2IDSA

Structure of m98a mutant of amicyanin, cu(i)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFARGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Generation of Novel Copper Sites by Mutation of the Axial Ligand of Amicyanin. Atomic Resolution Structures and Spectroscopic Properties
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2idsA00
3SBPA 3MX0B 1IC0A 1KV7A 9PCYA 4BDVB 5F7AA 2DY2A 1AZRA 3AG2B 4E9SA 1ILSA 4ENZA 3X2QB 3CDZB 1AACA 5F7BA 3RYMA 3T71A 1NTDA 3UAAA 2AZAA 2EIKB 1QLEB 2YAHA 5B7FA 1GY1A 2BZ7A 2XX1A 6PAZA 1MZZA 7PAZA 3FPXA 3CVBA 4QKTA 1L9SA 1PY0A 3SQRA 5I6OA 4F7KA 4G7RB 1V55B 3AG3B 4NERA 1OCOB 2IDUA 2JKWA 1ETJA 1XMEB 2GHZA 1QNIA 4UF7C 1GYCA 1WA2X 3ABKB 1JVOA 4DP2X 3PLYA 2JXMA 5I5JA 4YSEA 2J55A 4KOCA 2H5UA 4W9ZA 1SF3A 4HCIA 4AKQA 3IBOA 1IBYA 1RZPA 2IWFA 1JXDA 3NYKA 4L0PB 2HLEB 6PCYA 5B7EA 2IH8A 5D4IA 3ERXA 3EH4B 1OOWA 1AQ8A 2XV3A 2GBAA 2OCCB 4N4YB 1UATA 1RCYA 4YSSA 1SFHA 4E9QA 2FT6A 1ET8A 4UAHA 3DKHA 3ZX1A 2UXFA 4A2FA 3X1FA 1SDDB 4HHWA 4M4RB 2I7SA 3FYEB 4YSUA 2FWLB 2PLTA 3WIAA 2BP8B 5D4JA 1GY2A 2CJ3A 1AR1B 3OQRA 3NP4A 3WG7B 1BYOA 1EZLA 4G72B 3FU9A 3T6VA 3NJNA 4P5RA 3CVCA 3NSDA 1ZPUA 2BHFA 2PPCA 4YSTA 2IDFA 3AZUA 1NWOA 4WKXA 4QLWA 2YXVA 1M9WA 1ASOA 1BAWA 2UXVA 1ID2A 2PP9A 3T9WA 3QJQB 3BVDB 1URIA 1SHXA 1JXFA 4GP5B 1PZAA 1XB3A 3NJGA 4HCGA 3GXUB 1AS6A 5I28A 1CURA 1KYAA 2XYBA 1PNDA 5AKRA 4FA7B 2QT6A 3H4HA 4PAZA 4F2FA 3FQYA 3U25A 2H3XC 1CC3A 2YAQA 1RKRA 1E30A 3QQXA 1WA1X 4A67A 4GP8B 5AZUA 2YAPA 1DZ0A 1KCBA 2FQGA 3TBBA 2EINB 5B1JA 3DTUB 2ZWNA 3WKPA 1PZCA 5FC9A 2NRDA 2IWKA 3X1BA 4KOBA 1V10A 1I53A 2WO3B 4K9JA 2OJ1A 3TBCA 1OE1A 2HX7A 4ZK8A 2QDWA 4M3HA 2UX6A 3D12B 1HAUA 4JHVA 2FQEA 3FSVA 4HIPA 3NJKA 3V9EA 2VW4A 1PZBA 2EILB 3FPYA 3MBWB 1ADWA 1MZYA 4GYBA 1OCRB 1AS8A 2X88A 5I5MA 1ET7A 1FWXA 4GXFA 4HHGA 1CYXA 2JFCA 4A2GA 4DP8X 1W6LA 1OE3A 4Q89A 3ABLB 2XXGA 5EHFA 4G7QB 2VMJA 3NJIA 4DP7X 1A65A 1JXGA 1A4CA 4G7SB 5PCYA 2CUAA 5AFAA 1F56A 1ASPA 3JTBA 2UXGA 1TU2A 1KGYE 4E9WA 1OCZB 2IDQA 2AZUA 5B7MA 3NSYA 2PPDA 2YAEA 4FAAB 3G5WA 4N8UA 2EIJB 1CYWA 2W88A 1PAZA 1J9QA 3OD3A 1GS6X 1A4BA 1PNCA 2A3TA 2BWIA 4WTQA 1OV8A 3ZDWA 4A2DA 1NZRA 1J9SA 4BWUA 3QJVB 4BWWA 2P80D 3KW8A 3AY2A 1ZIAA 2CBPA 1BXUA 1SFDA 1KBVA 2IDTA 7PCYA 3UAEA 3S8FB 2AVFA 3OMIB 1GS7A 2QPDB 1JZIA 3HB3B 1BXVA 1BXAA 2BZCA 2DV6A 2X87A 3FYIB 3NJHA 3TA4D 3TASA 4E9VA 1AANA 1GR7A 1AZBA 4EF3A 2Y69B 2BP0B 4E9XA 3NSCA 3X1GA 3S8GB 2FQDA 4RH4A 2YAFA 1M57B 3AG1B 1OE2A 3BQVA 2XV2A 4KO5A 1L9QA 4A2HA 1WAEA 2E86A 1GS8A 2GSMB 2WO2B 2BP0A 4PCYA 4AX3A 4E9RA 2BW4A 1IBZA 1IUZA 2VW6A 2VW7A 1AZUA 1L9RA 1J9TA 2DWTA 2R7EB 3NJMA 3HEIB 5TK4A 2N0MA 2UX7A 2BWDA 4Q8BA 2GI0A 1YLBB 2XV0A 3FU7B 1A4AA 1ZDQA 3WKQA 4DPBX 4DPAX 3NJJA 1QHQA 1AOZA 2RACA 1PCSA 3WNIA 2CALA 2R7EA 1NIDA 2VSKB 4YSOA 2PPAA 1NIEA 4YSRA 2J57A 4NB7A 3FU7A 4DP6X 4HALA 1JZJA 3X1NA 4AI7A 2YQBA 2QPEB 1GW0A 2W8CA 3NJLA 3T6ZA 1X9RA 2YXWA 3FSWA 2HZHA 4A66A 5B1BB 2PP8A 2MRYA 3ASOB 2Y1AA 4P5SA 1ZV2A 1HFUA 1JZEA 1WS7A 2CCWA 1SNRA 1RZQA 4KNTA 1E5YA 1L9TA 1ILUA 1AG6A 3PAZA 4DP1X 8PAZA 1GSKA 1AZNA 1NPNA 3IN0A 4YSPA 3NP3A 1JVLA 1NIFA 5I6MA 1T5KA 2PPEA 4MFHA 4DPCX 4KNUA 2ZOOA 3PCYA 3IEAA 2ZONA 3KW7A 3JT2A 4GP4B 1X9UA 1JZFA 2TSBA 2FQFA 2YARA 4JKNA 3S3DB 1ZIBA 3H4FA 3ZBMA 1JERA 1AG0A 3AG4B 3CG8A 2PCYA 3PAUA 2VM4A 1NWPA 2XVBA 2B3IA 3C75A 3N55A 4YL4A 5LDUA 2XXFA 3ASNB 4HCFA 5B3SB 1ET5A 4G70B 4W1TA 3WNJA 2XLLA 1KDIA 1AS7A 1V54B 4DP9X 1NIAA 4YVUA 1L9OA 1NIBA 3OMAB 2GB2A 1PLBA 2VSMB 2IWEA 1KCWA 1MG2C 2FT8A 1BYPA 3T6WA 2QDVA 3NJFA 2FNWA 3AW5A 3L45A 3CZUB 1J5CA 1SHWA 2HX8A 2YAMA 1J9RA 2Q5BA 4AKOA 3IE9A 1WS8A 2J5WA 3V9CA 1PMYA 3DIVA 2HRHA 2PCFA 2BW5A 3FQ1A 2GIMA 3FSAA 1A8ZA 3FU8A 3N2JA 3QJRB 3S3CB 2OV0A 1E67A 3SBQA 2LLNA 4BDVA 2CAKA 1MDAA 2IH9A 1CUOA 5IY5B 3CDZA 1R1CA 3S3BB 2XWZA 1TEFA 1BQRA 3FSZA 4BK5C 1KDJA 1JOIA 1OF0A 5B1AB 2UXTA 4JHUA 4DP0X 2HXAA 4YSDA 4DP5X 5I6PA 5I26A 2P80A 2ZXWB 4HZ1A 3NSFA 3UABA 1L9PA 1KBWA 4AZUA 4YSQA 3OMNB 5PAZA 2WSDA 1JZGA 5A7EA 1NICA 4X4KA 1NPJA 2GC4C 3PXLA 3OM3B 1BQ5A 3UGEA 4KNSA 2BO0A 2I7OA 4BWTA 3QJSB 3SBRA 1TKWA 4YSCA 3NT0A 2DYSB 2J56A 1W8EA 1PF3A 1ASQA 1SJMA 3ABGA 3T6XA 2XX0A 1JZHA 2AFNA 1E65A 2FTAA 2IDSA 2VM3A 1WA0X 4YSAA 3PPSA 2AANA 1AZCA 3CVDA 1IKOP 3GYRA 4A68A 1SDDA 4GY4A 2BP8A 4BXVA 2H47C 3UACA 3UADA 2GC7C 4UANA 2B08A 1MG3C 3EF4A 1BEXA 3QPKA 1AAJA 3GDCA 5E9NA 4E9TA 2XU9A 3EHBB 1NINA 4CSZA 1OCCB 5ANHA 4F2EA 4DP4X 4TXVB 4G71B 3PAVA 1HAWA 2PPFA 1J5DA 5TK2A 4E9YA 4KO6A 3FT0A 5B1JC 5I6NA 1ZDSA 1XB8A 3EH3B 3H56A 3QJUB 2TSAA 1N68A 1M56B 3WI9A 2FT7A 2IAAC 3FQ2A 4BXSV 1FA4A 3EH5B 4HAKA 2EIMB 2FJSA 1N70A 2HX9A 4AKPA 2I85A 1SF5A 1AIZA 1TEGA 4YVNA 1B3IA 4CSPA 2VN3A 2PP7A 3FS9A 1E5ZA 1DYZA 4KO7A 3TU6A 2Q9OA 2DYRB 5I6KA 3QJTB 5B1KA 5I6LA 1EHKB 1NDTA 1PLCA 4KO9A 2MTAA 3ABMB 1FFTB 3ZIYA 1BQKA 2YAOA 3IN2A 1W6WA 1XB6A 5D4HA 1PLAA 5I5IA 3X1EA 4NAJA 2HRGA 2XUWA 1A3ZA 1VLXA 4A2EA 2DWSA
chains in the Genus database with same CATH superfamily
4OLXH 3EGDB 4JFQB 3RUGB 4Y19E 3SKOB 3SQOH 3X17A 4Z3HA 4HLEA 5I8OL 2VDPB 1QFOA 2EACA 3HUJE 3P0YL 5DD1L 4D8OA 4KMLB 1FPTL 1NFKA 2XXCB 2CDEB 5BJTA 4H5SB 3SGEH 1GGCL 1EGJA 3EGDA 1EEUA 4KK5D 4KX8A 5D8JL 1I9RL 2XXMB 2TAAA 2R51A 3RUGA 3SKOA 4JUTA 4K8RC 3ECQA 1MCPL 2APTA 2KLSA 3ZUNC 4WVRA 1EMTL 4RFEA 1LILA 4NWTH 3BWUF 2CDEA 1DQTA 3O4LE 2DQEL 5ESAB 2CR0A 3UG5A 2JXMA 4KJPC 1MJUL 2F5BH 5EULV 2H5UA 4PJEB 1S7VB 4ZNEE 2GKIA 5H37H 1M6UA 4P9HL 4WI5A 4AQ1B 3NZUA 2IWFA 1UM5H 4ZQTA 3VJ6B 5ESAA 5KBNC 2C3WA 3T77B 2DQ6A 2JJVA 1M3IA 2XETA 4B96A 4F92B 2EC8A 1H9DA 1CGTA 3TN0C 3ZN6A 4PJEA 1KEMH 1QLFA 1S7VA 4E9QA 2QADB 4N2FA 4WWNA 4AQ1A 5SWZB 3VJ6A 2PLTA 1EV2E 3ZY7A 5I66B 3T8MA 5AB2A 1HXMB 1XGZA 4UT9A 3OKLB 4H20H 2X3AA 2N7BA 3OKNB 4X8JB 4JPIB 2AV1A 5F7EL 2DQJL 2EYSB 5IKCB 1V3JA 5BV7L 5KSAC 1A21A 2C4FT 1DTUA 4IEFB 5HVWA 4FNQA 1HXMA 1DBBL 5C0EB 2ZUVA 1KFAH 4YGAB 3OKLA 4NAQA 3TT3H 2H3KA 5HY9B 3ETTA 3OKNA 4X8JA 1XSJA 4JPIA 5I1CL 4JY6B 3BGFB 2O30A 4DKFH 2IBBA 1X5XA 5IKCA 4UAOC 1OHQA 3GXTA 5D1ZD 3RWGB 2YHGA 3EJZC 4IEFA 4MCNA 1IQWL 1ANUA 5I28A 3UTOA 5KVMC 3JTTA 3HI6L 1MCKA 1KYAA 4N8CH 4UM8B 5JHLL 3HS0B 5HY9A 1QRKA 3NBNA 2MCMA 5CEXB 5D7SL 2VC2L 3CZGA 4JY6A 2YAQA 2F53D 2H9GA 1WFOA 3TONA 3RWGA 4YBQD 2YAPA 5HYSG 1TUPA 4BZYA 5L2JB 4P4RB 4Y19D 4UM8A 1MLCB 3IJEA 2D3JA 3HS0A 2ZWNA 1G7PA 1YEWA 1MCOH 5CEXA 5KJRH 4PHXA 3ZR6A 4S1DD 4KJWD 2IAMD 4Z77B 4JMNA 2OJ1A 2FE0A 3PPEA 1WC7B 4NRZB 5HHOE 1JXJA 5HVGB 2I9LB 5L2JA 3VG0H 1MLCA 1KB5B 2QHLA 3P30L 4ODBD 5IROD 1FH2A 5L7XH 3WL9B 1A6AA 3OJDA 4U2YA 4V2BA 1OCRB 4NWUL 4WUKL 5KBPA 4BUGA 4BE6A 1IM9D 3O4LD 4JGJA 5JIIA 2BNQD 1WC7A 1BDYA 2JFCA 2I9LA 1DLFL 1G1KA 1G9ML 2G2RB 2NR6C 1UURA 5IB5B 5C0AD 1ZXQA 1KB5A 1IGMH 4MQ7B 5CGYD 3LB6D 4G1MB 3D0AA 2GAZB 1ZANL 4FP8H 2YGVA 3Q13A 4ACPA 3EOYG 1A5FL 3TXAA 5IB5A 1KGYE 4QYOB 3K0YA 3VYNA 1SXBA 3LZOA 1Q0YH 5FS5A 4MQ7A 3LTVA 4G1MA 1VB9A 5HHPB 2GAZA 4LHUG 1Q72H 3KL3A 3LN9A 1TTBA 2E47A 4XMTA 2FWUA 2JQZA 2F58L 3AS2A 3OJ2C 4QYOA 4O00A 5BZDA 4ODUB 3BZ4A 4GMSL 5DJ8B 1IBFA 1JZ8A 1KULA 4QIRA 4PWJA 3N44F 7PCYA 5IQOA 4JO1L 2F08A 4NOBA 3HCVB 2DKSA 2QPDB 4DKDC 4JCLA 1HE8A 1ZSDB 4ODUA 1WFUA 5MEPB 4EF3A 5DJ8A 2KZBA 1HNFA 3WN6A 3TN0B 1FP5A 1INDL 5D7IE 5CGBA 4OD3H 3N1QC 2FQDA 5HYEA 3ARBB 4H2CA 3HCVA 4AEFA 4X6DE 4OTXH 2WY3B 1WAEA 1ZSDA 3VD5A 4Z95H 2GSMB 3AABA 1Q8MA 5C0CE 1KZYA 4L0ZA 4FG6D 2QSTA 3ARBA 3FTWA 4A63A 4EZKA 4NENA 5CEZH 3HUJF 4NO3B 1EVTC 1PAMA 5KSAB 4FLSA 4NFBA 3SO5A 3JVGC 1YLBB 1S9KC 3ZO9A 3RGHA 1FAIL 1QHQA 5EN2B 4TNVK 2EXSA 2APWA 2CALA 3QS3A 2HG0A 2AERT 5DZAA 4UAOB 4TSCH 4JDVB 5HHOD 3S96B 5L0QC 2B1AL 3BSGA 3T2QA 2PPAA 4NX0A 4GXVH 3SY0B 2VDQB 1HKLH 5EN2A 4BV1A 5BW7C 4AI7A 3BE1L 3QUMH 3HLAB 5C8JB 5KSVB 4NNXB 4DJMA 2ZCKL 4GRLD 2X9XA 3OB0K 4JDVA 3QXDA 4AT6A 4CSSA 4LLMB 2EECA 2H3NA 3SY0A 2H2SD 4AVHA 4LDEB 1E5YA 2K0RA 4OZIE 3EYQD 5C8JA 3JYCA 5KSVA 4NNXA 3U1SL 2VGLM 5CNHA 3RNKB 4N5ED 5DEGB 1VJSA 1ZTXE 4LLMA 1KV3A 3ARPA 2C9SA 4L5FL 2EVFA 4HK3J 4TQHA 4OJAA 4IJTA 4XNXH 2JJUA 1XCTB 4MZ3A 1IC4H 2NDGA 5LQBH 3HHMA 4N8VA 4ODTH 3MRBB 8CGTA 5AW0B 2B77A 5DEGA 1AD9A 2MQGA 3NPSC 4X6EB 3DX2A 3B6SB 4KQ3L 2LVEA 4N68A 4N0UA 5IOPB 3LKOB 1WZAA 4KZEL 2ZUQC 1XCTA 4EBQL 5BOJA 4HAFA 1FNFA 4Q74A 3VM5A 2VN7A 4AJ0A 1COBA 2ROYA 2XTJE 3Q2WA 2VZOA 3MRBA 3W39B 2NQ3A 1YEIL 4JPKH 4NQSB 4X6EA 1ET5A 2OMZA 2W92A 3B6SA 4I0PD 1BEYH 2NR6A 4J7RA 2VLKB 1CICD 4AOFA 1HH6B 5IOPA 1SOQA 3D48R 3LKOA 4RMUA 4X4ZA 1F8TL 1RXLA 5M94B 4KUZH 1YYMH 1MJ8L 3TA3C 4JFEE 4XXCA 5B4MD 1X5AA 1LK3H 4RDBA 3W39A 2OZ4H 4NQSA 1I7RA 3ZE1B 4P8QA 5MEOB 2VLKA 2WGNB 1MCRA 1HH6A 3BUBA 3GQFA 3JV0A 3S35L 3ZGHA 2EVHA 1EDYA 5C0CD 1VZHA 2PXYC 3WNOA 4JM4L 3V9CA 3MLYL 5L8KB 4QXUL 4XC3L 4N6RA 2D3NA 4MCMA 3FO9B 5D70H 2VR4A 2GIMA 1UYWL 5MEOA 9CGTA 5EEWA 3MCYA 2HA1A 4YZWA 5F88B 3EXJA 3VXME 4ERSH 1N5YH 4KQ0A 1P9MC 4QCIB 2IWGA 3MX0A 1Z1WA 2LLNA 3EJYC 2DMGA 4Y8DC 3FO9A 3J2PA 3JUZA 2FBJH 2K7PA 3FOLB 5SV3A 5F88A 1OF0A 4QCIA 3B2XA 2NNFA 1PZ5A 3PIQB 4AEIH 4FCAA 1MAML 4IMKA 5DR5H 4XB3A 5DDHB 3T3MB 3I74A 1P4UA 4C4UA 3FOLA 1JPEA 1YZZA 4N2CA 3JBG7 3GMQB 2R69L 4XPAH 4O4YH 3BLBA 2DQHL 1A7QH 3M7OA 3X11B 3PIQA 1BQ5A 2EXYD 2J3SA 3KPPB 5DDHA 3DIDA 5C0BE 5CGMA 2PCPB 5L0QB 3GIZH 1HCVA 3GMQA 5SV4A 3V7MA 3JVGA 1JZHA 2OMUA 1FI8C 3X11A 2OSLB 5KS9B 1A6WL 3EKCA 3S3JA 4OUUA 3KPPA 5B8CC 5MHSE 1LEKB 2IQ9L 2PCPA 3CCHB 4Y1SA 3JT0A 1A6UH 1FNGB 1PKQB 3KJ6L 2YQGA 2ZOTA 4OU3A 1L0PA 3H6JA 2YKKA 4U1JB 2PTUA 4NQXB 4ONFH 4XN5A 5FA3B 4MS8D 2OSLA 5KS9A 4PRNB 4UANA 5BQ7B 2ZP8A 2XTJD 2AK4E 3VGAB 5MP6L 1LEKA 2HKAA 5D7IF 3CCHA 4UBDC 2RR3A 2ODHA 1FNGA 1AAJA 1PKQA 3MLXL 3NIDE 4Y5XC 4YXKH 1CG9B 2DW5A 4X6DF 1K4CA 3GTTA 4U1JA 4DP4X 4NQXA 1HNGA 1NM4A 1WZLA 3MLWH 5LJYH 1FO0B 1V3MA 4EDWH 1U8JB 3SJVB 5BQ7A 1A2YB 2IVFC 3VFMB 4CNIB 2FIRT 1AGBB 1DVQA 2B39A 4WK2B 1ND0B 5CP7B 3RIKA 1S7RB 2VUYA 4TF4A 4H2AA 3NPSB 1CG9A 3QO1B 1X5ZA 1ZDSA 2YD5A 1EAQA 1BVZA 3ELQA 2FO1A 2HRPL 3MRJB 1ODAA 4OM1L 1FO0A 1A7PL 3FQUA 1U8JA 3SE3C 3SJVA 4Z23A 4BYHA 3FQTB 1A2YA 2JI3A 1TSRA 1T6WA 4GXUM 2GY5A 3IMTA 1AGBA 2CKNA 4IYKA 3QARA 1ND0A 5CP7A 1S7RA 3EBHA 1TEGA 3V95A 3HC0B 4I85A 4UV7L 3VXMD 3QQDB 4LKXB 3MRJA 3BDYL 5HHVL 3BI9X 2E3VA 1A6ZB 1CDJA 3IPFA 3QR2A 2CHWA 2DYRB 2LLLA 1BOGB 2YWYA 3LKRB 1RHHB 4UQ9A 4NQUA 4B53A 6CGTA 2KKQA 4O58L 3OAZH 4A7UA 2O6EA 3HC0A 1Z0MA 4TVPL 3QQDA 3DJTA 1U91B 4LKXA 3EYFA 4PS8A 3K2IA 5G5DB 1A6ZA 4X99A 3IU3A 2BY3A 3JWDH 1OZTG 4OT1H 3LNDA 5C6TL 3T2NH 2RMNA 3LKRA 2X9WA 1RHHA 3KGRA 1DQIA 4M9PA 5C7XL 4PJAB 4OZIF 2WIIB 5IG7B 3VQ2C 2OSWA 4MMZC 3VWKC 3SPGA 2VLJD 3AG2B 1U91A 1ZK5A 1DHKA 2OSXA 4YDLC 3H53A 5G5DA 1NQBA 1OWRM 1N9PA 3WNLA 2B2XL 2OYPA 1KYUA 4IHBA 3R18A 5C9KA 4L3EE 3NCFB 2WP3T 4W9EC 5B7FA 1E9PB 5LGHL 1OSPH 4LHUD 4PJAA 2BZ7A 5C0BD 3FC8A 2WIIA 5IG7A 2OI9B 1ETZA 3NIGE 3W5MA 4F7KA 4OCSL 1KEGL 4J39A 1GYWA 4P4KB 3E1F1 1XMEB 1E9PA 3AS0A 2EICA 4NEHB 2CM5A 5CJXA 3EYUL 1I9JL 4GBXC 3GXFA 4PYHA 1P5UA 1JPGB 1UB5B 5I9QC 1WAAE 3MA7B 5LHDA 2NX5D 1SF3A 4X7FC 3HG1D 3Q5OA 4P4KA 3B2VL 2AK4D 4P2QA 4FQ2H 2EEAA 2CGZA 5J11C 1JPGA 1IBGL 1UB5A 1Z2KA 3CFKB 3L9YA 3MA7A 4OCXH 5DA0B 3SPCA 2D7TL 1RZKC 4Y4HC 4MJIE 1U8KB 4E41E 2GJZB 5J13C 5B8CB 4YQXL 4OCYL 4HC1A 2IXQB 3VM7A 4RZCA 3CFKA 4P48A 1D3CA 2DJSA 4PP2A 3L4CA 4GINA 4IJ3C 1T6BX 3BPOC 2VR8A 1U8KA 1S5IH 2GJZA 4HS3A 4EDXA 2W9LA 3EDDA 2Q8AL 5B8CA 5HDBB 2IXQA 5E8DL 4G1EB 3DRTA 4M8UA 4Y5XB 2P26A 3CV5A 1ASOA 1P6AB 2CNZA 4KMTL 3RE0A 1EDHA 4PJDF 5LNGA 1J18A 1WV7T 2ZUSA 1EA9C 3GRGA 1AO7E 2FYYB 3BXNB 3VWJD 4G1EA 4Y5XA 5I19L 1S3RA 1A64A 3LVTA 3OLGA 1X4YA 4GFXA 5JA8B 3AACA 1CLYH 2NLJB 5C86A 3K6SB 1X5IA 5JXEC 1E4JA 3DLQR 3TT1L 2P7TA 4ADJA 1E30A 2FYYA 4NZTL 3VMPA 2B1HH 3OKOB 4AXWB 5HGBA 4K7PH 1PSKL 1KCLA 1PZUB 4IBVA 1A1MB 2E9JA 1WGOA 3BKJH 3FTGB 2NLJA 1UD5A 5FC9A 4OKDA 3KLHC 3K6SA 3SE3A 4XNDA 4EI5C 3LEYH 4L3ED 1IM3D 4XVSL 5AVQB 2A9NH 5D72H 4FF9A 5EEVA 3PHAA 4HIJA 3R8BB 3TBCA 4LO9A 3OKOA 2G60H 4L18A 2AK1H 1FRGH 5I8CB 3IPEA 1WCBA 3LHPH 4FTVB 1A1MA 3FTGA 4HIPA 4AM0B 3QEUB 3PL6D 4YLBA 2H0JA 1UA6H 1DBKH 2VLRE 3R19A 2W0LA 4JN2B 4QTFA 4TSAH 4MJ5B 4J27A 4L4JA 1L7TL 3OXRB 4KAQL 5I8CA 4CJ1A 2Z9TA 5JZ7C 3L3JB 4AM0A 3D25B 1JJUA 3QEUA 3V9FA 1XQ4A 2XXGA 4UMSA 4JN2A 2JCCB 1AR2A 3TURA 5F3BB 1OLZA 5AFAA 4MJ5A 2C7FA 2WQWA 3VG9C 1XXDC 5I0YA 1DZBA 5IQ9B 1UA7A 4E9WA 1MELA 3BCFA 3L3JA 3A67H 3D25A 3RY6C 1U8MB 5GGVL 7TAAA 2KYIA 2Z7YA 3TTSA 4N8UA 5BO1H 3MLSH 4E41D 5M7QA 3QUXB 2GIXA 2JCCA 4FNSA 4PJ5D 3VGDA 4GUCA 3DROB 4N1HB 5D2LB 1AQHA 5F3BA 6FABH 5KYWB 5LUMA 3CK0H 1R19A 4J3OH 5IQ9A 5E1GA 2LOEA 4ZX5A 2C3XA 2ZNWA 5I9QB 1UXLA 4NUGL 2YZ8A 4OF7A 1THAA 3HG4A 2G2NA 4S1QL 4FNPA 4AGQA 1UD8A 1P4IH 3QUXA 3ARSA 3DROA 3HG5A 3PGCB 4OI9A 5D2LA 2WZPD 4XOBA 3OMIB 5TDNA 5KYWA 1OW0C 3D30A 3S36X 1SXSA 4RGNE 1XZWA 4NZRH 4DTGH 5J11B 2WWNA 4QJ4B 4G8IA 4UT9L 4A04A 4MD4B 5H2BB 3P11H 1C1EH 3B7UX 4Y4HB 1AQDB 3GI8H 3MLRL 3PGCA 4RMTA 5FYJH 4AL8H 4AK1A 1AO7D 4KV5E 5C0FB 2QJDA 5J13B 4I3GA 1NCNA 5EZJB 5FYLH 2AEOA 4R26H 5C1MB 1GS8A 3P73B 1ZE3C 4L8BB 2V2WB 3QHTC 2HH0H 3RB5A 4MD4A 2DQGH 1IFHL 2AEQH 3DTXA 4Y4HA 3RBSA 3BPOB 1AQDA 1S3KL 4IU3B 1JL8A 3MXWL 4I9XA 4HWUA 3NAAH 5C0FA 2IOOA 5EZJA 2DPKA 2Z8SA 3FUFA 2BWDA 1E8ZA 4LSUL 5TQ2L 4L8BA 4I7ZC 4JVWA 4C4KO 2QLYA 1OWWA 4U1SB 3UZVB 1HEHC 3UAJA 3OWRA 4S2SB 3UTQB 1WPCA 3EJJX 4LPCA 1BQSA 3GLAA 4IU3A 3HR6A 4ZI8A 2RFXB 3S88L 5DJCB 4EPSA 1AXSA 5FHAL 1AE6L 4ZJ9A 1NBQA 3B37A 3E38A 2MOVA 1EFXB 2HWZH 4U1SA 2Q20A 1QFPA 1E4WH 2GUOB 1T7XA 4XPBH 3UZVA 1KCUL 4S2SA 4QRSB 5GQBA 3LEXB 2VLRD 2EYRB 4NNYB 1WAAF 2RFXA 3V0DA 2Y1VA 3O2WH 4XWGH 3NJLA 1BQHG 3QWQB 4RRPA 4TQIA 4Z3JA 3VU1A 5EUKB 1E4XL 4ADGA 4Q2ZA 4LEXH 1EFXA 5I1HL 2WYHA 2GUOA 2PUQT 1TTAA 2W9EH 3LEXA 4QRSA 4W70A 4NNYA 1FJ1B 5JXEA 1IIKA 1HL5A 1G7HB 5FGSA 3AT8A 5EUKA 3I6KA 5KVEE 3W1ZA 2IBZX 1VZGA 1XDTT 3WFEL 3ZE0E 1MDTA 5DWUL 1KB5L 3U9PL 4JAMB 2XY1A 2C8NA 1JVLA 4J1UA 4C55A 3I6SA 5I6MA 1FJ1A 2PPEA 4HH9B 4GUPB 4HWEL 4BFFA 1G6RH 3IEAA 1G7HA 3LKPB 4UCFA 3GO1H 2COVD 2DD8H 4HV8A 1EHAA 2YMXL 1IKNC 4OW6A 4KHXH 2VDOL 2VDNH 3QFJB 1U21A 4JAMA 1AJ7H 3T5WA 3P4OB 1U2CA 4GUPA 3QXAB 4Y0GA 4DETA 1HL4A 3LKPA 1ZOXA 1DVZA 5J6SA 2IBZY 4RGND 3VG9B 2DM2A 5IQ7H 1HHJB 2FCBA 1MH5B 1X6LA 4UOW1 3P4OA 2GB2A 2ADFL 2VSMB 3QXAA 2DJMA 2XY2A 5DRNB 1BF5A 4YDJB 4MDJA 3DBXB 3ULUD 3WFHB 1HHJA 4TRPH 1RUKL 1UWGH 1PZDA 1MH5A 1II4E 5SX5K 3TBVB 3AXLB 5I1LA 1KSRA 1JV5B 2YAMA 4OVVA 3RY6A 2G3NA 4H7VA 2P8MB 1IGFL 1PVHA 1QFWI 4HBCL 4R6UA 4XP9L 1AHMA 3A4FA 3BT2L 3OLDA 4YDJA 3DBXA 4X6CE 1UUNA 4L5FE 3NCYS 4G5ZL 1JRHI 3F58H 1U3YA 1YEKL 2CZNA 5KSBB 3QJRB 3TBVA 4XPFL 3R1GH 3AXLA 1CD1A 1JV5A 2FNBA 1QEXA 4X7SL 1ZAGA 3EOTL 2PR4H 3BZFB 4X42A 4YDIL 4W9CC 2CAKA 2IH9A 5EU5B 4OD2B 1HKFA 4PS3A 3UBGA 1OW0A 3B5TA 2XWZA 4ZZKA 3VRJB 3GEWB 4N85A 5KSBA 2ZOKA 1INQA 1OAXL 3BSHA 2IJ0C 4DWHA 2H2PD 4XVUD 2F15A 1D5XB 4R2GC 3BZFA 4PJIE 3EO1A 4FQJL 4OD2A 5CZVH 5EU5A 1WBYB 3QPQC 4HJJL 4DQOL 5EU7C 2WNKA 2ZG3A 5JA9A 1HC1A 3GTVA 4X80H 1D5XA 4ZS7L 5CF3A 3IF1B 3A5VA 4JEGB 1X3DA 2A9CA 2NY1D 3OMZA 3SYAA 5DMGC 5ILTH 1ZEAL 5EOCL 2Y24A 3P9LB 2VZ1A 4XE0A 3HI1A 3LEVH 3TF4A 4PWFA 1YC7A 2J56A 3HW7A 1T3FB 1DQKA 4IQHA 4HWBA 5ALCH 3ABGA 4DFIA 1TEYA 5EOQL 4APQC 2VDQL 4MVBC 4NJ9H 4Y4KB 3IF1A 5FO7A 1WHOA 1J1XL 2VDKH 1WFTA 1CS6A 4PJ8D 1HQ4B 1L4IA 1Q0EA 1U6AL 2OS7A 3P9LA 4J5VA 1G1OA 4F1ZA 3RY4A 1QI4A 2WZ5A 1WDAA 2FJFB 1T3FA 2VXVH 5A16B 2HPTA 1DFBH 5AUMA 4HIEB 4Y4KA 4LPVA 3D69A 3GSUB 4A7GF 1TZIB 4ZX4A 4Y2DC 2RAMA 1RSYA 4ZUSB 2WV3A 1BEXA 4WTXA 2FJFA 3S34H 2ZQKA 2XU9A 3P40A 5A16A 1QBMH 3RG1C 2Z0UA 2DN7A 3L5JA 2ZF9A 2ADYA 2HLFC 4OF5A 3TOPA 5F6HI 4ODHL 3MRCB 4RLDA 3D4YA 4JL1A 1R3HB 3LZNA 2Y06H 3NCBB 1F1DA 4EQ3A 2CRYA 3ZRFC 1IAKA 1U30A 1P5VA 1KY6A 5AKSA 2VTFA 1RPUA 5DEFB 1M56B 3MRCA 3X14B 1MW3A 3L1OL 4IK6A 3V7AG 1R3HA 1N5AB 2EDFA 5GRZA 4Y5VC 1IKNA 2VWEC 3G6JB 4NKQB 1JGVL 1F42A 1A14H 4LOUD 5HHXL 3O3BB 4D8PB 1HL9A 1GA2A 1I1AC 3X14A 1CN4A 2Q9OA 1WP6A 1V05A 3QIBB 4KDTC 3SIKA 1BBDL 1AGEB 1E7VA 1N5AA 3HS9A 1SY6L 3GJFB 5IK3B 4B5ZA 4C54A 1SEBB 1MIMH 1Y6KR 5J1SC 3G6JA 4ZQKB 2ENJA 3O3BA 4D8PA 3FZUC 2XTSA 3PWUB 3X1EA 3P2DA 3DO7B 1ZKAA 1DVUA 1OB1B 1QQDA 3L3DB 3QIBA 4XAWL 4H13C 1AGEA 3GJFA 1X5YA 3PWVB 4JLRB 1SEBA 4N9OB 4PJCA 4Y7MA 4X9FA 3LQZA 4MXQC 1AZRA 3VFNB 3X2QB 2DH3A 1N7ML 3HAEH 5DK0B 5F7BA 4ODXA 3U7YL 1FORH 3D2TA 4G5AA 3ZE0F 3DO7A 1CFSB 1OB1A 3L3DA 2FLBT 2Q6WB 1AYRA 3PWVA 1GY1A 4JLRA 4KHTL 2AEIT 1XHHA 3VI4B 3ULAB 3O2DH 4QKTA 1NCIA 1RFDH 3GMRB 4FKKA 3ZMNA 3VFNA 1S7WB 3HKFA 4JJHA 4JY4B 5DK0A 4L23A 3WHE1 4R2GB 1YQVH 3O11A 1SEQH 2BMKB 3DGDA 1MWAH 1CFSA 1VESA 3KPTA 1QP1A 2VM9A 3IDGB 5T1KB 1GGBL 2Q6WA 4CC4C 4UF7C 4LRIC 3IXTB 4JFHE 3VI4A 1R3KB 1WA2X 2VDLH 1KG0B 3KS0J 4FFYH 3ZDZB 3PLYA 1S7WA 2B14A 1UZ8B 3A0OA 5T5NF 3UTTB 3NA9H 4R90H 2C34A 2BMKA 4AKQA 1KXTA 3QQ9D 1N67A 1Q0XL 2K6ZA 5T1KA 5FKAB 2AP2A 1RZPA 3IXTA 4OLUL 5EUOF 4L1BA 1KG0A 3TCLB 2HP4A 2NY2C 1D5RA 5L6YH 4N4YB 1UZ8A 2DI8A 3M45A 3KR3H 1NGXA 1MW2A 3KLAB 4HSAC 3CN0A 2UXFA 1YNTF 5FKAA 2X1WL 1WGVA 3KPRE 2HFFB 5LCVA 4YSUA 3TCLA 3VDCA 4YLCA 2F19H 3EAKA 3UTSB 4Y16D 1P1ZB 4LGSB 5MEQB 4X6CF 4BFOA 4QXGH 1EZLA 3W81A 1MFCL 3FU9A 3KLAA 1TMCB 1J05B 4M6MH 1ZVNA 3NSDA 1YO4A 5KW9H 3BH8B 5DUMH 1XGPB 3MDJA 4OAWB 3VXRB 2HFFA 1D9KB 2Z8WC 4Y2DB 3RVTC 2IPTL 4LB8A 3UTSA 3L3IB 3PHQB 3RAJL 4BFIB 2YXVA 1AQMA 2A4CA 4FQ1H 3MLVL 3TEYA 3MOBH 4YX2L 1GL4B 2HVBA 3BH8A 4L1LA 1XGPA 4OAWA 3NEXA 3GBDA 1Z3GL 5F7FA 1D9KA 4Y2DA 3IYLW 1XB3A 3HOGA 3OB0H 3S5LB 4PJIF 5I17B 3ZZQA 4BFIA 3PHQA 5JPMC 3FTVA 5KTEH 4QRAA 4AUYA 2JJSC 2QPSA 3B83A 4PH8A 1D5MB 4P59L 1Y07A 5HI5C 4F9PC 4L8SC 4KX9A 3Q0HA 1UA3A 3DHUA 1CC3A 3L9BA 2CLVA 2OTWB 4Y88A 2RHEA 3LXAA 1DCEA 4JFDD 4TN9A 3I50L 3S5LA 1JIBA 2FQGA 5BRZD 2WW8A 1KELH 1D5MA 2W0KA 4AW7A 5IUSA 4I1NB 5L9DL 3RIFK 1PZCA 2J8UB 2AXFB 2V6HA 1ACYL 1I1AB 4X8CA 1U8PB 3O8XD 1I53A 1ZGLM 4YBHA 1H3GA 3CVHL 3R0MA 2DM3A 4JHVA 4IS6B 4BFEA 5F72S 3Q44A 4RISH 2J8UA 2SEBA 1I1AA 1MZYA 2VAJA 1AS8A 4H88H 3K2UL 3V0AC 1U8PA 4OJEH 3NESA 3WDJA 1GHFH 4J3WA 1CLVA 3JUYA 1Z9NA 2DICA 2V17L 5CZXD 1RUPH 5I8KL 1IBHA 1MRDL 4IS6A 3BVNB 4LSRL 3SD5A 4KFMA 2XACC 4HS6B 3BRGC 2W0PA 1GOGA 4TYUA 2NZ9C 2WWKT 3ARXA 2F61A 5KUMA 1T1XB 3PWPD 4I3RL 4OZFG 2CHZA 2H26A 2Y7QB 2AZUA 5DD5H 2WXMA 2YAEA 4HS6A 2A74C 3MLTB 1ZHNB 2CU9A 4E0RB 1JPTL 2FGWH 2P47B 4XX5A 3WXVH 3DMMA 2E7DA 3KPRD 1CCZA 1QHOA 1UWEH 2BWIA 4UQBA 2A77H 4DVRH 2Y7QA 1OSYA 3VI3B 2NXZD 4LQ1A 5KBKA 2P80D 3UYOD 2R29H 5BZWA 5IBTH 3MLTA 5HJGA 1ZHNA 4E0RA 3LDBC 4G6KH 2VQUA 4H40A 3I2CL 3VNZA 2Y7LA 3O0RL 5F96H 4AEEA 1X44A 2HN7B 3RWFB 3SE9L 3L4UA 1A8JH 3OKYA 2AABL 4HC1L 4PY7B 3VI3A 1WT5A 2NY2B 1AANA 1AZBA 2WVUA 2PNDA 3CDCA 4Z0BH 2ZKHH 1G9NL 4E42A 2CIKB 4PPTA 2HUEA 1K2DB 4CU8A 2VSCA 4TPRL 3U4BL 3ZZ1A 4GKNB 5FWRA 3RWFA 2HN7A 2XV2A 3LZPA 5AZEH 4YO0B 2A99A 4EIGB 1J8KA 2E86A 4GXUN 4OQTA 4PY7A 1PY4A 3OKDB 3ARGA 3D52A 4F58H 4UTBA 1KENH 2CIKA 1CGSL 1B6UA 4HXBH 1HK6A 1K2DA 4AMKH 4DW2H 3BRDA 1RZJC 3MCG1 3WMPA 1YNKH 4GKNA 4A6YH 3VGEA 2CDFB 3HEIB 1NBCA 4DHLA 1F2XK 2JKJA 1MQKL 2UX7A 1AGDA 5F6IC 2E9GA 4JO3L 4WNQA 5BVPL 3RA7H 2XV0A 5DHDA 4ZFGL 1VACB 2ZF8A 1JZDC 3AWGA 5B39B 5DLMH 1T89C 2CDFA 1JNJA 3LPOA 2F1EA 4JQVC 1M2VB 4MZ2A 4PJEE 5D9SB 2ZOWA 3OGOE 5JPMB 4E9LA 5DD6B 5I1DB 4ZBJA 2FRGP 4RWHA 4L3AA 4GO8A 1YPZB 1VACA 3UERA 1AYOA 4JRYD 4L8SB 3UTPE 5AYTA 1KIUB 2QPEB 2IPUG 2W9DL 4ZPTA 3QZWB 3TZVA 5E2UH 3E8UH 1M2VA 1TLKA 4EZMA 5DD6A 1NC2D 5I1DA 1RIVH 1AD0B 2ZX6A 4L0YA 5EIIA 4KKZA 1KIUA 2DL2A 5DVNA 4N2IA 3CFCH 5IB4B 3O9WC 4NFDA 2Z35B 3LVEA 3QZWA 1L9TA 1HYSC 1C12B 4HUCA 4JPVH 4AYID 4B3EA 4GLRI 1AD0A 3DETD 2FB4L 4DF9A 3NP3A 3BDBA 2YEQA 1W0WB 5BQDA 5IB4A 2UWEF 3BAYA 1EAOA 3JWOC 3ILEA 3O6KH 1C12A 1JGEA 3D4ZA 2JCWA 3KH3A 5E2TH 3U48A 2FQFA 5CBAB 5HBBA 2D3VA 2NNAB 3SE4C 5E4EB 4OCWH 1AG0A 1JNNL 1NPUA 4F8LA 5F44A 4ZOBA 1MW0A 4YEFA 4LAQL 4KKBD 3J8F7 1HYRC 3ASNB 3FU5A 2YUVA 5FO9B 1QYGL 4JHAH 3WNJA 5CBAA 4WTZG 2NNAA 1UD4A 4MB5A 2CMRL 2A74B 3VX0A 2IWEA 2UZXA 3E2HC 1EK3A 1MJ7L 2R0ZH 4H8QA 4QTHB 5FO9A 1Z9SA 5TPWL 3BP5A 3DGCR 3CZUB 2APSA 3BPCB 3FT2B 4P3CH 2QSQA 1MPAL 2A74A 3MBEB 4LF3A 2R39A 4QTHA 4L1HA 1BWMA 1DEDA 4M9OA 4FZ8H 2JKLA 3BPCA 4PJHF 3FT2A 4FG0A 2NQCA 5JIPA 2WD0A 3SDXA 2QEJA 2CUMA 1JWUB 3MBEA 4IM8A 4JQIA 1DL7H 1MHCB 3DO3A 4WQOA 4NGHL 4IBQA 3LNGA 2XQ0A 3VFRB 2CCLA 2FBOJ 5GJTH 3EG9B 3UTPD 1JWUA 4B9IA 4YSDA 5L88L 5JR1H 2X42A 1RP9A 1SXZA 2JB5L 1MHCA 2VJXA 1OCWL 1NCCH 1C5BH 3HZVB 1HE7A 4UTAH 2J2ZB 2O61B 4YSQA 4BA0A 3VFRA 5DO8A 5MERB 2QADD 1A1OB 5CFAA 5F6IB 3CHOA 4GS7C 3FQWB 3EJRA 1WE5A 5SWZD 2YD3A 4JKMA 1YQ2A 3QGVA 5CBEB 4MQXD 5IEHB 3KL0A 4F37K 3PV7A 2AC0A 5EZIL 2QVKA 3ATAA 3HZVA 1CDUA 2XBTA 2O61A 2ZX9A 5MERA 3CJJA 1A1OA 4MAYB 1LD9B 2Y3NA 3MQIA 4XCFH 2FJGA 4S0SD 5CBEA 5IEHA 2VDRL 1EZVX 3BVVA 4U1GB 4WY7L 4YDNA 3MRPB 1T89A 4LL4A 1FFRA 2P4AB 5LG1A 5E0FA 5C3LD 1AR1C 2DIEA 2KH2B 1TMQA 1RULL 4MAYA 3FB5B 4NC1E 5H35B 3KPNB 1LD9A 3ZT6A 4XHJC 1MFEL 1RZFH 5CJOL 4OLWH 1NANH 3MRPA 4DN3L 2P44B 4YL9A 5DHYB 2X0WA 4MDIB 1IAIL 1D5IH 1NA8A 3FB5A 3KPNA 3MFFB 5ANHA 1KCRL 2VXQH 2R0KL 1EZVY 2MQ3A 4MNQB 1UB6B 5I0DA 3CFTA 1BMGA 1HXKA 5DHYA 1A9EB 5DD1H 2EH7H 3O6MH 4MDIA 4CVZB 5HVHC 4KPHL 2ZKXA 4KZDH 3MFFA 1XB8A 1E6OH 2AV7B 1XTMA 1UB6A 1MCHA 3RIAK 2WZ6A 3FT1A 4E68A 1N8ZB 1F5WA 2A6DB 3MRLB 5CILH 3OKKB 2NUPB 5DFVC 1T66C 2GTZB 4CVZA 5G4NA 5T3XD 4M7LL 2CGRH 1CFBA 2CCVA 5DUPL 1AQKH 1O75A 2A0LC 2X6AA 2AV7A 2D7NA 1GVIA 1N8ZA 2A6DA 3MRLA 1DUZB 3E2HB 2EDXA 4QGTA 1D7FA 2GTZA 4U05A 3ZL1A 3ABMB 2YBRB 4YN3A 3EFDH 2XJLA 5I74C 1AKJB 5KWYC 4OZGB 1DUZA 1KLFB 4EIBA 3BPLC 4GG8A 5GGSB 3TS8A 3WIFB 1QD0A 2ATAA 5FXCH 2DWSA 3N85H 2JKNA 3BUDA 4N0UE 5DZLA 5CUSH 5LXGH 2YBRA 3CXDL 3JSSA 5E08L 3GBNH 1AKJA 4GRWH 4PR5B 4JO2L 2Z4QA 4MMXC 1XGYH 2VMFA 1KLFA 4I5BB 4OZGA 4ETQB 3WIFA 3FO1B 4LRNL 1AXTH 1BVLB 7PAZA 5GGSY 2ORBH 3D07A 2XZQH 3AITA 5TF0A 1MCNA 4JN1H 2Q3ZA 2QKIB 3ETBJ 1NAKL 3B1UA 3VTAA 1HWGB 5IP4A 3FUIA 3FUKA 5E8NB 3QQ3B 4PR5A 4NERA 5HXMA 4I5BA 2IPUK 4ETQA 1RUMH 2JJTC 2VLKE 1TR7A 3QUMA 2WKOF 1A47A 1BVLA 3Q6FB 1GYCA 4WWOA 3TN0D 1E2WA 2QKIA 3DDFA 4HWBL 4YSEA 1HN1A 1OGTB 3EDFA 4GW5B 4GS7B 1XXFC 3I3BA 3ARBD 5E8NA 3QQ3A 1EJFA 5CMAB 5F7LB 3IK2A 3ZE1E 1J7VR 1NUFA 5T1JA 1IGYB 2XWBB 3NYKA 3Q6FA 3LRGA 3DUHA 5F9JB 4YS4A 4NM4H 2XV3A 5IF0B 3SOBH 5I71C 5JYMA 1OGTA 1KTCA 1M1SA 4GW5A 4AC2A 4YSSA 2JIXB 1JUFB 4DNLA 1QKZH 5CMAA 2NY5L 4N2LA 4ABQA 3C2SA 3CDFA 5KSAD 5J56B 2ZOLB 4HHWA 2XWBA 3WIAA 5DJ2B 5F9JA 1AR1B 3NP4A 1HS6A 2JIXA 5JIMA 1CF8H 4PRHB 4IU2B 3RJDA 1H3VA 3CXHJ 2ZUTA 5TE7L 1LE9A 3RVWC 3EJZD 5C3IA 1NFIA 3RURA 5DJ2A 1NLBL 2AEPH 4WUKH 1IFRA 1KN2L 4X7CC 4JKPH 3E9TA 1J1OL 2UXVA 3KGTA 2QGEA 4FLHA 4MAUL 4PRHA 4IU2A 2EC9T 3CXHK 1WEJL 1NFAA 5FA4B 3ULUH 4I4WB 1KC5H 4HJEA 3ARWA 3NJGA 5B3NA 3CIQA 4HCGA 3QUZC 5LAXB 5HVHB 5AKRA 3SYOA 4F2FA 4NO5B 3QC5X 4LSQL 5FA4A 3IGKA 3VXUB 4UOQA 4I4WA 3V4PH 3WYRA 2ED8A 1CR9H 1KPUA 1ZVYA 3FTXA 1FIGL 5LAXA 1QASA 2BSSB 1HINL 5KS9E 2WLZA 3F6JA 4XO8A 1OARH 4NO5A 3VXUA 3F7QA 2FX9L 2L8AA 1NEZB 1QTSA 2NR6D 2NY3C 5EBWB 1MSPA 5F3FA 5JTWA 1XGUB 2F8VA 2H7WA 4G43B 3BSZA 5HYFA 3V6ZB 4N8PA 1Q9WB 1A66A 4M93C 3E1ZA 3MJ7B 1Z32X 3FN3A 2IV9A 1ZLSL 4KC3B 2J1WA 3CGTA 4Q7DA 5I74B 1IC5H 3MBWB 1ZJAA 1ADWA 3NMEA 4HUWB 5FECB 1NEZA 1INDH 2VLKD 5EBWA 2IH3A 3BPLB 4NBZB 1XGUA 2ZUWA 2KT6A 2HVKB 5E9DB 3RRQA 3TFKC 3V6ZA 1CZ8L 1Q9WA 1RK0B 5GZOA 3MJ7A 2BH0A 3MGOB 4M62H 3WFCH 4PJ7E 3SJVE 3CH8A 3PAYA 2VH5H 2FJHA 3ABLB 2NPLX 4QXWA 1RP8A 2OULB 1LO2L 3MBWA 4HUWA 5AYUH 5JDSB 3TF7C 5KVEH 4MMXB 1R17A 2X4TB 2O26U 3KPSB 2X6VA 2HVKA 5E9DA 5C2BL 4LDOB 3MGOA 2X2YA 5SX5H 3CUPB 4JG1L 1WFMA 5JHMA 2EIJB 3LRLA 4MHHI 1P4BH 5JDSA 2DQCH 4MMXA 2X4TA 5FCUH 2Z65C 1J9QA 3C8DA 1ML0A 1I31A 4RCAA 3KPSA 4OIIH 1JNLH 1U3ZA 4M5ZH 4BWUA 3QJVB 3CUPA 1UASA 4ZD3H 3KW8A 4R7NB 5A2IH 1NCHA 1TJHL 4N24A 1R3LB 4XO4A 1M05B 5LCVL 1JZIA 1BXAA 3FYIB 2ZCKH 1G87A 3RZCA 1HHHB 5I71B 4R7NA 4I1RA 1RJZB 3RKDC 2WLIA 4PJAE 2P24B 3ET9F 3S8GB 1KTJA 1SYVB 1R3LA 5F1IB 1M05A 5F6HJ 4OVUA 1M7DB 4BFNA 1E8YA 1FBIH 2N3JA 5I1EH 2J1KA 5K33A 3L48A 1TT6A 1KNOB 1HHHA 1J0HA 4WI7A 1PYWB 1GOHA 3MRKA 2BW4A 1T80A 2P24A 1SYVA 3LZLA 2OCFD 2YPKB 1PKOA 4LLQB 1M7DA 3LH8A 4ONGL 3Q9PA 5HPMA 4FZEH 1KNOA 4HUUB 2AI0L 4RRPG 1NC4B 1CDYA 4CN1A 1A4AA 2ZCLL 4P2QE 1NGPH 2RACA 3D3VB 3EH1A 4FQIH 1AY1H 4UT6L 4JVPA 2YPKA 4ALAH 1JDCA 5JXAH 3VMNA 5F1OB 3QUZB 2M8XA 4PUBH 4P5KB 4HUUA 3BWSA 4WO4C 3L5WB 2LU7A 3BAXA 4GSXA 1CLOL 1U42A 2R4SH 4YC2C 4FQHB 2WXNA 2ZXGA 5DD3L 3GXMA 4QRPA 1JHTA 2DQTL 3B2DC 2VMCA 2HFGH 4BHUA 4EQ2A 4JM2C 1H15A 4P5KA 3UGUA 1ZV2A 3L5WA 3KYAA 3SJVD 1RZIB 4FQHA 1TJXA 3J27A 3GLDA 4KNTA 4W6YB 2OFQA 2X4PB 3WY2A 5LNEA 2NY3B 1JGDB 4TNWK 3MLYH 3VSUA 1KWGA 2WYTA 1LQSR 2MPAH 4HKJB 4JFFB 3WN5C 1RZIA 4M93B 3JVFC 3HTLX 4HW6A 5HP5A 4WKZA 2EO7A 3C5SA 5HDBE 4CUCA 4Q9RL 1TITA 3K4DA 1DEEB 2X4PA 5GRJL 2ITFA 4HQQL 1LEGB 2ZONA 3MROB 1JGDA 1DN0B 2F7QA 1CXEA 5DXWA 4LSPH 4Z7UB 2QQNL 1FLRL 2TSBA 4GPVA 3T0EC 4GFTB 4HKJA 2ZUXA 4JFFA 5ALBL 5TH2B 2J7LA 1YEGH 3KWXA 2GITA 5EORL 1KN4L 3SPVB 1GPOH 1DEEA 4XBPB 2Z4TA 3H7LA 1LEGA 4YL4A 2G0LA 3MROA 1WH0A 1DN0A 1KPVB 1MHHA 1ZD6A 2XOTA 4Z7UA 3TC9A 1ZTMA 5EPMB 1XF3B 4HLJA 5DD0L 5D7KD 4A7SA 4DP9X 5TH2A 2YD4A 1UM4L 4K9EH 2X3CA 2Q3AA 3SPVA 2R69H 4MRBA 4XBPA 5EWIH 4NXSA 1K6QH 2DQHH 1QW8A 1KPVA 3T6WA 2JV6A 3ULVL 3NJFA 2FNWA 5TFSL 1J5OL 5EPMA 1XF3A 5E56A 1I7ZB 3MYZA 2HX8A 3QNFA 4QRBA 4A38A 3MNWA 5E94B 1WS8A 3QDGA 3NN8B 4NN6C 4ZUWB 3OAUH 2YUWA 1JPSL 2XFXB 4JFVA 2BVEA 4NNPL 5JIQA 1OY3B 1OGAE 2E7LC 1I7ZA 2HTLC 4ZUVB 4P4KD 4UTBL 1ZHBA 3RGVC 3IRPX 1CLZL 2EDTA 3KJ6H 5E94A 3NN8A 4BFKA 4ZUWA 1X7QB 2K78A 3N43F 3QEHB 3ZKNC 2VRKA 4K3JL 4PI0A 2H45A 4JDZB 5DQDL 3OVUB 4HG4J 2FD6H 2Q7YB 1K9TA 1SQMA 4ZUVA 3UBXB 4PY8I 4CKVX 3VRIB 3AWEA 2Z34A 4Z0XA 2ZWLT 2JCCE 1I8IB 4DP5X 5DGQA 4AQ8C 4A55A 4M7ZB 3HNVL 4PJ7F 2P45B 2DM4A 3R8QA 1MEXL 4HG4K 3KS0H 5FAAA 4M48L 1YECL 1BREA 5FUZL 4JK0D 5GS0L 1F02I 1D6VL 5A7EA 2C4FU 3UBXA 3VFWB 3UEQA 4X4KA 3VRIA 4TULH 3QCTL 3CFBB 4P2RB 1GZPB 1I8IA 2ESVB 3WFDL 1GZHC 4OCNC 3ZL4H 1JN6A 1JP5A 4H0IA 3SB3A 3CH1B 5AVYB 5L4FA 3LSOB 2NNXA 4H8WC 4KRMB 4I0KA 4AEHL 4QNPE 2BFVH 1ZS2A 1L9NA 2VXSH 4OLXL 3VFWA 1WFIA 2OMXB 1EJ8A 3CFBA 1GZPA 2ESVA 4P2RA 5EH1A 3SQOL 4BSVB 1WF5A 2EUWA 4YC2B 5B38B 1CFVH 1F4XL 2OMVB 3CH1A 5HHVH 4GQRA 3P4MB 2ZXAA 2QZQA 1CL7I 3E80A 2OMXA 4GY4A 2B0SH 1H5BC 4BXVA 5B38A 3N1PC 3GHBH 3EH2A 3R0NA 2ZSWB 3WIIL 1UZ6E 3KWWB 4NWTL 3ZSTA 3VXPA 4G9FA 3B7SA 4PJAF 4HX1B 4OFDA 4C83B 4R97C 3P4MA 3ZU8A 4N2GA 1TPXC 2R1XB 1F90H 3WN5B 2YD2A 1OCCB 3T0BA 1TNNA 3QRBA 2ZSWA 5AB1A 1JXKA 3UIZA 3AVEA 4HZAA 2HJLB 1CI5A 3QEQB 4H44C 4UIMB 3LRHA 2VRAA 4HX1A 1UM5L 2PWHA 2R1XA 2Y5QA 4WSGA 3T0EB 4JFYB 3MLPA 3ZT5A 1NMBL 1KEML 3AU1B 2HJLA 3QEQA 3F7KA 4UIMA 2G5UA 2YGNA 2VN6A 4ZUTB 4FTVD 3QB7C 3UPRB 3T0XA 3T0EA 4JFYA 1GC1C 1J86A 4LP4A 4Z7QB 1GJIA 3LIZH 2UVEA 1XEDA 3AU1A 4FFWD 4PM1A 3FSOA 1N0XH 3L2MA 3M17B 4JX0A 4LCYB 2CKBH 4XMZA 5B3JE 5DRWA 1T7YA 4JB9H 4ZUTA 3GS4A 5B1KA 3UPRA 3WY3A 3W9DB 4KO9A 2GBTA 3P4LA 4JFPB 3EZ8A 1OO2A 3QJHB 5FW7A 2W95A 1KFAL 4F8NA 5I5IA 1Y0LB 3TT3L 4LCYA 4NN6B 2FSEB 4A2EA 3UL4A 4KRNA 4DKFL 2DYPB 3W9DA 3UZEC 4JFPA 4F20A 1U41A 4OCYH 3QUXD 4B5EA 3RGVB 4AYEC 3QJHA 3KPQA 1NSNL 1NTDA 1Y0LA 4CKQA 5IVOA 5DS8B 3K6FA 2NYYC 2FSEA 1S6NA 1TVDA 1BZOA 1Y1DA 2DYPA 3S7GA 5HDBF 1Z5YD 1FHGA 3TJHC 1PY0A 5T3ZH 5I6OA 3RGVA 3LNFA 5CINH 5K9QI 1TQCB 3CSFA 3I3EA 3AXIA 5DS8A 1MCOL 4KMTH 2FUQA 1ETJA 4PRPB 5KJRL 3PGFH 3SDDB 4EVNB 1G1YA 4JRXB 4GQZA 5IHWA 1BHGA 1SJHB 3L3HB 4J3VA 4OCMC 5DA4A 4CC0A 5HVFB 3IMRA 2VIRB 5AW2B 1X4XA 3T3PE 1MHPH 4Y4HD 3T08A 5CFHA 3VG0L 1BG9A 2ZNXA 4Z78B 1HHIB 3V6OE 3DOHA 4AQ8A 2VR9A 3B4NA 4PRPA 3IBOA 4OF3A 3SDDA 1MOEA 3Q6GH 5L7XL 4JRXA 5E5MA 4TL5A 1SJHA 1G6RB 1MCJA 3L3HA 1IBBA 4NN7C 5B7EA 2IH8A 4ODVH 2R9HC 3ERXA 3UAJD 2R15A 3I6LE 2JKRM 4EN3C 5BUGA 1BM7A 1T0PB 2OL3B 4Z78A 1HHIA 1IGML 2VDNB 2OMNA 4OZ4B 4R9HA 4FP8L 1OTUC 5KSBE 2EAEA 1G6RA 1OSEA 2WPGA 1ZGLB 2OKMA 1UD3A 5FLVA 2WTRB 2OL3A 3PXJA 4G72B 3IU4H 4OF8A 4GIAA 3HG0A 2XFGB 3OC5A 4OZ4A 4XN8A 4Z8FH 3T0DA 1QACA 3Q9QA 4HJGB 2X09A 4ZMYA 1Q72L 4MYWB 1EFXD 3D33A 3G08B 3CFJB 2JSFA 1ZGLA 4R97B 5I0ZA 1JVKA 1TPXB 2QV4A 5AZ2H 3BAEH 2WTRA 1JGUH 3S5LG 2FHFA 1EGJH 3QWRA 5CEYB 5I18L 4KAQH 1UACH 2R83A 3TYGH 3V0WH 5IFAH 1ZV5A 2HMID 2VDPH 4HJGA 2JCCF 5I23A 4ATTA 1BMZA 3G08A 3CFJA 1LYQA 5GPRA 5CEYA 2YK1H 3BHBB 2X2IA 4BK4A 4YXHH 4WW2A 3L5IA 4OD3L 4L9DA 4ENEC 5DHVB 3ZW3A 1M9SA 4LQFL 5C0IB 2B1OA 2WLYA 4KXBA 2CNYA 3OGCB 4OTXL 3TBBA 5JPNC 1DQDH 4WI6A 4Z95L 2X4UA 4QNPF 1KJ2H 4OLZH 3UTZB 3WLWC 4KOBA 3BHBA 2RH0A 3CZNA 2DBJA 4WHDA 5E1QA 5ELIA 5DHVA 5C0IA 3MUY1 2DI7A 5CEZL 5JZ7D 5A2CA 3QFJD 3EO9H 3DYOA 3LKQB 1NL0H 3OGCA 3U2SB 3H9HB 2AJZB 5GRVL 5C9JB 2C7UB 4X98B 3MJ9A 2YD7A 3UTZA 3VAEA 1LVEA 2F53A 1PZBA 2EILB 3MSPA 4HUNB 3W11D 1IE4A 3LKQA 3FO2B 3U2SA 4TSCL 3H9HA 2AJZA 3OKEB 5C9JA 2C7UA 1R46A 5BPPA 2GVYA 4FJYA 4GXVL 4GEJA 2WUCH 4WTWA 1HKLL 4DP7X 5BXFB 5D4QA 3FO0H 1JXGA 3MA9H 1IFHH 4KI5E 1KY7A 1TZGL 3IMVA 3QUML 3FO2A 1Y6NR 4A37A 3HPJB 3UZEA 1D6EB 2OYLA 3OKEA 3I6LD 2YWZA 1KBPA 3UMNA 3KD4A 1U3HC 3QXTA 4GUQA 5TQ2H 2W65B 4FQXB 5T8IA 4AQEA 4I88A 1DFXA 1DVFC 2AAVA 3D5OF 5C0AA 5AENA 1OV8A 2B59B 3HPJA 1D6EA 5HHNB 5IVZA 5CKAA 2ADGA 5IJVB 3F7PC 5DMIH 4FQXA 4XNXL 2DMCA 1A6TB 3P0GB 4MHHG 4XB8A 4PJCE 3WAJA 1NFDE 1IC4L 5TJWK 5LQBL 2B59A 4NN7B 4ODTL 1TJGH 1KGUA 2ICES 5HHNA 3NJHA 5B3JF 5AVUB 5IJVA 1PU0A 4EN3B 3BP6B 5KVDH 3LD8B 4KJQC 3T2OA 3X1GA 4HK3N 4BFJA 4NT6B 1A6TA 5DJZB 2WLMA 1LHZA 1ZSHA 1SBBA 3ATFA 2OK0H 1M57B 4LSVH 1JF1B 2MCPH 3VO0A 4JPKL 4DKTA 1FZOA 4BHUI 3BP6A 1BEYL 5DC2A 4N0YH 5EO1B 4E9RA 1OVZA 2OX5B 4PSRA 5IOKA 4PJFB 4NT6A 1ZY9A 3GF8A 1B4LA 1KB5H 3N9GH 3GM0A 5DJZA 2ADIB 1S78C 4KUZL 3U9PH 3VI4E 5T3XH 1LK3L 2DS4A 5L2KB 5B39G 1JF1A 4Y4KD 2OZ4L 1PFCA 5GXBB 3GJFK 3DHPA 2LVCA 5EO1A 1QATA 3PNRB 2OX5A 1GTNA 2B9BA 2BSBA 3LPGA 2YPLB 4PJFA 2MHAB 2ADIA 3APDA 4ADIA 4HHAB 2CDGB 2QFPA 1A4JB 4U7SA 4S0HA 2VSKB 2P3YA 5L2KA 3TO4C 1UWXK 5D70L 5T33H 1HHGB 4IHOB 3QZWG 4C4BA 3IXAB 1N5YL 4ERSL 2YPLA 3T3PF 5EB9A 2MHAA 4QR7A 1PX8A 3AS3A 4HHAA 2CDGA 3UJTH 1A4JA 1ZHKB 4A66A 4XODA 3ARRA 4HUXB 3T0WA 4OZFH 1IVLA 2FBJL 3WLBB 4P5TB 1HFUA 3LKNA 1HHGA 5JPNB 2XA8H 4I2XB 4WENB 4WU7B 3IXAA 3HE7C 4DFHA 1DBJH 3HAEA 1H3PH 1RUKH 2ZIDA 4OFYA 3IMWA 3BIBX 4GKOA 2WQRA 4PWHA 1ZHKA 2G3MA 2DOCA 4AEIL 4Z7OB 1QFUH 1DQQA 4HBCH 4MA8H 4DP1X 4HKBA 3BT2H 5DR5L 3WLBA 3EHBC 2RALA 3NCMA 4P5TA 5JPNA 4I2XA 4Y9GA 5KSBF 3QHZL 4G6MH 4WU7A 1SMAA 1E4KA 4G83A 5BRQA 1KCVH 4XPAL 3WDIA 1RD6A 1A7QL 3P54A 4MFHA 4X7SH 3HS8A 2XICA 1L6PA 1XCQA 5ACLA 3BESR 4FMFA 3TGXA 4IKNA 3GIZL 5DS1A 1P7HL 2J25A 1NDMA 3QIBD 4WAFA 4B7IA 3VQMA 3AG4B 2J8HA 3PQYB 4UYPA 1E3FA 3ZKQD 1OQXA 5J12C 5AKTA 3ESNA 3KM1A 4L4TB 4RAUB 4BH7A 4QJ3B 2D7MA 1BBJB 3C6LB 1A6UL 1I3RB 4RGMC 4Q58C 3ZL2A 4JFWA 2J88H 1IKFH 1OP9A 3K2KA 4HS8L 2IEPA 4MNHB 1PLBA 1DJXA 4MQTB 3T4YB 4ONFL 4XNAA 3K71B 4KKQA 2WQXA 1PD0A 4RAUA 3KDMB 4L1TA 4TNGA 5IMKB 1BBJA 2J8UE 3C6LA 1R5WB 1BM3H 1I3RA 3RWEA 3EOAA 3GDBA 4K23H 4M6NH 1YYCA 3HZMB 1Z5LB 4PQXA 4YXKL 3UBXI 4M8QB 4MNHA 5F71A 2PF6A 3IE9A 3T4YA 4BJLA 3Q5YA 3MLWL 2ITCA 4AW4A 3MNZA 1EJOH 4RMWA 3DJZA 1CICA 5IMKA 4R2GD 1R5WA 1KYFA 4HZLB 4EOWH 3S3CB 4BGDA 5MI0C 3IAGC 5T1KD 1Z5LA 4PJBF 5EIQA 1GKOA 4M8QA 1DVTA 2IDCA 1YAZA 3K4AA 3QPQD 5EO9B 4BDVA 2WWMC 2EDBA 2K4AA 4AJVA 5D5MB 2JKIS 1E28B 3HRPA 3THMH 3UTTD 1BZEA 4LDCA 4HZLA 1BQUA 3IS1X 1V7MH 5DMGD 4FXKC 5F7MC 2X9YA 5EO9A 5I26A 1YJDC 1B0RB 4ZMVA 4OLVL 3P2TA 1V3KA 1E28A 1TKWB 3NTCH 4MVBD 5TF1H 4KI5F 3TYFA 3REWB 3D0VB 5AAMC 3ULVE 2Q3XA 3C2AH 4FI7A 1OM3H 4DUXA 3UTSD 1B0RA 1HOCB 3JWDL 4OT1L 3QUKB 5GGUB 3VI3E 3MR9B 3T2NL 1N64H 1HZLA 5GS0C 1TKWA 3QUYC 1E27B 3TO4B 1W8EA 5E4AA 3B9KC 5KN5B 1CFNB 4PN6A 3VXRD 5EEYA 3D0VA 1D9KD 3D34A 2IDSA 3I84A 4Y2DD 5J1TC 5FM5M 4M5SA 4R84A 4JW3A 1HOCA 5GGUA 3QUKA 3ISWA 1LWHA 1OSPL 2E7MA 1E27A 1W15A 1XL6A 3POHA 3INOA 2HLFD 1BWWA 1NFDF 4GAJH 4PJCF 3WEMA 5KN5A 1FGVL 1BMWA 1CFNA 3QULB 2CA3A 3ZGIA 1KYDA 3HE7B 1EWHA 1ZLVK 3GB7B 1V5JA 3BJ91 5C07B 3TCXA 2XWCA 4RFOH 2DLHA 3QPKA 1CBVH 5EDSA 3L16A 4NUJB 3EHBB 3VFSB 4CC1A 3CZSA 3QULA 3ZTNH 3PDDA 1VPOH 3HE7A 2CIIB 3GB7A 1E90A 1NKRA 2X4SB 5C07A 3WFBH 5I16B 4TOYH 1CXKA 3S6CA 2Y36H 4FQ2L 1B90A 2YZ1A 4NUJA 3VFSA 2ZXBA 3L95B 3ETSA 1I1AD 4OCXL 4U2ZA 2CIIA 2C1PB 1N68A 1LO0H 2R29A 3M88A 2X4SA 5IQMA 2FT7A 4P46C 5I16A 3BN3B 3EH5B 1QFWH 4O02B 1V7NL 4Y5YA 4KJYB 1O7DE 1FLTX 3L95A 1JRHH 3FZUD 1U8OB 2FZ3B 1NOFA 2WVSA 4RGMB 1QI3A 3EUUA 5LGJB 2BWQA 1DSFH 2MEJB 5F70A 2D2OA 4JY5H 3Q3GB 1G43A 4O02A 1S5IL 3STBA 2UVFA 2CO6B 5JMOC 4NSKB 4Z7WB 1FFTB 1U8OA 2DAVA 4PGDA 1W6WA 5LGJA 2NDFA 1JTPA 2P5WE 4KK6C 3L3KA 4N25A 3Q3GA 4OFIA 2FHBA 1J1PL 2OXHB 2CO6A 3F83A 4NSKA 4HMEA 2WJ7A 3BD5A 2H0PA 1OPGL 5FFOA 1ILSA 3VGGA 1S7UA 1MIEH 3RGBA 1KCKA 3WTYA 1CLYL 1I85C 1MFCH 3W0WB 3TIEA 3KAAA 1MZZA 4N22A 4M1DH 1UFGA 3G6AA 2B1HL 4K7PL 3ZJAA 1V55B 3MLVH 3BKJL 4JE4B 1KGIA 3W0WA 5J7CC 3BVWA 2NY2D 3LEYL 1FO0H 1TXKA 2A9NL 4OFKA 3GMLB 4RNRA 5D72L 5DLLA 2VLJA 1WBXB 4YE0A 1R6VA 5JOEA 4MBRA 2G60L 3L54A 2AK1L 1FRGL 4XP1H 3TTYA 4PV9A 3LHPL 3RNQA 4HCIA 5K9QG 3MCLH 4M43H 1UA6L 1DBKL 2CUIA 4M1GH 4QGYA 3GMLA 5CN3A 2QELA 1WBXA 2F7RA 3SDXE 3QUYB 4TSAL 3T8XB 2OP4H 3B9KB 5C08B 3TH4T 5AAMA 3KPOB 3PABB 3OLIA 4IKJA 4YHMH 3RVTD 3F01A 1UJ3B 2DLFH 4ZW3A 4J28A 3QCVH 2GBVA 3FYEB 1VFBB 1MCDA 5EU3B 3ZXAC 1K4DB 3QUYA 2DEWX 4U1NA 3T8XA 4I18C 3B9KA 1PG7H 1BYOA 4J6RH 2AJSL 5C08A 1IQDB 3HG1A 4J4PA 3NJNA 3KJ4B 3A67L 3KPOA 3PABA 4H26B 1ZPUA 2PPCA 3FB6A 4KVPA 1UJ3A 3VFUA 5BO1L 1KIPB 1VFBA 3MLSL 2EDOA 1KIRB 3Q7JA 1DBAH 2H8PB 1S7TB 3MV8B 4PRBB 1K4DA 6FABL 5KBDA 3K2UH 2YFOA 3UJIH 1TYRA 4YDKH 3QSKB 2D31B 3A3YB 3CK0L 1OANA 1IQDA 4ZOEA 2MQCA 4PLKD 5I8KH 3QRGH 4Q52A 4H26A 4DVBB 4M61B 5IHHA 3EGSA 4LSRH 3X13B 5G4OA 3NFPB 1KIPA 2EDRA 1P4IL 1UG9A 1KIRA 1IGIH 5I2IB 2H8PA 5FIEA 1S7TA 3MV8A 4PRBA 1OP3K 1VRSA 1PZSA 2D31A 3M46A 4I3RH 4NZRL 2AJYH 3JXAA 4DTGL 3T2PA 3LV3A 5KYYB 3LX9A 2GCYA 4DVBA 2GFBB 2R2CA 4M61A 3X13A 4F7PB 1NBZB 3NFPA 5INDB 3HG3A 1C1EL 3P11L 4P46B 3GRWA 3VA6A 5I2IA 3GI8L 5IB1B 4AL8L 5FYJL 3ULVF 5FYLL 3VXSB 3VI3F 5DI8B 4R26L 3LAFA 4P0DA 3GI9H 5KYYA 4UB0H 3WJLA 5J1AB 2GFBA 3BP7B 4F7PA 2VZUA 1Z9MA 1NBZA 1TVHB 5INDA 2DQGL 2VDMB 2AEQL 4P46A 5IB1A 2WO3B 4CN4A 3PWLB 1E7UA 3WO3B 4AYSA 2E9BA 3NAAL 4CILA 3VXSA 3IBEA 5DI8A 2NZ9D 2FQEA 4XXDB 5J1AA 3L4TA 3BP7A 1YN6B 3FU0A 1MREH 2FX7H 3FXIC 2JE8A 4PY8J 1TVHA 5HJDA 2P28B 2Q87A 4GXFA 3PWLA 4N86A 4TPRH 4A2GA 3LZQA 3IGUA 3ZTDC 3V4UH 4B50A 5C0NC 4NQVB 1DN2A 4XXDA 2J1YA 3FB8B 1SVCP 1IARB 1YN6A 2HWZL 2J6EA 1E4WL 2LV4A 4XPBL 3C09C 1CGSH 2WYIA 4URTB 4Y2OB 1HX0A 3O2WL 3JTBA 4XWGL 2EYTB 1JE6A 2OBGA 4YGVB 5J6HB 3AAZA 3APFA 3MBED 2DLGA 4NBYB 2E4FA 3FB8A 4KKLC 2XWJB 3FFCB 4LEXL 4OGQC 4Y1AB 5DUJA 1WCQA 3ENEA 4HSQA 5C2UB 2NYKA 4Y2OA 2A3TA 3H3PL 2EYTA 4W6XB 2BSEA 3BGAA 4LE8A 4Y1AA 4NAMA 2XWJA 3FFCA 1GGTA 1SFDA 5BUAA 5CEZE 4X5PA 2BJMH 3S8FB 2OCJA 4WEEA 1G6RL 3FBKA 1THCA 3GO1L 4ISVA 3VX1A 4B27A 4KHXL 3BUPA 2H1LM 5CIPB 4OZGE 5KJ4A 5INCB 1WSST 4WZ9A 2VDNL 3CFUA 1AJ7L 3QDMB 5IMMB 2UY6B 3AREC 1T4KB 2FYVA 4OQ1A 1I8LC 4F27A 1F4AA 4PCYA 5INCA 1G7IB 1MF2H 1S7XB 3QDMA 1L9RA 1P0SE 1QTYT 3EDEA 4QHKI 5IMMA 2G0KA 4K94L 4MAYD 1ITCA 1T4KA 3U36B 3U83A 5T1DH 1B4TA 1UWGL 4KKAC 3NJJA 1S7XA 2QSCL 4KUCD 4X6BB 1JNNH 1AP2B 1NH6A 4Q97A 2WAQA 3U36A 1HWHB 2PWGA 2GSIB 1NUGA 3F58L 3G5XB 2J57A 3ES6A 3RDJA 3RZWA 3INUH 1N59A 3R1GL 4FGMA 3CHPA 4NZUH 3VNYA 4PJGB 4X6BA 5IB2B 1GW0A 1AP2A 4ZO7A 2PR4L 1T0OA 3IE4A 1T1ZB 4LP8A 4K5PA 5AW9B 3CSTA 2FK9A 4HGWB 1HTYA 1UXMA 4GB9A 4WDIB 2GSIA 5E6YA 4D9QE 2WGXA 3G5XA 1U58A 4EZJA 1PQZA 1K3IA 2LU5A 3SDXF 2JJWA 2X2JA 1KWKA 4WK0B 5IB2A 2P1YA 4K5LA 2BHYA 3EGXA 3K0WA 1T1ZA 5CZVL 1QZ1A 1KTRL 4PRHE 4WDIA 4CVXB 2XNAB 3U46B 1XR9B 4FS0A 4I87A 1I3GH 4X80L 4F57H 2ZOOA 3V4VB 1RZKH 4LEOB 1LJMA 5AWNH 4GP4B 5F7DB 1NCDL 3S36H 1N4XH 1CU4H 2P5PA 5EU4B 3RTQB 4CVXA 3LEVL 4GKZB 3U46A 4NGHH 4XI5C 5ALCL 1B0IA 1ZIBA 2H1XA 5KYUB 4F8TA 2X10A 4XOCA 5EF3A 4NJ9L 4U1HB 3C09B 2Z0BA 4IK7A 4LEOA 2VDKL 2DEYX 5LDUA 1Q38A 5L88H 4BCYA 1M42A 1C08B 2JB5H 1IL1A 3QP3A 4PG2A 5EU4A 3RTQA 1UCBL 1AKJD 4GKZA 2CBOA 2YPVA 3VXUE 2VXVL 5T1MB 4QRTB 1DFBL 5KYUA 2CLZB 1NIBA 4YDZA 3BJLA 4U1HA 4MYPA 4ZMNA 1BAFH 2Y7NA 4XCCH 4I0CC 3AY4C 2QDVA 1C08A 4LMQE 3IAPA 2IALB 5EZIH 2YEZB 1J5CA 4JUSA 3S34L 5DHMC 2GI7A 2Q8BH 1YUHB 2AQRA 4QRTA 1QBML 2CLZA 1VGEH 3M6DA 3OSVA 3U2JA 5M95B 4XGZB 2Z1KA 3C60C 1IV8A 4U3CA 4APXB 1HCYA 5EV7A 3GSXB 3VU2A 1EFQA 3Q8EA 3FQ1A 3FSAA 4KUCF 2YEZA 2Y06L 3UBHA 5L8LB 5GRYA 2PCXA 3IVKB 1YUHA 4UUJB 3WY4A 2GYSA 1I3UA 2YEVB 3QIUC 4QOKB 5I1KL 2H6PB 3IJYB 3KG5A 1RULH 2ZKWA 3TIDB 3UBXG 5CLWA 4XGZA 5E9DE 2HSIA 4APXA 2GTWA 3CDZA 5FW6A 1ZCRA 2WANA 3GSXA 3RFRA 2BVUA 4RX4D 2AGJL 3AREB 3IVKA 5EFIB 1L7IH 3QI9C 4UUJA 3TLRA 5D7JC 2PW1B 2H6PA 3IJYA 4XN9A 4ZSOB 1A14L 2I5YH 3KPSE 4DGVH 2YS4A 2Y22A 5FK9B 4NQTA 2WM0A 2VJ8A 4XNBA 2DKUA 5DJYB 4U6HB 2NXYC 2PO6C 1ACCA 2JIXD 1AC6A 4D0BB 3IJ8A 1R9FA 4D9QD 1QA9B 5EFIA 1G0XA 1MIML 4HJ1A 4JZJC 3ZMRA 2UUDK 2PW1A 3QJZA 2R8SH 4HSCX 4OB5H 3PXLA 3HRZC 2ED6A 4ZSOA 3U1QA 4BA8A 5FK9A 3NSJA 1TZHB 1AR1D 3P0VH 1BG1A 3G6DH 4U6HA 5DJYA 4D0BA 1D5ZB 1E5AA 2BX5A 4P07A 4PRHD 4K0OA 1QA9A 5KYXB 3GS7A 4GLRH 4QLRA 2R0WH 2ZZUT 3H9SB 4KTEH 3B2UC 5H94B 3ABZA 1TZHA 1FORL 3PPSA 2AANA 1AZCA 2X70B 1D5ZA 3FB7B 4ILDA 5AQ0A 4F5CE 4O2CB 2KQNA 3B2MA 2Z8VC 4V1DB 4GW4B 5KYXA 2ZKMX 4IOFC 3O2DL 2BRRH 3AUWB 3US9A 1RFDL 3ZYIA 3DX8B 2BP8A 1BZ7B 3H9SA 4XVOA 3UADA 5H94A 3DA0A 1YQVL 1GMEA 1SEQL 5JW4N 5K69A 1YUKB 2X70A 1MWAL 4OZGF 1SOXA 3N41B 4ABWA 2VNCA 2PMZA 5CXPA 2DQMA 2NW2B 3FB7A 3KBPA 1N3NA 4V1DA 4E9TA 3BKCH 2EDHA 4FFYL 2VDLL 3VUAA 3VXUD 3KLSA 4TLTA 1TFPA 1BZ7A 3ARYA 1O9ZA 5JO5B 3O4OC 4G8EB 2BNUA 5FKPB 1FC1A 2CQVA 3NA9L 4ORGB 4R90L 5DFVD 1T66D 3KYMA 3UFIA 2G5BB 4HYTB 4K2UH 2NW2A 1J5DA 5JW3H 3E8VA 1RSFA 5AW8B 2A0LD 3PHSA 2HT3C 3D08A 3IETA 4QD2E 5L6YL 3VW3H 4QRPE 3FAXA 4FDWA 2ADJB 1E6JH 4G8EA 5FKPA 3KR3L 1NAKH 1ZE3H 1TYJA 3LXBA 4EIUA 3OXSB 5GZOD 4F7TB 2KERA 4AKPA 4DGYH 1AIZA 1MFDH 4ODSH 2YGPA 4K3EH 4CSPA 4RAHA 4F7EB 5D1XB 3DUUB 5AKVA 2ADJA 4AGOA 4KKNA 3L1FA 4M6ML 5E9DD 5KW9L 3WTSA 4L2YA 2OJEB 2ZPKH 3OXSA 3QJTB 2H6OA 4OI7A 2XWTB 4JMXA 4XVTH 5E7FA 3B8YA 1F6FB 5I0XA 1LNUB 3DUUA 5D1XA 1GRWA 4G8FB 4FQ1L 3QC6X 5DMKB 1SN5A 4J23A 5LGKA 3KPSD 3QCUH 3JWNC 1YNLH 3MOBL 4BH8B 3ZUCA 2OJEA 4PRDB 3C60B 3AY4A 3DPDA 1VF5C 1CXIA 2XWTA 4JFFE 5A6LA 2QSVA 2ICEC 3Q48A 5I73C 4TLKA 3UG4A 2DY2A 4M5YH 4OJDH 1LNUA 1MRCH 4G8FA 3U0WL 4WI8A 1LQBC 3QEGH 5DMKA 3I9GH 1WYJA 5SX4I 1DJYA 3QIUB 1F1GA 4MCZA 3ZHFA 1J8HE 3DXAB 1ZLUK 5AVRB 4BH8A 4JVUA 4Z7UE 1TQVA 1QLEB 2H4EA 5G55A 2Y6SC 4NQCB 4PRDA 3C60A 5LGYA 4TKWA 4D2NA 2XX1A 3N40P 1JV2B 2P5EB 4FI8A 3IGAB 1E9OB 1J0YA 1U8IB 3IRCA 4BQ8A 4WNJA 4Y89A 3BFOA 1KELL 1P2CB 4MA1C 5D7JB 3QIUA 3DXAA 1OCOB 2IDUA 2LR4A 5E8OB 5K9KB 3U82B 5FHBH 4XNUH 1JV2A 2P5EA 2K8QA 4XTRC 5ICXB 1E9OA 1U8IA 2NXYB 3ABKB 1RZ8B 2PO6B 1JVOA 1OTTC 4WWPA 4AG4H 2FH6A 3QDGE 3WV0A 4JZJB 2ZX8A 4W9ZA 5D7JA 1SBSH 2I60H 3HRZB 1N2RB 3A6BL 4RISL 5DUBB 5E8OA 4GOSA 3SPJA 3HB3C 5BZZA 4J3TA 2XTLA 4H88L 5ICXA 3OZ9H 4NP9A 1RZ8A 2PO6A 1DO6A 1GHFL 2BVOA 1QI5A 1I9EA 2OXGB 1FIGH 1XD0A 4JZJA 3RVWD 2E46A 1RUPL 2HFEB 4PI2A 3DKHA 5DUBA 5KG9B 2VL5B 4TL4A 4D9LH 1FL3A 1NC4D 1AFVH 4LCIH 1C5CH 1LO3H 3NJVA 5GS1C 4NC0B 1YMMB 2OXGA 3GJFH 2RQEA 3D3VD 4BQ6A 2HFEA 3QQ4A 4M29A 4QRPD 4P5RA 1VSCA 5DD5L 3CVCA 1FN4B 4WU5B 1NUDA 1ZLSH 5KG9A 4N26A 5HI4C 3QUZD 4LHQB 4U1MB 3WTTA 2FGWL 2IDFA 3WXVL 3CE1A 3VXNB 4BRJA 2IIJA 4Q9QH 1UWEL 1UWXH 3GSNB 2J6WA 2A77L 4XCEB 3V0EA 3ZE2E 1BAWA 4DVRL 1PX4A 5TE4H 3WELA 4Y4FC 4ZODA 4NHCH 2R29L 3AC0A 3A24A 4U1MA 4HIXH 1QMUA 4G6KL 2B9AA 4JFTA 1LO2H 2NT0A 3NIFE 4LESA 3VXNA 4GW1B 3BWUC 4P2RE 5F96L 1AS6A 2ESVE 3GSNA 1LWRA 2ITDA 2LAAA 4XCEA 4MSWB 3L9RB 1G7QB 4Z0BL 1FVDB 2ZKHL 3OX8B 2EH8H 4JG1H 3K4ZA 4JFFD 4GW1A 2EO1A 2F54B 4QWWC 5A6MA 5AZEL 3DPBB 2EINB 4MSWA 4Z1PA 1UH2A 1GTFA 5FOBB 1WFJA 3UROR 3WO4C 3WKPA 4F58L 1KPRB 1G7QA 2DH2A 1K8IB 1FVDA 1KENL 3OX8A 4G9FE 2DQDH 2EJ1A 4WWKB 4AMKL 3TFKD 4DW2L 3PREA 4UMGA 5HDWA 1TJHH 1F18A 1YNKL 4A6YL 2F54A 1G9EA 2NY4C 2RD0A 5E6IC 1DJZA 3D12B 4ZS6C 5LCVH 4X50A 5FOBA 3CQPA 2B4CC 3OQ3B 1KPRA 1HOEA 2V7NB 1K8IA 3RA7L 3MFGB 4WWKA 3RDTC 5IJKA 5DMYA 5DLML 1EX0A 5BRZA 3CMGA 1R5IA 2ICEB 5I73B 1FL5B 3WKMH 1DSYA 3VGFA 4AYFB 2V7NA 3FUJA 3QUGA 1YY9D 5LDSA 1LXMA 1A6VL 1MAKA 3EBGA 5DZNA 5LNDA 3T0EE 2LU4A 4JGUA 3E3QE 4H1LB 4UV4H 2ICEA 4B7LA 1FL5A 3DVNB 1KYOJ 1IC7H 1ZT4A 2E6JA 3E8UL 4R0LC 5E99H 1RIVL 4LLAA 4MA1B 2P52A 4IW4C 4M4PA 5DU7A 3QZPA 3WGVB 4B60A 2ZCLH 1NBYB 3CFCL 3TVMB 5FYLE 3LS5H 4S1SL 5F7UA 4H1LA 4GAGH 3VQLA 1KYOK 3DVNA 2X12A 4Z7QE 3EDJA 2L7JA 4K4KA 4JPVL 2AMUA 4BWWA 4KVNL 1K85A 4IBLT 4PJXB 1KTKE 2IDTA 2DQIH 4G8GB 1CLOH 4WI3A 3K6OA 2JTDA 1P7KB 5FO2A 3TVMA 3RPIB 5CZRA 3HB3B