2XQBH

Crystal structure of anti-il-15 antibody in complex with human il-15
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
227
structure length
227
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYSFSSFGISWVRQAPGQGLEWLGWISAFNGYTKYAQKFQDRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPAAWPLQQSLAWFDPWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords INTERLEUKIN 15
publication title Engineering a High Affinity Anti-Il-15 Antibody: Crystal Structure Reveals an Alpha-Helix in Vh Cdr3 as Key Component of Paratope.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2010-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqbH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqbH01
2JB6B 1ZLVH 3W0WA 2V2XB 5JQ6H 2MQ0A 3SJVD 3QHTC 3O2VL 5E1AA 1M71A 2O5XL 2Y25A 3CCHA 3QA3A 4PREA 3WHXB 2V17L 1ZHKA 4MB5A 1WBXB 5HHOB 4CVWA 4I4WA 3ZDZF 2B5IB 1FGNH 3ZKNC 5DFVD 3D0LA 3QEHA 3D2UD 4ONFH 4EN3B 1OGAB 2NX5D 3HZKB 4X7FC 5DC0A 1H5BB 4K3JL 2HTLC 3ARFA 2RAMA 4RDQF 2XZQH 1A7RH 4R4BB 3O6KL 5SX5H 3L1OL 1W72H 5D7IE 4P49A 1KIQA 4XCNB 5FXCH 2H2SD 2Z91B 4QHKJ 1JZ2A 2M26A 3HHRB 4JFEB 2YEZB 2AEIT 3RAJL 3HE7B 5MENE 4X8JB 3L3IA 3QISA 1MWAA 3BSZH 4JY4A 4PY8I 5JOFA 1GOHA 1S7TA 2JKXA 1JPTH 1AY1H 3LEXA 2FIRT 3MV7A 3QG6A 4DOHE 3D3VA 4PJ9C 3LD8B 4R90H 4UB0H 4MCZA 3HC0A 5LGJB 3HMXL 4UIKL 3U36B 3BXNA 3P77A 3GFUA 3P4OA 4PJCE 2W92A 3PDGA 4CDGC 2JJSA 1JWUB 4U1JA 1ZSDB 4F7CA 1WISA 2AVGA 1D5IL 1K5NA 3UTSD 1DVFB 2AS5M 1MJ8L 1AGDA 5KBNC 4NHUB 1QSFA 3SGKA 2ZSWB 3RWFB 1TQBB 4HFWB 1RZIB 1FRGL 5KZCD 3OPZH 3RX7A 5BRZD 1WBYA 2WBJA 4N0CD 3MJ8A 1FIGH 1NFDF 3GIZH 5D96C 25C8L 1TQCB 1VFAB 3MJ9L 1DUYB 1JBJA 3C8DA 1CFTA 3MLTA 4LSPH 3OKKA 4JHAL 2DM2A 5FKPB 4CDHA 1OB1B 3OSKA 1K4CA 3MLXL 1I7TB 4GMTH 3HUJB 1XIWC 2PXYC 4Z7VA 4KKBC 2G60H 1N4XL 3H42H 1QR4A 1GAFL 4ZPVA 5TGBA 1FG2B 2J4WL 3EGSA 3ZE1F 1RK0B 3Q6GL 5A40E 1MEXH 1DL7H 3S34H 3VXSE 3D39D 4BZYA 2ZZUT 1KPVB 4XCCH 3KPSD 4GQ9L 3JVGC 3PP3K 1T89C 4P5TB 5KSAA 2R56H 2NYYD 2B7DT 3ESUF 1RSFA 2X1XR 1HKLL 1I7UB 4LLVA 5IV2A 3LRSA 1JZ8A 4YPGA 3NOIA 3HI6H 3WFDL 1YJDC 3SJVA 5C8JA 1JV5A 2VMFA 2B39A 1F8TL 4H26A 1A9BB 5CINL 1VHPA 4AQ1B 4ODTH 1KTDB 3NCCB 2ITCA 4K2UH 3ZMRA 1IT9H 3FONB 3QDGD 1JNJA 4CADA 3D2UA 1OTTD 2NX5A 3WS3B 3QRFM 3N50A 4LLYA 5IFHH 2EE9A 3RVVD 5BV7C 1B4JH 2NY3C 4ZD3L 3H0TB 4HC1A 4BZ2L 3MLVH 1WC7B 4FTVD 2GT9B 2W9DL 3TCLA 5LWYH 1K8DB 3DVGA 4Y5YC 3B2VL 5E8DL 3VCLA 5IBUB 2HAZA 4MCYB 2N7BA 5JORA 5IROA 5D7IF 1JHTB 5FECB 2XZAH 5CGYC 4GAJH 5BV7L 4N0FB 1I7RA 3JWOC 4WV1C 2X4SA 5DO2D 2BP3A 1MVFA 4KVCL 3G5XB 1XGPA 4TSBH 2KPNA 5DEGB 4J8RA 3NIGE 1F00I 3D0VB 3QXWA 4WHTA 3KS0J 2VC2L 5FOJA 1R3HB 1CYGA 3GRWL 4Q6IA 3BAEH 1LNUB 3MV9B 4NM4L 4FG6C 4XWOC 2V6HA 3KYOB 4R2GB 4U7SA 3IFLH 4MXVF 5C07D 1P4BH 3PJSB 1G6RA 1FNHA 3CPLB 4LVNB 1NJ9B 4DUWA 1MHEB 3WL9B 3RKPA 1UWEL 3RVWC 2R39A 3U9PL 1DUZA 4YHLH 3FQNA 3Q5TA 2BMKB 2DQFB 5C71A 3TNMA 4OSUL 1E4KA 3U6RB 4JM4L 1CU4H 2WV3A 4MJIB 3WN5A 3W2DL 5C0NC 3EHBC 4XVUD 3UTSA 3FB6B 4PJ8B 4XWGH 1KJMB 3IFOB 4LVHC 3LS5L 3MRPA 3CSBA 4NQSA 5FA4A 1KSRA 4KY1H 2DLFH 5J3HC 4PG9A 4U6HB 2HKFL 1BQHB 3BP5B 3GI9H 1R3LA 3KR3L 5BRZA 4S1QL 1Z0NA 2QQNL 1PZ5A 3QNXB 5EUKB 1J0IA 3P30H 4DGYH 1U41A 1I8IB 1DANT 5BVJA 4K94H 5I66A 2EH7L 3T65B 4I2XB 5F3HA 4N0YH 2QQLL 2RCSL 1JNNH 1MCIA 5IM7A 4RWHA 4Z5RB 3CIQA 2ZCLH 5T5NF 2AXGA 1GHFL 2VDRH 5L8JB 4IOFD 2EO1A 1W72B 1OW0C 2W91A 5EU7C 3NA9H 4TVPH 2D7TL 3GSUA 5F7YC 3EO9H 1XF3B 5I8EA 1CFNB 3VXTB 3BW9A 4Q9CA 4QRPB 1S7RB 1CGUA 5J13C 3ARSA 3MPCA 1IILE 3ZTJH 3D39A 3GJEA 3IS0X 4XP5L 2J7LA 3KPSA 3U1SL 1KUMA 4JRYB 2X4PA 5HY9B 3TBVA 4Y19E 4PTTA 2W1NA 1G7IA 3O2VH 2CIKA 2H26A 4NC2B 2APBA 5B39G 3DNKA 3RZCD 2O5XH 2D4DA 3F65A 1J1PL 3ULVD 2Y07L 3C6LB 4PJGA 2V17H 3MLPA 3G6JA 1VENA 3VDBA 1CFSA 1Z9OA 4GT7A 2PCPA 2PO6D 3ZYJA 3K74B 3S37L 1ETZB 2HLFD 4K3JH 5ALCL 5CSBA 2F74B 3QDGA 3AU1A 3VFTB 4ODUA 5ITBL 5L0QB 4XNMA 4LCUB 3O6KH 2AJUL 4P57B 4H0HB 4JRXB 3L1OH 1RUML 4PJDF 3G04B 3L5XL 4F7PA 3ULSA 3GIVB 3TIDA 4FTVA 1OSZB 2OR9L 4OAWB 4KQ3L 5DVLA 1S5HB 3I75B 4ONOA 3C5JA 3MRJA 3QP3A 3RAJH 4IRJB 4QWWD 5EWIL 1FNGA 3PL6B 1ZGLP 3PGCB 1BX2B 5FO7B 3HTLX 2ZKHL 2JCCA 4QXGL 4PJEB 2VAAB 5I8CA 3ZLQC 1CGXA 5D8JL 3PWJA 4TN9A 3CU7A 5IVZA 4JFDB 1TVHA 1R3JB 3HMXH 3NIGF 5KSVA 3BYTA 4UIKH 3CX5K 3MREA 5HHME 4O4YL 1CIDA 4E41D 4CVZB 5C07A 1FE8L 3AY4A 4S11A 1RIHL 4OB5L 2IFGA 2HG5A 1V5JA 4LSVL 4QHNB 2EYTB 1KT2B 4UBDD 1IAOB 2XKNB 1D5IH 1CGVA 3DLQR 1J1XL 1MJ8H 1YUHB 4RA0C 4RZCB 1AD9A 3ZYIA 5TDOB 3OKOB 1FRGH 4M61A 2E7HA 4NUGL 3UP1A 3L95A 4TSCL 2GAZB 1JF1B 3JZ7A 4WO4B 3LB6C 3VH8B 5ADPL 5KSBA 5EBLB 25C8H 2VRAA 3MJ9H 3GJFB 3L3GA 2HFFB 4XP1L 1YEJL 4DZBA 3QR2A 4UOW0 4JHAH 2C7UB 2VLMD 5BXFB 5JIIA 4GS7C 3BH9A 4ODWB 3MLXH 5F96L 2JJTC 1ZT4B 4CN4A 1N4XH 4G8IB 5FOBA 1WWBX 1GAFH 1CN4A 2J4WH 1H9VA 2YUZA 4PJ5D 4L8DA 3Q6GH 4KJYB 5E9DB 5T1MB 3TA3C 5I73B 3PQYE 2YD8A 3A6CL 3B9VA 4GQ9H 1A6TB 5IFJB 1OLLA 5H94A 5D7KD 3RY5A 1HKLH 2P5EB 5CJXA 2LVEA 1YA5A 3HZVA 3WFDH 3WKNA 4KDWA 4OUUA 3CZFB 3KHOA 3RZCA 2N4IA 4U1GC 4RAVB 1F8TH 2J5LC 4K23L 5CINH 2SEBB 3NPSC 5KVFL 5EZJA 1FH5L 4YXHL 4MSWA 4MJ6A 3N0PB 5IGXL 3V5KA 3NFNB 5I15L 2E8ZA 2PO6A 4OFPA 1U91B 3S96A 3S3PA 5AG9A 2I9TB 3TEUA 5IMOB 1REIA 4ZD3H 5DUPL 1UB5A 4BZ2H 1Q9LA 3G5VA 3ZKSD 2W9DH 3GSNB 3B8SA 1R5VA 1NCWL 3TO2B 3B2VH 5E8DH 1NMAL 4YHNB 5DHXB 2CDFA 1T5WB 3MGTA 4FFYL 5M94B 1UXSA 3MX0A 4HXBL 5BV7H 4KXZH 1N5AB 2VDML 4XB8A 1J7VR 3MRDB 4KVCH 1LO5B 4HH9A 2GTWB 3ARGC 4F3FA 4RFOL 1KXVC 3RI5K 3GMNB 2VC2H 1YPZE 4X6FA 4XHJC 5IIEA 3GRWH 5MI0C 1HDMA 4NM4H 4WDIB 1AR1C 4WCYL 5KAQG 1ADQA 1KIRB 4KJPD 1JN6B 1BWMA 3MO1A 5CZVL 1LO4L 2D31B 3JTSA 4JKMA 1RIVL 2VAJA 4O02L 1GOFA 1DE4A 1UWEH 1NGZA 4M43L 3RL1B 1QHPA 3BD5A 3FB7B 3U9PH 4E41A 1ACYL 2LQRA 3BKML 4OCWL 4JEGB 4XHQA 1JZ3A 2E9BA 4OSUH 3BN9C 1MFEL 4JM4H 2YPKA 1PQZB 5EU6B 1NANI 3VFWA 3W2DH 1X5JA 3ARUA 5EO9A 1PYWB 5K59E 3Q2CA 4CGTA 5I0ZA 4GKNB 2DOCA 3PHOB 3LS5H 1B6UA 1Y6NR 1WTGT 2HKFH 1DZBA 1CFBA 3KR3H 4HSQA 3MROB 1K3ZA 3AAZB 4S1QH 3FMGL 5FV1L 2QQNH 3ZKMC 3KG5A 3X13A 3W9EA 5EOCL 3MRLA 3WDHA 2EH7H 1JZ6A 5KVMC 4NCC2 3FAXA 2QQLH 2BRRL 2RCSH 2XZCL 2Q8BL 2Y5TA 1H8NA 2HRPL 1GHFH 5IHUH 4CUCA 5FK9B 4BKLB 4AMKL 1OT2A 1YMHA 1XEDA 2HFEB 1JGDB 5HHPA 3RNQA 5F7KC 3QQ9D 2D7TH 4LEOB 2IQ9L 1JWMB 4RDQG 5E2JA 3IF1B 2DQHL 4PJ5A 5EFIA 4QRSB 3VD3A 2DLEA 4LQ1A 4PBVC 4XP5H 1QR1A 3RRQA 3U1SH 3D39E 4ISVA 2AEQL 3IFNL 3KPSE 1WCBB 4PRDA 4P2OD 4MWFB 5EORL 3DV4A 4O2CA 3QUXC 1HHHB 1J1PH 1V8HA 2AV1A 4G80A 2YBRB 1RPQA 2Y07H 1A7BA 2MOVA 2R2BA 4U6YB 5DHVA 1XMWA 3QI9C 5HI5D 1U93A 5EBMB 3G6JE 1J88A 3KLDA 3QO1B 2ILLA 1OHQA 3S37H 3MUGB 4LIQL 4BFEA 1NEZA 5ALCH 1W8OA 5FGCE 2YMXL 5GPRA 1H8SA 4JPWH 2DF3A 3KYMA 3L5WB 3QDGE 5ITBH 4NBXB 2AJUH 4LLWB 3PWPD 4HHAA 3IGAB 1RUMH 1PLGL 4PGEB 3P4NB 3L5XH 1VFBB 1JYVA 3INUL 2OR9H 2A0LC 1G7LA 2ESVD 5JO5A 2EDJA 4KQ3H 3EYFA 4OZFH 4UI2A 4BFBD 5I8KL 1CK0L 3BIBX 1LD9A 3MYJB 5EWIH 4MVBD 3SDXB 4RCAA 2I27N 2H32A 3R1GL 1C5CL 1NBYB 4D8PA 5MHSD 4WI9A 2XY1A 2AEWA 5I71C 2ZKHH 4DCQB 4QXGH 3QDHA 4JREB 4QHLB 5D8JH 5KN5B 1HE7A 1Y0LA 2BCKB 2JCCE 5HHQA 2IH1B 3D18B 3UZVB 5F6IB 4CVUA 2VUYA 1NAMB 3QIBD 4O4YH 5CEXA 4HGWB 4U1IA 3GMMA 1JYWA 2IADA 1MLCB 4FS0A 1FE8H 1RIHH 4OB5H 5KSUA 3FQWA 5C07E 4LSVH 3SGDI 1I9RL 2ICEA 3QDMB 1U8KB 3HAEB 2I07B 1J1XH 3WUWA 3JUZA 2MWCA 1X5IA 5IHZA 4JQXC 4GG6A 2FNBA 4GW5A 4OCYL 3FOMA 1FFNB 4NUGH 4TSCH 1CXKA 1X5ZA 2V2WA 4GXUM 4U1KB 1G7QB 2F58L 3TT3L 5F7WC 3BRGC 5K59F 2LVCA 3FL7A 1FYTD 4BQ8A 1A5FL 4QY8B 4XTRC 5TFSL 2O93L 5ADPH 3CGTA 3QUZB 4QF1B 4PGBB 2VOTA 3EO0B 4XP1H 1YEJH 2A38A 2C3WA 1O7SA 5IKCB 1KCVL 5FV2A 2VSCA 5JW5B 4M6OL 4FFVD 5BS0E 5F96H 1SEBB 4G6KL 4AQOA 1R5IB 4E9LA 2QTEA 4U1MB 1P7QB 3U79A 1T80A 4X5WB 1CD1A 5L2JA 1KLUB 3F7QA 1IAII 4IRSC 5IMMB 1F3RB 4XI5D 3C5SB 4PJXA 3A6CH 4YHML 3BZEB 3DXAE 3O3AA 1ACZA 4HULB 1LEIB 2PTTA 4HKJB 3NCMA 2WBKA 1UJ3C 1KCLA 4NQTA 2QHRL 5GZNC 4U2ZA 5D1ZC 5HHNA 4G6AD 4P46C 2WLYA 4LFHD 5JR1L 1E28A 1VACB 2ZOLB 4P2OA 1T83A 1YN7A 2H8PA 1C8PA 4K23H 4NZUL 4U2YA 5FUOL 4C58B 3P4LA 1J8KA 2QSCL 5KVFH 2MJWA 3MCLH 5FO8A 3GMLB 1QFWM 3H9HA 2BY1A 2ZOKA 3RIFK 1FH5H 4YXHH 1U58A 3ULUE 3CVHL 4R3SB 1IGYB 1A4JA 5IGXH 1CDGA 3BO8A 5I15H 3F7YA 2Z0BA 1KB5L 4G8EA 2JJWA 3ALPA 3MRNA 5HPMA 4NKIL 4CW1A 1CD9B 5KVEL 4YDIL 43CAA 2UWEB 2C1OA 5DUPH 5F97E 3D85B 1G9EA 3D25B 2ATPB 3O45B 3DMMC 1ZXQA 3ARTA 3CJJA 4U33A 3PWPA 3UTZB 1AJ7L 1NCWH 5EC2A 3BHBB 1NC4B 4XZUA 1NMAH 4X6DB 5C09B 2CRMA 4KZDL 1T21A 2ESVA 3IJHB 3G6DL 2XTJD 3VXMB 4FFYH 4U0RB 3SDAB 1QSED 3DJ9A 4HXBH 2VDMH 4PRPD 1BF2A 4X8XA 2BY2A 5ECJE 2W60B 4N9GB 1GOGA 5CJQH 3ZDYE 5I74B 4O2EB 3OKEA 4RFOH 3AREB 3KPRB 4J1UA 5DK3A 1HINL 2DBLL 1EFXB 3B6SB 2ZCKL 4OT1L 4WCYH 3BQUB 1TTGA 4NN7B 4MD0B 5CZVH 2HWZL 1FZKB 1RIVH 4O02H 2YZ1A 4HUXB 3QIBA 4U3HA 4M43H 3MJ7A 1RJLA 1ACYH 5FYKU 3HI5L 3BKMH 4OCWH 4M7LL 5EUOE 1MFEH 4E41E 5F71A 3H6JA 1A6ZB 3KPOB 1IC4L 5GSRB 3GHBL 4Y88A 5JPMA 3MNVB 2GSIA 4XRCB 2Q76B 4JZJC 2L0DA 5EO1A 1JFQL 4B7LA 5AG8A 3FMGH 5LGKA 1WZLA 1FYTA 5DK0A 3ET9F 2CLZB 5EOCH 1U95A 1XF5A 5F44A 3MRQA 3IDXL 5FF6B 4QGTA 1P84K 1II4E 3S37X 2BRRH 2XZCH 3FQXB 1MJUL 2CLVA 4L8SB 4ZYKB 3DRTA 3MQIA 2Q8BH 3WE6B 4DN4L 1KEGL 3HRZB 2VLME 2Z9TA 4NQEB 2HRPH 3K8MA 4TPRL 5DRZA 4G8FA 5HHOD 4AMKH 4OD1L 4WWKC 1MRCL 1CBVL 2HT4D 4OIBA 3WIHL 5BOZG 5FA3B 1SYVB 1OGAD 2IQ9H 3P0GB 2Y72A 3MUHL 3PIQB 2DQHH 3C5ZC 2GJJA 3RDTC 3R06A 1IAIM 4WJ5B 5IK3A 2BHYA 5TDPA 4W6XB 5IR1A 4Y4HC 5D4QA 2GEEA 4ZUWB 2AEQH 3IFNH 4S1DD 4R4ND 3MBXL 2V9TA 5D7KE 5EORH 4W81A 3OHXB 5C0AB 1KLGB 1E0OB 4PJIE 3ECBB 1V3MA 3QQ3A 4JFED 3JV4A 3NPZB 2VR5A 4M7ZC 5CIPH 4N68A 3S5LA 4HK3N 2NR6C 4IOSD 3HE7D 1F3JA 5I76A 5J6GB 4MAYB 5DMGC 5K9KA 4L1DA 4IRZL 3A6OA 4M8QA 1EEZB 2DJSA 4LIQH 3CSYA 4LNVA 1S7UB 3U4AA 2YMXH 4FQJL 3ULUF 3E0GA 1EO5A 1UH2A 5FYJU 1CGYA 2GKIA 4JFXB 1EIBA 1KJ2B 3P11L 1IGTB 4GRLB 1PLGH 4GMSL 4XCEB 5GRZA 5GGRA 3INUH 4DWHA 3PGDA 4TTGA 3FHAA 4CU8A 4KMTL 4JQVC 5I8KH 1CK0H 1H0DA 3OG4B 3L3OB 3T1FB 3CFEB 1DVFD 1UGNA 2H41A 1QSEA 3R1GH 3UTQB 1C5CH 2C3GA 1FG9C 4PRPA 3QAZC 4H1LG 2CKBA 3NN8A 5GZOC 3GSOB 4N8VG 3PP3H 2YXMA 2X4QA 3QPQC 3DUHA 4HUVB 2OR8A 4KDTA 4H1LA 4OLWL 3B9EA 3G9VA 4RNRA 5L88L 3ILQD 1LEKB 4BUHA 4N8VA 4YFLI 1I9RH 4PJ7A 3WKML 2IC2A 1NCCL 1T2QL 5TPWL 4UT7L 5E24E 3X14A 4OCYH 4R6UA 1XCTA 1VFMA 5EBWB 2VERN 4GG6E 5EOTA 3R4DA 3MV11 2F58H 3TT3H 4MB3A 3QIUC 4Y4FB 3VFNB 2QR0B 1A5FH 5TFSH 4PGCA 3FO0L 4AEEA 5DLML 1IGIL 3SCMB 2BJML 2EDWA 2JB6A 1KCVH 2V2XA 5GGUB 4HGKC 1TNNA 4M6OH 2AV7B 4G6KH 3I3EA 3HCVB 1MFNA 2BOBB 1L0YA 5KOVC 3WHXA 4KKNA 4PJBE 4N1EA 2EO9A 1I3UA 2X7LB 1WBXA 5HHOA 1AGFB 1SQ2N 5B3NA 3DO7B 2HT3D 4MGXA 1XZ0B 4OM1L 2X1OA 1OGAA 3HZKA 4YHMH 1AH1A 3F12B 2XNAB 5ACMA 1H5BA 2X40A 2R29L 2R2HB 2QHRH 5B3JE 5CEZD 2AGJL 2FIKB 3QXAB 4YHZL 1VSCA 4R4BA 4D0CB 4PLNC 1K4DB 2FD6L 3HE6C 2XG5A 4I0CC 5JR1H 5J89A 2IG2L 4YK4C 4NZUH 5FUOH 2X4NB 1Q9WA 2QSCH 4HV8B 4XCNA 2Z91A 4LBEB 3JBG7 4JFEA 2VIRB 3EKCA 4HUWB 2FO1A 1HXYB 3Q5YA 3CVHH 2YEZA 1O5DT 3T0EB 3ARBB 3MRGB 4PJIF 3QUML 3G08B 3HE7A 4HDIB 4OZIE 1D5MB 4X8JA 2DIAA 1KB5H 4OIIL 4HAGA 1K9TA 3FB5B 3ZDXF 4N5ED 4NKIH 5IBLC 5KVEH 4LRIC 4YDIH 1WVZA 3IU3B 4HS3B 3MV9D 4R2GD 3KNBB 2VDPL 4H25B 3DURB 4Z7NF 4OLZL 4XVSH 4LDOB 1T22B 1AJ7H 2EIEA 1ZLUK 5A43C 1C5BL 5LGJA 3U36A 3PWPE 4Y16A 4G6ML 1F11B 3TLRA 4OV5B 4KZDH 4K3DL 3G6DH 4JN2B 4QXWA 3RWCB 4M1DL 5IG7B 4GAGL 3WFEL 1DFBL 4MJID 1JWUA 2DLIA 1ZSDA 1LEGB 1UZ6F 4PV9B 1UM4L 1DVFA 4QNPE 4PJ8D 1J8HB 2GY5A 1MELA 1E4XI 2ZSWA 2X89D 1AO7D 3RWFA 1HINH 2DBLH 4HFWA 1RZIA 2JIXB 2ZCKH 4K71C 5C0CB 3NZ8B 4DQOL 4OT1H 5MHSE 3OAYK 5ICYA 2F8VA 4HJ0D 2FECL 1RHFA 1HHIA 4NO5B 3AB0B 2HWZH 1MCJA 1PVHA 2BK8A 1R5WB 3EO1A 4IMLB 1VFAA 3AS0A 1I8KB 1DUYA 2NXYC 5DJDB 3HI5H 1A22B 1HQRA 4M7LH 5FKPA 1MWAL 1OB1A 1I7TA 4N5UA 2V5RA 1VEMA 3HUJA 1IC4H 3GHBH 1QO3B 4HWEL 1FZOB 2E7MA 3ROLB 4IDJL 3RBGA 2A6DB 2FCBA 2OS7A 3C2AL 1FG2A 3ZO0A 3CAFA 2P7TA 4QRPD 1RK0A 5KANI 4L4VB 1JFQH 3IVKB 1KPVA 4KMLB 1BMGA 4JRYD 1I7UA 5E4IA 3R8BB 3IDXH 4PP1C 3T09A 4ETYA 4EI5B 3OJDB 4NCDA 4GXUN 3PWUB 2LU3A 1SVCP 1MJUH 1A6PA 3C6LD 1JRHL 4E0RB 4DN4H 1KEGH 2EDDA 3RWDB 4LLAA 4TPRH 2QADB 1A9BA 1KTDA 4OD1H 2D7MA 4YQXL 1MRCH 3WIHH 1RMFL 2EDYA 1B88A 2FJFB 5EN2A 3FONA 3E3QE 5ANMB 32C2B 4MD5B 5I1LB 3WS3A 2CJUL 4WHYH 5KSAC 4L9LC 5IBUG 3MBXH 3TO4B 4FMFA 4JRXD 3MLYL 1NBZA 3H0TA 4L3EB 4JR9L 2BVTA 1WC7A 2GT9A 1K8DA 3P9LB 5E70A 1EHAA 3UJIL 4F9PA 5B3JF 1PKQB 2NY1C 5FKAB 3TPKA 4EZMA 1FBIL 4IRJD 4CKVX 4MCYA 4NDMB 1Y18B 4M03A 3TVMC 1JHTA 4IRZH 3PL6D 5FECA 4D0DB 4M5YL 2VZ1A 4K8RC 3T0BA 4KC3B 1L9MA 5C0RL 4N0FA 4FQJH 5C0GB 1HHJB 1JGEB 3G5XA 3QWQB 4POYA 4LSSL 4OZIF 3LSOB 3CFKA 4B0MM 3P11H 1R3HA 2DS4A 3V95A 1LNUA 4GMSH 3MV9A 3CLEL 4N0UE 3MV01 3KYOA 1AC6A 4OZGF 3OGOE 5IB5B 3PJSA 5ERWB 4UNVA 1ZHNB 3CPLA 3E2HB 4KMTH 1NJ9A 4P59L 1MHEA 3B4NA 3WL9A 1RZJC 3FOLB 2BMKA 2DQFA 4Q74A 2FLRT 4OLEA 3U6RA 4JFYB 4MJIA 1QSEE 2DQCL 3WNPA 3VE0A 2N56A 3FB6A 4ZPTB 1LDPL 4PJ8A 1KJMA 3KLSA 3IFOA 2WP3T 1T66D 1AO7A 2X89A 2A9NL 4WO4D 4U6HA 5E08L 3SN6N 1BQHA 3NIFF 1BZ9B 5FB8B 5ESQB 4OLWH 3QNXA 5EUKA 4PJFF 1I8IA 5L88H 3BDYL 3IJSB 3MUY1 4XC1L 3VMNA 1HYSD 2VR9A 4UQ2A 4I2XA 3WKMH 5KTEL 1BBJB 1NCCH 1T2QH 2KZ1B 5TPWH 3BJ91 4UT7H 5IW6B 4PJ7E 1TENA 1XGTB 1E4KC 1TITA 4PY7B 4Z5RA 5INDB 1W72A 5E9DD 2ADFL 3V6ZB 2YPLB 3F7VB 4LPWA 3JV5A 1D9KD 1XF3A 1CFNA 4QRPA 1T3FA 2FL5B 2P5ED 3TP4A 3FO0H 1G6RL 2YA1A 5GQBA 2OTWB 5DLMH 1IGIH 3BFOA 3ARXA 2BJMH 2VQTA 4G9FB 4JRYA 5HY9A 1T5XB 5D2LB 2WZPD 2P49B 1ODAA 3EUUA 4X9IA 3L3KB 3SDDC 3BRDA 3C6LA 3VMPA 3VFRB 1HCFX 5C86A 5T33H 1F6LL 4ZXBC 3LPWA 2XICA 3ZHKA 4L9DA 1YY8B 3GSRB 4OM1H 5T3XD 5HHOE 3O2DL 1ETZA 1QP1A 2WIMA 2NY6C 4KUCF 4NO3B 2OTPA 3RY6A 3CH8A 2F74A 4OFIA 1OGAE 2D0FA 3VFTA 2R29H 2BSRB 4NYLB 4ELMB 1WV7T 4JM2F 1GL4B 2AGJH 3SBWA 3C9NA 4YHZH 4FA8A 4LCUA 3BEWB 2FD6H 4P57A 2NYYC 3QQNA 2IG2H 4JRXA 3G04A 2KH2B 2X4OB 4JG1L 3GIVA 2YRLA 2X4UB 1OSZA 3T4AB 1T04B 1S5HA 3I75A 4YR6B 2VXVL 3MYZA 3QUMH 4IRJA 4U1HB 3TN0B 3IDYB 4OIIH 4Z0BL 5T1KB 3PL6A 3PGCA 1BX2A 1EHLL 2MNUA 4IIQB 3CXHK 2JJVA 1C12B 4TNVF 5FO7A 3UAJD 1E6OL 3GSWB 3GMQB 4FQCL 3IKCB 3QFJE 4PJEA 4YPJA 1LP9E 1OTTC 2JJUA 2VAAA 2P44B 2VDPH 4LLQB 4OLZH 4AEFA 1TZGL 4Z7WB 1R3JA 1C5BH 3U4EB 3FZUC 1IEAB 4G6MH 3BT2L 1XF4B 4X6CF 4K3DH 4CVZA 5GXBB 4O58L 1IGFL 4M1DH 4D9QE 5SX4H 5B38G 4GAGH 1A8JH 3WFEH 1ZE3C 1DFBH 1X44A 5EU6D 4QHNA 2EYTA 4PYHA 1N64L 1KT2A 2X1QA 1IAOA 2X4RB 2XKNA 4FQ2L 1UM4H 4IBLT 4RZCA 3EOAB 5EU4B 3FJTA 5TDOA 5ID1B 4JDVB 3TNNB 1OAYL 4FQXB 4DQOH 4CJ1A 2GAZA 1JF1A 2DN7A 1FGVL 2YD2A 4WO4A 4BSWA 3VH8A 4GKSB 1M7XA 3JV0A 2EEDA 5EBLA 4N0RA 3JV6A 3GJFA 1ULVA 2P4AB 2HFFA 1W0YT 3DBXB 2C7UA 3T3PE 5BQ7B 1MWAH 5BXFA 2X70B 3AY4C 2D7PA 1JE6A 1UENA 1VADB 2Q3AA 1ZT4A 4HWEH 1IC5L 4G8IA 3KPQA 4IDJH 1DBAL 3HUJE 4KJQC 2CDGB 3EJZD 2Z93B 4LCIL 2GITB 4P9HL 2YN3A 3C2AH 2J3SA 5E9DA 5T1MA 4KJYA 4RWYL 1FN4B 4NJ9L 1X5AA 4K7FB 1D9KA 4OBSA 1A6TA 2P43B 5IFJA 4YEEA 2P5EA 4KHTL 3U46B 1HSBB 2NXZB 4NNXB 4WUKL 5JHDE 5LGHL 2Y9RT 3UTPD 4GBXC 1JRHH 5F9WC 5L7XL 3CZFA 2D4FA 1X5KA 1F4YL 4RAVA 3ZKXC 3SY0B 3VRLF 2SEBA 4XNZB 5L9DL 4JDZB 4YQXH 4I9WE 1RMFH 4LSQL 4YFLF 1F90L 5D2NB 5EBGA 4TUOB 2BXYA 4F37F 2XWTB 1U91A 1BQUA 5E5RB 2CJUH 4YFEA 2HMID 2I9TA 4JGMA 5IMOA 2R69L 3MLYH 4MJ2A 4LCYB 1DBJL 4JR9H 1FP5A 5AAWA 4LARL 4JY6B 3VGHA 4LKCB 3GSNA 4Z7UB 1EBAA 3UJIH 1U8OB 3TO2A 5ABDE 2XG4A 4YHNA 2CRYA 5EDXA 3RZCC 3V6OE 1FBIH 2IANE 3O4OB 2E8YA 3QEQE 1VKXB 3TYFB 3J8F7 3ULUC 3FO1B 4M5YH 4P2QB 5C2UB 4HMCA 3QCVL 5C0RH 4EUPB 1N5AA 4OFYD 3MRDA 3B2UC 2VLLA 1LO5A 2GTWA 2JB5L 4LSSH 3B5TA 1YDPB 4RGOH 4LP4A 1FAIL 4E5XB 1JUFB 5CILL 2ED7A 3UMTA 1FL5A 1EEQA 1Q8MA 3CLEH 4FQQB 1KIRA 1KG0B 5HYSB 1TETL 5GRWA 2MCG1 3ULVL 1JN6A 1RK1B 2D31A 1LP9F 1EEYB 4P59H 1RI8A 4KROC 3RL1A 3V4VL 3FB7A 3QDMD 4LMQI 4YLQT 3LY6A 1PQZA 5EU6A 4APQB 2DQCH 2ERJB 4MJIE 1PYWA 3QXVA 5DJ0B 1LDPH 4GKNA 3HNTL 2ZG2A 4G8GD 1NMCB 2R2EB 3PHOA 1IL1B 5J12C 2A9NH 4BJLA 5E08H 2YWZA 1AO7E 3AAZA 2ICWJ 1HH9B 7FABL 3QZWG 5F6HI 2RGSA 2X42A 2B1HL 4RMWA 3SE8L 3BDYH 4GRWH 3PABA 1T20A 4XC1H 3UCRA 5KTEH 4K55A 3NGBB 5C08E 8FABB 1P7QD 4LCWE 2ZUUA 2MKWA 3TBTB 4XPHL 1MHCB 1V7NL 5FK9A 2VH5L 5GS1B 4BKLA 2ADFH 2OMNA 2HFEA 1JGDA 2FB4L 3BPLC 4R96B 3FT3A 4WTZA 1ADQL 4LEOA 5SWSB 4M48L 1JWMA 3IF1A 2B20A 4ZSOA 2OM5A 2P5WB 2HP4A 4LU5L 4QRSA 1G6RH 1G7PB 1P4LB 4QRPE 4WFGE 3BWUC 3F62A 4JPIB 5FUZL 1CTOA 2CKNA 5EIIB 2P8MA 1WCBA 2RJMA 2YRZA 4MWFA 4JZOB 4MNQB 5GRVK 3RPIB 1KPUB 2ENSA 3CX2A 4U6YA 5DJZB 5EBMA 1BM3L 4C59B 3QO1A 4KKCD 1T03L 1KFAL 3MUGA 3O2DH 4OF8A 3TJHD 1MRFL 3D85D 2CPCA 1TPXC 2FHFA 1WLHA 3L5WA 2DTSA 1P6AB 2WNGA 1NQBA 4OGXL 5HTSA 2YXFA 4LLWA 4JDTL 3IGAA 4JKWA 4PGEA 3P4NA 3T8XB 4JG1H 1VFBA 5C09D 1S3KL 2FRGP 4XNQB 3QJHB 3WJJC 1UQSB 3T1WA 3CZJA 3SDAD 4F7MB 2W9EL 2VXVH 3QUYC 3TV3L 3O3BB 2XRAL 3HZYB 3MYJA 3REWB 1A7QL 1WFNA 4MQXC 3SDXA 1W8NA 4Z0BH 1LVEA 1UVQB 4PJ9B 1EHLH 1NBYA 1NLBL 3ARED 4EBQL 4XBPB 4OFYA 4KWUA 1E6OH 1EFXD 2PYFA 4NCC1 4FQCH 4DCQA 2F53B 2ZUQC 2VXSL 3EYSL 1GGCL 4QHLA 1QACA 2NZ9D 1F6AB 2DLTA 3BQUD 3IAGC 1WAAE 3MSPA 1TVBB 4PJEE 4HJJL 1TZGH 2IH1A 3GKWL 3RGVB 2B4CC 1NAMA 1S78D 1EO7A 4HGWA 3SE9L 1SHMA 3BT2H 3BZDA 4WW2F 1MLCA 4O58H 1IGFH 3DARA 4NM8L 1X5LA 2PTVA 1LK2B 3BZFB 5IHLB 1N64H 3LPGA 3QDMA 2Y6SD 1U8KA 3HAEA 2VZUA 2I07A 4FQ2H 2B2XL 1U8HA 1OP3K 1BFTA 4OFDA 4XMKL 2AQ3A 1RV6X 1ONQB 5A2JH 1A21A 4XGZB 1OAYH 1OLZA 1U6AL 4LHUG 4G8GA 1G7QA 4U1KA 3VDAA 3BPCA 1FGVH 4FXGB 2R8SL 3O3DA 5C6TL 4QKXB 4P4KC 4FOMA 2VYRE 1XIWB 4QF1A 4PGBA 3EO0A 4BH8B 2IBZX 4D0BB 5IKCA 5HVHC 9CGTA 2EDRA 5JW5A 4F2MB 1SEBA 3ISWA 1R5IA 5F3BB 2VUOA 1Z0MA 1P7QA 1IC5H 1FDLL 2DJ4A 4X5WA 2Q6WA 4ZOEA 1TTUA 1U8NB 1DBAH 4CVXB 4LSDA 1KLUA 4ZFZB 5EU5B 4LCIH 4P9HH 1KGCD 5IMMA 5ESVB 5J1SC 2YZ8A 3C5SA 4RWYH 1OAUL 3RHWK 4NJ9H 2NLJB 4V1DB 3BZEA 5B4MD 5F1KC 1LEIA 4HKJA 4KHTH 5D7LE 4WUKH 3TFKC 3S3SA 3K0WA 5LGHH 4ZUVB 5C0AD 1FQ9C 1F6FB 3WFZA 2Q86B 1I7ZA 5L7XH 1G9NC 5ETUB 3WXWL 2XZZA 2ZOLA 1F4YH 3DX8B 5DUBB 1MFDL 4IOIB 3BH8B 5L9DH 1EVUA 3CNKA 3N1GC 4MAYD 1FL3B 4LSQH 1F90H 4AENB 5DMYA 2NY3B 1RZKC 4R3SA 1IGYA 2DI7A 3T2QA 2BHZA 3W39B 3UPCA 2ADJB 2NTSP 5T3XE 4Y5YB 5CP7B 2R69H 4Z7QE 2UWEA 3D85A 4GRLD 3D25A 1DBJH 2ATPA 3O45A 4LARH 3K2MC 4KI5F 4XNUL 2Z31C 4HLZG 4YHKL 1FAKT 2JLLA 3UTZA 3OAZH 5D93C 3BHBA 3OJVC 4X6DA 5C09A 4P2OC 1T83C 3UBXI 1SY6A 3IJHA 3SDAA 2EZ0D 5A3ID 1AKJB 4YH6A 2CIIB 3QCVH 3QDJE 1N7ML 1I3GL 5HI5C 4R97C 2W60A 4N9GA 2JB5H 4O2EA 5C3TA 4X0KB 5D5MB 5KW9L 3AREA 2NY0C 1EFXA 1FAIH 1G7MB 1MCEA 3B6SA 1PD6A 5CILH 5AZ2L 2BVOB 1JNLL 2MPAL 1TLKA 3BQUA 1TETH 3ULVH 3NH7L 3WLWD 5TF0A 1JF6A 1J05B 1FZKA 3T0DA 4HJGA 4HUXA 3W81A 1WAAF 2A77L 3V4VH 4TVPE 1LILA 2Y5EA 5KS9B 1CXHA 4NWTL 2QHLA 1I1CA 4ZQKA 1HSAB 1PFCA 3KPOA 2ZUTA 5GSRA 3QWOB 5EU6E 3SE3A 3BI9X 3I3BA 4MVBC 4YXLL 3HNTH 3MNVA 4MNGB 3U83A 4E42B 4XRCA 4WUUB 2Q76A 4Y4FD 1DR9A 4KU1A 5DRNB 4OQ1A 1TDQA 4RRPG 7FABH 3SCMD 3V0AC 1R3KB 1AI1L 1SJVA 4MD4B 5H2BB 2B1HH 1D5XB 3SE8H 4MXQD 1H3VA 5FF6A 4UIMB 4MMXC 3QIBC 1ED3A 3W82A 1S7QB 3FQXA 4L8SA 4ZYKA 3WE6A 4TTDD 2FHCA 3HRZA 5J13B 4XPHH 1V7NH 3ME0A 3W5MA 2VH5H 4POZD 1FVEB 3QQ4B 4KTYA 2FB4H 4LPYA 1ADQH 1SYVA 3SO3B 4M48H 3U30B 1KB9K 3PIQA 1BFOA 4NC0B 4LU5H 2F19L 4WJ5A 4ZSOE 3B9AA 5GS0C 5FUZH 2WW8A 2YS4A 1PX4A 3DETC 3NVQA 4ZUWA 4AG4L 5IEKA 5MEPB 3BUYB 2COQA 1ZLUH 1UKQA 4U0QB 4ALAL 3OHXA 5C0AA 3BJLA 5CSGA 1XT5A 3ECBA 3RVTD 3UTTB 4CMMB 5DMIL 2RR3A 3ARBD 1BM3H 5E7BA 5J6GA 4GH7B 3BMVA 4MAYA 2V7HB 1IZJA 1T03H 4RX4D 1KFAH 5B39B 1EEZA 3E3QC 1F02I 3O6FB 1JTOA 1DQML 1S7UA 4K7PL 1KIUA 2M1KA 1MRFH 2AJZA 2AK4D 5TE6L 2OI9C 5IEHB 4OGXH 5I16B 2IBZY 4JFXA 1KJ2A 2I9LB 4JDTH 1IGTA 4GRLA 4J7RA 1UADC 4XCEA 4UZGA 1S3KH 1K6QL 3SKMB 5I30L 4Z7QF 2OCFD 5GS3A 4PRHE 2FYYB 2IPTL 2W9EH 4K07A 3TV3H 1I3VA 2XRAH 4ERSL 3L3OA 4BFGA 3T1FA 1A7QH 5DA4A 1MCWW 3P9MB 3UTQA 1J8HD 2QEJA 5E6IB 5EIQA 3RU8L 3K2UL 4DW2L 1NLBH 4EBQH 1J11A 3K1DA 2JIXD 5C0CD 4P23C 3GJFK 2VXSH 3EYSH 4ZAKB 1GGCH 2VO5A 3WD5L 3GSOA 3VJ6B 3WS6C 4KK9D 4G5ZL 4JFPB 1DJSA 4RMVA 4NC1E 2A6JB 4HJJH 3GKWH 4M3JA 4EOWL 1A3QA 4HUVA 1DEDA 5DHVH 1CD8A 1I9JL 1INDL 3SE9H 1R3IL 4PLKD 1QLEL 4NM8H 1I1AB 1IRAY 1FFRA 2R1WB 1LEKA 5C0FA 4XAKE 1RQ5A 2FZ3B 5MERB 3HRPA 1NFIB 2B2XH 2C3VB 3H9SE 4KK6C 5D1QD 5HXMA 5JMRA 1SBSL 1IARB 1X9QA 4XMKH 3NZHL 3TPUB 2X4TB 4JHWL 1H15B 1OD9A 4JANB 1DN0B 3NCYS 4DAGL 2LABA 5EBWA 1U6AH 4L4VD 2QSQA 3EW3B 3I6LD 1P7KB 3MR9B 1NH6A 2R8SH 5DZLA 4Y4FA 3VFNA 2QR0A 1GVIA 3R0MA 4MB4A 3V8CA 4G8GE 5C6TH 3B3IB 1GIGL 5DD5L 3CFDB 4EI5D 4HG4J 3SCMA 2VQ1B 3HG1B 5GGUA 3QXTA 1V3LA 3EJYC 2H32H 4BZ1L 2AV7A 5E2UL 1LE9B 5EZIL 3O9WC 3HCVA 2QADD 3SKOB 1ZV5A 1FDLH 1MCNA 2BOBA 2EECA 2XWJB 2Z4QB 3ARYA 4B50A 3MZGB 4TOYL 4JFFB 4U3XA 2X7LA 1AGFA 2BFVL 5CJOL 3DO7A 3MC0A 1OAUH 1WQVT 2FH6A 5KVGL 1XZ0A 2GCYB 3F12A 2XNAA 3EIFA 1N2RB 5CJ5A 1BECA 1KTLB 2A1WL 4U1GB 4MNHB 3HNVL 2J5LB 3TO4D 2R2HA 3NPSB 2FIKA 3QXAA 1K4DA 1GCFA 3U7AA 3WXWH 1RULL 3RY4A 1MFDH 2VZTA 4PD4K 2F54B 2X4NA 4B7IA 4HV8A 4LBEA 4LPCA 2VIRA 3GSVB 5CD5D 3LS4L 1HXYA 3RWEA 3WNNA 3ARBA 1YEKL 4HDIA 1D5MA 1IKNA 3B9KC 3CXDL 2VWEE 4RX4A 1U8LB 2BC4B 1YNLL 3OB0H 1NUDA 2DQGL 1RZFL 1MF2L 5E7FA 1OGTB 1JF5A 5K9QI 3VGGA 3IU3A 1MCKA 1YQVL 4RGNE 1BVLB 1BP3B 2AK4A 4HS3A 5SWQB 3PE9A 4XNUH 3I2CL 3KNBA 4H25A 3DURA 2YD1A 1VEOA 4YHKH 2XKUA 4R4NC 4OV5A 1MI5B 1F11A 3DI2B 3R0NA 4WGWB 2Y1VA 3ARGB 4JN2A 4X6DE 3RWCA 1AR2A 5C09E 5IG7A 4PJAE 4HKZB 1N7MH 4NQDB 1RJYB 1LEGA 1I3GH 5MI0B 4PV9A 4NBZB 4U3CA 2AKRB 3T4YB 4RMTA 1OVZA 1U9KA 1J8HA 3SGEH 4HIJB 4Q9QL 5KW9H 1T1WB 2HA1A 5AZ2H 2JIXA 5C0CA 3NZ8A 3GBNL 1JNLH 2MPAH 3H9YA 3S36L 4KK5D 3HB3C 3G6AB 3NH7H 4NO5A 5I8OL 3KPPA 4ZNEE 2ARWA 4Z9KB 1O0VA 3VXRB 1KXQE 4IMLA 5DI8B 2A77H 2VDOL 4TRPL 5DJDA 2WINB 1I85C 4NWTH 4JO1L 4Y16C 5HBBA 2E9WA 1PJ9A 2C9AA 4N8CL 4ZFGL 1UWXK 4M6ML 1JI1A 4MJ4A 1QO3A 2WQ8A 1HCVA 3JWDC 5D1QA 2CRZA 3ROLA 1N0XL 4YXLH 5BVPL 2YPLD 2A9ML 3BP4B 4EVNA 3KPTA 5HYEA 4WU7B 3UPRB 4HZAA 4BM7A 2A6DA 3LV3B 2JF1A 4L4VA 1H3XA 3IVKA 4NPYB 2ZSVB 4G9FD 4MQTB 3OKLB 1AI1H 4MAUL 4C56A 4KV5F 4AZ8A 1NGQL 4YDVB 5JZ7D 3BPOC 4EI5A 3OJDA 3GO1L 1HWGB 2J8OA 3QRGL 3VGDA 1A6WL 3PWUA 1P4IL 5L2KE 3BP7B 3RFZC 4PTUB 1NDGB 1U42A 2GHWB 3LH2L 4E0RA 4G43B 3RWDA 3K8LA 1F3DJ 4OI8A 3VI3E 4GQPH 3QEUB 4OIAA 2FJFA 4PR5B 4FQLL 2F19H 1FFPB 5ANMA 3QUXB 5KANG 4MD5A 4X9GA 1INQB 4F9LA 4P48A 4FFWC 5I1LA 3JTTB 4OLYL 3WCYA 5GRJL 4AG4H 2EXWC 1YY9C 1BIIB 3QI9B 3TO4A 1GGTA 4ALAH 3LDBC 4NQUA 2K7PA 1FNFA 4YAQB 4YHOL 1J0KA 5C0AE 2XXMB 1PKQA 5DMIH 4Y5VC 5FKAA 5EIVA 3MFGB 5M95B 4NDMA 1Y18A 3TN0D 5F7DB 5T1KD 3PWVB 4D0DA 3BZ4B 3FTGB 1DQMH 1BQLL 3EOBB 4K7PH 3VFUB 1EJ6A 4N90D 5C0GA 1JGEA 2HT3C 4L3AA 5TE6H 1NCDL 4HZLB 2DWEB 3LSOA 4Q6YA 3DHMA 1KCRL 4I18A 3C09C 2VDNL 1ZGLM 1K6QH 5I30H 4KTEL 5IB5A 3GHEL 4J4PC 4XCFL 5ERWA 1ZHNA 4J3OC 2IPTH 4F9PC 3V6OC 1IGML 4YO0B 3IDGB 1HZHL 4ERSH 5I71B 4HIHB 3FOLA 4LGPB 1B0GB 1MQ8A 3KYNB 4JFYA 3RU8H 4RFEB 3K2UH 5HGDB 4DW2H 4OF7A 1NC2B 3R8QA 1S7WB 1QKZL 2UVFA 4PJAF 3WO3B 4ZPTA 4FQXD 2R9HD 2ZUSA 4P2RD 5CEZL 5DDHB 3WD5H 3PHQB 2Q8AL 3AVEA 4UDUB 4QCIB 1YEIL 4G5ZH 4NO0B 2VNCA 4X99B 4WW2C 3DUSB 5JMOC 1A3RL 4EOWH 2XWBB 1BZ9A 5FB8A 5I1KL 1I9JH 1INDH 2ENYA 1L0XA 5ESQA 1R3IH 2ED9A 2YPVL 2EDOA 1QLEH 2YK1L 1OF2B 3X3GL 4PGJA 3TF7C 1YEDB 1EBPA 2X10A 4S1SL 5IMKB 1A9EB 1NFDB 2X1PA 5FGBC 1BBJA 1CTNA 3TC9A 1SBSH 2J88L 3NZHH 2VN4A 4JHWH 4PY7A 5INDA 3OMZA 1KACB 4LLDA 3KLHD 4DAGH 3V6ZA 2YPLA 3F7VA 1Z3GL 4QXTB 3X17A 1XGQB 5ISZB 4I1NB 4JHZA 2FL5A 4JCMA 1PY4A 2NXZD 2QKIB 1GIGH 4MHHI 5DD5H 1ZLWK 2OTWA 5IT2L 4G9FA 3ARRA 4BFIB 4HJ0C 5D2LA 2MCPL 3L6FB 4IRSB 4BZ1H 5E2UH 5EZIH 1ES0B 2QLVB 2CK2A 3KDMB 4Z7OE 4FQHB 3ZTNL 1EUTA 3L3KA 4ZUSB 2ZUYA 5DC4B 3P73B 3VFRA 4TOYH 1A1MB 5F72S 1ZEAL 2BFVH 1UJ3B 5CJOH 4NT6B 2IPUK 2DBJA 5KVGH 1YY8A 3GSRA 5D1ZB 4P46B 3VI3F 4H1LH 3C6SA 1TVDA 3UJTL 2A1WH 4NO3A 3RVXC 3MODL 3DROB 5GGSB 2BSRA 3HNVH 4NYLA 4ELMA 2DAVA 2OL3B 2GFBB 4JLRB 3V79C 1PY9A 3K46A 1RULH 5F93C 1TZHB 3MRHB 3HZMB 1YEHL 4PB9L 2X4UA 1J0HA 2VXTL 2BNRB 2OSLB 3Q3GB 3T4AA 4OZHE 3C6LC 1MH5A 3LS4H 4P2QD 1KN4L 4YR6A 3SGJA 2NPLX 2ICWB 3PXHA 2FBJL 1YEKH 5K93A 4PLOB 2EXYD 4U1HA 3TN0A 3FRPG 3CXDH 1IC1A 1MCPL 5T1KA 1YNLH 2EE2A 3WJLC 4IIQA 4U49A 5D7IB 2DQGH 3AMLA 1RZFH 1MF2H 2X44D 3GSWA 3GMQA 1YQVH 3WDJA 3IKCA 1C7SA 3MA7B 3FRPA 3I2CH 4LLQA 5ALBL 2AK4E 1UCTA 3U4BL 1NCTA 5MENB 3OKYA 4Z7WA 4ZUUB 3BE1L 1IEAA 1IC7L 2VDQL 4QRTB 1XF4A 4ENEC 4L1HA 2FJGB 4APQD 4G3YL 2GUOB 2CO7B 5A2IH 1FVCB 2X4RA 4WI7A 4GSDL 5J9PB 3GDBA 3EOAA 5EU4A 4JFOA 5T1LB 4Q9QH 5ID1A 4JDVA 3TNNA 3RWHB 2DDQL 1M7IB 4J3XA 4FQXA 4DKFL 2BERA 3GBNH 4P2RA 3S36H 5A2LH 5I19L 3BP6B 4M7LT 5I8OH 3RTQC 4H88L 1IKFL 2NY2C 1BREA 1T0NB 2H45A 2VDOH 1H3TA 1C1EL 4TRPH 4HKBB 3DBXA 4JO1H 5I2IB 3CFCL 5BQ7A 1DQJB 4N8CH 4JFQB 4JZJB 2X70A 4ZFGH 1T7ZA 4M6MH 5TQ2L 4MA3B 1A64A 1JCKA 3WFCL 1N0XH 5BVPH 2A9MH 3PWNB 3D87B 2CDGA 3QCUL 1G84A 5SWSD 1CGSL 2BSED 3L5IA 1JK8B 2P5WD 2D7QA 3ARPA 1FN4A 4K7FA 3F7RA 4HUMB 4L4VE 4MAUH 4KRMB 3I6LE 1T66C 5IP4A 3U46A 1HSBA 1NGQH 4NNXA 4RIRB 2YN5A 2UV3A 4WO4C 2XA8L 4C56E 3L3JA 2EC9T 1WEJL 2L7UA 3GO1H 4LIQE 2A73B 4WWKB 3QRGH 1A6WH 3CH1B 1P4IH 4YGVB 2APXA 2IFFL 3LH2H 3H3BC 4K7PX 3RUGE 3VXSB 3C5ZB 2HTLD 3SY0A 1QBBA 4JDZA 1NCUA 3SPVB 1AQDB 4Y4HB 5J1AB 1UEYA 5D2NA 2EDXA 3FQTB 4FQLH 3L5JA 1T7XA 3WYRA 4U6XB 1AHWB 2XWTA 2CLRB 3WBDA 5EG6C 4OLYH 1D9KC 5GRJH 1TMCB 4M7ZB 3T77A 2Z35B 1S9VB 4LCYA 4UV7L 4JY6A 3VWJC 2WWMC 2XPGB 4LKCA 4YHOH 4Z7UA 3IRPX 4EUPG 1CDIA 1ITCA 4FABL 1CLZL 3VGBA 3IDNB 5F9AC 4LK4A 1VKXA 1MHHB 5DYOB 3TYFA 2GYSA 1MCFA 4PJ9D 3FO1A 4P2QA 4EDXB 1GJIA 4EUPA 3FRUA 1BQLH 4OZHF 1NSNL 4QRUB 2EDTA 3VGFA 3BESR 4DZ8B 2AP2A 2F53D 4XPTL 1I4FB 1NCDH 4F8QA 1YDPA 3UYRL 1KCRH 2VITB 4E5XA 3THML 1JUFA 4FZ8L 4MLIA 2XT1B 3RGVD 3V5DB 2VDNH 4Q97A 4FQQA 1KG0A 4OI7A 3QO0B 5HYSA 4KTEH 3GHEH 4XCFH 1RK1A 3V7AE 1EEYA 1WT5C 1IGMH 3QAZB 3RA7L 1EZVX 1HZHH 1X5HA 3VFGL 1CI5A 1I1FB 5T3XL 4WI2A 3ZTJG 1EJOL 2XQBL 4LOUD 4NRYB 3SE4C 4APQA 2FX8L 2WP3O 1QKZH 1GC1L 3GBLA 1OD7A 4HS6A 4K94C 1KJVB 4L8BB 5DJ0A 1T7YA 5CEZH 2Q8AH 1YYLL 2R2EA 4H0IA 1SJEA 1IL1A 4JO4L 1YEIH 3W5NA 1ORSB 3GSNL 5BW7A 1A3RH 3BIAX 3MCG1 3UAJC 2GTZB 2HTKC 1XIWD 5I1KH 1A0QL 4KKBD 1HH9A 2YPVH 1FFOB 2YK1H 1CICC 1NDMB 3S97C 3X3GH 3BEVB 2Y06L 3MLUL 4QOKD 4S1SH 2FBOJ 1N0LA 5JIKA 5F70A 5F9JB 8FABA 4I5BB 5I17B 2J88H 4XX1G 2FGWH 5IVXE 1CGTA 5LBSL 3I3DA 3TBTA 3QG7L 3UXFA 2EDHA 1MHCA 4M1CC 2K3TA 5GS1A 3U7YL 1N8ZB 5INCB 2ZUXA 1Z3GH 1ZA3B 4G6JL 4R96A 1CXFA 4V1DD 5SWSA 5LJYH 3RL2B 2YPLE 3DRQB 2NY4C 2IMMA 3QUMA 1P4LA 1GGYA 2X5PA 3F5WB 2WM0A 5IT2H 3EOYG 4JPIA 2MCPH 5EIIA 4G9FE 2Z8RA 4RSVA 3ZTNH 2VL4A 1KPUA 1T0PB 2OP4L 1JZ7A 2B0SL 2BVQB 4NKDB 5DJZA 1HHKB 1XR8A 4I3RL 2NY3D 1ZEAH 1WCQA 4U1SB 2J8UE 3RUGF 3WHE1 4Y19B 5I9QB 3D6GA 3HE6B 3UJTH 1MY5A 3MODH 4XPAL 5E1AB 1M71B 1M7DB 4ELKB 4JB9L 4NQCB 1J10A 4ONGL 5I1CL 1UT9A 5CGYD 5FHBL 1G0XA 2AI0L 3T8XA 1YEHH 4PB9H 1ZA6B 4XNQA 2VXTH 3QJHA 2Q7NA 1UQSA 2E9JA 2GJ6E 2ZPKL 2XY2A 3L9RB 4F7MA 1KN4H 3TM6A 1AKJD 5C0BB 3O3BA 1RUPL 3REWA 2FBJH 3S36X 1MCPH 4K9EL 4XWOD 1UVQA 4PJ9A 1UH3A 1EK3A 2XN9B 4XBPA 4LGSB 4Z0XB 5F1NB 5IB4B 4AM0B 2F53A 3GMPB 1GH7A 4N90E 4JG0L 5ALBH 3PP4L 1YMME 1TVBA 5E6YA 3U4BH 3ARDC 4GG8B 3RGVA 1OAQL 2YUXA 3BE1H 4K7PY 5MEQB 1IC7H 4NSKB 2VDQH 1X5GA 3DGCR 5EB9A 3CDYA 5JOFB 1M05A 4G3YH 3BZFA 1EA9C 3L5HA 4Y7MA 5EU3B 5CUSL 1U3HA 4GSDH 2VKXA 5ACLA 3RNKB 5J06A 4WUUD 4TUKL 1ONQA 3MOQA 2DDQH 2W0FB 4ZODA 5HHMB 4XGZA 3M1BB 4DKFH 2NXYB 1BZ7B 3FO9B 5I19H 1MIML 4LNRB 4NC1C 5FYKL 4FXGA 5TDNA 4H88H 1IKFH 4P2RE 2YD7A 2DL2A 1OSPL 1XIWA 1C1EH 1U3ZA 3KWWA 4BH8A 4D0BA 4Y2OA 3CFCH 4HWBA 1CQYA 5B21A 4QOKA 4F2MA 4H8WL 5J1TC 1IAKB 1QFWL 1LGVA 1U3YA 4OCNC 5TQ2H 5LXGL 3TYGL 5I1JL 1BOGB 1VGKB 1X6NA 2H6PB 3WFCH 5GGVL 4CL7A 1QNZL 3JVGA 1U8NA 1T89A 3ES6B 3U82B 4CVXA 2ED8A 4ZFZA 3QCUH 5EU5A 1FHGA 1CCZA 1GPOL 3ZYOA 1CGSH 1JPGA 1NGXB 5ESVA 5IVXF 4EI6A 5I6XB 4OV6F 1NAML 2VLKA 2NLJA 6FABL 4V1DA 4YBQC 2C3HA 1YEEL 2XA8H 4GUPB 1WEJH 3MRMB 3G5ZB 4ZUVA 1EZVY 2BSTB 2UVEA 2Q86A 3TBSA 3O41B 4AIXA 2IFFH 5ETUA 1ZK9A 5GGRY 1RY7B 2VLJB 3PQYB 4ZPVB 5DUBA 1BJ1H 3FFDB 1CIUA 4TNWK 4IOIA 3VXUB 1R6VA 3LZFL 1FL3A 4P9ML 1T7WA 1TTFA 5E5MB 4Y5XA 1F45A 4L9LB 2HVJA 3O6FD 2HRLA 5D2NE 5T1DL 3W39A 4D9LL 5IHBA 1WIPA 4UINL 4KAQL 3GJFH 1WGOA 4KRNA 3U0TB 1E27B 2ZWLT 3EYUL 2J8UF 2ADJA 2NY1B 2ITDB 4Y5YA 5CP7A 5A16B 3T3ME 4KTDL 3G5YB 1KCKA 2EKJA 4UV7H 2VTFA 5CBEB 1WIOA 3TVMB 1YN6A 4FABH 1CLZH 2FJHB 1EX0A 3CDCA 4JPVL 4GLRI 1VPOL 4NJAL 1J5OL 1DDHB 3IDMA 4WI8A 3V5HA 5FYJL 1AKJA 5E6ID 3X3FL 2CIIA 5HGAB 1MJJB 1KLFA 2VWEC 1NSNH 5E8OA 1WUNT 1F4XL 4XPTH 4ZAKD 3DV6B 1FZJB 4X0KA 5D5MA 3UYRH 3O81A 1VDGA 1DLHB 1G7MA 4RGNC 4FZ8H 3THMH 3DVGB 4LAQL 3SKNB 2BVOA 5C9JB 4PPTA 2H2PD 5AWNL 4YZFE 2PF6A 1J05A 1I1AD 1G0YR 3RA7H 1FO0B 3MBEC 3PG2A 2X4SB 4ESKA 1QLRB 5KS9A 4QHUB 3VFGH 3HPLB 4I0PC 3WNKA 1YPZB 1XGPB 5T3XH 4EQ2A 1EJOH 2XQBH 3GEWB 3QJFB 3WIFA 1RAMA 1HSAA 1YNKL 2FX8H 3LOWA 3MV8B 1GC1H 1AGBB 1A1OB 1CZ8L 2Z8SA 3QWOA 4FQIL 4YDJB 4E42A 4PJCF 1IAIL 1YYLH 4JO4H 4WUUA 4NZRL 5I74C 3WSQL 1CD0A 4ZTPL 1Q9KA 3GSNH 4ZO6A 5DRNA 1A0QH 1R3KA 2AJVL 3HG1D 1U8QB 3HC4L 4MD4A 2BVEA 1SY6L 5H2BA 5CLWA 3O2DA 1CXLA 2Y06H 3MLUH 2X9YA 4IS6B 1N59A 4Q0XL 1OW0A 4UIMA 3N1QC 1S7QA 2V5SA 1E6JL 5HI4C 1JWSA 3S3JA 2VXUL 5LBSH 5FA4B 3QG7H 4JFFD 3U7YH 4QHMB 2R1XB 2Y6SC 1FVEA 1BLNB 1R3LB 3QQ4A 4G6JH 5IHUL 3SE3C 1E4JA 3LKPB 1EDQA 2ATKB 2BVYA 3I02B 2J2ZA 3IAQA 5BVJB 2UUDK 5SWSE 3GGWB 5DTFB 4OZFG 4Z8FL 3SDDB 3IXAB 1F13A 3STLA 3U9UB 4ZO9A 5MEPA 1PEZA 3BUYA 3W9DB 4ZXBB 3DX9B 5CJ8A 3W0WE 2F54D 1MFCL 2OP4H 1AIFB 3LKQB 2B0SH 1MCBA 2NY6B 1ZTXL 4HK0B 1J0ZA 4JY5L 4CMMA 4I3RH 4J23A 2UY6A 3GMOB 2I5YL 5FEBA 1MCHA 3D39B 3OQ3B 2HT2D 2V7HA 4CAGA 1CLYL 4JAMB 4YUEL 5B39A 2Z8WC 3MLWL 5AZEL 3O6FA 1P69B 2AQ2A 4Y2DC 5IJKA 4FMKA 4XPAH 5JTWA 3OB8A 4JB9H 5IEHA 4ONGH 5I1CH 5I16A 4JPWL 3C8HA 4DJMA 5B4MC 3AGVA 2I9LA 3G6JB 4OF0A 5FHBH 4MDJB 1P53A 1T0MB 2AI0H 3Q48A 1MI5D 3T3MF 1CFSB 3ARGD 4YXKL 1ZS8B 2ZPKH 4U7MA 5ICXB 5DJXA 2FYYA 1GRWA 1KPRB 1RUPH 4KGLA 4NQDD 1UWXH 4K9EH 1AR1D 4ODUB 4PG2C 4OM0L 3P9MA 5E6IA 2HVKB 4AIZB 2IMNA 2K9UA 3DUUB 4ZAKA 3C2SA 2VDKL 4JG0H 3VJ6A 4JFPA 1YYML 3PP4H 2F53E 3BN9D 3VXRD 1UJTA 1OAQH 3QULB 2XTLA 15C8L 3MV7E 4GRLC 3D3VE 3RKDD 1FNGB 3TZVB 4WFFD 3H9ZA 1I1AA 2R1WA 1VGEL 5JPNB 2FZ3A 3S35X 1NFIA 4O5LL 5CUSH 2C3VA 1AC0A 3ZKMD 4NFBA 2PYEB 3P0YL 3OBAA 3TPUA 2X4TA 4TUKH 1H15A 1I1RA 2EIBA 4JANA 1DN0A 1ZHBA 1DEEA 1KJ2L 3V0WL 5EO0B 3MR9A 1P7KA 5B38B 1MIMH 1QSFE 3KJ6L 4HS8L 5FYKH 4HUNB 1U8IB 4LGRB 2XOTA 2XQYG 3B3IA 1OSPH 3RX5A 1IZKA 2JJTA 4R0LB 5DD3L 4U05A 2C4FT 3CFDA 3UX9B 2GY7B 2VQ1A 5JOEA 3HG1A 2FO4B 3F7PC 3WLWC 4H8WH 1AD9B 2EYSB 1QFWH 2CR3A 5LXGH 3TYGH 5I1JH 4QOKE 4KRPC 5DEZA 3SKOA 5D1XB 5GGVH 5J6HB 1QNZH 2BVUA 2FEEL 2XWJA 2Z4QA 1M1SA 1IM3B 2HH0L 1GPOH 4JFFA 4ZDHB 4OGZA 5F9OL 5AEAA 3RI5F 1BVKA 4Z7VE 1Z9LA 1DANU 3QUXD 3N1MC 1NAMH 3U0PA 2GCYA 6FABH 2V5MA 5BS0B 4GBXB 3D9AL 1N2RA 3MXVL 5HGBA 2VLKE 1KTLA 3BOVA 4H5SA 1YEEH 4Y4FC 4CN6A 4MNHA 3QI9D 1IQDB 4QXUL 3CK0L 4KK8C 4XNXL 4PJHA 3HAEH 3MLZL 4DKAA 1QQDB 2DYPB 4GAYB 1P9MA 4PS4L 3CC5A 3NTCL 3M8OL 4KH2A 2F54A 5TH2B 3SJVE 3DXAB 3LZFH 4P9MH 3Q6FB 3GSVA 2EDNA 3MCLL 4NZJA 3LQAL 2B8OT 5T1DH 4D9LH 1Z9MA 1CVSC 2Y4SA 4KAQH 4LCCB 4UINH 1U8LA 2BC4A 4YBHA 3EYUH 3HZVB 1OGTA 1CLCA 4KTDH 1BVLA 4X98B 2NX5E 5SWQA 4I13B 2APWA 4EQ3A 3VFVA 5EZJB 1OTUC 3CDGB 1LMKA 5GRYA 4JPVH 1MI5A 5B22A 3TJEL 1VPOH 1FL6B 4NJAH 4FRWA 1J5OH 4QEGA 3LKRB 3UZQA 4H20L 4DTGH 2EIDA 4OCXL 5EZLB 1IAMA 4FFZL 4HKZA 5FYJH 3X3FH 3GZKA 4NQDA 1RJYA 1BFVL 3ARBC 1A14L 1D3CA 1MCQA 2AKRA 3T4YA 2N1KA 3NCEB 4N8PA 1IKNC 3G5VB 4U1NB 5DUML 1F4XH 4C4KT 4GRWE 4X4YB 4P2CG 4HIJA 4UDTB 1T1WA 4NO0D 5CJQL 4POUB 5D6DC 4KROB 4LAQH 1EERB 5D5ME 5K9QG 4F33A 3QIWC 1ZLWH 2CDFB 3LKSB 5AWNH 1G0DA 3G6AA 3IXTB 3DYMA 3VXRA 3SDCC 1EVTC 5DI8A 1DLFL 3WV0A 5B8CC 4BA8A 4C54A 2WINA 4X7TB 5HI3D 1K8IB 5J12B 4NOFA 5KS9E 1WZ1L 2Z92B 1WIUA 1YNKH 2E3VA 4HT1L 3BPNB 4X80L 1CZ8H 5BZWB 3T0AA 4FQIH 4URTB 1IAIH 3BP4A 4YWGL 5CEYB 4WU7A 4NZRH 3UPRA 4L5FL 3WSQH 5TQ0L 5ISZD 3UO1L 2NW3B 1SM3L 3VG9C 4ZTPH 3LV3A 1OWWA 3UTSE 2HJLB 1JTTA 1NGZB 4NPYA 5EA0L 5EUOB 1MVUB 2AJVH 3OKLA 3HC4H 3TGXA 1SY6H 2KBGA 4KK9C 1JJUA 4IRSD 4YDVA 1AXSB 5BRZE 1S9XB 1ZT1A 4Q0XH 4HLZH 4BQCA 4PUBL 4JO3L 3BPLB 1E6JH 3BP7A 3K4DA 4PTUA 2VXUH 1QSVA 5JDSB 4G43A 3AS1A 5I1DB 2Y36L 1QRND 4WI6A 3REVB 3QZWB 5IWLC 5D1QC 5KOMC 3LMJL 2R4RL 2D0GA 5D1ZD 3QEUA 1N5YL 4P46D 1J1OL 3VWKB 4PR5A 5CKGA 4NN5C 3X13B 1FFPA 2OMBA 1AGCA 3RIAK 2NQCA 3QUXA 5F89B 4Z8FH 1INQA 4BUGA 2CDEB 3JTTA 2HJKB 3HI1B 4HUUA 2Y5TB 1BIIA 3QI9A 4FXKB 1OL0A 4PGZA 4EI5C 2W38A 4MX7B 1PX3A 5C2BL 1MFCH 4YAQA 2BNRD 3H7BB 1I9EA 1ZTXH 4JY5H 1DTUA 4JFHD 2I5YH 4PJGE 3PWVA 1NCAL 4JKLA 1CLYH 1P1ZB 4YUEH 5SV4A 5JHLL 3BZ4A 3FTGA 3MLWH 5AZEH 3KLAB 3BX7C 3EOBA 1XR9B 1QFOA 4PJIB 3B5GA 3DV4B 1FC1A 1E4XL 5D72L 4F9LC 4HZLA 2DWEA 4YX2L 3SKUD 4KGJA 3BWAB 3QUYB 3VXPB 3D5OF 5HGGS 5MEND 5JNYB 3C60C 5HYJB 3TO4C 1GSMA 1CT8B 1CGWA 1DQQB 3OAUL 5JA9A 3O11B 4YXKH 3WDIA 1U36A 3MRIB 4JJ5B 4FHBD 4YO0A 3UZEA 3IDGA 2VE6B 4HIHA 4OTXL 5TE7L 1B0GA 2EICA 4FTVE 2ZUQB 1RFDL 3KYNA 4P0DA 4OM0H 2VABB 2DICA 4RFEA 1UM6L 5HGDA 5T1LD 5D7JD 2Q7YB 1S7WA 1EO8L 1B0WA 1JGVL 3RQ3A 1UZ8B 5DDHA 3PHQA 2VDKH 1J87A 4UDUA 4QCIA 1YYMH 4NWUL 1FVDB 4NO0A 1OQOA 4U4BA 4HMEA 4GRWF 15C8H 2YSSB 2XWBA 4I18C 1Q72L 5F7UA 5HDOA 1P5UA 4Y4KB 1YPZF 1OF2A 3DPBA 2DMBA 1YEDA 3RIFF 1VGEH 1WFTA 5IMKA 1DQLL 4KVNL 4WEMB 1NFDA 4O5LH 3HPJB 4QGYA 5CLTA 3P0YH 3WNMA 1Y0LB 4P4KB 3V0WH 1KJ2H 3TH4T 3MNWB 5HVHB 4QXTA 1XGQA 1T6VN 3KJ6H 4HS8H 2I60L 4NRXB 5ISZA 2HJFB 4U31A 5KSUB 2PUQT 2QKIA 3HS0A 5DD3H 5K9OA 4AEIL 1JZ4A 3S4SG 4U6VL 3L6FA 5KSBE 3HG1E 4IRSA 4LHUB 3KDMA 3VXSD 4FQHA 5D6CB 5J0BA 3SHSA 4ZUSA 3WO4C 3KJ4B 3P73A 2HH0H 4RAUB 1A1MA 1QRNA 1T6WA 5F9OH 1HH6B 4M93C 5I1GL 1UJ3A 4NT6A 4JFFE 5D1ZA 4P46A 2LE9A 4I77L 3D9AH 5J56B 3MXVH 2AJXL 2XXCB 5DHYA 3DROA 5GGSA 4PGDB 4QXUH 2YRPA 3CK0H 2OL3A 4MHHG 2NR6D 3QH3A 4XNXH 2GFBA 4PJBB 4JLRA 4OF6A 5DMGD 2GW5A 3MLZH 3NFPB 5MP6L 4FP8L 4PS4H 4PJHE 4UNTA 1U8JB 1F42A 3NTCH 1X5YA 5JZ7C 1TZHA 3MRHA 4NN6C 3M8OH 1O7VA 5JW3L 3HZMA 4I3SL 1MCWM 3TH2T 2BNRA 2OSLA 3Q3GA 3OKMB 1H8OA 2C1PB 2ICWA 4LKXB 3LQAH 3MMEB 3ULVE 1NLDL 5CZXD 1HI6B 3EYOB 2Z31B 3VRJB 4QRRB 4BK4A 1T1YB 5D7IA 5D93B 4PJGF 1UXWB 3G6JF 1BHGA 1PG7L 4EJ1C 3CMGA 5HDBE 1XFPA 1KTKE 3MA7A 1RZ7L 1CWVA 3KS0H 5FO8B 5IESL 2ZOKB 5MENA 1D5BB 4JGJA 4OZIB 4X6BB 4ZUUA 1XF1A 4XVSL 4R97B 4QRTA 4J3UA 3TJEH 4JO2L 1HN1A 4H20H 4OCXH 1MAML 4FFZH 4OZGB 3C8KB 2NY0B 4P3DB 2FJGA 3QPQD 3SGJC 1BFVH 2GUOA 1A14H 1FVCA 1T1ZA 3I6GB 5F8RC 5J9PA 5DUMH 4NQDE 2CH8A 5K9JL 1C5DB 3I6KA 1A1NB 5T1LA 5D7JA 5HYQB 3RWHA 4IIQC 3O6ML 2H3NB 2YD3A 2J1KA 4HLJA 1KNOB 4WVRA 4RGMB 3W11C 4ONHB 3BP6A 5IW3A 2CXKA 5F6HJ 1T0NA 5J11C 1DLFH 4ODSL 3MRFB 1AP2B 3VXRE 2I26N 4HKBA 4MXWL 4NKMB 5I2IA 2BDNL 2JCCF 3AROA 2OLDA 5E5UB 4JFQA 4JZJA 4YGAB 1QUNA 1WZ1H 1UC6A 5T5NG 4PJFB 3IDIA 4HT1H 4WFFE 4MA3A 4X80H 2GSGB 2CUIA 2DQDL 4LSRL 1M4KA 1UKTA 4WHYG 3PWNA 4YWGH 1L4IA 4L5FH 4TSAL 5TQ0H 3T2PA 3LAFA 3UO1H 1SM3H 3LVEA 4UT9L 3BGMB 3L7EB 4M6NL 5FGRA 1X3DA 4M4RA 2IAMB 4ODVL 5DJ8A 2DLHA 5EA0H 1EFQA 1RURL 2FR4B 4S10A 4RIRA 5CCKL 1EHNA 1I8MB 4XB7A 3O2WL 1BIHA 4PUBH 2A73A 4JO3H 1QFHA 4YGVA 4ETQB 3C08L 2IBBA 3DHJA 1HNGA 3VXSA 1VFOA 2Y36H 3FQRA 4IJ3C 2OQJB 5KSBF 5F9DC 1CE6B 2XFXB 3LMJH 2R4RH 4Y19D 1AQDA 3SPVA 5EC1B 1N5YH 4LRNL 1J1OH 3FQTA 3HE6D 4M4PA 4EN3D 4U6XA 1YC7A 1AHWA 4K3EL 2CLRA 3BGFC 4YNYB 4NQCD 5GGVY 1BWWA 5E99L 4PJ5E 5C7XL 2NXZC 2Z35A 1S9VA 1QTYT 5KVDL 5C2BH 4JM2B 2XPGA 4ZOCA 5EPMB 5E8PB 3FFCB 5C0BD 3IDNA 4PJDA 3CFJB 2OI9B 1MHHA 5DYOA 1NCAH 5KG9B 4EDXA 4OGAC 5JHLH 5D2NC 2XN9D 4QRUA 4BQ9A 4GOSA 2MKLC 3VFPB 4DZ8A 1E4XH 4DKDC 5D72H 4Z76B 1I4FA 3ULVF 4YX2H 4LEXL 1S5IL 3T04D 1KF9B 2VITA 4S2SB 4JQVA 2EIZB 3V5DA 4LSTL 3EFDL 1IEBB 1PAMA 5JW4M 4YC2C 1F3JB 4X7EC 3OAUH 1IVLA 3MRRB 4PIRF 1QBLL 5E6ZA 2O26U 2GJZB 1H3UA 4OTXH 5TE7H 4P23B 2QV2A 4X83A 3O0RL 1RFDH 1HWHB 4XPGL 1I1FA 4WU5B 4JQIL 4PRNB 5HHVL 4YIQB 3KPMB 1UM6H 4NRYA 4X6CB 1F2XK 1QRKA 4N0UB 5HHMD 1EO8H 2P46B 5C92A 5HGHB 2GK2A 1JGVH 1KJVA 2NXYD 4L8BA 3ZHLA 4NWUH 1ORSA 3CSGA 4X9FA 2GTZA 1Q72H 4MZ2A 1DBBL 3ZDYF 1VEPA 1BF8A 1MCLA 5CSZB 1KIPB 5BOPA 2LAAA 1FFOA 3BEVA 4NRZB 4N1CA 3S88L 3Q0HA 5JXED 1FSKC 1DQLH 4KVNH 1KCUL 3OAZK 1QOKA 3O8XC 1F2QA 3HLAB 2UYLB 5E8EB 4I5BA 5I17A 1OAZL 1NFDE 3DX6B 5DJYB 2ZUWA 2CUHA 4U7KA 6CGTA 4PP1D 3ZT5A 4CNIB 1N8ZA 5INCA 1JNHB 4QO1A 5EUOF 2R4SL 2I60H 3KPNB 3CU1A 5JIHA 4P5KB 5ESAB 3RL2A 2B1AL 1OCWL 3DRQA 3V9FA 3O9WB 5ISZE 2E7LA 4RNRB 4XNYL 3BD3A 1G7JB 3NAAL 4P5TD 5BW7C 3N1PC 3F5WA 4JFZL 4PLJC 4AEIH 3ELAT 4PJ7B 2WUBL 4UTAL 4RAHA 1MHPL 4U6VH 3ZE1E 3GMRB 2JTDA 2VLJD 3DVIA 1U92B 3PQYD 1Q0XL 1H3PL 2KKQA 3SEPA 3VXUD 3ARZA 4D2NA 3QNYB 2BVQA 4NKDA 4PRAB 4G7YL 1HHKA 3HA0A 1R0AL 1S9YB 5I1GH 4EIGB 3DIFB 4U1SA 2FSEB 5T33L 2O61B 1QRNE 4Y19A 2E7BA 4HWNA 3ALWA 4I77H 2QSTA 1KN2L 2AJXH 3HE6A 4EN3A 4F15C 2NY1D 5FM5M 1M7DA 4ELKA 1PG7W 4PJXE 3QNZB 4NQCA 5EZOL 4Q2ZB 2LV4A 3TVMD 5MP6H 1G7HB 4HD9A 4K8RD 4FP8H 1BD2B 5I75B 5JW3H 3B9KB 4I3SH 1ZA6A 1WBZB 4X6EB 4HKXB 4HIIB 2V5YA 5J7CC 3L9RA 1IGCL 3EYVB 3N85L 2BNRE 5C0BA 4LRIA 5IW1B 1NLDH 2XKSA 3EFFB 4JFHE 1MFAL 2X9XA 2XN9A 4LL9A 2FH8A 4HEME 4Z0XA 5F1NA 1PG7H 5IB4A 4AM0A 3GMPA 1Q9WB 4JN1L 1RZ7H 3MJ6A 2H9GB 3ARFC 2R0WL 5IESH 3V4UL 4GG8A 2ZJSL 1I9IL 1BQSA 3EDDA 2BY0A 5MEQA 4NSKA 3B9DA 4JO2H 3H3KA 1B6DA 3UJJL 2PNDA 4XPFL 1SYSB 1MAMH 3I84A 4Q58C 5AD0B 2OR7A 3QFJB 3MV8D 1LP9B 5EU3A 1NBQA 2ESVE 4MXVE 5K9JH 5HD8C 1JHLL 3RNKA 4ZFOL 2VLRB 3DECA 3O6MH 2W0FA 4NHUA 4PRIB 3M1BA 3BIKB 2UUDH 2FLBT 2NW2B 1BZ7A 3FO9A 4RMRA 5DJ6B 1HILB 4LNRA 4Y16B 1ZVSB 1UFUA 1QG3A 1LO3L 1NL0L 2E7CA 4LP5A 3GNML 4ODSH 3RGVC 1K3IA 4MXWH 1CDUA 4NQVB 5F7MC 2BDNH 1WWWX 3V8OA 5FDYA 5JXEA 1IAKA 4NNYB 1BOGA 3EZJB 3PGFL 1VGKA 2DQDH 2H6PA 3BYYA 4LSRH 1U3HC 2EEAA 5ICYB 2JJSC 3ES6A 3LEYL 4TSAH 1HHIB 4LOUC 4UT9H 3VA2C 4M6NH 3BPOB 1NGXA 3EO1B 4ORZC 4ODVH 3SGKC 4HAFA 5ID0B 1RURH 3N9GL 3SDDD 5GISL 1HQRB 1DSFL 2W59A 3LIZL 3OJ2C 1J12A 5CCKH 5GGTA 4P5TA 4X4ZA 2WBJC 4Y89A 4GG6F 4I48B 4GUPA 3MRMA 3O2WH 3G5ZA 4ZXBD 3V7MA 1TFHA 1YEGL 1FYTE 2BSTA 1B0RB 4Z78B 3O41A 4JGUA 4OCRL 5LQBL 3C08H 1D6EB 2NY6D 2VLJA 3IFPB 3PQYA 3FFDA 2P7TB 3JWNC 3VXUA 4DFIA 2RQ8A 2G5RA 5HYIA 4HFUL 2X1WL 4FNLL 5E5MA 4UU9B 4LRNH 5JHDB 1W0VB 4J3WA 1FIEA 4L9LA 2DTML 4LVOC 4M9PA 5ICZB 3LDBB 4K3EH 2FGZA 3VD7A 3U0TA 1E27A 4PJBF 3VG0L 1JZ5A 5E99H 2DLGA 4Y5VB 4GJTB 2ITDA 1F4WL 4HWBL 5A16A 5H37H 1QYGL 4WHDA 5C7XH 3G5YA 2VL5B 5KVDH 4UTBL 5CBEA 3TVMA 3RWJB 4PJXF 1J9CT 1XGRB 1NGWB 4M5ZL 1CDBA 3V0VB 2FJHA 5EN2B 3CMOL 1IBGL 5I1EL 3CFBB 5F7HA 5DK2B 1DDHA 3VRIB 4PJDE 1YJDL 5HGAA 1MJJA 3TWCL 3C09B 4Y5XC 3FZUD 2BSSB 1NBZB 3DV6A 4IM8A 3G9AB 1FZJA 1S5IH 4LEXH 3T0XA 5DFVC 1DLHA 2Y7QB 4NUJB 5DEGA 2IANB 3D0VA 4YHPB 4RGOL 3BN3B 3SKNA 3QEQB 1MCDA 3EFDH 4L4TB 4LSTH 4YFDB 3RJQB 4LPVA 5C9JA 4JFDD 1N6QL 3TZVD 1QBLH 3O3UN 1MSPA 2ICES 1FO0A 4BSVB 2YWYA 4ODHL 1QLRA 3O0RH 1XGYL 3KPLB 2FEDD 4XPGH 1UG9A 4OD3L 3HPLA 4QHUA 1YPZA 4JQIH 3P9WB 5HHVH 3QJFA 4WW2B 2PYED 2H2SC 4MQ7B 3CFKB 3MV8A 5IROC 1AGBA 1A1OA 4PBWD 4XBGB 4RFNC 4DVBB 4Z95L 4NO2B 2Q20A 2XTJE 5A2FA 4YDJA 1JI2A 2X2YA 4J12A 2CR6A 4PRPE 3OB0K 5F1SA 4NQXB 4QNPF 1DBBH 3JWOL 1Y6KR 3VD9A 3K1KC 1U8QA 3BP5A 4Q6IC 4KJQD 4S1RL 3UROR 3S88H 4IS6A 1KCUH 4X4MA 4EUPH 3VE0B 4CRPA 1OAZH 5D1XD 3T65A 2DM7A 3GUTB 1AO7B 4C83B 3L3HB 5GHWL 4QHMA 12E8L 1MJ7L 2R1XA 1RZGB 1BLNA 3WN5C 1P7HL 1FNSL 2R4SH 2A74B 5BS0D 3LKPA 2ATKA 2B1AH 1OCWH 4GBXD 2WIIB 3I02A 5IB2B 1UB6B 4GKZB 4XNYH 5C08B 3GGWA 3NAAH 4LCWB 3VXTA 4FXLA 4JFZH 5DTFA 1S7RA 2WUBH 4UQ2B 3SDDA 1A7NL 4UTAH 1MHPH 3IXAA 3GB7B 3U9UA 3MGAA 2VISB 3VXNB 3V52L 2DYPD 4N0CC 3W9DA 4ZXBA 3DX9A 4M8VA 1Q0XH 2OJEB 1H3PH 3OJMB 3FT4B 2CO6B 1AIFA 3DXAD 3LKQA 5SV3A 4HK0A 4G7YH 1PG7X 1R0AH 1T3FB 3GMOA 4D3CL 5EOCJ 3BRFA 4JAMA 1KN2H 3IKKA 5F7NC 3SO3C 2AXFB 2QJDA 3ZSTA 3U30C 2HFGL 3ZYZA 3AC0A 5DA0B 3VFOB 4O2FB 5EZOH 2W0LA 4QTIL 3ULUD 4Z77B 3KVQA 4NQCE 2AQ1A 4MDJA 1T0MA 3BKJL 4CU7A 1JIBA 3B2UD 2YA0A 5CBAB 2XV6B 5ITFB 1ZS8A 1WITA 2KUTA 4O51B 5ICXA 2A6KB 1IGCH 3N85H 2XI9A 4PV8B 4OAWA 5DVKA 5F1IB 1KPRA 1BFSA 2JE8A 4JFEE 5C0BE 2YD5A 4LQFL 4AY0A 1HQ4B 4C55A 1MFAH 3C9NB 1RHHB 1A6UL 2WK2A 3SDYL 4KRLB 4NHCL 2HVKA 5DQJB 4AIZA 3H8NA 3O6FC 5IJKC 3DUUA 4KROD 4DFHA 2XN9E 4ZOAA 1A6AB 5E95B 4JN1H 2ZCHL 4KKAD 3LQMA 3S6CA 2R0WH 3V4UH 3QULA 4UUJB 2ZJSH 1I9IH 5DQ9B 4HXAL 3KHQA 3RVVC 4JFDA 5SWZB 3MRKB 3TZVA 3UJJH 4XPFH 5L6YL 5JPNA 5JW4N 1NEUA 1JHLH 1A4KB 3RTQB 3VFSB 2PYEA 2ICCA 4LPUA 2NY2B 1YUHA 1V3KA 5E6IC 1MQKL 3MOBL 5EO0A 3OKOA 4BQBA 1PW3A 2EH8L 4M00A 5B38A 1U8IA 5DO2C 4ZAKC 5JW4R 1LO3H 1XGUB 1NL0H 4DEPC 2RFXB 3DO3A 3GNMH 1Z5LB 4P9HC 4R0LA 5CWSB 1QVOB 3BDXA 1RIUL 2W07A 2FO4A 1GZQB 4ORGB 2H2PC 3D69B 1UKSA 3MLSL 1FNAA 2EYSA 1I1AC 1MAKA 4OQTA 4ODWA 3PGFH 4CU6A 3EDEA 4HH8A 5D1XA 5J6HA 3P0VL 4ODXB 2DRUA 3LEYH 1IM3A 3NBNA 3VWKD 1KXTB 4ZDHA 4BSWB 4JVUA 3ZZ1A 3K8KA 4P4RB 3JV6B 4FQPA 4PJ7F 1DBKL 1ZKAA 4XVUC 3N9GH 5BS0A 5GISH 4GBXA 4LHQB 1DSFH 3LKOB 2W65B 4XPBL 3Q1SL 3LIZH 3LQZB 1IQDA 3DVNB 1YEGH 2D7OA 3KPQB 4OCRH