A 4PJGB 2W1NA 3MRIB 4MYWB 1JNHA 3A0OA 2JKIS 3AY4A 2W07B 3S36X 1G7PB 5CFHA 1A4KA 1KXQA 1DVFC 1YQVH 4DKFH 4FABL 1T3FB 2WW8A 3HEIB 3Q2VA 4MD5A 4OCRH 2WXPA 3VFTA 3K6SB 4OGYH 4KI1A 4MAYC 2P80A 1JTPA 3CVIH 1P7QB 4M61A 5TDPB 2HMIC 3STZA 4QRTB 2BSRA 4N0UA 1R3LA 2DQTL 5TFSH 4CVWA 5D7LB 5BJTB 3KPRD 3AQDA 2WCSA 3OAZH 1UUNA 4FQLL 3EDJA 4BUQA 5HYSG 1B4LA 5CGYD 4Y4KC 1WZ1L 5CKAA 4KZEH 2DL2A 2NQ3A 3SO3B 4YAQA 3CUPB 3I9AA 1FDLH 1R46A 2BSDA 2O5XH 4P05A 3QRGL 3NP3A 3SKOB 5JIKA 3V4PB 4MA3B 5F1NA 5EOTB 4URTB 5KBLA 2NXZD 3L9EA 1OSZA 2XDHA 4AIXA 1TVDA 1QQDB 1WBZB 3JWDC 3BGFC 3MJ9H 2AV7A 1IBHA 3P1VA 4NHCL 4LVNC 4YDKL 5IJKC 2FJSA 2NNXA 1IAIH 1NCJA 3GSUA 4JFQA 4TNVF 5EO1B 1PCSA 4YHYC 4UF7C 2BMKA 1QHOA 4B5ZA 1NQBA 1I4FB 4U7SA 5DR5L 1RK0B 2E86A 2OMUB 5JHAA 3ZDZE 4C56E 3WTUA 2XG4B 4OGZA 4YSCA 3VGGA 4YFEA 3QPQC 4U4IA 2CBMA 2NY2B 3O8XB 4LDEB 2P42B 2W0KA 4LP5A 3AC0A 3MBEB 2CM5A 1KTRL 3IAGC 5T1KB 1ZK5A 4XBGA 5F9AC 1L0XA 3SPHA 2V7HB 3RWIA 4HAGA 3RBSA 4LDCA 2O26U 4MXQC 3I2CH 1XMWA 1LE9B 3BUTA 1DFBH 1JPGA 3BMWA 3FKUS 3NDYE 2R0ZH 3UAJA 5HVWA 1PSKH 1ASPA 4XMXA 1TJHL 3AG4B 4XWOC 3MBWB 4KKCD 2X9XA 4OLVH 4R4BB 4KKRA 5DD1H 5IVXE 4I0KA 3CQQA 4R7VA 5JHBA 1A4AA 5E8EA 2PO6B 4KQ4L 3BPNC 1WCBB 5D7IB 5FO8B 1N67A 2IPKB 2QKIA 1QLFA 3L3HA 3OJDA 3RPIA 3T77B 4F27A 5CSZA 5AAMA 1INEH 3L4TA 3SE3A 1XCTA 2WVSA 1W8NA 1J5CA 3DX6B 3Q8CA 4MA1B 1I8KB 5EDXA 3VX1A 4OCYL 1CURA 2YC1A 1J7VR 3UERA 3PRZA 4E36A 2D7MA 2YSTA 3SBWC 5LGHH 1R5VB 3V79C 5IFHL 1MLCA 4TVUA 1QWHA 2FUTA 4OLXH 2VR9A 3BT0A 2V9UA 3NSJA 1UT1A 4DEUA 1IE5A 4WCYH 3BD4A 5D1QB 5E00A 4AQ1A 4MA7L 2CIIA 2H6PA 4UTAL 1S9YA 3HMXL 4HWBH 4UQ2B 4W9KC 2DMGA 1S7XB 1FBIL 3N1MC 1EV2E 2EADA 4QI3A 4L8DB 4RRPG 4M9OA 5LBGA 4C8XA 3N06B 3Q43A 5F7HA 2CMRL 5KYYA 3VG9C 1WO2A 2WVVB 3P2DA 3AXIA 3PV6A 1INQB 1RUAL 1BM3L 5AVYB 4UV7L 2VR4A 3UBXG 3UTPE 2CJUH 3Q3GA 1V27A 4OJYA 2PPFA 3MRQB 5FGBC 1Q4NX 3JV4B 1DQJB 2YKLL 2A6JA 4FTVD 3BVVA 1QO3A 2EVHA 3H0TB 43C9A 1FFTB 4QHLB 1DQLH 3X1BA 2A9NL 1P7KB 3CVHA 3NCBB 4LLQB 1XIWB 3BUYB 4W4OA 5JDSA 2B1AL 3QORB 1MJ8L 2GTWB 3HZYB 1M7DB 5CILL 4BZ2A 5I73B 1YECH 1KXQE 3MRJA 5LXVA 1BV8A 1XEDA 3S5ZA 2EDMA 1TQUA 3H3PL 3A6BH 1MRCH 1ZJAA 1WBYB 2ITFA 3EO1B 4P23A 4BFNA 4N0UE 1U21A 3DSFL 2YQ3A 4TSBL 1BAFL 3PNRB 4EJ1C 1EERB 2LT9A 1SEQH 3SDYL 4LAJH 5J6GB 1PY9A 3Q2WA 5KVEE 4XX1G 4M03A 5C0CA 1R0AH 3L3GA 4KXZH 2YIHA 3JWOL 3D3VA 5FA4B 1LE5B 3SD5A 5AOLA 2B15A 2OCJA 1FE8H 4U1SA 5KVGH 2ZQKA 5DJ2A 4CVXB 2DJUA 5BV7H 2UX7A 2WZ0A 4XNXL 4Y4FB 5ABAA 1UWEH 4OM1L 5FIEA 3P4OB 4OBSA 2YBRA 1I85C 1KG0A 1MPAH 1T89C 2WBJC 4HK0A 2DIEA 2V5TA 4FAAB 4YIQA 2O5YH 4F2EA 2PW1A 4RGNE 1T6BX 3KDMB 3ZTDC 4XPFH 3ZGIA 4KK6D 4LSSH 5C9JA 3TVMB 2DM7A 3IDIA 5I0YA 4TV3A 3VFVA 3DROB 1Z3GL 1AQMA 3O6FB 4LU5H 4IBZA 4TTGA 2ZNXA 1Q9OA 2DI7A 4BJLA 1VEMA 1NIBA 3GBNH 3P69A 3QIWC 2D2CC 2L3BA 1DQMH 5DEFA 5DS8B 3D4YA 5CJOH 1C12A 2AXFB 2YD4A 3KR3H 1U93A 2TSBA 3VXQA 1XX9C 4G1MB 1AG6A 2FRGP 3L2LA 4HEPG 4IRSD 3M45A 4UT9L 5C9KA 2EXTA 2BY3A 4JPWL 4S0SD 2P24B 2Y0SA 2VABA 5ILTH 3HG1D 4P9HH 1NCCH 5IREA 5LAXB 2P8LB 4BFFA 2E7LC 4FI8A 3GRWA 3UO1L 1L9PA 5DK2B 3G3LA 2J1YA 2IH3A 3BCFA 5FO9A 5I1JL 3BDYH 3F7VB 5T3XD 3KEDA 1ZA3A 3L48A 3UL4A 1WC7A 5T1LB 1YEDB 3O11B 4YL9A 5EO0B 3V7MA 1CMOA 1F1DA 4I3RL 1T5XA 1FRGH 2DQUH 4L0PB 1S2EA 1DN2A 3JYBA 4PJ8C 3Q13A 3BP6B 1OZTG 3O9WD 3ZE0F 1E5CA 1GXEA 2C26A 4NNYA 1TZIB 2C5DC 3RNQA 1O7SA 4XI5C 5IOPA 2GW5A 1EFXD 4I9WE 1NEZG 3RWGA 4EZJA 5JHDA 3D4ZA 3GKWH 5D72H 1NC4A 1VADB 3HC3L 3KYNB 2WIMA 2NY4D 3PABA 5B21A 4DGVH 1B0IA 5HYJD 2OW6A 4LGRB 2EUVA 1RIVH 2GHZA 2EH7L 1ETA1 2IOOA 3WKPA 2EH8H 4YSOA 4DSYA 2VLJA 3A21A 3EFOB 4ZTPH 3WFDH 3BKCH 1A8JH 3DVNB 3M7OA 5E6ZA 1EAPA 1FWXA 4O5LL 1DQIA 5CUSH 3FHEA 4L3AA 2EYTB 4LF3A 4LNRA 3HE6C 3F84A 5EU6A 2LU3A 3I6LE 3BVWA 4XCCH 4FFZA 2EDFA 4PJIF 1IEBB 2ZSVB 1T0NA 4XHJC 3DX9B 1P69B 1NIEA 2OSYA 3FB6A 4FA8A 1A25A 3AREB 4FQ2L 2IANB 2CBQA 4F7MB 5BOZG 2GTQA 1WWWX 2O61A 1UXLA 3AADB 2QTEA 3G5ZA 4YXHL 4YHZL 1AACA 3RWDA 5L6YH 5CD3A 3LPFA 3RU8H 2XBDA 1S78D 4M8UA 4DH2A 1FNEA 4JJ5B 1QFWI 5IG7A 2Z3FA 3QZOA 4QHMB 1TG8A 1CICD 2O6DA 3FUHA 2Y5EA 2VXQH 1D5ZA 5FYJE 4AQEB 3BOVA 3BX7C 4L8SC 2WKOF 3BWZA 3NA9L 2YD0A 5I8KH 1L5GA 3AG2B 1X9LA 2HRHA 1YYLL 3C2SA 4U0RB 4OGAD 5C0CE 6FABL 1UM6H 2BSSA 3D25A 5CGYC 2R2CA 2CHNA 3D3VE 3NZHH 4F37F 2VDPL 4NB7A 4O58H 1ZHBB 1CFTA 2X4PB 1CQKA 3GMLA 1R3HB 4YSEA 1TVHA 1I8IA 4YHIA 3MV9A 1KJMB 3SODB 1MJ7L 5FS5A 4WHTB 2Z35B 3B3IA 4PGEA 3HI5H 2NXZC 1TR7A 1URZA 4BUGA 5DA4A 1LEGA 3O41A 3NH7H 5GGTH 3T3MF 3L5HA 3LB6D 2WP3T 1I7ZB 2F74B 2ZONA 1ZV9A 5KBPA 2WIIA 2AKRB 2G3NA 4HGWA 4YHKL 1BVKB 4QXWA 5IT2L 3U1SL 3S5LB 2MRYA 1U6AL 4YSDA 1PDKA 1A6AA 1JZHA 2FWSA 3IJHA 1E7VA 3QRLA 4RQQA 1J5OL 2AJXL 1ROCA 4GMTL 2XJLA 4PJIA 1HAUA 5HHPA 3QS2A 2YPVA 3KPLB 1UT9A 2CDGB 3FRPB 5EN2A 3C6SA 2XXCB 1IGJB 1ETJA 5HHOD 4P3DA 1I3RA 4XP1L 4Z9KB 1QBBA 5I19H 2FIKA 4CAGA 3II1A 4YHLL 4B5EA 3T8XA 3M1BB 4KKCC 4ZUUA 2BZCA 3S37L 1A6ZA 1DZBA 4H26B 3RKPA 2OZNA 3GLDA 2WKOA 4AMKH 3ETBJ 3QDAA 1J1XL 2PYFA 4DO6A 4CW1B 1CZ8H 1AGFB 1HL4A 3KBHE 1Q9WB 1AQDA 4ZSOA 4DNLA 4JDZB 3JTBA 1OGPA 3UAFA 3CFJA 1FNGB 1AKJD 4WI0A 4K5NA 1TU2A 3L5JA 1MY5A 1OAKH 4ZUWB 3HUJB 3MNVB 5BRPA 5DZ9A 1N3NA 3BKYH 1XF4B 2ZX5A 5C07A 5I2IB 2VDRH 1I1AD 4ZFFA 3BSGA 4CKVX 5SX5H 2A2QT 4PVMA 4WFGD 3LQMA 3F7QA 5CS7A 3DUUB 4FLOA 2ZX8A 3HC0B 5JHDE 3KM2A 4B0MB 4NQEB 1OAJA 2FO4B 4IIZA 4RFEB 3DVGB 5GSRA 1R3JA 3WEMA 3FU0A 3GMOB 4G8GD 5MHSD 4PRPA 3CD4A 3VMPA 4E5XA 5AZ2L 4TSAH 3IGFA 3UYRH 4BH7B 5EORL 4BD4A 5DK3A 1BBDL 2VLJE 2ZUSA 3B7RL 4BKLA 4PV1C 5E4EB 3G08A 4DZBB 1QAWA 2HFFA 4U1JA 4OIIH 3QQ3A 1QR4A 1VCAA 2EDTA 5DGQA 4ABVA 5L4FA 1TCMA 4OZIA 4AY0A 3KLAA 5EU6E 1PAZA 4F5CE 2ZX7A 1R6VA 4IQHA 1N8ZB 4ODUA 5EIIB 2RTTA 1ACCA 1B0WA 4EUPA 4QTHA 2ESVD 4PY8I 4NQVB 2Z65C 5HYEA 3B37A 1TLMA 3ZW3A 5C0RH 4DUWA 2A6IB 1MFAH 2W88A 4A66A 1CBVH 1M2VB 2GY7B 3DX2A