2XQBH

Crystal structure of anti-il-15 antibody in complex with human il-15
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
227
structure length
227
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYSFSSFGISWVRQAPGQGLEWLGWISAFNGYTKYAQKFQDRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPAAWPLQQSLAWFDPWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a High Affinity Anti-Il-15 Antibody: Crystal Structure Reveals an Alpha-Helix in Vh Cdr3 as Key Component of Paratope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords INTERLEUKIN 15
total genus 45
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2010-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqbH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xqbH01
3ISWA 4ZQKA 4MQTB 2AXFB 2WSKA 2X4RA 1YEFL 4K7FB 1VFAA 2Z35A 3BJLA 1KLUB 2HJLA 5JNYB 2WQRA 3ARXA 4NBZB 1JTOA 3RNKA 5L9DL 5I17A 1U8JB 1G7IA 1ZVHA 3C2AL 1HN1A 5EUOA 1XGYH 5IVNA 2D03L 2A74A 4R0LC 1K2DA 1HHGA 3TV3H 1NEZG 2NCMA 1ND0A 3W9EA 1MHCB 1ZTXH 2LAAA 2XQYK 2ZUQC 4ODWA 2Z0BA 5FYKH 2NY7H 2IH1A 2J4WH 4H20L 4PRHE 1G7PB 4KTDH 4O2FB 3SOBL 4LOUC 4NUJA 5DSCB 1I4FA 1T1YB 5J6HB 4TULL 5T3ZD 3JTTA 2AABL 3F5WA 2LU3A 2FX9H 2RIKA 1INEL 5IV2A 4XCNA 4HUUA 3VFUA 3MLXH 3CFJA 3UTPE 3E3QC 4MA8L 2H9GB 5AZ2L 4LHUG 2D0GA 4QRSB 3V4UH 5DVLA 4M93C 1D5ZA 3HPLA 3QQ4B 5I66A 3NA4A 2UYLA 4PJCA 1MUJB 3RWIA 1HNFA 4J3SA 4OD3H 1MH5A 1JHTB 4XNXH 5IM7B 4ELKB 1AR1D 4MQ7B 4G9FB 1J12A 3VWJA 4PB9L 2ICES 1FVDA 1PY9A 1QR4A 4JFOB 1NGQH 3LKNA 3QIBD 3WNKA 3B8YA 3CX5K 1WGOA 5IHUL 4UV4H 3RP1A 1VPOH 4NHUB 1FNAA 4NO3A 4I2XE 1S7QB 4G80A 1S7VA 4KPHL 3GSOB 1C08B 1H15A 3T8XA 5CD3B 3U7WL 1HH9B 2XKNB 3EO1A 1QSVA 3RU8L 1CU4H 1NFDB 1SY6L 1LP9A 4NQEA 2EIZA 3W2DH 1U93A 1DBAH 1F45A 2UZIH 3T08A 4JY5L 1RZIA 2IPKA 4GAYB 5FM4A 3GIVB 1Y6KR 4H0GA 3ARPA 5IB2A 3VFOA 3O4OC 3EGSA 2OSLB 5B38B 3DI3B 3JWDC 3OAUL 3BZDA 5I8CB 1FFRA 5SV4A 4YIQB 3BPCA 2XWJA 2ZCHH 1XF2B 2VLKB 2W0FB 3DX9A 4JGMA 1Q9WA 2ARWA 5LVEA 2CDGA 3DV4A 3KYNA 5C71A 4UV7L 4ZSOE 5ELIA 1F6LL 5DHXB 4E5XA 1HIMH 4JRXD 4NJ9L 5DQ9A 4MGXA 3BUTA 2XA3A 3KPRE 3F7YB 3BX7C 4EBQH 1PKOA 1UZ6F 2IQ9L 5IEKB 2XRAL 5D8JL 5E03A 2IAMC 1NEZB 4RWYL 3RY5A 5B39B 1BF8A 1MSPA 1MIEH 4NGHH 1FORH 5JPNA 1CICA 5FCSH 2V17H 2BZDA 2ITCA 2D7OA 3QUYB 4MVBD 4WEBL 1HXYB 4L8BB 1TJGL 3DV4B 1UH3A 3E8UL 2DQEH 2QQKH 5I1KL 3C8KA 4ISVB 2OI9C 1MLCA 5IBUB 2EH8L 1EEUA 3RIFF 2CR6A 1I8LA 3AXLA 2IC2A 4W4OA 5C0RL 4KRMB 5B38A 1DZBA 3G5YA 3P9MB 4WY7H 3RL2A 4L8DB 2HT3C 1I1FA 1RHHA 2W9LA 2O26U 4GKSB 3S5LA 4X9FA 4NQEB 1N2RB 1QFPA 4H8WH 5MEQA 4KQ3L 2NYYD 1IC1A 4N9GA 5AZ2H 5EBWB 1NCUA 5FO7B 1YY8B 4QHLB 1J0IA 3GSOA 2F19H 4H5SA 3W0WA 4GW5B 1S7VB 4G80B 3KAAA 5J13B 3LDBC 2RJMA 1FZMB 4YJZL 4XNXL 1A3LL 4G8GA 4HC1A 3UYOD 4ODXA 5LJYH 3WJJA 3K7UA 5EWIL 5EOTB 3VXTA 2XY2A 3VWJB 1ZKAA 4M3KB 4G9FA 1YQVL 1M7IB 2J8UE 4MB3A 2DMBA 1JHTA 3D3VB 3FB7A 2P4AB 3IDXL 4AG4L 1GL4B 3L7EB 3LS5L 3U6RB 3MLWH 3QQ4A 4RMQA 1JCKA 5GS0C 1XAUA 4J3WA 5K59E 3ULUD 1A7PH 4NQUA 1M6OA 4S2SB 1QLEH 2YK1L 3EYUL 1W8NA 5LCVL 2FGWH 1ZA3A 4NUJB 1BM3H 3H9YA 1G7PA 1D9KC 5HI5C 4PFEA 3UP1A 1DP0A 3O4LD 4ZTPH 3WIFA 2GK0A 1B88A 1XR9B 1CXIA 3SKNB 1TVHB 4NNXB 3WFCL 3TP4A 4TSCH 4YDIL 1HHGB 4HWBH 4AEIL 2A74B 2CRZA 4YGVA 5E2VH 5EOCJ 4HG4J 2XTJE 3UO1L 2BY1A 2RB8A 2X10A 3ZKXC 2FL5B 2OR8A 4HDIA 1N5YH 1KJMA 4PJFF 4GBXB 4K7FA 1PG7L 2AXFA 3NACL 1HSAB 1AE6L 3WDIA 3ARBA 3DVIA 4R4FL 3KPTA 2AI0L 2YPLB 2FX8H 3GJEA 4PJ5B 4EBQL 1WITA 3RA7H 4OZIA 3C6LD 2XRAH 4HZAA 5D8JH 4CDHA 3A6BH 5C09E 1JF1A 2A38A 3G6JA 4EQ2A 1KELH 4NGHL 1DDHB 4M4RA 4HUXB 1AGCA 1IAKB 2V17L 4P23C 4Y19E 4WEBH 3VXOA 1UB6B 3MUJA 2B2XL 1QUNA 2QEJA 3E8UH 2DQEL 2QQKL 4PBXA 4P2CG 3DRQB 1PSKL 2NTFB 1S9WA 4BZ2L 1DL7H 2VYRE 2CXKA 4Q6IC 3K4AA 4G7YL 1NAMH 2E9IA 2JCCE 4LCYA 5CD5D 1HCVA 5C0RH 1F3RB 3Q1SL 4PTTA 5C3LD 3P4MA 4X80L 2DRUA 1JF5A 3DROB 1VDGA 5I1GH 3WS6C 3U83A 1T2JA 1B3JA 1OSZA 1F6FB 1FYTA 4K3DL 1F2XK 4QHNB 4G6JL 2C9AA 3T77B 1UG9A 5HHVL 2YZ1A 1S7WA 3AS3A 2B5IC 3EO0B 3DO7A 1YJDH 1MCDA 4PD4J 5HJ3A 4Z7NE 1FGVL 3GIZL 3LS4H 1DBML 4ZUWB 3BKJL 3SGEI 5J9PB 4V2CB 2APXA 3WFEH 3LKOA 1HDMB 1CE1L 5C0IA 2IPUG 1HWGB 1K5NB 4I77H 1UCBH 5D9SB 4NN7C 3AB0C 2R1YB 2R1XA 5FDWA 4P2OA 3ILPA 1NBVL 5D2NE 2GITA 1OHQA 4M5ZH 3AS1A 1FAKT 3PWPE 4QRTB 4U2YA 2VXQL 3ULUF 3GFUA 1NKRA 4K7PX 1RV6X 4IDJH 4D94A 5C6TL 4LPCA 4LCWE 4OQTH 5GGTH 3O11B 3T2QA 2ATKA 3VXNA 3UJTL 1L4IA 4M93B 2WUBH 4RAVB 1A7PL 3HI5H 4S1RH 5E2UH 1R0AL 3IU4H 5IOPA 1S7UA 3V4PL 2BNRD 2FSEA 3O9WD 1BM3L 4WI3A 3TCLA 3DJ9A 2GCYA 1T6VN 4ZTPL 3LN5A 1AQKL 2C7UB 4NZUH 3T4YB 5I8KL 4V1DB 4I1NB 1MRDH 3VJ6A 4BFIB 1A3RH 1AY1L 5ID0A 3KPNA 4XI5C 4PJ7E 1WICA 1SEQH 5D1QA 4Z9KB 3SDXE 3GBLA 2OP4L 1JNHB 2V6HA 5KANG 4APQB 1E6JH 2EDOA 1CD9B 4JANA 4G8EB 4ELME 2DQHH 1PG7H 2SEBA 5DF0A 4MSWB 5KVDH 3QUZD 4LQFL 3BKYH 3L9RB 3OJMB 3U9UA 1HQ4B 1MLBB 3DXAA 3NACH 2RQ8A 1A9EB 5LWYL 4OZ4B 1KN4H 2NMSA 3GB7B 1OD9A 2NLJA 4E41A 3PQYB 3L3HB 1NAMA 5HGHB 1JF6A 4XP6L 4XCYB 1QZ1A 5DTFA 1XCQA 5J3HD 3A6BL 1FAIH 4FTVA 5MENA 4D8PB 2NNAA 1CXLA 3WE6B 1MI5E 4D9LH 1U8PB 1LEGA 2LVEA 4LLDB 4TNVK 1HOCB 4F58H 1VADB 3FT3A 4WHTB 5FGCB 4TQEH 5FV2A 4F9PA 4S1DC 1HYSC 5GRUL 5MHSD 1NAML 3QDGB 4PRHB 4ETYA 1OT1A 2C3VA 4DZ8B 5IK3B 1J87A 1P4LB 5DZLA 4MA3A 3O2DA 3OKLA 4X80H 4IOFC 4Y2DC 4E41D 2PTVA 4Y5YA 3BESR 2HN7B 3HUJB 2B39A 2F53D 1X5JA 2VLRB 3ZTJG 4ZUSA 4YHKL 4WGWB 3QWQB 2CKBH 2YZ8A 5C0EA 1UWXH 2HT4D 5F21B 1DQLH 4KROC 4YK4C 5I19L 4MQSB 2X40A 1QLRB 1JHKH 4PJ8C 2EYSA 5I1EH 1X5IA 4HJGB 4RSVA 3LEVH 5L2JA 4GMSL 1NMBL 5GSRB 2Z8VC 3ET9F 4DWHA 4DOHB 1MNUH 1QSZA 3QO1A 1T6WA 1UZ6E 2VITB 5EO0A 1P5VA 1ROWA 3TVMC 3VFTA 1S9KC 3IAGC 3MJ8B 3SGKC 1V8HA 2UUDK 1RZJL 1XH3A 3MRJB 4UMGA 5DK0B 3BKML 2IAND 3ARFC 4KHXL 4GAJL 1NBVH 1TZHB 2X7LB 5IEHB 1FVEA 3JWNC 4L29B 4YBQD 1BEYH 4LVOC 3IRZA 3ALPA 2E9JA 5BQ7A 3QDME 2IG2H 3FT4A 1KBGL 2A1WH 4O2CA 4YDLB 1VB9A 3CPLB 1K8DA 3FCTB 2B1HH 5F7YC 3PGCB 2NY2B 5GGTL 3PP4H 1JTTA 2ED9A 3DX6B 2UZYB 4OTXH 3UJTH 3L3JB 1VACB 4M7ZB 4D0CB 1OSPL 3T1FA 2MPAL 3WDHA 3FFDB 4HEPG 1ORSB 3U30C 1NLBH 4HFWA 5GIRB 1ZHLB 5C0CA 2CGRH 4MJ5B 3IU4L 5C0GB 1KIQB 5C8JA 2PXYA 1E27A 4PY8J 3G6DL 5H2BA 3FAXA 3RQ3A 4MHHI 4AMKL 5CKAA 5FOBB 5E8OA 3TNMB 5I15H 5EU3A 2YC1A 1ZS8B 3UC0H 3WUWB 4C54A 4WTXA 5DXWA 3OSKA 1A1OB 5I8KH 1QPPA 2DQDL 4MLIA 4DFIA 5GJTL 2R9HC 3HMWH 3FT2A 3FN3A 5BW7A 1DQDL 3GSRA 1XGTA 4JKPH 3RWEA 4QOKB 1BOGA 1S3KL 4RMRA 3SY0A 3TN0B 4M8QA 3VI3F 1IAII 4YLQT 2P5WD 1I1RA 3BKCH 3R8BB 1KC5H 1WSST 2KQMA 1JK8A 5FB8A 2DQHL 4PJCE 5GRVK 5C9JA 4G9DB 3GM8A 1XGTB 5F88B 2UVFA 3MRMB 3UTZB 1MIML 5LWYH 3HZYA 4AJ0A 3JWOH 3BGFB 3V6OE 4PJEF 4WFHD 4YPGB 1S5HA 3IDMA 3WUWA 4XXCC 2VR4A 3CDYA 4L3EA 2V2WA 3F6IA 5F97E 1ZHLA 2NTSP 4UT7L 3ZE1F 2A83A 4R2GB 3TIEB 3BIAX 4GKNB 3C5JA 3NBNA 2QADC 1FYTD 3CLFH 3LQAH 5DMIL 4CRPA 5LGJA 1MJJB 3PGCA 4PR5A 4I3SL 1XCTA 3WN5A 4RGNC 2ARJB 1J05A 3QUKB 5DJ0A 2YWYA 1S7RA 3H3KA 2OJEB 5A16B 1X6NA 1L7IH 2XNAB 1GZQB 3L5WB 3GDBA 3MRJA 3QIWA 2JJSC 4TYUA 4P3DB 2BSTB 1J1OL 3TPKA 2H2SD 5CGTA 3C9NA 3U79A 5CWSA 5I8EA 1JPSH 3AFLA 4FTVD 5J6GB 5MEND 3FZUC 3K4ZA 5FXCH 4A2LA 5IESL 3G08B 3N1MC 4MYWB 5DJ8A 2BNUA 4Y5VB 4Y1AD 2VZVA 5GSRA 3GSNH 3QXAB 3MFFA 3BEWB 3IRPX 3VXPB 4G6KL 4NQED 2WW8A 4OIBA 1N64H 5FHAL 2DQGH 3IJHB 4O02L 4XBGB 4DEPC 4K71C 4IIQB 4OLXH 2PW2B 4GRWB 1MRFH 4XP5L 2VLRA 2A2QT 1U3JA 1RVFH 4PJEB 4HT1H 2Q20A 3X14B 4AENB 4KJYB 4OTXL 3QDGA 1X5YA 2LAGB 1OSPH 4Q58C 5FYJL 1BFVL 2MPAH 5E2TL 4E9LA 1V3KA 4LLAA 5E8EB 4WHTA 3VWJD 4CJ1A 1Z5LB 4FXKA 4BSWA 4ORGB 1DQJB 4I48A 3FQUA 4PTUB 1GOGA 4S0TD 2VLRE 5EUKA 1FNSL 1QEWA 2G75A 3V4VL 1XCQB 4P4KC 5GJSL 1MAML 3MLPA 5ESVB 3UC0L 2MHAB 4JCLA 3IS1X 1CFVH 3VMPA 1KTDB 1S9VA 3AU1B 2X1PA 5DEFB 5GJTH 2NR6D 1GC1H 3T3PE 4P5TA 2ARJQ 4JKPL 4O9HL 1S3KH 4LAQH 3U9UB 1R5WA 2X6MA 3M17A 3CDGB 1CGXA 5FK9B 5MP6H 3UTSD 3HLAA 3LEYL 4RMSA 1Q9LA 1NDGB 5DYOB 4G9FD 5EIIB 1WWCA 5IBTH 5C0JB 5LQBH 1JNHA 2NZIA 3ESVF 5EB9A 2HT2C 2YUZA 4WI9A 1IEAA 3KPNB 4U6VH 1A7NH 2ICEA 4PP2A 3MREB 1A6PA 1KJ2B 2C7UA 2EE6A 2BNQA 3T4YA 1QBML 1FZKB 5I1CH 2DBLL 1YUHB 2H2SC 2HG5A 3VXRE 1F4YH 2IWGA 3RWFA 4HK0B 5L88H 1MCOH 2O93L 3E6FB 3ETBF 4JPVH 4MD5B 5D4QA 5IQ9A 1T83C 2NY6B 4P2RD 1JJUA 5C0DB 3MV7E 3FQTA 1UQSB 5E8NA 1R3KA 3L1OH 3CFBA 7FABL 3C60A 4S0SD 3BW9B 3QG6A 5DRZB 4I3SH 2GKIA 4QNPE 4QRTA 1U91A 3BI9X 3FO1B 1A7OL 4NFDA 3ILPB 3HZVA 1L7IL 4TVPH 1MEXH 2HLFC 2Q76B 4FQXD 4K23L 5IMOB 1U36A 4PUBH 4ZS6D 1JGDA 1K5NA 1L7TL 1J11A 2DQTH 1Y6MR 1B9ZA 5E6ZA 5EU6A 4P59L 2CXGA 2AVGA 4EN3C 3GJFH 2B1AH 2XN9D 1OF2A 3GSVA 3QIUD 4GUPB 3EO0A 1ITCA 3O2WL 4NQEE 5IROC 5ESAB 2D7PA 1KJ3L 2Z8SA 4FXGB 4ZPTB 4QHNA 4L8CB 3QXDA 4F7PA 1RIVL 4NN5C 4GT7A 5CKGA 3D2UB 3UX9B 3MV7A 3DROA 5EIVA 3SCMD 1KCRH 2HVKA 1EGJL 4TTDD 1HZHH 2FX9L 3HMXH 2HMID 4F37K 1JYNA 1XGUB 3MRBA 1YEIL 4JJ5B 5I74B 5D1ZB 3FO2A 5JXAL 2C26A 3RAJH 1NUGA 5ITBH 3AVEA 4CMHB 1U8IA 1EJ6A 4NO0B 1I1AA 1EDQA 1ONQA 3UYRH 3HAEA 4OZIB 4HZLA 4J1UB 5DRNA 2C5DC 5A3IC 4D0BB 3KPRD 5C08D 3RIAF 2BVTA 4KPHH 3QUMH 1KG0A 2I60H 1UM6L 3IJSB 3MUHL 2FL5A 1S78D 3H42H 4HUNB 5IBTL 4QTHA 2PW1B 1ZEAH 4WW1B 4P23A 4WW1A 2EDFA 1WBZA 1WT5A 3MO1B 6FABL 3AS2A 1VFOA 3BPLC 1TVHA 5IFAL 1BIHA 1VFBB 3O3AA 2DYPD 2HRPH 1FLTX 1N8ZA 3WIFB 3O9WA 5E94A 3CSGA 5HYJA 3SE8H 5TGBA 3KXFD 4HZLB 3UTTE 3MXVH 2X4PB 3MGOB 3OAUH 5SWSA 4LNVA 1KPRB 2KBGA 1BGXH 1MJ7L 1F4YL 3U46A 4JO1H 3NGBC 1MCOL 1U6AL 4UOW0 4A6YB 1U8IB 2XQYG 4H1LH 3OR7A 1I85A 4KMTH 1I7UB 1ZE3C 4ZUTB 2ZUSA 3L7EA 4TPRH 4N8VG 3FO2B 2CIIB 2FBJL 4JJ5A 4NJ9H 3MACH 5JOFA 4NUGH 1MWAB 4Y16D 5KS9F 5FEBA 2XTJB 2E27L 2IQAA 2X41A 3CU7A 3UTOA 5SWQA 2AJZB 3D2UA 5ADOL 5EZIH 1OWWA 1H5BC 1XGRA 2JIXB 3HE7B 4YXLL 3FMGL 5BJTA 4KTYA 3FB8A 5JW4N 3VRIA 3LHPH 5FO7A 1OD7A 3B9EA 3PV7A 2IANE 2OCFD 4GUPA 2X09A 1KUMA 2A9NH 1OF2B 5DO2C 2EH8H 1WC7A 4U0RB 4HWZA 2B0SL 4KI5C 2G9HB 1RULH 4PLKD 5AAWA 2ED7A 2FEDC 2Q6WA 1IZJA 2A6DB 4XHJC 1RHHB 4FRWA 4K9EL 1EIBA 4JGJA 4XB8A 3IDIA 5IMOA 1VGEL 1I7RA 2OTPA 3QFJB 3V6ZB 3QFJD 5ANMB 5KJRL 1F8TH 1F90L 3AXLB 5K9OA 1HZHL 2LE9A 1MCFA 4X7CC 4KUCF 1Y18B 4ZFZA 3HMXL 4DKFL 4HH9B 1O7SA 3V0WH 3QI9B 3BW9A 3QG6B 5E56A 3CVIL 3LH2H 4NN6B 4GRWF 4C4KT 4H8WC 3DX8B 1UQSA 1CICB 5CSGA 5C0DA 3RAJL 3REVA 3CU1A 2AJYH 3MRLA 4FABH 4F15C 4UBDC 3RVUD 5MHSE 5C2BH 3RWFB 4WUUE 1QSEB 5EWIH 4RBPK 2OK0L 2ZP0T 1QSEE 3QUZC 1I3UA 1W0VA 1H8NA 3I6KA 4M43H 2QQNH 5DQ9B 3K74B 4X6DA 1MFAH 3OQ3B 1KJ2A 1HILB 4HUVA 4JQVA 3MREA 2ICEB 4PP2B 4ZS6C 4XC1H 4YFLI 4LARH 4LEXL 2HT3D 4HXBH 1UM6H 2KZWA 2X9XA 5AG8A 3UTSB 3CFIC 2W0FA 4UILH 1QLEL 4OIAA 2BP3A 4BQCA 4PJAF 3EYUH 5LCVH 1NDGA 4WWKD 2Y6SC 3HLAB 5D1QD 3LKPA 2XI9A 5JW4R 3M17B 5IB2B 1H0DB 1T7ZA 5KVEH 1U8MA 2ESVE 2GFBB 2X4OB 1S7TA 2FYYA 1QNZL 4RGOL 5JW4M 3LN9A 3EZ8A 1KTDA 1S9VB 1GGBH 1LP9B 5SX5H 1U6AH 3KYAA 5ISZA 1HH9A 5JA8B 3HPJB 3WXWH 5IW3A 1H15B 4KMTL 2ATPB 1K4CA 1NUNB 2VLMD 3FQUB 3RGVC 5D1QC 1KTLB 4BZYA 4P2RB 1RUKL 2AQ2A 2V9RA 4N0CC 5E8EA 43CAA 2EKJA 1QLFB 3HC3H 1JV5A 3QWOA 2VZ3A 3LKNB 2AJUL 2AJXL 4L9LB 2FX8L 3X14A 4AENA 5JW5B 4PJEA 4PJIB 4APQD 3K2MC 4KKCC 4OBSA 2EIDA 1T7WA 5ADOH 4KTEH 1NGXB 1D3CA 1J8KA 4G6ML 2UYLB 4PJCB 3VXMB 3FMGH 5KSBF 4ZG1A 4IJ3B 1NSNL 2NY4B 3ZZ1A 2NY6C 5KOVC 3CGTA 4PJ7A 4WI2A 5DZOA 2RGSA 3VXPA 1PSKH 4XC3L 4NCC1 1JPFB 5E08H 3ECBA 5F1NA 2GSGA 1HYSD 1UM4L 4C58B 1F3DH 3WSQH 4LSUH 3JTTB 5DC4B 5J6GA 2VR9A 1FG2B 3QQ9C 1W72A 4A6YL 5KSBE 4RQQA 2VSDA 5JMOC 4GW1A 5DHVA 4Z7VB 1VERA 4UB0H 5HHOB 4ODWB 4NDMB 3L5WA 4M5YL 5KJRH 3QUYD 4N8VB 4P9MH 4L4TE 4Y5XB 2OJEA 4FS0A 4WFFE 1DQQB 2EYTA 2X70B 2A6KB 2HTKC 4LLWA 1YJDL 3BN9C 3LAFA 3I9GL 2I07A 2PXYD 2APTA 1VFAB 1F4WL 4POYA 1WIUA 1QFUL 4CADB 4XWOD 2A83B 2XYCA 5D2NB 4I77L 3L3KA 5EZLB 5EU5A 1RQ5A 4PV8A 2C3XA 1MQ8A 1KPUB 4LDLB 4KK9D 4I18B 5H35B 1HHHA 4XCFH 4JRXA 3C5SA 3BWUC 3LV3B 5HHOE 3AREB 4TTDC 4MAYA 4UT6L 4YPGA 4IDJL 1MFAL 1WBYA 1P7HL 3GO1L 2ZOKB 5INCB 2GY5A 4K3EL 1CWVA 5HGBB 4GFTB 3O0RL 4LEXH 5T1KB 4HXBL 3VGDA 5DJXB 4ONFL 5B8CC 4P46A 3LRGA 1JUFB 5BXFA 5C9JB 3VMNA 3C6SA 1R0AH 3T3ME 1WTLA 2PYEA 1NPUA 1Y0LB 4NZRH 4NC0B 3V4PH 2EEBA 3QO0B 4M7KL 1PX4A 1DVFB 4O2EB 4G7VL 4YXHH 4Q9QH 2E6JA 4C83A 3MBXH 2COQA 4LFHD 4QOKA 3HKFA 2EDWA 1U2CA 1V7NL 4HBCL 3Q3GB 5FAAA 4HAFA 1D9KD 4OAWB 5F9WB 1IQDB 4F33A 2DKUA 1GGBL 3RIAK 1Z3GL 5EO9B 5CP7B 2ADIA 1RI8A 3FHAA 4Z7WB 2OTWA 1WV7T 2XTJC 2OP4H 1LNUB 5EU3B 2W38A 4WJ5A 3WXWL 2E7LA 2ZPKH 5MEOA 4HHAA 2IGFH 3NZ8B 3QJFA 4R7NB 1HHKB 4KU1A 4UAOB 4HFWB 5GIRA 3ES6B 2DQIL 1BZ9B 3BKYL 1N59A 2EO9A 1FL6B 1OAUL 1GGCL 2HJKA 3L3JA 5D1XC 2XPGB 5AUMB 4JLRA 3DX6A 3ULUE 4L3CB 4HKBA 3V7AE 5J1AA 4FFYL 4PJGF 4OZFA 4KTEL 3MUY1 4P99A 4TVSa 3TJEH 1BBJB 1RK0B 3D5OF 5HDBE 3WFHA 4KC3B 5IEHA 1N5AA 3X17A 3ELAT 5KSBA 4F58L 3PWVB 4X5LA 1FYHB 3KLSA 2VXTH 2FJHB 4UZGA 2D3VA 3MUGA 4XC3H 1GYAA 2H26B 5E6IC 1TTFA 4CVZB 2VITA 1JNNL 4R96A 4LSUL 4DVRH 3GMPA 1YMMA 3W11D 2NY4D 1OAYL 4X6EA 5HHMD 5D5MA 4HJGA 2FR4A 3ROOA 2Z93A 3CSYB 4YX2L 3MOBH 4K94H 5GHWL 2O5ZH 3H9SE 1BVKA 1IE5A 4M5YH 3FHQA 4XWGL 5DURB 5E99L 5EUOE 1F3DJ 3IXAB 1PW3A 1QRNB 3B5GA 4M6ML 1ETZA 5D2LB 5EH1A 5I19H 1GJIA 1D5MA 1QFWM 3GBNL 4S11A 5DGQA 2H32A 4K3JL 3BXNA 3HUJA 3VRJB 4BQ9A 4DOHE 5I1EL 5IMLA 2OBGA 4ETQB 4X4YB 1P4LA 3MV8D 2JK5B 5IK3A 2C3VB 4DZ8A 3V52L 2MCPL 2PYFA 1NANI 1H3XA 4HFUL 3RTQB 3WO4B 4QHUB 2VLJB 2QSCH 1IGYA 1LEGB 3BKMH 5DGRA 5IGXL 1OVZA 3WEXA 4JM2C 2FWOB 3V6OA 4XAKE 1G9NL 4FP8L 4OCRL 1XF4A 4P23D 4JN2A 1I8KA 3MZTA 5I1DA 5J0BA 1CQYA 1BZ7A 1MPAL 1J1XH 4KHTH 3H2WA 3EOBA 3QI9C 3B2VL 1GHFH 1I9RH 3FO0H 1B6DA 2AKRA 3I6GA 4KDVA 1WEJL 3OHXA 1RZ8B 2V7HB 1Q94B 4QWWD 3G6JE 5IT2H 5IMMB 4JANB 3HZKA 1QFHA 2BVOB 1I3VA 1XIWA 4OCXL 4XMLL 5C9KA 4ZSOB 3UZEA 1W0WA 5FF6A 5EC2B 4HBCH 2FCBA 3BUYB 3S3JA 1IM9A 4GRWE 1X7QA 5IVOA 4D3CH 5ID0B 5KANI 3HAEG 4J3UA 3NCCB 4NHCH 3FFCA 4JDTL 3QFJE 2G2RA 4WO4C 3NABH 5C07D 4LRIC 4LPVA 4QYOA 2VN7A 3OJDA 5HI4D 2OM5A 3GSQA 3OV6A 3VFMA 4KUZL 3UXFA 1LO5A 5EORH 5FA3B 3EO9L 1KIPA 5DO2D 4X9GA 3WIHH 1NQBA 2W60B 3JWOL 4XMKH 1P7KB 2W1NA 1XIWC 3RBSA 2IH3B 5F89A 3I2CH 3V6FB 3EFFA 2VRAA 3P73A 3SJVA 3V7MA 4YR6A 1QD0A 2GITB 1OB1A 1F02I 5I18H 5L2KE 2Y5EA 3EJYC 4Z7UB 3TGXA 2AW2A 1MFDL 1IEHA 4QY8B 3K4DA 2FEEI 5C0IB 1L9NA 2XA8H 3QEQB 4LSPH 3QEQD 1U8KA 3B5TA 2X1XR 1X3DA 5E70A 2GTWB 3LQAL 4WNQA 1ZLUK 1ITBB 4FQXA 4MXWL 4M02A 2JIXD 3HE7D 5E4EC 3MJ9L 2PCPB 3MROA 4YHIA 1IM3B 4EVNB 4KH2A 4K94L 4UU9A 1PQZB 3RUGE 5H8DA 4JZJB 2JB5H 4HUWB 3P11L 1MVFA 2VC2L 1OSZB 1IFHH 5E9DA 3VH8G 1ZSDA 3UTTD 5I1LA 3B9KD 4YNYA 2CMRL 3B9KB 4WRLA 2ZUXA 4Z7UE 2NZ9D 4PRHD 3MRKB 1Z9SA 3ZE1E 4PJAB 5ICZB 3HG1D 2OXGA 4NSKB 4YBLC 1G6VK 2MCPH 3IXTA 3VFPA 5FKPA 4G6KH 4YEEA 3S7GA 4WUUA 4IOIA 4OLYH 3SBWC 1I1AD 3T65B 2DQGL 4YWGH 4O02H 5KBNC 3N1GC 5FYKD 5MI0C 1MWAH 2PTTA 5IGXH 2VZOA 1A7QH 4KUCD 3VXUB 1ZHKA 4OCRH 3OGCA 4Y4FA 5BMFH 1JPTH 4JQVC 3CZJA 1BD2D 1RVFL 4HT1L 3BMWA 3DGGB 1P9MC 2QSVA 4ZTOH 4OT1H 3NIGF 1I9RL 1TXKA 2DBJA 3FO0L 2KDGA 3L95B 3VG0L 1B4RA 4X6BB 3GI9L 2XWBA 3HS0B 2QV2A 4QGTA 1A5FL 2VDRL 1OP5K 4WUUD 5CIPA 1IARB 4NRYB 4FQHB 4MHHG 5DQJA 4FFZL 1CDIA 1FNSH 1KNOB 4XMLH 1A4JB 2XV6B 4XP4H 4DN3H 3U9PH 4D0DA 4PJ5E 3RRQA 3MTRA 3MYZA 3SE4C 4WW2B 2NY1D 3VMOA 2ID5A 2F9BT 3KHOA 3VA6A 1QFOA 4ONGL 4HMDA 2GK0B 2R2EA 4Y2DD 4O9HH 5DUPL 5EC1B 5GS0H 5BRZE 2NQCA 5KW9L 4FG6C 3BJ91 1ZA3B 5ERWA 1MCQA 3LEYH 4XVSH 4OFKA 1QSFA 3D1MC 4KY1L 1PZ5B 3B43A 2L7JA 5E7FA 1MFBL 3LQZA 5H37G 4MD4B 5BZDB 1VSCA 4R7DA 1UGNA 4P5KA 3G5XA 3MGAA 4LLQB 4HV8A 1U92A 1FN4A 1A7NL 4LQ1A 3RY6A 4ZYKA 3MNWB 3JTSA 1QBMH 1JHLL 5KVMC 4Z8FL 1D6VH 4ZDHB 2AJVL 1M7IA 2Y07L 3BGFC 3GSWA 4IRJD 2D31B 1S8DA 1F4XH 3OMZA 3RI5K 1CDJA 3I84A 2BFVH 2LTQC 4DAGL 4LCCB 2PR4L 3P40A 1MFDH 1FVCA 4OUUA 1AGEB 15C8H 1A7BA 3U4EA 3F58H 4OLVH 5D7IB 5HDQL 1FZMA 2Y4SA 2JJVA 1OAKL 2Y36L 3RWHA 2F54E 3WFBL 4GW5A 4LDEB 4TRPL 1AXTH 4E42A 3DX7B 3WIIL 4QHKJ 3ZKNC 1WQVT 3O6FB 1T3FA 3MJ9H 2Z92A 4X4ME 3S5LB 5E00B 5FYLL 3PWUA 3GEWB 3P11H 1MEXL 5I8OL 4YFEA 3FFCD 4FQPA 2QR0B 5A2IH 2E6PA 4PUBL 1OTUD 2WBKA 2IALB 2DF3A 2WAHA 1UJ3C 5GISL 1CBVL 4OFYD 3BAEL 3O9WC 1Q9KB 2BNRA 5I1HH 2K1MA 5TDNB 1YJDC 4GLRI 1KXVC 1A9BA 2RCSL 4N9OB 1UXSA 4PJ5D 1MWAL 1VHPA 2W0KA 5JPNB 3VFNA 2VLJD 5FGBA 3P77A 1ZT7B 1B2WH 2DYPA 4ZUUB 4OJFH 5ENWB 1CD0A 4GG6B 5EOQH 1G7LA 2XZCL 1UH4A 1KCRL 3JV4B 2AK1L 3GMNB 1CCZA 2R8SH 5AAMA 3MA9H 4OT1L 3S4SA 1NLDL 3VG0H 3ROLA 5GGRY 2C4FU 4NP4H 4IS6A 1I1YB 3BEVA 3QJHA 3O3EB 4JQIH 3T3MF 1XR8B 4NM8L 3HG1B 4RAUB 4X7FC 4BFEA 5FYLE 4ODBD 4LSSH 4M6OL 1TCRB 4AQ1B 4Z0BH 4LCWB 2WANA 3FRPA 3ZTNH 3BPCB 1OCWL 2ZUTA 4PPTA 3MV9A 4GH7B 4N1HB 7CGTA 4PRIE 1URLA 1CDYA 2C4XA 3EGSB 3ARSA 3G6AA 5C6WH 3FOLB 3FB5B 3O6KL 1T1XA 3GMOB 1KYOK 2JCCA 4OV6F 3GSXA 2I24N 3O3DB 5DK2B 4OM0L 3VGGA 1A6AB 5IHBA 4Z7OE 3RWCB 3C8HA 3H42L 4IOFD 3I50L 5D72L 2E7BA 1CQKA 5F71A 5GZOC 1RK1B 4G43A 4PV9B 4FZEL 4HWUA 1D5XB 1C08A 1CLOL 4PBVC 3E0GA 2HRPL 3OR6B 3PV6B 3QHZH 2XN9E 4QXTA 1RPQA 1RJCA 4ZAKA 3VCLA 4MD0A 4RZCA 4OGYH 4S1SH 4I0PD 4Y89A 3MXVL 3DXAE 3NFPA 4MA1C 3VRLF 1MJ7H 2E8YA 5L6YL 1KIRA 3PIQA 5B3JE 1HYRC 1IGML 5F8QC 5BS0B 2BVQB 5IJKC 5CUSL 4AIOA 3CC5B 3HC0A 3OXRA 1KENH 4JFEA 4YHNA 2Y36H 3BPOB 4KI5E 3W9DA 5A40E 1D5ZB 4NQCE 1FL3A 1JI2A 5D6CA 2FBJH 3C60C 4LPWA 2H9GA 4KV5E 3PHOA 1T1WA 2YRZA 5GGVH 1MFCL 4Z7OF 4NUGL 4HK3N 2HKHL 2PO6B 2OQJA 3WLBB 2LVCA 4CMMB 3MNVA 4KRLB 1ZGLM 1YY9C 3T0XA 5DJZA 5E5RB 2FO1A 3QCTL 1QSFE 4F2MA 3PHQA 2BSSA 1YEFH 3CZFA 1RUAH 4JVWA 1CG9A 1INQB 1CBVH 3ZHLA 5L9DH 3SGEH 1J0ZA 5JO5B 4IRSD 3C2AH 5T1DL 2CLRB 2A9NL 1JWMA 1WIPA 4PJIE 2RCSH 3U48A 5D96C 3RVXC 3TV3L 1FNGB 1P7QA 1RULL 1ZTXL 2OL3B 5D7SH 2NX5E 2X4RB 1DBJH 3DVNA 2H45A 4X4ZA 2J5LC 4ZQKB 4H20H 4QEGA 3DSFL 1I3RA 4MNGA 4NM4H 2VLLA 4K9EH 4CW1B 3KPLB 2XZCH 1R3JB 2P5WA 5E1AB 5CBEA 1K8IA 4C4KO 1VGEH 1A1NA 4ONHB 3RVTC 3HRZA 4PGEA 3H9ZA 4N0FB 4MDJA 4NP4L 4UQ2B 1YEKL 1V05A 3ARDB 4WV1B 4MCZB 2EZ0D 1FFOA 2YRLA 5IFHH 3GI8H 3H7BB 4P4KA 2G5BB 5AYQA 1LEKA 4JFFE 1XGQA 1LK2B 4OD3L 3U7YL 3UROR 5HVWA 5FM5M 3ZTNL 4KQ4L 1OCWH 1Q0YL 2MOVA 3QEUB 4TUJB 6CGTA 3GJFB 1F11A 2EC9U 3W0WD 4OI9A 1NGQL 4NRZB 1AQDA 5JHLH 4NQXA 3HB3C 5FO9B 3SKOA 4D9RE 1I85C 2I27N 3EYOB 4I9WE 4ODTH 4Y2DB 4MA7L 1OTUC 4XC1L 1XT5A 3BP4A 3EHBD 1U3HB 3TPUB 4IHOB 3R06A 3D39A 3DHMA 3TBYA 5IHZB 1OAQH 1YPZB 2B4CC 2A73A 3IT8D 4UILL 1LE9A 4ZXBB 2X1WL 2YBRB 4QCIB 4WUKH 3G5ZB 3DYPA 2N4IA 4JFQB 4JY5H 3KPQB 3GMRA 2CDEB 3GMQA 4FZ8L 4PGBA 4I2XA 1MJUH 4JFPB 3JWOC 1WT5C 3ZDYE 1INDH 1MVUA 1YNLL 3MBEC 4ZXBA 3TO2B 1UWGH 4WW2F 4ZO6A 1IGMH 3BP7A 3BZ4A 1RZGA 1NMCB 1RUQL 2VXVL 2RBLA 3SDCD 4P2QA 4E0RA 1KENL 2ZUVA 4OF8A 4UV7H 2VE6B 1UJ3B 1A47A 1N0LA 4NKDA 3EYOA 4PJAE 4N90D 4PRIA 4XNQB 3HC3L 2BXYA 3BRGC 4H0HB 4Z7NF 5DLML 3CIQA 1DBKH 4WFEE 1I1AC 2AJUH 3QUMB 4GRMB 2AJXH 5D1XD 4OSUL 3VH8B 3RL1B 4JFXB 1T5XA 4OV5A 3NCMA 3KPRB 1SJXA 2CLVB 4Z7WF 1U3ZA 1MCSA 1LK2A 4P2QD 4QRUA 3GBML 4XNZC 3O6LH 1KEMH 1P69B 3OJVC 4U1GB 1FNEA 1FBIH 5CINH 4JFDA 5EIQA 5BS0D 3NIFE 2HLFD 2GYSA 4UQ2A 5E08L 3C5ZB 4N0FA 2AEWA 1KIUA 4XHQA 2FIKA 3WSQL 1HKLH 3D0VA 2GT9A 1A1NB 2LFGA 1YMHA 4HPOL 2NY5C 1WCBA 5KSUA 5J4MA 1MREL 1QBBA 4NM4L 1G9NC 3ABZA 4K3HA 3U7AA 2VWEE 1MCWW 3DVNB 1C5CH 5HHXH 1BFTA 2OL3A 1FV1B 5BS0E 2VDLL 5B4MC 1P7QB 4P46D 4P9HL 3RZCA 4KQ3H 1QVOA 3AB0B 1I7ZB 5BW7C 5F3HA 2E8ZA 1MHPH 3X12B 5JO5A 3VXSA 4ESKA 4K7PL 5DQDL 5DA0B 2Y7QB 3GI8L 3EBAA 1OTSC 3C6LC 1A1MB 1KB5H 3BIBX 3WCYA 1HQRB 2M1KA 3EDJA 4I5BB 4YDVB 3F8UB 3V6BR 4UAOC 3MLZL 2VISA 4BQ8A 4OGAD 1CTNA 5DJCA 5GZOD 4P5MB 3M07A 3TYFA 3L6FB 4R8WL 3PGDA 5EN2A 4YUEH 3EDEA 3P4NB 4EI5B 1S7SB 1AHWB 2DIAA 4NQVB 3W39B 4EUPG 1FSKB 5CP3A 1MHEA 1NCNA 4URTB 2KPNA 4Z7VF 2JF1A 4NNYA 3QB7C 4WFFD 3G5VA 2VQ1B 2ZOLB 3ARFA 4L4TB 1CR9L 3HZMB 3QUYC 3NCYP 1J5OL 5HI5D 1G9MC 3NFPB 2FGWL 5J11C 4M00A 1ADQH 1IGFL 1GC1C 3C09C 4W6WB 3QRFM 3BFOA 2B7DT 5I1IL 4WWKC 2P5ED 2DQUL 3FRUB 4O51A 2JJTC 2IANB 3S3PA 2R2HB 1RJZA 1YNLH 2Y1VA 4HS8H 3BWAB 4OZGF 3QIUC 1LO0H 3SGDI 3TNNB 3VFGH 1LMKA 2GJZA 3EYFA 1UEYA 4HWEL 2J6EH 4AH2A 1A64A 1DVFD 1N5YL 4AQOA 1A6AA 2JJUA 3KLHD 5E8PA 2F53E 5IMKA 3GJFK 2WBJB 3O3DA 4NOBA 3C6LA 3SDCB 3RNQB 1YEDB 2ICCA 4WEMB 5EOCL 1OAUH 5ETUB 4KK5C 3HI6H 1U8LB 2X1QA 2W9EL 1G9MH 2YUXA 2PO6D 4H88H 3P0YL 4XGZA 2VLME 4HJ0C 4Y4HD 5C09D 4NKOA 3MMEB 5F9OL 1KCKA 5DD1H 4GG6E 3DUSA 4XPGH 4F9LA 4CU7A 1P84J 3QEHB 3QULA 2P44B 4NWTH 3VI4E 3MA7B 3X3FH 4KAQL 2EDEA 1HK6A 3WO3B 5MEPB 1JNNH 1BVZA 4G7YH 4QT5A 5J12C 4JRYB 1A0QH 4XPBH 1ZLVH 5FUCE 3TZVB 2APFA 1CTOA 5HBBA 2OR9H 2GSIB 2JLLA 2A6IA 4BH8B 2O5ZL 2NY3D 2YUWA 2Z31A 1UXSB 4G6JH 4JZOA 2J8UA 2JJSA 2YEZB 2A77L 1A9BB 4K3JH 5FGRA 4MJ6A 5KAQF 1NGWA 2OMBA 4HF5H 3QNZA 3FO9B 5ALBH 3QDMB 4K7PH 1QSFD 5DQDH 4WHDA 3BKJH 2X4TB 4HD9A 5ECJE 5EULV 1UKTA 1ORQB 5DZNA 1U8QA 3EYVB 1LO2L 1N6UA 1LEIA 2IFFH 3ILQC 4NC1E 3SO3C 1KV3A 1XZ0A 3QH3A 1HEZB 3PWUB 1XGPA 2O5XH 5LAXA 3DUHA 3MV11 4XAWH 2PETA 4R3SB 2VXQH 1TPXC 2B20A 2NW2B 3FZUD 4YUEL 2BCKA 3I3DA 1IGTA 3CMOH 3FONB 4OQTL 2GUOB 3I85A 2UV3A 2I9LA 4WV1C 1A14H 1GHFL 5CEZE 3X11B 5CILH 1U95B 1MRCL 3RVWD 3HN3A 1FVCB 3C2SA 4OUUB 1QR1B 4NKMB 2W91A 4FNLH 4P4RA 3ZYIA 3LSOA 5C70A 1S8DB 2EKSB 4OF5A 3HE6B 1QRNE 2ZNWA 1UB5B 5JQ6H 4D3CL 4BSVA 1A3RL 5BRZB 1UM5H 1E6OH 1FIGL 3EIFA 4JDTH 5IG7B 2OZ4A 3RDTA 3L3OB 1QOKA 4JHBA 2J6EL 5J13C 4U6XB 1T89A 4PREB 1E6JL 3I3BA 3Q6GH 3W82A 3WS6A 3LSOB 4P4RB 4JKMA 1QHOA 4NKMA 3O45A 4LQFH 5CHNA 5SWSE 5I6XB 1AGDA 3GKZA 2YN5A 4LNRB 1A2YB 5EC1A 4W6YB 3FN0L 1ZXQA 4JO4H 2ZG1A 2GUOA 4MWFA 5E8DL 4Y4KB 3ULVC 1NANH 2Q1EA 1ZANH 3O8XB 2BCKB 3P0YH 3PL6B 4XP6H 4B5EA 4D0DB 1IGIH 2BJML 1FO0L 1TMCB 5MI0B 2DMKA 1ZWIA 4QRRD 4LSTH 3JV0A 5GGQH 1DLHB 2BNQD 4OLWL 1MELA 1T21A 3OX8B 4X5WB 5GGUA 1W8OA 3IFOA 2QJDA 4NWTL 5CJXC 5T1MA 2ZUWA 1IC7H 1HE7A 2AJ3A 2BVPB 2UZXB 1N3NA 1NCWH 3MRIB 2VQTA 4LHUD 4U1JA 4MXWH 1PY4A 2EE3A 2L4OA 3TWCL 3OB0K 5JIIA 5DRXB 1AD0B 1ZHKB 4U6HA 4QNPF 4HKJB 5EU7C 3SE4A 2CKBL 5EA0L 3QUZB 2VL5B 1C5DA 4JZOB 3SGKA 1YYLH 3CK0L 5FOJA 2FO4A 1SJVA 1BLNB 5E5MA 4QO1A 5FKPB 4QRQA 1J7VR 4X8JB 2VWEC 2UWEA 5DVKA 4DCQA 4JHWH 1CT8B 3IXTB 1IGCL 2BHUA 1C5BL 4JRYA 2WWKO 3RWGA 1D9KA 3O4LE 3IKCB 4QT5B 5BOPA 3MRKA 1VGKB 4YHZL 3RHWK 5IR1B 2R15A 1SJHA 4KVCL 4KKCD 1LO2H 2HWZL 3HA0A 3IF1B 4XTRD 1DUZA 5HGAB 5L8LB 5A2JH 2D0FA 1ERNA 3HNTH 4OF3A 4Y16B 4CDGC 5HY9B 4JZJA 2O5XL 3DMMD 1BEYL 2VDPH 4FQ1L 4Q9RL 3DHJA 3RWJA 1QO3A 5L2KB 2AQ1A 4XCEB 5GGSA 5D71L 3ZL4H 5DHYA 1SJEA 4QHMA 3GGWB 3PP4L 2N7AA 1FIEA 4S10A 3QIBA 5DD3L 1YEDA 3RTQD 5E1HB 3RNQA 5TF0A 4PY7A 3RVTD 3TC9A 3OBAA 3C6LB 4OLZL 3S37X 1KOAA 1QKZL 1UEMA 3STBA 2K7PA 5C0BD 5KS9B 1EA9C 2FEEL 3EYFB 3DNKA 1QRND 4ONOA 1I8MA 3HMWL 2XZQH 2EH7L 1CGSH 4LGPB 3RZCD 1DSFL 4JG0H 5T3ZE 4H0IA 3F7VA 1PYWB 4MCYA 2XZAH 1RURH 4LF3A 4HWNA 2ENSA 1I9IH 4M6AA 5C0BE 4OLUL 3GSQB 3QBTB 4M9OA 2AGJH 4MJID 1MFBH 4QYOB 1G6RH 1KXQE 2XWTA 4W4OC 2EDNA 1RAMA 2G60L 3RVVC 3B2UC 1AD9B 1PFCA 2MQ3A 5C0AD 1X7QB 4Z7VE 1AHWA 4K8RC 3FN9A 3MRPA 2AJVH 2Y25A 2Y72A 2ZSWA 3FTGA 1XIWB 1F4XL 1EEZB 4JFYB 2PR4H 5FA4A 4BH7B 1Q94A 1MCNA 1EBPA 4I5BA 2V7HA 1JPGA 4DQOH 4OGXH 2NY2C 4PLNC 4JN1L 3CLFL 1RZKH 4BZ1L 5T33L 1OAKH 1NCWL 2Y7QA 2FX7H 4JCMA 4U1NB 5BZWB 1ACZA 4WFGE 4JN2B 2GI7A 2F54B 1CGWA 5TQ2L 1Z6JT 5F44A 1I7ZA 3ZKMC 1QVOB 1MCKA 5DJDB 1DJSA 2ZKHL 3IU3A 5SX5K 4PJXB 4Z77A 4PG9B 2VAJA 1YYLL 3CK0H 5I9QC 1CD1A 1CN4A 4LCUB 1J1OH 4QHUA 3CH8A 1AKJD 4GLRH 4WU5A 1JPSL 1AXSA 5B8CB 1YMHB 3D85D 2A0LC 1SYVB 3RX8A 1UENA 2VUOA 1KLGA 5IVXA 3RGVD 4ZD3H 3BN3B 4ETQA 4X4YA 4WU7B 4U31A 4X7EC 5GZND 3WS3A 4CN1A 5C07A 1H3UA 2BOBB 4L1HA 3VXRB 4DGYL 5FHAH 1F3JA 1OL0A 5TE7H 4Q9RH 1Q8MA 4OJFL 3NCEB 5DI8A 4XP5H 3ROOB 3RDTD 2JELH 3JWDL 1QQDB 2ZUUA 5DRWA 4NQCB 1T5XB 1AKJA 3RL1A 2AV1B 4J8RB 3RKDD 1KSRA 4OBRA 1GOHA 4PRPB 4KFZC 3VFSA 1T5WA 1BFOA 4PLJD 1EJOH 2APVA 8CGTA 5IB4B 4M62H 4UTBL 2H26A 4LSQH 1BFVH 5FO8A 5E2TH 4BKLA 1IAOA 4EI6A 4K2UH 4QHKI 4XBEL 3OAYH 4HS6B 3QHTC 3WHXA 4FA8A 5AZEL 2LU4A 4I4WA 4H26B 1YEEH 2K9UA 4HIEA 5BVJB 1EK3A 1AO7E 1HINH 5EG6C 3GNML 1CIDA 1H3PL 3ARBC 1CL7I 4KZEL 2A6JA 1CGSL 2VR5A 4OZGE 3ARGB 3S35L 1FO0B 1C12A 1DSFH 1QA9B 3O6KH 4JG0L 4YO0B 1BZ9A 4ENEC 3GMRB 5D93B 4FTVE 5MENE 4JFQA 4EXPX 5I71C 1NCDL 3GHEL 5KSAA 1NC4A 3D18B 3UZVB 4NQDB 1YPZF 2A73B 2R56L 2FHBA 1CK0H 4YE4L 3UPRB 1EUUA 5DD5H 2OTWB 1O7VA 2VXSH 2CIKA 2BOCA 4KK8D 4IRSC 1U8NA 3PWLA 4Y2DA 4JY6B 1EPFA 1YA5A 1YDPB 1CXKA 4DEPB 2CKBB 2P45B 2DBLH 3QNXA 3N50A 5D2LE 4Z0XA 2X4UB 32C2B 2FZ3B 3QO0A 2V9TA 2YA1A 4UNVA 3NN8B 3TYGH 5L88L 4OZIF 2P5EA 3OG6B 1FLRL 2DLFL 1PG7X 2H8PA 4JN1H 5F6IC 5BXFB 1JUFA 1LVEA 1L0XA 5D6DA 2E7LC 4M61B 5T33H 2R1WB 5C92A 4YDKH 1WVZA 5FUCC 1FFOB 5C09B 4U1HA 4WFHE 4GAGH 1UWXK 3IDYB 5GGVL 1KB9J 3KPSD 2ZUQB 3CDFA 3MCLH 1NBZB 3WKMH 1UVQB 5EBMA 3NFSL 5C0AB 4TVPL 4XNUL 4DK3A 4Z5RA 3MLTA 2P8MA 3KPLA 1M05A 2D9CA 2VLLB 4CW1A 3DRTA 4X6CB 4YHOL 1YEHL 3BOVA 4CADA 1PJ9A 1P53A 1HI6A 1RUAL 4HSQA 3EUUA 3S96B 3T2PA 4HJ0D 4W70A 1SVZA 1PD6A 1JWMB 1FH5L 1W0YT 4X4XA 4U1IA 5T1DH 3QZWB 3TA3C 4PJGB 2EYTB 3ALWA 1DQQA 3HI1B 3BDXA 5EBLA 1KJ3H 4NRXB 4RFNC 1A6ZA 1DBJL 4IMLB 1DEDA 2BSSB 3O3BB 3PHQB 5DJAA 3PJSB 4J3XA 4OZHF 4RQQB 2B8OT 3MRCA 2YSSA 5I30L 1FG2A 3GMLA 1GGIH 3FQWA 2FJFB 4N90E 4WO4B 3MV9D 3QEQE 1A6VL 5F93C 4LDOB 4CMMA 2OQJB 3VFVA 2VSCA 3VI4F 3SE3C 5IB5A 1IKNC 3OAYK 2W9DL 4RA0C 2DTMH 2FATH 4GBXD 3OKKA 5TDPB 4B53A 4H25B 4U1LA 4H25A 2P49B 3B9DA 4XP1L 5HXMA 4MNHB 1D7FA 1JZ6A 2BVQA 2P8PB 5KSVB 3JXAA 3J8F7 3U0WH 1TTUA 1OT2A 3ULVF 4KQ4H 2Q87A 5HI3C 2X4NB 5JW5A 4WO4A 2P5EE 2FJFA 2ZG2A 2WINB 3DVGB 4WI4A 5T3XE 1KCLA 5T5NG 4RNRB 1SEBA 2ATPA 3QUML 1SM3H 5FHBH 1CFNA 5EBLB 3HI1A 4YE4H 2YR3A 2DKMA 3MLRH 4NPYA 4NKIH 5CAYB 3T04D 3HCVB 2Y06L 5IFAH 3BSZL 4X7DC 1WAAF 5CBAB 2JTDA 3DO3A 1CGTA 1J10A 4M7JH 3A67H 2JCCB 3K8LA 3UCRA 4ERSH 2K7QA 3G04B 5BV7B 1N0XH 4G8GE 4XZUB 1UVQA 3S8WA 1BGXL 1NBZA 3MGTB 3RGVA 3TYGL 4L9LC 3A6CH 3IDNB 5L0QB 4JFFB 1MFEL 4X9HA 5L8JB 4WCYL 4HUKB 3UMTA 4TPRL 3IB4A 3STLB 4M61A 3IKKA 4X6DB 4XAKD 5C08B 4AT6B 3BPOC 4IS6B 2HKFL 4EZMA 2HT2D 2OZ4H 1DBKL 3S4SB 4ZFOB 1OLLA 1P84K 1BIIB 1YQ2A 1F58H 32C2A 4Z0XB 1R3LA 1GIGH 4I0PB 4PGCA 3D3VD 5SWZD 4HJJL 2H3NA 2R0LH 2DYPB 3MCKB 4JDZA 1OY3B 3IDGA 4OF7A 5HDBF 2M2DA 4YXLH 2HTLD 1GXEA 3CH1B 2P7TB 2BOCB 3LHPL 4GG8B 4HH9A 1ADQA 3E3QE 4Y5XC 5TDNA 3K1KC 4CKVX 2F5BH 4FQQA 2JB6A 3H9SD 3LDBB 4R0LA 2VH5L 4XB7A 1HKLL 2EDBA 3ULUC 4ODHL 5KSAB 1CDUA 4Y4HB 4YDJB 4HPOH 4DVBB 4LAJH 2DL2A 1U3YA 5HHNA 4YO0A 3SEPA 1CFQB 4KTDL 4FG6D 1FO0A 1JWSA 2EXWC 3JV6B 4U1KB 4WDIA 1GGIL 5JIHA 5JTWA 2IAMB 2PF6A 3CX5J 1IMHC 5I0ZA 4P9HH 2OXHA 3MLXL 4KRPD 5DA4A 2V7NB 2VLKD 5BVJA 1DLFH 1TDQA 1T04B 1E4JA 2DTML 5EU6E 4F57L 3DX7A 1J0JA 1T2XA 3ARDC 1TQCC 1RSFA 1XGRB 1HXMA 1FNHA 3ZYOA 2CK0L 1KB5L 3SDAA 4MXVF 3U0WL 1EFXD 1WLHA 1CFSB 5T5FH 2EDRA 5AWNL 4PB9H 1KFAL 4GMTL 2OK0H 2HFGL 1PKQB 3K0WA 5IVZB 1V3LA 4NQCA 3BP6B 5D5MF 4M43L 4P0DA 4UV4L 5DI8B 3REWA 4GW4A 3KYOB 1BD2A 3ARGD 4ZYKB 5BO1H 4CUCA 1U92B 3MNZA 5J8OA 5ICXB 3VXRA 3OR7B 4PGJA 1JWUA 4J3OC 5F9WC 3MYJB 1YECL 5IW1B 1CR9H 3KJ4C 4WU7A 3MLRL 1GZPA 4Z7UF 2GJJA 3W2DL 1PZ5A 2NW3A 2Y06H 4LLUB 3BSZH 3SDDB 3EW3B 3SCMB 1O0VA 1CZ8L 4M7JL 1DANU 3IGAA 3W0WE 5CD5C 4IRSA 2NXZB 3V0AC 1N8ZB 1DE4B 3O3AB 4JKWA 4M48H 3S36X 4RGOH 2E7HA 5FYLD 1EGJA 2NX5A 1LO0L 3MRHB 5I71B 5GGVY 5JOPD 2IEPA 4TNVF 4QTHB 1WZMA 1KNOA 4G8IB 1KN2L 3BH9B 2CUHA 5DQJB 1D5IL 5IF0A 1IBGL 2GTZA 2DQFB 2MWCA 1EAJA 4LVNB 2X4SB 3HS0A 5FKAA 3H6JA 3OF6D 4R26L 2ESVA 5FA4B 4BH7A 3H0TA 2F8OA 3GRWA 1RMFH 3HI6L 3MV01 4LEOA 4I0CC 2YPKA 4R4BB 5FUZL 1BQHB 3VXME 2R29L 4ELMA 3UPCA 4RWYH 2Q8BL 2ZUYA 4RMUA 4NQDE 2R0LL 4EDWL 5DS8B 1J8HD 3KPMB 4G6MH 2W07A 4XPGL 3QDGE 5SWZB 1XGUA 5SV3A 5BV7L 5C3TA 3TESA 1B4JL 5GS3A 5FGCE 4NSKA 1XIWD 4RMWA 2HVKB 2AEPL 5I1JL 5HHQB 4WY7L 3D85B 5CP3H 1WZKA 2EDHA 3MV7B 3GUTB 4FFVC 4ZO8A 3IAPA 1X4YA 4NIKB 4BELD 4I0KA 2GEEA 5KVGL 2VAAB 2BVEA 5E2WL 4FXGA 4ZPTA 3U0TB 4UNUA 5MERA 1ZT4A 4UT9L 4H8WL 1I8MB 5CZVL 1IM3A 4XP9H 1KTKE 4YHIB 1JGEA 2YA2A 2PCPA 3VFWB 3GSVB 4NT6A 4P2OD 4QXUL 2F19L 4LASL 2D7QA 3T0BA 1T4KA 5EU6B 3P3YA 1F4WH 1U8KB 3MR9A 1PX3A 4LBEB 1EEYA 5F7UA 5IJVB 3SPVA 3MRDA 1TZGH 2Q76A 4G6FB 3HZVB 1P7QD 5FV1L 5E6YA 4XAWL 4C56D 4J4PD 1EXUB 1H5BB 4MNQE 1JGEB 4MQXC 4O4YH 3F65A 1EHAA 5HI4C 4YXKL 5BO1L 5C2UB 1IAIH 1VFMA 3O0RH 5E8NB 5HY9A 3ARTA 4Y16A 1L6XA 1A14L 1KIPB 5HGAA 3E6HB 3MPCA 1FG9C 4H1LB 1FNLA 1YECH 2AXHA 4ZUVB 1MRCH 2XKSA 1E4KC 2DAVA 4HK0A 2UUDH 3Q2CA 2YRPA 2CQVA 3RJDA 5HGDA 4N0CD 3RWGB 3LRSA 2WV3A 4M7KH 1EHLL 1OPGL 1CZ8H 4Q9QL 4MAUH 2UWEB 4D2NA 2F53A 5SWZA 2I25N 3OG4B 4RX4D 1V7NH 3LZFL 5HYQA 5CJOH 4M48L 3TA3A 2EICA 2FO4B 4PJFB 5IW6B 3WFCH 2VL5A 3QUZA 2BRRL 3BUYA 3EJYD 5T3ZL 5JZ7D 4MLSA 3S3SA 1AD0A 4RBPH 4F7TB 4ZSOA 2EEAA 2YPKB 3QQ3B 3RUGF 2YS4A 5JXED 3M1BA 1OTTD 1N3NB 3MRIA 3RWDB 2BVPA 2DTSA 3AM8A 1OP9A 3CDGA 1RFDL 2DQIH 4DN4L 1B6UA 2WUCL 3OHXB 3QDJE 4KGLA 4OGAC 1AE6H 3TCXA 2Q3ZA 2DQFA 3WXVL 3VFRA 1FZOA 4R4FH 5HYFA 3D87B 3LIZL 4HAGA 1I9EA 5DEFA 4F7MB 4JDVA 3C60D 5FUZH 1ZWIB 2AJSH 1VEOA 2MHAA 1XF4B 2Q8BH 1FO0H 1YN7A 4EDWH 2NX5B 3MRHA 4IRJA 4U4BA 1XF5B 1T66C 4PTUA 4HW6A 1DQJA 1Z5LA 3PWJA 3CFEB 2C3HA 2ENYA 4UDTA 3C87A 5KZCD 1FCGA 3RTQA 2P8LB 1AGDB 2PYFB 1ZLSL 3NIDE 1OAYH 3CFKA 4XWOC 2HFTA 4N0YH 3Q1SH 5B38G 5F7KC 4M1DL 2P1YA 4RRPG 3RVXD 3MOBL 4K3DH 5D2LA 1QRNA 5E2WH 3SKMA 1R5IB 3IJHA 5HHVH 2XOTA 4PJCF 4OKVA 4XP9L 1UKQA 1M1SA 1PAMA 3A6OA 2FR4B 3TN0D 5DJ6B 3GMMB 1EVUA 3TBVA 3QWRA 2X5PA 4M7ZC 2D2OA 4WTWA 3ZLQC 4QLRA 2X4QA 5IB3A 4X6EB 4QXUH 1C5BH 1NC2A 1YMMB 3ZE0E 4LASH 3PF2A 4R96B 3V52H 3WFEL 2EYRA 1G7MA 4X5XB 5BCAA 4U3CA 5CWSB 4F80A 1KLFA 2JCCF 1U95A 1T0NB 2I9TA 2EDTA 3MSPA 4P3DA 2QSCL 3MOAH 3VD3A 1REIA 2J8UF 4R2GC 1A4KA 4R4NC 1N5AB 4Y88A 3WFHB 4M5ZL 5TE6L 4JM2F 3IYLW 5LBSL 3QUKA 3MV7D 4FP8H 2NY6D 1QG3A 2WM0A 2NW2A 4XPHL 1CE6A 1SBSL 4OZFB 4R3SA 2DMCA 3PP3K 4AY0A 2ADJA 3PE9A 5FFLA 4HH8A 1TZIB 3U2SB 1IAIL 4L3CA 3CX2A 5AUMA 4WDIB 4YBQC 2VUYA 2PO6C 4NBYB 3TH2T 2VDKL 5L7XH 5IBUG 3C5JB 1WEJH 5K93A 3TIEA 3CAFA 3HI5L 1MCPH 2QLVB 3EYVA 1U8QB 3BIKB 1T20B 2YXMA 1V3MA 4OLZH 4S1QH 3OXSA 4Y4HA 4YDJA 5IQ7L 5GS2H 3QDGD 3T0EB 5KVFH 5I16B 5JUEL 4F8TA 4ODUA 4DJMA 3MV8B 1WWBX 3FO9A 4YC2C 1CGUA 1R5VA 1EV2E 2XFXB 3BGMB 2YXFA 4LVOB 3LZFH 5GGSY 1MRDL 2J8UB 2X44D 3CH1A 2GJ6E 1AY1H 3HE6C 4JGUA 4J12A 3IDGB 3MRMA 3UTZA 5JA9A 1AJ7H 5C0BB 4WFGD 1JNJA 2H3NB 4G9DA 1UXWB 3KHQA 1G9EA 2XZAL 3TJHD 1I9IL 5C08E 3H9HA 4OLUH 1Y0LA 2AGJL 4ZFOA 3MFGB 2VDNL 3D0LB 3C6SB 3WD5L 1G6RL 3QA3A 4KK9C 1OW0C 4LCCC 4FFWC 3QULB 5DJXA 4UBDD 5LXGL 5HYEA 5JOPE 3DUSB 4AM0B 1NC4D 2NXZC 2ZOKA 5INCA 1LWRA 2VTFA 3HB3D 3IETB 2EDYA 3B6SA 3ARUA 2YC1B 1CFTA 4LRNL 4JM2B 1DFBL 5FOBA 1TVBB 5DR5L 1U8LA 2NXYC 5I18L 4D9LL 3T0EA 3TN0C 3OXSB 5EU5B 3L3KB 4KRPC 1FE8L 3ARVA 3SDCA 3BO8A 4JQXA 4TQEL 4D0CA 1FFPB 1VACA 5IMKB 2DL9A 2FX7L 4N0YL 2ADJB 3WLWD 4AK1A 1CE6B 2WK2A 4M1DH 5CSBA 4L4VE 3FT4B 3LQMA 4JFED 5BQ7B 3SJVE 4YHKH 4TVPE 1X4ZA 2ZKHH 1TZHA 1MF2L 5E4IA 2R2HA 1U8OA 2DJSA 3H3PH 1ULVA 1DQLL 5H37H 3T2NH 4NDMA 3QP3A 4PJHE 5E9DE 1IFHL 4Z7VA 4GW1B 2I9TB 1T7XA 4ZOCA 4QOKD 5KN5B 4HKZB 3LKSB 4GMSH 2VZ1A 5HPOA 4LHUB 4K94C 3HHRB 4RIRA 5JZ7C 1MNUL 4NJAH 3MCG1 5IB3B 2X1OA 4ZD3L 3X3GH 2GSGB 3TBVB 1JPFA 3CXDH 4JPKH 1UKSA 5HYSB 5KSVA 5F9DC 2JJWA 4B41A 3VGBA 5CIPH 2V2XB 4Q74A 5TFSH 3P9LA 4KHXH 5DVMA 2MJWA 3W39A 5D7KD 5LBSH 2IG2L 5ID1A 4LL9A 2R39A 1KBGH 1MI5B 2XXMB 1NGYB 2M26A 3ALXA 3JWDH 5IB5B 3H9SA 1SBSH 1AI1L 1YEGH 3UEZA 3EYSL 3CXHK 5F9AC 4ZTOL 4X99A 4M62L 4UTBH 4F8QA 4LSQL 1JV5B 3QWOB 4FXLA 2P8LA 5DJAB 3O3BA 3SDYL 4K2UL 4P2RA 1A5FH 4UDTB 4XBEH 2VDRH 2CGRL 1KTLA 2WBJC 5DWUL 5J06A 1HH6B 1BHGA 4NQSB 4LLDA 1I1CA 3BQUD 5F6IB 4WHCA 5AZEH 3VXSB 1CGYA 4MZ2A 3QZWA 2LU7A 3GNMH 1MCHA 3HFMH 1H3PH 1RZFL 4E41B 2DQDH 2YD1A 3O2VH 1S9YB 1FV1A 3VFRB 1DQDH 3NA9L 4LKXA 1AJ7L 5GRXG 4JZJC 1ED3B 1H0DA 2DDQL 2PN5A 4XPFL 4X6CA 3LKPB 1M05B 4B0MM 3VXUD 4NN5B 5EBMB 4KY1H 1H8OA 1KJVA 3S35X 3DTXB 2FIKB 3QIUA 4TUKL 3JVGA 3WD5H 3IFPA 2Q8AH 2B4CH 4LGSB 4F7TA 1NFDF 3L5IA 1T22B 1T1ZA 1I9JL 3P4OA 2P43B 3NPSB 3NAAH 2YD9A 4N68A 2V5YA 5I76B 4I3RL 5D5ME 1JHLH 1P4BH 1D6VL 1TIUA 3KJ6L 3I6KB 2F53B 2P5EB 2VLRD 4HIIB 4EQ3A 4K07A 3NN8A 5HD8C 4DAGH 4GRMA 4EUPH 2OL3H 3HNVH 15C8L 1A6TA 1FLRH 2DLFH 4NZTL 4RAVA 4QXGH 4PRIB 4XNQA 3E6HA 3H7LA 3RX5A 4J2XA 3OKMB 4MJIB 2ATKB 3O11A 2EDKA 3WIIH 3H3BC 3CSBA 1RZGB 4ZFZB 1Y18A 1H5BA 3MCLL 4X4MA 3WKML 5FYLH 4K55A 4LVHB 4PJ8B 1NC4B 1I7RB 1EO8L 4JFDE 5D96B 4WW2C 5F1IA 3SPVB 4N0RA 4AL8L 4QRPE 1NCBL 4LBEA 3BT2H 4HLZG 3BDBA 3ARGA 4LMQE 2A6DA 1T4KB 4KJQD 2DLGA 4ODSH 2DLIA 3UBXB 5I1HL 3ME0A 5HJ3B 5IHZA 3STZB 2KZ1B 4JPKL 4I4WB 1X5FA 3Q6FB 1CVSC 1ZT4B 2P42B 5TFSL 3VRIB 3VXQB 3DYOA 1I7TA 4ZNEE 1X9QA 1RZJC 5F9JB 5FO9A 3PABA 5I30H 2AK1H 4QOKE 3EYSH 4JQXC 4XXCA 3ULSA 1X4XA 5GRJL 2AV1A 3SDCC 1MWAA 1AKJB 1NLDH 4H1LG 5GS2D 5DUML 1QQDA 5DRWB 1QBAA 1T0MB 3MRQA 1FC2D 3KDMA 4CVXA 1OAZH 2W9DH 3DRQA 2FLRT 5DFWH 3GSUA 3SJVD 3S88H 3K3QA 1ZT1A 3AREC 5I6XC 4JRYD 3TT3L 1XEDA 4O00A 2E7MA 2VIRB 2IMMA 4IMKA 4Z0BL 1QBLL 2AP2A 1KEGL 1K9TA 1BQHA 4MDJB 3X13B 1CFVL 1LP9E 5F3BB 2UWEF 1KPRA 4PGEB 2WLYA 4N5ED 1GC1L 2A9ML 1AXSB 5TGBB 3ARBB 1CLYH 2XKUA 4OCMC 4XPFH 2Q7NA 4JPIB 3ARGC 4I0PC 3QG7H 4KDTC 4PG9A 4EUPA 4ENED 3MRFA 3BH9A 1MY7A 4NN7B 4EDXB 5JDSB 3I50H 3MO1A 2CLRA 4LLYB 2VZTA 2XT1B 5JDSA 4FZEH 5HHPA 4LOUD 1GGTA 3P9WB 1CLOH 1INQA 3ULVE 2R4RL 4D0BA 1DE4A 4KKBC 5HHOD 3A67L 3SO5A 3D25A 5I1CL 1YZZA 4OGYL 2DS4A 4PRAB 3SCMA 3UAJC 1N0XL 1I8IA 3FL7A 2FH6A 3MNVB 4Z95L 3TA3D 2Z4QA 2NW3B 1EERB 1YY9D 2V5TA 3BISA 4JKLA 1GZPB 2OL3L 3HNVL 3QT2A 2WMPA 2VIRA 3ORJA 1FL3B 5D6CB 3W9DB 3FJTA 3L1OL 4R90H 5IP4A 4KJPD 4PJBA 5BVPL 3GSUB 4GW4B 2CO6B 4NO0D 1RD6A 4L4TD 2HLAB 4DGVL 3PIQB 1A7OH 2AAVA 1PKQA 4V2BA 3DETD 2YN3A 1BF2A 1MCCA 5DMGD 5I1AA 4TN9A 4W81A 5EU4B 5F9JA 3F7VB 3HRPA 1NCBH 2IBZY 1I7TB 1SYSA 4MNQB 2E3VA 5T1LA 1D5XA 2E9BA 3V8OA 5ESAA 4RDQG 2F58H 2JJTA 3I02A 3W81A 2FH8A 3OWEA 3UBXA 2F5BL 4OCNC 1CXHA 5MEQB 4WWKA 2K3TA 1FPTL 3MOQA 2EC9T 4YFLF 5HVFB 4PJHF 1P6FA 4U1KA 1JWSB 3JV6A 1JYWA 4BK5A 3DSFH 4X6FB 4PY7B 4EXKA 4L8DA 3MV9E 2QQQA 5JOEA 3QIBB 2HYMA 3P9MA 5T1LD 1GRWA 4PGZA 2BX5A 1EGJH 5GRJH 3WO4C 2JB6B 4OCLC 1LDPL 3HNSH 1JZ2A 1UFUA 4XCEA 4PG2C 1QO3B 1YEIH 5DRZA 4YHYB 2EXWD 1TCRA 1M7XA 2DM4A 4L8BA 5B22A 3ZYJA 2ITCB 1U2HA 3QUYA 5IFHL 3PL6C 3HG1A 2VL4A 1HNGA 3KPSB 4JY4B 4PP1C 2CK0H 4MD5A 5IUSA 4PGCB 4L1DA 4FFWD 2ZJSH 1RU9H 5IEKA 2CSPA 1KFAH 3VXSD 1VGKA 4LVNC 1HHIB 1GGUA 2A9MH 3F7PC 3GMNA 2FECI 2YD2A 5C86A 5JHLL 3TVMD 1NUDA 1G7LB 4X8JA 4P5TC 3KYKH 1CLYL 5TDOB 4Q6YA 4GRLD 2MQ0A 2ED8A 1NDMA 5I76A 3ZDZE 1WFTA 3KYNB 1T22A 3RZCC 5DFTA 4KJQC 2QSTA 4AYFA 1WTGT 6FABH 2XWJB 3QIUB 1ZLUH 3CFDB 5GSVA 1ZHNB 4WI7A 3P30H 1MQKL 3QPXH 3DPBA 4Y1AA 3D9AH 3JUZA 3MJ7A 3QPQD 1BREA 1MHHB 4FZ8H 5DMGC 3IFOB 5T1MB 1TFHA 1RZ7L 2WLZA 1Z9MA 5B3NA 1S9YA 2NY0C 2EIZB 5ESVA 2Z92B 4HGWB 1NFDA 2BVUA 3QAZB 3O8XA 3EDFA 5IFJA 5E95B 2G75B 1CFNB 4LCWD 5EUKB 1S7QA 1HH6A 1X5GA 4MJIE 4NHUA 3MACL 5ANME 3IDUA 2EXYC 2WINA 1U3HD 4X99B 3BGAA 3LCYA 4RISL 2E27H 2YPVH 3WFDH 3IFLH 3PWPA 1QPXA 4KKBD 2ITDB 4MQ7A 5E24E 3GSWB 4ZDHA 4R9HA 2P8PA 3LVEA 3O6LL 1AO7D 3RVWC 4LLQA 1KEML 3HPLB 4PYHA 3G5XB 3IAQA 3C8DA 4QRSA 3QXTA 3RZWA 3EKCA 3S6CA 4MD4A 5BZDA 5HYSA 1T7VA 1IKFH 3MFFB 2D4FA 3R0NA 5BV7H 1B4JH 4Y5VA 3VFVB 2R0ZH 4J3VA 2RFXA 1FPTH 2DD8L 1U42A 1OTSD 1QR1A 3LKSA 3ZKSD 1MREH 2OMNA 3OKEB 4JZNA 4IMLA 4Y8DC 3KG5A 2I9LB 2YMXL 4AEHH 1F8TL 1F90H 5A16A 3FONA 5DVOA 4KKLD 1K2DB 5CZVH 1IGTB 4IJ3C 4U1IB 4DKFH 5FCUL 2XG5A 1XCTB 3V0WL 1OGTA 1LQSR 4PR5B 2C4FT 3LH2L 1TENA 3T0VA 4DUXA 1MJJA 5K9JH 4NQTA 5LGJB 2J6EA 2Z35B 4J3TA 2AJYL 3OTTA 2CO7B 2F74A 2AK4D 2CUMA 3VGAB 3BO8B 2XWBB 5C2BL 2QKIA 4NC1C 4Z5RB 3KVQA 2X05A 2HMIC 3SKUD 3QDMA 5ADPH 1BX2A 1OARL 3UDWC 3TBTA 1CFTB 3L3DA 1NGWB 4Y4FB 4C57C 1A6UH 3IETA 4G3YL 1S7XB 4N1EA 1MCJA 3VXUA 4O4YL 3SHSA 4U1HB 3VXMD 5HVHB 3EOTL 3HZYB 2Q86A 4PRPD 4J6RL 1AR2A 4BH8A 4CNIB 1H3VA 3OKOA 4G9FE 4PJ7F 5F88A 2VDMH 3C08L 3WHE1 3AAZB 4A2MA 2GSIA 5FECA 4HIJA 3PQYD 5B39G 2VXUH 1R24B 1C7SA 5TJWK 3TZVA 1JK8B 2BMKB 3QCUL 2QADB 2FZ3A 1CLZH 3PDDA 1EEQA 1ODAA 4M8QB 4OB5H 1UXWA 4YAQB 3VGFA 2HFEA 2YKLL 5TH2A 2DLTA 3LKRA 1ZSDB 4QRRE 4HQQL 5KVEL 4X83A 4J7RA 5E9DB 2J88H 5ISZD 1DN0A 5CJOL 4Q7DA 1L9MA 5CMAB 3PWLB 4HUWA 3RTQC 1U8NB 3MMEA 2OX5A 4FQIH 4PJXE 4XGZB 3MROB 2FDBP 4ZOBA 5IB1A 1BBDH 1P4IL 3MV8A 3G6JF 1NMAL 4Q9BA 4XT1C 4FQXB 1KIQA 4BSJA 2ICWA 4MJ5A 3CFCH 3BIKA 1RUKH 2WIIB 1ZAGA 4DN4H 1BPVA 2WUCH 4OD1H 4WHYH 3WXVH 4Z7UA 5CEXA 5DD0H 3VWKA 4PP1D 3PDGA 1CICD 2W9EH 1K8DB 3IFLL 5LG1A 2RAMA 4C59B 4L9DA 5CSZA 2Y6SD 4FHBD 3MX0A 4GRLA 4GBXC 5HTSA 2B5IB 5IJKA 3KPOB 1A4KB 4FMFA 1GVIA 4O51B 2Q3AA 3NOIA 1KTRL 1JN6B 3EDDA 3WNOA 4GSDH 1FSKC 1IAOB 1UM4H 1G7MB 2R0ZL 1TJHH 3T0WA 3HUJE 4PRPA 3VFSB 4GXUN 1NC2B 1A0QL 4J8RA 12E8L 3TBSA 5F7HA 3KGRA 2OR9L 3HZMA 3S98A 5DJ6A 4L4TA 2VQ1A 3BE1H 1S5IH 2N1KA 2PUQT 4JHAL 4OKVB 3SBWA 3GKWH 4UB0L 4HIXH 1R5IA 4GKOA 4P9ML 1CDGA 2BOBA 1VENA 2A77H 3P4NA 1MCWM 4K9EC 3HUJF 3WS3B 5EN2B 1BVLB 3PGDB 2BXZA 2W0LA 1FYTE 3I9GH 5ALBL 3ZSSA 1JZ5A 5DUBB 1UZ8B 5K9JL 3AC0A 2QL1A 4PRHA 3HZKB 3FB6B 1JFQL 3O4OB 4WU5B 3T0DA 1WJ3A 4OQTA 5J56B 1TCMA 3PWJB 1HOCA 5KAQG 1BWWA 3DUUA 1J18A 1BZ7B 4IRJB 3MODH 5DJDA 5DTFB 2OTUA 4IDLA 5F3HB 2OTUB 4XPHH 5HVGB 4NC2B 3CMOL 1Y6NR 3L3HA 1G6RB 4F7MA 3WEXB 3KYMA 5SWZE 3THML 4N8CL 1E28A 2R0KH 1IGYB 4APQC 1YNTA 4ZOAA 3UJJH 2VDKH 5CILL 5L7XL 3L9RA 4B50A 1MCPL 3KLHC 2KUTA 2O5YL 3S97C 4MSWA 3RWDA 4NZRL 5ACLA 4BM7A 3M1BB 1G7HB 1SVCP 2FJGA 2JK5A 5K33A 4YBHA 4NYLB 5DMJB 4OB5L 1BVLA 1E4WH 3MBXL 3ARZA 4YHLH 4JFDB 1X5LA 3Q5OA 2APBA 2AS5M 4N8PA 2CLZB 5TQ0H 1LDSA 1ZA6A 1E6OL 1FIGH 5D1ZC 4UNTA 3FRPG 1FGNL 1EH9A 1Z3GH 2ILLA 3R1GL 3LN5B 2J4WL 4B7LA 2XWTB 1LE5A 4P2OC 4FQCH 4LVEA 3TCLB 3UJIH 1BBDL 1P4IH 4CMHC 1EX0A 2FSEB 2ZPKL 4HX1A 3VH8A 1OQXA 1F97A 2IGFL 2VB5A 5HGDB 2AABH 4CVZA 4MCYB 2CDFA 3TT1H 4MB4A 1UJ3A 1JN6A 4JO4L 2XY1A 2WNGA 5AEAA 5JHDA 4Z7QE 4FFYH 5M95B 5EZJB 1RK0A 1IGIL 2BJMH 2DKSA 3BP7B 3BZ4B 1DFBH 1QHPA 2E7CA 2G5RA 2QHRL 4BQ6A 5CEXB 2HJKB 3MRDB 4PJHA 1FL6A 1EEYB 1FE8H 4GSDL 4PY8I 4Z7QF 1VPOL 2WIIA 1L0YA 1WCQA 1YEJL 4DGIL 2AERT 1HDMA 3KPQA 1WZLA 2ICWB 2EEDA 4DVRL 3SN6N 5GS1C 5CJ5A 12E8H 5MEOB 1KB5B 3U7WH 1J0YA 3KLAA 5CEZD 5CGYC 5ICYB 1S5IL 1CU4L 3D39B 2P46B 3B8SA 4YX2H 3N85L 3R06B 1GAFH 1F4AA 5EO9A 4HIXL 1FQ9C 3PXHA 3U0TA 3BZFB 3H3PL 3RKPA 1DN0B 2AK4A 1MCEA 3ZT7A 3IF1A 3DWTA 3LQAC 4YAQA 4YZFF 3P4MB 1SJHB 2QBWA 1AQDB 1RIUL 3O8XD 4GAFB 4PTTB 5IR1A 3IKCA 2BMKA 3QEUA 1R24A 3U30B 4NJAL 3UBXG 3KJ4B 3KXFB 3L3IB 5HVHC 2HRLA 2HWZH 2LTQB 5EFIB 5E5MB 1ZVSA 1BLNA 2YWZA 3OKOB 1ZK9A 3QNYB 4I13B 3R8QA 2G5BA 3VXOB 2Q86B 3H7BA 1AGCB 1FC1A 4XCCH 4HUXA 4POZC 2IBZX 3NZHL 3L3GB 4MAYB 2Y5TA 3F12B 2YOCA 3S36L 4AIZB 3OAZK 4L3EE 4I18A 5H35A 4U1JB 5C0ND 1JPST 3GJEB 4PJ5A 1J1XL 2R0KL 3H0TB 2P5WB 5E1AA 2AJ3B 2ESVB 5FKAB 4RFEA 5HD8D 4LSRL 2GAZA 4LK4A 3SDYH 1A22B 1ZHBB 5EPMB 3KPSE 1QKZH 2GTZB 2F74B 5GGUB 3VXSE 3QFDB 3OX8A 5IT2L 5F70A 1KJMB 1DLHA 4HDIB 5CZXD 1UYWL 4LLWB 4M1GL 2X70A 4XNMA 4ELMF 3HFML 2MCG1 3SKJL 3KR3H 4HKXB 4OCWH 3O2VL 4Y4KA 4Y5XA 1PLGL 4MWFB 2XZQL 3VD5A 3UDWA 1X5ZA 3R1GH 3NA9H 5DHVB 3W5NA 4JZNB 2DDQH 1D5BA 1W72B 4F7EA 4WO4D 2R69L 2RFXB 4KUZH 4TUKH 2NY3B 4U6XA 3QUXB 3EO9H 1T1WB 5IW1A 3QUXD 1JWUB 2G60H 3MRRA 5ICXA 3LMJH 4PJ7B 5CGYD 1TITA 4M1CC 3NAAL 4XMKL 3KYOA 3OXRB 3QDMD 3CC5A 1NCCL 2CKNA 4L4JA 3ARDD 2R23A 3VA2C 5KTEL 3B3IB 2XN9B 4PJIA 5EOTA 4L9LA 4POUB 4TSBH 1I75A 2EO1A 1K85A 3VCLB 4G8GB 4YH6A 4ZAKB 3V0VB 4DQOL 4ZAKD 5CCKL 1BOYA 4LSPL 1YEJH 1HXMB 1RZKL 1X6LA 4BZ1H 3ZDYF 1CLCA 3QEGH 1AFVL 4PYGA 3VG9C 4X7SL 4LFHG 4PV9A 4JM4L 5IFJB 4PJFE 2VQUA 1CICC 3UTQB 2Z9TA 1GAFL 1ZMYA 3R4DA 2XIDA 2JB5L 3I75B 1JGLL 1HEZA 3RHWF 2DN7A 2IAMA 1XZ0B 3B9VA 2VC2H 2X4OA 3V9FA 3GSXB 1LEIB 1Z9LA 5C0NC 1T1XB 1MHHA 3GMOA 3MJ7B 4Y1AB 3SDDC 2C3GA 2DWEA 3MLUL 5FUOH 5KG9B 3LY6A 4LRIA 5AG9A 3BVNA 4ODSL 3SQOL 4TSCL 4YDIH 3INUH 4TOYL 3QNZB 3O6MH 1BQUA 1N4XL 2GHWB 2P7TA 4DGYH 4P2YA 4DW2L 2HP4A 3CLEL 2Z31B 4XCCL 1NBYA 5B3JF 5TPWH 2A6IB 3QJHB 3BEVB 4BFGA 1NEZA 5CJBA 5TDOA 2ZWLT 5BMFL 4FN0A 1Q72H 3WKNA 1ACYL 3ROLB 3WYRA 1KCSH 3QDJA 1TLKA 1BIIA 5DFVC 1IKNA 4J4PC 1QSEA 3LD8B 2D0HA 5MEPA 1VESA 1OAZL 4LSRH 2J8HA 5ENWA 4HG4K 3MRLB 4GS7B 1R6VA 3BRFA 1C7TA 1NBYB 5FYKU 4Q0XL 3TT3H 3MLSL 4X9IA 2B2XH 4XP4L 4DN3L 3QI9A 3DX9B 1HINL 4BZ2H 2BNRB 4L5FH 3SKJH 4P2QE 4Z18A 5K9OB 4KZEH 1PLGH 4XZUA 5KSAD 3QFJA 3V6ZA 3T0AA 4DKEH 2OYPA 3IDIB 5A1AA 5ETUA 2DWEB 4KI1A 3V6OC 3WLWC 5DUPH 2DQJH 4PJ9C 3GIVA 4X6FA 2C3WA 2AEQH 1BECA 1RUML 3VWJC 4WFED 3QG7L 3BQUA 1NCDH 4X6CE 2IADA 4XVSL 1QTYT 5DEZA 4HWZB 3ZSTA 4NQCD 3C5ZD 4BUHA 1WC7B 4NPYB 4KKLC 3EZJB 4JFZH 4LPXA 4KI5D 5JW4Q 5JHDE 2GJZB 5DD5L 3EO1B 1PEWA 1PEZA 2XKNA 5TE4H 3TNNA 3O6FA 4M03A 1RHFA 2EIBA 3BWAA 5ACMA 1DBMH 4E42B 1SEBB 3QXWA 2R4RH 3P4LA 3MUZ1 2W92A 1QFWI 3NFNB 3PWPD 3EYQC 3NPSC 4X6CF 2AJZA 1AGEA 1UCBL 5EU4A 3ULVH 5I1AB 2BFVL 1RJLB 2VKXA 1UCTA 2BY3A 2HJFA 3T1WA 2CPCA 2HLAA 2KKQA 3ARFB 4MVBC 4GQPH 4D9QD 3G5VB 3RWIB 4PJBB 1MUJA 4NNYB 5DURD 4PD4K 3QEGL 5CGMA 1AXTL 3OKKB 5BVPH 2CR3A 2WUBL 1NBQA 3QUXA 3LQZB 2Y9RT 3CFJB 4S1RL 4DGVH 5E2UL 5IV2B 3L6FA 3B2UD 2QSQA 2Z4QB 3D6GA 5ERWB 1I8IB 3GMLB 3QI9D 2BSRB 3MRCB 1D5BB 1YEHH 5HYJB 3PJSA 2YHGA 5HGGS 3VWKC