2IDSA

Structure of m98a mutant of amicyanin, cu(i)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idsA00
1AG6A 3FQYA 3QPKA 3TBCA 2XU9A 3BQVA 3CDZB 2H3XC 2Y1AA 1J5DA 1HAUA 2EIKB 4A2HA 1JVOA 1NIAA 3OMIB 1ZV2A 2A3TA 4YSCA 1BXVA 2IDQA 2H5UA 1KGYE 4P5RA 5I6MA 3N55A 2YAFA 4GXFA 1HAWA 3NJKA 4TXVB 3TA4D 3NJLA 5I5JA 6PCYA 2YAMA 3CG8A 4DP8X 2EILB 1ASQA 2YAPA 1SDDA 3QJSB 1KDIA 3AG4B 2DWSA 2X87A 1W8EA 4GYBA 4ENZA 3H4HA 4JHVA 2HX7A 2TSBA 3NJIA 3ZDWA 1OCOB 4BDVB 4DPAX 4E9WA 2E86A 3CVDA 1EHKB 3FSAA 5I6PA 4E9SA 1BYOA 1SF5A 2LLNA 3PAZA 1ET8A 1GSKA 4QKTA 2CBPA 2YAOA 4AKPA 3ZBMA 3H56A 2VM4A 3G5WA 1KCWA 1DZ0A 4YSOA 3WG7B 4NB7A 4YVUA 3ABLB 1AR1B 2W88A 5TK4A 1ZIBA 2DYRB 1E5ZA 3QJRB 5B3SB 1CC3A 2IDFA 1SF3A 1L9QA 4KO7A 2J5WA 4UF7C 2OJ1A 4GP4B 4N8UA 2FTAA 3TBBA 1CUOA 2GHZA 5EHFA 4E9RA 2B08A 1JZHA 3PAVA 4YSEA 2B3IA 2JXMA 2NRDA 2Q5BA 1ET5A 3T6VA 2YAHA 1ASOA 3T71A 2X88A 4YSSA 1E67A 2Y69B 1KDJA 5B1JA 2VSKB 1OE3A 2ZWNA 4UAHA 7PAZA 2EINB 2UXFA 1PNDA 3CVBA 3EH4B 4NERA 2XV0A 4M4RB 4DP5X 1NIBA 5D4JA 2YAQA 3FU9A 5PAZA 4YSAA 1BQ5A 2AANA 2PLTA 1NDTA 3MX0B 3HEIB 4BK5C 3WNIA 4K9JA 1TKWA 3PAUA 4F2EA 4YSUA 4UANA 4G70B 2JKWA 5B1BB 1JZIA 4BXVA 3UABA 4E9VA 1NWOA 1WA0X 2GI0A 4L0PB 4G7RB 1RZQA 3UAEA 1OF0A 3D12B 4WKXA 5A7EA 3ZIYA 4PAZA 3UGEA 3QJUB 2XX0A 3TU6A 7PCYA 3NSCA 4QLWA 3S3CB 1UATA 2XV3A 5ANHA 4BWWA 1A65A 1MG2C 2FJSA 3QJQB 4W1TA 1PZBA 2YXWA 1BQRA 1PMYA 1A4CA 2N0MA 1T5KA 1BXAA 4HHGA 2WO2B 3AG1B 3T9WA 1V54B 2BW4A 3ZX1A 1PZAA 1QLEB 5B7EA 1MDAA 3HB3B 5I6OA 2UXTA 4YSPA 1JZGA 4A2EA 3N2JA 6PAZA 1KYAA 1RZPA 2YARA 1AZNA 1VLXA 3AW5A 4KOCA 4BXSV 1WA1X 2BP0A 3FPYA 1IKOP 1SDDB 1KV7A 2ZXWB 2GC4C 2BWDA 2IH9A 2UXGA 4X4KA 2XLLA 4E9YA 1E65A 4DP2X 1AOZA 2PP9A 9PCYA 2BP8B 2GC7C 1ZIAA 4DPBX 2RACA 5B1KA 2IH8A 2OCCB 5IY5B 1FWXA 1NIDA 3S3DB 3NSDA 3ERXA 3T6XA 3NSFA 3PPSA 3QQXA 3CZUB 3V9CA 3OQRA 4KO6A 3EHBB 2DWTA 1OE2A 1SNRA 5LDUA 3OM3B 2DY2A 2MRYA 4F7KA 2MTAA 5TK2A 1QHQA 2EIMB 2Q9OA 1YLBB 1ID2A 3EH3B 3NSYA 1OV8A 4HALA 4AI7A 5I6LA 3FT0A 5F7BA 2YAEA 4E9XA 3NYKA 3PXLA 2FQFA 1PF3A 1SFDA 4G72B 4AKQA 1A4AA 3DIVA 4G71B 2PP8A 2WSDA 1PCSA 2BZ7A 2I7SA 3PLYA 1NWPA 3X1BA 2HX9A 2GBAA 3GXUB 3FU7A 2CALA 1NPNA 2PPAA 4HAKA 1FA4A 1E30A 1EZLA 4NAJA 5B1JC 1BYPA 5PCYA 2ZONA 3SBRA 1TEFA 1M57B 2AVFA 5I5IA 1JZJA 1PAZA 2CJ3A 2BW5A 1HFUA 1ETJA 1WS7A 3AG3B 2XV2A 3SBPA 4GP5B 2EIJB 3V9EA 4JHUA 1WAEA 3IN2A 3DTUB 4PCYA 3L45A 2VSMB 1GS6X 1AZRA 1NIFA 3QJVB 2VW4A 5B7FA 1JERA 4DP1X 1JXGA 1E5YA 2PPFA 3SQRA 3FU8A 2J56A 1NZRA 3ABMB 1AQ8A 1ILUA 1V55B 1M56B 1IUZA 2BO0A 2HRGA 3EH5B 2QPDB 1SFHA 2QPEB 2PPCA 2GIMA 2VW7A 5AKRA 2XX1A 2UX6A 1WS8A 5D4HA 3S8GB 3X1EA 8PAZA 2JFCA 2FWLB 3DKHA 2PCYA 1IBYA 4HZ1A 1SJMA 1W6LA 2HXAA 1L9SA 1OE1A 2FQEA 2QT6A 1QNIA 2IWEA 3EF4A 3WIAA 4DP0X 2BP8A 2R7EB 2BP0B 2HZHA 1XMEB 2HRHA 2IAAC 2PCFA 3NJFA 4A66A 3OMNB 1URIA 3BVDB 4WTQA 2BWIA 3T6ZA 4ZK8A 1FFTB 3WI9A 1PNCA 1PZCA 1NICA 3FYEB 3QJTB 1OCZB 2XUWA 1OCRB 1GS8A 1JXDA 2VW6A 3S3BB 4A2GA 2ZOOA 5I26A 2J57A 4BWUA 1L9PA 3MBWB 2P80A 1AZUA 4G7QB 4YSDA 3RYMA 1J9QA 1AS6A 3IE9A 1AZBA 1BXUA 1AAJA 3ABKB 3NJMA 1JOIA 2HX8A 3FU7B 1XB8A 1AS8A 2HLEB 3S8FB 3X2QB 1J5CA 1I53A 4KO5A 1AANA 1AACA 3IBOA 4EF3A 3U25A 1F56A 3X1GA 4YSRA 1N70A 3FS9A 2XXFA 3KW8A 5I5MA 2XWZA 1GR7A 3NJJA 3WNJA 3NP4A 1JZEA 3FSZA 2CUAA 2P80D 4HCFA 4BWTA 4HCIA 5I6NA 4YL4A 1IC0A 4DP6X 3JTBA 2DYSB 2FT7A 1AS7A 1L9OA 1CYXA 1GY2A 4E9QA 2DV6A 5D4IA 1J9TA 2IDSA 1DYZA 4KNUA 5B1AB 1BQKA 2AFNA 1W6WA 3ASNB 4KNSA 2PPEA 1NTDA 1NINA 2CCWA 3NP3A 2FT8A 3OD3A 4Q89A 3JT2A 1V10A 2FQDA 2I7OA 4A67A 2WO3B 4KO9A 2FNWA 3UAAA 4AKOA 2CAKA 2H47C 1M9WA 4AZUA 1ZPUA 2VMJA 2W8CA 1AZCA 1ILSA 3FYIB 1N68A 1WA2X 2AZAA 3CDZA 2FQGA 4MFHA 3SBQA 4A68A 4BDVA 4F2FA 1KBVA 5B7MA 3NJGA 2GSMB 1GS7A 4E9TA 1BAWA 3KW7A 4GY4A 5FC9A 1ADWA 4FA7B 5F7AA 3PCYA 4A2FA 1PLBA 2IDTA 4YVNA 1NPJA 1J9SA 2VN3A 3IN0A 2QDVA 2R7EA 1CURA 1JXFA 2IWKA 1MZZA 1PY0A 1OOWA 3AZUA 3AY2A 1JVLA 1TEGA 2J55A 4G7SB 4A2DA 1RKRA 1ET7A 5I6KA 3H4FA 1KCBA 1L9TA 1OCCB 3FQ1A 3IEAA 3X1NA 1JZFA 3TASA 4DP4X 1PLAA 1GYCA 4YSQA 4DP7X 4AX3A 3T6WA 1J9RA 3GDCA 3NJNA 4P5SA 3C75A 3FPXA 2TSAA 3FSWA 2IWFA 4YSTA 2QDWA 1A8ZA 2XYBA 3NT0A 1A3ZA 1SHXA 3ASOB 4CSZA 2VM3A 3NJHA 5AZUA 1RCYA 1ZDQA 2UXVA 5I28A 2YQBA 3AG2B 4W9ZA 4DPCX 4N4YB 2FT6A 3UACA 5AFAA 1TU2A 4DP9X 4RH4A 3WKPA 2GB2A 2PPDA 2AZUA 5E9NA 2YXVA 1IBZA 1SHWA 2IDUA 4JKNA 4M3HA 3X1FA 1MZYA 2BHFA 1ZDSA 1BEXA 4HHWA 1X9RA 3CVCA 2UX7A 1A4BA 1GY1A 1X9UA 2I85A 3OMAB 3UADA 1XB3A 1PLCA 3FQ2A 4CSPA 2OV0A 2PP7A 1ASPA 4HCGA 1GW0A 1KBWA 1NIEA 3WKQA 2XVBA 1XB6A 4HIPA 1AG0A 1L9RA 4FAAB 4GP8B 3FSVA 1R1CA 1B3IA 3GYRA 4Q8BA 2XXGA 4KOBA 1AIZA 1CYWA 1MG3C 2BZCA 3ABGA 4KNTA
chains in the Genus database with same CATH superfamily
3BW9B 3W0WA 3SDYH 4NBYB 3GHPA 3EYVA 3T8VA 4U0QB 5KN5B 1NEZG 3I50H 2VR4A 3HHRB 1OSZA 2YSSB 3CQPA 4Y9FA 4YSCA 2ED9A 3MBEC 4PJ9C 2IDQA 1NOAA 4L3AA 1T3FA 4XBPA 1AQKL 5IIEB 15C8L 1C5BL 2A38A 1DN2A 5DJCA 3F5WA 3B2DC 4KK8C 5KS9E 4HK3J 1X6NA 5IIEA 2HG5A 4AQEA 3BMVA 1GKOA 2A6DB 2PR9A 1HWGB 4GYBA 4W81A 3WSQH 1EMTL 1FNSH 3PGDA 1HOCA 3QIBA 1RZ8B 4R6UA 5FGRA 4UM9B 2EUZA 3MXWL 2I32A 4LSSL 2R0KL 3STZB 1TNMA 3FT4B 2YJLA 5I8CB 4YDZA 2CRMA 2PWHA 3P4LA 4NQDD 4XP9H 4BDVB 3HNVL 1S46A 3G6DL 3H1ZA 1I1AA 4XNXH 1JNLL 1E4XL 4OCMC 3N9GH 4CVWA 1BYOA 5GRJH 4YFDB 2OMNA 3ARGB 4M02A 3QDGE 4NNYB 4POUB 2BC4A 2CBPA 1QNZL 2FJFA 1GGTA 5EULV 2HTKC 3H2PA 4QRRA 5I30L 4PGJA 5IJDC 3DO7B 2R1YB 1EBPA 4J7RA 5D71L 5DRWA 5E2UH 1G1OA 5SWSA 1NGYA 2WXHA 5KVFL 4L0ZA 1YJDL 1E5ZA 1DQJB 4X4ME 3VTAA 1KWGA 3L4UA 4GXVL 3HS0C 5DU7A 2J1YA 2YGNA 3RNKA 4ZUTB 4KPHL 1LWRA 1LDPH 3BZFA 3UPCA 2F2HA 3WHE1 1X4YA 1W8OA 4GP4B 4NRYA 2L7UA 5D1XD 2HVKB 3C5JA 2LE9A 4HISA 3SYOA 2HA1A 4EUPG 1FFOA 4JRXA 1A14H 3RTQD 5E2VL 4FI7A 5AALA 3MROB 4GIOA 4P5TD 5EF1A 4CNIB 3SJVB 2X88A 1IVLA 1T20A 1TT6A 1T1XA 1ZTMA 3MLYL 2X1OA 2EEFA 1E5BA 7PAZA 1F1AA 3CVBA 1OALA 4GT0A 1AD0B 2G0LA 4IKIA 4NERA 3P4MB 3UIZA 1MCDA 4FL4B 4B6ZA 1G0XA 1WFTA 2APBA 3TLRA 1PZ2A 1BVNP 1NDTA 2EDBA 2NXYD 3LS4L 4M7JH 2Z8VC 5JYMA 3TBVA 5E24E 3HEIB 1C8QA 2G5BA 2QADC 4XB8A 5HY9A 2DJMA 1T21B 3FCBA 2H9GA 1CGYA 5T5NG 4JDVA 1XSJA 5DUJA 1U3NA 2GI0A 2HFGH 3OLGA 4DAGL 4J3WA 3SD2A 4OCWL 5KVMC 1L7IH 3TA3B 4P57A 3TBTA 4B9YA 2PTTA 2G60L 1OF0A 3UTTA 5E99H 3NEEA 2BVUA 4RSYA 4XAKE 1N6UA 4MB1A 3GIZL 2VSCA 3V0EA 2C3WA 3BUDA 1EO8L 1P2CB 3U9WA 2BY2A 4QRPB 4AEHL 4D9RD 1MDTA 3HRZA 3BN3B 1JV5A 4J8QA 2WWMC 1JS4A 2YFNA 5DUPH 2Y7NA 1DHKA 2E27H 3EOBB 4B50A 4Z6AT 4JKPL 1WEJH 3O9WA 3C9NB 1N0LA 1PZAA 1DVFC 3IFNH 2CIIA 3NK4A 5KOMC 3MUY1 2XG5A 3GIVB 2YRLA 3TO4D 1KCSL 4ODWA 3UZVA 2WBJC 4BSVA 1N0LB 3V6OC 4WFEE 4XMLH 4D3CH 1TPXB 2Q7AA 4ZQTA 1MFAL 5EV7A 4YLQT 1UADC 4HWBH 1ADQL 1XH1A 3QQNA 2ZKHL 3GMQA 3CU1A 1AE6H 2BP0A 4AYGA 5INDB 4FXGB 1DQIA 5BW7C 5ABAA 5ALBH 1FFRA 4FYQA 4X99A 3DVGA 1LYQA 1U8PB 2XLLA 1GPOL 3OKYA 5FF6B 4DGVL 1VA9A 2GC7C 3D2TA 1PJWA 1T04A 5LAPA 3EO1B 4C83A 4Y19D 5TGBA 2Y5EA 1S5IH 2FSEB 3UTQB 2OCCB 4LLYB 4FXTA 2XFGB 1MVUB 2EYRB 2BRRH 2WWNA 4PV1C 5KSUB 3PUUA 4L4VA 3T65A 4KO6A 5FF6A 5LDUA 2WBXA 3C5ZD 3M46A 2BC4B 1M05A 3QNFA 5AWNH 3WFEL 5CUSL 2FO4A 3VXRD 5I74B 4BINA 2JKIS 4AQ1C 4LLWA 5FKPA 2GT9B 4FF9A 3EH3B 4U1SB 5HI3C 2YQGA 1TZGH 3MN8A 3GMOA 4PGZA 5AW6B 3S88L 4G6FD 2IANE 1VFMA 2NW2A 1LGVA 2F54B 3ALWA 1EXUB 3KLAA 3NYKA 4ELKA 2FQFA 4Q9QL 4QMEA 2OR9H 1ND0B 1BDYA 1FFNA 4M6OH 4JM4H 4G71B 2PP8A 3LHPH 1R46A 3FO0L 4K2UL 2BZ7A 3DBXB 2XYCA 1UM5L 2BSDA 2GBAA 4J12A 1NPNA 5I75B 1VZGA 5CU5A 4GKNA 1F2XK 3LNDA 4NC1C 4IKJA 3ULSA 1CFSB 3RU8L 2OXHA 1OGAB 1A7RH 4PJCB 5E1IA 3FONB 4LNRB 3S37L 3VSTA 1G9EA 3HI5L 5DTFA 3H6AA 4WW1A 4MNHA 43CAB 3U4AA 1RJYA 3IRPX 4P23A 4K7PY 2VQ4A 3ZLQC 2VSMB 1GS6X 5J1TC 1DVFB 3AWGA 4EE2A 4M9PA 3PYCA 5G2NA 1MLCB 3IVKA 4XNQA 3F62A 3ZE0B 4ODHH 5L8KB 5EMYA 3TJPA 2WCSA 1LP9F 5GGRY 4CADB 5E5MB 4AZ8A 3QJXA 3DJZA 5BVPL 1KN4H 3ZK0A 1EJOL 4DKEL 4W4OC 1HC1A 4H1LG 3S8GB 4FQ2H 1D9KB 3C60A 3TBWB 5DMKA 4GSQA 4NRXB 3MOAH 3MU3A 4Z78A 4IOFD 5BRPA 3HZ3A 3TV3L 1U8HA 3QPXL 5IFHH 3ZT7A 2HXAA 3Q8FA 5DEFB 1DJZA 2EUVA 4FABL 5DD1L 1QVOB 4MVBC 5EC2A 3LRSB 3MA9H 2JJSC 3LZNA 2HRLA 1C5DB 3LMJL 4KNQA 4F9LC 2DQUL 4HS6B 4ZX4A 3S34L 3QEQB 1ROWA 4XOBA 1MAMH 5EOTB 2HT3D 2C3HA 1I3GL 4K23L 4AQAB 4DOHB 3ALXA 1WSST 4XX5A 4G6JH 1Z6JT 3VGBA 4NC2B 2HVKA 1PZCA 2R0KH 3SKOB 2XRAH 4PG2A 3V6ZA 4P3WA 2AVGA 1BFOA 2DMBA 2VDNL 2CWRA 1VESA 4ETQB 2YPVA 1HSBA 3IRZA 3NTCH 2FATH 5L88H 3GNML 4IBLT 1H5BA 3D48R 5JIDA 2D9CA 4KRLB 5D7SH 4GW4A 3RYMA 3SYQA 2X0VA 1GVIA 2WIMA 3MLPA 3QQDA 3LCYA 4MD5B 5F7MC 1DZBA 3UROR 1RPUA 4JO1H 2NOYA 3FU7B 4OZIA 5C0AB 3HN8A 4L0YA 4BQBA 2BJMH 2P43B 5EZPA 5I8OH 4I18A 2NYYC 2CK0H 3PF2A 4LVNB 1MJJA 3QVAA 4GAYA 3KYMA 2XXFA 4PVLA 3W81A 4I18B 1GR7A 4ANWA 5JHBA 2TAAA 4YXKH 1XGYL 4DFIA 3FSZA 5FA3B 3HS0B 1WH0A 1WD9A 5EA0L 4HBQA 3BKJH 4XMUA 4AQOA 1EK3A 3QA3A 3L3JB 3BI9X 1E9QB 1J8HE 2YIHA 2CLZA 4X6DF 3UEQA 2M2DA 1U8KA 1FNLA 5E2VH 1T66D 3CHOA 4P8QA 5F21B 4UINH 2A83A 4ZNEE 4PP1C 1BVOA 1QBAA 1ZY9A 1J8SA 2X4NA 2MQ3A 4QO1A 2CDFA 1MIEL 2OZNA 4O2EB 1R24B 1QTSA 2IWGA 2YD3A 2AJVH 1JGVL 3GSWB 4PJDB 4QRRE 3VO0A 5T3XH 2FQDA 2HT2C 2FL5B 3L9RB 4JL2A 2A83B 3GJFH 4DVBA 5KSVA 3QC6X 3BO8B 1LNUA 5DMIH 4LHUG 2WV3A 2ZG2A 1BVKB 3FO2A 4LPTA 2X4RB 5T1DH 4JRFA 4L4TE 5FCSH 1HZLA 2X9ZA 4X4YA 1OHZA 2AZAA 4X9IA 2FQGA 3RZCB 2WXQA 4JFXA 2KI6A 5A7BA 5TQ2H 4N85A 2HKFH 1JPEA 4XT1C 4ZAKC 1QA9A 1WBXB 3M07A 3GMPA 1U95B 4RAUA 4R26L 3GBNH 5F6IC 3HI1B 3SE4C 4AYMC 2GJRA 5LGYA 2JB5L 3JTTB 4PJ7F 3VDBA 3STLA 3BZ4B 3QIWB 3SCMC 3H2QA 5KOVC 2A6DA 2CLVA 2FK9A 4U05A 3AREC 4G9FE 3O8XB 3S4SB 5D71H 3DPBA 4WGVB 1J0KA 1G7IA 4MJ2A 2GFBB 2ZAHA 4MCMA 1ZT4A 2UYLA 3PWPE 1FGVL 1T7YA 4Z77A 1RUAL 4QRTA 2LU4A 3OJMB 5J7CC 2CJUL 2OYKA 3O9WC 1IKNC 2B14A 4PWEA 4AX3A 2AQSA 2QSVA 3K8KA 4MAZA 3DXAD 4NLAA 5E5RB 3ZE0F 3PWUB 3MLTB 3WO4C 4MMXB 1B4LA 3GHBL 2WQXA 2ADJB 3CVHL 4P46C 3KYAA 3NIFF 3QUGA 1SHXA 1AGFB 3HJ0A 5HYQB 4WFFE 5FGBC 1G6RA 4OUUA 2J8OA 5IM7B 1OGTA 3NIGB 4YK4C 3D0AA 1RIVL 4LMQE 1G7PA 5JW4Q 3Q2CA 6TAAA 5E9AA 1QLRA 2H0JA 4C57C 1KEGH 1NEZB 1YYMH 4RH4A 2OMBA 2HPOA 4XP9L 3AGWA 3CIAA 1MW1A 4FG4A 4FXGC 1Q0YH 3FTYA 4JCLA 5EEUA 4JO4L 5M95B 2V9TA 1XF3A 3DARA 2F7PA 3P11H 4LBEA 2V8LA 2KQMA 3CVIH 4B9FA 3U6RB 5T1LD 4XMXA 4H8PA 1ZSDB 3UJIL 4EN3A 4EZMA 5EZOH 3OJ2C 4UDUA 3M88A 2OJEA 3Q5OA 4WI3A 1SYVB 5KG9A 1P6AB 3KYMB 4PCKA 3B3IB 4AH2B 2QVTA 4I0PB 4LSQH 4TUKH 2OTWB 4YBLC 1L9RA 5E2WL 2AK4E 3KL5A 4X4XA 3FSVA 1TVDA 4AQ1A 3D39B 3X13B 3ULUE 1CGTA 1SYSA 4XPFH 1EAQA 1AJ7L 4FQJH 4M48H 5B22A 5IK3B 3QDGB 4GUOA 3HE6C 2ICWI 2WJ7A 1SDAB 1CDGA 3EBIA 4UIMB 2VLJA 2PXYA 3VW3H 4LMQI 3DWTA 1QW9A 3OMIB 1RFDL 1ZV2A 3WTUA 1KOAA 1P84K 3DVNB 4MMYB 5FKAB 1QRKA 2Z35A 4BK8A 4OZFA 4N2KA 3L5HA 1F4HA 4NKIH 1QBLL 1A3LL 1HAWA 4Y4HB 1KCSH 1G9NH 5I5JA 3UFIA 2YA2A 5CHNA 4LCYA 2QV4A 4X6FA 3T1FB 5KBDA 3QJSB 3R06B 2NX5A 2X87A 2ICES 2WZ5A 4I48B 5DD3H 4V2BA 3O8XC 4N20A 3O6FD 4U1JB 4KUCF 5B3JE 4Z0BH 2D7OA 4I3RH 1GYUA 2AXHA 4H2CA 3V0HA 1E40A 3MLZL 5I8EB 3CWGA 1MCKA 3IWVA 1NM4A 2Z8SA 5T3ZE 4E9WA 1Z1WA 2QL1A 2V5MA 4NO3A 1NM9A 3VGDA 3CZLA 5AG9A 1S5IL 5DRXB 4AMXA 4OKVB 2G3NA 4HZLB 3PWVA 1ESOA 2VM4A 4APQC 4F7TA 3UAJC 5MHSD 3U7AA 3FFDA 4EZJA 5JMOC 1TQWA 4YSOA 1NFDB 5GRXG 1WAAA 4X98B 3QRLA 3WTXA 1ORSA 4PG9A 4FFZL 3I6LE 2DQJL 5SV3A 3SZ6A 4DZBA 4NIYE 2CNZA 5BRZE 1Z5LA 3EYOB 4N25A 2MNJB 1JHTB 4J1UA 3V4LA 5GGTA 4YDLB 1H6EA 3E6FA 2VIRB 3MV8A 4JRYD 5I15H 4PY7A 2WHVA 1C7SA 1KYOK 1E2WA 2B1HL 2VL5A 3B7TA 3MDJA 4U6TA 5F9OL 3TO2A 4WI6A 4DQOL 5CZVL 3SKMB 2V9UA 3CZFB 1LDPL 3QULB 1NOFA 3JVGA 3WLBB 3D07A 3MLRH 1L4IA 3OKKB 5EDXA 2AW2A 4G8FA 2GBVA 4N0UA 4HEPG 1OGAD 2G2PA 3KR3L 1NBZB 4M4RB 4BFIA 1IGMH 3FAWA 1FYTE 2W0PA 3ROOA 5F3HB 3MUZ1 3DSFL 4G80A 2EDDA 4PI2A 5B38A 3T3PB 2VXUL 1YEDB 3BKYL 1PJ9A 2JKWA 3V0DA 4PU2A 1VACB 1YN7A 2OA9A 3QCUL 1OAUH 4E9VA 4OF0A 4NBXB 2WLKA 5INCA 1VADA 2VJXA 4D9LL 3FFCA 3DXAB 4ZI8A 1CDCA 4KJYA 1ZGLP 1BD2A 2E9GA 4PAZA 5T5FL 1KWKA 2PMZA 4F7EB 3TU6A 5DQ9A 1N8OE 1JNNH 3PQYA 5I1IH 3BPOC 2H4EA 5ANHA 2P28B 4P2QA 3WY3A 2D4DA 2ODHA 2LTQC 4NPKA 1T0MA 4HIHA 1QWHA 3FQXA 1HWWA 3CQQA 3QAZB 2N0MA 2BVQB 1Z3RA 2WXNA 3W1ZA 4IHOA 4XCCL 1RK7A 2P8PB 5G4OA 3U1QA 3NOIA 1HQ4A 1YNLL 4JY6A 3GFUA 1QLEB 1TJGH 2CO2A 32C2B 2ATKB 3FH8A 1RL1A 3OPZH 1XF5A 3QPXH 5IFHL 5IMOA 4AQEB 5EEWA 5FB8A 2YD4A 1D7BA 4FQCH 2IANB 3LKRB 3MJ9H 4DT2A 5HHNB 3FBKA 4J3OC 3RVTC 1HX0A 2B2XL 4MX7A 1U3HB 2IANA 1MFDH 3LKRA 1QSEB 3HI5H 2RCSH 3T08A 3ES6A 1WA1X 4TQHA 4B41A 3T2OA 4MDJA 1A6VL 3L16A 1UA6L 4LT7A 2GC4C 4J3UA 4JFSA 5E94A 5HDLA 4WCYH 4LRNL 3BUYB 2WGNB 4E9YA 1AQKH 3DGGA 5JHMA 3GBMH 5ICYA 3MBEA 2VJ0A 3AADB 4U4BA 3DMMB 4YS4A 3KLHD 5C6WH 3GGWB 1EAJA 1AVAA 2RH0A 1FWXA 3UEZA 4ZFQA 4HKZB 5FGSA 4B9KC 4OZ4A 1T0OA 5IB4A 4EVNB 1XTLA 3DUUB 5CBAB 5FW7A 4MAYD 2DQTH 3OXRB 4XR8C 4J4PA 1TITA 4EOWH 1BIIB 2DI7A 4HWEH 3H9SA 3P30H 3NFSH 2EE9A 1BIIA 5DJ0B 3QCVL 1ZGLB 1ID5I 1E4XH 4BUGA 5F7BA 3HMXH 4E68A 3DUUA 4E9XA 2DS4A 2F7OA 2C8NA 5ICXA 2RGSA 3WFCH 5D96C 5I8KL 1HYSD 3MZTA 4IJ3C 1XGRA 2BRQA 1MQKH 1E8ZA 1C08B 3G9AB 3ZHDA 5LXVA 1WFNA 2H41A 4JFWA 4JQXA 1DQML 2BFGA 1Q9KB 2OR9L 2X2IA 3K0YA 1FA4A 3TFKC 2P26A 2GIYA 1K9TA 3VRLE 2CLZB 4K4KA 1Y6MR 1RERA 5IW1A 4FG6C 4CU7A 2EIBA 5I5IA 2J1KA 4NZUH 4S1SH 2ZPKH 1Q0EA 4ZMLA 3EJJX 4JDZB 4Y2LA 43C9A 2BZDA 4N0UE 4E41B 1I7RB 2E74C 1OLLA 1BVNT 3DUSB 3DVNA 1BLIA 1ES0A 4W9CC 2X9YA 3TF7C 1OPOA 4PCYA 2ZOTA 4L8SA 5L6YL 4XCYB 5EUOA 3P0YL 3REWA 1FO0H 3BJLA 1AZRA 2OR7A 2Y07L 2VW4A 4CN4A 1JHKL 2Y1VA 3IGAB 3JUZA 4W9EC 3L4VA 3BP6A 4RGMB 5EZIH 5E8PB 4MGXA 3T77A 2NUTB 4PWJA 1SLWA 2BO0A 5DFAA 2JTYA 5FV2A 3RX5A 2WZ0A 4AGMA 3BSGA 5CMAB 2XX1A 4Y7MA 1CVRA 1NJ9A 5D4HA 3ILPB 1KIUB 2QSCL 4LLMA 3UMNA 4X5XA 4ABUA 8FABB 4HWUA 4N2LA 1WBXA 1UXSB 2O93L 3U2JA 1H3PH 5A2FA 4ODTH 3GIZH 2YXMA 3STZA 1BG1A 1C5CH 2AK4B 3WMPA 3MUJA 5C08E 1V3JA 4GMTL 2CK2A 7CGTA 4Y4HC 1HCFX 3B6SA 3HE6B 5DEGB 5IGXL 4CVXB 3HC3L 1RK0A 1N7MH 2R2BB 4PIBA 4XWOC 2WUBL 2YPVH 1B4JL 4Y89A 1G0YR 4LU5L 1R17A 1QFWI 4I3RL 4RAHA 4IOSA 3BAEL 1JXDA 3GJEB 2ZOOA 5I1JH 1EHXA 2X4QB 1AQDB 3LNGA 1NGYB 3HG0A 2JF1A 4HPHA 2Q2LA 2K4WA 2BVPB 2ZKHH 4HWNA 3O41A 4XMWA 3E1ZA 4XO3A 4QRRB 1EH9A 4Z77B 2XWTB 5D2LE 1E6OH 3QXVA 1BXUA 4GS7B 2XFXB 3U1PA 1J5CA 1CFVH 4X0KA 4PS4L 2QLYA 1UG9A 4JR9H 3SGEI 3UO8B 4MHHG 2PR4H 3NACL 4I4WA 4XCNA 1G5GA 5DJXA 5TE7H 5I17A 1S5HB 2E9IA 3EJTA 2A6JB 3BRGC 4OBSA 1EEZA 1EO8H 5HHOA 3LD8B 1T1XB 1AXSA 3HRPA 3MLXH 2A7BA 3QWNA 2MHAB 5DS1A 3TNMB 3WFBH 2CK0L 1I85A 4HUVA 3JTBA 2DYSB 2F8XC 4OF6A 3L8QA 5BZDB 3BWZA 3DX9A 1Z9SB 1V27A 3MRHA 5T1KD 1RZKH 4K8RC 4OT1L 1BQKA 3MA9L 4ZSOA 3ML9A 5DJZA 4G9DB 3TPKA 5FW8A 5LXGL 1FL6A 2EDLA 2WXGA 5FCUH 2NY4C 3RZCC 1B2YA 1RVFH 3ARFC 1J8HD 1FAKT 2N1TE 3GRWA 5DVNA 3G9VA 1I7TA 4YDLC 2W5PA 2CCWA 5BRZB 1IBGL 5AUMB 4P07A 2DICA 4OLVL 4Q89A 5E23A 2BVQA 1BA9A 4QYAA 3QISA 1I7TB 1MAJA 3JT2A 4JB9L 5IJBC 3C5ZC 5IF0B 1MH5A 5TF1L 1RZJL 2ATKA 4Y4HA 3U0TB 2JKXA 3CXHK 4WI0A 3GM8A 5TDPB 1Q72L 1D5RA 3LNFA 5KVFE 5DJ2A 2HWZL 2FD6L 5J4MA 4WHTA 1ZLVK 1NH6A 2E3VA 4BDVA 4S2SB 3V5DA 2EDEA 3F12A 4N2FA 1CFBA 4D9QD 4M1DL 2DDQH 3C5SA 5GZNA 5F7WC 4FQ1L 1HCZA 3KW7A 4L4TD 4JBSA 1BJ1H 4N2CA 3CBJB 4MYPA 2UY7A 4OKDA 3ARVA 3O4LE 3PWJA 1N5AB 1IGTB 4K94H 4KUZL 4PRBA 1DN0B 2QDVA 3ARBD 4N5ED 2ZUTA 3V6FB 5ISZE 3RA7L 1IC7L 1MLBB 3C09C 3UBXI 5C6TL 1M7DA 3OPZL 3CUPA 3K2UL 3RG1C 2AHIA 2H32A 3IMBA 2JCCE 1NCCL 1AR1D 4LP5A 4N6RA 3T4YB 4RNRB 3HVDA 2CDEB 4WEBH 4OZHE 2VXVL 4O2CA 3MLWH 4ZZKA 3IRCA 4J8RB 2E47A 3MRQA 1BFOB 4JZOB 5B8CA 4Y19B 4HMCA 1PY4A 2WKOA 2YGPA 2D8KA 3GMLA 1A3ZA 3MV11 3CLFL 4NZJA 4X5QA 5DHMC 4CBZA 4DWHA 1ZDQA 3B9KB 2VWEC 1T22B 4WVRA 4LVHB 3PIQB 1F4YL 4PY7B 1N59B 5JPMA 3VFUB 2ZWYA 3N44B 5DFWH 4MASA 3L3JA 3ZOAA 4FQQA 4G3YH 3US9A 2YUXA 2UX7A 5IHUL 1YCSA 3ME0A 3RIAK 3VGEA 4YHLL 4ZO8A 2UWEA 4A2LA 1CI3M 1P6WA 1CLZL 4PEEA 3DX3A 1D5XB 1INDH 1QO3B 1GW0A 5FUZH 4XOCA 5DJAB 2JJTC 1YNTB 3LQAL 3PWLB 2A6JA 2P5WD 2VE6B 1VKXA 4QXGH 3PWLA 1FNEB 3VA6A 4TV3A 2VISA 4ZFOL 5CIPA 3ROOB 2YFOA 4LSQL 2Z31D 1FL5A 1WLHA 4MBOA 5F93C 5C0EA 1S7XA 3FOMB 1TCRA 5IJVB 4GKZA 1HH6A 3LNHA 1VERA 1RUKH 2JH2A 4JKWA 1Q1JH 4XBPB 4F27A 1CICA 3Q43A 5DTFB 1BFTA 3PL6C 5HXMA 4RMRA 3TBYA 4MCYB 1I8MA 1A1OB 1QSVA 2AQPA 3CK0L 3UPRB 3A4FA 5AAPA 5F7UA 3RTQA 1J0JA 3Q9PA 4WI2A 4RBPK 3ZT5A 2EILB 2Q76B 3MLUL 4IBUA 4K3DL 3TX4A 3WDIA 5AW9B 4P9ML 4CVZB 1VIWA 5E7FA 1NGQH 4JHVA 3UDWA 1TVHB 3RJOA 4XPTH 1JDDA 3X11B 2TSBA 4I87A 4OCLC 1CJYA 3DRTA 3WEOA 1E7UA 4NJAH 4PH8A 3L9BA 4MJ5B 3V0WL 5T1KB 3MRPB 4D9LH 3AS0A 5I6PA 2HT4D 3RP1A 1R3HB 3OGCB 1N6VA 2FLBT 3OX8B 3GXIA 4U3CA 1U3HD 1UJ3A 3EG9B 2B8OT 5KBLA 3ECWA 2FO4B 2WMPA 4BFNA 3DVFA 2DIJA 3MGOB 1Q9WB 4F15C 4RDBA 4PJBE 3MLVH 2Z91B 5FGCB 1HCVA 1IGYB 3HPJA 4Z3FA 2NYKA 3BOVA 2AKRB 3K91A 1N8ZB 2UZXA 4PN6A 2J5WA 3TBBA 1CUOA 2XN9B 1JMZA 2J8UA 5C0RL 4EIZC 1GYAA 3ARDC 3OZ9H 2CLRB 4MA7H 1Y07A 4Y4KC 1F3DH 2BIQA 5HDWA 1PD0A 2Q5BA 2VN5A 4OZHA 3ZN6A 4PW9A 3WNOA 2WBJA 4TPRL 1GTNA 4NKOB 5F9OH 4QHUB 1E67A 3AXLB 4MD0B 3S35L 1SJEB 1WFOA 1J8KA 4UILH 1PNDA 2VDMH 1XGZA 3VXSE 4LLDB 2YAQA 4U6VL 1D5ZA 1OWWA 1CDHA 2XIIA 2APTA 1KF9B 2PLTA 2BMKB 2YA1A 5EUKB 3VXRB 2HYMA 4BK5C 5ADPH 3D39A 3X13A 3QAZC 5BO1H 1P7HL 4E5XA 1TTRA 3C6LC 4G70B 1TQTA 1NMCC 5TQ0H 3SYPA 4AIZB 3K2MC 1WA0X 1YN6A 3FQNB 1DDHB 3BE1L 2J8HA 4AIZA 5K59E 3DROA 3NDZE 3QCVH 3TNNA 5C7XH 4P46B 2D73A 1IEBA 4GRWH 5KANG 3DX1A 3KHQA 7PCYA 1TSRA 1NUDA 1F00I 4XP1L 3ZE2B 2L7JA 4OLYL 2UVFA 3WL9B 4Z7VF 3NFPB 2WLIA 4LCYB 3UTSA 4KMQA 4JPKL 4DUXA 2O5ZL 2HB0A 1JGUL 4LCCA 4OV6F 2V2TB 4OFVA 1A4KA 4P05A 1PQZB 5T1MA 3WTVA 4MJIA 3VXNA 3H9SD 3G08A 1P4LA 4G6KL 1H3GA 3WIIH 3WTWA 5DWUL 3BPNC 4XCEB 2R1WB 2NY0C 3HOGA 4BHUA 4JM2A 5D1XB 5GISL 4I9XA 5C0BA 4JFOA 2BCMA 4QJ4B 2YARA 4PJGA 2C9SA 3IJEA 2NZ9D 1YMMB 3QFJB 1RPKA 2X53A 3KXFE 5F1IA 2YLKA 3D2UA 3GF8A 3L5XL 2I24N 5IB3A 4PD4J 2EE2A 2PXYC 4OSUH 1E28A 4Y9EA 4JPIB 3VB9A 1Z5LB 1AXTL 1VGKB 2ZYRA 3LZFL 3CFNA 1ZANH 4QIRA 4QF1B 3EXJA 4TMPA 1GL4B 4DTGL 4YDNA 1GIGH 3FCSA 3S3DB 1PLGL 3FRPA 3UZQB 3NSFA 3QQXA 4ODVH 1TJHL 3MV9D 4KRPD 5LQBH 4E41E 1DVSA 3V9CA 1AO7B 3OX8A 3UJIH 2DWTA 4M8RA 4JANA 4XPBL 3T0WA 1OAZH 3KPSB 3RJDA 1MJJB 5AVYB 1P7QD 2Q9OA 4I18C 4IU2B 3GSNA 5AW0B 4ZUUA 5I1IL 3OKLA 25C8L 1E42A 2JJVA 4JGUA 4NQXA 5E2WH 1IGIL 3CHQA 2HH0H 1TPXC 2BCKB 3I85A 4IGBC 5DHDA 2VH5L 2XTJB 2HJFB 1PGRB 4BZYA 4GUCA 4L4VB 4UQEA 4KKCC 3T65B 1S9KC 3UYPA 2BNRA 4PJAB 3GSNH 1H6FA 1JN6B 2GCYA 4U6YA 5T3XD 2WSDA 1S3RA 2ZAGA 1YEDA 1NANI 1ZVYA 2NLJA 2QKIB 2Y06L 3LIZH 2ZSWB 1KFGA 2YPLD 2CALA 1R3KA 3VFTB 4EQ3A 4M6NL 3ESPA 4M5ZH 1NBZA 3D05A 3HTLX 1SJHA 4DK3A 4GMSH 1TEFA 1IL1B 1NBYB 3QZOA 3CE1A 5FO8B 2GBTA 4YXHL 5GS0C 1SJHB 1T03H 4L8SC 3V4VA 3ZDZB 3ESNA 5IMKA 5IBLC 2WXMA 4LLUB 3RBSA 3KL0A 4WEEA 1BFVL 5I74C 2B0SH 4GAGL 1V7NL 3BH9A 3MV9E 1A6PA 2I9TB 2F1BA 1CL7L 3IN2A 4XP6L 4M3KB 5AZEH 1MCOL 4AGNA 3CDGB 1NBQA 3QUKB 5DVMA 4AC2A 1GJUA 1QA9B 3F05A 3HZKB 3T3MF 3ZDXE 1PS3A 1SUHA 1YEFH 2VXTH 4XVUD 3VQ2C 1QZ1A 3KWXA 1TZIB 3E8VA 2FBOJ 2ZKXA 1E8WA 5CFHA 4W9DC 4F33B 4JO2L 1SDYA 4WQOA 1N64L 1JTTA 4KJQD 1W0WB 2B20A 3UG3A 3QZWB 1MWOA 2IBBA 5DFVC 2IJ0C 3PY9A 4KHTH 5I8CA 1ZHKB 3D9AL 4X8JB 3R0MA 2P3YA 3O4LA 3RLSA 3AY4A 1SOQA 1WT5C 3LN5B 1S7WB 3MCYA 3QHFL 1OLZA 1LTXA 3SKOA 4PUBL 2IFFH 2F5AL 3OAYH 2DLEA 5HJ3A 3TH2T 1C12A 1DDTA 4XHJD 5JR1L 2YEQA 3DBSA 3LNIA 4Y8AA 1RZJH 3QI9C 4K0OA 2GAZA 3WNNA 3QFJA 4PYHA 4A7QA 1O0VA 1O6TA 3LKQB 5AOZA 3QJTB 4X0NA 4EIBA 1AOHA 2EIZB 3RVUD 2ZX9A 5I0XA 4JO8A 3VXMA 1P4IL 2HJLA 4UYPA 1W72L 2Q7NA 3GJFA 3MROA 3T3PF 1T4WA 4LOFA 1L9PA 5AW7B 4W6WB 3LPGA 3O6FA 2EVFA 4JRXB 3QSKB 5GRYA 1G9NL 3L3KA 4I0CC 4KJPC 3QWRA 4MHHI 3K6IA 1AGDA 4HFWA 1DQQA 4KMTL 1ZLDA 4JN2B 4P5TA 5C71A 3KYNB 1EGJA 4PG9B 4RMVA 1B0RB 5E4AA 3QIUA 1AANA 1B0GB 4L1SA 4MAUL 5BPPA 2XA3A 4LFHD 1I85C 4FDWA 7FABH 2JKSA 4U1NA 4BFEA 4JS7A 4F15B 1P5UC 2I5YL 1U4EA 2D3LA 1IC0A 2NTFB 3IDGB 2IEPA 3ZHKA 4MNGB 5KSBE 4UIKL 1HHGA 2EE6A 1L9OA 1QTPA 4F91B 1K2DB 4RRPM 2W95A 1PX3A 1U33A 1W91A 2ZYHA 2H6UA 1LO5B 4XCYA 1T0PB 2YMXH 1L0QA 4M61A 3OKMB 1W6WA 3AROA 1BZ8A 2W9DH 5E1HB 5FO2A 5FGCE 1JRHI 3O3EA 43C9B 3P54A 3VU1A 4PJ8B 4NQDA 4XPGH 3VRJB 1J5OL 5KVEL 2IPKB 3ARDB 3L7EB 4NQDB 4HUXB 2XA8L 3WTTA 3UTZA 2X4NB 1KBKA 2JCCA 3H7LA 4N5UA 3DJTA 5DQJB 2V5SA 4RMQA 4YWGH 5B4MD 1EUTA 2A6IA 4K3EH 4EIUA 4JB9H 1TZOA 5HHPB 3VWKB 5HHOE 4ALAL 4PJHB 3OKEB 2VDPB 3Q05A 3HNVH 5A2CA 4XCEA 5D6DC 3SOBL 4TLKA 5BXFB 5GS2H 3CV5A 1QHOA 1OP5H 5JHLL 3Q1SL 4KGJA 1FZOA 1A7QL 1SBSL 2A4CA 5F88A 4OJDH 1RZKC 4K8RH 4D0CB 3CFDB 3IDMA 4XPAL 5F7AA 4G8GD 1UXWB 4JFEA 1E4WH 1FVCA 1WZ1L 4LIQE 1FO0L 1MVYA 3RUGB 2B1AL 1RIUL 3MLXL 3PNRB 4LLYA 2BSED 3JTTA 2BNUB 2OTUB 2WXIA 3BJ91 4LEOB 4X7SH 1ET7A 1OSPL 4Q52A 4IDJH 2FGZA 3MRGA 5EU3A 3FT4A 2BM3A 4DP4X 2PWDA 4AV0A 3F8UB 5E9DB 4ZO7A 3RKDC 4F1SA 1L5GB 5KSAB 1XF2A 1UH4A 4JHAH 5SWQA 35C8H 1G7PB 5I1AA 5L2KA 3BUYA 1LP9B 2L8AA 4UT9L 3T4AB 2EIEA 2OSXA 4JM2D 4YSTA 3QEQA 4ZS6D 5A2AA 1EQWA 1ZK9A 1PFOA 3OWEA 3GB7B 4FLRA 2JWYA 1U42A 3A6CH 2IBZX 5AOIA 1WCBA 5I19H 1EXUA 4DVRH 3FUKA 3BUBA 3JWOL 3ULVE 1FFOB 2IQ9H 2ZCHL 1BQHG 2IV9A 3AXLA 4NJAL 4ZO6A 4N2MA 2Z7UA 4LCUB 4NQEA 4YHYC 4U2YA 3AREB 4B9PA 4URTB 3SO3B 3VFTA 4L8DA 5BZZA 2EZ0C 5HD8C 3UADA 4X9BA 3N1MC 2VDNB 4QRSA 4XODA 2AERT 4PJ8C 3UG4A 1ASPA 3ZKND 2A73B 3II2A 2D3VA 1MFCH 3L4WA 1AZZC 3K4AA 1YEHL 4JDVB 2YWZA 2N01B 1FV1A 5D6DA 3OWRA 2G5BB 3DROB 4X6EA 2B4CC 3D33A 3AUWB 4Q9RH 1I7RA 4V1DA 3SPJA 2FECL 2Y72A 3GMNA 1GC1C 3BQVA 4ZQKA 4N86A 5IW1B 2H3XC 4E5XB 2Y1AA 4HWZA 2NNRA 5K1VA 1XIWA 1LEKA 4DCQA 2ITDA 1BXVA 4JPKH 5D9SA 4I48A 1MFAH 2G5RA 1CFNB 1T4KB 1FF5A 5IJCC 1UWGL 4X6FB 4EUPH 2X4TB 3TA4D 2XACC 2B0SL 3CXFA 4LU5H 4M43H 2ZCKH 5D70L 3P3TA 3RVVC 4YHOL 4F3FB 4PBVC 3J27A 1HHHA 1KDIA 1DL7H 1P2CA 1U4FA 3CBRA 4HV8B 1OAYL 2EVGA 1BXXA 4FL4C 3T2NL 2I26N 3VXUE 2KBGA 3JQOB 5T1MB 3PS6A 3V4PL 5D7JD 3OXSB 1YQVH 5GRWA 4HD5A 5ABDE 2WK2A 3TH4T 1IT9L 1EFXA 1SF5A 2AEPL 3T4AC 3WHE0 3L1FA 1EJ8A 5KVDE 1BVZA 4RVBA 2WTPA 1TR7A 4WK4B 1L3NA 3SDXE 4ANXA 4NDMB 3W57A 4PRDB 4I77L 3WS6A 2PYED 2P8LB 2Q8BL 4JJHA 4GLRH 3QXDB 4FQHB 5TK4A 4WU7A 1IV8A 4WU5A 2OZ4L 4GRLD 4I0PD 2FAUA 1F58L 2LU3A 1AIFB 3FTGB 4HFWB 4P5TB 1M71A 4UM9D 1CD8A 1IFGA 2BP5M 2WANA 4XP4L 4LPUA 2WZPD 2ZWSA 4HW6A 1OTSD 3O3AA 2NRDA 4XOAA 3VMPA 1OAXL 3ULUD 3F7VA 1FVDB 1ET5A 3MV7D 2UVEA 1W72H 1A7RL 3JUYA 2HFEB 1KJMA 1NAML 3OF6A 3SKNA 4R8WL 5E08L 1IC4L 4HT1H 5CXPA 4FLSA 1XBRA 5TF1H 2XXCB 2AK1H 3K80A 2Y5TA 5DGRA 3QI9B 5BCAA 2VXQA 2CIKA 1U92B 3C09B 1BQ5A 2YEZB 1JYNA 4UU9A 3TA3D 3RIAF 1IEAB 2K6WA 1A7NL 3KXFB 1SXZA 4LPYA 1BBJB 4YFEA 1NCHA 4I5BB 2K4AA 1IC5H 1NWOA 4JHBA 4TS6A 3K5SA 3ZDZF 3SPVB 1BYNA 1IM3D 1ZE3C 4P2QD 5C0JB 1IMHC 4NKMA 1F0LA 3K72B 4IBZA 1PZSA 3DOSA 1P1VA 3NSCA 3SKJH 4QLWA 1SY6L 1P5UA 2JKTM 5B1CA 3B7YA 2DQ6A 2GJPA 3MHZA 3VWJA 3X12A 3N1FC 4OZGE 2L7QA 1BXAA 3NACH 2EYSA 3MRMA 2A77L 5KS9A 1V54B 2BW4A 3L1EA 2BS9A 1D5BB 3DOSB 5DD1H 4AENB 4XVTL 4IBVA 5C6PB 1T1WA 2DEXX 3L3OB 5I1EH 1H5BC 3CN0A 3MLWL 4MNGE 4A2EA 2YQ2A 1WBYA 3TN0B 4DGUA 1IM9A 5J5EA 2VR6A 4CVZA 5HYIA 4IU3B 3IPBA 4DK6A 3GDBA 1BSIA 2GTWB 1H3XA 4IU3A 3S3JA 3ARXA 3FCTB 1XF5B 1F42A 1Y0LA 2I07B 2IQAB 1G9ML 2UXGA 3V8CA 2GUYA 1WBYB 1AOZA 9PCYA 3C5XA 4FTVE 5CKGA 3CGTA 1C5DA 1ZVSA 1H0DB 1PFCA 1MFBL 1DQJA 4QHNB 3H55A 5H94A 5JO5A 1IFRA 1BREA 2X12A 4L2YA 2A9NH 3PPSA 5HI4D 2BSTB 2MOVA 3Q8CA 4FNTA 5HYSB 1JL8A 1XT5A 4ELMF 2AAAA 3QORC 5GZND 1QHQA 1NCJA 4PJXB 3QNXA 1BX2A 4K3GA 1AXIB 2YBRA 3KPNA 4KHTL 5CP3H 2VLRE 1X5ZA 4OM1L 3B37A 4TSAH 4ZUSA 5HVFB 2HRPH 5C09A 2D7MA 3DYPA 4F7CA 4IRZA 5FO7B 4E41D 4X7TA 1GJWA 5J11C 1FZMA 2VDOH 1I9JL 1D9KC 2A73A 3JXAA 3LKPA 4LKCB 2BHUA 4JPVL 2G60H 4P9HL 5ABZA 1PCSA 2TRYA 4PJAF 1NWPA 1FFPA 1L6XA 4AK1A 4M5YH 4GI9A 4MD0A 4JVPA 5C0CB 2E7LC 1EHNA 2P5EA 1WFUA 3FT3A 4QRQA 2WSKA 4PRID 1AHMA 3GEFA 2FGWH 2HT4C 1HINL 3IKCA 1CTOA 3BAKA 3Q6GH 5T3XE 1KJMB 2OR8A 1NCTA 5GJSL 3RUGF 4YDVA 4P2OB 1KLGB 2VDQH 2N7SA 3BDBA 2HKHL 3KJ4B 4GINA 1IGCH 3O11A 5K9OA 1RAMA 4GP5B 4ICWA 5FK9A 4QO1B 4JHUA 4BSWA 5SX4I 2UZIH 3HMXA 5EF3A 3EOBA 1CVSC 3EYQC 3ZTCC 4Y5VC 2V2TA 1A1MA 4ZMZA 1TENA 3U4KA 1ERNA 5DC4B 4B5ZA 1NIFA 3OVUB 4MAUH 4R9HA 4QXUL 3LQZB 5IQ9A 3ZTJG 4IBYA 3OR7A 4TQ8A 3OPUA 2NCMA 4FFWD 3ARDD 1UXSA 1RHHB 4NKMB 1DVFD 4AE0A 4ES8A 4MRBA 2QPDB 3UTSD 4HH9A 4NQEE 2X5PA 2VW7A 4PIRF 1TF4A 4FQIH 4KFMA 4PRPD 5AKRA 4G6MH 2GJZA 3WE6B 2K8QA 1XCWA 3FQUB 3NPSB 5BV7L 3PXJA 4HJUA 4H0IA 2JFCA 3IETB 2ZF9A 3LH8A 4RGOL 2ZX5A 5AVRB 3BE1H 3GSRA 3U36A 1A6ZB 2WZAA 2YO3A 4XNXL 5HJBA 4GI6A 2NUTA 4LCWA 4NDMA 4DO5A 4PLJD 5JOPE 4AMKL 3KPLA 5KVDL 3B7UX 1RUPL 1SOKA 2AJ3B 2GQHA 4BRVA 1WZKA 4RA3A 4PJ7E 3VVVA 3CDCA 4XGZB 1HOCB 2XWDA 3C6LD 3MYZA 4P0DA 5JHAA 3CN1A 3OMNB 3QEHB 4WWPA 1F18A 3T6ZA 2A9MH 1XGPA 4JMNA 3SE9H 1OCZB 2VDRB 2H45A 4LEXH 4M7LT 3BPLB 4KKRA 4BQ6A 5GS0L 2MQGA 4LASL 5AB0A 1JZ8A 1AD9B 3KBEA 3NK3A 1TU2B 4OR1A 1UURA 3LAFA 2QFPA 2G30A 4OCRH 3RWHB 3FUHA 1WCBB 4UTAA 4P5KA 3LV3B 1UOLA 5D5MA 2DMGA 1A7QH 1SBSH 1R5VB 1BG9A 3HUJE 3D87B 2DKSA 1IGYA 3HPJB 5LDSA 2CGYA 1KBGL 3T4AA 4GBXA 1RZGB 1QFWL 2Q8AL 4XN9A 2AQ2A 1SN5A 1KTJA 4QHMB 5D1XC 2XWZA 2J21A 3WNJA 5HHOB 4IM8A 4NKQB 2O5XH 4P2OC 3J7HA 4OD2B 3BVWA 1NUNB 2E7CA 2VLRA 3I74A 1ANUA 1EEZB 5EEVA 3BH4A 4D94A 2IMMA 4NZFA 1VF5C 3SGKC 3G6JE 4HKJA 5D4IA 2IDSA 1PG7X 4FQ1H 3QYCA 2XBDA 3AREA 3IFOB 1O9WA 1S9YA 1X5GA 2W0LA 3MJ6A 4JM4L 4Y5XB 5EFIB 5I73C 1RJZA 1UWXH 2PPEA 5CZXC 3KJ6L 1AGCB 1O75A 3F5WB 5ANME 2P5EE 2R0ZL 4QT5B 4I13B 1XF4B 4TNEA 1NL0H 4NHCH 4X42A 2Y4SA 2QQLH 4WO4C 1KIQA 3UBXB 1TJIL 2FX9H 1QRNA 4LL9A 5DJYB 2VXVH 3U2SB 3HAEG 3T3MB 3KVPA 4Z78B 5C2BL 4LKXA 4HPOL 4ZO9A 2Z65C 4KKCD 4ZTOL 2VMEA 2ENYA 4NLHA 4ZT1A 2B39A 4PB0L 3UG5A 4ZMQA 2GSMB 4IOFC 2F58L 3RVWC 3SGDH 3CN3A 4F2MA 5HGHB 4J3SA 3M1CA 1AGBA 2C34A 1UKTA 4Q6IB 3T0XA 4UOQA 3MRBA 5JOEA 3BFWA 4S2SA 3V5DB 1HHJB 1KN4L 5ISZA 2WBJD 2QVIA 3AZUA 1CU4H 4P3DB 4XN7A 3WY2A 4DKFH 5IROC 1E4KC 5E6SB 1FVEA 1TNNA 5CP7A 2BIPA 3H4FA 1IGJB 4LVEA 1GMIA 4JFTA 5IBLD 4Y8DC 1EFXB 4YLCA 3PHSA 3HZMA 1KZQA 2ADGA 5M7QA 3HLAA 4A2MA 4U6XB 2OMXA 1F97A 2BSCA 5FUZL 5JNYB 4YHYB 3U6XS 2LU5A 4W70A 3DVGB 2IH3B 1N59A 4JHZA 3FRPB 3M45A 4UMGA 5FDYA 2XYBA 1IC1A 4L8CA 3NT0A 3SGKA 3MGAA 3VXQA 4HXBL 1E8YA 2NNFA 3NIDB 5EU5B 3PHOA 1J0ZA 4XHQA 1N26A 1S9XB 5IFAH 4M6OL 3P02A 5IQMA 2XNAB 3RWDA 4DPCX 4HS8H 1JHLH 3AQDA 3FN0H 3MRQB 2NY2B 4QOKB 4DW2L 4FRWA 3QCTH 3RWDB 1KXTB 2GB2A 2PPDA 3US0A 2CDGA 3BKYH 1KELH 4WK0B 4JKNA 1FLRH 2IDUA 2YKLL 4B97A 2XTJD 2BHFA 1EMTH 1FNSL 2ZJSL 1ZDSA 3ZGIA 2BHYA 4JGJA 2QKIA 4PJFA 4TVUA 2MCAA 5IQLA 1X9QA 1KGUA 3FFCD 3HS0A 3MLUH 4FTVB 2IIJA 3OBAA 2WXLA 1YNTA 2WQSA 1PZDA 1I8IB 1NCBL 4Y2OB 1ZLSH 1DUZB 2Z8RA 2GKIA 1A7PH 4HUWA 1XB6A 5E6ZA 4GP8B 3MYJA 2XPGA 3QORB 3SY0A 4YLBA 4JM0A 1FG2A 1CYWA 2XG4B 1NCAH 1U8LA 4Q56A 4XP4H 3B9KC 3EJPA 4YHIB 3VWKA 1J0IA 1GGYA 1LVEA 4KJWD 4AVHA 3GLZA 3ROLB 1T0NA 1DVUA 2BXYA 3L3GA 1NCGA 1OGAA 5L8JB 3CFTA 3QS2A 1OAXH 4PJ5E 5J11B 2HJKB 2YPKB 4RWYH 2FL5A 2YMOA 4H20L 4ZPVA 2EQDA 2NY3B 2JQMA 1X4XA 5CBEA 1MAKA 4NENB 4FLQA 4R7DA 1PYWA 3D4GA 1E4XI 3QO1B 1CE6B 3IKKA 3AT9A 5JW3H 5CD3B 4E2OA 5DUPL 2ENQA 1HK6A 1P4IH 4MX7B 3VCLB 4BZ1L 1GSMA 3A24A 2K0RA 3IMVA 4PWFA 3KYKH 3S97C 3ES6B 2Y5QA 5FB8B 4M5ZL 4Y16B 3WFDH 2WLZA 4WLCA 4F1ZA 4PRHE 4QRTB 5IEKA 2XN9D 2E86A 5IMOB 4LAQL 1MHCA 2DLGA 2OK0H 3QEHA 1O5PA 1ZHKA 1ZAGA 5JPNA 1F4WL 1GSKA 5EU4A 5BV7H 4AUUA 5C07E 5HVWA 1DEDA 1NEPA 4OGYL 4NUGH 2OX5B 5CCGE 5H4ZA 1WZMA 3B9DA 1U8NA 3I3BA 2FJFB 4MVBD 1I75A 3W82A 3VFGL 4UT6A 5CBAA 2A4ZA 3UJJH 1BZDA 1MKFA 1WZAA 4LARL 1BLNA 2IDFA 4HKBB 1Q9WA 1BEYL 4PGEA 1V3LA 3WKNA 3CHPA 2XFXA 4NXKA 4XI5C 2GI7A 3CZEA 4NQEB 5A2KH 1YEGH 2AF2A 2OSYA 1UQSB 2IPTL 3HIZA 4OQTA 1IAII 2P7TA 4BGDA 3G04A 1D2PA 4IIZA 2KT6A 2J4WH 4EUPA 1U2YA 1X5LA 2B3IA 2JXMA 5BZWB 4KX9A 1AMYA 4A37A 2B5IB 3IF1B 5FDWB 1OO2A 3UYRH 3BPLC 5D6CB 4J3OG 5FYKE 4BRJA 2WYIA 3KWUA 2MNWA 4H13C 4U1HA 5IVXE 4KV5E 3NCMA 4CC4C 4R3SB 4OW6A 2XNAA 3ZYOA 4ZMVA 3RAJL 1DVZA 3IFLL 2V7HA 4OFQA 1J1XL 2WBJB 3MV7E 3VU2A 1UM5H 2CA3A 5F97E 1B9KA 2J1WA 3WNIA 3SB3A 2DQIL 3PAUA 4XNUL 1FNHA 1SHMA 2IH1B 2HN7A 5B1BB 1JZIA 1P7KB 3UABA 4Y1SA 3WS6C 1JVKA 1FC2D 2VMDA 3C8HA 4TUUA 5HHME 2VR8A 4QRQB 1U8MA 2OBGA 4ICXA 5D1QE 3W9EA 1SY6A 4DGIL 4AJVA 5JW5A 3LEVL 4P2CG 1RK1B 1FAIH 3GXTA 3NIGF 2FO8A 4FX5A 3DIFA 1GZQA 4J4PC 3WEXA 3QFDB 1AY1L 1P9MC 3PGCA 4HD9A 2GHWB 2WKGA 4OLZL 2R69L 5I73B 1LD9B 1K8IA 3CFCL 2C9QA 5AB1A 1CL7I 1SVZA 1LE9A 3AY4C 1OW0A 1RHHA 2VDKH 4IJ3B 4YHNA 3SIKA 1SEBB 2C1OA 4M6AA 4YBHA 4NQQA 3SO3C 3V5KA 1FBIH 1JUFB 1KJVA 3QR2A 4JPIA 5EIVA 1NFKA 2D03L 3TEZA 5BJTB 4KROB 5KANI 1P5VB 3HS8A 5GRUH 4PJIF 4ZXBA 5EO1B 1UEMA 3QT2A 1G7JA 4WJ5A 4HZAA 5I1JL 1IKFL 2UZIL 3K4DA 5BOZG 3WMQA 4WCYL 1Q94B 4DQOH 3THML 4F8LA 3IYLW 2WZPA 2ZUXA 3ETBJ 3TBSA 2JB6A 1S4IA 2FLRT 1GZHC 1IFHH 1S2EA 2FX8H 2IFGA 4NNPH 4R5TA 1EFQA 1E9OA 1CFVL 4NM8H 4TQIA 4UQBA 2OTPA 4W4NA 2XT1B 1TTUA 1RZ7L 3MV01 2CBQA 4LSTH 3N85H 2MKLC 3OKLB 4IBSA 4P2AA 5ITBH 3ISRA 4YH6A 2Z92B 1ID2A 2DIAA 3NTCL 3A67H 4UTCA 2IAMA 4W68A 4UOZA 2NY0B 1BWWA 3Q8EA 3C2SA 2P24B 3CC1A 4AI7A 3VJ6B 2B59B 5E8NA 1M1SA 3O0RH 4NFBA 3VTTA 3ECVA 4EXPX 4N2GA 1FIGH 4EZLA 1R33A 4P46D 1UOKA 3MRKA 5A2LH 2ZUQB 4Y4FC 1OM3L 4NQCB 4L1TA 2NUPB 1NCNA 1VGEL 4GBXB 5F1KC 3GZQA 4FTVA 2CO1A 3IJ8A 5DZJA 1DLHA 1C1EH 2VN6A 4YX2H 2A0LD 4BEIA 4WNQA 3BH9B 1Z9PA 1MEXL 2CKBB 4HBCH 2F61A 5L7XL 2AVFA 1YG9A 1TZGL 2ZKYA 4LLUA 1SJEA 3EYVB 2NDFA 1H9VA 5GSRB 3MLRL 4JE0A 1CFSA 5J3HC 2A9AA 2XI9A 4RMSA 3VSVA 2Y7MA 3MCG1 3HE7B 1IAIL 5GPRA 2BW5A 1NDGB 4Q7DA 4EN2A 3QUML 3H9SE 4JRYE 4N0FA 5A43C 2EXSA 4QYOA 1OCWH 4UT9H 4APXB 1A5FL 1NCUA 4PB9L 3K2IA 5BS0D 2Y1ZA 3MJ7B 5C0ND 3TVMB 4FHJA 5DUBA 3CX2A 1O6SA 3HVNA 1THCA 1MCFA 3S96B 3TEYA 3N3EA 1A1OA 1ZRUA 3FBQA 3H3BC 1H6TA 4JG1L 1SLVA 3FT2A 3LZRA 3WKML 4OFPA 2QKIC 1MI5B 3E80A 4RAVB 3RWCB 3GMNB 5EZOL 3UTTE 1D9KA 5F7DB 3SE3C 4BE6A 5DJDB 2GK0A 1X5HA 3V10A 3D5OF 3HZKA 3DTXA 4Y1TA 5ESQB 4EI5D 2D0HA 1L7TH 4A1RA 1P1ZB 2APWA 2VSDA 3RWFA 4M62L 2BH0A 1L9SA 3IPFA 4ODTL 4XC1H 3GEWB 1QNIA 5AVQB 4R90L 3R8QA 3UTSE 3S8WA 1M4KA 4GAJH 1S7TB 4MXWL 2I9LB 3H9HB 1KC5H 1LDSA 1HDMA 2HFFB 1D5MA 5DK2A 3WEMA 4BFKA 5T33H 4G7VH 3FCTA 1UB6B 2PCFA 4PV9B 4AXWA 4FN0A 2O61B 1IE4A 4PBXA 4GNKB 4HF5H 4AL8C 2Y23A 3D18B 2C4FU 5E8EB 1UUNA 2P1YA 4PJ5B 3RWJB 5E08H 3SSGA 2VW6A 4KK5C 4P48A 3QR0A 2K1MA 3HW7A 3BZFB 1DJWA 3KPPB 5F6HJ 3WJLC 4ZG1A 5LN4A 3PU7A 2OMTB 3AB0B 1FH5L 3JVFC 3MRDA 3IBEA 5DD6A 1JOIA 3BISA 4GQ9H 1FE8L 4JVWA 4LE8A 4ABVA 3S8FB 4OZIE 1MUJA 3GTVA 2ZSVB 3DX8B 3BC9A 4L3ED 4XNYH 3RDTA 1F56A 1WBZB 3X1GA 4GFXA 4LARH 4QTHB 4ZUUB 4J23A 1YY9D 4IRJA 5IWLA 1VCBC 1CD9B 3O6MH 1KTCA 4GKSA 1K2DA 4JW3A 3RGVB 5I18H 3HG2A 5BUGA 3FQNA 2JTDA 5F9WB 2V37A 3MUHL 3RRQA 5EORH 3ABZA 3MVSA 1YDPB 3DECA 5ERWA 5F3HA 3WHXA 1DJSA 1TTAA 2WNXA 4I77H 4KK9D 1N2RA 2YD6A 1J86A 5CCKH 2Z31B 4S1QH 3MNMA 1RMFH 3EUDA 3QI9A 4KNSA 3IDIB 4LLQB 3W9EB 1MWAL 3MC0A 5AVSB 3LKOA 1MHEA 4PS3A 2WVVB 5ETUB 2QSCH 2NY7L 4KROD 1ZHNA 5L9DH 3AWFA 1YMHB 4DN3L 1OT2A 3A23A 4NI6A 3WS3B 4LEXL 4PJDE 1M2VA 4PJDA 1FCGA 2A6IB 3IM1A 4YHMH 4YIQB 5F9DC 4AK2A 4WEMB 1G9MC 1HKLL 4HV8A 4ERSL 4OVVA 3BFQG 3LS5H 4N1CA 35C8L 1EVUA 2ZOKB 1PQZA 3P0VH 3FOMA 3FHEA 4NO2B 1RFDH 4JCWA 1MFBH 4PR5A 1IIKA 4A68A 3VCLA 3MLSH 3CCHA 3P0YH 1A3LH 4PJIA 1LWJA 3BEWA 5F70A 4IMLA 1KLFB 2Z7ZA 3L1GA 3Q9QA 1F6AA 3VFSB 2V9RA 1WAAE 4OJFL 4KUZH 2R7EA 4GG6E 4HLEA 1CD1A 4Y5YC 4PW3A 2IG2H 5D93C 5AKTA 4ZDHA 3QXDA 1OOWA 4FC3E 4FQLH 2XV6B 3RY6A 5C6TH 1QQDA 2AXFB 3M17B 5HHMB 1JVLA 1EZVX 3HBQA 3ZHNA 2XPZA 4DH2A 1SM3H 5LBGA 4BKTC 1M7XA 4NQUA 2DJ4A 1FO0B 2NQCA 3LDBB 2CSPA 3JV4A 4Z8FL 4KQ0A 1RLBA 3JT0A 5I16A 5CLWA 1HVXA 2IADB 3PWPB 1BIHA 4YSQA 3CFMA 2R8SL 1JG9A 1LQBC 5F0PB 5LGJB 1IARB 4JZJC 1AKJB 1AFVH 2PF6A 4Y2DA 4KI5D 3ULVC 2ZXCA 4HKZA 3QJHB 4YDIH 2EYTA 4A7GF 3WDJA 4AW4A 3BD4A 4FMKA 4FOMA 4XXCC 3GLAA 3VA2C 5EEXA 2DQJH 4D0DB 5LJYH 1AGEB 1I3RB 1RCYA 5I8KH 4YN3A 2O4EA 3M8OH 1XL6A 3KCPB 3QDHA 3QAQA 4MMXA 2AXGB 3WJJC 1IGFH 1T20B 3E1F1 3F6LA 4H8WH 3PJSA 3WIHL 5ACZB 4FADA 2AXGA 3GSOA 3TF4A 2X2YA 3D3VB 4IKNA 5IVXA 2G9KA 1I3RA 3B8YA 4M00A 1A4BA 1GY1A 1TLKA 4JFYA 1CIDA 4KVCH 4PCTA 3CPUA 2W91A 2XZCL 3U0PA 3F04A 5F7LB 2PP7A 2XKNA 3PABB 3VFWB 1HYSC 3ZE1E 1JF1A 2X6AA 1NIEA 2ZYSA 4UDUB 4JQIL 4PRHB 3NIFB 5C0CD 5D7EA 1ZOXA 3KDMA 1FCCA 1ZHLB 3SDCD 1MLCA 3IVKB 3FQXB 1KFAH 2PYEB 1AIZA 3MRCA 2YRPA 1F11A 3ABGA 3UBFA 4U3SA 1IQDB 2Y2WA 5EZIL 1MF2L 2ESVD 4IS6B 4K94L 1HAUA 5D7IA 2WLHA 4LLVB 1WPCA 3E9UA 1UWYA 4AV5A 2PYEA 5GRVK 1MQKL 4HUUA 5ICZA 3N1QC 1KGYE 3F7LA 1LO2H 2J12B 2Q3AA 1SVBA 3VI4A 4PVBA 3NJLA 4ZX5A 4POZD 2EEAA 2GUOB 4LO9A 3CG8A 3QQ9D 3U9UA 1X5XA 2GK2A 4FXKC 4QHLA 1QHPA 1QVOA 1A9BB 2FECI 4NJ9H 4PCSA 4PJ5D 4C4KO 5KTEL 3IPEA 4FKKA 2I07A 1UWFA 4M5YL 2KKQA 4LDEB 5EO9B 2MCG1 1UTDA 3VH8B 3KJ6H 4P2OD 4XRCA 5IVOA 2XZQL 2J1ZA 1G6RH 1FN4A 2D7NA 1PTZA 4HMEA 1QACA 3RL2A 1N7ML 2EICA 4RNRA 2HFFA 1NPUA 5DK2B 1QABA 3ZGHA 3IJEB 1H8NA 1KNOA 2BNRD 4AEIH 1ZE3H 2ORBH 3NCBB 1AC0A 2E9JA 1COBA 4QKTA 3EGSA 3BP4B 3D39D 1MCCA 1V7ML 1WIPA 4KTDL 1GC1L 3WDHA 2N56A 3RUGA 4GQRA 5ID0B 3VG9B 2P42B 3QUXA 2DYRB 5EH1A 1CC3A 3WAJA 4LSRL 4JZNB 1ORSB 4WO4D 1IC5L 5FA4B 4P4KA 1KJ3H 2F53D 4UF7C 2C3VA 3MV8E 3PWVB 4C83B 5L4FA 3K2UH 4OFYD 1G5AA 2ZCLH 1FBIL 3DJ9A 4EAEA 4MLIA 3QH3A 3QEGH 3GWJA 4E9RA 1KGCE 1FI8C 1OZUA 1X7TA 4B95C 1B90A 1OTTC 5LAXA 4NCC2 5HBBA 2F68X 4S1DD 5C9KA 4U1KB 1Y18A 4NUMA 1IBFA 5ISZD 1PW3A 4Z7UB 4AQ8A 2BINA 5B1JA 4YDKH 1A7OH 5BUAA 3IDJA 2VSKB 4Q4EA 4M4RA 4BFIB 2ZWNA 1FC1A 5AVVB 3FMGH 2QV2A 5EPMB 4MS6A 2CIKB 3DETD 5A40E 2YPVL 3IU3B 4N0UB 5HGDB 1T2XA 2FUTA 2QPUA 4N9GA 5PAZA 5LBSH 3BFOA 2QPFA 3PJSB 3VRJA 5ACZA 2B1HH 3LPWA 3CZSA 3O3EB 1BVLA 1HEZB 3O6LH 4FXKA 4H26B 3B5HA 4MXQC 3G5VB 4QAWA 4X9FA 2SEBA 3GI9H 4ZOBA 4ZPVB 1YECL 3HZVB 4KI5F 4BK5A 2QQKL 4MB4A 4HYTB 4BJLA 3VGAB 3UAFA 5IW6B 1FRGL 1S9YB 3FO9B 5CUSH 4KTEL 3P4NB 4XP1H 3ARFD 1A6AB 1H6UA 4TSCL 5J6HA 2FX7L 3D9AH 1BPLB 4TSBL 5ESVB 1S7VA 4OCNC 1BQRA 5LVEA 1UXWA 4LCWB 1ETZA 3X12B 4FNLH 4R0LB 3RHWK 2YGVA 4LDOB 4F7EA 4IS6A 3CDFA 1HL4A 2J4WL 1KCRH 5J1SC 1X44A 5EN2A 4OCYL 1WICA 4G83A 3TEUA 2FB4L 2DWEA 3S48A 4G8AC 3D3VD 1J5IA 1JRHL 2DRUA 1SN0A 5EU6A 1IC7H 1NCOA 1XEDA 5FUOH 1JZ6A 5IHZB 4L9LB 1G4RA 3DK2A 3LXCA 3PGFL 3OAZH 3UDWC 3MZGB 1YEJL 3BVXA 3V7AE 2O6FA 5TJWK 2H32H 5AVUB 2GJ6D 3F64A 1TOXA 5I71C 5HDBF 4XRCB 5F2FA 4KRPB 5HJ3B 4DPBX 2ZPKL 1F4XH 3VG0L 3C8KB 3BGMA 5IGXH 1ZHBA 5ESAA 3JV0A 3VD7A 3AT0A 4FQCL 5DZ9A 4KJWC 4ZZFA 4P99A 2F1EA 3A21A 3EHBB 5BZWA 1XXFC 3CMGA 12E8H 3H9SB 4F7KA 1MW0A 1R5WB 3R7QA 1F4YH 2P7TB 5DRZB 5KJ4A 3QJFA 1WIUA 1N8ZA 2UZXB 3ZTJH 2ENJA 3WSQL 5HGBA 4Y4KD 1OV8A 2Z1PA 5ILTH 1J48A 2WKOF 4PGBB 3QNYA 2YZ8A 3JWDH 1UCBH 4OGYH 2OJEB 4OLXH 1S8DB 1ZVHA 3M7FB 3OLEA 4HC1A 1ZMYA 3U6RA 4PRHA 3FB6A 1LLAA 4PVMA 3UCQA 4MCNA 3BSHA 5DO2D 3KYNA 4RWYL 3F00A 3UC0L 2PPAA 3LXBA 5MP6L 2XKNB 2DQTL 1B9ZA 3DVIA 1H3PL 4NAJA 5I1LB 4Z3IA 1KXTA 3W3BA 3KGSA 2K6ZA 2CM5A 1TDQA 3LN4A 4X8XA 1IKFH 3LPOA 4FQQB 1K85A 3D1MC 4H25B 1PAZA 2WNWA 4WK2B 4O58L 3SBPA 1RUKL 1ORQA 2YSTA 3L3HA 3O11B 4YIQA 5HGAB 1K8DB 5JIIA 5CHNB 4XNYL 5ICZB 2NQDA 2J8UE 4TLTA 3HRZB 5CSGA 2BERA 4O2EA 4K8RL 4DP1X 3VRIB 1KUMA 1I1RA 2C9AA 4OSUL 4MJIB 4OD3H 5GHWL 1SEBA 4ZS7L 3FUFA 1DEEA 2GIMA 3B2PA 4HQQH 4EZKA 3O0RL 3OMZA 5ISZB 4PRIA 4PJIE 5IMMB 4IJTA 4GRWF 5AB2A 4RQQA 3BWAB 3RTLA 3SY6A 2B16A 1J5HA 4TUOA 4O00A 1OSEA 2ZTBA 4JRLA 3AXIA 4ZTPH 4ZW7A 1J1PL 2B1OA 4U1GB 4XPBH 5CCKL 3TV8A 1OE1A 1SMOA 5SWZD 5C97A 4WWKC 2BNQE 4I1NB 5DI8A 5EB9A 3V0GA 1QBBA 3UZQA 2KYIA 3QZBA 4GQZA 3FOLA 2BP0B 5INDA 3FO0H 3O45B 3Q2WA 4S0TD 3AVEA 3OAUH 1KPUA 3EBHA 4XC1L 1M3JA 4TL4A 3R1GH 3TWCL 3ISWA 4LOEA 3ELQA 4V2CB 1NICA 4WDIB 1CPUA 5CLZA 1HXMA 5MEND 1T80A 2KZWA 1PX8A 5E51A 4Q14A 1WP6A 4OLVH 3LY6A 3U83A 4QOKA 3MJ8A 4Y2DD 4G8IA 3S5LG 4WGWB 4OF8A 1IZKA 1GHFH 3BZDA 4X6CB 3S36L 4D0DA 4OZGF 5C0GA 1LEIB 1TO4A 4HIQA 5CO1A 4L1LA 5D7KE 1Q8MA 4GB9A 1CZ8H 5CEZD 5HVHC 3RNQA 5FYKH 1AGFA 5D2LB 1GXEA 3FTWA 2XN1A 2V2WB 4AJ0A 3WMSA 4YHKH 1W8NA 1AACA 4JRXD 4EF3A 4LF3A 5SX5H 5DK0A 3VSQA 1NAKH 3AAZA 2JXMB 4LSRH 4CUCA 4NCDA 5C3TA 2I5YH 3N44F 3H3KA 4G5AA 4GRLA 4K7FA 3TIDA 4HJSA 4BWTA 4F24A 1KXVA 1PKQE 1DBKH 5I6NA 2ZOUA 4Y2NA 4IKLA 3DX9B 3MRHB 3BDXA 5FO7A 4YZWA 2E7DA 3OJDB 3HG4A 5HDOA 5E99L 2OTWA 5INCB 1FL5B 4D7BA 5F7FA 3CFCH 2MPAL 3KDMB 1XF3B 3WFZA 2NY6D 4GSUA 2BMKA 3HR6A 3FCUB 2DM2A 4K7FB 3BT0A 2E7LA 3G6AA 4KITB 1A21A 4JREC 1NLBL 3QHTC 3PPEA 4PG2C 2WM0A 3G5ZB 4JKPH 4LVOC 5D7JA 2NW3A 2OJZL 3OD3A 1DQDH 4D2NA 5HDQH 2JMRA 1T2QH 1EA9C 3S96A 2I7OA 5HI5D 4YHOH 3H9YA 4KO9A 4OFIA 4FQXA 5JW5B 4YDJA 3WFBL 5DLMH 5TDPA 1TQSA 1IM3A 1MI5A 2DQHH 1ZCRA 3CLWA 1UZGA 2IPUG 5D93B 1MH5B 4A7TA 4I9WE 3DRQA 4Y5VA 3D52A 3VFMB 4JG5A 4JY6B 4MWFA 5KTEH 1ILSA 3BRDA 3EGDA 2XWRA 3L95A 4PRNB 3CDZA 4G11A 4XMZA 2DYPD 4QT5A 5IP4A 3VYOA 1TETH 4KKNA 3EGDB 1DLFL 4GBXC 5EC2B 3S6CA 1MCOH 5E00B 4N0CC 2L4OA 4LHJB 1HE8A 1OCWL 1O5DT 4BQCA 1OIOA 5EU6D 5AVZB 2AQ1A 1INQA 5AD0A 4JFUA 2H8PB 4PRAB 5J9PB 1MZZA 1RZIA 4FYTA 1KMGA 5GIRA 4TNWF 4TUKL 1CT8B 5AEAA 1DP0A 2VR9A 5DMYA 3A6BH 4HZLA 2J55A 2QQNL 4HAFA 4LLMB 1CFTB 1YPZB 4NP4L 3CH8A 1MRFL 1PKQA 1SJVA 1WJ3A 4FE9A 2EO7A 3CVHB 4NZRL 2VR3A 4I85A 4NWUL 2EDYA 2DDQL 5DS8B 3GDCA 3NJNA 1ONQB 2RBLA 2P44B 3FB8B 4LHUD 5TDOA 1WUNT 3EO9H 4QAMB 2J7LA 4W9GC 4QNPE 2QDWA 4KJPD 4L1HA 1M42A 3NEXA 2ZE0A 4XBGB 4R7NA 3UC2A 2HP4A 2YUWA 3WBDA 3K6SB 3GXMA 3LJ3A 5AZUA 4A38A 1J18A 3BKCL 3C8DA 4MXWH 4KRPC 5IBTL 4N4YB 3KVDD 2FT6A 4K71C 4YDIL 1TU2A 2IQ9L 2ZCHH 2RIKA 4DP9X 1LEIA 3HJEA 1AH1A 3OR6B 5EEYA 4BZ2L 4R4NC 4EI5C 1J5OH 2F7RA 1MZYA 2MH4A 3K74B 3Q6FA 1BQSA 4KDTC 3VI4E 3OMAB 4PJXF 4F9PC 2EDHA 2YR3A 2XWCA 3DI2B 3LN4B 3HZYB 3EFDH 3O6LL 1E9QA 3L3HB 1FQ9C 1DR9A 2CXGA 1KGJA 1V7NH 1M2OA 5TE4H 2N1KA 5E2TL 5FW6A 2QGBA 2DQMA 1DSYA 5HYEA 4B7IA 2F7IA 4KNTA 4KK5D 4XPHL 5I1GH 1N5YH 2WTRB 5C1MB 5KEZA 3QE5A 2AJYL 2X09A 3BPCB 3EJYD 4BM7A 4YHIA 2X4RA 4A2HA 1YJDC 3BSZA 2D31A 5LGKA 8CGTA 1O6SB 4MQ7B 4G5ZL 3DTDA 1AMXA 2WXPA 1L0XA 5B39B 4KZ0A 4PLKD 4F7PB 2GSIB 2YAMA 2G3MA 4PJ6A 1SEQL 1MCWW 4S1RH 2O72A 2PO6C 3MRFB 4FXGA 3SZKC 5IESH 3AG4B 1M6UA 1YJDH 4RGNE 2WLNA 4MCZB 1A47A 2CA4A 2Z7WA 2VQUA 3MKKA 4LCWD 4YO0B 3U2SA 4HU8A 3ARBB 5IOKA 4YC2B 3WIIL 1EANA 4Z7UE 1X5YA 4F7PA 2V8MA 4F8NA 5D2NC 2EC9U 4YGVB 3O2WL 4QCIB 2JK5A 2VXUH 3NCJL 4BUQA 3VB8A 5MERA 3S9DB 3CIQA 3CZJA 2UYLB 3C2AH 3QWOA 3L4XA 1QAWA 3OKDB 1E3XA 5HHNA 4F57L 2BY3A 4OBRA 2GSGA 1XCTA 5D5ME 4LPCA 2HLFC 3ZBMA 5IT2H 3IDYC 4KY2A 1DZ0A 4NO5A 3ZKMC 2ZZUT 1BZ7A 1XVSA 4YGAB 3RJQB 2BRRL 2XZAH 2B59A 3WENA 1CXEA 1H15B 4EMZA 2F54A 1CFTA 4ZAKA 1J0YA 2J88H 4L37B 5I0ZA 3G04B 1MFMA 3O3DB 2VLME 4CKQA 5EBMA 1A3RH 3U4EB 4R84A 4HOXA 1T1YA 3D69A 3UO1H 2OL3A 4UYQA 4D9RE 4ETQA 2V5RA 4MSWB 2FR4B 2KERA 5HYSA 4G7YH 2O5ZH 4JKKA 3L9YA 5F44A 1R5WA 4NQSA 3KD4A 4LCWE 1CGSL 2A9CA 3HPLA 1GOGA 3KWWA 3BAIA 5CILH 5EWIL 1NAMH 4UAHA 3FQTA 1N9PA 4NGHL 2EINB 4ZXBD 3RIKA 5CD5D 1T22A 1CXIA 5EOCJ 1NIBA 3L3IA 3VXMD 1Q0XL 1X3DA 4G59C 5D1ZI 4EDXA 3FTXA 3FZUC 4G9DA 5D1QC 4QHUA 1VEPA 1MIML 2WP3T 3LH9A 2DTMH 4EI6A 3LRGA 4K9JA 5K9KA 3ARYA 3I75A 4E41A 3TT1H 2R9HD 3IDXL 3MAWA 4FQXB 1NKGA 1XGTA 4KH9A 1CDYA 1NFIA 1D3CA 4APQA 4E5XG 5EDSA 2FWSA 3G5YA 4S0HA 4FTDA 1PU0A 3KH4A 3MA7A 5GS1C 5ILTL 1JWUB 2X1QA 3ATEA 4DF9A 1K8IB 1TTFA 1YAIA 1SN2A 4LSUL 5EC1A 3ULVD 2XX0A 4EOWL 3JWDL 3S3CB 4RISH 1SY6H 1DVYA 1MG2C 2VLMD 1JV5B 1QUNA 6CGTA 2FYYB 4NNXB 3EDDA 2CU9A 3EYUL 3RX9A 4AY0A 2YXWA 2KUTA 3P2TA 3P73B 4X9YA 1PMYA 4AM0A 4FZ8L 2A2QT 5JW4R 3LN5A 2A99A 4HHGA 3D6GA 5EF2A 3T9WA 2JKNA 2C4FT 4HJIA 5IR1B 2JQZA 1AP2A 1YNKH 3GI8H 3R4RA 3ZZQA 4AQ8C 4HH9B 3SE8H 3RPIA 1BVKA 3GRWL 1MRCH 4XP5H 2FHFA 4UTBH 3VDAA 5DRXA 4GJTB 2CUHA 3N2JA 2Z6FA 6PAZA 4TKWA 4YDKL 5D7JC 3WIFA 5FM5M 2NTSP 1JZ4A 1FNGB 5DRNA 1U8PA 2PTVA 3V6ZB 3GMQB 3QIBC 1CK0H 3QUXB 4HHAA 5KBPA 1RK0B 4J28A 4ELME 3P3YA 4ODXB 2F19L 3BKMH 4JDEB 4IDLA 4XMLL 4JZOA 1KLFA 5IB3B 3PGFH 1I3GH 3ZYIA 5BO0D 2CE6A 5DDHA 2CDEA 4LZKA 4KPHH 1NC4B 1RSYA 5D7LA 4CA4A 4ZMXA 1F5WA 3EOTH 4L1DA 3ERXA 4I0PC 1NC4A 4L8CB 2R2EB 4PGDA 3DV6A 2ZP9A 4KFZC 3RIFF 1I4FB 3U46A 1HKLH 1JNHA 5L4IA 2MCMA 1SNRA 1XF2B 2GEQA 2EEBA 2AEQL 3COOA 5D7SL 2X42A 1E5UI 2XZQH 3Q48A 3P11L 2BFVH 3S2CA 3IDJB 3ZQXA 3RKDD 1HE7A 4GSDH 4Z7OB 1G7HB 4POZC 4Y2DB 2NTFA 3OHXA 3QQ9C 3DX0A 4MQXD 5CLTA 4OI7A 1JNNL 1PF3A 3AU0A 2ZOLA 4N26A 3FK3A 4XMKL 4AZ8B 4JFVA 1WUZA 1D6EA 2NR6D 1G7MB 3KLQA 4BH7B 4NM4H 3ARSA 3N43B 4I5BA 4XWGH 4MSWA 2DBLH 4JE4B 1I8IA 2JKLA 3OHXB 3QEUA 1N19A 3TA3C 1RJYB 2NX5D 4Z9KB 1VADB 4Q74A 2EO9A 2JJSA 3KS0H 1NA8A 4MJJA