2IDSA

Structure of m98a mutant of amicyanin, cu(i)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idsA00
1L9QA 5LDUA 3N55A 4NB7A 4G7QB 1ZIAA 2E86A 3DTUB 2YAPA 3N2JA 4M3HA 2FNWA 1TKWA 2P80A 3UGEA 3FSVA 5B7FA 4DP9X 1XB6A 1PZAA 2UX7A 2AFNA 1OOWA 5B1BB 1E5ZA 4BWUA 1JZFA 1BYOA 2BZ7A 3FT0A 2HXAA 1SJMA 4GP4B 3ABLB 2XXFA 1XMEB 4DP1X 4CSZA 2IH9A 2QT6A 3OMIB 4CSPA 7PCYA 1PLBA 2DWTA 1EZLA 2DWSA 4Q89A 3QJSB 4FAAB 3EH3B 1W6WA 5AKRA 1MZYA 1SFDA 4Q8BA 4FA7B 1AS8A 2IDQA 1WA1X 2IWKA 3T6VA 5I6MA 2OCCB 2N0MA 4HIPA 1RZQA 3FPYA 4P5RA 2FQFA 2VM4A 1MG3C 2IDSA 2MTAA 4W1TA 5TK2A 1JZGA 4PAZA 3AG2B 1GW0A 3OMNB 3FYIB 5I26A 1FA4A 1A65A 1E5YA 1AANA 4AZUA 1BXAA 2PLTA 2W8CA 2FT6A 4ZK8A 4DPAX 1RZPA 2YARA 1TU2A 1PY0A 2UXTA 2EIJB 3NJHA 2UXVA 1L9RA 2DYSB 1ZDQA 1MZZA 1JXFA 2XWZA 3FSWA 1F56A 4G72B 1CYWA 1PLAA 3FPXA 5B1JC 4HCFA 4YSEA 2YXVA 3TA4D 2H5UA 2X88A 1BEXA 1V54B 4DPCX 4E9QA 2GHZA 2XX1A 3X1BA 4BXSV 4E9YA 1JERA 4MFHA 2B08A 2BP8B 3AG3B 2PPAA 3PAUA 5ANHA 2ZXWB 2J57A 1L9PA 3WKQA 4YSCA 1SHWA 2I7SA 3ZDWA 4KO6A 1J9TA 5B3SB 3MBWB 1AS7A 1PAZA 1ASPA 2VMJA 5D4IA 4GYBA 3PPSA 5F7AA 3ERXA 2DY2A 2CALA 1J9RA 1KGYE 2OJ1A 4L0PB 1X9UA 3NJKA 4TXVB 3UADA 3S3CB 2PPDA 1B3IA 1HAWA 1GS8A 2VW4A 3CVCA 3NSCA 1AZUA 1ET7A 1IUZA 3S8FB 2VSMB 5F7BA 2IH8A 1SHXA 3BQVA 2Y69B 4JHUA 1N70A 5B1KA 2JXMA 1GSKA 1JZEA 2CAKA 3SBQA 2EILB 1NIDA 2XX0A 5B7EA 3HB3B 1A3ZA 1A4BA 4AKPA 3TBBA 4QKTA 1OF0A 2XLLA 4HAKA 1L9SA 1GY2A 3EH5B 3FS9A 2IWEA 2JKWA 4A67A 3QJQB 5I6OA 4DP4X 1WS7A 1RKRA 3IN0A 4JHVA 1QHQA 3TASA 2GIMA 1KCBA 5D4HA 1AZRA 2BP0A 4YSPA 1KCWA 3FQ2A 2GI0A 7PAZA 4KNTA 1NWPA 1SF3A 2HX7A 3CDZB 3T9WA 3OD3A 1BAWA 2HX9A 2XV0A 5B1AB 4A2HA 2QDWA 5I6NA 9PCYA 3OMAB 5I5JA 2LLNA 2PP7A 2Q5BA 2YAHA 3ZIYA 5IY5B 4KOBA 2IAAC 3NJJA 1E67A 2J5WA 2XU9A 3D12B 2GC4C 3X1FA 4HZ1A 2FWLB 1PMYA 1NIBA 4E9RA 2P80D 2VW7A 4DP7X 2FT7A 3SQRA 3PXLA 3ABKB 5TK4A 1A8ZA 1AZCA 3FSZA 3DKHA 4F2EA 1TEGA 2ZWNA 3NJNA 4HCIA 3NYKA 4X4KA 4DPBX 3TBCA 2VSKB 1NIAA 4KOCA 5PAZA 1TEFA 3KW7A 3C75A 1L9OA 1QLEB 2CJ3A 2BWDA 4AI7A 4YSSA 1MDAA 3ABMB 2XVBA 4DP2X 4YSQA 1JZJA 1M9WA 2IDFA 1RCYA 3EHBB 2TSAA 4E9TA 2HX8A 3QJRB 3TU6A 1AZNA 3CVBA 1AACA 4N4YB 2EIKB 4KNUA 2FQEA 5EHFA 1KBWA 3T6XA 1ADWA 4QLWA 3CG8A 2WO2B 2X87A 3H4FA 4F2FA 4YSAA 4BK5C 1ASOA 1HFUA 2ZONA 1JVLA 2PP9A 2CCWA 2TSBA 2FJSA 2DV6A 1UATA 3GYRA 4M4RB 3DIVA 1VLXA 1JZIA 2QDVA 4A66A 3QPKA 1J5DA 3T71A 2XUWA 1JXDA 4KO7A 1HAUA 1KDJA 3AZUA 3SBRA 1BQ5A 2DYRB 2IDTA 1WS8A 3OQRA 3PAVA 3T6ZA 4HALA 1X9RA 2EIMB 1OCRB 2XYBA 3QJVB 1L9TA 1R1CA 3NJLA 2BP8A 3NSFA 1NWOA 3WKPA 3NP3A 2B3IA 2HRHA 2QPEB 3FYEB 2UXGA 1T5KA 1GY1A 3UAAA 2YAMA 1EHKB 1FWXA 4DP8X 5I6PA 3WNIA 1AIZA 2JFCA 2PPEA 3IBOA 2HLEB 4YL4A 2UXFA 2XV2A 2AVFA 4GP5B 4KO5A 1A4CA 4KO9A 5AFAA 2FTAA 1PNDA 4DP5X 2J56A 1ASQA 2HZHA 2BHFA 3PLYA 3L45A 4G70B 3X1GA 4YSOA 2GBAA 1AS6A 1SDDB 1V55B 4BWTA 1OCCB 2PPFA 3PAZA 1SDDA 1M56B 1BQRA 4WTQA 2FQGA 3OM3B 4YVUA 4A2FA 4KNSA 4WKXA 1SNRA 1W8EA 1MG2C 1NICA 1XB8A 2BO0A 1ILSA 1NPJA 2AANA 3FQ1A 1PLCA 5E9NA 6PAZA 2I85A 1J9SA 1KBVA 4ENZA 5B1JA 3UABA 3MX0B 3BVDB 1KYAA 1DYZA 1ET5A 3NSDA 4A2GA 1CYXA 2VW6A 2VN3A 3NSYA 4K9JA 3CDZA 3AY2A 4AKOA 4P5SA 5I28A 1AZBA 1OE1A 2H47C 1GS6X 3G5WA 1NIEA 2W88A 3V9EA 1NIFA 1ZV2A 2PPCA 1ZIBA 1WAEA 8PAZA 1WA2X 3AG1B 2YAOA 5PCYA 2NRDA 2PCYA 3AG4B 4HCGA 2GB2A 4HHGA 1QNIA 1A4AA 1BYPA 2YXWA 5B7MA 2IWFA 1URIA 4YSTA 1NZRA 2XV3A 3JTBA 3NJMA 4GXFA 4UANA 1SF5A 1KDIA 3FU7B 1NDTA 1NTDA 4W9ZA 5A7EA 1PCSA 2BW4A 3QJUB 1XB3A 4GY4A 3HEIB 3FU7A 3QQXA 2BZCA 5D4JA 4BDVB 4NAJA 1WA0X 1OV8A 5FC9A 3H4HA 2R7EB 1W6LA 5I5IA 1OCOB 4A2DA 4BDVA 3FQYA 1AOZA 2MRYA 3FU9A 2R7EA 1IKOP 3NJGA 4RH4A 3T6WA 3UAEA 3QJTB 1BXUA 1DZ0A 2AZUA 3GDCA 3S3BB 1SFHA 3NT0A 2UX6A 5I6KA 1CURA 3KW8A 3WG7B 3WI9A 1OE3A 1ETJA 3SBPA 2EINB 3ZBMA 4HHWA 3EF4A 3WNJA 1JXGA 4AKQA 4YSRA 4PCYA 2RACA 1CC3A 1OE2A 5I6LA 3ASOB 4G7SB 3NJIA 2YAFA 4NERA 4UAHA 4YSUA 2ZOOA 2I7OA 1AR1B 1AG6A 2GSMB 3H56A 2YAQA 3CVDA 1AAJA 4UF7C 1PF3A 2CBPA 1JVOA 4GP8B 2AZAA 1NPNA 4A2EA 1PNCA 3IN2A 1GR7A 1ET8A 1M57B 1IBZA 3GXUB 4JKNA 2YQBA 4BWWA 3WIAA 2YAEA 3NP4A 3JT2A 3AW5A 3IEAA 2QPDB 4YSDA 3NJFA 4E9XA 1YLBB 4E9WA 3V9CA 1BQKA 2FT8A 3FSAA 4BXVA 4N8UA 1GS7A 1JOIA 3IE9A 3X2QB 1I53A 1ZPUA 1N68A 2IDUA 2CUAA 2WO3B 1IBYA 1KV7A 1J5CA 3ASNB 3X1EA 2WSDA 5I5MA 1ID2A 1GYCA 2BW5A 5AZUA 4G7RB 2GC7C 1BXVA 1JZHA 3ABGA 3UACA 2A3TA 4A68A 2XXGA 4DP6X 2VM3A 1ZDSA 1IC0A 1J9QA 3S8GB 3ZX1A 1PZBA 2H3XC 2Y1AA 4YVNA 1NINA 1V10A 3U25A 1OCZB 3RYMA 3S3DB 1FFTB 3PCYA 4G71B 2PP8A 3CZUB 3EH4B 1AQ8A 1ILUA 6PCYA 4DP0X 4F7KA 2BWIA 1E30A 2Q9OA 2HRGA 1CUOA 2PCFA 2J55A 1PZCA 4E9SA 4EF3A 2OV0A 3X1NA 4E9VA 4AX3A 2BP0B 1E65A 2FQDA 1AG0A 3FU8A
chains in the Genus database with same CATH superfamily
1FSKB 5H35B 1WT5A 3JWNG 2FR4A 4U1NB 1VJSA 4PUBL 2YAPA 2NR6C 5JORA 4NNYA 2UY6B 5EN2A 2CBTA 2J1ZA 3VWJB 5A1AA 2ZKMX 1S7XA 4JFEB 4F58L 4W9IC 1JDDA 3WDHA 4BFGA 3NRQA 4QCIA 4V33A 1WVZA 1QWUA 3FT0A 3AQZA 4RAHA 1H9VA 4P2RA 5IFAL 4OV5B 4L37B 3K8LA 4HH8A 4BSWB 2C1PB 3S36H 2K7QA 4FEIA 4JL1A 1AIFB 1AY1L 3CGTA 4Q89A 2H3KA 4ZXBC 1W6WA 2XIIA 3SYAA 2JJSC 1YEKH 5EV7A 3GBMH 3QRLA 1QSFB 4QRQB 2W38A 4QXTA 3HE7B 4YDKL 4E41B 3ZE0E 1YEJH 1M53A 3GMRB 1T66D 2OCCB 3KPNB 2VDLB 3FN9A 3TTYA 1IGYA 1WSST 5JNYB 5DDHA 2MTAA 3BT0A 4S10A 3U6XS 3VU1A 1HTYA 1SJXA 3VH8A 3VQLA 4IKNA 4JFHE 3OMNB 5BZZA 3PGDA 1JWMB 2XWTB 4YX2H 3BQUD 4DVRL 4ZI8A 3F84A 2WZAA 4FQCH 3RWDA 4PJ9B 1DVTA 1JRHI 4P2RE 4P2QB 1T1WA 2YLKA 1IJNA 1VCBC 5ICZA 4BQ6A 1KGCD 1ZS2A 1TVBB 3TA3D 1IAIM 1TPXB 4QRUA 2G75A 1X5LA 4U1GB 3GFUA 4F9PA 4LHJB 1DQML 1FDLL 3M7OA 4YSEA 5FO7B 4V2CB 3WENA 1F0LA 1FLRH 3KYKH 2Y0SA 4BEIA 2D0GA 1E9PA 3IDIB 4NGHL 5D2LA 3VXRB 4XVJH 3V6ZB 2GTZB 3VD7A 4UT7L 4ZUWB 4ZOCA 1M05B 3B4NA 1E3ZA 4YSCA 5D8JH 3LRGA 3FQXB 3O6ML 1XF5B 1S7RB 2B15A 5GGVY 5H94B 2VXVL 2WSPA 3D2UA 4XMLL 4QHKI 4C55A 4ZFFA 1XD0A 4HU2A 1HXMA 4GXUN 3ZR6A 5KUKA 4LLQB 2UZPA 2XJKA 3W3BA 5FHAH 1NCAH 1EMTL 3K3QA 4XAKD 1KCSH 5ETUB 3NJKA 1EDHA 1A7RL 2XHNA 4TNVF 3WTSA 2ZPKL 3IJ8A 1KIQA 2ID5A 2YFOA 1YDPB 4W9GC 2JCCB 3STZA 3IJYB 1QFWH 4YR6A 3DYPA 4UZGA 1R3KB 3DGGA 3MTRA 2EIDA 6FABL 1D9KD 1MJJB 3B7SA 4QO1A 3S8FB 4AG4H 3MBEA 3MMEA 4Z7VA 5I18L 32C2A 1SHXA 2AK4D 2Y69B 3HI6H 4OJCA 4U1JA 4QOKD 4FNLL 1T0NB 3S35X 3MLXL 1A4BA 3OGCA 1CGTA 5F9WC 4RSVA 4PLKC 1QTYT 3EJSA 4JDVA 3DVNA 3GPSA 4HAKA 4K7FB 4N2AA 5CEYA 1E8XA 3D50A 4XC3L 5K9KB 1H3PH 4E5XG 3DXAA 3BAJA 1VPOH 3VI4B 3WTXA 3PWPA 2A9AA 4XBPA 1HHGA 4FGMA 5ESVB 3HC3H 5D70H 2YN5A 4W9JC 1FBIH 2ADFL 4KXBA 1GCYA 5DFTA 3CU7A 2FJFA 1ONQA 1TMQA 5JA9A 5EU6B 3OWEA 2DI7A 1QR4A 2FYYB 5MERB 4WEMB 3TPUA 4X6FA 1KTJA 3ZIMA 2ICWA 1RLWA 1X4YA 5FOBA 4Z7VE 2Q76A 4F8OA 3I2CL 1QEXA 1TZIB 4N9GA 5ALCL 3MROB 5EUOA 3O4OC 3LXUX 2X3AA 3W9EA 4OF8A 4XNQB 2VC2H 4Q6IB 2Q8BH 4DT2A 3CSTA 4K8RH 1S7SB 1UXWB 4YEFA 3C5ZC 2P44B 1VERA 5FYJE 3WELA 4ELMB 2DQCL 3UJIH 2XFGB 3P3SA 1U3HA 2W07A 3JVFC 3DXAE 1RHHA 3MR9A 2ZWNA 1L6XA 4B5EA 1S9VA 1I1FB 3RTQC 2E7HA 1JPTH 4UTBH 1ZANL 3B6SA 5PAZA 3MUUA 4UBDD 5T1KA 1VFBB 4KK9C 1M6OA 3GF8A 3BMVA 4E5XA 3BAWA 4GKNB 1YMMB 2H7WA 4TUOB 3G6JB 5MEND 3SB3A 4RGNE 3SQOL 2VDPH 1TCRB 3U2IA 2ZXQA 2G3ZA 4JS7A 4U3SA 5T1DL 2D7OA 4LSTH 4PD4K 5SX4I 3T6XA 5EHFA 1A47A 5EUOE 3OKKB 4JFDB 3H2WA 5TH2B 2A1WL 2WQ8A 1FAIL 3X14B 2WZPD 2EVGA 1Y0LB 1JGUH 3QJFA 4WW2F 4BFBD 4M4RB 3SGEH 1QR1B 1JAEA 4DQOL 3NACH 1PU0A 2QSVA 5IB1A 2QDVA 2Z31D 4OJYA 5F89A 4G8FA 5D1XD 4YDVA 5MI0B 4UAOB 3DUUA 4ODUA 5GIRB 4ANKA 2ERJC 2FEDC 4KKAC 1MY7A 1EEYB 1G7HA 2APTA 2BPBA 2WINB 3FCTB 4FMVA 2VDNB 3OAZH 2EYSB 1Z9OA 3FZUD 4ZTEA 1YAIA 1Z7JA 3MAWA 3TZVC 2WLLB 1EZVY 3APFA 1TZGH 1RZ8B 3QORB 1IGCH 3LXCA 4D94A 1GGBL 1R0AH 1TUPA 2Y1VA 3V7MA 3N44F 1I1AD 3V4VL 1UA3A 1RY7B 3H0TB 3KBHE 3UTSA 5CLTA 3QDMA 5JA8B 3RP1A 3JV6B 4NKOB 4KRPC 2IG2L 4LSDA 4GXVL 1S6NA 3D85D 2A9CA 5BJTA 3F5WB 4B53A 5CGYC 3PAYA 4C83B 2J8UE 3CZFA 4DETA 4LRIC 4X4MA 3UYPB 4FJYA 4KZ0A 4PWHA 2K8MA 2XZQL 3UTZB 3RWJB 1WF5A 4P59H 1BZ9B 5DD1H 1AQDB 3DSFL 4K15A 4XO3A 5TTRA 3EGXA 3MNWA 1EEZA 4IBSA 4HUKB 2VLRA 4OIBA 1SNRA 3MV8E 5L2JB 3J2PA 5DK2A 2BO0A 4ZW7A 4KDTC 1VFMA 3GK8L 3MRIA 3CFBB 2CKNA 1CE1L 4RAUA 3AU1A 3IMUA 5K33A 4I9XA 4UQDA 2ARJB 4F9LA 3W5MA 1IGFH 5J6HB 2A2QT 3MLZH 5JR1L 1CYXA 1CLVA 4WI0B 4AEHL 4PRDA 4U6YA 3JTSA 1BEYL 2D8KA 4X4ME 3UO8B 1CGWA 1NIEA 2E75C 2VN6A 4QTHB 4QYOB 4XPAL 5DZVA 4OGXL 3R4RA 1Y1UA 1F90L 1S7VB 3FT9A 2VLMD 1CK0L 1UM4L 3ECWA 1KCKA 2NOYA 2WCPA 1P6FA 4PJ7F 5J11C 4U1LB 2ZWYA 4ZX6A 1ZK5A 3UPCA 1MCQA 4G8GA 3VD5A 5ECJE 1TQWA 3QEHB 3L3HB 3NFPB 4Y19B 3U36B 4Y4HD 1FI8C 2WQRA 1SZNA 2CLRB 5B8CA 2IDCA 2MCMA 5F7MC 1D3CA 3FH7A 2OW7A 1NFAA 4WNQA 5C2BH 1VFAB 4H1LG 5EZIL 1I8AA 4HJIA 3ET9F 5CM1A 1RIHH 2XQBH 4W9ZA 4MJ6A 5AENA 1J8KA 3GMOB 1KEGH 1N0XH 4WGVB 3T77B 1Q9WB 5EC2B 3L5HA 3Q06A 5LXGL 1K4DB 1KJ3H 3QVAA 3DRQB 4X7CC 2YWZA 4CKVX 1A9BB 1GIGL 2MRYA 2OSXA 3BP6B 3E1ZA 3S5LA 1UWGL 4PLNC 3WNNA 4Z7WA 5I0WA 3VFWB 3I6KB 4RNRA 2AZUA 1SFHA 4P5TC 1FV1B 1UC6A 4MASA 5D1QB 3GJFK 3C60C 3LQZA 5SWSD 5AYQA 2CO2A 1MCFA 5C0GA 2ZKHL 3SBPA 1BSIA 4JFWA 2YRLA 3UYRL 5FO2A 4WNSA 4YSRA 3CIAA 2RACA 1A6WL 2APWA 1RIUL 3TXAA 2A9NL 3NZ8A 3DOSA 5JXEA 1ED3B 3GMPA 3SCMB 3QFGA 1ZJAA 1PG7L 4OIIH 1EGJA 5D5MF 5DQJA 2DWDA 1M3JA 5DJ6A 5EUKA 3O9WA 1TSRA 3E6HB 1J5HA 5C07B 1WBZB 2GCYB 5DZ9A 4PW4A 4Q14A 5ABZA 2YSTA 1JPFA 1KTKE 4ZZKA 1YNTF 4BYHA 1V3JA 4J2XA 1RV6X 1JK8B 3TM6A 1PQZB 3KCPB 4F37K 1ZT7A 4K5LA 5FHBH 4G6MH 2AVGA 4TSCH 1RUPH 2B4CL 1R5VA 5F0PB 2KZ1B 3BIKB 4ZG1A 1TVHB 4H25B 4NYLA 1L0XA 3WIAA 4ENED 5CJ5A 3DTXA 2BSBA 3AW5A 4UQ3A 4HD9A 4E9XA 4YO0B 3RVWD 2FT8A 4PBWD 5I19L 1N19A 1IVTA 3D87B 4PJ8A 3WUWG 3TNNB 1EJFA 4TNGA 4JBSA 3K4ZA 2VXTH 2OULB 2ADJB 1QABA 2WVVA 5KSAC 2V2TA 4JPWH 4EIBA 1MNUH 1NMBH 2WXGA 1JNHA 1M7IB 2WXIA 1LD9B 1WCQA 1MWAH 3L2LA 1P5UC 4TTDD 5F2FA 1TFHA 2DPKA 3J07A 35C8L 1HHJA 1X5HA 2JLLA 1LO4H 3GNMH 2XWBB 3CX5J 4FOMA 4QJ5B 4ODTL 1J0HA 4OKVB 4IMKC 4Z7OE 1J88A 2JXMB 2ZYHA 1W9XA 4AQOA 2H3XC 2E6QA 3NIDF 3CFDA 3MRHB 4QDGA 3ZY7A 1RZKC 1ZT1B 1CDHA 3F7PC 1UA7A 3MX0A 4JDTL 5FKPA 2Y36H 4KVNH 2Q9OA 2HPOA 1PYWB 4HUUB 4HKJB 1ORSA 2VR9A 4IS6A 4OF0A 4XMPH 5DRXA 5B38G 3WO4C 1J5OL 1N3NA 1B4JL 4J3XA 4JZOB 3P11H 3IGLA 3C9NB 1A22B 2ZUTA 1DBMH 4QAMB 5BOZG 3T3PE 4NKQB 3PABB 3NZSA 3GSUB 4LMQI 1P0SE 2E86A 2WCGA 5A2JH 5H35A 4MBRA 5LO7A 1H19A 3O6LH 3GZQA 4N87A 5B1CA 4JFFD 4HSCX 4D7BA 1MI5D 5E00B 3VWJA 3WIIH 1CD1A 1SJMA 1XFPA 3MV7B 4IRJD 4BRVA 5D7IF 2VDKB 4HJTA 1KT2A 3H2PA 2O93L 4G80A 1F5WA 2IH9A 4I0PC 5E9DD 1GZPB 4Y4FC 5HY9B 3HS9A 5IJCC 3OTTA 4LEXL 2B0SL 4APQD 2R0KL 4OV5A 3H1ZA 3V2AR 2VRAA 4L37A 4BSWA 3X12B 2C1PA 3OVUB 4AV5A 2BVPA 1EGJL 1JN6B 4FL4C 3VMNA 2V8MA 2X2HA 1AIFA 5GGSB 1E2ZA 2EXWC 1H3TA 1ES0B 1QSFA 3V0IA 3VYOA 5ACZB 1X4XA 3HE7A 1HEJC 4QHNA 12E8L 1H3XA 2PN5A 4JFQA 4P3WA 4Y9FA 1YUHB 1UACH 2DBJA 3GMRA 4P9MH 4KXCA 3KPNA 1LHZA 2J6EL 1KWKA 3TJEL 5JNYA 4HQQL 4OLUH 4XN9A 5HPMA 2R1XB 2UWEA 3FYIB 4V11A 4WLCA 1KXQA 2MPAL 4MDIB 2XJLA 3BUPA 3QPXL 4RRPM 4OLVH 1XGUA 2XWTA 4JFEE 4UV7H 3H9SA 2X4PB 2CIIB 2TAAA 2BNQB 1KY7A 4PJ9A 3CPUA 1L0QA 4P2QA 3A6CH 3V6BR 1IIKA 5IR1B 5DLML 1RPKA 3T4AB 4IKJA 2QSQA 1TVBA 3UGUA 1XEUA 1W72B 3VFOA 1IKFH 2OSLB 3DOIA 3LNIA 4AVHA 4X5PA 1TOXA 5CCHE 1SVBA 2NXYD 4LSSH 1FE8L 1T80A 4LASL 4X4XB 1YQVH 1QSFE 1BEXA 1V54B 3M7FB 3HIZA 3RGVD 5ISZB 4XXWA 5A16B 5FO7A 2OCFD 2EDHA 4KI5C 3N04A 4E41E 4X9YA 1AGBB 3NQIA 1JUFB 4XX1G 3FHEA 3PAUA 3VXRA 2FUTA 3V6ZA 2ATKB 2GTZA 1OP5K 3WKQA 3GZOA 1PBYA 4Y2OB 4ZUWA 4BK4A 3WTVA 1KXQE 1YYCA 3RDTD 2F19L 4FZEH 1M05A 3VACA 4R7DB 5IM7A 1ND0B 3ATAA 2YZ1A 4AC2A 4MXQC 1CGSL 1XF5A 2YO3A 1S7RA 3EOYG 4K3EH 3QC5X 4P2QE 1F42A 1V7NL 1UM5H 3D30A 5H94A 1IZJA 4K23L 1ZTXL 4Y16A 1HL5A 2WXFA 4UOJA 2K45A 3MOBH 4JM2D 4LLQA 1MFBH 2C7FA 2DL9A 2EDXA 4JGJA 3VMOA 5BV7H 5F0JB 3E2HB 3PJNA 5BUPA 5KVEE 4IBQA 5ETUA 3F12A 3KBPA 4K71C 4P4KC 2Q3ZA 3HN5A 4PCTA 2Q6WB 3V0JA 4JKKA 3DURB 1YDPA 1A1NB 2JCCA 3IJYA 2AMUA 4UNIA 3B2PA 4KVPA 5GRVK 2CAKA 1MJJA 3UXFA 2I9TB 2ZWZA 3VXRE 4OQ1A 2H2SC 3WXVL 1S7QB 3UEQA 3NSJA 2GW5A 3N40P 4JPIB 3P69A 3O3EB 4S1RL 4ANVA 3IM1A 2H2PC 4XPFL 1T0NA 2H0EA 3BE1H 1KGWA 3QZMA 4YIQA 3SPGA 3V5KB 4UNVA 2YUVA 3U46B 4K7FA 2GJPA 5EOQH 3QJQB 4ALAH 1OSZA 1EV2E 4RX4D 3JWDL 2OP4H 4QPEA 1JYWA 3ULUH 1S9WB 5FFGA 2VXSL 3KGTA 3VI4A 2F7QA 3OL2A 1ZOXA 4L1SA 1CXEA 2E3VA 5ESVA 4U6VL 1BAWA 5EF2A 2VDLL 4L9DA 4PJHB 4WTZA 2B20A 2DQHL 3QR2A 2LLGA 5CUSH 4WIQA 4ZUSB 3UBXB 2JCCE 3QNFA 5IT2L 5MERA 3IMWA 1UFUA 5T5FA 3MODL 4ICWA 3O3DB 3IGUA 4JO2H 5EB9A 4B9FA 4DGIH 4MJHA 2DIJA 5TQ2L 3GSNH 2P80D 3MROA 2ZXBA 3HNSH 3RU8L 5I30L 1VACB 3IS1X 4Q6IA 4XNQA 3ABKB 1G9MH 1S7SA 1UXWA 3WJLC 5KVEL 3LMJH 1GGCH 4ELMA 2WYZA 2G3NA 3OZ9L 4XN4A 4AJVA 2HKFH 3RUGF 3VI4E 3VFUB 5DQ9A 5AVUB 1MRCL 2QKIC 4NFCA 1I1FA 3DUHA 1VZHA 4WI9A 5IVZA 4RFOH 5K59E 3BQUB 3S36X 3HG2A 3HN8A 2Y2TA 1YMMA 4TUOA 5EU6E 2CM6A 3AXHA 1BLIA 2OMXB 4YAQA 1DBBH 1TCRA 3SGKC 1MQ8A 1OPGL 3TA3B 3STBA 3DDGA 4F2FA 3BT2H 4XOCA 1XGYH 2YEQA 2JKSA 3FTZA 4N2MA 2Z8RA 2YD0A 3VXMB 3MXVL 1FFQA 3U1QA 4G5ZH 1IFHH 3RA7L 1IEBB 1V5JA 3OKKA 4JFDA 2FO1A 8FABB 2WYIA 3P3YA 3R1GH 2NZ9C 4P3DB 4EPSA 3X14A 1Y0LA 3ML8A 4FERA 5KVFE 2F53D 3T71A 4ELME 4FADA 1SY6H 5E8EB 2PR9A 3WKML 1R3LA 3OQRA 4P9HC 4LSPL 1AD9A 4M56A 3HHSB 4KV5E 2D7TH 2CDGA 3BD3A 3RNQB 3QAQA 2HWZH 5I8EB 5K39A 4OQTH 1CFTB 1RZIB 3N0AA 4ONGH 2P5EB 5KSBB 2MHAB 1MPAH 2WINA 3FCTA 3ZE2B 4BQCA 1I4FB 2EYSA 2WNWA 3D4ZA 3EJPA 3G6JE 4JRLA 1P4UA 3B2MA 4KROC 4ZXBA 2R2CA 4WCYH 1RZ8A 3IKCA 3QORA 4KY1L 4IBZA 2BRRL 4JFDE 1ZE3H 3H7BB 3SKJH 4YL4A 5CD5D 1LK2B 4KO5A 1PD0A 1OHQA 4F2MB 2P42B 1O6VA 1PNDA 1GMIA 4GB9A 4CW1B 5DD6B 1U4FA 4NKOA 1NUGA 1D9KB 4K7PY 4UM9D 3K6NA 4YHLL 1AO7D 3QO0B 3F5WA 2IAMC 4XB7A 1XGQB 1E4XL 4F24A 4C83A 2VDMH 2AK4B 5T3ZH 5MEQB 1ZD6A 4G83A 1FRGL 2B1AL 4QOKB 2I9LB 4BQBA 4BZ2A 2RMNA 2D7MA 1OAZL 1IAOA 1M56B 1BZ9A 4X8CA 1AQDA 1JK9B 4JFUA 2X4TB 2NSXA 1UH2A 2BCMA 2ADYA 1MCKA 2NY4C 4FQQB 4MJ4A 1GAFH 2DLHA 2VJXA 5L2JA 4RAVB 4V1DD 4HLZG 4MAUH 1KCUL 3CFBA 3WTUA 5CEZL 3WMSA 1RZGB 1GZHA 4N2GA 1ET5A 3ULAB 4LIQH 3GUFA 1T4KB 1F1DA 2ARJA 3WY3A 5IKCB 1JMZA 3F00A 4K73A 2C9SA 3NVQA 1BLNA 4AKOA 5JIHA 4F1ZA 43CAA 1FFNA 3BPNC 4W93A 5A43C 2J6WA 1HWGB 1ZV2A 1UWEL 4QYOA 3QUHA 4FZ8H 3ROOB 4LO9A 4WSJA 3BUTA 4G6FD 5PCYA 3SDCD 1W15A 3C08H 4NFBA 1BAFL 1S9XB 4OLWL 4RZCB 4NI6A 1BYPA 3KM1A 4FMFA 4U1LA 2NMSA 3RURA 3FB5B 5ELIA 4EI5D 4JE0A 3WJMA 3QEHA 1V3KA 3HMWH 3L3HA 2AI0H 3NFPA 2IOIA 4Y19A 5FYKE 4NUMA 3U36A 5D1ZI 2V9TA 2CLRA 2KDYA 3GLEA 2GY5A 5D2LF 1B3JA 4ODSL 1VFAA 5K1NA 1BG9A 4GRWH 3C8KA 1N8OE 4WDIB 4XPHL 1X9QA 2WOBA 2CRIA 1Q9OB 2BZCA 3ARFD 3GMOA 5EULV 1A7PL 1WTGT 3BLBA 5K9JH 1X9LA 5I1HL 1S7WB 3T77A 4U1IB 1JE6A 1Q9WA 3SDDD 2PR4H 4W9DC 4KTDH 1D5RA 4QMEA 5EC2A 1T3FB 3ZYZA 3BKYH 4L05A 3REVB 5EU4A 3T6WA 3DRQA 4RWYL 1A9BA 2A74B 4WUUA 4JB9H 3BP6A 2D0FA 2GJ6E 3L7EB 2ADIB 5I6KA 4GAGH 4JZJB 1OHZA 3I6KA 2VL4A 4XB8A 3BP5B 3WG7B 3WI9A 1FV1A 5D1QA 1DLFH 5IB3B 3IFOA 3VFGL 4Y19E 1N4XH 1FH5H 2VOTA 1CDJA 5D1XB 1MW2A 3MJ8B 5E1GA 1CF8L 2VDQH 1FORH 4YDJB 1HHKB 1X44A 1ANUA 5AW1B 1A6UL 5GRJL 4ONFH 1O0VA 2NNAB 1UH3A 1WK0A 3NJIA 3V4PB 3WFCL 1IQWL 4NERA 3UX9B 1HI6B 5KS9B 1EVTC 4HJJH 4BZ2L 2BERA 3ZDXB 1AG6A 1ED3A 4R2GD 1OY3B 1FVCB 5IGXH 3UP1A 4ZMNA 3BZEB 3QHTC 1VEPA 2J25A 3E6HA 1G43A 4PRPD 2WXMA 2GCYA 4PV1C 5C07A 4JQIL 4PH8A 2CBPA 1YPZA 5BRQA 3C5ZA 2DH2A 1RUAH 1F4YH 3WAKA 4TQEL 5ESAB 2XA8L 1JK8A 1PQZA 1MIMH 5MP6H 1J8HA 3V0EA 1BZDA 3GBNH 5DWUH 5D1QE 1KBBA 4X98A 5ALBL 4TSAL 3BIKA 2HRPL 5A2AA 4H25A 3NN8A 3F3HA 1NBCA 5DEFB 3MLUL 3MOQA 4N8UA 1DBAL 2VE6B 4G7VH 3QYMA 4YO0A 2G5RA 3KWVA 3QCVH 4L8BB 3ZT7A 3TNNA 3VDAA 4LK4A 4DVBB 3D3VD 2XT1B 1HQRB 3A4DA 4IRSC 2LGNA 3S37L 4JN2B 4X5XB 2YFNA 3LIZA 4GW1B 3EG9B 1M7IA 1OAKL 3DBXA 5L88L 3O0RH 4GRLD 4HSQA 4ZUVA 1UKTA 4FF9A 5FYLE 1QFPA 1WWAX 4H20L 5C07E 2R4SL 4PTUB 2CXGA 4J6IA 3IDUA 2BRQA 3O6KL 4Z3IA 3GI8L 1PZBA 4OKVA 3HG5A 2VN7A 1D6EB 3U25A 1VGEL 4JK0D 3BWUF 1U58B 2ISDA 4I48B 2MQ3A 1WBXB 1AJ7H 3KPRD 3MRHA 4XCNB 1FYTD 6PCYA 4IRZA 4ZMZA 3BHBB 1ZT1A 3K1DA 3TLRA 1CUOA 3RJOA 5D7SL 4JGUA 4Q9BA 3VGAB 4E9SA 2GABA 7FABH 2VWEE 1PYWA 4HKJA 4XN5A 5E6IC 1E65A 5BZDA 1DN0B 2CPCA 1RJYB 2FJHB 4JZOA 4JQXA 1T5WA 2WLYA 4Z78B 5ITBL 3C9NA 1MRDH 1HHIB 2ZZUT 4FYTA 1B0WA 5HGAB 2JELH 5CJQH 4FFZH 3I50L 1HDMB 3GSUA 4Y4HB 3ESVF 4P04A 2ZCKL 3Q0HA 5IJBC 2W60B 3UTTA 1E5ZA 1F4WL 1JZFA 5LBSH 4OB5H 2VUKA 3AY4C 1MCBA 3FO0L 3QQDB 2Q3AA 5E00A 4ZZFA 4HC1A 2K3HA 3L1GA 3MV7A 3B9AA 4ONHB 4IBWA 2CHZA 4KUZH 1P2CB 1MJ7H 1PLBA 1GZPA 3BRGC 3GRWL 5E8NA 4XP6H 2NW3A 3VVWA 3KE0A 1IAKB 3QHFH 5DZLA 3TO4B 4DKFH 3UAJD 4ZDHB 3SGDI 3QGVA 3X12A 3NK3A 4Z3EA 5EN3A 1JN6A 1CVSC 2EXSA 4UILL 4P06A 2EUZA 1M9SA 4PBXA 5GGSA 4HIJA 5J56B 1ITCA 5F7EH 1NEZB 2WHVA 1ES0A 1MG3C 3SYOA 4KDTA 5DZJA 1B4TA 5SWSB 3VXNA 5C2UB 5L4FA 1YUHA 1KFAL 1YEIH 4FFYA 4LCUB 1FG2B 1XVSA 2YC1B 3FRPB 5E08H 2G60H 1KB5B 3U2JA 2B59B 4D8OA 4BH7A 3GZKA 2WP3T 5ENWB 4MDIA 2IBZY 3S88L 4Q9QL 4FQJH 4DPAX 2E27L 3WNKA 2BINA 2C34A 3MV7E 1FC1A 1JYNA 5I1KH 2X4PA 4LGSB 5CBAA 2BNQA 3B9EA 5EG6C 3QDJD 1U36A 1QRND 2A73B 2ZE0A 4FXGB 5E1IA 5EWIH 1MF2H 3LIZL 4AL8H 3T4AA 3BPCB 3ULUD 2RQEA 4TOYL 2R8SH 2OSLA 1QWNA 4L4VD 4DPCX 3PXJA 4PPTA 4P2CG 1ADQH 4X4XA 2UZXB 5I0YA 2J1WA 2EH7L 5FUCE 5ISZA 1IC4H 4J3OC 2PPAA 4IOFC 3LKSB 1AGBA 2AQTA 2XQYG 2OPCA 4AVIA 3O2DL 4X5LA 3NIFE 5JZ7D 2MIZA 3CZSA 2ATKA 3TF4A 4IRZL 4Y2OA 1ND0A 2L3BA 3TTSA 4LCIH 2X6VA 4LXFA 2BSRB 3MRKB 3JQOB 2A83B 4L0PB 2BNQE 3EYQC 3L81A 1ZSDA 4MHHG 2F8IA 2NQDA 4JE4B 2XN9B 1G87A 4RA3A 1P7QD 2ZXEB 5F97E 5J1AA 3MJ9A 3MRLB 1PJWA 3BZDA 1F6AB 3N41B 2Q6WA 3SJVD 4YZWA 3CZGA 3DURA 5ISZE 4UTAH 1HSAB 2YJLA 1JGLH 1WFOA 3RL1B 4GLRH 1IC7L 4LNVA 4NN6B 4Y2DC 1RMFL 4HETA 3OX8B 1EO8H 2I9TA 3TBBA 1S7QA 5IQ9B 1UTDA 4XNUL 1YYML 2FGWH 5AVZB 3O3EA 4M6OL 3BPOB 3V5KA 2FX9L 5C3IA 3LYRA 1OWWA 1T89A 1BJMA 2XQYA 4J8RA 2Z35A 5D1ZC 5L4JA 3U46A 1P4BH 5IJKC 2F6AA 4PJDB 1N2RA 4NXKA 1S9WA 4Z7WF 3IK2A 1SF3A 3E8UL 2DQUH 3VXSD 5C3TA 4Q0XL 1MI5B 4XWGL 4JNXA 5LG6A 1J0IA 1VF5C 2W0PA 4PJHA 3OAUH 5E9DB 4ZUSA 1OAYL 5KYXA 1I3RB 4BUHA 4APQB 2KLRA 2FWLB 4W81A 1E90A 1PMYA 4E9RA 4QXGH 3VYPA 5IWLA 3O3DA 5LN4A 4WV1C 3JWOC 3H3PH 3RIFK 2BNUB 3FDWA 1EO7A 3V8OA 2DJ4A 1VACA 3MREA 5E0FA 5E6YA 3H6JA 3KLHD 4IK6A 4AE0A 3DX9B 3WL9B 1KXHA 3IXAB 3FL7A 5IVXB 3BFOA 3EDDA 3ABZA 4IMKA 2GY7B 4OCRL 4TN9A 3VFUA 4J23A 3MLYL 2XVBA 5KWYC 4MJID 4KVCH 1KN4L 5T3ZD 1QYGH 3GZPA 4OF6A 4PRHD 1USQA 1J0JA 1IBFA 3E3QE 3FAWA 3ML9A 4O58L 3ZUCA 4PJHE 1NCGA 1VFOA 4XX5A 1A7NL 1KBWA 2CJSA 3L17A 5GRUL 1OIOA 4TQIA 1BJ8A 2H0JA 2OMXA 5I82A 4BK5C 1MFEL 4G7YH 2PP9A 4RA0C 2CCWA 3TNMB 2I25N 4LOUC 2CJUL 4TULH 3VXMA 3D0LB 1AMXA 5BRZD 3L9YA 1IEBA 1SEBA 3VG0H 5CIPB 2BP5M 3RGVB 4Y5XB 1X7TA 1JFQL 3MJ9L 4Z0BH 2C3VA 4F33B 1D7CA 1IE4A 3T65B 4HALA 3TJPA 5FM5O 4WF7A 3WJJC 5F7HA 1AE6H 5KVGH 4QLRA 2FE0A 4NPKA 1JIBA 2VM9A 5JW4M 3PREA 1DJXA 2XN0A 3RDTB 1E50A 3RNQA 1DQQB 2EUXA 2OCJA 2V4LA 4W4NA 4Y4FA 1CFTA 2VITB 1RZIA 2FNBA 3P0VL 4PJBB 2VC2B 4MCMA 2P5EA 5ESQB 2MHAA 3RGBA 5KSBA 1FWXA 2ESVD 5F71A 1XTLA 1INDH 4TM9A 2YSSB 4JM2B 4KNQA 3K6IA 4ZD3H 3VG9C 5KZCD 4RMVA 3AAZB 1E5UI 3VXME 1MCLA 2VXUH 4UQEA 3TWCH 4KQ4L 2H6OA 3H7BA 3HAEH 5GZND 2X44D 3BIBX 1BCIA 4FQXB 4RMUA 5HVFB 4F2MA 5JIQA 3VMPA 1TJGH 3SKOB 5I75B 2QFPA 4CW1A 5DD6A 2O61B 1ESOA 1PKOA 4K5PA 4X8JA 3QO0A 3DVGB 4HWZB 1XGQA 2D4FA 1FL5B 2FEEI 1ETZA 4PLJC 2I9LA 1AI1H 1LP9B 1HWWA 4YVUA 3OKDB 5F9OL 3DRTB 1XB8A 3QZLA 2EO1A 1JK9A 3FFDB 2P5EE 5KSBE 2X4TA 3ZE2E 4CSSA 3QS2A 4ERSL 2VXQL 4BJLA 5DURD 2C9VA 4FQQA 1A14L 3GM8A 1B88A 4S0TD 4X2UA 4J3SA 3CUPB 1ZLUK 3DX0A 1KYAA 2NY2B 1B6UA 1UUNA 1U8JB 2D03L 4I8DA 3CDZA 1LO0H 4TYUA 4F2ME 1CICC 1T4KA 2NY0B 2UWEF 4OGQC 5IKCA 3D9AH 5GJSH 2WNKA 1LO5B 5D93B 1CQKA 4S1SL 3EW3B 4WI7A 2AK4E 2BHYA 3ESPA 5FFOA 1EZVX 3SDAC 2DQIL 4QOKE 3MRDA 1ZLVK 3B7YA 4M6ML 1D5MB 1LO2L 3ZKQD 2DBLH 4PGJA 5B7MA 3BP4B 4RZCA 4HS8L 2WYTA 4M8RA 4HXAL 4XVTL 1NZRA 4Z23A 4OCWL 3FB5A 4WUKL 4Z5RA 4KKLD 3V55A 3TEXA 3LY6A 2BW4A 3II1A 1HKFA 4EXPX 5DJYA 1F8TL 5DLLA 3MLWH 4B3VA 1KYOJ 1Q9KB 5C0NC 3C6LD 1O6TA 5AB0A 1WD8A 1S7WA 5ILTL 3S34L 2DTSA 1T3FA 1PLGL 1UD8A 3CSYB 3REVA 4EEEA 4BCXA 3LS4H 2VKWA 2WLZA 2A74A 1M7DB 3OKEB 2ADIA 2EINB 4MDJA 3GD1C 1CD0A 4GW4B 5DFVD 1EHLH 4HIEB 3BP5A 3BDBA 5IB3A 5L7XH 3ZJAA 3GJFH 4MA7L 2YKLL 4YDIL 2ENQA 3ZRCC 3C87A 5A3IC 4L48A 3MJ8A 1OM3H 2VR5A 1HHKA 1VRSA 3P4MB 1G0DA 4G3YL 2B7DT 3V4PA 3VRJB 1JHKL 4HK3N 2Y3NA 1FAKT 1I9EA 1UZ8A 2YQGA 4LLMB 5F3FA 5F7YC 5KS9A 5JQ6H 1PY9A 4R97C 2WXPA 3VFMA 4TNWF 3CWGA 3EYOA 1FFPB 1FVCA 1JXKA 3OPZH 4QRAA 1ZHLB 3BZEA 1IO4C 3WFHB 5TDNB 4KZDL 3LEXB 2C4FT 3WJLA 1MRFL 3EJCA 1G9HA 1BD2D 3HN3A 2N7AA 5ESAA 3WXWL 1WUNT 3JT2A 4U7MA 4MMZC 2ENJA 3L4UA 1B6DA 1GJIA 3KWTA 1N26A 2QKIA 4OF3A 1AO7B 3COOA 5LGYA 1EFQA 4FYRA 3D39D 2GK2A 1ZPUA 1V05A 3UJJL 3INOA 3T0DA 5DEFA 5D1XE 2WO3B 1NCWH 1WIUA 2VE6A 3DTDA 1G7JA 4MA1B 3X1EA 5BUAA 2A4EA 3ZE1F 4NM8L 4HT1H 4MD0B 4GBXC 3LEVH 5I5MA 4L8BA 5GGTA 3SGKA 5KS9E 4ZBJA 1HQRA 2A9DA 3NEOA 4F7MB 4JN2A 4X5XA 3RY5A 3ZDXE 3IJ7A 4GW1A 4R6UA 5BO1L 2EIZB 3QH3B 3PWNB 3AQDA 4QRPD 3THMH 4A68A 4XI5D 2Y23A 3SKMA 3MLRH 2FIRT 4MX7B 5DJ2A 4A2LA 2XY2A 1SDYA 5DJDB 5T1LD 4PTUA 4N22A 2X5PA 3MI6A 1MFAL 3DETC 2ICEB 4TL5A 4PSPA 4RMWA 5AVVB 4ECNA 5T1JA 3PCYA 2F68X 4BSVB 3H42L 1D6EA 1FF5A 4YDLC 4N85A 4DKEH 2CHXA 1E30A 1U58A 1FNLA 4I48A 1J1PL 1WBXA 4BHUI 1C5CH 3BHBA 3O8XD 4JFOB 3U30B 4EZMA 4YBQC 1AG0A 4CADB 1TQTA 4DQAA 3SDCB 1RK1B 5CJOH 3MNZA 3WSQL 1TKWB 4G7QB 3GS4A 5AYUH 2G5BB 1G1OA 1DN0A 2FNWA 2FJHA 3QCUL 1R19A 1HHIA 3B8YA 4XGZA 1MKFA 3II2A 4Y4HA 3ZKND 4JY5L 4ZW3A 1D6VL 4BCZA 1KBGH 3APCA 2I5YH 5CHNB 2W60A 3HW7A 5TFSL 1XMEB 4IMLB 5HGBB 2BSTB 3BWAB 4PVNA 5DC9B 3GIVB 1J1XL 3U4EB 4ZNEE 4NXSA 3QQDA 2DWTA 3T4YA 1D5ZB 4ONHA 1NAMA 5DD3H 3EBAA 4R4NC 2X1OA 3DX6A 1P2CA 5DEJA 2F5BL 2ZKWA 2HFEB 5AWNH 2BNRD 1RUMH 3V8CA 1IAKA 3TO4A 1YEEH 2IXQB 4MS6A 5IROA 3MJ6A 4ZFQA 1C7SA 2VLME 4WQOA 3M07A 2VM4A 3BAIA 3NUKA 4IHBA 5IBTH 1TZHA 1YYLH 2QADD 1OB0A 4ILDA 1I1YA 1PDKB 3FU0A 1E27B 4FP8L 3GLZA 4Q6KA 1E2VA 4AYFA 4LCUA 3T0EC 1FG2A 1VCAA 5L8KB 1BZ8A 2YC1A 2A0LC 3FRPA 1E8YA 3C09B 4LVNB 2B59A 4PQXA 4Z3FA 1AQHA 2QGCA 4LP4A 1A25A 2YMOA 4BZ1H 3EFFA 2MQCA 4X7FC 4KHXH 4EI0A 3MXWH 5GGTL 4E42B 5B1JC 3CDGB 4P4RB 2A73A 4KQ0A 1I3GH 2KBGA 1D7BA 4O2EB 2N7BA 3T8XA 2CKBH 1L3NA 2B08A 4JRYD 3P77B 5LNEA 3WTTA 4L3EA 4HHAB 2EO9A 1QBMH 1Z9PA 4MA8L 1L9PA 2F8VA 5SWSE 1T1YA 3GMNB 3ARQA 3V95A 1LK3L 3F2LA 5HHPB 5TQ0H 1AS7A 3U9UB 4LAQL 3LJ3A 4UQ9A 3QUYD 1F6FB 1NGQL 3NA9L 5KBLA 1N5AB 1UVQB 3L16A 1KLGA 2X05A 2FBJL 1HNYA 2IOOA 4WY7H 1OP5H 4XPGH 1YQ2A 3F65A 1KZQA 3D3VB 4HXBL 1A9EA 3FCBA 4GG6F 1IIIA 2EDYA 4FC3E 4JG0L 2BSRA 3L2NA 2A83A 3U6RA 4GRLB 2R0ZH 1HAWA 2VDRH 1E2WA 2VW4A 2XTJB 4R7VA 2UUDK 4IJ3B 1CXKA 1IBBA 1OGPA 1Q0YL 2XN9A 3CMOH 2BVOB 4FFWC 4GKLA 5AVYB 3T08A 4ATTA 3GXTA 2FZ3B 5F9JB 3MRLA 4YDZA 3CFUA 3BGAA 2KQMA 5JIDA 2NY1C 1UWXK 3R06B 1F6AA 3IFPB 5IIEA 3HB3B 3ULSA 4PUBH 1FYTB 2LAGB 3LQAC 1DVFC 1BMZA 4QKTA 2K78A 2OX5B 3RL1A 1NAML 2LU5A 3Q8BA 4F58H 3OX8A 1A6AB 1IV8A 5M7QA 3ZTJG 4G5AA 5IQ9A 4HVBA 5I6OA 4Z7NB 3QRGL 4IGBC 5IFAH 4AK1A 1RL1A 2WBJC 1JNLL 4J4PA 4FXKC 3RVUD 4KKQA 2CDFB 3FQ2A 1IAII 5L4MA 4KNTA 4TVPD 3KGUA 4Z7UF 2BIPA 1TNNA 2VAAA 3BUIA 4PJDA 1S5IL 1AY1H 4EZLA 5I1GL 3L3JB 3ETBF 2SODB 3FT4A 2AK1L 5BZWB 2XN9E 5BOPA 4MAYC 5I5JA 4BKLB 1KCRL 2CK0L 3RB7A 1IGJB 4YDKH 1IARB 2WIIB 3QJXA 2Q87A 1YY9D 3VJ6B 2MKLC 1YNKL 4WSGA 1KV3A 3BEWB 5E9DA 3SYQA 1I3RA 3MRGB 3OWRA 3ZKXB 4APQA 1SHMA 3OG4B 2V9UA 3HJEA 3BAKA 2Z4QB 1UXSA 4DVRH 4Y1AB 1HXYB 3OKOB 3A67H 4IIZA 5B3JE 4X4KA 5BV7B 2BNUA 4HISA 1YPZF 2DIBA 2AAVA 3II3A 3DX9A 2XVLA 3WL9A 5KBDA 1Z0NA 3KD4A 2BWDA 2AEOA 4JO4L 1MDAA 3ABMB 4PJDE 3SGJC 4AGMA 1B9ZA 4YSSA 1MCCA 3QUZC 2OTUA 1L6PA 1C12A 4M6AA 1E4JA 5DHYB 1DQMH 1FDLH 2PMZA 3F05A 1MI5E 1KXVA 1PW3A 3GDBA 5IW1A 4Y4KD 3CG8A 2OMVB 4NGHH 4NO0B 2WXKA 1N6QL 5E9DE 1F86A 1ZHKB 3QDJB 2MNJB 4UT7H 1QRNB 3GXIA 2B9BA 3LZRA 2LTQC 2IFFH 4M5SA 5E6IA 5GHWL 1JZIA 1QEWB 1Y18B 2I69A 3A4FA 3IU4L 1HILB 4AV4A 4OI9A 3O6MH 2XUWA 1M1XB 3D0LA 4JR9L 4L4VB 1BF2A 3AZUA 1QPXA 4R7NB 1BQ5A 4TV3A 2VXVH 1HVXA 1N8ZB 3OB8A 5CIPA 3V0VB 4LLYB 3PAVA 4N28A 3SPJA 1QKZL 4F33A 3SOBH 1EMTH 5IVXE 3AY4A 2AEQL 2P9RA 4O5LL 2HT4D 2VLJA 3NSFA 1A7RH 4OZHF 2ZPKH 5I71B 1E7VA 1UXLA 3F7RA 3RDTA 3TJHD 4J8QA 6FABH 5IMKB 4QJ4B 2VITA 5DFAA 4PJBA 1XIWB 4DEWA 3N06B 5I18H 5ESQA 1NOLA 1XTMA 4FNLH 2IPUG 4J3OG 2XV2A 1SUJA 5ICYB 3MV11 2YSSA 4NQCD 3MLXH 2FJGA 2ED7A 1P5VB 5F88A 1T66C 2APBA 3AAZA 5JHAA 2WQVA 5D7LA 4XC3H 4HCRL 1PZ2A 2PUQT 4E9LA 3X1GA 3CFJB 4FQXA 3SJVB 4KDVA 1H5BB 4C58B 4CDGC 1WISA 4ODWB 1C5DB 2O61A 1TJIL 3DJSA 2ADFH 2TRYA 4CILA 3DVGA 1ZT4A 4HWZA 4PG9A 2EH8L 1IVLA 4OH2A 1LP9A 4AQZA 5SV3A 3OKDA 1ILSA 4HFWB 2ZG1A 1WE5A 4B7LA 5HYIA 3ARDC 3F6LA 3DRTA 3BAEL 3RX9A 1T5XA 4KRMB 3JWNH 4PJBE 2I85A 2XACC 3FFDA 3I2CH 3M1OA 3TN0B 5BMFL 1J9SA 5KYWA 5ALCH 4AQ1B 2AXWA 4NRXB 2VW6A 5JIKA 3VXSB 1CG9B 3CUPA 3M8OL 4Q7DA 3RAJL 3I3BA 4F8PA 5I28A 1HS6A 2DQCH 5JHMA 1U8JA 1L9NA 1P84K 2JQZA 4W9HC 3RPIB 3SSGA 3MZGB 1AQKL 4AIZA 1WA2X 3AG1B 1LO5A 1ZANH 1OO2A 2NRDA 2PCYA 3UTPE 3PHOA 3JXAA 1YRKA 2F74B 2R59A 3RDJA 2YGNA 3NIGB 5AKTA 5BW7C 1GC1L 1D5MA 1LP9E 1E5CA 3SQOH 4LHUG 4H2CA 5JYLA 3P2DA 2OBGA 1UD4A 1NJ9B 3BP4A 2F08A 3LH9A 4NZRL 4EO5A 2I07B 1FZJB 3WLWC 2E4TA 3HUJB 2LVCA 2FCBA 4K7PX 1GPOL 2Z9TA 2GBVA 3S48A 3D06A 1JPEA 3PDGA 1ETA1 3QQ9D 2A1WH 3L1EA 4ABWA 1H6EA 5A7EA 4I77L 4PLOB 4GY4A 1BXXA 1FAIH 5JPMC 2VDMB 2XG4B 3CCHB 4JO3L 4PRHB 4LSVL 2ZKXA 4DQOH 1OGAA 3H4HA 2CRMA 1MWOA 4LNRB 3LZNA 4Y2DA 3V0FA 1Q9KA 3FO2B 5CLWA 3UTQA 1XCWA 3BPLC 4F7CA 3IVKB 1SGKA 4NZUL 5DMIL 4QKXB 2W91A 2SEBB 4AYGA 5DS2A 5D1ZA 1S78D 1WFNA 2HTKD 2XQYK 5IJKA 2D3LA 2ZOLB 4AMXA 3LZLA 5HGHB 2AJUL 5IMOB 4NQXB 5MHSE 3QZNA 2EACA 1JNJA 4NRYB 4OZIB 1GGBH 4C59B 3MKKA 1FGVL 4GW4A 2EQDA 1XR9B 4HIEA 3ASOB 3V4VH 4WHCA 1NBVL 4ZOBA 3HG0A 2OL3B 4M1CD 2F1EA 4ZS6C 2I7OA 1UGNA 1SYVB 2IG2H 3H2QA 3P4MA 2NW2B 3TURA 3WNOA 3F7LA 4X80L 3VRJA 4GEIA 3HG1A 1X5YA 1QATA 4A2EA 4BKSC 2XZQH 2J12B 2GT9A 1HINL 2HG5B 1ZHLA 2FO4A 2EEAA 4JKNA 3WFHA 4EAEA 2WVTA 1Y7VA 3DSFH 1KJ2B 2VDOL 1R47A 3LEXA 2P7TB 3MCKB 3EOBB 3NP4A 3GSXB 1X5MA 2YD3A 5E2TL 2X4SB 2JKNA 1YLBB 4OFYA 3O4LB 3RHWK 1NFDB 2WB1A 3S5YA 4GRWB 3T2PA 3N5AA 1DQVA 1J05A 1IGTA 3BD4A 1CE1H 2AAAA 2EAEA 2AQ2A 1FZKB 4R5XA 2CHDA 2F7IA 1DN2A 5C97A 5JR1H 4MD0A 3QIBB 4GW5A 4UV4L 4AEHH 4BK5A 1XF3B 3PFUA 1BZQK 4L1LA 4DFIA 1K9TA 4F7MA 2BOCB 4XPAH 4WO4D 2VR7A 4OGXH 1MCNA 5HGDA 2EIZA 2OFQA 1F90H 4AZ8B 1CK0H 1XSIA 3RZWA 3U9WA 1UM4H 3WEXA 3FTWA 1QASA 5DJDA 5FUOL 5EIQA 1CVRA 1ECYA 2Z31C 3G7TA 5FF6B 3QJZA 2ICEA 1NM9A 1TJHL 3HS0B 4A39A 1NLDL 1KTBA 3WJJA 4BSVA 4GAJL 4LDLB 5IFHH 3WY1A 3CFIC 4FNPA 4KMTL 3VXUD 4KUCF 1F6LL 4M1GL 4Y2NA 1AO7E 1FJ1B 5CN3A 2FSEB 3FZUC 5EZIH 1MLBB 4JFOA 4OD3L 3C8DA 4CADA 1RK1A 5M95B 1TKWA 1IT9L 2IWGA 3EJZD 4NZTL 3DK2A 3UGEA 2G5BA 5B7FA 1I1AC 5E95B 2E9JA 5AB9A 2FWOB 5LXGH 1MEXL 1SXNA 3AXIA 2GSIB 4X4YA 1GIGH 2OS7A 2NZ1A 4UDUB 4L8CB 3SE3C 1UWGH 1VHPA 5CHNA 2D9QB 1EHXA 1OT4A 2VZOA 4JRXB 5IZ7A 2BSTA 4QXWA 3BWAA 5A7BA 1OK8A 4ZFZB 2WD0A 5EBWB 2FEJA 4AH2B 5HJDA 3U4EA 2XDHA 5KBNC 2ZKHH 1D5ZA 1EPFA 2PF6A 4LCCC 4L5FL 4Q8BA 3UYRH 1XO8A 1AGEB 2HFEA 3VTMA 1WA1X 4JO8A 4WWPA 5DU7A 4M5YL 2OW6A 2J88H 3G5YB 3IB4A 3L9RB 1A6WH 3OJ2C 1MQKL 4BFKA 1T0OA 1I9IL 2IXQA 1RIUH 2A9NH 3EZ8A 2K9UA 4AVKA 4DGUA 2LT9A 4N5UA 1PG7H 1LWRA 1NMCB 2H6UA 2O6EA 1O9ZA 5BNXD 3CN1A 3QQNA 1PDKA 4B9ZA 1E27A 2VCOA 2CHWA 3OC8A 3LS5L 3KZ8A 1J0KA 1ZHNA 3MSPA 4XCEB 2NYZA 5EO9A 1CICA 2XRAL 2R29L 5GS1C 3FN3A 1RULL 2B4CH 2X4QB 5AKSA 2DWEB 3KPSD 2RALA 3S2CA 1H3WM 5I0DA 3HRPA 4N2OA 1E4HA 4NZ8A 3TA4D 3VI3E 5I19H 3QCTL 2E9BA 3CDGA 4XBGB 2VL5B 5AAWC 2EDKA 4FABL 1PCXA 1EFXB 1BD2B 2DWYA 2QQNL 3AG3B 4JHAL 4OI7A 3S4SB 4R4FL 2R83A 5A2BA 5CILL 4DF9A 4JCWA 4LCVA 3UP6A 3FT3B 3GQFA 4OLYL 4HHAA 35C8H 4KI5F 3KWWB 5DC4B 4X7SL 2ITFA 3GMNA 3RKDD 4ODTH 2E6JA 2F9BT 5I1EL 5HHPA 2EVIA 2WWMD 1N5AA 4WI2A 1J12A 1UVQA 2DQDL 4EKJA 3DHPA 4Z7QF 4KK6D 5HDQL 2OK0L 4QRSB 2NSMA 2XNAB 2PPDA 5D7KE 3FFOA 4JDTH 2XBDA 5IOPA 4LAJH 2OMWA 1YN7A 5D2NB 1UB5B 1AZUA 1NC4B 2KLTA 4MXVE 3MUHL 3PY9A 4X9FA 2XTLA 3QZOA 4POZD 2FWSA 1KTDB 1J5OH 1J10A 2ZOUA 1B4JH 5T1LB 3N1MC 4XNDA 2ZUXA 5IMLB 2BVOA 2WQAA 4EN3D 4XNMB 1PG7W 3RILA 2EILB 2Y25A 5F9JA 2W1NA 1FCGA 1XDTT 1NCDL 1WAAF 2IBZX 2EYRB 3HBPA 1UT1A 1ZXQA 2GAZA 5IK3B 3U79A 3P4LA 3QW9A 2J5LC 3R06A 3NRPA 1GL4B 4HPYL 5LHDA 5C0JB 2OX5A 5JIMA 1JF1A 2W81C 5DZPA 4TQ8A 2XWRA 1KG0B 1J1OH 2NY3B 3AREC 3NJVA 1N18A 3T8VA 3D3VE 3EO1A 1VAHA 2B0SH 2R0KH 4LEXH 2COVD 1ZS8B 1A6ZB 1IM9A 1EGJH 2Q7AA 4PW9A 4H1LH 2EP6A 3QIWC 5DVOA 1J11A 4PGEA 2MTPA 2Q5BA 5I15L 3L3JA 4N26A 2XTJE 4ZOEA 5BZWA 4MMZA 4ENEC 1N6VA 1U8MB 2BCKA 2J21A 3GSVB 3HE6D 4MQTB 4WWKD 4BKLA 12E8H 2VERA 2G4EA 1IGJA 5C6PB 2WIIA 3VJ6A 1JPSL 2OXHA 2J6EH 3TJEH 5IQMA 4HQQH 2BNRB 3KPRE 4YBLB 1FYTE 4MB3A 3MRGA 2ZX6A 1KLUB 3NFSL 4QHMB 3RVVD 3QPXH 4GBXA 1HZLA 3EDEA 4P2RD 4B9CA 1OW0C 1WZKA 5GGVL 4B9KC 5IQ7L 4CN4A 4TTDC 3PS6A 4MSWB 4Y1AA 1HXYA 3OKOA 4Z7NE 2QADB 1SPDA 4UB0L 4R83A 4FFVD 5DLMH 1GOFA 4AYEC 4HKBA 4XVUC 4XR8C 1I31A 5HDBF 3QEQB 3DGDA 2J8HA 4MZ3A 5D71L 5D6CB 3L95B 1FE8H 1XCTB 4LASH 1J48A 2FQEA 4HIIB 3VSTA 2COQA 2DTML 1QBLL 5DHYA 4O51A 1NCOA 4LDEB 5A2FA 5CMAB 2OMVA 2TSBA 4NO0A 4NEHB 5HI4C 3O3BB 1BFOB 4LLWA 4TF4A 2DLFL 2F19H 1MCIA 3PWUA 1QEWA 3SZ6A 2ADGB 1Y18A 3HG4A 1HILA 4JRYB 1AXIB 4Y1AE 1CGSH 1M1XA 4L4VA 2G2PA 5SWZB 3T6ZA 4H0IA 4R7NA 3P9WB 2LOEA 1V7NH 1N8ZA 4K23H 1ZTXH 3V0VA 4LLYA 5IV2B 3KJ4B 2CZNA 2DOCA 4Z0XB 3HC0B 2GEQA 4IRJC 1NWOA 2MJWA 3NA4A 4Y5VB 2ZKYA 2APXA 2YD9A 1TQUA 1R24B 1L6ZA 1KACB 2DAVA 4ODHL 4OZFG 3OR7A 3LZQA 2V6HA 4ISVB 2HLEB 5IMKA 4BELD 4Z3TA 1UASA 1OT1A 4CJ1A 2ALWA 1XIWA 3VA2C 3Q01A 3WXVH 2CO7B 3QDJE 1LXMA 2GITB 1QRNE 4S1RH 4HK0B 3G6DL 4XPFH 5AOMA 5FM4A 3W39B 3QUKA 5ICYA 3D2UD 1IEAB 4MB5A 3GMQA 1P5VA 3IRPX 1W8NA 4L4VE 4O2FB 4WW2B 3FK3A 2EJ1A 3JWDH 3H3KA 2L7JA 4PHXA 4GUPB 5F6HI 1OCCB 1T21B 3SJVA 5I9QC 2VXSH 1IZKA 5EOTB 3ALXA 2KHAA 3T0EA 1BQRA 4H8PA 1C5DA 3M1CA 4U6VH 1G84A 1WP6A 1I1RA 2BY0A 2VDLH 3RWCB 3TT3L 4GJTB 2F61A 3CTTA 4O2CA 2EDWA 2DQHH 3S3PA 3V7AE 3FT2B 1BHGA 5GXBB 2VQUA 4GUOA 5IT2H 2VJ0A 4HKZB 1YO4A 2M1KA 5B1JA 3MYJB 3VRIA 1YA5A 3TN0A 2NXYC 4YE4L 5C0IB 3RBSA 1UOLA 5TQ2H 4AQ1A 2PCFB 3GLDA 3NSYA 4K9JA 3RU8H 3MOAL 5I30H 3N44B 1X6NA 5FWQA 3C5SB 1KGXA 3BFWA 3DXAD 3VXSA 3WS6C 1PZUB 3BLKA 3PWPD 1CLZL 1ZLUH 3ZDZF 5KVEH 4AOFA 2IPTL 5CJXA 3ZGHA 4XN7A 3OZ9H 4A63A 3MNVB 1A1OB 1BVZA 3SJVE 4ELDA 1M4KA 4R26L 3PP3K 3RPIA 1MRCH 1E6JL 4J5VA 2G0LA 3NAAL 1A4AA 1XEDA 1A4KA 2ZUVA 4EUPG 5L6YL 5FGRA 1CTOA 1FLTX 4I0KA 5ES4B 1U8PB 3SY0B 2XG5B 5J6GB 1FIEA 1ZLVH 1HH6B 4I3GA 3HOGA 1OPGH 3HAEB 1U8IB 2D7PA 2EE2A 3VCLB 1C08A 1NJ9A 1MXDA 1N6UA 3P30H 4PJGA 5HBBA 4BINA 3BVVA 4CMMB 2FX7L 1FZJA 3MXVH 1BYNA 3LKPB 3OHMB 3HUJA 3QISA 4F91B 2E7MA 2ZYIA 3ATEA 1UEMA 3CPLB 1U3HD 1SUHA 3HKZA 4KJPD 3VXSE 2LABA 3OC5A 5FC9A 5KJRL 2XG4A 1OCOB 2BMKB 4FQLL 4MNGB 4PRHA 3EDKA 3LHPL 4FCAA 4UMGA 4Y4KB 2AJ3B 1HCYA 4PG2A 5D7EA 1S7UB 5T1KD 2YOAA 3WKMH 4KXZI 3AABA 3ISRA 5I1AB 3J27A 2IGFH 3U0TA 3FO2A 1NUFA 4UI2A 5E03A 1B0GB 4R84A 4LPXA 4W9EC 4FXKA 2SEBA 1BOGB 4PJ7B 4YLQT 5HVHC 2ZWLT 3ZHFA 2ZOLA 1U8HB 1X5FA 4GKSB 4GSDL 1MXGA 5HGHA 5IMOA 2DM3A 4NQXA 1U92B 4KY1H 2QZ5A 4NRYA 4OZIA 2BRRH 2Q1EA 1NDGB 2WWNA 1FNSL 1E4KC 2OL3A 3BAXA 4MJIE 1QPPA 1ZWIB 3QI9C 4PRHE 1SYVA 2CRZA 3LEYL 2NW2A 2ZCLL 4YHLH 5CCKL 1E4XH 3UOAB 4M62L 4F8TA 3QQ4B 3DX8A 4Y5YB 5E5RB 1FRGH 2B1AH 3IN2A 4F15C 4NQCB 2FLMA 1WG3A 4R0LC 3V4UL 1OAZH 3UPRA 2FLBT 2X9YA 2QPDB 4YSDA 1KJ2A 2P7TA 3MCKA 3Q2VA 5GZNA 3EOBA 3U48A 3GSXA 4DHLA 5K5YA 2X4SA 3SGJA 4AYDC 2FEEL 3O4LA 2VZTA 1N68A 3TOPA 2CIKB 3QUZA 4HGWB 3UTSD 4DUVA 5E6RB 4LIQE 3QDMD 4OZIE 1KCUH 3MRNB 2ZYRA 2HKHL 5JW3L 5CEZH 2W0FB 4HJ0D 4Z9KB 1ID2A 3B43A 2BW5A 5IHHA 2RCSL 4X42A 3QDGA 3ABGA 2N4IA 1WGVA 2V3DA 4MZIA 5I1JL 3QIBA 3DX7B 4NKMB 3AQXA 2WXOA 3ZHLA 3HRZB 5D5MB 1PIFA 1XF3A 2K4WA 3ZX1A 5HD8D 1UWEH 2BOCA 4IU3B 2VR8A 5FW6A 4YXLL 1MAJA 2WLNA 1A1MB 1OCZB 2VLRD 4NIYE 4AZ8A 3P4NB 1YNTB 3CZUB 1SHSA 4OLWH 4CC0A 2YD1A 2VMFA 4KXAA 2DH3A 4OI8A 1FNFA 1QLEL 5FF6A 1K2DB 4YFDB 4LKXB 2DI9A 3R7QA 3O4LE 3X13B 1IL1B 3Q2WA 1NFDE 3GMMB 4IIQC 1XGTB 4LESA 4GRWE 3LQAL 4U4BA 5JW4Q 5LDUA 4NWTL 1FJ1A 4N1EA 3T0AA 2IQAA 2FSEA 2GJZA 4O00A 4ODSH 5TE4L 3BUYB 3BW9B 4XPHH 3TBSA 3WHXB 3UDWC 3EOAB 1CD8A 5EU5B 1E8ZA 2AERT 1A7PH 2X3BA 2ED6A 2EEBA 2HXAA 5E5MB 3SO3C 5I1HH 1I8LC 1PSKL 2OZ4A 5AD0B 4DP1X 1YZZA 1QSZA 3UJTL 3EH1A 2FWOA 4BA0A 3MO1B 4OUUB 5EIVA 4FFTA 2IOMA 2UVFA 3B37A 4ODVL 4LOEA 4RWYH 4BHUA 2GSIA 2BHZA 4G8GD 4PR5B 3LH2L 3B9KD 5FM8A 1EZLA 4FNSA 5EO0B 4UINL 4JRXA 5HYSG 4UQBA 3BGFB 2OL3L 2OLDA 1MREL 1UD5A 4PS4L 4ZFZA 5AUMB 1WFMA 5EBWA 4FA7B 3VFGH 1NBYB 5IEKB 4GFTB 1XCXA 4KK8C 2QMKA 4ELKA 4DUXA 1S3RA 4AUYA 1CF8H 4HIPA 3TWYA 1A6UH 3BFQG 5GRJH 2Q10A 4FTVB 3WFCH 4PRBB 1IQWH 1ODUA 3ARDA 3G5YA 3L9RA 3CFKB 4I87A 2E56A 4BZ2H 3VFTB 4L3AA 4QIRA 2WXJA 1BZEA 3PJLA 3L1OL 4FHKA 1VDGA 4AUJA 5I1DB 1AANA 3QUXC 1KJ2L 2R0WL 3S6CA 3UG4A 2RAMA 4GS7C 3OF6A 4JQIH 4C47A 2KERA 1RZPA 2OSYA 4FDWA 3VD2A 4TQEH 2UXVA 1L9RA 2XA8H 4XCEA 5HPOA 2X4RB 2Q86B 1N67A 2J43A 3K91A 3T04D 1KWGA 4K3DH 4K3JL 1NCHA 4JRXE 2J7LA 2X4QA 5D7IB 1INQA 3FQUB 3PQYA 5ALBH 2DWEA 4TSAH 3PJSA 2HRPH 1UJTA 3ZQ9A 3SDCC 1BMWA 5HHXL 3MLUH 3OAZK 1DBAH 1OTUD 4A7VA 2DB8A 4IBTA 2Z8WC 5JXED 1HWHB 3D4GA 2P5PA 4XBGA 4MMYB 2VL5A 2ZG3A 4EI5C 2JJVA 1BVNT 4FFZA 1DANT 2LVEA 3ZVVA 3WTYA 3ATBA 3O9WD 4Y9CA 1EFXA 1GYWA 4PRAB 4KO6A 4YC2C 4KKPA 1N64L 3S4SA 5GPRA 1OAKH 5L88H 5B3SB 3UG3A 3U4BH 2NY6C 4NENB 4PB0L 4KQ3L 2ZAHA 4H20H 4J3OF 1H6FA 1Y6KR 2R4SH 4MJ5B 1DEDA 1T20B 3FTXA 5HI5D 3KWWA 1WHPA 5GSRB 3IRCA 3GI8H 4YPGA 1LM8V 3P02A 1UD6A 3ARFC 4PGCB 1T04B 4P46C 1VGEH 2PW2B 3KPQA 3SDDC 5ACLA 4X7TB 4ZJ9A 1XCQA 3S96A 4G8AC 3NSCA 4PJ8D 1PEZA 5EZJB 2XNAA 1OSPL 5DQDH 3QUGA 4WO4B 5D7SH 1QACA 3MV9B 5D2NA 1UB5A 1XAKA 4WU7B 1BPVA 1JCVA 1BGXL 1NC4A 3EOTL 5C9JB 2OZ4L 5EEVA 1KTDA 1C8QA 5HTSA 3CQQA 1U2HA 2UUDH 5IMLA 1BD2E 2C4XA 5ITBH 4XNMA 1UWYA 4GQQA 1PZDA 2A6IB 2PWEA 4OZ4B 5TE7L 2EYRA 1DSFL 2ZCKH 5IK3A 3RGHA 3PL6B 5D7JD 5DEZA 1F4WH 3KVPA 3PIQB 1W16A 4R2GC 5CSBA 3KYNA 5C0JA 3FO0H 1H8NA 1OTSC 4D3CL 4D8PB 2BP0A 3TP4A 3PUUA 1JDCA 3CXDL 1JGDA 2Y1YA 1KG0A 2OMZB 3LCYA 2CKBB 1I1CA 3GRWH 2ZWSA 3UBHA 4XP4L 4A2HA 2NLJA 1MHEB 2D3JA 3K5RA 4J28A 4U4IA 1T1ZB 5HVGB 1ZS8A 2LLNA 3LSOA 4I2XB 3EYSL 1G7QB 5D2NE 1KUMA 4UILH 3SQBB 5JDJA 1M42A 1ZVNA 1UCBH 5C6TL 3L7FB 4XRCB 3VRLF 1W2KT 2CLZB 4GRMB 2A99A 1KPVA 3F7QA 1HYSD 3HC2A 1U8MA 3QJHB 4BGDA 3HNVL 4K5OA 1M2VA 5EF1A 4W4OA 3L54A 2DMBA 4FQ2L 1TFPA 2D3NA 1KFAH 2OTWB 2WTOA 3HPLB 3VWJD 4YHOL 4M9OA 3GHPA 3DKHA 3Q48A 3NJNA 4HOWA 4LP8A 1KLUA 4QHMA 4DPBX 3LN5B 3LN4B 2J2ZB 2YD2A 3S88H 4Q9QH 5GISL 2E27H 4LEEA 3UCRA 2WKGA 4R4BB 4MSWA 4AI7A 3L3OB 1OAJA 5EMYA 1RCYA 2ZUQB 1NCNA 1EHNA 3EHBB 2QFRA 3K8MA 3LIZH 1NA8A 4KK5D 3ZT6A 4A7TA 4TOYH 4H8QA 3QEQA 4UOZA 3HE7D 1JNNL 3B3IB 3G08B 2J1YA 5D6CA 3L95A 4HIIA 4GXUM 2EH7H 3FFCA 3I85A 2JCWA 1YEHL 2DW5A 3O2DH 1K8IB 3O3BA 1PG7X 2BNRE 1TTAA 3C2SA 1BFOA 1KDJA 3H9SD 3HCVB 3K72A 1D5IH 4I7ZC 3QT2A 4IRZH 1JPGA 2C1OB 3W11D 1U33A 2HVKB 4P2QD 3Q9QA 5E56A 2K4AA 2ADGA 4L3FA 4IHOB 3GJEB 3GMLB 3MFFA 4HS3B 4P23C 2CD0A 2E76C 5SWZA 3OAYK 3D18B 4WSKA 3L13A 1ROCA 3KYAA 4HEME 4EN3C 5IV2A 3LRLA 1NGYB 1I9JL 4JFPB 4M4PA 3RUGB 3U9PL 2X53A 3L5XL 2XY1A 4Z0XA 3HC0A 5K1JA 3SE9L 4ZPVB 4PVLA 1EHKB 4Y5VA 2XZCL 4R3SA 5C71A 1XH3B 5C0AB 3RJQB 5HDWA 1F3JA 1XF4B 3IRZA 4J27A 1R24A 3VXRD 3UAJC 3LZFL 3DNKA 4FN0A 1ZGLB 1HQ4B 1IC7H 3WY4A 1EUTA 1RMFH 4LHQB 2CCVA 5DRZB 2CO7A 1PZSA 1YYMH 3AB0C 3LD8B 2GITA 3QXVA 2RGSA 3PGCB 5HHOB 5C0BB 4HK0A 4M6OH 3W39A 2APFA 4XNZB 2FX9H 3U2SB 2MQGA 1IEAA 2O6CA 1AS6A 4Y16D 5I66B 4YUEL 4JRYE 4GG8B 4O2FA 5SWZE 4WW2A 5DO2D 4NQVB 1H6TA 4GUPA 3VUAA 1T21A 2YHGA 3E8UH 4JANB 5CKAA 5EOTA 1EXUA 1NICA 1OPOA 2E9WA 4LOFA 1LWJA 4Q0XH 4XWGH 3ZDYF 2WLMA 4FG4A 3RFZC 1IAIL 2VRKA 1LGVA 1QD0A 1P9MA 2OJEB 4WFFD 5KYNA 2P47B 3FT2A 1OAYH 1SMDA 4IM8A 4M3KB 2ZX8A 3ULUC 2FWUA 4JHZA 4P2AA 2WN3A 5JHLL 1F00I 4K9EL 4W9LC 1GH7A 4WENB 4AYBA 3F6JA 5AAWA 1DEEB 1EVUA 1MVFA 3MRCB 2X12A 3ZGIA 3RE0A 4L9LB 4PWJA 4XXCA 4PU2A 3CLEL 5E2UL 3US9A 8PAZA 1WAEA 3HE6B 4WWKB 3CNKA 4AQEB 2XOTA 1QW8A 3PYCA 4Q9CA 5CS7A 4LL1A 3JT0A 5C70A 4MQSB 1CO1A 3MNVA 1A1OA 3FQWA 4B96A 3FF7A 3ZTCC 2IH3B 4OCRH 3Q2NA 3MLYH 5IB4B 1V27A 4XO9A 1KN4H 1CI5A 4XP1L 3SYPA 4LF3B 1G9MC 4FKEA 2WKOA 1Z3GL 3AUVA 1A3QA 2Q7NA 1A7NH 4CVUA 5GRUH 1SF5A 2XG5A 5J6GA 1PL3A 3I74A 4FCHA 1KOAA 4ZFGL 1HH6A 1TTRA 4MQXC 1MFEH 1PCSA 5DD5L 1U8IA 3JV5A 1ZEAL 3VCLA 1NKRA 4QWWD 3HEIB 4J12A 2CJUH 4QXTB 1CTMA 3GB7B 4CMMA 3LKPA 4FKHA 1WA0X 4NN5C 2NYYC 3CPLA 4G6KL 4OT1H 4N2DA 1IGYB 5CEZD 1JFQH 5DDHB 3MJ9H 3N1PC 5KVGE 4TPRL 3TT1L 3U7AA 1GTFA 2BMKA 3NJGA 4RH4A 4E36A 2AJ3A 3ARBB 3GDCA 1S7UA 3PGDB 2V0AA 2WCSA 2YEZA 3OKLB 4I1RA 4L29A 3ATFA 3FO9A 4ANWA 5LKNA 1YMMD 2H1LM 4HS6B 3KW8A 1GYVA 3P40A 3MA9L 4CVXB 3RZCB 4BUGA 1B0GA 3BESR 5ICZB 4M7LL 2WP3O 3VWKD 3P0VH 4YK4C 3H85A 3CHPA 1BOGA 1TG8A 1JTOA 4L8SC 5DUPL 4IKIA 4PJ7A 2ZJSH 2P43B 3QIWA 4GKSA 3Q1SL 4FLSA 2Q8AH 3BLPX 3N85L 4FYQA 1NDGA 4KQ4H 3SKNB 2EDJA 1Z0MA 2KMWA 4XOBA 2V7NB 1NFIA 4GSUA 1Q4NX 4NQSB 1A6VL 4JJ5B 1GGIH 1ZWIA 3TH3T 4JAMB 4MNGE 3GT6A 3CFMA 4X6DF 3T5WA 1L3WA 1G5GA 2HG0A 1P7HL 2C3HA 2G9KA 1MCEA 3QQ4A 4Y5YA 5C0DA 4HOMA 3M88A 4F80A 3F6IA 3D2UB 2EADA 5F9OH 1MFVA 4BXVA 1H6UA 4ZXBD 2H26A 3QORD 4PW3A 4ERSH 2GKIA 2IDUA 2VXQH 1HL4A 4PJ7E 1A14H 1YNLL 2BS71 4PTTB 2JTYA 2DS4A 2CIKA 4FHBD 5CN2A 3MRNA 5GGQL 3DGGB 3ULVC 2D03H 1SYSB 5I74B 2NXZC 3MMEB 32C2B 4PI0A 1JZ7A 3H6AA 2YPLB 4OFPA 5CF3A 3V0WL 2M8XA 4S1SH 3DX7A 4B27A 4NKMA 4YVNA 3OGCB 3HRZA 4MB1A 5D5MA 5CINL 1FL6B 4JDVB 5FUZL 2DQIH 2LU3A 4JY4B 4G71B 3WTWA 4IU3A 4M6MH 3S2AA 5SWQB 4NQCE 1LO2H 2XIDA 1A1MA 1A7QL 2B3RA 4ADIA 4JPSA 3P4NA 1YNTA 2PWGA 3PWPB 3V4VB 5DO8A 5AOJA 1B0IA 1HHGB 4HS8H 5EIIG 5FYKD 4ZMTA 1ZGLP 4HXAH 4XVTH 5I8KL 3X1NA 4DN3L 4E9VA 1S7TB 4OCWH 2VZSA 3L9EA 4LKXA 3FU8A 1L9QA 3IDMB 3ZYJA 1IL1A 2FJFB 2PO6C 1ONQB 1CYGA 3GMMA 1XGTA 4JLRB 4J3VA 5ITFB 2EZ0D 1NAKL 3ZZSA 3ESMA 2RD0A 1F8TH 5BZXA 2DQFB 1NL0L 1KB9K 3V6OA 4UIKL 2NX5B 5SX4H 2LU7A 3BW9A 3QWRA 4N2KA 4YN3A 1OTTC 3WHXA 1J5IA 2QQQA 3EOAA 5EU5A 3RI5K 5DK3A 5T8IA 4QY8B 4UQ2B 1G4MA 2OZNA 2QT6A 3B56A 5E5MA 3AROA 5D5ME 5AOZA 5ILTH 3S34H 2XXMB 3VX0A 2V5SA 4G11A 2JJTA 1PLGH 3MO1A 5J1SC 1K85A 2W07B 2JJUA 3KJ6L 4GNKB 4LT7A 4PR5A 3NDYE 1G6VK 4CN1A 1DZBA 4FQHB 4FNTA 2IDQA 3K81A 1TYRA 5AUMA 3B1UA 2G0KA 2N0MA 4QT5B 4M02A 4E5XB 1NBYA 5IEKA 4MA7H 2YKLH 4TNFA 4YDIH 1Z2KA 4G3YH 4PY7A 1MCPL 3GBML 4FTVA 4U3SB 1JHKH 4JPKL 3V6OE 4CSTA 4X8GA 5ANMB 2XN1A 3FUHA 3PWJA 5D6DC 1HCZA 4C8XA 3CLWA 4HBCL 3LXAA 2RR3A 4WUUD 3VXOB 4XMWA 5AB1A 4KZDH 3QIUC 2BSSB 1MRFH 4HMCA 1MZZA 5IB1B 4RWHA 3P1VA 4HKXA 5D1QD 3DPDA 5DF0A 3WXWH 2X4RA 2E47A 1CYWA 2Q86A 3ETBJ 4AEFA 5DZOA 5F89B 1LMIA 4GIPD 3CVIL 4DO4A 5DXWA 4P49A 5E2VL 5D7IA 5FA4B 1HKLL 3FQUA 3NIDE 1RIVL 1UFGA 1UJ3C 3HZMA 3MV01 4G59C 4KZEL 4K07A 3UJJH 1G7HB 3L8QA 2F54B 5D55A 1L7IH 4NM8H 3TV8A 1G7PA 4PRIA 4FTVE 4H0GA 3BVNB 4NP9A 4M29A 4OCLC 2XZZA 4HGMA 4KWUA 5J0BA 1DP0A 1FLRL 5C07D 5IQLA 1PAZA 4P0DA 5BO1H 2RJMA 3C5ZD 2Q3XA 5DA0B 1P69B 3TFBA 2WUCL 2DY2A 2B5IC 3UTSB 3QDMB 4NENA 4RZKA 5D72L 5AAMA 2GI7A 2DLEA 4P2OB 1J8HD 4MJ5A 3A6OA 1T20A 4MVBD 3GSQA 5LNGA 1MFAH 5GSRA 5BJTB 4CMHC 3QXWA 4LLUB 2YD4A 3C6LC 3H42H 1W0VA 4PGCA 4KK9D 1T04A 1AOHA 2MCPL 2PW2A 3CVCA 1PX4A 1DQTA 3WE6B 3ZHKA 2D31A 4HEPG 4Q74A 1J1PH 5D7IE 4X7TA 3QFJB 1HXKA 1MHCB 25C8H 3C8HA 5EZJA 2IH8A 4ODXA 4JFSA 4WO4A 1EEZB 2V17L 2VLRB 3MV9A 1JVKA 3H9ZA 4WU7A 3WSQH 4U1HB 2A5UA 2VZ3A 1BZ7A 4PJGF 5DFVC 3T2QA 3AS1A 3GIZL 5C9JA 3ZMRA 5E2JA 3WIFB 5CBEB 5JPNB 4M03A 5DK2B 3U83A 1OF0A 2IEPA 3QCUH 3MRIB 2BOBB 1RI8A 4PP2A 2R23B 4OGZA 4W6XB 5DRNA 4JY5H 1E4KA 1D6VH 2BFVL 2ODIA 3FF8A 1H8LA 3JUYA 3PL6A 1LQSR 4JHVA 5TFSH 2KLSA 3TASA 4AW7A 1IKNC 3PIQA 4PI2A 4GINA 3RJDA 4B95C 4PJXF 1J1XH 4U6YB 4I18C 4D8PA 2FEDD 4KKAD 2FHFA 3CVHB 3I6GB 2OMZA 3IGAA 2P28B 5D4QA 2F5BH 4R7XA 2H32B 4TSBL 2CKBA 5HJ3A 4R0LA 4TNEA 2YAHA 5C92A 1MHEA 1TZAA 1T7ZA 3NJJA 1E67A 2DRUA 1T1ZA 1UT9A 2GC4C 3MV9E 4I2XA 5EEZA 2HT3C 5KN5B 4HLJA 3B9KB 4DKTA 4LPVA 5E8DL 3L7FA 4XRCA 4RRPA 2CLZA 4GRMA 2IANB 4MMXB 2KPWA 2VZUA 4NN7C 5EZLB 3PXLA 4KFMA 5GRWA 3QJHA 3UTTD 4FP8H 4WNQB 3L4ZA 2HP4A 2OTWA 5CO1A 5FK9B 3RVTC 2CUMA 3AFLA 3HPLA 4PJFA 2IC2A 2VSKB 3MV7D 4MJ6B 3GUTB 2K0RA 3NCMA 3PWLB 1F3RB 2FECI 5ID1B 4WEEA 5JHDB 3VNZA 3A0OA 1OXYA