2IDSA

Structure of m98a mutant of amicyanin, cu(i)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idsA00
4BK5C 1PLCA 1TEFA 4P5SA 2FQDA 1W6LA 4DPCX 5TK4A 2ZWNA 3NYKA 1JZFA 4QKTA 2HZHA 1OE2A 4F2FA 3S3CB 1SF5A 1TU2A 3FSWA 1AIZA 2XVBA 2PCFA 5I5MA 4A2HA 3OM3B 1BQRA 1NWPA 3PXLA 5EHFA 1KV7A 3QJVB 3IN0A 3FT0A 1NIBA 1E65A 1JVOA 2IAAC 1JOIA 2YAHA 5F7AA 2B08A 2IDQA 4HHWA 4M3HA 3NJGA 1J9QA 4KOCA 1SDDA 1RZPA 2PPFA 3TASA 3UGEA 2FQGA 3EHBB 3NJHA 4YSAA 1NIDA 1PMYA 3FU7B 1WA1X 3EH5B 2NRDA 4YSOA 2OCCB 4HZ1A 4G71B 2BWIA 1L9PA 3EH4B 2AZAA 2QT6A 2GHZA 4WTQA 4AI7A 2CBPA 1AS6A 4YSQA 2PCYA 4FA7B 1L9RA 1L9SA 3NJLA 1WA2X 4KOBA 3CVDA 1OE1A 1B3IA 2GI0A 2CUAA 4KO7A 2BP0B 2TSBA 3N55A 3H56A 5D4HA 2A3TA 1PNCA 5B7FA 2HLEB 3T6VA 1SF3A 1PLAA 4E9TA 3S8GB 1HFUA 1IBZA 1GY1A 4HAKA 2VM4A 1L9QA 3UABA 4YSSA 1QNIA 4BWTA 2J55A 4YSUA 4G70B 2CALA 3GYRA 2YAOA 3NP3A 1A8ZA 4BXSV 2FT7A 2DYSB 3FYEB 2IDUA 1ZDSA 3X2QB 5B1JA 1V54B 3UACA 3ABGA 1CYXA 1TKWA 3C75A 1OE3A 1PNDA 4YL4A 3NT0A 4KO9A 2CAKA 3T6XA 5B1JC 1ASOA 4X4KA 3T6WA 3AG1B 3DKHA 3TBBA 2IDTA 2WSDA 3IEAA 3TBCA 2E86A 2XV3A 1XMEB 2BWDA 1MZYA 4ENZA 2I85A 1PZAA 3AY2A 3WNIA 4F7KA 5I28A 4YSRA 2XLLA 1BYOA 3KW8A 4AZUA 1WAEA 1NZRA 4HHGA 3UADA 6PCYA 2FQEA 2QPDB 5I6MA 1A4BA 4P5RA 4YVNA 1TEGA 4E9RA 1BEXA 5AKRA 4Q89A 3NSFA 4YSEA 2ZONA 1GYCA 1GS7A 1AZBA 1JERA 2YARA 4YSCA 3ASOB 3PCYA 4JKNA 4DP7X 2H3XC 5B7MA 1I53A 3FSZA 2PP8A 1W8EA 3QQXA 3IBOA 4BDVB 1CYWA 3MX0B 2QDWA 2AVFA 3ZBMA 3CVBA 2GIMA 2VM3A 2BZ7A 4MFHA 2UX7A 1JZEA 2FT6A 5PAZA 4AKPA 1NIAA 6PAZA 1MG2C 3ZIYA 4E9YA 2VW7A 3U25A 1DZ0A 2UXFA 2MRYA 4HIPA 3NJFA 3SQRA 5B7EA 4HCGA 3QJUB 3WKQA 1E5YA 1OCOB 3N2JA 1NPJA 1F56A 1N68A 1A4CA 5F7BA 3RYMA 4E9QA 5FC9A 3T6ZA 3T9WA 1AZRA 1ET7A 2Q5BA 5I6NA 2BO0A 2DY2A 4GXFA 2AZUA 1NTDA 2EIJB 4A2GA 3AZUA 2XXFA 3NJNA 4N8UA 4KO5A 7PAZA 1JXGA 1SFDA 2QPEB 4G7RB 3S8FB 4PCYA 1VLXA 2N0MA 2YAQA 3CG8A 2VN3A 1WS7A 2IWKA 9PCYA 3FU7A 7PCYA 5I6PA 1AOZA 1JXFA 3X1FA 2R7EB 3WNJA 1NPNA 1KCWA 1NDTA 2X87A 4DP8X 1RCYA 2BP8B 3JT2A 3UAAA 1KBVA 3WI9A 2QDVA 5B1BB 4BWWA 3CZUB 1KDIA 2OJ1A 4DPBX 3NJKA 2IWEA 4YVUA 1MG3C 3IN2A 5I6LA 2DWTA 2FTAA 3NP4A 3PPSA 5B1AB 4A2FA 2OV0A 3FQYA 2GBAA 4FAAB 1FA4A 1HAUA 2EILB 2P80A 4EF3A 3NJJA 3SBQA 2EINB 3UAEA 1BAWA 5E9NA 8PAZA 1A4AA 1AZCA 1L9TA 2J56A 2YAPA 1OCRB 1NINA 2XWZA 2YAMA 4JHUA 1ET5A 1SNRA 3AG4B 2GB2A 2BW4A 2UXGA 3OMAB 3CVCA 3WIAA 1J9SA 5I5IA 4K9JA 1M9WA 3D12B 2IDSA 3G5WA 1KDJA 2WO3B 2CCWA 1XB8A 4NERA 1NICA 1GS8A 3GXUB 1T5KA 1AACA 2PLTA 2XV0A 3GDCA 3SBPA 1PZBA 1R1CA 3PAUA 1KYAA 1X9RA 2XX0A 4RH4A 2AFNA 3PAVA 1FWXA 1M56B 1PCSA 1IC0A 5TK2A 1ETJA 2AANA 1E5ZA 1ASQA 3EF4A 1GY2A 2GSMB 2B3IA 1E30A 5I5JA 4W9ZA 1ASPA 3QJTB 4WKXA 1XB3A 1BQ5A 4L0PB 3V9CA 4DP0X 3QJRB 2YAFA 1PLBA 2FJSA 3ABKB 1NIFA 4UAHA 4NAJA 4A68A 1BXAA 2GC4C 3EH3B 2EIKB 1PZCA 1JZJA 2H47C 4KNUA 1J9TA 2HX9A 2VW4A 4DP9X 1ZDQA 1KBWA 2IH8A 3ABLB 1SJMA 3DIVA 4AX3A 3NSCA 2IDFA 4KNSA 1ID2A 1IBYA 2WO2B 3V9EA 2BW5A 2PPCA 1AANA 3WG7B 3WKPA 2PPEA 4A66A 2BZCA 3AG3B 1ZPUA 1AS8A 2JKWA 4G7QB 3HEIB 1AQ8A 1JZHA 2H5UA 2HXAA 1X9UA 2XYBA 4W1TA 4E9SA 1ZIBA 3CDZB 3AG2B 2XV2A 1AZUA 2Q9OA 3OMNB 2GC7C 1J9RA 3X1EA 3SBRA 1FFTB 2MTAA 1JZIA 5A7EA 4YSPA 3OD3A 1KGYE 2CJ3A 3ABMB 3T71A 3OMIB 3H4FA 3QPKA 1V55B 1QLEB 2XX1A 1PF3A 4A2EA 5IY5B 2P80D 3X1BA 1L9OA 3ERXA 2PPDA 2FT8A 1ET8A 1AR1B 3PLYA 3S3DB 4DP4X 1AG6A 4CSZA 3DTUB 3FPXA 1GW0A 2R7EA 2IH9A 2BP8A 3ZX1A 2UXVA 4G7SB 5LDUA 2XU9A 1JZGA 4UANA 1XB6A 2HRGA 3QJQB 4N4YB 3BQVA 4A2DA 1JXDA 2Y69B 4E9XA 2W8CA 2YXVA 2PP7A 1ZV2A 3X1GA 1HAWA 2LLNA 1RZQA 4NB7A 1BYPA 4DP6X 3FSVA 1DYZA 1SDDB 4GY4A 2BP0A 1BXVA 2ZOOA 5D4JA 4A67A 2EIMB 1SHXA 1CUOA 4KO6A 1ZIAA 4TXVB 3TA4D 4DP1X 1JVLA 3H4HA 3KW7A 3QJSB 4GP8B 1NWOA 1ADWA 2ZXWB 3ZDWA 4E9VA 2J5WA 3AW5A 1MZZA 5I26A 4ZK8A 5PCYA 1SFHA 2JFCA 4GYBA 4Q8BA 4DP2X 2YAEA 2X88A 1E67A 1QHQA 5I6KA 3HB3B 1AZNA 4G72B 2HRHA 1EHKB 3FSAA 3L45A 1J5CA 5D4IA 1AG0A 1AS7A 2JXMA 3PAZA 2DWSA 1N70A 2I7OA 1GS6X 2PPAA 2TSAA 4AKQA 1RKRA 2Y1AA 2HX7A 2YQBA 4E9WA 2IWFA 3OQRA 2UXTA 1WA0X 1YLBB 2VSKB 5AFAA 4UF7C 3NJMA 4HCIA 4YSDA 1ILUA 4M4RB 3BVDB 1OOWA 1A65A 2W88A 3IE9A 1GR7A 5ANHA 1GSKA 2UX6A 4YSTA 1CURA 4KNTA 3MBWB 1OCCB 3NSYA 2DV6A 1OCZB 2VMJA 4BWUA 3FS9A 1EZLA 1BXUA 1V10A 2XXGA 4BDVA 3FQ2A 1CC3A 2FWLB 1BQKA 1IKOP 4F2EA 4HALA 5AZUA 2J57A 1PAZA 3TU6A 3ASNB 4QLWA 2VW6A 1ILSA 5B1KA 4GP5B 1URIA 1AAJA 1J5DA 4PAZA 1PY0A 3S3BB 5I6OA 4AKOA 2HX8A 3CDZA 2XUWA 4JHVA 3X1NA 3NJIA 1WS8A 3FQ1A 2PP9A 3FPYA 3FYIB 5B3SB 4GP4B 2FQFA 4BXVA 1SHWA 1W6WA 2YXWA 3FU9A 4DPAX 1IUZA 2BHFA 1NIEA 1KCBA 1UATA 2I7SA 3NSDA 1OF0A 3FU8A 2DYRB 1OV8A 2VSMB 4CSPA 2FNWA 4HCFA 1MDAA 1A3ZA 3JTBA 2RACA 4DP5X 1M57B
chains in the Genus database with same CATH superfamily
1QUPA 1Y6KR 3DOHA 4M8VA 5KTEL 4IMLB 2ZWNA 3BESR 4HIEB 5E8EA 4AM0Q 2F53A 3DTXA 1OOAA 2O6DA 3ESOA 2P8LB 2XNAB 1ORSA 2CRZA 5L6YH 4Q6YA 4Y5VB 3OM3B 1H8NA 4JRXD 5IW6A 5J13C 3V0IA 1A7BA 3B1UA 3HZMB 2NZ9C 5AKSA 1JGEA 1DVTA 4Z6AT 4JE0A 5FWRA 4S1RL 5T1DL 5C0AD 4W81A 4HHWA 1RURH 2WLKA 4D9QE 4ENEC 4FA8A 4DH2A 2DLIA 4GG8B 3RE0A 4R8WL 1D2PA 4D9LH 1E9QB 3PV7A 4UIMB 1ZLSH 15C8L 3ZRSA 5CFHA 4PJFE 4XB3A 1S9VB 4AENB 4DEPB 1I8IB 4CGUB 1EZUA 2OXHB 1YCSA 4OUUA 3ARDC 1YAZA 2P8MB 1JHKL 1IBGH 4MWFB 3IDYC 5HDBB 4YJZL 4Z3HA 3APDA 2X4SB 4WW2C 4F15C 1UZ6F 3OG6B 4YE0A 4PMFA 5IJCC 4OFPA 4MQXC 3BEWA 4H40A 3BIKB 3FTUA 3BYYA 5E2TH 1CS6A 4HIIA 4FLQA 4TUUA 4XBEL 3LHPL 2FECI 3RKDC 2GJJA 1P53A 3KLSA 4ADIA 2VRQA 3SY0A 3G7TA 4NWUL 4YBHA 2R2EA 5BQDA 2QQLL 3UJTH 1IBZA 1F11B 5ECGA 4EPSA 4ZJ9A 4RAHA 2OXGB 1YDPB 1F58H 3RFRA 3BISA 4U6HB 4X9BA 3WEAA 4CL7A 2UWEE 2OYLA 2GY5A 2EDXA 3CVHL 3J27A 4LLUB 3VA2C 4M4RA 4J8RA 3E1ZA 3O3AB 5E2UH 4UTBL 3ZUCA 2DWXA 1Q1JL 1A8ZA 1KY6A 2XWBB 3D85A 5EO1A 1OLZA 2CKBH 3EO9H 4UQBA 1V54B 4RFEA 3BIBX 5E99H 3VAEA 1QLEL 4HH9A 5K1JA 3WHE1 2FIKB 5L88H 2G60H 5I16B 1B4JH 1QFUL 1R5IB 2PW1A 4KHTL 3GMLB 3WSQH 5IIEB 3HI6L 3ZIMA 2QBWA 2FEDD 2LV4A 4WJG3 4X9YA 4PRAA 3VI4F 1T0NB 3CFEA 3CN2A 4HXAL 4NYLB 5DA4A 4YHZH 4E5XA 1UJ3B 2NR6D 3ESVF 3CN4A 2X1OA 5KBDA 1NANH 1P7KA 4GLRI 1I82A 4PJHA 3CDCA 3QUMH 5FV1L 4NHCH 1RJYA 2BFVL 2WUCH 3IDNA 3R8QA 3ULUC 4K9EH 1AZBA 2QV2A 2YARA 2VWEC 3NOIA 4NPYB 5CSGA 3KPRA 4L3EA 3LRSA 1V8HA 3BH9A 3C87A 1FL5B 2HT3D 4WFGD 4X6CE 1W8EA 4BDVB 3FZUC 1SPDA 1ZLUK 2QDWA 1GC1L 1IGIH 2B20A 5HI5C 4FQ1H 4YOKA 3L2NA 3GIZH 1N9PA 3MLSL 2DICA 4AUYA 4J3OC 4OJCA 2NTFB 4E9YA 1I1CA 4PRPA 1H6TA 1R5WB 2UXFA 2N7BA 4HIPA 5J6GA 5BUAA 5IMKB 2Z93B 3L9RB 5DJCA 2WXOA 4B9YA 1S7WB 1O7DE 1IIKA 4D0DA 1X4YA 3SQBB 3N6YA 4WFEE 2NSMA 4PJGB 5EO9B 3GBMH 3VD9A 4X6DF 3U9PH 1QSFB 2P8PB 5HP5A 3LKOA 5IVXA 2I5YL 4FEIA 1QABA 3IFPB 2QVMA 1GGCH 2XN9E 4IOSD 1SXAA 4RBPH 2IADB 2BO0A 3ARBB 3GSWA 4LNRA 2ADIB 1RFDL 2WM0A 2WYZA 1DQML 3D7PA 1KPRA 4R5XA 4UQ2B 3QWOA 5IMLB 4Y5VC 1N5AB 3LPFA 2AMUA 5IOPA 2QPEB 2D9CA 2CK0L 2GIYA 1E40A 4KXZI 5CN2A 5INDB 2YK1L 4Z7VE 2E7BA 4ODWB 2VDPL 3SGEI 3KGTA 4A55A 1OW0C 4FTVA 5GXBB 3VXRD 4N0FB 2BP8B 2H6PB 2M8XA 2X4PA 2O61B 2OMYA 1T03L 2WVUA 5DQ9A 2Z31A 1RJLB 2WB7A 4V11A 2A2QT 3FQNB 3MLPA 4HDIB 3OR7A 4CC0A 2GHWB 2ZP8A 1CD8A 4AYMC 2B1HL 1HESA 2WXMA 4DEPC 2OMTA 2VH5H 1CFNA 5A2JH 3FN3A 3QZOA 4Y16B 1TJMA 1J0JA 5F2FA 1TSRA 4C56D 3MUGA 1A4AA 1AXIB 3DO7B 3NIFB 3FT9A 1D7DA 2JCCB 5TF0A 2Q8BL 5HHOB 2YAMA 5FB8A 3V5HB 4BH8B 4PY7A 3VJ6A 3RWFA 4DK3A 2UXGA 1U21A 4NUGL 4K9JA 2K1MA 1M9WA 3BGMB 4JRXA 1KLFA 1U6AL 2HCZX 5IB2A 2YBGA 5DZVA 1ZVYA 5DD6B 1G43A 4ODBD 3VFUA 1AACA 3AWGA 5C0AA 3V6BR 3EDJA 5GHWH 1FCCA 1R1CA 4CN4A 5IWLC 1IE4A 4LOVA 2VITB 3GJEA 3L1OH 4H88H 2K4WA 1FFOB 5CWSB 2QKIB 5LGJB 4LSQL 4XVUD 3U6XA 4LEXH 4KPHH 5FO8B 2XVKA 5IBUB 3NN8A 5GGTA 2TRHA 5FDWA 2GY7B 5GS0H 5DR5H 4OGXH 3HPJA 2R69L 4FCAA 4PJ7F 3DJZA 5ESQA 4L8DB 3FUMA 3A6BL 4QGYA 1IAOB 4JY6A 4RSVA 1MCNA 3FO2B 1J8HB 5AZEH 3F7VA 3I02A 2DB8A 4M62L 2J1ZA 3I6LE 4NO3A 3N1GC 2ZOUA 4F7CB 4QRRA 5ITFA 3NCYP 3QFJD 4B9PA 4J12A 2ENQA 2ZQKA 4UQDA 4NQVB 2VXQH 3W9EB 5EEVA 4NOFA 1X5IA 3SO3B 1BVLB 4ZMWA 1ZHNB 1UJ3C 3UZVB 3QAQA 1HIML 3LNIA 1FJ1B 4ODTL 4PHXA 1ZDQA 1M71A 4XNXL 1IAKB 2A6JB 1FN4A 3DIFA 4AX3A 1E9OB 3MX0A 4JRWA 2RCSL 2P4AB 3EADA 5EU4A 3WOVA 1UTDA 2LOEA 2ZP9A 4G80B 1ID2A 1WBZA 4P3CL 1BZ7A 5E94A 3L7FA 1MCRA 5GRUH 1GAFL 1KCUH 4P23A 3RI5K 2GKIA 4OZHE 3WJMA 2VMFA 2V5TA 4HJSA 4S1DD 3IJYA 5DS2A 4PJFF 2HT4C 2QSVA 4PGCB 3QA3B 4J27A 4KRPB 5DJ2A 4D0BB 4NENB 2DQ6A 5I1LB 3SGDH 1DQQA 3NIDB 4ABVA 3T0VA 4WHTA 2O6FA 2Q9OA 4QDGA 1MXDA 3KLLA 4PRDA 4HFWB 3OF6D 1JZIA 5F3HA 4LLVA 4LEOB 3LNFA 2F1AA 4KVCH 1IFGA 1KGJA 3O2WL 1XR9B 4Z8FH 4GW5A 2FR4B 1GTFA 3Q8EA 5LG1A 4KTEH 3DX6B 3V0WH 5ICZB 3T3PE 1A4KA 5BUPA 4X5QA 3F3HA 1GL4B 3VVWA 1J0IA 4AMKH 5IY5B 3RVTC 1I8KB 3TN0D 4NQCA 1ET8A 3MFGB 4K55A 3HMXH 5D7LB 4X8JA 3VXUA 5KVEH 4WUKH 3ARBC 3FFDB 1AG6A 2Y5QA 4MLIA 3GLEA 4OFYD 5CGMA 5FR3A 5F7YC 1LMKA 4XVTH 2UWEF 4ETYA 3WIFB 3VE0B 3UMTA 1ZTXL 4UQ9A 4MNGE 2EYRB 4QRQB 1A4JA 4CU7A 1SM3H 4P57A 1ZLVK 3NTCL 2R4SH 3KXFD 5EO0B 1NCAL 3MLUH 5J1AA 2AABL 2QKSA 5D7IE 5JIKA 3VA6A 3EGDA 4DCQB 4G2AA 3O11A 3QJZA 4Y2LA 1WDAA 2JK5A 1MWAL 3TO4D 1XGYH 1BYPA 4OM1H 1SDDB 1JL8A 3F7LA 3X3GL 1KF9B 3B2VH 1BXVA 3L7EA 3QQDA 3TT1H 1IKFH 2BIIA 1ZY9A 3N40F 1BQHG 4XMVA 5SWSE 3MRPB 4GKLA 2YPLD 4F9PA 4KY1H 1HS6A 3S3JA 2XY1A 1U8OA 5BJTA 3KW7A 3HC4H 4BHUA 2CPCA 3ATEA 4Y16C 3BAYA 5ID0A 1FNEA 2OZNA 4IOSA 4PW3A 5A1AA 4WO4B 3GBEA 3S88L 1DL7L 3K91A 4YN3A 2EXYC 1QQDB 4AQAB 5K9JL 2NNAB 3I9PA 5DHYA 1WHPA 3QEGH 5JLZA 3S98A 1G5GA 1AGDA 1QFWL 3GXMA 4EUPH 3OB0H 4LVOB 3H2WA 1XD1A 4MS8D 4X6CF 4F57L 3V5DB 3ZKND 1R3HA 2A6KB 1EHKB 2AK4D 1Q94B 3EOAB 3ZE1B 2EABA 3L5HA 2YOCA 3VXRA 4UT6H 3E3QC 1Z9LA 4K0OA 5HYJD 1B0WA 4PSRA 1DCEA 2QKIC 4JY5L 1SY6L 1BVOA 3SE8L 4PVMA 4FABH 5EN2B 5F7DA 4OGYL 1AVAA 1JWMA 3B5HA 3H8NA 4LIQH 1IGML 2PO6D 3UTOA 1ZHBA 1RZKH 3NJMA 3ZDYF 1AQHA 2MKLC 4J7RA 1ZT4B 4ZW5A 5HHVL 1C08A 4LAJH 4RGND 1KLUB 3EYSH 3LNHA 3MV8A 4FQPA 2UX6A 4L2LA 5GGSY 5TE4H 5TGBA 5MENB 4RX4D 1TKWB 4WNQA 5LO7A 1CXIA 4YO0A 1QR1B 3T09A 4HS6A 3T4AA 3VSVA 4JFZH 2P5EE 2Y6TE 1U41A 2VE6B 4LP4A 3IDJB 1CQKA 4NQQA 3SD2A 3ULVC 2EUWA 1JS4A 1KY7A 5DK2A 2WTPA 3HUJE 2Q7YB 3SE4C 3SO3C 1IKOP 4ZD3H 5C8JB 3BW9A 3TU6A 3ASNB 1MHCA 4Z7VF 1J1XL 3R7QA 4ZRGA 3RUGB 2DQFA 2WHVA 1KENL 3NZHL 2R29H 1W91A 3ATDA 1CICC 2CH8A 3VI4A 1DVYA 4XPAL 1P6AB 3MXVH 1AQKL 1WS8A 2AJVH 3SE9L 3DJ9A 5TE7H 4UQEA 5I74B 1GXEA 1HX0A 2VLMD 1BZEA 4JREB 2PP9A 4QHMB 5B3SB 3F7RA 3KYNB 4OJDH 5GZOC 1N64L 4KRPC 1BAGA 1Q72L 1T20A 1U92B 4PG9A 4ANVA 1KJ2H 4DPAX 4G11A 3QO0A 4UQ3A 4Q2ZA 5I8EB 4YK4B 2ZXBA 3OKLA 1JBJA 3DC0A 3EO0A 3MJ8B 4JFQB 3VFVA 4WI7A 2XRAH 5DTFA 1QI3A 5F0MB 1MNUL 3V4PH 3DGCR 1DDHB 5I66B 1QMUA 4OB5H 5I8KH 3TIDB 3U0WH 3LDBB 5LGHL 5IW1B 1MPAL 1X7QA 4G8GB 1Z0MA 5AW9B 3PU7A 4WJKB 4HC1A 1MFEL 1RIUH 4HPYH 1XR8B 2PCFA 5C3LD 4UYQA 2PCPA 5FW8A 1M7DA 1E4KA 4MDJA 3VX0A 5I82A 4FQ2L 4YDVB 2DKMA 3IDIA 3BP7A 1HOCA 4KGLA 2YAHA 4QYOB 1OT1A 3H1ZA 3R4RA 5I19L 3FU0A 2D0FA 5JIIA 5HDWA 1INDL 2VDKB 2ITDB 5IKCA 1AGEB 3KJ6L 1J9CT 1NKOA 3NJHA 3U2SB 4R96A 3KYKH 5IZ7A 4ZPTB 5F1SA 4Y4FB 2ICEB 3ESNA 3DV4B 3MJ7A 4YDKL 4G71B 3EH4B 5DUML 3UTPD 5LVEA 1A7NL 4Q14A 2VN4A 2R1YB 2WLJA 3LOWA 1XXFC 5FGCE 3MRFA 3HAEA 5BS0D 3ZQWA 1H3TA 1OCWH 1NOAA 2PCYA 2CO7B 4MA3B 1L6XA 3B3IA 1IAII 2IPKB 1FVCB 1XBDA 4KHXH 1HINH 3WGVB 2BP0B 2PMZA 4WO4C 1OPGL 2F74B 1KIPB 4OFYA 4WI0A 3QUXD 1EDHA 1FYHB 5DMGD 4E9TA 2BX5A 2LVCA 2GQHA 4OZHF 3B6SA 1RZJH 1ZLEA 3GHEL 1H6UA 3QWQB 4KRLB 3CFMA 4OZGB 1E3ZA 3KXFA 3AY4A 5LCVL 4ZFFA 3ASWA 3VD1A 1RZFL 3KPQA 5B8CB 4G70B 2BCMA 2CALA 3FOLA 3TO4A 4NJAL 1IQWL 3QIBD 4H7VA 3QNXA 2ZUSA 3SODB 4GKNB 2IDUA 4EUPG 3B3BA 1CK0L 2ROXA 2ZTBA 4Z7OB 1G1YA 1OY3B 3P54A 3CTTA 1CE1L 1NC4D 2W0LA 1UM4L 3C75A 1SYSA 2LU4A 3EZJB 3MBWA 3WNPA 2YPLA 3P2BA 4K94L 3EFFA 4KXAA 3T3PF 2VTFA 4DGYL 1OB1B 4R4BB 3V2AR 1I7UA 4IU3A 2WNGA 4HSAC 3HE7B 4U1KA 3QS2A 2WAQA 1X9LA 3GSQB 1AD9A 5KVFH 3LKQB 5DD1L 4AW4A 2BWDA 4KTDL 1M7IA 1XCXA 3LIUA 3K2UH 1GIGL 2FL5B 4N0UB 3M6DA 3LHAA 3M45A 2AJUL 4QHKJ 1A4BA 2EUZA 3NEEA 4HCRL 1EO5A 1ACYH 1DBKL 4O02H 4QCIA 2AK4A 3RY6C 1JK8B 1Q0YH 3IMSA 4TNEA 3S5YA 3NCXA 3PCYA 4R7XA 2BVOB 3GLDA 5DJ0B 4YEFA 2X4QA 5D7IF 2AERT 2EZ0D 2JV6A 2XWTA 1XSOA 1YN6B 2F7QA 4YS4A 2RA1A 3CVBA 4ONFL 3CZGA 2WKGA 5I74C 2PO6A 3GMPA 4IDLA 4JREC 4O2CA 1BJMA 3B5GA 2WXKA 2YD9A 5EOQH 3RX5A 5E6RB 3HHMA 4L5FE 5J1SC 3MYZA 1F4WH 2GTQA 1KIRB 1VCBC 5AAMA 3RVXC 4PHZA 4ZOBA 1S7RA 2FUQA 3AJ7A 4RX4A 4YK4C 3Q7JA 5D4QA 2FJHA 3LZLA 4BIKA 4N0CC 1U8MB 1ZLDA 4H8QA 3ARGD 3CAFA 1F6FB 1U93B 1PKOA 4U1NA 5CEZL 2PWHA 2ZOTA 3LDBC 1FAIH 1PX8A 4KI1A 1CDJA 4JAMB 1H5BA 3L5WB 4PGBA 1KPVB 4XGZB 2V4LA 4WNSA 3PIQA 4J2XA 4UQIM 3UPRA 1MFMA 4R4FL 4HLJA 3OJDB 1A6VH 4PYHA 1W72B 3GHPA 5GS1A 2WWKO 7PCYA 1HHJB 2EO1A 3CWGA 3KGUA 2IOIA 2EYTA 2YGQA 3BFWA 3LB6C 3FOMB 2XA3A 3CSTA 2YGNA 3EYFB 3HHSA 3KCPB 3EYQD 4PBWD 4DGWC 4NRZB 3U4AA 2H9GA 4KQ3H 1NC2A 3DVGB 3R1GL 4NHUA 4BWWA 2D4FA 3LH8A 4MDRA 4LGPB 5K9KB 1UACL 4YPGB 3WTWA 1CGTA 4QPEA 5FKAA 3ZDZE 4Y4FC 1NUNB 2XIDA 2OV0A 4YBQD 3BVNB 2ZD0A 3H7BB 3JVGA 3P69A 1IM3D 5C08E 1TZHB 3UAEA 5JHLA 1SOQA 2G9KA 3LEXB 4ZMVA 2O1AA 3HUJF 1BREA 1XH2A 2D8KA 2UYLB 4F2MA 2FGWL 1RV6X 4G6AC 2BM3A 3PS6A 2A5UA 1Z6JT 2IDSA 4RMSA 2N59A 3KG5A 1FE8L 3QQ4B 35C8H 2ID5A 5AVSB 1NICA 3TXAA 1HHHB 3WIIL 2NYZA 4FXTA 3H9SB 1U2HA 4PD4K 4LVEA 2IFFL 4JRFA 1DJZA 5E8NA 4RGOL 2K8QA 4JKMA 1VACB 5IGXL 5EF3A 5F89A 5EWIL 4OFQA 4YGVB 1RULL 3GZPA 1CDIA 5B8CC 2ODHA 1XH0A 1A5FL 1HXMA 3KMDA 4G8IB 2J8HA 5JA8B 5BMFL 4OZFB 4GXVH 4WFHE 4X6CA 1N3NB 2MSPA 1SJEB 2JI3A 3RX8A 3PP3K 5EV7A 5BS0A 5A2FA 3B2UC 3S36X 1N7ML 3L13A 5DMIL 3WU1A 3DBXA 5CJXA 4H25B 3HE7C 4IBVA 4R7VA 2CWRA 1T66D 2QVTA 3TBYA 5EF1A 1LEIB 4WHYH 5I8OH 4N86A 2QL1A 1GKOA 2R2CA 5IFAL 3CIAA 3KVDD 1NMAH 1T22A 3CZLA 3OAUH 3L3DB 2ZCLL 1YEHL 1U3HB 4MX7B 3BXNA 4HJGB 3SDCD 4LMQI 3K6OA 2XWRA 5FW6A 2E6QA 5A40E 3D3VD 3Q2CA 3VRJB 1NL0H 2WTRB 3RX7A 2LE9A 4XBPB 4YHKH 5DJ8B 3QIBA 1JGLL 1IT9L 4ZUTB 4TUOB 3UH8A 5B39A 4NZJA 4ELMF 1JNHA 4LARL 1EMTL 2JVUA 2P9RA 4JO3H 5FUOL 1JZ8A 5HGDA 1HWGB 4AQZA 3I3BA 3UPAA 4U7KA 1MQKL 1RI8A 2WGXA 2XV2A 4OCYL 2VQ1B 2GC7C 5DDHA 1HL8A 1CFQB 4IOIB 1TTUA 1NGQL 3DO4A 3VB9A 1Z9SB 3FU3A 3ILPA 4W9IC 3C09B 5E7FA 1BHGA 2CJUL 4HMCA 4XH2B 5CBEA 4ZUWA 4JG5A 25C8H 2J6EA 4TLSA 4XHQA 3O3BA 4W9CC 3ULAB 1HSAB 4LCYA 3GMRA 3B83A 5HJ3B 5HI3D 3ROLA 1EAOA 2GCYA 4R7DB 4HULB 1W16A 2Q0ZX 4N0RA 2Q6WA 5ADOL 2WN3A 2DQGL 4X4XA 5EUOA 1KCRH 1OT2A 4KKCC 1CU4L 4FGMA 4YLCA 5GGRY 1ORQA 5E8EB 4LESA 2F53B 3OWRA 3DTXB 4NQUA 4XPBH 4YR6A 3VQ1C 1ORSB 4N87A 1B4LA 3G6DH 4G8AC 1LEGA 5IW6B 2HG0A 2RIKA 2XI9A 4QAMB 4BZ1A 4KV5F 1JGEB 3TWYA 3F7YA 4BRJA 5AW6B 2W81C 4I77H 1QNZL 2CPUA 2ZWZA 5IBTL 2VJ0A 1FO0A 1JRHH 4LAQL 2P43B 2X12A 4JQXA 1KLGA 3MRIA 4ORGA 3UIYA 1JPFA 2ZAHA 1JVLA 3QJFA 4F33A 3ARGA 5AL8A 5IMMA 4QO1B 4A7UA 4C4UA 4OUUB 2APVA 1NWOA 4MD4A 1WIOA 3CZFA 3OZKA 5HYSG 1U4FA 4Z7NE 1UZGA 3WO4C 3CFDB 1MJ8L 3DDFA 5CMAA 4PJCA 4B3EA 3T3ME 3BEWB 3Q2LA 4GYBA 5F7WC 3RBGA 5H4YA 3GSNL 2K6ZA 3HB3B 1AZNA 5AB0A 3KL5A 4HIIB 3NA4A 5DZLA 5I1KL 1BGXL 5KTEH 2K3TA 3GJFH 4XCNA 2OMXA 3JVFC 2JXMA 3BKYL 4V2CB 3SY0B 4K8RL 1K9TA 1UC6A 3L2LA 4XBGB 2R2EB 3VG0L 2VLLA 4KI5E 1V3LA 5GS2H 3H9HA 2FWSA 3NCCB 4NPJA 4X7FC 2A6IA 2G4EA 2EIBA 4M4RB 1KBBA 2IQAB 1I8LA 4J8RB 4OZHA 4S1RH 5T1DH 2BVPA 1FZOA 1IM3A 2VCOA 5EO1B 1ZSHA 4MSWA 2YSTA 1WEJL 4OW6A 5J7CC 4RFEB 4XNAA 1UXMA 4R8WH 4HH9B 2DV6A 1W0WB 2NY6D 3ZXAC 1W9XA 4FFVC 3SBWC 1JGDA 1IGFL 2PW1B 2YJLA 2CDEA 32C2A 4YBLB 3J07A 3ISYA 5ALCL 1UWEL 1XF4A 1BSIA 4GW4B 1JHKH 4PRAB 1EZVY 5TE6L 4GKOA 4GRMA 1PAZA 3CFEB 3G6AB 4HEME 4B0MB 4E5XB 4J8QA 1AJ7L 1U3HC 5IP4A 1PS3A 3HI1A 4DUVA 1PY0A 2XZAL 1P7KB 4HLZH 3FUHA 3NRQA 4PJHB 4WHYG 3LIZA 1FBIL 1T04A 4JHVA 4RMRA 4JRYE 1I9EA 4XP6L 1FDLL 1SLUA 4XBEH 3TV8A 2H1LM 3LHPH 5IROC 4BE6A 1JZ3A 1PZ5A 1KCVL 3KPRB 3O3EA 4L3EB 3LRSB 3ZDZF 3BH9B 3MO1A 3DJTA 2WXPA 2O5NA 2HRPL 4GP4B 4NWUH 3TBWA 3M7OA 2QQLH 2R0ZL 1MKFA 5F1KC 4L3FA 2MKWA 1IUZA 2IFGA 2NX5E 2QVIA 4ZSOE 5A6MA 1HNGA 5DLLA 2EC8A 2OYMA 3FU8A 4M03A 3B8SA 3CVHH 1T2QL 3C09C 4JFDE 5KZCB 5EHFA 1NCTA 4UTBH 3L54A 5J6GB 5I1GL 3T6QC 1Q1JH 1W6LA 4N2BA 5DJCB 3NYKA 2O5YL 3EOBA 4OIFA 4QKTA 4D0DB 4HWEL 1R5VB 2DYPD 3QSKB 4XVJL 3BPNB 2QSTA 3UTQA 1SF5A 1E50A 1QLEH 3B56A 3OAZK 3RLSA 1MCCA 5IVXB 3SDCA 4A7TA 2GJZA 4KHTH 1QFUH 1FNFA 1BWWA 3HI6H 3PXHA 3JWNH 2FVNA 3KPPA 4LVHB 3C5XA 3PXLA 3GS7A 4DESA 1OF2A 3GSWB 1NIBA 2EKJA 4WWPA 3MQIA 5JOPE 4HXAH 2QQKL 4LNRB 5F7AA 3TCTA 4XOBA 1BP3B 3QISA 4JO4L 2AEWA 5IOPB 4KC3B 3T1WA 4D0CA 1J0HA 1XIWD 2IV9A 3LN5A 4QD2E 4ZMQA 1FNLA 2BFVH 4FTVB 4OCWL 1FAKT 1XEUA 2EVFA 3PUUA 4GSRA 3AC0A 1A1OA 5DQ9B 2Z31B 4U1JA 4UQCA 1GC1H 4U1GB 1XCQA 2QQQA 4J3WA 5CINH 3MLSH 4ABQA 1L9SA 4H13C 2XHNA 1ZV5A 4CA4A 2C3HA 4J4PD 5KOMC 3D4ZA 2OMTB 4DWHA 1CFNB 2YUXA 4ZPVA 3VXSD 1VPOL 1EUUA 1EZSA 1GYWA 1N59A 4UMSA 5TFSL 3MUGB 2IBBA 4IMKA 4ZFGL 1HT6A 1TNNA 1CFVH 1FPTL 4PU2A 1SF3A 3ETSA 2CNYA 4NAQA 3WJLA 5FB8B 2KBGA 5LNEA 2QMJA 3O3UN 4PY7B 3VJ6B 3RWFB 4HIQA 2WLHA 4JRXB 3ZMRA 4TUJA 4NM4H 1KLFB 4PI2A 4TQPA 3ZW3A 2TAAA 5IB2B 2EE3A 1KT2A 3QI9A 1Z9OA 1AQMA 1G6RL 4JL1A 1RFDH 5C0AB 3ZT7A 1DQMH 1QWHA 4NOBA 4GKSA 3X2QB 4PRNA 4TVPL 2CK0H 2ETWA 2M1KA 3VFGL 2YK1H 3NN8B 1NFDB 5FDWB 2VDPH 4CSSA 5D2NE 3ZO0A 4F80A 4JPSA 3DI2B 5ESQB 4NEHB 2KI6A 2NT1A 1UURA 1AC6A 3IEAA 4JY6B 1T03H 1XMEB 2VM9A 2WCPA 2DIJA 2FWOA 2UV3A 2B7DT 3BDYL 3F7VB 3I02B 5IVNA 3CGTA 4NO3B 1BYOA 4YBLC 1YAIA 5ITFB 1PZUB 2B1HH 6PCYA 3GMNA 1UXSA 1EO8L 4HT1L 4GO8A 5DWUL 3NSFA 2ZONA 5EZLA 5CSBA 3L4XA 4GUCA 1XCWA 4KUCF 3WY2A 2BNRE 2K78A 2Q8BH 3AS0A 4FQHA 3CSYA 1M71B 3QQXA 4AJVA 3DIFB 4Q52A 3MX0B 5EU4B 5A6LA 4NUGH 3P4OA 3D25A 3RZCD 1WBZB 5E94B 1U6AH 3L7FB 1WVZA 4JO1H 2G3NA 4P23B 4U31A 4KKPA 5T33L 3IM1A 2Z0UA 3WJMB 1CGSL 4YFEA 4KK6D 4EKJA 2QVKA 1USQA 1GZQA 2VKWA 3F62A 1CDBA 1R3IL 1E5YA 4PP1D 4LSQH 3BUDA 1DQQB 1S9KC 1F6AA 3P3YA 4Y8AA 4Z7NF 4MQSB 4PRDB 3QFDA 4NUJA 4GRWH 5L7XL 3T3MF 4NZUL 2R69H 2CK2A 4I4WA 3A6BH 2IBZY 3DVFA 4GW5B 4ESKA 5CCJA 2Q86A 2HKHL 3BPNC 4OU3A 4LL1A 1A4KB 4KXBA 4M62H 3D69A 1F0LA 1GSMA 1BZQK 5CNHA 3TC9A 1TJIL 2IV8A 2V2XA 2G4GA 3IMTA 4X8JB 1WS7A 2IWKA 4D3CL 4KI5F 4A04A 1SDYA 2X1WL 3H53A 3AFLA 7CGTA 3F6LA 1KCWA 4HG4J 1HIMH 1T3FB 4HUWA 4KX9A 4ODTH 5BOPA 5KVEE 2MMXA 3W9DA 3GZKA 4XNXH 3V4VB 1A4JB 5B1BB 3JWNG 1U91A 4P57B 4YDNA 5FYJU 2FSEA 1OAYL 3TFBA 5J1AB 4P3CH 2XG4A 4GIOA 3UPCA 3O11B 1GAFH 1K4CA 4H0HB 2JK5B 1USZA 5KSUA 2EILB 4GUQA 3SBQA 4P5TD 2OYKA 2Z31C 4U1GC 5ADPL 4XMTA 3L7EB 1GGBL 3QQDB 3GIVB 2P5WD 2DYPA 1MFBL 2J56A 4NQXA 4MMZA 4A1RA 3W1ZA 1FORL 2OL3A 1U8OB 1HHIA 4YWGL 4HSCX 3WIAA 5BJTB 1AGFA 3Q8AA 5HYFA 3MRGB 5ID0B 3D12B 1FNEB 1E4WL 3CFJB 1S2EA 5DD5L 3D2UD 4I88A 3FCUB 3ARED 2E5EA 5LN4A 4ZFOL 1WWWX 3ZZSA 4R5TA 5DHYB 5JLZB 5FHBL 4E36A 1AGDB 1HDMA 2ZKWA 1BVNP 2PXYD 2B39A 1XIWA 2FSDA 3PAVA 43CAA 1PZSA 3EYUH 4BGLA 2VLJE 3OX8A 4PJIF 3HN5A 3ATFA 5IT2L 3VXRB 1ASQA 3KJ4B 4P2OD 5BNXD 4Q9RH 2ED7A 4KROB 1ZTXH 5IEKA 2Y3AA 2OZ4L 4OCMC 4NZTL 5F7DB 2ADYA 3NTCH 5GRJL 1JWMB 1NCAH 1MHPL 2X70A 3S0PA 3W81A 1HK6A 2AABH 5DRZA 1MCQA 4DP0X 4KKQA 3RWEA 1XGPA 2DKUA 5DHVB 1T0OA 3VXTA 4J4PA 1MWAH 3N44F 1AR1D 1D6VL 4HD5A 3VXSA 5M95B 1BXAA 3MV8B 3BRFA 3X3GH 4CVUA 3SPIA 4WNQB 5DJXA 3BX7C 1FGVL 1C12A 3ECVA 1URLA 1JRHI 5I15L 4HS6B 3T4AB 1KBWA 3L4VA 1SJMA 2BY2A 5EZJB 1GW6A 1JV5B 3WY3A 5DK2B 5KAQG 1NBQA 4S2SA 3CFBA 2ZX9A 2A99A 3S88H 1MHCB 1DL7H 3WS6A 3FU6A 1Z66A 2BZCA 5K9JH 2P5PA 2DQFB 3PF2A 2JKWA 3QNYB 4V33A 1QFWH 2HXAA 2V2WB 2CE6A 4F57H 1I8AA 4P23C 3ILQD 2ZJSL 4P3DA 1J9RA 2VQTA 4WU7A 3SBRA 1LGVA 4GNKB 2I9LA 5DJ6B 2EEFA 4NP9A 5JXED 1BIHA 2NY3D 4YGAB 1T20B 2WGNB 4PG9B 4JY5H 1SY6H 2CJ3A 4A2MA 1MVYA 4KFZC 4EQ2A 1CDGA 3SE8H 4UQ3B 4Q2ZB 3EJJX 3Q44A 1B9ZA 4OGYH 4R6UA 3R7RA 3OKLB 4L8CA 4IRSD 1IGMH 1DQTA 4HEPG 3QDME 3EO0B 4IRJD 1RP8A 5I0ZA 4ZTOL 3UTSE 2FEDC 3QFJB 5KW9L 5HHVH 1YYML 1F86A 3O6LL 1OIOA 2J43A 3BVVA 4GW1A 3FPXA 1P1ZA 1X7QB 1PEZA 1AY1L 3COOA 2R7EA 2B1AL 5FYJL 4PI0A 3IFLL 1R6VA 2ADFL 1YECL 1BQLL 1IL1A 1IEBA 2PCFB 4A37A 2EDFA 2PCPB 1M7DB 4MJID 1JZGA 3AGWA 4MDJB 3RZCA 1EK3A 1XB6A 2CZNA 3IDIB 3NAAL 1QFWM 3BP7B 3FQWB 1HOCB 3S3SA 2OFQA 3L4TA 1J1XH 3JT0A 4ECNA 5EC2B 3V6ZA 2D0GA 5IKCB 5ERWA 3TONA 3NZHH 5AW2B 4P2RD 4WEUD 2PW2A 5BZWA 3WFCL 2DKSA 4U3CA 4HUCA 4XPAH 4R96B 4DP1X 1AQKH 43C9A 1PZDA 3SE9H 2KL6A 3IVKA 2YC1A 3MJ7B 3MN8A 3HNTL 5E2JA 4X8GA 2D3LA 3FRUA 3NJXA 1X7SA 1N64H 1MEXL 1Q72H 3ZDWA 4HHAA 4TS6A 1WBXA 1HL9A 3HAEB 1UOWA 3UERA 4F9PC 4X4MA 2BSBA 2G2PA 3B3IB 2JFCA 1ZGLA 2Y2WA 3NPZB 4DOHE 4ZAKA 3ZYZA 1ZVSA 4UNUA 1FG9C 1IGJA 3ORJA 4N2DA 1MNUH 4C8XA 5LGHH 1MPAH 3PRZA 4WI0B 3MNVB 4GIAA 5JQIB 3VYPA 3FQ4A 1NGPL 3FBQA 2FO8A 1MFEH 3MV9E 1SHSA 3B6SB 1E7UA 3WEXA 3KXFB 2HG5A 4ZFFB 4DVRL 1ETB1 2F61A 4FQ2H 1I3VA 4K7FA 4JG1L 3KJ4C 3KPQB 5MP6L 3EO1A 3TO4B 2V5YA 4YZFF 4KROC 3QNXB 5I19H 1INDH 5ANHA 5INCA 1NCBL 2ZUUA 3QDGE 3KJ6H 1BWMA 3FXIC 1H9DA 2JMRA 2P5WA 3MBWB 1OCCB 3RWCA 1SYSB 4F8QA 2O6CA 2B1OA 5BXFA 1OCZB 2YPLB 4C4KO 3EFFB 4OGQC 3LKSB 5C7XL 1HCFX 4B96A 4TSBL 4XP4L 1CLCA 4YDKH 1I7UB 1QEWA 4IU3B 2F8XC 3SPJA 3IKKA 4U1KB 2BVQB 1AD9B 5DUMH 2QV4A 1A7NH 4X5RA 3D2UA 1EQWA 4JVPA 2ZCHL 2DQJL 3AREA 3Q8BA 4ZBJA 2J8OA 1M7IB 5F97E 3UP6A 3QYMA 3T4AC 2E7HA 4S1SH 1BPLB 5F93C 3Q3GA 3ARSA 1FG2A 1IGCL 5GSVA 3T0WA 5I6OA 4AKOA 1BFTA 4KVNL 4QCIB 3EHBD 3S36L 4AQEA 3ZL1A 3X1NA 2LAGB 2AK4B 3F85A 1OPGH 3K6NA 1HKLL 5I0DA 4P2OA 3WNMA 2I32A 2XWTB 1KC5L 1UH2A 4M00A 2FQFA 3F5WA 1IE5A 4XVUC 3RVWC 3GHEH 2FATL 1UATA 2D3JA 3H9ZA 3NSDA 5LCVH 1HH6A 2PO6B 1OF0A 3GMPB 4HGMA 4JFPA 4O2CB 1RZFH 1A3ZA 1IQWH 1Z3GL 4NJAH 4RGNB 1CBJA 1H3WM 1CK0H 4Y9GA 2C9AA 1OE2A 1CE1H 5GRVK 1UM4H 3BVXA 4OQTL 1UFUA 4CSTA 2PUQT 2XVBA 4K94H 5AVWB 4DGYH 1KTCA 2D73A 3FTWA 4KKNA 2HSIA 3IGFA 4H0LC 2E6JA 4U1NB 5F9WB 1I85A 2JCWA 3FBKA 1E65A 1JVOA 3CU7A 5DD1H 3GM8A 4ATTA 4KTDH 4AOFA 5GS0D 4TLKA 3BUPA 1JPGA 1N12A 1IEAA 5JIPA 1GIGH 2VLRD 4KJQC 2AJUH 2V3EA 3B7SA 1B2WL 4HCRH 2G5BA 5GS1B 1DBKH 3JQOB 3SKUD 2XWJA 3N85L 5ABAA 1T0PB 5F7LB 3W0WD 2ISDA 4B9ZA 1RK1A 2D7MA 1NCWL 2XWXA 4S1DC 3KHQA 3HHSB 4ZX5A 1ACZA 1KB3A 3BRDA 2KUTA 2EDJA 5A3ID 2H9GB 3EGSA 1NC2B 4NHUB 5HVFB 3PDOB 4ONFH 4YMPA 1VGKA 5FKAB 4IRSA 3RWGA 3FT1A 5E1IA 4B5ZA 4IRJA 3HG5A 3TBVB 1S5IL 2Y7SA 4IKKA 5EEUA 2EQDA 4N20A 4BSJA 3POCA 1MLCA 5HGBA 1U8KA 2UUDH 3MZGB 5I1IL 2D2CC 5AAWA 4F2MB 4XNUH 4X83A 1ZJBA 3CX5K 3GXFA 3K46A 1AFVL 5EIQA 1QSZA 2CKBA 4MJIA 2XBTA 5IQMA 5AW8B 2VM4A 1VEMA 1ZLWH 4HEMA 1CXHA 3L3JA 4ADGA 3HOGA 3TBTB 2VYRE 5D1QE 2IGTA 3AY4C 4P2RA 4R4FH 4WK2B 5F89B 3HG1D 3MLWL 3MOAL 3NPSC 4JZOA 5JYLA 2WQSA 4JRYA 4M6NL 5C0IA 4TNWK 5IK3A 3TO4C 1HXMB 1QA9B 5CZVH 1W15A 4EO5A 2A38A 3ATBA 3WD5L 3PWPD 2YQ3A 1BD2D 3QUMA 4NKMB 4X4KA 5KYUA 2CHNA 3QXDB 2YKLL 3R1GH 2Z92B 3L1FA 1UACH 2NX5A 5BS0B 3HFML 4H2CA 1QBML 4LLDA 3DBXB 4NJ9L 4ELDA 3VD2A 4O00A 3RPBA 3TBYB 5FDYA 1ADQL 1GGUA 3NA9L 2GI7A 3CSFA 4Z5RA 3SDYL 5L2JA 4L0YA 1EJFA 2Y4SA 3PHQA 2C8NA 4IBQA 3QUXB 1PBYA 1T22B 4FX5A 1TPXB 2FGWH 2WXIA 3H3PL 5F7EL 3BXNB 3IBOA 4PV1C 1WUNT 4MS8C 1FRGL 5I1CL 3ZKNC 5A2AA 4EIUA 1N4XL 3DUUA 3LZNA 4WU5A 1Q9OA 1FE8H 1LTXA 3V7AG 1SN5A 3WIIH 3QIBB 1GVIA 5B39B 2VW7A 1U8HB 3ZTNL 4U49A 1EH9A 1JNHB 2IFFH 2KT6A 3QQ9D 5HGDB 1BFSA 4RGOH 4P2AA 4ZO8A 3PL6D 1XGRA 4UB0L 1NC4B 2PO6C 5EWIH 4XCEA 1F56A 3VNZA 1RULH 4XNDA 3A4FA 3HNVL 4RDBA 5DDHB 4Z78B 1X5MA 5CAYB 1A5FH 5KS9E 1HE8A 2FBRA 5D6CA 3ILPB 4RGNC 5BMFH 1LNUA 4HQQL 5AAMC 1CGWA 1ET7A 4ZUVB 1KYOK 5IVOA 3IK2A 5CBEB 1NAMH 4CC4A 3O3BB 3OPZH 4L1DA 5ALBL 3GMRB 1CTOA 1YJDC 2DLTA 4KTYA 3S35X 3ROLB 3WMPA 3X13A 1N7MH 4KMQA 4UMGA 3MV01 5DMIH 4KITB 4W68A 3IT8D 3V10A 5IHHA 1QRND 1CIUA 1PU0A 4XZ4A 2Q6WB 4X4XB 2VN3A 5EUOB 2X2JA 9PCYA 4FYQA 3B7YA 1ORQB 5J89A 1H5BC 3ZKMC 5IFAH 1TR7A 2V2TA 4YR6B 1TQUA 2ZCLH 1YEHH 1GPOL 1VESA 4HGKC 5GS1C 1LEGB 4RETB 5JPNA 4Q9QL 5CP7A 1J1PL 5JIMA 1I4FA 4CBZA 2RHEA 4X50A 2HLFD 3F7YB 1J5HA 1JGLH 1IT9H 1IBBA 1EMTH 1QBLL 2EC9U 4LARH 3HN8A 5FUOH 1WGOA 4U05A 2X2YA 1P7QA 1T6BX 1MQKH 1QFWI 2WYTA 4P04A 3TTSA 2LVEA 4OCYH 1KLGB 3MRIB 4YDLB 4TRPL 3VXMD 1BQSA 1JPFB 4OFVA 3AG4B 1GCYA 2FH8A 2IVFC 2ZSWA 3OMAB 3ARGB 4K3HA 3JVGC 1WLHA 5IMMB 2XVGA 2R0WL 2EE0A 1S78C 3LNEA 3QZMA 3G5WA 4MD4B 1KDJA 2CJUH 3VM5A 4CILA 2B0SL 4FQIL 4D8OA 4JMXA 1LK2A 2O6EA 2GTWA 3QBTB 3OAYK 2JTDA 3ZTJG 5CMAB 4PJCB 4KWUA 2VLKE 1QPPA 4B50A 5CGBA 5DURD 3DYOA 3PAUA 1IU1A 1O7VA 4JFXB 2XQYG 4NI3A 3FUKA 3E1F1 5ADOH 2DQGH 4FS0A 2JJWA 4RFNB 3INOA 2WJ7A 1MFDL 4X42A 1CU4H 1RUPL 4XCNB 3W0WA 4PLJC 1FNAA 4NX0A 4EZKA 2GSMB 1FNGA 1QYGL 3MROB 5IJDC 2HTLD 2BNRA 1QPKA 3Q01A 1UVQB 2VXQA 2NCEA 5I5JA 3PQYE 2VLLB 3DIDA 3QCTL 1VB9A 5C1MB 3H9HB 3GD1C 3QDHA 2F68X 1OTSD 3QXWA 2A6IB 3TA3D 4F5CA 1YO4A 1S8DA 2FJSA 3KR3L 3PG2A 1X5HA 2BVPB 1FZOB 1IM3B 3F84A 4HUMB 2YXFA 4MSWB 1OVZA 1QNZH 4RQQA 5H94A 2N1TE 5IBTH 2R15A 4JG9A 1N26A 4X6FA 5J6HA 1YMME 4LAQH 2L4OA 5HXMA 4MRBA 2GTZA 5CJXC 1IARB 4N2HA 4DP9X 1JGDB 4TSCL 4R83A 2CDEB 32C2B 3G08B 3REVA 1GOGA 2B4CL 3SOBH 3U2JA 1XF4B 2YSSA 1LYQA 1SYVA 1CLVA 2WO2B 1UB6B 3D87B 5BPPA 3AQYA 4GRMB 2C1OA 1MJ8H 1TPXC 3QNZA 1MHHA 1X4XA 5AD0A 1EIBA 3EH1A 1HH9B 3GSRB 3HI1B 3BJLA 4J3XA 2CO1A 1E8ZA 3GSNH 3LNGA 2VR5A 3HG1A 1VZHA 1T04B 4XI5C 5LKNA 1AZUA 1HEHC 4QI3A 5I1KH 1BGXH 5MEPA 1PZ5B 3QIBC 3TH3T 2G30A 3O3EB 4LPCA 3MO1B 2AW2A 4YHOH 3BKYH 1EGJL 1K4DA 1YNTA 3C2AL 3DK0A 3PWPA 3TO2A 4K8RH 1BD2A 3HMXA 4XPGH 3TBWB 3D06A 3DURA 2D31A 3VG0H 1YC8A 4XOAA 3H4FA 4PS4L 3TZVD 3IPEA 2P80D 1E42A 1XF3A 1FZKA 2Y7NA 2PPDA 1RK0A 1NA8A 3QULA 3LKNA 4D9RE 3M7FB 1WEJH 4WTZG 4PJ5E 1GW0A 5ACLA 2D7OA 4O9HH 3UTQB 4PREA 2WWMD 3T0ED 4QRPD 3OJVC 4Q56A 3SDCB 4JK0D 1IGFH 2GJZB 3QGVA 4G7SB 1VFBA 5ALCH 1RIVL 3D3VB 2BIOA 1UWEH 1KWKA 3KLKA 3QFGA 2WCGA 1AO7E 4PBVC 4Y88A 2LABA 3QHFL 5DUPL 4CMMA 1OF2B 2I60H 1PPIA 5TE6H 4EI6B 3KGRA 3OLDA 2BS71 1RZQA 2J8UE 4NB7A 1AJ7H 3FSVA 2DWEA 4WTXA 1U30A 3L1GA 4G8FA 3CPLA 2XZAH 4D0CB 3LN5B 1XXDC 4TSAL 3PL6A 3FUDA 5DJYB 4PBDA 2E7LA 1FBIH 1YQVL 3RFZA 4XP6H 1FDLH 4XTRD 5FFGA 1A9VA 1MXGA 3H4HA 1MW1A 2PETA 2BVYA 3HE6A 1AD0A 3UG4A 4EUPA 2HRPH 3L3KA 4P2QE 3EBAA 3CLEL 3I84A 4MYWB 2MNJB 1A1OB 4XE0A 2R0ZH 2WBWB 1GH7A 1XCQB 2D3VA 1HQRA 3TCLA 4JQXC 3LX9A 4PJEE 4UT6A 2WN2A 4YDLC 3O6ML 3ARGC 1IFHL 3DX1A 2DMHA 2VMDA 1T2QH 2I69A 1E67A 3MBXL 3DRQA 1QRNA 2C9RA 4ZPVB 4MD0A 1XF2A 1S6NA 3LCYA 1J0YA 3DDGA 5I1GH 4KK8D 5IHWA 1N59B 5DC4B 1S4IA 3MUJA 4MCYA 5IREA 2O5YH 4MBOA 4NCC2 1AG0A 3P4MB 1JF5A 3MUHL 3PAZA 4XVJH 3FH7A 4MNHA 3EDFA 4DTGL 4HWEH 4ZG1A 1GS6X 2PPAA 2XPYA 1ZVNA 4Z9KB 5EIIG 1YRKA 1JMZA 3D5OF 3HZKB 1DTUA 2VSKB 1T4KA 4IIQB 2P42B 3EJUA 5GRYA 2QQKH 5FO7A 3LD8B 4E2OA 2C3XA 5KS9F 4GKSB 4JO4H 5J11B 1QASA 4YSTA 4DPRA 4IBWA 3ZSTA 1TSHA 3WJJC 1HEJC 4LKXA 3GSXA 1I3GL 4FN0A 4YBQC 3TYFA 1R24B 3C6LA 4M7JL 1I8LC 2BIQA 3DX7A 3CC5A 4OCWH 4PS7A 5AW5B 2R29A 1J5OL 4MS6A 3OV6A 3UGXA 4HALA 1LQSR 2OJEA 2BNUA 1FH2A 2FWOB 5DJZA 3AACA 4ZW8A 4PJXA 5CZXD 3K8MA 2DIAA 3LZPA 1G7MA 1CD0A 3GMNB 3UTSA 5EU7C 3HC0B 1KJ2A 1WFMA 3N50A 3T1FA 3CDZA 2B14A 5IR1B 5DQJB 2H3NA 2OMWB 1VPOH 1A47A 4H8WL 5TFSH 4ZFGH 4EEEA 1FPTH 2Z91A 3RIKA 2E8YA 1YZZA 2YD8A 4K23L 2I25N 1ZT7A 3P4OB 2BHFA 3D25B 4U6VL 2Y5EA 2VZ3A 4DAGL 2XYCA 5DHXB 4MXQC 1ED3A 3P77B 5IHUL 3Q05A 3ZO9A 2RACA 1O5PA 1G6RH 3EZ8A 4AITA 4U1LA 2KPNA 1UYWH 4TYUA 5E8PA 5CR8A 5D7KE 3A4DA 2X0VA 1BMGA 1F6AB 2R51A 3VFGH 2NY6B 1YNKL 4NUJB 1DQIA 2XICA 5CO1A 1T66C 5JR1L 4KU1A 3WLWD 3K72A 2V6HA 1SMAA 3ENEA 4YDMA 3BVTA 2YGOA 2IAAC 5CIPH 5FGCB 3BDYH 4GRWE 2AJ3A 4JPQA 4HFUL 4PJ9D 3SDCC 1X5JA 4M3HA 4XPTL 3MKGA 3R0MA 2WB1A 3BHBA 4LHUG 5EBMA 2ZCKL 3TOPA 1WFTA 1UUSA 5F71A 1EO8H 1OGAD 5HGHA 1C7TA 4HT1H 3MREA 1WWBX 5DWUH 1KTLA 4XP1L 3D50A 2IAMA 5E4AA 1L9PA 2ZUXA 5C71A 4HUWB 1N67A 4AT6A 4M8RA 3OXRA 2WTOA 3W9DB 2GHZA 2CGZA 1U91B 2FSEB 1JAEA 2XG4B 2YPVA 2FH6A 4ZS7L 3TZVA 1L9RA 3QXAA 3KPTA 1JI2A 1TNMA 1K4CB 1V3KA 3NJLA 1Y7VA 2BVUA 2AEPH 3PYCA 5T33H 5AAPA 5KSUB 2CUAA 1N10A 4PVBA 3QDGA 1MRDL 4GINA 1R3IH 5HI3C 5C2UB 1TO4A 2DYPB 2F08A 4NQXB 2Y1VA 1SDAB 1UFGA 2AITA 4XPFL 4QRPA 5DGQA 3T0EA 3P3RA 2OL3B 5D9SA 1HHIB 5IM7A 1AGFB 1Q9KA 2KKQA 5L7XH 4NZUH 4RLDA 3U7WL 3WL9A 2QPFA 1T1YA 2CUMA 4IMKC 3OHXB 3FKUS 2HKHH 3WJLC 1EXUA 4WEEA 3QDAA 4UBDD 4ZOCA 3O4LD 3A67L 4O2FA 1QHPA 3P4NA 4KFMA 5SWZE 1XIWB 43CAB 1PZ3A 1TJIH 2EEBA 1OE3A 2W9DL 3BLKA 4KKBD 2ZXQA 3LQAC 3OX8B 5FM8A 4BFEA 4D3CH 5DGRA 3QI9C 4ONOA 4AIXA 3K6SA 2WUBH 4KO9A 3LD8C 1TTCA 3CX2A 2CLVB 4W6YB 3RZWA 3WMSA 1DN0A 5A2BA 1OGTB 1IJNA 3H55A 4K7PY 4O02A 3K4ZA 4JZJA 5IEKB 3OKMA 3TBBA 3MTXA 3KL3A 5LLIC 2B3RA 4OJYA 2DIEA 1OAYH 3AY2A 3IDUA 4M9PA 3P30L 4YSRA 5DRZB 3INUL 3RWEB 1AZVA 4G59C 3ECWA 1XGPB 5LQBL 4G83A 4JJOA 2P48B 3FO1A 3ZL2A 2ATKA 2FB4L 4UDTA 2J1XA 3VXSB 1BEXA 3UAFA 3AS2A 5L4IA 5IQOA 2AKRA 3OKYA 1GGBH 3WNLA 4YSCA 3ARVA 1MFBH 1R47A 2B16A 4HK3N 3FSZA 2D7NA 3M1CA 4ONHA 4ENED 4UV4L 1FORH 8FABA 1CYWA 4N28A 4BUGA 3BH8A 2XZCL 3B7UX 2GIMA 4A38A 4M9OA 2PYEE 1TJXA 1RZ8A 4S2SB 3CFBB 1E4WH 5DD5H 1NIAA 6PAZA 1SEQL 1I3RA 5D2LE 2KPWA 1T7YA 5KOVC 3ARDD 3KH4A 4NKDA 5FHBH 3EAKA 3VH8G 5AWNL 4YDZA 3ZMEA 3F58L 3RL1A 2DLFH 2O5ZL 2V17L 2AC0A 1M6OA 3FNKA 4CMHB 4P3DB 2DJMA 5JHDD 3BAEL 4WU7B 4KDTA 4PJEF 1UADC 3LNDA 5IT2H 3WIHL 2YWYA 2I9LB 4QOKE 2YEVB 3GQFA 3L17A 1QBAA 3K4DA 3T6ZA 5IJKA 2HA1A 3M8OL 1YC7A 1DLFL 3ZJAA 2OZ4H 3DJSA 1I7ZA 2NY6C 4JO2L 4PCSA 5GRJH 4JHBA 4L8CB 1MHPH 1IRAY 1CR9L 3DHMA 2ROYA 3FB5A 4AK1A 4G7RB 3LRGA 5GS2D 3FT3A 1D6VH 5HYSA 5BRQA 4HK3J 3K81A 5I6PA 3ZVVA 1KJVB 2H0FA 4GW1B 4UT9L 1P1ZB 4HUUA 2R7EB 3VXOA 5T1LD 4EN2A 2XG5A 3CSPA 1IL1B 5I15H 1IEBB 1U36A 3WI9A 4P4KD 4L37A 4POZD 3RZCB 4PY8J 3VFRA 2KC0A 5T3ZD 4L1SA 1HAUA 4G7VL 3V6ZB 2KZ1B 4BUQA 1BAWA 4WI3A 4M43L 5F1NA 4EI5D 2NXZB 1I8UA 2PW2B 5BZWB 3E8VA 3LEVL 4F93B 2WINA 2DMBA 4FZEL 43C9B 2ZJSH 3SDXE 3IVKB 2YC1B 5IR1A 1K5WA 4L5FL 4FQXD 5TDOB 4Z3FA 4Z95L 3U9WA 4OZIE 4JQVA 5AW1B 3FRUB 4RWYL 5BV7L 3ULUD 1GKEA 4HHAB 1WBXB 4E68A 4MMZC 8CGTA 5JPMA 1KGCD 1P4BL 2QADD 4PJ9A 3EIFA 1ZGLB 1HYSD 1X9RA 4ZTOH 4ZAKB 5HI5D 1HE7A 1XZWA 1ZVSB 5KW9H 1YYMH 1VFAB 1IGJB 4PD4J 3O6LH 1DQKA 3LZFL 4CRPA 4K5PA 4CVZA 5TK2A 4Z7QE 1FLRL 4HJUA 4JW3A 4XP5L 3V8OA 1M2OA 3EF4A 1AY1H 5DHMC 2VR7A 2ZOWA 2B1AH 3HIZA 5FYJH 1KTRL 5I75B 3IFLH 2ADFH 4CBPA 1YECH 3FDWA 4A7SA 1BQLH 2VZSA 2AQTA 4F24A 1XIWC 5DEFA 2HG5B 2FE0A 4FULA 4M5ZL 2WMPA 3KWXA 3K0WA 3NAAH 1AXSA 4NZRL 5C09E 3EO1B 4PJAA 5C97A 4KKLD 1NCIA 4H1LH 3SYPA 1NIFA 2WBJA 2WZ6A 2W38A 4R90L 4NAJA 1E8WA 1NUGA 2GC4C 4JEGB 5TH2B 4G42A 5HVGB 4XMLL 2P5WB 2WIIA 1JWSA 3RWCB 3WFCH 5BXFB 2VW4A 4J4PC 1QEXA 2MCAA 4OLZL 4QRUA 4KRMB 4UM8A 1QEWB 3K74B 3HNTH 1ICTA 3NIGE 4RMUA 3CDGA 1TLKA 1T1ZA 1T1WA 5MEQA 3D2UB 4NC1E 3AREB 4M8QA 4J3OH 3EOTL 5E08L 1NLBL 3GI8L 1FG2B 5GSVB 5DUJA 4L1LA 4KJPD 1L3WA 1G7QA 1CL7L 3GO1L 3O6FA 2VDLB 1KNOA 4AQEB 3UG5A 3WS6C 2XSKA 4NT6A 2F54D 3CHXA 4P2OB 1D5RA 4DJMA 1NGPH 4KZEL 3F5WB 3RGHA 4IBTA 2X6MA 1WP6A 3WV0A 1LP9A 4BFIA 4CMHC 1X5LA 3OMIB 4DVRH 4JPVL 2DBJA 1OP9A 3ECBA 4JG1H 5MP6H 3ERXA 1B6DA 2XT1B 3TGXA 4AYDC 3QEHA 3KPLA 5MEOA 5TDNB 1IBDA 1AR1B 3ZHNA 4MDIA 2L8AA 4X5LA 5G2NA 1COBA 1A6UH 1NCBH 4MJ2A 4IOFD 1ZEAL 3DTUB 3OKKA 4NO2A 4CSZA 1VJSA 3PGDA 3GMOB 5E6ZA 2XIBA 2WXNA 3BZDA 2ITEA 4FQJL 3L95A 5C7XH 4TSBH 4XP4H 1G6VK 3I6GA 4GSXA 4LK4A 1BFOA 4PRID 3T2NL 4PTTA 3PHSA 1CWVA 2IPTL 1VA9A 4NQTA 5E0FA 4Z7WE 2VUKA 2ZCHH 2DQJH 4R84A 4Y1AE 3RB5A 1JPGB 2ZSVA 3X12A 2VLKA 1HXKA 1SMOA 3WDJA 5BCAA 1IGCH 3WCYA 4ES8A 1ODUA 3RZCC 1WAAF 1FFPA 1TENA 3S35L 1T5XA 2F9BT 4KVNH 2G5BB 3IMUA 3S36H 4JFOA 4PCKA 1LWRA 3ZQ9A 2XWJB 5JHDA 5EFIA 1HKLH 1CXLA 3Q9PA 5AB1A 4N8CL 1GYVA 1RK1B 1IO4C 3D30A 4XRCA 5E2VL 5CGYC 1KC5H 3F64A 2A9ML 2NY3B 1LO3L 2WQVA 3EGSB 2NXZC 3PQYA 4PP1C 5KVDL 3GJFA 2FATH 3QIUD 4IRSB 3RWGB 3BSZL 4IRJB 5D7SL 3QC6X 2CLRB 1Z3GH 4TVUA 3RDJA 5IB3B 1XAUA 1MLCB 5KSBE 3IXTA 2OMNA 3UJJL 4AUJA 1U8KB 2V7HA 4NFBA 3LJ3A 2YLKA 4L4VD 3GT6A 1JTTA 5T1LA 1M7UA 2C5DC 4OQTH 3REWA 3SE3C 3SZKC 2OR9L 4MB4A 3G5VB 4ZAKC 2CKBB 2WQRA 1RHFA 4P4KA 4PVNA 4MJIB 4QHUA 4WUUE 1SRDA 4L4TE 3F01A 5EEXA 5I75C 1C1EL 2W0KA 3EFDL 3LN4A 4XAKE 4OJFL 4EI5A 1RMFH 1QBBA 4P2RB 5DSCA 4I9WE 5K59F 1B2WH 1F45A 2P24A 4JZOB 1YEJL 5C0IB 1D5MA 5IK3B 2O5XL 3N85H 1UM6L 3VQMA 1ZE3C 1JTOA 5TDPB 1JWUA 4MKTA 1V10A 3LQZA 1NCWH 3QUMB 2FDBP 5KYUB 2CHDA 3ARBD 2DRUA 2EDHA 1MNNA 3OSVA 3H6AA 4ZNEE 5JNYA 5HGAA 2BY0A 1E8YA 3H2QA 4BK4A 4K5MA 1MCSA 3VXQA 1HI6A 1S5IH 4LEBA 4JJHA 3RURA 5D5ME 3AREC 1MJJB 4Z5RB 4GAAA 3B2PA 4PJ5A 1DQJA 3S34L 3CVHA 3PHQB 5I1IH 1BBDL 1GYUA 5FA4A 4P5MA 4UDUA 1GZHA 4UTBA 1AFVH 1U58A 2J21A 1WFIA 4L9DA 2GJ6D 3N3EA 3CQQA 1KCBA 2I7SA 4AC4A 3DUUB 1AO7A 1Q9OB 3V9FA 4P2OC 2PR4L 1XHHA 4WWOA 3IETA 2J8UA 2PF6A 4Y16D 1M42A 3SDXF 1TEFA 4PGEA 5KYNA 5K5YA 4OZIF 2ZUVA 4FFYL 1SXZA 1FFNA 1VFUA 4JFEE 2EXYD 3U82B 3I3DA 2XTLA 3MLWH 4YDJB 3MOAH 3UJTL 3FSWA 1MJUL 4M6NH 1HEZA 4EXPX 2B9AA 1AR1C 2DL2A 5DVKA 4A6YA 2VQUA 5D6CB 2CO3A 1CI5A 4BFFA 1LNUB 5D1XE 5AL0A 3ZRFC 4MXVF 4XO9A 1BQHB 5AUMA 2YKLH 5E2UL 1HC1A 2GW5A 2B08A 2YQGA 4Z7QF 3HFMH 1QBMH 3X13B 4NJ9H 2AI0L 4JM0A 1I9JL 1RZPA 1F02I 1N0LA 1NCHA 4XO8A 1KJMA 1OSZA 1I85C 3BWUF 3EHBB 4NSKA 4ORZC 1PMYA 3GJFK 3N5AA 1B4JL 3WSQL 3NA9H 2NRDA 3SDYH 1E5BA 2V2TB 5FYKH 4OIAA 3KLHD 1ZS8A 2UVEA 2VNCA 3D4CA 3EG9A 3H3PH 5EBGA 3N43F 3GMMA 4H0GA 2YZ1A 5I1CH 2WSPA 5CP7B 5JPNB 1HYRC 1KB9K 1WYJA 4YSQA 1N4XH 1E3XA 3BCDA 1NH6A 5ECJE 2NLJA 4BQBA 2VISA 2H0EA 3ULVD 3DTDA 3ZTNH 5D4HA 4L8SA 4LSVL 3O2DL 1P7QB 4O51A 1BVNT 2A4CA 1CDYA 4IRSC 4UB0H 5LXVA 4XCYB 1M05A 5FM4A 4IRJC 1JG9A 3HNVH 2F7PA 1U3NA 2ZSWB 4JRLA 1CICD 5ANMA 2JH2A 2CDFA 2GYSA 2NNCA 2RD0A 1QG3A 4HQQH 4LSUL 4PRIA 4U3SA 4AIZA 4YSSA 1R9FA 4LPTA 1LK2B 2GTWB 5AAWC 2YRBA 3QPXL 3VU2A 2X05A 5ALBH 3QXTA 2LLLA 2YAOA 3UTTE 2ZXEB 2DD8L 2J71A 3NP3A 4Y19E 3WN5A 5C0DB 3U6RA 4OGAD 1JYVA 1J05B 4H8PA 3ZPDA 4UTCA 2ZUWA 1E3FA 3W0WB 4WFFD 1A14L 4FFTA 2ALAA 4DFHA 2APXA 1FNGB 1QATA 4GG6A 2ZF9A 2VSDA 4APXA 4W4NA 1OARL 1GPOH 3TBCA 1D5ZA 4G9FD 4NXKA 1KCSL 4Q9QH 3SDDD 1G87A 3QIUA 4TL5A 2RB8A 1J1PH 1YPZE 3EJTA 5L2KD 4M29A 2J1KA 1S8DB 5IVZA 2FQEA 5D7LD 3V4VL 4UIKL 4EZJA 5H94B 4RQQB 4K9EC 1QBLH 2C9UA 4U7SA 2VGLM 3SKNA 4JFFE 5LGKA 1GS7A 4X6FB 5EUKB 4L4VA 4HEPA 5J6HB 4HETA 1BM7A 4MZ2A 1I53A 1A8JH 2GTZB 4Z7WF 4TRPH 2PP8A 3REVB 1QFOA 3ZBMA 3H3BC 2R0WH 2VM3A 1UZ8A 2YSSB 3LH9A 3AT9A 1SYVB 2B0SH 1M2VA 1MW0A 4BBWA 1PD6A 1TZGL 2C1OB 2NZ1A 1P7BA 3U25A 3X11A 1MHHB 2R69A 4PSPA 5AD0B 4MMXA 1HCYA 4PUBL 1NBZA 3SKJH 2WOYA 4KBPA 3WKQA 3FHQA 3HG1B 4JFHE 1BLNA 3CV5A 5DRXB 5F9DC 1KZYA 4LHQB 1T7VA 1MFDH 1N8OE 2AEOA 1RUPH 3N41B 4I0PD 5F7BA 4IKIA 1QYGH 3PWLA 1K4DB 1YNTB 2YEZA 4XWGL 2IDCA 3PWPB 4Z7UA 3TO2B 2JTYA 1BD2B 2HFFB 3T9WA 4WO4D 1AP2A 5F0PB 3DURB 1MFAL 2D31B 2OCFD 3QQNA 3QCTH 3TBSA 5C0GB 1U8IB 2ATPA 5KSBF 5C6WH 2GSGA 1WICA 5LBVA 5GZND 1XF3B 3KR3H 3ABZA 1RK0B 2MCMA 3QULB 2O26U 2YAQA 3LKNB 4CC4C 2WLIB 1HJBC 4AQ8A 1TTFA 4MNQD 3F7PC 3GF8A 1NPNA 2EC9T 1UXLA 4I2XE 4PREB 1EEQA 3JT2A 1C5DA 2OTPA 1EDQA 4OIIL 4TSCH 5JO5B 3EHBC 1VFBB 2C7UA 2GJ6A 3QJOA 4MA7H 5CU5A 2B4CH 5C0CE 5I6LA 3V6FA 3T5WA 1F2XK 4CMMB 5MHSD 2BSSA 4UCFA 5K39A 3CUPA 1JZ6A 4FAAB 5DI8A 1GOFA 1X6NA 3U0TA 3QC5X 1TQSA 3F2LA 1QP1A 4LSSL 5DS1A 4DO5A 4G8FB 4F27A 3CPLB 5JPNC 3QEQD 4RISL 3DPDA 1P9MA 4BCYA 3S4SA 3PL6B 5FIEA 4ANXA 3N0PB 3RFZB 3IXAB 2UY6B 5EC1A 1U4EA 3PV6A 3TS8A 1YYCA 1AD0B 3QW9A 4MHHG 5ENWA 4EUPB 3L3KB 1EGJH 3C2AH 1OAKL 3OHMB 1R0AL 3LXBA 1KG0A 1HQRB 3TCLB 3B9KD 3TPUA 4N3TA 5D5MF 4F8NA 4PS4H 4ZTEA 1UWFA 1QRNB 3NEXA 4MD0B 1TLMA 4MCYB 5GS0C 4NNXA 5I17A 4AYID 4P5KA 1MWAA 1DZBA 4GXUN 2N7SA 4MNHB 2KDYA 1NBYA 4JM2F 1FUNA 4N90D 3RVXD 3BLBA 1XB3A 1XT5A 1QOKA 3VMOA 5GS3A 3VUAA 1RIVH 1UCTA 2J20A 4AMKL 4P06A 1N6VA 2BWQA 3QHFH 1TVHA 5DUPH 3BFOA 1CD9B 2VDML 5D2LA 5FO7B 4BSWA 2CG9X 4Y1AD 1P84K 3VM7A 5A3IC 2WD0A 4XT1C 5C2BL 3LV3A 2CIKA 4I1RA 2AEIT 4X6EA 2FYVA 2Q3XA 4PJBE 2ERJB 4TSAH 3P02A 3E8UL 4Z3GA 3NCMA 4LKXB 3GSXB 5CZKA 1OM3L 2AV1A 1YQVH 1UCBH 2Z1PA 4GQZA 4P9HL 3TYFB 4POYA 5DHEA 1JSYA 4A63A 2AF2A 1ZT1A 3CC5B 3DX7B 3DIVA 3MA9L 2BP5M 1I1AD 2DQCL 3DPBA 4QOKA 3W82A 3I74A 1AI1L 1IBYA 3K2KA 2PPCA 5E6YA 2OJEB 4LCCA 5DJZB 5GGVY 5EU6D 3CXHK 3O6MH 4PJXB 5J56B 5DURB 1IFHH 1G7MB 3U4KA 3UTSB 1SY6A 1KJ2B 5DZ9A 3AXLA 4B97A 3T1FB 3CDZB 3AG2B 3RGBA 2H3NB 3CHQA 1YY8A 1I1YA 1TJGL 2XJLA 1GYAA 4EN3A 3PWUA 1RERA 3SYCA 2YPKB 2Z91B 2CNZA 3WNNA 4BGDA 3RWJA 4DTGH 4CADA 4LCIH 2VR4A 2I26N 1F13A 1ZT7B 1G84A 1EZVX 3SDDA 3IFOA 1WD8A 3TA3B 1CMOA 1ED3B 1LQBC 4NCC1 5EEWA 3UC0L 1CGVA 1AQDA 2COVD 2EACA 4KXCA 1R34A 1NCJA 1E28A 4U1LB 5FOBA 5HD8D 3AUWB 5CEZD 4HKJA 4XAKD 5CLWA 1RY7B 3A4AA 5E8PB 2VR8A 4K3DL 5EEZA 3SPVB 2NY1C 5KJ7E 1KSRA 3P3SA 2YXMA 3MV7E 2H2SD 3U0PA 4AUUA 1ACCA 4WEMB 2NY2D 4LB8A 5DK0A 1J5OH 3T8MA 4UANA 1YEFL 1P5VB 2G5UA 2LW3A 3AXIA 3K72B 3TFKD 4N4YB 4LCVA 2Y69B 2P26A 3MMEA 3PDGA 3OKDA 2CBOA 3X1GA 1P4IL 1EHAA 2AJ3B 4N2EA 3BKCL 4W4OA 2Y24A 3VFRB 1JHTA 3BHBB 1F4HA 1S3RA 2XDHA 5EBMB 3UEZA 2J4WL 4TLTA 3WXVL 5HGHB 3MREB 1AZZC 3TA4D 3B2UD 1XSJA 3LXUX 4H8WH 5T8IA 2IAMB 4I0PA 1T7WA 3PY9A 4A2LA 4BZ2L 4AT6B 5FAAA 2H41A 3PL6C 4YXKL 4HS8L 3VI3E 4K23H 2E7LC 2W0FA 4U6VH 3RFZC 4Q6KA 4DAGH 2X6VA 3TZVB 3B7RL 1D5IL 3QXAB 3TVMB 3HE6C 3U4EA 1BMWA 5IHUH 4BFGA 5GZNA 1MFNA 2WBXA 2AV7B 3RJQB 1U8JA 1TQWA 2X4OA 3T8VA 3ZYOA 5TE7L 2ZG2A 1TTGA 1JGIA 3WTYA 3QDGB 4MNQA 1LL1A 1RH8A 4YAQA 4LPWA 4IGBD 2DWSA 4ODHL 4EVNA 3T0EB 4QRPB 4KQ0A 1YNKH 5D9SB 1EBAA 3DHJA 5CN3A 2QSCL 5IM7B 1Q9KB 3RTLA 3WL9B 5JR1H 2AJZA 1T1YB 4BA0A 1RZKC 4JN2A 3BDXA 3NQIA 2ZWLT 4G6FD 4LCWD 1EXUB 3AT8A 3NJVA 1OOWA 4UOJA 2J72A 4HFUH 4WY7L 3U0WL 4O2FB 4XPTH 4ABUA 1ZXKA 4OT1L 2ZCKH 3QEQA 1CD1B 4U1IA 5KG9A 5FF6A 4HPYL 4PJDE 3BN9C 3K6SB 4XP1H 4FNUA 3FS9A 4L9LA 2YOAA 3QZWA 4ZYKB 1KEML 3Q43A 2NUTA 3OSKA 4MAUL 1DJHA 3FRPA 1DN0B 5DZPA 4O02B 2NY5L 4YHIA 4AL8L 5CS7A 4OFKA 4JZJB 2ERJC 4ZW6A 2EDWA 3WEBA 1ILSA 4BCZA 3B9KA 3NSXA 2MOQA 4ZS7H 1TETL 2X7LA 3FO1B 3HC3L 4E0RA 2ATKB 4EOWL 4UDTB 2H2PC 1JZDC 1DBBL 5EU5A 4HV8B 5LCVA 1FV1A 3DETC 2AKRB 2A1WL 1MRDH 4S10A 1CF1A 1A3QA 1TFPA 2KHAA 1DSWA 4U4IA 2ZXAA 4XPFH 4ONHB 3SYQA 3D39D 3VRLE 2YA2A 1TO5A 4BK5A 8FABB 3ELAT 3BH8B 3FU9A 3GZOA 3WGUB 4CU6A 1IM9D 1FLTX 3U7WH 1RZGA 1RZ8B 3IRZA 5F9JA 5E03A 4JKLA 4BKTC 2DYRB 2CU9A 4MA8L 1ML0A 1ROCA 2HTLC 2ESVD 1MDAA 3FTXA 4K07A 4Y1AA 3RGVD 1F97A 1NDGB 5I1DA 2EH8L 3A67H 5FGBA 1S7UA 4CVWA 4NKDB 3TEWA 2IG2H 3P0GB 4G7YL 3FT2A 3RL1B 3ARYA 1OTSC 2Y07L 4WJ5A 4HIXL 1M6OB 5KBLA 2GUYA 4Z7IA 4MA1C 1NFAA 3G5ZA 1OWWA 3MOBL 4A2HA 1I1AA 5HHME 3IGLA 4HCRA 1NWPA 1KV7A 2OMBA 1W80A 5EU6A 2J3SA 3UX9B 2Z4QA 5H2BB 4IJ3B 3P30H 3INUH 3L8QA 1J9QA 5LQBH 2OMUA 3FB5B 4YH6A 2PPFA 3BQUA 2FB4H 3FT3B 4YSAA 1AKJD 5HYSB 4M3KB 1MVUA 2XV6B 1UKSA 4JFFD 4YSOA 5TD4A 4E42B 4HUUB 2GAZA 4JCMA 3VXOB 1KXTA 2BWIA 3BPCB 4J1UA 2XG5B 2Y0SA 2XQYA 1B4TA 3PJSA 5DRNA 2Z34A 4PW9A 1TQCB 2IBZX 2XZCH 4WUUA 2QR0A 3KDMA 1FYTD 4PJBF 2IAMC 9CGTA 4KOBA 5T5NF 1SEQH 4L4TA 4FFZL 3T0BA 2H0PA 3OZ9L 5JW3L 2BOBA 2XN1A 1HJCA 2HN7A 3ARTA 5KSAA 5F1NB 3RHWK 1EEUA 1H6EA 2OCJA 3P3UA 5AWNH 3F58H 3ZE0F 4HOXA 1VIWA 3TZVC 2O5ZH 2V17H 3ZDXB 1PX3A 3TVMC 4ZZKA 1UGKA 6TAAA 5C0NC 1A0QL 3AWEA 5T3XH 3P0YL 1RZJC 1DCLA 2DLGA 3BAEH 3KBPA 4OF3A 5HHXL 4DZ8A 2BIPA 1A21A 3S8GB 3WIHH 3STLA 1ZANL 3LXAA 4LGRB 3BUTA 3BUBA 1ZHLA 3M8OH 5E6ID 1DLFH 5IROD 1AE6L 2X2HA 4N26A 2HVKB 4LL4A 2WWMC 1NCCL 4MJ5B 4JO2H 3SB3A 3T0EC 5JQ6L 4WZ9A 5JPMB 4PJ9B 4W9HC 1C16A 2WZ0A 5HHPB 4K8RD 1BA9A 1SJXA 2FJGA 3CZNA 1CYXA 1PNDA 3VGGA 4ODXB 2X10A 2D2OA 4CVZB 4UT9H 3SJVE 2YMXL 4LHUD 4QHPA 4NBYB 3JWDL 4JPIA 4N2MA 5DEFB 2WSDA 3QDJE 5E9DE 2BNQD 1D7BA 1QI5A 4TV3A 2WMPB 3CQFA 4WI2A 1QAWA 4XTRC 3NG5A 3S96A 1AXSB 2X53A 4PJAB 4JFWA 1NCDL 2UZPA 4P46A 4G7VH 2EEXA 5BQ7A 4JZJC 5ESAA 2X40A 3QXVA 3UYOD 2AXGA 4G42B 2XC8A 2DTSA 4M43H 1JERA 4JFEA 1JWSB 4JKNA 3P9MA 4PRHE 3HKZA 3LEVH 4IGBA 2OSWA 2LT9A 4FZEH 3S3PA 4K15A 1A6TA 4QRUB 4L5FH 4UM8B 3QZPA 4Z95H 4Q74A 4KK8C 4WTZA 5D1XA 2EDEA 2J2ZA 1T1ZB 1T1WB 3VFTB 1WFJA 3NUKA 5BV7H 4AKPA 3VGHA 5CM1A 4LCWA 3A4EA 4M8QB 4AEEA 1P4BH 1JPSL 3N42F 3FB6A 4IRZL 5AOMA 1G7LA 1U8PB 1DJSA 1XD0A 4QHNA 3NESA 1G7QB 5JORA 1OCOB 1KN4L 2EXSA 1KNOB 2LLGA 1OEZW 3VI3F 2AQ1A 3LZFH 4NT6B 4XP5H 4QXGL 1AGCA 5TJWK 1KV3A 1ZLUH 3JTSA 3SEPA 1KGIA 2VDNB 3BGAA 2ZX8A 3UJIH 1LP9B 2HUEA 1ZGLP 4RMWA 4M5ZH 4KDTC 4DQAA 2XXFA 3ECBB 4NZRH 3G6JE 4LBEB 1KYOJ 4MJJA 5E2WL 2DM7A 3QEHB 5MEOB 5IJKC 4R90H 4MDIB 1H8OA 4OLEA 3X14B 3OXSA 2UUDK 1MI5D 4NO2B 4ZMLA 4XMLH 3PGDB 3GXIA 3WNJA 3X1FA 4B9IA 3WENA 3LTVA 5CZXC 4KZCA 1OD9A 4PWIA 5D70L 4IK7A 4DP8X 3D39A 3L95B 4LOEA 5DYOA 5FO9A 3WHXA 1DJXA 3CFUA 4OLZH 4DN4L 3I6GB 4N6RA 4Z76A 2Z8RA 3FSOA