The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
176
|
structure length |
135
|
Chain Sequence |
b'ELHNDDTRVVRVKVIAGIGLAILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENDDFLGQVDVPLYPLPTEPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPTHLPHPP'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Basis for the Interaction between the Growth Factor-binding Protein GRB10 and the E3 Ubiquitin Ligase NEDD4.
pubmed doi rcsb |
| molecule keywords |
Growth factor receptor-bound protein 10
|
| source organism |
Mus musculus
|
| molecule tags |
Signaling protein/ligase
|
| total genus |
25
|
| structure length |
135
|
| sequence length |
176
|
| ec nomenclature |
ec
2.3.2.26: HECT-type E3 ubiquitin transferase. |
| pdb deposition date | 2010-03-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00168 | C2 | C2 domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | C2 domain |
