2IDSA

Structure of m98a mutant of amicyanin, cu(i)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Amicyanin
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idsA00
4FA7B 4KO9A 2IWEA 2XVBA 4HIPA 4UF7C 3X1BA 3FPXA 3NP4A 4CSZA 5I6KA 2XWZA 2GBAA 7PAZA 1CYXA 4YSRA 1AIZA 3ZIYA 4HCIA 5B1KA 1L9RA 3QJRB 3AG3B 3FQ1A 1NWOA 3FS9A 3WNIA 2PCYA 3NSFA 4HHWA 2WO2B 3FYEB 2YAQA 4DP0X 2LLNA 1NIAA 3ZDWA 5IY5B 1OCRB 1W8EA 1AG6A 4MFHA 4HZ1A 3WG7B 3RYMA 1SJMA 1KBWA 3UADA 1E30A 2W8CA 1JZHA 1AZRA 2CCWA 4A2EA 2XV3A 3PPSA 3NJKA 2VW4A 5LDUA 2AVFA 3FU9A 4YSUA 3X2QB 4YVUA 1BEXA 4KOBA 1GSKA 1URIA 2CUAA 2DYRB 1MZYA 2YAHA 4AKOA 4BWTA 4F7KA 1AOZA 4QLWA 4BK5C 8PAZA 1ASOA 1YLBB 1E5ZA 1ZDSA 3ABGA 5B7MA 2WO3B 1MZZA 2XX1A 4KO6A 1A4CA 1AZNA 3SBQA 1BQ5A 4G71B 2IDQA 1ADWA 4N4YB 3S3DB 2MTAA 4YSAA 4A66A 1CUOA 1L9QA 3IN0A 2IAAC 4G7QB 1ID2A 3NJJA 2FQFA 5I6OA 1GYCA 1PNDA 1WA1X 2DYSB 2J56A 5F7AA 4DP1X 4UAHA 3NJHA 1A3ZA 5I6MA 4WKXA 2ZXWB 5A7EA 1NIEA 4JKNA 4YL4A 1GS6X 5B7FA 1BAWA 3QQXA 4YVNA 2FQGA 3OMAB 2PPCA 2N0MA 2HZHA 4L0PB 3FQYA 2GC7C 1JXDA 1J5CA 4X4KA 2Q9OA 1PMYA 4DPBX 2VM3A 3NSCA 3QPKA 3S8FB 1GW0A 1OOWA 1XB3A 3OMIB 1HAWA 3CDZA 2VSKB 1J9QA 3ZX1A 1KGYE 1IUZA 2TSBA 1NPNA 4E9YA 4AKPA 3FSVA 4NAJA 1WS7A 2HRHA 2HX8A 3EH3B 3TU6A 5TK4A 2BP0B 1CURA 1JZFA 4YSCA 2IH9A 1BXAA 3FU7A 2BZ7A 4YSPA 2AZUA 2Y69B 1EZLA 3DTUB 5I6NA 1E5YA 3FT0A 2FQDA 4HAKA 2XUWA 3JT2A 3WKQA 1NWPA 2E86A 2TSAA 3NJMA 5PAZA 1WS8A 1PLCA 3QJUB 2P80A 3N2JA 1ASQA 1KBVA 5I28A 1J5DA 3OMNB 3TBCA 1L9OA 1M57B 2FT7A 3IE9A 3D12B 1OE1A 3NSYA 3V9EA 1BXVA 2CJ3A 4ENZA 1OE2A 2BWDA 1NICA 5AZUA 2HX9A 5E9NA 1OCZB 3OM3B 3FU8A 1IC0A 2QPEB 2XXGA 3CVDA 2YAFA 1WA2X 3BVDB 4BDVB 1GY1A 2XXFA 1PAZA 2GB2A 3C75A 2YAPA 2EILB 4G7RB 2BP8A 3X1GA 3H56A 4E9TA 1ILUA 1JZGA 1X9UA 3EH5B 5I26A 1TKWA 3H4HA 5B7EA 1SF5A 4HCGA 1KYAA 1QLEB 2GHZA 4A67A 4CSPA 1JXFA 4ZK8A 2UXGA 3IN2A 1NIDA 4AZUA 1ILSA 4G70B 2JKWA 4AX3A 4EF3A 3AW5A 1B3IA 4KO5A 1AZBA 2MRYA 4Q8BA 4YSOA 3WI9A 6PCYA 1NZRA 3NP3A 3IEAA 2CBPA 3PCYA 4A68A 3L45A 5I5IA 3KW8A 4K9JA 2HLEB 1AS7A 4F2FA 3UGEA 3WKPA 3FSWA 1HAUA 1DZ0A 2WSDA 3ERXA 1PZAA 4DP5X 2BHFA 1GS8A 2JXMA 3AZUA 3QJQB 4M3HA 1JZEA 1BYPA 4DP7X 5D4IA 1OF0A 2BO0A 1RZPA 3AG2B 1KV7A 2BW4A 2PPAA 1J9TA 2FWLB 3S3CB 1JZIA 3FPYA 3ASNB 3OD3A 4GY4A 2XLLA 1GY2A 4GYBA 5D4JA 5PCYA 1TEGA 3KW7A 3SBRA 2IDTA 2CALA 3QJSB 3TASA 2BW5A 1PNCA 1V10A 2XYBA 2IH8A 4E9VA 1ETJA 2XU9A 4N8UA 2B3IA 1XB8A 2BZCA 1NIBA 1UATA 1PZCA 3HB3B 4A2FA 4Q89A 1KDJA 3DKHA 1KCBA 3G5WA 1RZQA 1GS7A 1V54B 4KNTA 4GP4B 2IWKA 1KCWA 3CZUB 4F2EA 1MG2C 2IWFA 1AZCA 1NIFA 4A2DA 1SFHA 2P80D 1ET8A 4DP2X 1L9PA 3SBPA 2PP9A 4GP8B 1F56A 2GC4C 1QHQA 3V9CA 1GR7A 4HALA 4P5RA 2YQBA 2IDUA 3DIVA 3TBBA 2VSMB 4NERA 1XMEB 2FT8A 4E9XA 2ZWNA 3N55A 5AKRA 2BP0A 3AG4B 2R7EA 1JXGA 1VLXA 2OV0A 2UXVA 1KDIA 1X9RA 2JFCA 1ZV2A 3CDZB 1E65A 1RCYA 2FQEA 3PAUA 2NRDA 3FSZA 1L9SA 1JZJA 1DYZA 2B08A 3OQRA 3NSDA 1BXUA 1QNIA 2AZAA 2I7SA 2X88A 2ZONA 1AS8A 1NPJA 2AFNA 4QKTA 3T6ZA 3T6XA 4PAZA 1SFDA 1TU2A 3FU7B 5I6PA 2XV2A 2OJ1A 1V55B 1FFTB 2YXVA 1AZUA 3T6WA 2AANA 5D4HA 1ASPA 1HFUA 5EHFA 1BQKA 5F7BA 1BYOA 3ABMB 6PAZA 1PCSA 4A2HA 4HHGA 1OE3A 3PXLA 2FTAA 3TA4D 1N68A 5I6LA 1E67A 4KOCA 2QPDB 3NT0A 3QJVB 2QT6A 1SF3A 1I53A 1A8ZA 1SDDB 4YSEA 1PY0A 4GXFA 3X1NA 2PLTA 4JHUA 1PLBA 1ZPUA 3PAVA 1ZIAA 4TXVB 2I85A 5B1JC 3UAEA 2GIMA 3H4FA 4M4RB 1OCOB 1JVLA 1WA0X 3CVCA 3UACA 1WAEA 1TEFA 1AR1B 3X1FA 1ZDQA 3EHBB 3NJGA 2DWTA 3ASOB 4BXSV 3NJFA 2UX6A 2BP8B 2HXAA 2EINB 3NJNA 2PPEA 4FAAB 2BWIA 4E9QA 3FSAA 2A3TA 3T6VA 1J9SA 2FT6A 2EIJB 1CYWA 1A4AA 4PCYA 2XX0A 2QDWA 2VM4A 2GSMB 4YSQA 1OCCB 3X1EA 5B1JA 2DV6A 1L9TA 4KNSA 4P5SA 1A4BA 2OCCB 3PLYA 4BWWA 2FNWA 2YXWA 3MX0B 2EIMB 1JERA 3UAAA 1FA4A 1AG0A 1NDTA 4DP6X 4AI7A 2I7OA 4E9RA 2YAOA 1N70A 4HCFA 1R1CA 4RH4A 3GYRA 1ET5A 5I5MA 3AG1B 2PCFA 3CVBA 3T71A 2J5WA 4E9WA 4DPCX 4BWUA 1BQRA 1JOIA 3NYKA 3IBOA 5ANHA 1AANA 2PP8A 2VW7A 2XV0A 4BXVA 1RKRA 1CC3A 2ZOOA 2UXTA 1FWXA 7PCYA 4DP9X 1J9RA 5B1BB 2HX7A 4G72B 3GDCA 4UANA 4YSTA 3NJIA 2QDVA 1ET7A 5AFAA 1PF3A 2W88A 1EHKB 4GP5B 5I5JA 3QJTB 1MG3C 4E9SA 1M56B 3S3BB 1SHWA 4KO7A 3UABA 4WTQA 2J57A 4W1TA 4AKQA 1NINA 4YSSA 3CG8A 3WIAA 1PZBA 3T9WA 3ABLB 1W6WA 2H47C 5B3SB 1AS6A 5TK2A 2DWSA 4G7SB 1NTDA 2X87A 3WNJA 1AACA 1OV8A 1PLAA 1ZIBA 1W6LA 2PP7A 9PCYA 2R7EB 4DPAX 3EH4B 2VN3A 2PPFA 3SQRA 2DY2A 2H5UA 2EIKB 2IDSA 2RACA 4NB7A 2UXFA 3MBWB 1SHXA 2YAMA 4DP4X 1IBZA 3U25A 3FYIB 3BQVA 2FJSA 4KNUA 5B1AB 2Y1AA 1T5KA 2HRGA 2H3XC 4A2GA 3EF4A 4BDVA 4JHVA 1IBYA 1IKOP 2UX7A 4W9ZA 1A65A 1MDAA 2GI0A 2PPDA 1SDDA 3HEIB 1XB6A 3ZBMA 4DP8X 2CAKA 1AQ8A 2IDFA 2Q5BA 2YAEA 3ABKB 1M9WA 1AAJA 3GXUB 1SNRA 2VMJA 2J55A 3AY2A 3PAZA 5FC9A 2VW6A 3NJLA 4YSDA 3JTBA 1JVOA 3FQ2A 3S8GB 2YARA
chains in the Genus database with same CATH superfamily
4HH9A 4M03A 1T20B 4A2LA 4MSWB 2Y36H 1AQDB 1FFQA 4A7UA 3U0TB 4PRHB 3AG3B 4K7FA 3DMMB 2QQNH 3CZNA 5LG1A 4Z7UE 1AXSB 2VO8A 3AFLA 32C2B 2D0GA 3C8DA 3CH1B 2C7FA 1O6SA 4PCSA 2PKDA 4Y1AE 1TTCA 4OCYL 2AMUA 4U05A 1KN4H 2VTFA 3KYMB 4K5LA 1LM8V 2W0FA 1BV8A 4ONGH 1PZUB 3RHWF 4AQ1C 4JJ5A 3GIZL 4LLQB 3RVWD 4IIQA 4X9HA 2NXYB 1AZRA 2DYPD 3VM7A 5C09D 2I25N 1GAFH 3DIDA 3NJKA 2JSFA 3GIVA 4IS6B 1NBCA 2GTQA 2BC4A 5BO1L 5ADOH 2ESVB 3MZGB 4NSKA 3TWCL 4A39A 4IOIB 1U33A 5C0AB 4KJQD 4LPXA 2EE9A 2CUAA 3WN5A 3EUDA 3FRUA 4OGXL 4XXCC 1E4KC 2DICA 4NRXB 2C4FT 1OP3K 5AW2B 3B1TA 3UGUA 4KRPD 1MZZA 1AZNA 1PD1A 2RBLA 2YSSA 3MA7A 3NIGB 2IDQA 1LO3L 4ZPTB 3KPPB 4ZTOH 5C0BB 3JBG7 5EBMB 4EIBA 4YWGH 4EI0A 1L9QA 1TTFA 1S3KL 1PDKB 3IRCA 4PJHA 3D85B 1M71A 2WLLA 5C09A 2R0LH 3SN6N 1G6RA 5EWIL 3FT1A 3IWUA 3O4OC 1Z1WA 4OLVH 1U4FA 1U8QB 4G3YH 4IHOB 3P9LB 1BAWA 3T2QA 5I18L 1FVCB 2HZHA 3FRPB 3BZ4B 1P84J 3PWVB 4JO4L 2X6VA 3TPKA 2X70A 5DT1L 5AW5B 2NDFA 3NEXA 4Y9FA 4NPYA 5DZNA 1IM9B 2YKLH 2CK0L 3OMIB 4QF1B 4PIBA 5CMAB 2UY7B 3ECBA 1BX2A 3WXWH 4XHQA 5I2IB 2YEZA 1BGXH 4F93B 3CPLA 4J3OC 3NIDE 2BP0B 2Z91B 1UM6L 3HE7C 3LRGA 1H8NA 2DDQH 5AB1A 1KENL 2N7SA 3VE0B 1FGNL 5EU6E 2G9KA 1IAKA 4Z0BL 2CLRA 4ZOAA 1JHTA 2YK1L 2AXFB 3O9WD 2P4AB 4K8RC 1MJ8L 5D1ZC 3CXHJ 3IJYA 4DFHA 5HD8D 4P59L 4DW2L 4U6YA 1RUKH 2TSAA 4FQCL 5PAZA 3ULVD 2VCOA 4P2OB 5HYSA 4D0BA 3OMNB 4IRJC 1L9OA 5E9DB 4U1NA 4PJXE 3UGXA 5JORA 4ZD3H 2EDNA 4D8PB 2ADFH 3DUHA 4Z7IA 2YGNA 3EYOB 1KYOK 2YLHA 4MRBA 1XCQA 1YY8B 2CDFB 3M1CA 3MYZA 4HCRH 3EKCA 4KY1L 4NQCD 4UT9A 4QAWA 2TRHA 3VQLA 4DK5A 3TBWA 3O9WA 5D2NE 1LEKA 5AD0B 2VXSL 3TJHD 4DF9A 5GISH 5T1KD 3CN2A 3NZHH 3GMPB 2ITCB 4MASA 3PWNA 4PTUB 1HINH 4GS7C 5CEXA 4NOFA 2WXKA 2GJ6B 2OR7A 2K7PA 3G5XB 4W4OA 3M45A 2XY2A 3S4SA 1TKWA 2X05A 4E41D 1J5HA 2C9UA 1RK1A 4JFVA 2YZ8A 1XVSA 2OQJA 3IN2A 1CLCA 1E6JH 2JH2A 1P7HL 2A9DA 1XH1A 4FG6C 1OTUC 1WEJL 3WD5H 2CBPA 4CC4C 4DZBA 4KHTL 4YN3A 5T1KA 2IWGA 2R29L 4XNMA 1VFUA 3FU0A 4OY9A 2RCSH 4UMSA 1ZV5A 1DZ0A 3VYOA 2C26A 3SDXB 4B9PA 4OZIA 3WUZA 3K4DA 4X9IA 4DP7X 4IOIA 5D1QC 5C0AA 3HRZC 4WAFA 4E41A 4FNTA 2GJZB 3U48A 4FFZH 1X9LA 3HRPA 1SVBA 3EGSA 5CD5D 5EO0B 4HETA 1P4UA 2BH0A 1FH5L 4PJBE 3VB9A 2R8SL 2O61A 3AQXA 1BG9A 3ARED 3OB0H 1QP1A 1ADQH 1TZAA 3I9GL 4LF3B 3BP4B 3QJSB 5ENWB 5JOFB 1SOSA 2XV6B 2WZAA 1PDKA 3HN5A 5EC1B 4OD3H 5C70A 5IV2B 2VKWA 4LFHD 3BRGC 2AEIT 2XU9A 3DSFH 5D1XD 5AL8A 3RWGA 4XAWL 4HS3B 1NDMB 2ZKWA 2VR8A 3B37A 3FULA 3N44F 4JFTA 5JO5B 4NZRL 3HB3B 1U8QA 3EYUH 3DKHA 2R4RH 3P9LA 4PJGE 2ZOKB 1T03H 5CU5A 2OZNA 5I71B 4R4FL 4L8CA 4JFDD 2AV7B 2A0LC 2VDKH 4OFDA 3BAKA 3MJ6A 4AYFA 1YYML 3AREA 4MS6A 1KCWA 5JIIA 5I1HH 2DKUA 4XCNB 4Y5YC 3QQNA 5HGGS 1X7QA 1IM9A 4NQSA 4XRCA 3RB7A 2UY7A 2IGFH 5D1XA 3RIAF 3CZGA 3D2UA 4PHXA 5DD0H 5HHXL 5FB8B 4YE4L 2MCPL 2AXJA 4DZ8B 1TJGH 3ARDD 1OGTB 3NPZB 2BP0A 2Z91A 3KWTA 2RALA 5I8EB 3V4UH 2QADD 2OV0A 3CMOL 4UV4H 5HVWA 3MYJA 1SXCA 3V0WH 1KELL 1HKLL 1WP6A 4ZFZA 2GK0B 4JFDA 3B8SA 4EN3C 1Q72H 4F24A 2FGWH 2JI1A 1N8OE 4WI3A 4ZW8A 3C87A 4OCRL 2ZAHA 5GGSY 1NGZA 3FTUA 5C0CE 5D71H 2E6JA 5EZJB 4LNRB 2AFNA 2XZCL 3B4NA 4WV1B 2VE6B 2VH5H 4ZX4A 5HP5A 3U6RA 3HG0A 4TN9A 4D8PA 1P6WA 3KWWA 3LRHA 3QNXB 3A0OA 3ZO0A 1ZVSA 2P5WB 3PQYE 2ADGA 1YY8A 3SO3B 4NJAL 3AB0B 3ARQA 3SKOB 4CMMA 1NDGB 2AXWA 3GEFA 1UH2A 3RWHA 3ABZA 4BHUI 1T3FB 3OGOE 4LSRH 5AD0A 2VZ3A 1CBVL 1NFIB 3AQZA 5ITFB 3QFJB 3BSZL 4GMTH 3GMPA 2KZKA 2K3HA 1YEJH 4YHZL 1RJZB 1OAKH 1OHZA 3TVMC 1BZOA 4ODHH 1A7OH 3UEZA 1YEHL 3G5XA 4AQEA 2V9RA 5CFHA 1IZJA 2ROXA 4ODWB 4XBPB 5K5YA 4GFTB 4GW4B 5HJ3B 1P4BL 3MLZL 4EI6A 5I1CH 2K9UA 4OW6A 4HJJH 1BOYA 4ANWA 1AR1B 1HWHB 4DTGH 4EXKA 4J3WA 4JDTH 5K39A 4IBYA 2XI9A 3GC3A 1EUUA 1I7ZB 4APQB 2HXAA 5FO8B 1G7QA 3E6FA 4OM1L 1E6OH 5E4EB 3FDWA 2BNRB 4PRIA 3DUUB 4Y19B 4H5SA 4JFHE 4QWWD 4JFEE 5AENA 4AJYV 4PVBA 5HBBA 1HWWA 4HBCH 4LZKA 1FFNA 2EDMA 3SDXA 1T0NA 2E6PA 4NP4L 3TTYA 5IMKB 4AH2B 4OZHF 3CFJA 5FKAB 2ICES 1D9KA 4GKOA 1F6AB 5FHAH 5EO0A 2ZICA 5AKTA 3ZOAA 2XXCB 3CMGA 3VVWA 4KNSA 4G8IB 3MNZA 1A4BA 5DJYB 3ECQA 5E70A 2V2WB 5B39A 1DVSA 2WGXA 1TPXB 2JVUA 1XAKA 3BW9B 2YXWA 3EJRA 4JZJB 5J0BA 1TR7A 5EC1A 2D2OA 4BK8A 2OBGA 3GPEA 1LYQA 3SDAC 1XGRB 1DBKH 2W9EL 4OGYL 4YC2C 3BUIA 4OLXL 2ZSWB 1FF5A 4HWZB 3IPEA 2IVFC 1R1CA 4R96B 1SEBA 3G5VB 4J2XA 4PGEB 4Y4HD 5DRWA 1WAAA 3OAUL 3V0FA 4LLDA 3ZVVA 5BRZB 4N2EA 3APCA 1N10A 3UZQA 2PP8A 4LCWA 3IDNA 3CFCH 4WI2A 4XN1A 1LDSA 3CX2A 1TZIB 3BVVA 3QE5A 4M1DH 3DSNB 4XC1H 2E47A 2Y23A 4RBPK 2QDVA 5FOJA 3C5XA 7FABH 3F6IA 5AOIA 3UJTL 5IBTH 1M56B 5ETUA 1UWEL 2RHEA 2G5RA 2OMWA 4DGIL 3U46B 3QUKB 2Y7QB 4JCMA 1W6WA 5HGDA 2GK0A 2ENQA 3O41B 1G1KA 3T2PA 1MWAL 3TN0B 2BXYA 2K0RA 5I0VA 4PCKA 4X6DF 5IM7A 1ORSB 1TYJA 3DURA 4LRNH 1XSIA 2KL6A 1P53A 4YHLH 1BF8A 1BVZA 4XVSH 5GS0D 4LNRA 3GD1C 4XAKD 2XDHA 2VE6A 4CGUB 2Q3AA 2VLJB 2H0EA 4DPAX 4O2EB 5IVXA 3HW7A 1MIEH 1VENA 5DRXB 3SQRA 3ZK0A 2OMYB 3QHFH 5HHMB 4PLJD 2I5YH 5EUOF 4MHHG 4OD1H 1RY7B 2X2UA 5KSAD 5B1AB 4FQIL 5I73B 3G5YB 2WJ5A 1NDGA 3O2WH 1JRHH 5J1TC 4UZUA 2E4FA 2ENJA 2JJVA 1FNLA 1ZVNA 1T3FA 3M88A 4KY2A 2EE0A 4TNVK 3IJ7A 1NFIA 3IWVA 4A6YH 5HJGA 1XFPA 4NM4L 2HA1A 3KXFD 5I0YA 2OCJA 4IDJL 5HVGB 3L9YA 2DQFA 4BGLA 1RJZA 4HK0A 1K2DB 5C3TA 4DOHB 2IPTH 4PREA 4PWHA 4L3ED 2NNCA 4K94C 4BFEA 5I30L 3ESVF 4XBPA 5IB2B 3UC0H 3DDGA 3BWSA 35C8L 3UYRH 5KSAA 2FDBP 4RRPG 1AC0A 3BKJH 1MAMH 4JM2D 3UAJD 4X6DB 3TEZA 4Y4FB 4UF7C 3EUUA 3X1BA 3VSUA 3JZYA 1CVRA 2VDLB 4APQA 4ALAC 3MGAA 1AGEB 3AU1B 2BNRA 2DQHL 2HRPH 2ERJB 3GO1L 4HF5H 1EV2E 3FQ1A 1X4YA 1YPZF 1JK8B 4ZNEE 3KXFA 3LV3A 1BM3H 1F3JB 4IDLA 3IMUA 2R59A 3V6BR 1YYLL 4P05A 5EUOB 1WWBX 4L3EA 4AH2A 3X3FH 5FKAA 1UGNA 1Z9OA 3FMGL 4HT1L 3UADA 2XPGA 4NWTH 3HS0A 1DJGA 1LE9B 3AMLA 3PPSA 3GRWH 2PWDA 5DJYA 4PBXA 3UAJA 2V2WA 4MJ2A 2FZ3B 3NIFF 2OULB 2VZVA 3I84A 4XMPL 3CN0A 3GBNL 1BEXA 4YVUA 4NS0A 1XTMA 3VFTB 4P46C 1FV1A 4GOSA 1VCAA 1XGRA 4F7KA 2EEFA 4GFXA 4QLWA 5BOPA 3V0GA 2YPLB 5GGRY 1B4RA 4QXVA 4KZEL 4H1LG 1CR9L 2ZSWA 3ABGA 3DUSA 4R96A 4F7PA 1QATA 3FCUB 1IFGA 4LSVL 4MD5A 3S0PA 3S35L 3S3DB 3RIKA 2Y2YA 4PGEA 2ISDA 2XN9E 4K8RL 5EF3A 3KYKL 2L4OA 3G7TA 5BRZA 3S3PA 1VZGA 2GPZA 2HN7B 4UZGA 2ZUYA 4OVUA 5FYKL 1FDLL 5F88A 2GABA 5I8OH 3M17A 1YPZB 2O6PA 4U0QB 3DSNA 5I6MA 1MFNA 5KVEL 5JUEL 1FVEA 2A9CA 4JKNA 5EORH 4P2QB 1LO0H 4XZUB 2JLPA 4CU6A 1ZKAA 2F2HA 3CDCA 4Q6IB 1YUHB 1DFXA 1KYUA 2W60B 4JPWH 3HNSH 4ZMPA 5FYKE 2Q9OA 2AEOA 3S8FB 1HQRA 4G8GE 2ZCLH 4J8QA 3U46A 1FE8L 2DN7A 3MODH 3O6FD 1E4JA 3VQMA 1DQVA 1GYWA 5KVEE 3CDZA 2VSKB 2AK4D 3BUYB 4AEIH 5IMMA 4LOEA 3TN0A 2FO4B 1MFBL 4X80H 3LAFA 5DHVH 3I75B 1UXSA 4MBRA 2VLJA 1ZXQA 1FG2B 1XQ4A 5E2WH 1MNNA 4ZFGL 4OTXL 3V52L 1D6VH 2UVFA 4G9DA 2AZUA 2Y69B 2WGNB 1W72L 4DERA 1OZUA 4PVNA 1RSYA 1ZK9A 4ZDHB 1NH6A 3MZTA 3P3TA 25C8H 4HLJA 1S7UB 4OQ1A 4JN1L 3O6FA 3QJUB 4M5ZL 3V8OA 2A74B 2FHBA 2P80A 1U41A 1HIMH 3N2JA 5D6CB 1NSNL 1YN7B 5I1EH 3SDCD 3TBCA 2AK4A 4GAGL 2G4EA 4KAQH 4HX1B 2M8XA 3N1MC 1Q0EA 2CHNA 3GBLA 1WV7T 3FH5A 3BP5A 3LX9A 2QR0A 1GZQB 3HMXL 4Z5RB 3ULUC 4OFIA 4O51B 3VI4F 4UAOC 5IB2A 4G7VH 2Q86B 4HJGB 5DD3L 4XP4H 1DJIA 1OGAB 1PAZA 3F12A 1OB0A 3W57A 1MCDA 1CDBA 3MRKB 3W2DL 3VFRA 1Q94B 3M86A 4KK8C 1JFQL 5D1QE 3ME0B 1WIPA 1ILUA 4RETB 1AGEA 4NM8L 5E5MB 1U8OA 3X11B 4DKFH 1L9NA 4QEGA 1QLEB 2GHZA 3LQAH 5I8CA 1JK8A 4H13C 1F3JA 5I1AA 2VJ8A 3DROA 1AO7D 3K8KA 3QFGA 2WYHA 1IX2A 4JVPA 3P0VH 1ZTXH 2CO3A 3KCPB 5GRVK 3T0EB 4WO0A 1H3TA 3K6IA 4J8RB 5F9OL 5J1SC 5IJKA 3ZZSA 4OB5H 3OKDB 1CTNA 5DUPH 2VQUA 4ELMA 3S3JA 1I7RB 2IG2H 1XGYL 5CSBA 2GFBB 3UGEA 3VDCA 5IFHH 3FSWA 3QFDB 2DQ6A 3M6DA 3JV5A 3DYPA 2UZIL 5DZOA 5I1KH 4HZLA 1EDYA 4TUOB 3VFTA 2CCVA 3GTVA 5F0LB 4D9RD 4I1RA 3VXSE 2BW4A 2FJFA 3VI4B 3G6JF 4MMZB 4GY4A 3VI3E 3RUGE 1A6WH 2CXGA 4UWQB 3P2BA 3V6ZA 2XIDA 1J0ZA 2HPOA 4K3JL 3PPEA 4G8EA 1TJHH 1CN4A 1V10A 3MV7D 4MCMA 3GMNB 2HN7A 5AB0A 5FM5O 5H4ZA 3CFDB 4OLUH 1FZKB 1U8JB 1UASA 2AJSL 4L1TA 2D7OA 2FLRT 4KH2A 3TX4A 4UTAL 2BNQD 3VXMD 3KPNB 3HAEG 4CKQA 4ES9A 4BD4A 2F19H 1G0XA 5C0GB 3GS4A 1QYGL 1YECH 4YHIB 1QX1A 4OD2B 1T1WB 3BP7A 4N2KA 1CLOL 5DHYA 3WEAA 1GTFA 2TAAA 3EYSH 4X4XB 4BQCA 3BUYA 4YHMH 2CO4A 2FO4A 4IKKA 5K1NA 4JANB 4X6EB 2P8MB 3I75A 3IYLW 4XP6H 5DLML 3EO9L 3DRTA 4LEEA 4PJ7E 3SKNB 4LLYB 5EOQL 1L7IH 2R7EA 2WLNA 4NKOA 1TZHB 2B39A 3WJLA 3JV6A 2GK2A 1SN0A 2ICEB 1X9RA 3PDDA 4R2GC 1XZ0B 1MVYA 1Y1UA 1OCWL 4JKPH 4M43L 1JMXA 3GSWA 3QO0A 4X99A 1KNOA 5EU5B 1F8TL 1AS8A 3EOTL 1YN7A 1IC7L 5CGYD 1ES0A 2WLJA 4P49A 3WDHA 5J06A 4PJDB 1T1YB 5D2LF 3HI5H 5E2VL 4OCSH 4NNPH 1PKOA 4HIEB 4FMKA 1TFPA 1BQKA 2X28A 3QG7H 3LQMA 1MHEB 3ABMB 5F7YC 4ZFFB 1VFAB 2XTLA 4MNHA 2DOCA 4FQLL 1TVHB 5KVFH 5JW5A 1UFGA 3QJVB 4PMEA 1IGMH 4HV8A 2Y2WA 1RJYB 4L4TB 4LQFH 3S36L 3ME0A 5A40E 1H9VA 2FBJL 1SDYA 2EYTB 4J3XA 5IT2H 4R3SA 1ZK5A 2ROYA 2HJLB 1TT6A 2P7TB 3BT2L 3T4AC 4W9FC 3X3GH 3QWRD 3QRBA 4HGMA 1KCRH 4LHUD 3DTDA 3KCPA 1I7TA 4NQXB 1FCCA 4BXSV 4J8RA 1KWGA 5EEXA 4K71B 1E4XL 5F96L 4KZDL 4ZAKD 3OKDA 2X6BA 2WQSA 1DBBL 3U36A 3NFNB 4JE0A 2CKBL 2EH8H 3ZGIA 5F1IA 3RFZB 1WLHA 3E7JA 3QFDA 2NLJA 3V4VB 3FF7A 2PW2B 2EIJB 1DSWA 3FTGB 2NT1A 2JI3A 4TUOA 4P5MB 4LPYA 2QDWA 2Z93B 3L9EA 1I9IL 2F5AH 3MFGB 4L5FH 2CMRL 4YGVA 4ZOEA 5A2AA 4MB4A 3AXLA 3V0IA 3TO4C 1NQBA 2F5BH 1GTNA 1JGUL 4IKNA 1KGCE 4LHUA 2ZKHL 3D3VB 4WK4B 2V17H 2FNWA 4H40A 4NBZB 4ZAKA 4PM1A 1B0GA 2JCCB 3PV6B 4OJFH 3ROOA 2WVSA 3JVGA 4JHWL 2WLHA 4Z23A 43C9B 3UCQA 2WWKT 4XVTL 1NGYB 1RUPH 4QTHB 1ECZA 2JIXD 4LLAA 5BVJB 3BAIA 3N50A 1UYWL 1MJJB 4OIFA 2PCFA 3ZTJH 2QTEA 4U33A 1H0DB 3IDIA 3STLB 2R0KH 2X89D 3V0HA 2OI9C 4GIOA 2XZZA 2HFGH 1BIIB 3UERA 2FEDD 2ITEA 4YHIA 3T3ME 5I1GH 3WE6B 4OD2A 4UUJA 1ZAGA 4R26L 3D0VB 1NAMB 4R0LB 4ZMWA 1A6TB 4WY7L 5H94B 1E4WL 4ONHA 3QUXC 2MOGA 2HKHL 4W6WB 1J05B 2EDYA 5JPMA 4TQIA 1S9XA 3UTZB 2JIXA 4KO7A 3H42H 4K94L 4PJAA 3SYPA 3U1QA 1SBSH 3ILPB 2X89A 4HFUL 4KKBD 3A3YB 3HG2A 3T9WA 5INCA 5K9KB 3G9AB 3VH8A 3DHMA 2ZAGA 1JYVA 4KXZI 1JHLH 1UKTA 3D06A 4G6KH 1NTDA 2DIBA 3W56A 4LRIA 4QRTB 1IGJB 4PBVC 3ZE0F 1DE4B 4ALAL 1R5IA 4KXZH 5C0IB 4NQDD 5FLUA 3KBPA 2HTKC 3VXPA 4PJDA 1T1YA 4H1LA 3V4PL 1R17A 2QVMA 4KX9A 4Y88A 5C07D 3N3EA 2CGRL 4QNPF 1NM4A 3LCYA 1QA9A 1BVNT 1GZHC 1M05A 1G9NH 3FT4B 3NA9H 3QIWC 1ZVYA 2ZWLT 5HYJD 2P46B 2Y6SC 4ZFFA 1VFAA 4NZJA 1S3RA 3WSQL 2IPKA 5AVZB 1IBYA 3LMJH 1TFHA 4AIEA 1MDAA 4BFRA 4ANKA 4K5NA 3OAZK 2AXHA 5F8RC 1OM3H 3GEWB 3OKMB 4Q74A 2IDFA 3WFEL 2F7IA 3HAEB 4HUXA 1B4LA 5AUMB 3KPLB 5HYQB 3GXUB 3QCTL 4P3WA 3TZVC 2HFEB 5C0FB 4S10A 5FC9A 5C07A 3QJOA 5C3LD 1HDMB 2FJGA 5LBSL 5HHQB 3O6LL 5C6TH 1JV5A 2NYYD 5E9AA 4KFMA 4NQXA 2UV3A 3NP4A 4XTRC 7PAZA 3O8XD 1UGKA 4ZSOB 4FFZA 3NFNA 5DQDH 3BCDA 5DI8B 1WISA 1EAPB 2H9GA 1XR9B 1N0XL 3L5JA 2EDEA 4L29B 4AQAB 1ADQA 5C08B 4Q9QL 4J3BA 3TV3L 5DMKB 2APSA 1B0IA 3LKQA 1JWMA 1SYSB 3BPNB 4P5MA 3X12A 2BNUB 4GG6E 4JO1H 3BD5A 4B9JA 5E5LA 4P2CG 4U3SB 4R5VA 1W0VA 2BSDA 3HC2A 3KEDA 5BZZA 4XNZB 1YEEH 3VYPA 4XMKL 3H3KA 2GJPA 3D3VA 3QXUA 5LCVL 3W3BA 1N5YH 2EO7A 2R2HB 3T0DA 1EJOH 4XE5B 3FU9A 2JCCA 3PV6A 1WFNA 2FEJA 1KULA 3ARFD 3RI5F 1T5WB 1U0QA 4UQIM 1U8IA 3FU5A 4BWTA 1AOZA 1JPGB 1I3GL 1S9WB 1ASOA 1BOGB 3B6SB 1MHPL 1HE8A 5BZDB 1YNLH 1HJCA 2WO3B 4GMSL 1WYJA 3L7EB 5BVJA 5BZWA 2XJLA 1GYVA 4LLWA 4OCWL 3TEWA 1CUOA 1RZ7H 4XGZA 1ZA3B 1HHIB 1KN2L 3REWB 1BIIA 4K3DL 2XBTA 4LIQH 2K6YA 5AOLA 2HT3D 2PXYC 1XD1A 1HH6A 3RGVB 3NESA 4MAYC 5H2BA 4R0LA 3TTSA 5IROC 3S88L 2GT9B 3VQ1C 3ARFA 2XWBA 1D7CA 3K8LA 4H8QA 1R4XA 3T0BA 3H3PH 3BT0A 3HE6D 2JTDA 4PYHA 2N0MA 5F7UA 4JN2A 3U9UB 3Q48A 1C7TA 3UTZA 5LQBL 5L4MA 2QVFB 3ULUL 4IRZL 5T5FA 2VDML 2OZ4H 3ILPA 3QIBC 3OTTA 2JELH 3BISA 1QEXA 5K9KA 1A6UH 2EYSB 3LEXA 3O6KH 4P5TB 2DMCA 1TSHA 3UTOA 3EJCA 2DEWX 3WEBA 4E9YA 1AD9B 2WVTA 4CSTA 2MJWA 3QCUL 3IGKA 3QXVA 2HRHA 5AW3B 2BX5A 5F3HB 5IHLB 3ULUE 1TLMA 5C0IA 5IWLA 1IC4H 3HE6A 2IH9A 1LEGA 1S8DB 1MELA 1LHZA 3HUJE 4BFIB 1AQKL 1CGVA 1ED3B 2PTTB 5AYQA 3K7UA 1QKZL 3DARA 2D9QB 1B9KA 1IBDA 3SDDC 5KBDA 1U8NA 1QASA 2XUWA 1B4TA 1PG7L 3CFIC 4N8CL 5CJOL 3WKQA 5A6IA 5IESL 4PWFA 3KGSA 2VXUH 3NQKA 4YS4A 4JPIB 3INUH 5I28A 4MJ5A 5BV7H 2YUXA 4O5LH 3BJLA 3S34L 3EXLA 4WW2F 5EFIB 2Y4SA 4ZUUA 3NN8B 2JB6B 4AG4H 3SYQA 1BQHA 1SEQH 3GLAA 1ZEAL 3BVWA 3GI9L 3GJFH 3OKMA 4IBZA 4N2CA 3V5HB 1ZSHA 1DBMH 3CHRA 5GRVL 3I6KA 5IB4B 5AUMA 4Y16C 1DLHA 2HFEA 2YAFA 5CU9A 5C0FA 2OSYA 1HK6A 1QPKA 3GNML 4PJ5B 1XEDA 5DUML 4M7KH 3QQ4B 4XH2B 5HGHA 3BE1H 2OR8A 1CU4L 4I5BA 4M48H 1UXMA 1KGUA 4OUOA 3KNBB 1GOFA 1WWCA 3ARPA 3CCHB 1IGCH 2QJDA 2YBRA 3ALPA 2WBJD 1HJBC 4DN3L 3GM0A 1WK0A 4PD4K 1EAPA 3DOHA 1AJ7H 3AS2A 2WCSA 4YIQB 1MFCH 4BYHA 2IBBA 5C08A 4CVXB 4Q52A 1B3IA 4AYEC 5DMKA 5KSVB 3HLAA 3NGBC 5HGBB 3GMQB 2CUIA 5EOCH 2BNUA 3RX7A 3PUCA 3B83A 2ZG2A 1TTGA 2OCFD 4QHUB 4BFJA 2ZNXA 4OH2A 3RILA 3GGWB 3IS1X 3GB7B 1T83C 3OGCB 3FO1B 4WW2B 3MRFA 4UT6L 2R2HA 3QPQD 1XXDC 3OLGA 4DWHA 4BFNA 3RTQD 1A7BA 1T5WA 2BO0A 2DLEA 4JFOB 4JRXE 4LCCB 2NCEA 4WWOA 4HGWB 3GM8A 4X0NA 3CC1A 3CFEB 1BOGA 1M2VA 4YUEL 3B6SA 3S3SA 2PN5A 3KLKA 3OD3A 4BE6A 3EG9A 3L7EA 4Z7UF 1DEDA 1TEGA 4U6XA 2HUEA 1EHAA 4WO4C 4FNLL 4R7DB 2L7EA 4F7EB 2WXIA 2Z3FA 4AMKH 4C56B 1LK3L 4K7PY 3ZT6A 4AVIA 4E9VA 2F7RA 4XC3H 3UO1H 2KUTA 1ZT1A 2DI7A 1J12A 1IEBA 3FFCD 1GGIL 3DX8B 4FEIA 2CU9A 3S5ZA 1DQDH 2GT9A 4NPKA 3CWGA 1AMYA 3SPGA 4P4KC 3RTQA 5D8JL 2ALWA 4FTVD 3RWEA 4JY5H 1KCBA 3QH3B 4PSRA 3OR7B 5GRUL 4DPRA 2HCZX 2X4QB 3SQOH 4ZX5A 1RK0B 5JDJA 2RQ8A 3BWAA 3K3QA 5DJCA 2KDYA 3HC0B 3CDGA 4RGND 4UQCA 5LWYL 5L6YL 1XF3B 1R3JB 1L9PA 5CHNA 3JTSB 1T04A 2EYSA 1AFVH 3QG6B 4E36A 1ECYA 3U6XS 4P5TA 4HALA 5C9JB 1A7RL 3CBKB 3RZCD 1HQ4A 3HFFA 3QR2A 4KJYB 4CADA 1H6TA 5DEJA 3FKUS 4EQ3A 4HLEA 2OR9L 2VRAA 3IMSA 1ROCA 4FTVA 4Z7UB 4PTTA 1S8DA 4PS4H 1KPUA 3HC4H 4BFIA 2DQUL 2N1KA 2PTTA 2RFXB 5KSUB 4A6YA 3JWDH 4Y1AB 3D87B 3BKMH 4E5XB 3SKJL 2A9ML 3CVHL 4BJLA 3L3KB 1MI5E 4W6YB 3EYFA 3WN6A 1WJ3A 5FW8A 2HT4C 1BVKA 4TVSa 4HOXA 1NGXA 1JNJA 4L3CA 3RZCA 1QEWA 5I1DB 5EFIA 3ZTJG 4MJID 3H3BC 1HYRC 1KGJA 5FFGA 4AYID 2KLTA 1PIGA 1CT8A 1Z9NA 4TL4A 3C5ZB 1OK8A 2DAVA 4KXBA 1NKRA 4N5ED 2FO1A 5F1NB 1U8CB 3NIDF 3H6JA 1EZVY 3NACL 4KK5D 3TWYA 5ID0A 1J1OH 2Q1EA 5FAAA 4PJ5A 4UQ3A 3E8UH 3PXHA 4I2XA 4XWOC 5G5DA 4Y4KC 3U7YH 4FQ1H 1XBRA 4XB7A 3ZKMC 1DDHA 2XZAH 3DX0A 1T66C 2DMHA 3WO3B 4GXFA 1N5AA 1I82A 4F3FA 2HMIC 1S7WB 4BCXA 3H9ZA 4RVBA 1E5UI 1FLTX 2VITB 1KIQB 1L9MA 3AACA 4PJXF 4YIQA 3GRWA 3SCMA 3QJHB 3SGEH 1G94A 2IIJA 3MTRA 2MKWA 4PLOB 5CD3A 3GMQA 4H8WH 4FQXB 1EHLL 3IDMA 1YEFL 2GEEA 3W11C 4GAJH 2XQYK 3NJNA 2PPEA 4DO6A 2BWIA 3FBKA 3VX1A 3D50A 1PU0A 1F13A 5TH2B 3OGCA 3FO1A 4TQEH 1MQKL 4N2AA 4V1DE 4G42A 5DYOA 5F7EH 5HI5D 3UPCA 2JKTM 2Z0BA 2UWEE 5CEZE 4LCCA 3QEQB 1HXKA 3GKWH 4N2NA 1IT9L 1JGDB 1IGIH 2R0ZH 3NIDB 3CFEA 2ZF9A 2NZIA 4M62H 3EJTA 5EU6B 3APDA 3QBTB 1L9TA 1W0YT 3SD5A 1JPFA 1HL5A 3U4KA 3ZTCC 1E4HA 1HL4A 3QIUC 4WFGD 1BJ1H 1YG9A 1DL7L 4PYGA 2VDPH 4PSPA 4RISH 5B3JE 1N6QH 1DDTA 1MCCA 2BVTA 1MRFH 3TNNB 4E9RA 1JD7A 1VJSA 2VZOA 4E9LA 4JO2H 1S4IA 3ECWA 1OSPH 5IVOA 4PJXB 5IUCA 2OYLA 3T71A 2WOBA 2I24N 4O2FB 7CGTA 1U8MA 1K5NB 2KLRA 1I7UB 1OAXL 4ZYKB 3OR7A 5J57B 1HESA 1OP5H 2X4QA 4WJKB 3C6SA 4FQHA 1RK0A 5FX3A 5DHVA 2VW7A 1NCAH 5D2NB 1TXKA 3HC0A 1ZHNB 4PRBA 4AGNA 4Z3GA 2DLFH 2Y06H 4PJBF 1CL7L 2W95A 4U4BA 3ARVA 3JTSA 4BELD 2GITB 5F3BB 4UANA 3QG6A 5E2TH 1A1MA 3NZSA 3WEXB 1TQUA 1PF3A 2F54D 1KTCA 2WAQA 3IPBA 3Q2NA 4J12A 4KTEL 3LDBB 4LCVA 1LDPL 4XVJL 5GJSH 2DQGH 4GXVH 1CO1A 2B4CH 1ZLVK 3DX7B 5JPNA 3FB7B 2WLKA 4O58L 1N8ZA 3OKEB 5HDBE 4JM4L 5GHWH 3QWOA 3QORD 5KSUA 3C6LB 2RFXA 5TFSH 3FCSA 4PJGF 3UPRA 3G6DL 4KDTC 4XXDB 4DGVH 4GAFB 4KJPD 2J8HA 3BGFC 3NRFA 3F83A 1W6LA 1TQCB 2CPCA 2ICWI 2Y5EA 3BWUC 3JUYA 4JL2A 3MV9E 4L8SA 2F54A 4WUKL 4F58H 2AJ3B 4I13B 4FHBD 1ZVHA 2C5DC 4BUGA 1H8SA 5DFWH 1S9YA 1QNZL 2FJSA 1XZWA 4HEME 4LSSH 5C1MB 5CN1A 1U8CA 4ZX6A 4L1BA 4BDVA 3GPSA 1OY3B 2K7QA 4CC1A 4OJEH 2IANE 4CW1A 5CZXD 3DJSA 1BVNP 1I85A 4KDWA 2PPDA 3DJ9A 4BUHA 1U8KA 1UOVA 3ESOA 4WHYH 4J3VA 2ZCHL 4LNVA 5IK3B 3OJVC 1KCSH 1M9WA 1C08B 4IIQC 1LILA 3ILQC 4ZQTA 2XFGB 1SNRA 4CVZB 3GSNH 1G1YA 2VITA 1QRNE 4K23H 2J4WL 3H53A 2XWEA 4YHPA 3VD3A 4MX7A 5BO0D 3NJLA 3FQWB 1UWFA 3JTBA 1OPGH 1X5MA 2XVGA 3DVNA 4JFXA 4OZ4A 5CIPH 5C0BD 4PJGB 4NNYB 4G83A 3D48R 3VW3H 2VLLA 3WV0A 1XGTB 2EDBA 2V7HA 2VSDA 3Q13A 3B2UD 3QJFB 2EVGA 2R1XB 4K55A 3WN5C 1K72A 3D85D 4ZXBD 5B4MD 1B0RA 4P23B 1NFAA 1F02I 1Z3GH 3FK3A 2DTMH 5JXAH 2NY3D 3MRJA 3BEVB 4NQEE 1U2HA 5INDB 3P9WB 3ZQWA 3BI9X 3SY0B 3CQFA 2IJ0C 5D7EA 3FB5B 2PYEE 3GRGA 4JRYB 4NEHB 4XNDA 3RVWC 4NLHA 3Q2LA 3QEQA 4GAYB 4ZX3A 5I0DA 1KBPA 4LL1A 4TVPL 1I1AD 4MJ4A 3Q7JA 3RJDA 5BXFA 1ZLSL 3LPPA 1IILE 2XWJB 4KJQC 4WWKD 4MXWH 1U8HB 1BAFL 5K33A 2H7WA 1FNFA 4ZXBA 4Z78A 2UZPA 1GSKA 3RU8H 2D7QA 4XNXH 5C0CB 1EO8L 3ISYA 4TVPE 3QAZB 3BGMA 3G04B 1YLBB 1E5ZA 1OVZA 2Q8BH 4U7MA 1HKFA 3D4GA 5C86A 5KZCB 4X6BB 4C83A 4DQAA 1C5BL 1KY7A 1Q0YL 4YSAA 2C9AA 3PQYB 3IN0A 4ZYKA 4ZBJA 2UY6A 2VR4A 4OIIH 4M7LH 2XN1A 1S5IH 4JDEA 3U1SL 2CM5A 1JK9B 1ZHNA 1DQML 5BOZG 3CVIL 2UUDK 2GEQA 2GITA 5E9DD 5E95B 1MFVA 1ONQA 1WUNT 2DQCL 3WFCL 4NBXB 4NOBA 5SX4I 4LKCB 4J3OG 4DKEH 2P26A 3TPUB 4J4PA 1PMYA 4NP9A 3THML 3B7YA 4Y2NA 2B14A 1IFHL 3QPKA 1GW0A 5A1AA 3DA0A 5SX4H 1T6VN 2WXOA 1K8DB 1RU9H 4R83A 1HAWA 1NJ9A 1KJMB 2R9HC 5ITBH 5JW4N 4YDJB 4HKZA 2HX8A 4F37F 1J0KA 4YDVA 4N26A 4TV3A 3FHEA 5EOCJ 1CURA 3O9WC 5DMIH 4JFEB 3HI1B 1RVFL 5TQ0L 5BS0E 3D30A 3P77B 1EZLA 3IGAA 4TOYH 3ULVC 4HMDA 1JVKA 4ZO9A 1AMXA 1ZHKB 4MA7H 2FQDA 3HZKA 3MFFB 3JT2A 1WBZA 4Z9KB 2IOMA 2M1KA 2YRBA 2Z31D 4W4OC 3AM8A 1INEL 4JB9L 4LARH 3NCCB 2WSKA 1N9PA 2D3LA 2FUTA 3WY2A 3CX5K 1NLBH 3VRLE 2CJ3A 2E5EA 1EHXA 4AJ0A 1FRGH 4ZUSB 2HX9A 2PETA 1PX8A 2EZ0D 2V7NB 3ARRA 3WJJA 3BIKA 4H26A 2YD2A 4X9YA 5JR1H 1B88A 1C08A 1J48A 3FU8A 1ZPLA 3TJHC 3N9GL 4UCFA 1CI5A 1L5GA 5CZRA 3RL2B 3PL6B 3AS3A 3I3DA 3MLRL 2GAZA 3FQWA 2E9JA 3LVEA 2F53E 1DSFL 1U3HA 4IEFA 3CSFA 4L9LC 4LGRB 1L3WA 2OK0L 2Z31A 4TUUA 1F41A 1D5IL 3VFGH 1VGEL 3Q8FA 4U6TA 4X8JB 5ESAA 2MPAL 4FLRA 3HMWL 1EVTC 4LDCA 4FZEL 3HBPA 3MOBH 4PRDA 3ULSA 3LOWA 2IDCA 3EGXB 4HPYH 3ALWA 4OLWH 2OTUA 1UJ3A 1VSCA 4ZK8A 1T0PB 3O11A 2WKOA 2XCMC 3L6FA 4PGBA 3HB3D 3DHJA 2JV6A 4OF0A 1QFWI 4JRYA 3RDTA 4Q8BA 4TULL 2QKIC 5IW3A 1FBIH 1RZFL 2E9WA 5TE6H 2L8AA 1E40A 4M7LT 3LNIA 4FI7A 4FZ8H 3M8OL 5CINH 5EPMB 4G1EB 1QVOB 1QFWH 3A23A 4AGLA 4ES8A 5IFJB 1EAOA 2DQJH 4P0DA 5BPPA 2N59A 2ZYHA 4UNIA 5CD5C 4N25A 5JA9A 2WLZA 5D4IA 3W0WE 2FO8A 3K6FA 5E2UL 3LN4B 2PW1B 2E7MA 3AREC 2PPAA 2XOTA 3MLTB 1OEZW 3G04A 1C5CH 4LGPB 4YHOL 4BH7A 1CPUA 2V3EA 3RP1A 4APXB 2XLLA 3IKKA 4GYBA 5D4JA 1OF2B 3KW7A 2XWTA 5E7BA 1CDJA 3BVNB 4RQQB 4TTGA 1MWAB 5D1XC 3PQYA 4LQ1A 4D7BA 1WITA 1Z5YD 5JDSB 2VIRB 4YNYB 1ETJA 5DC0A 5E0FA 3NRPA 1CGXA 3RWDA 4EDWH 2X0UA 4U31A 5FA4A 3EBGA 3ZHKA 1R46A 2CGZA 4N1EA 3TT3H 4F7CA 4OJCA 4Q89A 1NBYA 1QI4A 3IFOA 4JG5A 1GH7A 3AUWB 2X09A 1ZJAA 5E8PB 1LWJA 2UVEA 3VGFA 5I1LA 1XWVA 4U4IA 1T89A 1V54B 3BPLC 1KWKA 3PJNA 3MSPA 4AQ1B 3ECUA 1PZ2A 2H4EA 4LB8A 4ISVA 5TF1H 3TO2B 5KYXB 4L3AA 3FB8A 2C9QA 3LS4H 3I2CL 4QXUH 2RTTA 4FMFA 4D7PA 3VRIB 1QHQA 1KJMA 4QOKE 3SZ6A 5ANME 4GUOA 2IDUA 2DMBA 2NTFB 2JQZA 2QADC 1TZGH 3FT3B 5TGBB 1CFSB 4OKVB 3N55A 1EH9A 3WFZA 3GXIA 1MREH 1KPRB 4J3OF 5EZLB 4D3CL 1JMZA 3LIZH 3CSPA 4X9GA 3P77A 3FH8A 4FG4A 5SWZE 1B2YA 3UROR 1Q9LB 2DWDA 3KJ4C 4BINA 4XOBA 1ZHKA 3TBYA 1DCEA 1WZ1L 4BZ1L 3MFFA 4S1DD 3ZR5A 4LSTH 2Q7YA 4MD0B 4K9EH 1HEZB 1JZJA 2B08A 3WIFA 4NHUB 3MRBB 4P3DA 2AZAA 1Q9WB 3UZEA 3IDXL 1J8KA 3E6HB 3T6XA 4B9GA 1U93B 3GSQA 3N42F 5EG6C 1CLYH 1TETH 1PY9A 1WBXA 4KQ4H 4R7XA 4IU2B 1CYGA 2JMRA 2YZ1A 2M83A 3TXAA 4G8AC 1YMME 4L48A 3ARBD 4I3SL 2V7NA 1PG7W 2J20A 1T5XB 1EXUB 1SOXA 2EIEA 5D5ME 5F7HA 1MRDH 5KS9B 5IREA 1MJ7L 4JEGB 4NFBA 1BJ1J 3EBIA 4XPAL 2G3ZA 2QSCL 5KYYB 5SV4A 1DQTA 5F7WC 4QAMB 2AJYL 1XIWD 3FUEA 2XN9B 1SDDB 1EMTH 3UJJH 4WUUD 1D9KC 3BOVA 4X8JA 1A47A 4LGSB 3H7BB 3ESUF 1R19A 4ORGA 5GRJH 4TSCH 3FTYA 3HE7B 3R0NA 1NC2D 1BMWA 3QC5X 2P48B 4EIGB 2R39A 1TEFA 4OIAA 5DSCA 1J86A 1VFMA 3SYAA 1RZKC 5D1ZB 2DWTA 1WH0A 1ZT7B 4NT6B 4WNQA 2VLKE 5EPMA 5DC4B 4ONFL 2WC7A 3BDXA 2AC0A 3U7WL 3HR5B 4Z7VE 5JW4R 2ZKMX 2BSSA 2PR4H 3D6GA 4G8GB 3N42B 3IFLH 4PJ8D 1XIWA 2AKRB 2NQCA 3J2PA 2L7JA 2ZSVB 2ARJB 4HHAB 4Q14A 2VL5A 4QXTB 4IRJB 4R90L 1CDIA 3RPKA 1ACYL 1JPST 3VO0A 1FL5B 3BPCA 4EPSA 5CSZB 2R56H 4FLSA 1JUFA 2DD8H 3MRQA 3K71B 3OAWA 3U30C 1NC2A 2PW1A 2B15A 3MLTA 4WEBH 2ATKB 4WLCA 3RWCA 2EVIA 1OARH 2H32H 2F68X 4APXA 4AQ8A 4LBEA 2AF2A 3PLYA 5E8DL 3PABB 2ZX7A 2Y1YA 2D7TH 3BVNA 4RQQA 3T04D 3RVXD 3QISA 4HSCX 5JDSA 1ZA6B 2VIRA 4PJ8A 4YNYA 4GS7B 5IEKB 1NDTA 2ICWJ 1YEDB 4N0YH 2VKXA 3Q0HA 4UI2A 2ID5A 1DQLH 3NDYE 3B3IB 3JWOC 4X7TA 2OZ4A 2BJML 2CM6A 3GYRA 1W72B 4O2CA 4YK4C 1HNYA 1P84K 2W07B 3I02B 1DN0B 2OS7A 4FJ6A 4ZQKB 5A3ID 4UB0L 1JOIA 3FO0L 3NYKA 2EIZB 1WCBA 3ZHFA 1DBJL 4WFEE 1WZMA 3UYOD 3ZMEA 4QJ4B 5D7LE 4OFYA 4UOW1 3LZLA 3GFUA 1KTBA 1A7QL 3TO2A 3RUGF 3VI3F 2PABA 5E5UB 3MBED 2E9IA 1WO2A 1ET7A 2OSLB 5GGSA 4A7SA 1O9WA 3FT3A 5D1QB 1JDCA 5IW6A 2V2TA 3HRZB 4YDKL 1CFSA 2BOCB 4OKVA 5AWNL 5TD4A 3VXOA 3BAEL 3CXHK 3TBVA 1OOAA 1UT2A 4EZJA 5F7EL 2WSPA 3C60A 1KLFB 4DK3A 3U4EB 1P7QB 5GS0C 2LR4A 4DO4A 2NNXA 3LSOB 2HTLD 3GSRB 5TK2A 1NPUA 2BFVH 3FQUA 3GXMA 3GJFA 1SJHA 2FX8L 2CUHA 3EZJB 1AACA 1IBBA 4OZGB 4WFFD 3IGLA 2FR4B 2B1OA 3MBEA 1GJUA 2GCYA 3E6HA 4PLJC 3HZYB 1F97A 1QBAA 4YEEA 5JW4M 2I9TB 5HTSA 4BSWA 4G9FA 5JIKA 1G7JA 1J0JA 4EI5A 2EH7H 5KSAC 3QYMA 3W9DA 3ULAB 2BS71 1FZMA 1MCWM 4JGNA 3IB4A 5IB3A 1NGQH 1QR1A 3ZO9A 2X1OA 4APQC 1CGYA 1OSZA 1VPOH 4XBEL 3VXSB 1HU8A 5FF6A 5E4EC 4GW5B 2X4TB 4MWFB 4PJ7F 5KS9A 4EJ1C 2ZP8A 4L37A 5KYYA 5AVRB 3O2VL 3RUGB 1G6RL 3FOMB 4M6ML 2UX7A 4Y5YB 4LVOB 2YXMA 3LS5H 1IKFL 2W91A 3MOAL 1B6DA 1SDDA 3EADA 3RNKB 3GIZH 4M8QB 4EZMA 3H7BA 3MGTB 1OW0C 1H5BA 4OLYL 1NGWB 2AJUH 4PJHE 3TJEH 1NUDA 2AJZB 3NFPA 2YPLD 5C09E 3HS0C 4DGYH 1ZGLP 1OAQL 2EDWA 4JM2C 4JQIH 3UAJC 1S9KC 3O0RH 3OKOB 1MRCL 4OGXH 4JFZL 5CLTA 4KO9A 4EN3B 1ZT7A 3L2LA 1E50A 5IFAH 1LLAA 4K5MA 3F7PC 2IADA 3STZB 3QJZA 4HCIA 1AD0A 4G8GA 1CLVA 2ZSVA 1CB4A 2R0WL 1GZPB 5DD5H 3G5ZB 2APTA 5FA3A 4LO9A 2RA1A 3AQYA 3JTTB 3RNQA 3L3HB 4ODXB 2FEEI 3VUAA 4B9FA 1K4DA 1EEZA 4JR9H 4AENA 4X42A 3K71A 4ERSH 3WBDA 1B4JL 4PJ7B 2EDQA 4XPBL 1KBWA 4JY4A 1BBDH 3LPWA 4E68A 4Y1SA 5KANG 1JL8A 2W0LA 3FHAA 3TYFA 1WBYA 4YSUA 5DT1H 4KXCA 1JZ7A 3LNGA 3IMRA 3BO8A 1ZA6A 3GXPA 5IEKA 4ZFOA 4UT9L 3WGVB 1YEDA 3CXDL 5HHOD 4JUTA 4NQTA 2ZUTA 3B3IA 3MC0A 1RZJH 4KVNL 5DU7A 3U0PB 2G5UA 1E3FA 2APBA 1DVYA 3GZKA 4ZG1A 4Y5XA 2CO6A 3AT9A 4K7PH 5A16B 4NWUH 1DN0A 2HH0L 1T0OA 3A21A 1UM6H 1OAZH 4HC1H 2JKLA 3AADB 4MAUH 3AY4A 2CR6A 1DEEB 1MCOL 4Z0BH 5MEPB 2XACC 2CO1A 4HKJB 4KMLB 3II2A 3OSVA 1QTPA 4A04A 1QSFD 2WCPA 2ATPB 2YGPA 3AC0A 4Y89A 1GJIA 1FIGL 2OSLA 4LU5L 4OT1H 4WU7A 5HHOA 3UFIA 3ULVE 3O6FC 1IM3D 4WNJA 4DPBX 3BVUA 4BK5A 1RD6A 3MV11 2RD0A 3NSCA 4U1HB 2G0KA 3HI6L 2FCBA 4LEXL 4YO0B 4IMLA 3KPOA 3VFPA 43CAB 3ZX1A 3BDYH 1IIIA 5DGRA 8FABB 4AIOA 3FQNA 2IGTA 2ENSA 4D9LL 3D8MA 4K0OA 4NQCE 3MCLH 4MGXA 4NAJA 1MFAL 3GSUA 3KD4A 3ZHLA 3D52A 4OZGA 1Z3RA 1FNSH 3EOYG 3T3MF 2K78A 2D7PA 1RUQL 4KV5F 2WZPA 3IAPA 5CBAB 5K69A 2I9TA 4YC2B 1CS6A 2YD5A 2OMVB 5DMGD 4Q2ZB 4YSPA 2WNWA 2DWEA 4JE4B 5EU7C 3HPLA 2NR6D 1B0WA 3P40A 4KHXL 1IM3A 4HFWB 1CGTA 4OZIE 3SDCC 4PR5A 4E41E 1DVQA 1WS8A 2G3XA 4X7SL 5JMOC 2Z0UA 4GEJA 1KIUB 5E00A 1WWAX 4OF7A 3NTCH 5TDNB 3MCKA 4YBHA 1WEJH 4FYRA 3E1F1 2DB8A 1BXXA 5D7SL 3BFOA 4HSAC 4RIRA 3KYNA 1NICA 1TYRA 2N7AA 1CFVL 4YOKA 3VXQB 4ZT1A 5IJKC 4KQ3H 2R29H 4GJTB 5K9JH 2AJZA 2ODIA 2F6AA 3FN0L 1Z9PA 2XC8A 2HT2D 1BFSA 4HVBA 4X7FC 4GKZA 3MRHB 1G5AA 5DEGB 3S37H 4OF5A 4RRPM 2ZP9A 4M8RA 2DQEL 4YHNA 4G7RB 4EN3A 5LGHL 4GUPA 1FH5H 4XVOA 3V2AR 2R8SH 4ONOA 4H44C 1G7LA 3T3MB 2G4GA 2Q3XA 2VR9A 4JCLA 1SF5A 4A67A 3IVKB 1JXFA 5E4OA 2MNWA 2Z9TA 5CXPA 5LXVA 1QW9A 2EACA 5GJTL 3JTTA 5IB4A 4AZUA 3L3HA 2L3BA 4G70B 3RWFB 1JGEA 1QO3B 3NCBB 1HXYA 1K4CB 1B2WL 5D1XE 5GGRA 3KDMA 4QRPA 5I17A 3S96A 3BVXA 1TMCB 5GIRB 1LQBC 3KW8A 1KOAA 4XZ4A 2HLFD 5DRZB 4PRPD 2CHWA 3QXAB 4R4FH 2X4NB 1RHFA 4X5XA 3U4BH 4ZZFA 4H2AA 2BRQA 1YYMH 4JFDE 4AT6A 3S9DB 1J11A 2BHZA 4QYAA 1U92A 2BVPB 1BFTA 3CU7A 1BFOA 2O5ZL 1JPTL 2VAAA 1PX4A 4P3CL 5PCYA 3VXRD 2QELA 5HHXH 2MCPH 4YE4H 3O3AB 1ZANH 4CVWA 3CZFA 3FUMA 3QI9D 1KTJA 4RWYL 3B5GA 4JPKL 3CMOH 1F18A 1H3VA 2G75A 3MMEA 4PRPA 3FO9B 1KELH 4HKJA 1HKLH 2ZPKH 4L8DB 1RV6X 2B9BA 3KWXA 2DW5A 3CN3A 2JLLA 3WJLC 1Q0XH 5EV7A 3MXWL 5HJDA 5DWUH 3V4PB 1T2QL 4AM0B 3A47A 2ATPA 1KDJA 2WXQA 3L8QA 3QULA 3VSVA 2I60L 1THAA 5DQJA 5IG7B 4WI0A 1KCVL 1DJHA 3AUVA 5EZOL 3EOAB 4ODVH 2WVVB 3QI9A 4YAQB 1YEIH 4YO0A 2X38A 4DP2X 5E6ID 1JF1B 4GP8B 1U58A 2VC2L 4X5PA 3WXVL 1WGOA 3AGVA 4WQOA 1I8IB 2ICWA 5T33L 1IEAA 2FT8A 3K0WA 1OB1B 4P46B 1UWGH 1T1ZA 1TJXA 2YQ2A 3D69A 3AG4B 4N2OA 2PYFB 3BSZH 5DFTA 1VLXA 3F7YA 4KVCL 3VX0A 4PRIE 5F6IC 2Z34A 2EXYD 3WKML 2VR6A 3DRQA 1S6NA 1NMAL 4UM8B 1V3MA 4PP1D 1PEWA 3QP3A 1YEHH 3LEVH 2WP3O 2CRIA 4YXHL 3SDXE 1RZKL 4WU5B 3MRNB 4GG6B 1M7IB 3BPOC 5CGYC 3B2VH 5BNXD 3OQRA 5CJBA 2VMEA 1IBGL 2I7SA 2XWDA 1ZXKA 1NPJA 3MA9H 4UIMA 5I15H 5E6IA 2CPUA 5IMOB 4K5PA 1UEMA 2E8YA 3LKRA 4TNWK 5C0DA 2XNAB 1I8UA 1EEYB 3DYOA 3L3JB 2H41A 2OJ1A 5G4MA 1BM7A 3L3GA 5CIPA 5LAXB 3X13B 5KBKA 1AZUA 4W9EC 4EBQL 2VDQH 1JYWA 2BOBB 2QQKL 3R8BB 5A2FA 1X7TA 4QXGL 3KPSA 3ULUF 1SXAA 2WZ6A 5FV1L 4XMLL 5I76B 1OE3A 3ATDA 1S7QB 4ZZKA 2MQGA 2XWRA 2G3MA 4O02H 2X2JA 3HUJF 3BIBX 7TAAA 2Q76A 4X6CA 3W37A 5E08H 2Z7ZA 1XEUA 1WAAE 3ZSTA 1TJIH 3D18B 4AGOA 4AYSA 4GRLD 4XPTL 5EEWA 3IVKA 4LCWE 5J3HD 4S2SB 2ZXCA 3BH9A 2EKSB 3JWOL 4ZW3A 2FIKB 1QO3A 2XKNB 2WQAA 4ZAKC 2W9EH 4G8FB 4KRLB 2G0LA 3JVGC 4FQ2L 4QRUB 3BZEB 1OD9A 2WW8A 2EDRA 2QHLA 4X7CC 4OZFG 4WDIA 1CK0L 2W94A 4PS8A 1K3ZA 3ROLB 3K0YA 5GIRA 4XNQA 2A9NL 4YR6A 2ITFA 3TIEB 5LHDA 2J2ZA 4QR7A 3QXAA 4F7TB 2E46A 2OYMA 1IGFL 5SV3A 4KUZL 3ZDYE 4GRLA 3VRJA 2B1AH 1IAIH 1JHKH 1OCCB 2BVPA 3OB8A 1J5IA 1BZ7A 3M07A 2ZXBA 2VDMB 4PB0H 4JPVL 1LD9A 1IAMA 4UAOB 5AQ0A 4GRMA 5IVXE 3HUJB 3O3AA 4MA8H 1HI6B 4U6HA 2DLIA 4OLZL 2OL3B 5JPMC 2MQCA 4WI6A 5GS0L 2UZYA 3WNMA 4FJZA 3PP3H 5AW7B 4WI8A 4DGIH 2VLRD 3K6SB 3O6ML 1O75A 2XY1A 3D33A 3VFMB 5E6SB 2ALAA 3D0AA 3N85H 1LO2L 3QPXH 4JKMA 2GSIA 3K6NA 5F72S 5JHLA 4R5TA 4U1JA 3LH8A 2FEDC 3WJMB 4E9WA 1QLRB 5IQMA 1BQRA 3MRGA 5L7XH 1PQZB 4ZMLA 4X7DC 4XAKE 4LRIC 3TT1L 4C54A 1CZ8L 2W9DL 1KG0A 3A22A 4B0MB 3FAXA 2CDEA 1C8QA 2X9ZA 2OW7A 4LKXB 2PWFA 2BVOB 3MNWA 2F58L 1UURA 1F6FB 3EFDL 4BFBD 3QCVH 1QZ1A 4FQIH 2VLRA 4L8BA 1XSJA 4NRZB 1FFPA 2D3JA 1U8LB 2NY4C 2ITDA 3HPJB 2FX9L 1LK2A 2E7HA 2A6DB 1OB1A 4Z95H 3TF7C 4KKBC 1QWUA 2K8MA 4N87A 1AY1H 1ND0A 3LN5B 2X3BA 1IC5H 1MH5B 2H1PL 3CG8A 4AVKA 2KBGA 4R4BB 1KCUL 3KXFE 3IU4L 4MA3B 3ZE1E 3I6LD 1QSZA 4L3EE 3DTXA 4LCIL 4GG6A 4KTGA 5DJ0A 1A7NL 2YHGA 4K2UH 4N8VB 5FK9B 4ODTH 4PRAA 2O5NA 5FOBA 5IMOA 2E9GA 3OB0K 1F3DH 1WE5A 1EEYA 4JNXA 3IXTB 3HVNA 3ETSA 4P06A 5LAXA 2LE9A 4JRXB 1PZ5B 4K71C 3GO1H 4HIXH 1T5KA 2YN5A 2QLVB 4P5KB 2AW2A 3PWUB 4TSAL 4DIXA 5ACLA 5JYLA 5E8OA 4RX4D 4YDZA 2OMXA 1YQ2A 1S7XA 4WJ5A 1SY6H 3EDEA 1KEML 4DESA 6FABL 5FEBA 3POHA 3ZBMA 2Z8RA 3F00A 2GTZB 4FKKA 4XR8C 1N7ML 1VEMA 3RJOA 1EWHA 5CJ8A 1W0WB 5IBUG 3BQUD 3C5JA 4S2SA 3VYNA 3GBNH 3MXVL 1HE7A 1OGPA 4R2GB 1F86A 4MDJA 1OSEA 1NCCH 3R0MA 1YNKL 4PIRF 4FDWA 3F5WA 5DA0B 4CSZA 4QRUA 2EDOA 2WTOA 3PP4L 4RX4A 4Z7OB 1AIZA 5B1KA 4HWBH 1L9RA 5D55A 3ROLA 2IFFL 3S35H 3NCJH 5DUBB 2DH2A 3F58L 4F7TA 5GS3A 1HHJB 1K6QL 2WUCL 3MGOB 2FSEB 1GC1H 1FDLH 1N26A 5C9KA 3WKNA 1JYXA 2KC0A 3BQUA 5DVMA 4OJAA 5KVEH 1SXSA 5AVVB 1N18A 3ZDZE 3UDWA 5DD1L 1L0PA 3ARFC 1HI6A 2NNFA 2VW4A 4YBLC 3KLAA 2OL3A 3T3PE 3F65A 2YWZA 1J10A 5DK2A 1KZQA 1MOEA 5M94B 1MI5B 1WDAA 5AB2A 4AKOA 3K6SA 5A2CA 3GK8L 3RPIB 1UQSA 2NX5D 3VFMA 1ZDSA 2LVCA 4HH8A 3KLHD 1FP5A 2F8OA 4NN5C 5D4QA 4EO5A 2AK4E 1MFBH 2WQ8A 2KQMA 1M2OA 1WWWX 5L8JB 1J7VR 3FZUD 3WJMA 3CFBB 2WUBH 2UWEF 3ESMA 2HT3C 3CVHB 4JG1L 1T21B 3NJJA 5KYWA 5I6OA 1GYCA 1GPOL 2B59A 3S97C 3V52H 2DYSB 4ZS6C 5ILTL 3VCLB 4CNIB 5IWLC 5EO9B 1Z5LB 1JZ4A 2HVKA 4QTIL 2BVOA 3HE6C 4WKXA 4YGAB 1BEYH 5DVPA 4MXVF 3RY5A 2FJHB 2YPVA 3GQFA 2DS4A 2WWMD 3WIHH 4XN8A 1PSKH 4JN1H 4NRZA 3EJYC 3H9SD 3HPJA 5EU7E 2NX5A 3PJLA 1NSNH 4RAUB 4GAGH 5DVNA 1MLCB 2GC7C 3DGGA 4F9LC 4MA1C 1KTKE 2VRKA 2VZ1A 2X4SB 3LKSB 2BSCA 3HNTL 2FX7H 3MUHL 2X6AA 3TO4B 4M6NL 1MH5A 4OZFB 5EIIG 2G9HA 3GSXA 5AEAA 1RIVL 1A1NB 12E8L 1YEWA 3SQBA 1EPFA 2TSBA 4JJHA 2BS9A 4RAHA 5MEOB 1XMWA 3B9DA 5EZIH 5F7LB 2MPVA 3EH3B 2EYRA 5DJ6B 4GT0A 3WKYA 5GS1A 5FK9A 2A99A 2HLAA 2Q3ZA 4JLRB 4RMTA 2J6WA 3D05A 3HN3A 4AXWB 4ELME 1MF2L 2DBLL 2IQAA 2WXJA 5E7FA 3H9SA 3MLVL 1XH3B 4V1DB 2DWXA 1G87A 3BSHA 4XP1H 4NM8H 1Y0LB 1CTMA 1WSST 2UWEB 5KVDH 1RLWA 1PZ5A 4OVVA 3B7UX 1IIKA 2OI9B 1NWPA 2MIZA 2NCMA 4P5KA 3PWUA 4M5TA 1IEHA 1KTLA 3CFKB 1QZNA 5HDBF 4GSDL 4F2ME 2P5ED 1TMQA 1QTYT 3JVFC 1E8XA 2WPGA 2DBJA 2BWDA 5HVHC 3QUXB 1XD0A 4IOFD 4Z3JA 3PNRB 1EA9C 1M9SA 3ZKXC 4X2UA 4LSPH 5ICYB 4X8CA 2UZIH 1YRKA 3MACH 4OI9A 1GY1A 1NCBL 3MCYA 1MLBA 1UWYA 5CR1A 1I3RB 2LOEA 1FUNA 3T2NL 1CFMA 3MRRB 2LV4A 5T1DL 5MP6L 2Q2EB 3CFMA 2J1ZA 3AAZA 4S1RL 2WD0A 3CNKA 4C56D 1IGTB 1LO5B 2WXRA 3CIAA 3QUGA 3FFDB 2P5EA 5E1HB 5T1LD 4DETA 1NL0L 1MCPL 3MJ7B 2CH8A 2H32A 1NMCB 3PWJB 2GUOB 1A4JA 1HHJA 1EUTA 2IV9A 3QRLA 4U2ZA 4FFVC 5T5NG 2R1WA 3F8UB 4AK2A 3O3BB 4YSOA 1ZV9A 3NZUA 3V0VB 2F8IA 4OV5A 3NP3A 4GAAA 3B9KD 1RI8A 1CXLA 3QIWB 4FEMA 3QPQC 1ACCA 3F6JA 5HDBB 1USZA 2K6WA 2RGSA 1XBDA 3RTQC 1D3CA 2BNQE 2WSDA 3VXME 4BQBA 2BHFA 2CWRA 3VXUD 1OF0A 5T1LA 4RFEB 4MQXD 1CLOH 4N24A 3BD3A 4KROC 3FPYA 1DLFL 2IQ9H 1Q9KA 2HWZH 3OKKA 4Z77B 3MV9B 3UBXB 1O9ZA 4UBDD 2D0HA 4JO5A 5KBMA 5EMYA 4P5TC 3VA2C 5DLMH 4PW3A 3CFBA 4AEHH 2BIOA 5EOQH 2IH8A 1KXVA 3VJ6A 3MRLB 2ZCKH 4WI7A 2WBWB 1UD5A 2Z4TA 2IAMD 4ONGL 1KMGA 3OKLB 2IANB 1NIBA 1OCWH 3FQTB 3KGTA 3NOIA 3O3EB 2QGEA 5IBUB 3KBFA 4JZNA 4JMNA 2EADA 4NGHH 1UZ8B 1PD0A 4FQQA 2ZD0A 2NY7L 3EOTH 2DIJA 1IC7H 1ODUA 5CUSH 2X4RB 1X5GA 4XN4A 4GP4B 3PDGA 5SWQB 3VFWA 3GHPA 3TURA 1DBAH 1QRNB 1VACA 3BD4A 4OZFA 3RZCC 1I8KA 3S35X 4PRNB 2RB8A 3ZKSD 5IB5A 3SBPA 1FFRA 1HCFX 2HFTA 2WXMA 4XHJC 5F89B 3QXTA 5HDRA 2MCG1 1LP9F 5BMFH 4GG6F 5D96C 4FG0A 4HPOH 3TBBA 4YWGL 2HRLA 3MRIB 3PGFH 3L5WB 2ZWNA 2PF6A 2E0PA 3KGRA 4FQLH 4J28A 5DJ6A 1UXWB 3VGAC 3QNYB 5EO1A 3LNFA 2GBTA 1D5XB 4NQEB 4NLAA 1I4FB 5DCCA 4ELKA 2APFA 3OLEA 4GSRA 1MCLA 1A6ZA 4WNSA 3S36H 2BINA 1J9CT 3TCTA 2PYEB 4XMVA 3F62A 3ZU8A 2FBJH 4G3YL 3G08B 5DHDA 5IJCC 5KJRH 4MVBC 4DN4H 3BT2H 4PVLA 4R4ND 5FHBH 5A2IH 2PXYB 4MAYB 3SCMC 4JQIA 1P6AB 4FI6A 2F8XC 4N5EC 5F96H 4AOFA 2V6HA 4NUJB 5CILH 2YKLL 4I48B 3IJHA 4X0KA 4PJEF 4KK5C 5IJDC 2CKBH 2O6EA 3WXWL 4GI9A 1DUZB 3KBEA 4LPVA 3AWGA 5ICYA 3QDAA 4WW1A 4FRWA 3PXLA 3PHOB 2QBWA 1D6EB 1HHKA 3FUKA 3QIBB 2DDQL 1DJXA 3BIAX 1ML0A 5IOPB 1XSKA 5AYUL 2WB1A 2AABL 1IE5A 3DVGA 3OG4B 3ZTNL 3MRRA 1Y1DA 1A8ZA 2J73A 4L9DA 4LCCC 1P9MA 4BCYA 2VWEC 2Z8VC 1XF5A 4MDIA 3FFDA 1N4XH 5FYLL 3WOVA 3RQ3A 4G80B 4Q7DA 5I16B 2WWNA 4XOEA 2GUOA 3CVCA 4JHWH 1Q9OB 1X9QA 4FLQA 5EZPA 2GIXA 2DL2A 1P5UB 3O3BA 2BY3A 2ADFL 4XVTH 3BH8B 3X14B 3SDDB 1JIBA 4HJIA 1ACXA 4M61B 4PBWD 4LP5A 5TE4H 5JOPD 3QIWA 1UYWH 2F08A 2XQYG 4FAAB 4PY7A 5HI5C 1JZ8A 4DQOH 3H55A 4PJAE 4P48A 1DQKA 4IQHA 3SDYH 3MUUA 4LSQL 3N0PB 2Y3AA 5E4AA 1RULL 5GISL 3S5LB 3FUFA 2JKSA 4QTFA 3NZHL 1S7TB 4HC1A 2R23B 1S5HA 5T5NF 1HINL 1WGVA 4QRSB 4NI6A 4QD2E 1E4WH 1AZZC 4Y16B 1HT6A 2HKHH 4Z77A 2YD3A 1DSYA 3U0WL 5BS0B 2QHRL 4PW9A 2Y7OA 1PFCA 4PJDE 1CXIA 4JFYB 4I4WB 5B3NA 3Q06A 1F3DJ 1HSAA 4Q0XH 2LT9A 1E6JL 1HCYA 4ZMTA 5ADPL 1WIOA 4HFUH 5E99H 1G84A 3E2HC 3C08L 5JPNC 2ZWYA 2ZOLB 5EU3A 5FKPB 5IHUH 4L2LA 2ADIB 4D0DB 5I75C 2RCSL 2DQMA 2A83B 1GMEA 4ALAH 3VFOB 3NGBB 3WLWD 1MIMH 4LMQE 1UZ6E 3E1ZA 4XMXA 1IVLA 4MMXC 4OR1A 4FFZL 1QRNA 3HG1A 1VGKA 3AS1A 3NEOA 4L8SC 4URKA 2F53B 3EDJA 2X7LA 4QHMB 2VERA 5C07E 4NKMB 2X4PB 4N85A 4TF4A 4F5CA 2VXQH 2X4UA 1ADQL 1V3LA 1AGBB 3QZWG 1TQVA 1KFGA 5AZ2H 4ZNCD 3FF8A 3MRIA 3WSQH 1MG3C 3L5WA 4YFEA 5FO7B 2J57A 5CSGA 2CIKA 1FNHA 3QORC 5MEND 5MERB 1M1XA 3LQAC 2B7DT 5EC2A 1I85C 2CGYA 4ZJ9A 3WFEH 2Y07H 3VFVB 1KIRB 4WO4B 4MNQB 3EYUL 3IAGC 1XF2B 2R4RL 4ODSL 4G7SB 5FDWB 1MWOA 1PPIA 4LSUL 4QHKI 5GGUB 4XCCL 5IIEB 1P1VA 3DHPA 3POCA 1CQKA 4AVHA 2VDKL 5L88H 4O00A 4LP8A 4WWID 2H6PA 4MAYA 5I1HL 3ETBF 5IROA 5C97A 3RL1A 2UXFA 3ZR6A 4P4KB 2GY5A 5GQBA 4NUJA 1MCNA 3GTTA 3W0WB 3K91A 4KK9D 3U25A 3BQVA 5MENA 2NY0B 1PL3A 4ESKA 1N0LB 1DUZA 5L2KB 3MVSA 5DD0L 5CZXC 2HJKB 1R3LB 3EF4A 3DOIA 1TJGL 1CD9B 4Q9QH 4EVNA 1FL6B 5LN4A 5IOPA 3SE9H 1JCKA 2IH3B 4W9ZA 4MQ7B 1HEJC 2CA3A 5D7JD 4JFPB 3LXCA 3V0WL 4KU1A 5GGQH 4DP8X 1BQSA 1CDCA 1Q72L 4ANUA 2FGWL 3V79C 2ZWSA 5IZ7A 1KT2B 1NBZA 4GIAA 2VMJA 5D71L 5T5FL 2DQIH 3ZTEA 2NT0A 3QUMH 2ZUQC 4G6JH 2VH5L 2E59A 5EIIA 2Y6TE 1I3GH 3HCVB 1P5UA 2SEBA 2EIDA 2A77L 4ZXBC 2I07A 4HIPA 4UOZA 2NY3C 2VL4A 5D5MF 1J18A 3ES6A 2WQXA 1KBGH 2J8UA 4P57B 3RA7L 1QQDB 2KI6A 3FS9A 3V0DA 1AYRA 3GSOB 4QOKB 3FYEB 4LSRL 4ZOBA 5ANMB 3S36X 1I1AC 3ZDWA 4GMTL 4X5XB 4JY6B 1AG6A 2R23A 1GYUA 3MLXH 1T22A 2FH6A 4JFFD 1K8IA 4BH8B 1H6FA 1A1OB 4H2CA 3FTSA 1A7OL 4Q6YA 3D9AH 3CHXA 5IKCB 2YMXL 1JSYA 2CLVB 4ODUA 3RGBA 1MN4A 4KDVA 3CLWA 5SWZB 1FFOA 3ARTA 4EDXB 3QQDA 4F8QA 5I1CL 3PGDB 4IRZH 4N90D 3ZL1A 3ZT5A 4HJJL 4KOBA 4Y4KB 3GJEA 3BZ5A 3OXRA 1Y18A 4DTGL 2KERA 1II4E 4JDTL 1BAGA 3MJ8B 4J4PC 1FSKC 4Z7VF 2VNCA 1KCLA 2VUKA 2ZOLA 2OJZH 4JFHD 3IFPB 2CR3A 4WHCA 4JFED 4K3EH 3L3DA 4D0DA 4A66A 4JFFA 2C3WA 2CXKA 1EFXA 2X42A 1G4MA 4HBCL 4XO5A 3H9HB 3CC5A 3TA3D 2NW3A 5D5MB 4H25B 4WIQA 5L8KB 3L4TA 5J6HA 4B9YA 1AQKH 3MO1A 5FHAL 3BC9A 3K5RA 2VR7A 3JYBA 3QS3A 4I77H 4XCFL 5A7EA 3ZDXE 4N8CH 4NO0D 2CNYA 1PG7H 3NCXA 2X4PA 1BLNB 4B9ZA 3DJTA 1AGBA 2PPCA 4JK0D 1JV2B 1EHNA 3EDKA 3WNKA 4HUWA 2NPLX 5GGVL 3QA3B 1IQWH 4G5AA 4X6FB 3S34H 3VQ2C 5T3XL 1WICA 2KMWA 4GKLA 5MERA 4Q4IA 4GRWB 1DBKL 3N40F 3LVTA 1KIPA 2VN5A 3OAYH 3SGDI 5HPMA 1S7SA 3CU1A 4TPRH 1WHPA 5ESVB 3CE1A 1IUZA 3WELA 5CCKH 4WO4A 4CN1A 4MNQA 5ES4B 2F74B 2GBUA 3KEHA 5C08E 3SGDH 3WJJC 1XF2A 2FSDA 3QIUB 2Z1KA 3GNMH 5TK4A 4LOVA 3SEPA 4Z7VB 3H2PA 1C16A 5DUMH 5T3XE 3Q9PA 1CU4H 3GMRA 3P4OB 5FGRA 3CFCL 4LCYA 4TKWA 4AZ8B 4WI5A 1U3HC 2EVHA 3DTUB 3BWUF 1BF2A 3EHBC 1UA6L 4G6FD 2GQHA 5CS7A 3OR6A 1S78D 2Z31C 3MROA 4O02A 4P4KA 4JVWA 5A6LA 2EUZA 3DK0A 4AV4A 4DN3H 4A37A 3H1ZA 7FABL 2CHXA 1N0LA 5AVUB 1WFTA 2ZUVA 3RPBA 1RIHL 2ZXQA 4ANXA 5IBTL 3LPGA 1UJ3C 1FL6A 1YSOA 2EZ0C 3V9EA 3WDJA 4IRSD 2DJMA 3RDTC 2YC1A 4RGMC 2CA4A 3NFSH 4Y2DD 4UQAA 3F64A 3FQXA 4GEIA 3N04A 1VFOA 3TCLB 4CU8A 2LHAA 4LRNL 5CZVH 2O4EA 4YHLL 4UTBA 2NNAB 2AI0H 2X3CA 4FXGA 1ZS8B 2N3JA 2G5BB 4B3EA 5ICXB 3F7LA 3M7FB 1MIEL 2HKAA 3QHFL 4YUEH 3MUJA 1OXYA 2BP8A 1VEPA 4E9TA 4OD1L 3EH5B 2C8NA 5C0EB 5D7LB 3UTPD 4KPHH 3UCRA 4UNUA 3BGFB 2FECI 4P57A 4FNLH 3O2WL 1QQDA 5IGXH 1JRHL 3ARZA 4RGOH 2QMKA 3GSOA 4AMXA 5K9OA 1KJ3H 1LK3H 3QDMD 4U1MA 2XA8H 1RMFH 4LPTA 3JWNH 2V8LA 4A6YL 1EAJA 4KMTH 2R1YB 1CTOA 3CUPB 2EECA 4PJHF 5D8JH 5C0RL 3J8F7 1SLUA 2B0SL 2IPTL 3BGAA 2NSMA 2KZWA 4NENA 1QR4A 1HOCB 1KJ2A 1AS7A 1D5MA 4W68A 4K7FB 3LD8C 4FTVE 5GRUH 4LFHG 1UACL 3UC0L 3UC2A 3UYRL 4DP5X 4EDXA 4EKXA 3PGDA 1DVFD 2ED7A 3JXAA 2DM7A 3O45A 4Y4KA 1T89C 1U2YA 2ED6A 5EU4A 4B27A 1NOFA 3AG2B 3ALXA 1MAML 3BKJL 4FFWD 1KV7A 5GGTH 5L6YH 5AYTA 3EOBB 4ORZC 2W0FB 3QDMA 2WO4A 2HJFA 3BAYA 4JJ5B 4IIQB 5EOTA 1AHWA 1ZT4A 2HRPL 2PO6D 4HF5L 2ZG3A 1F4HA 3GIVB 3W5MA 1A3LH 1BM3L 2JKJA 1NBVH 5AAPA 3T77B 3L1FA 5F9JA 3EYQC 4L3FA 1R34A 1G9NC 3WN5B 3FRUB 2J44A 2BZCA 1H8LA 1MPAL 3QUYD 2G3NA 3WLBA 1UATA 2A9MH 1PZCA 2X9YA 3MA7B 4NWTL 4PJ5E 1EVUA 3GRWL 1NC4D 4I2XE 4RMVA 1EBAA 4UIKL 1NMBH 2F7PA 4CSSA 2F0CA 2L7UA 4HWEL 3EYVB 5LLIC 2CBQA 2GW5A 4HIJA 6CGTA 3QA3A 4PJHB 5JZ7D 3UZEC 5L9DH 2PO6A 2WLLB 2DM2A 3BXNA 5C09B 5IW1A 3ILEA 4PWIA 3SBWA 5KWYC 2R69A 1SFHA 4MJIE 2XQYA