4NCC1

Neutralizing antibody to murine norovirus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
210
structure length
210
Chain Sequence
QIVLTQSPAIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment light
publication title Flexibility in surface-exposed loops in a virus capsid mediates escape from antibody neutralization.
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc102
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc101
4MCYB 2E7MA 1KSRA 4LP5A 4BSWB 4OBSA 1CIUA 4NKQB 3OKMB 2C3HA 1GPOH 4AL8H 4OGXH 2W9EH 2JJSA 1P1ZA 3SE3C 3CDGB 3C60B 4LPYA 2C4FU 5BRZE 4OM0H 1S9WA 1R3JA 3F6LA 4NZUL 4ZAKD 3HI5H 1AXIB 3REVB 1A6WL 3HNSH 1ONQA 5K59E 3DETD 3W5NA 1MPAH 3OHXA 3AMLA 1ZLVK 3T04D 4R8WL 2GTZB 1B2WL 2YA1A 4YK4C 1ED3A 3OV6A 1HILB 2EDLA 4IOFD 1WBZB 1TZHA 1D5MA 3C5JB 4RDQF 4QRUB 1QG3A 3LHPL 2RGSA 1GCFA 2WQRA 3MXVL 1JV5A 2F54E 5E8DL 4X5LA 3VRLF 4PRHD 1E4KA 3FMGL 1NLDH 4LVHC 4F33A 3R8BB 1IGML 1AO7A 1ZA3A 1YECH 2NY5L 1NANH 4LVOB 4ELKB 4FTVD 1BJMA 2OZ4H 4MNQE 3Q1SH 5C6PB 5FYKH 4HJGA 3QUXC 1CGYA 3OGCB 3PJSB 4ELMF 3P0YL 1T1XB 5HI4D 3QUZD 4M1GH 3VH8G 4R2GD 4PRPE 5HHOD 2VDQH 4NBZB 4OGZA 4WJ5B 5EIQA 3VXUD 4TSAH 2GEEA 2X09A 2XQYG 4KKBC 1ND0A 1JGDB 1KN4H 5DYOA 3V7MA 2HAZA 5JHDB 2X1WL 3ROOA 3TESA 2E27H 3NCYS 3MGAA 2GI7A 3B9KA 5LGKA 3SBWC 1NEZG 2X40A 4NWUH 1XGTB 2HJFB 5FB8B 4GO6B 4CKVX 2AJVH 3CLEL 5CCKL 5DHVB 5E1AA 4MAYB 4P23C 3U0TA 3V4PL 1JGUL 4OZFB 2WAHA 1CE6A 5HSFA 5K9JH 4KHTH 2CDGB 1JUFA 2Q6WA 4P9HC 1I7ZB 5IVXE 4KK8D 3SDAA 1AFVL 5AUMA 5IMOA 4TNVK 5CJBA 1X3DA 4PY8I 4Q7DA 3AU1B 4XXCC 4LPUA 2W0FA 3VGEA 5T1MB 4GW4A 1XCTA 1C5DB 3RZCB 1AR2A 3QEQA 2VE6B 3VRJB 5EIIA 3HNVH 4KGLA 3UBXA 4PJFF 2H45A 5IHZB 3KDMA 3WN5A 4KTEL 4JZJA 1LDPH 2I07A 2XKNB 4NNXB 1WF5A 1NCDL 4L3AA 5KVEH 5IFJA 2YXMA 4LPTA 1OWRM 1JWUA 2X9WA 1CN4A 5EO1A 1KYOK 5JW3L 1B0RA 3FO0L 5CGYD 2BVEA 2P1YA 4YNYB 4QRTB 2J88L 1ES0A 3NCMA 5DK0B 5IEKA 1NAML 1BBJA 5J1AB 4DKFL 4NPYA 4MS8C 1DL7H 3RP1A 2YSSB 1CF8H 1R3KA 4EBQL 2DWEB 1CFSB 1H3VA 3P11L 3QIUB 4PJ5A 2D7TH 4QHLA 4Y4KC 4Y5VB 4P2CG 3DUSA 4PJHF 1J8HA 4Z7QF 2D3VA 3EYVB 2J5LC 3WXWH 4IRJB 4HCRA 4K9EC 3WDJA 5BS0B 5DZNA 3TZVD 2GK0A 1KN2L 4P2OA 3GSRA 3DI3B 3UX9B 5IIEB 2BOCB 1NMBH 2DF3A 4YDVB 4PRBA 5IESL 4WGWB 1F4YH 4LEXH 4DKDC 4KU1A 4G6ML 2F9BT 3GSNB 3TJHD 2PW2B 4Y4FD 2F8VA 5F88B 5BJTB 1DVFD 4KDTC 4B50A 1Q9KB 1A7RL 3AC0A 2ZCKH 1FSKB 5DJDB 2NY3B 2PXYB 5HYEA 2P5EA 4O9HH 1D5IL 2RCSH 5T3ZD 3HRZB 5JA8B 3LRHA 3JZ7A 1C5CH 2XA3A 3ARFB 1KPRB 3L3IB 1ORSA 3QDGB 1F4XL 2Z91A 2DQCH 32C2A 3CFKB 3OXRB 1WBXA 2VLRA 1U36A 3F5WA 3SCMC 3Q6FB 4S0TD 3DRTB 1V3MA 5KAQG 1HYSC 4ODBD 2VH5L 1RUMH 2CGRL 2BSTB 5EWIH 2EKSB 4X4YB 4JN2A 3SGEI 1FYHB 4PJ5E 1RVFH 2E9JA 1EO5A 3ZDZF 3SQBA 1CE1H 3ARTA 1ODAA 4Z0XA 1EBPA 2XA8L 1CFBA 1NGWB 1LWRA 4PJ8A 1YQVH 4WW2B 3CXDH 3RKDD 3IT8D 1OOAA 3D9AL 4P4RA 1Y18B 1Z9OA 2H1PL 3QO1A 3INUH 2KBGA 5D93C 1KTDA 3ARDB 4OFDA 5IB3A 5LWYL 3GMQB 2BRRL 5HGBA 1NFDE 4Q6IB 1N64L 4FFVC 1XIWD 1T6WA 3AB0C 3K1KC 3QDAA 3B9DA 2EDYA 2UZYB 1ADQA 2X7LA 1P7HL 3FT2B 5EU5A 4UU9B 3ALPA 4NJAH 5IBLD 2WWMD 4K7PY 3RJDA 3P0VH 1KIPB 1BFVL 2VLRE 4GXUM 3MRJA 3D25A 4YFDB 3IDJA 5J6GA 1U8KB 4JQXA 1KPVA 3C6LC 4PP2B 3BGAA 3CLFL 4Y8DC 5DJYA 1XF1A 4V1DD 5MEQA 5ANMB 3IRPX 1N26A 1H3PL 4UMGA 4QNPE 1NC2A 5IW3A 4PJIA 3F7VA 5ACZB 2BVQA 3X13A 4PJBA 1NAMB 2DQEL 3LKQB 5CZXC 5IG7B 5E2JA 4CADA 5JPMA 4WW1A 4XCEA 1I75A 3D39E 2MKLC 4JN1L 1BWMA 1NANI 4XTRD 2IPTH 4X0KB 3HR6A 5TF1H 4Y0GA 1A47A 1QSED 1KGCE 4IRSA 1FL3A 2HFTA 3GSUA 1N6UA 2C9AA 5AYUL 4JZNB 2AJYH 4OZHA 1DUYB 1XF3B 3V0VB 5K9KB 5C0AD 4E9LA 3TBWB 2UWEA 4QRPA 3LMJL 1IC7H 1QRNB 1QR4A 5FECB 4GKNA 4JFFA 3MLRH 4NQDA 1J0IA 2X2YA 3NIGE 2BVPB 4RMSA 1KNOB 4O51B 2R4RH 5CJOH 3BWAB 4LEOB 1IFHH 1JNLH 1F02I 5EORL 4OCRH 1HE7A 1OSPH 5FYJL 5KSBF 2ZSWA 4G7VL 4H8WL 5DUML 3TPUB 5JIIA 2NY1D 4PJ7B 4XMKH 2X70A 1IKFH 1OAKL 1NCBH 2C7UB 1FBIL 1LHZA 1SEBA 3C5ZD 1MQKL 4U6TA 4JDTH 4ZDHA 4RDQG 1LO3L 5L2JA 2P7TB 5HVHB 3ZKXB 3U9UA 3E6FB 4PJBE 4W4NA 4OI7A 3RWDB 1KLGA 1MF2L 1X5XA 4YHNB 3G9VA 2EDKA 3ROLA 2A6DA 3SO3C 3HE6C 3KPQA 4JJHA 1LNUA 3O2DL 3OXSA 3DUHA 4ZAKA 1OARH 4CJ0A 4HIIB 4KPHL 3WD5H 1I1AC 3DVGA 3K2UH 4NNPL 3GIZL 5H35A 2DQUL 2IMMA 4UOW0 5L0QC 4Q9RH 1TITA 4HV8B 4U1KA 3QXTA 3FB7B 5C0IA 1B6UA 2A77H 2XACC 3CSPA 4RIRA 1MIMH 3NACH 3RIFK 1HXMB 1HOCB 4JFFE 4PYGA 2G75B 5HD8D 2R4SL 2EYSB 2G60H 1OD7A 3EOBA 4NQDE 4PRHA 4XMPL 1I7UA 1VSCA 2LABA 1S7SA 3I3EA 4KKLC 5D2NC 3RDTD 4GXUN 3V79C 1JP5A 1F6AA 1FE8H 3W9EA 4RFOH 4OLYH 3UPAA 4M00A 3FB5A 5FHBL 1E6OL 1MVUA 2AJXL 3FJTA 1BZ9B 2ZCLH 3IJYA 3EOYG 1OGTB 5M95B 3MCKB 1P6FA 1TTFA 1A2YA 2JCCF 4NZRH 3NCEB 4LSUH 2XKUA 3QUZA 1U58A 1N2RB 4RAHA 3LN5B 4OZIB 4HFWB 4DZBA 4EN3C 3QULA 1HXYA 1KJ3L 1KLFA 3VXUA 3I6LD 4HGMA 3G6AB 4D0DA 1YEDB 4LCWD 3MRCA 1MUJB 1S7VA 3QHFH 3IDIA 4HS8H 5HYQA 1B4JL 5TE4H 3R06A 1OTTD 5DQ9A 5DURD 5HDBF 4MD0A 1PEWA 4LSSH 2AJUL 4NO5B 1FNGA 1AD0A 3MROB 2NY2B 3L95B 3QCTL 4Z7UF 5E8NB 1RZKL 1RUKH 3CFEB 3BP6B 4FFZH 5GHWH 2GCYA 5EFIA 2BMKB 2YD1A 1EFXD 4QF1B 4NGHH 3H9SB 1EXUB 3H8NA 1F58H 4AEIH 5DR5L 5DJZA 2YBRB 4HX1A 3KJ6H 1YNKL 4XWOD 4KHXH 2X1QA 2FIKB 4QRSB 1OAZL 3O3AA 4XWGH 3QQ9D 4HIEA 5J6HA 1U8HB 2AV7B 4FTVE 5DEFA 3WL9A 2HWZH 4UDTB 1A4KB 4P4KD 5DMGC 3TH4T 3L1OL 3TO2A 5I17B 4ODSH 4OLUH 4POZD 1D5BA 2NQCA 1U3YA 3U1SH 3MO1B 3JWDC 1JNNL 2X4UB 2MQCA 3DOSA 4OKVA 4Q0XL 5HHOE 3CFIC 3O6LL 2YD7A 3D69A 2BHYA 4QTHB 3JWOH 5I8KL 3VXUE 4TVSa 2ZKHH 3K81A 3H3BC 1NBYB 3BAEL 4PS4H 4Z7VA 3DO7B 4LIQE 2W65A 3B9AA 1DUZB 5GRUH 1CLOL 1R3HB 2ZUQB 2HKFL 5CD5C 5GS3A 1KT2A 2GJ6D 1R24B 5IB5A 1QLFB 1QP1A 3A6OA 3E1F1 2OTPA 5C08D 3BKCH 2CKBA 5HBBA 3AS2A 1GOFA 5J06A 1A3QA 3DHJA 4ODVL 3OKNB 4OCMC 4JKPL 4XCFL 3GHBL 5CBEA 3AXLB 2GYSA 5HI5D 4I0PC 5C09D 3ZTJH 1QYGL 3DV4B 2BC4A 3TZVA 4GKOA 2GTWA 1YN7A 4D3CL 5I6XB 3H9HB 4RFNB 4MA7H 3VE0A 4DVBA 5KJRH 4R96B 2OYPA 4JZOB 5FO9B 3UC0H 1JVKA 4KTDL 4PGJA 2V5TA 1S8DA 4BQBA 1P7QB 4XVSL 4Y16D 4Z95H 2OLDA 4ODWA 3P9MA 4G5ZH 1OAQH 3R1GH 3VDAA 4AL8L 5I1CH 4Y4FA 5GGRB 3T3ME 4OGXL 1W0WA 3MUZ1 4LLMB 3RL2B 4S1RH 4MA8H 1NC4D 1ZT7B 4QHNB 4IDJH 3HI5L 2MJWA 1REIA 2O5YL 4KUZH 4G6FD 5BOPA 4MJ5B 3BT2H 1KUMA 4Z7VE 4Q2ZA 3FRPG 1MFAH 1MRFL 2UZXB 3TBYB 1G84A 1NL0L 4K3HA 3BIBX 2M8XA 4ZFGL 5TDNA 5D7JC 2AERT 3I2CH 3WIFA 4NC2B 5DRNB 3O41A 4R26H 1XF5B 1QR1B 3MRRB 3BD5A 3TT3L 3DMMD 2F53D 4OIAA 4D8PA 1UZ6E 4S1DD 3RIAF 1IC4H 1T21B 1DEDA 3PHQA 2FJHB 4P2RD 1MJUH 3HG1E 1K4DA 3THML 1TCRB 3O8XB 2CLVA 2OSLB 4XNZB 3BH9B 5D5MF 4JHAL 2OZ4L 5HPMB 1S7QA 5JIPA 5FKPA 2HJLA 2ADFH 2YPVL 3Q3GA 5FYKL 5DQDH 4I1NB 1RUQH 3ARVA 2NCMA 2OMBA 3GSOA 3GSQB 3W0WD 2IH3A 4M1GL 4ODHH 3MYJA 3MUY1 1B9ZA 3MQIA 1AQKL 4TNWK 4UT6H 2A73B 2P46B 3F6IA 2IAND 3LEYH 4TSAL 3L5XH 1M71B 5IEHA 1EO8H 4XGZB 1Q8MA 1XIWA 3ULUF 2FWOA 1KN4L 3ARBC 4KJPD 4G8FB 5T3ZE 2DJ4A 2B4CC 4A2LA 2E27L 4WFFD 4EQ2A 1XR8A 1IEAA 1VDGA 1N4XL 3DO3A 1XR9B 4OAWA 2EDNA 3UTQB 5ITFB 2AXGB 4NWUL 3GI9H 5IVNA 5D1ZB 2FH6A 3D6GA 4ZYKB 2AJVL 2R39A 5DRWB 1FYTB 1MJ7L 1S3KH 1CG9B 4H1LG 4ZSOE 4KAQL 1UQSA 3LV3A 4ONHA 4V1DA 5K9JL 1BFOA 3TPKA 3FONB 2D0GA 4KK6C 4HUWB 4HUXB 2N4IA 4YK4B 4UZGA 3R0MA 4QOKA 5JORA 3IKCB 1JWSA 1DQLL 1ZLSH 1R5VA 4E41B 1D9KB 3LN9A 2OXGA 1V3JA 3BSZH 3I75B 4FHBD 2CMRH 1TETH 5HGDB 2DD8H 3TN0A 2RQ8A 3CFCH 4XI5D 1S7XA 2XWTB 4LSVH 1G7MB 2WBJC 1QSEA 3I6GA 4RRPA 4MXQC 5EU4A 3LEXB 1ZK9A 3BP7B 3W9DA 1LDPL 5BQ7A 2CK2A 3CC5A 2FATH 4MD5A 3TIDA 1NDGA 2VZ1A 3J7HA 4MDJA 5F71A 3QUXB 5C0AA 1IM9B 3VXNA 4PTTB 4GAFB 4KZEH 3GSVA 4EUPH 1K5NA 4M5ZH 1AGFA 2C3GA 1INQB 2HMIC 4KQ3H 3KPRD 1I1CA 1BAFH 1CICC 1DL7L 3KLAA 3ETBF 1CF8L 1I7RB 1FZOA 4NRZB 2D7TL 5ISZB 1LVEA 3H0TA 1MWAL 1RFDH 2NY6C 4Z7NF 3C5ZA 4HK0A 1IJ9A 3MLVL 4FXGA 5HHNB 2XZCH 3BQUD 4X8JB 5ITBH 3BUTA 2NYYC 3RI5K 1S78C 4HSQA 2DTSA 4CJ1A 4G8GA 4BZYA 4AM0B 1F4YL 1FZMB 2DI9A 1DBJH 1OD9A 3SDDC 2GFBB 1NEZA 3UTTB 5J9PA 1E28A 4N1HB 4XVJH 4K94C 2OK0L 5DFTA 3GJFH 1QSEE 4PRIB 1I9JH 2ZCKL 3ARZA 3RHWK 3AM8A 1RZ8A 2GT9B 4N5EC 2RCSL 5DJ6B 4DUVA 2EDTA 4CMHC 3QRFM 3KJ4B 1RURH 5IMKA 3GI8L 1C5CL 5IBTH 3UYOD 3M8OH 5FO7A 5DC4B 2D4DA 3M45A 5GS1A 5TQ0H 2IH1A 3WHE0 3D3VD 1RUML 3RDTA 2Q3ZA 4LSPL 1WFNA 4Z78A 3U30B 4WNQA 3AY4C 3OKDB 2DOCA 4MB4A 1SVZA 3NPZB 3GKWH 1RHHA 4UQ3B 1F11A 4UIKH 5EBWA 4TVPL 2QADD 4YHZH 3DROA 3RVWC 1EAPA 1EPFA 4JPWL 1EHLL 4DZ8A 5JO5A 1QBMH 4OGYH 4KRPB 1YEGH 3NZ8B 5F89A 3IETB 3CXDL 1QLRB 4QHUB 4Y5XC 3DJ9A 4Y4KB 1MOEA 4M61B 4F37K 4ZUTA 1T0NA 4R4BA 4JGMA 5CIPA 2AXHA 1QUNA 3OAYK 4MZ2A 4MQSB 5A16A 4GKZB 3LKPA 3UTOA 3WV0A 4P5TC 1GYAA 3FFDA 5JHLL 1X5HA 4LP4A 5GXBB 1FVDA 3KXFE 2ERJB 4ZS6D 3VXPB 1YYLL 2P24A 1IRAY 4K2UH 1JF1A 1Q9OA 4NKDA 2VITA 3QO0B 1OGAE 4LLDB 1H8NA 5A3IC 4HKZA 3G6DH 4PJEA 5EBMB 1X4XA 5HHPB 1G7QA 4OGAC 2OL3H 3WNOA 3ZTNH 1AC6A 4OV5B 1EMTH 3BN9C 2HFFB 5CP3A 5IK3B 5ERWB 1A6PA 3DSFL 3TBVB 1RJYA 3D85D 4EJ1C 5C0GB 5BCAA 3LKNB 5EBLA 2Z31C 3TYGH 4P4KA 1KJ2A 1IQDB 4OSUH 1DE4B 5ENWB 2MQ3A 2OXHA 3P73A 1SY6A 2GIYA 3WCYA 1FL6B 4PRDB 1U8JB 4KI5C 4J1UB 3LQAH 1JPTH 2OTWB 2RR3A 1MWAB 5MEND 3TO4B 2O93L 5I9QC 2DQFB 3MZTA 4GRWE 4FQXC 3I6LE 1AC0A 5EZLA 5MERB 3VGBA 4LCWE 2W0KA 4XNMA 1CGSL 2V5MA 3FT4A 4FN0A 1GGBH 5D7SH 2GJ6A 2XWJB 1FQ9C 4GBXD 1E6JL 1IC7L 5C0BB 2GSGA 1XCQB 3VFPA 3MLRL 4U0QB 2DI8A 5D93B 3S4SA 5C08A 4FG6C 3S96B 3GEWB 3IDMA 3KYMB 1HDMA 4GMSL 3EYOB 1JBJA 1IFHL 1JNLL 3UJTH 4OCRL 2XNAA 3QPXL 1FL5A 2ORBH 3ZZ1A 3WEXB 3CFBA 4BH8A 2WBWB 5C09A 7CGTA 2AXJA 2D4FA 3DYMA 3OAZK 4K3DL 4HKJB 5J3HC 2P8MA 4TQEL 1WIUA 1NCBL 2R23A 5DJ2A 3GKZA 3MLSH 5B3NA 5I0ZA 4OKDA 2V9QA 2AKRA 4YDLB 3DV6B 2JELH 3SKOA 2F58H 4Y16A 3QNZB 2C26A 5M94B 2GUOB 1DQJB 2NNAB 3OB0K 3CX2A 3BMWA 3C6LB 3FN0H 3MV7B 3LQAC 3O3DB 2XN9E 3FQTA 3DX8A 1RV6X 4K8RD 2APTA 3QDHA 2WINA 3K2UL 4WEUD 1WFOA 5DJAA 1IM3A 4Z77A 4ODTH 3LKRB 4GRMA 3QT2A 3OJDA 4GG6B 1BQSA 5CWSB 5EZOH 2VDRL 3X3FH 1KCRH 1SMOA 1JI1A 3ZDYF 4PTUA 1AP2B 4YJZL 2A77L 4JFOA 4F57H 2GJ6E 3N1MC 1MIML 3NACL 2KH2B 4P9MH 4HPYL 1TTUA 1E4KC 2R8SH 2F53A 3U0PB 3DYPA 1Z9LA 4EOWL 5IGXH 2YXFA 1IGYA 5C08E 4YXLL 4P2QB 1T2QH 2NW3B 5J11B 1CXEA 4P2RA 5C0DA 1FE8L 2AS5M 5TQ2L 3OR7B 4OLYL 5I18H 4RGND 5FA4B 1GRWA 1DQTA 3HRPA 4E42B 2NXZD 4Y88A 2ZCLL 3ZKQD 4WI2A 2ADGB 2Z9TA 2NY4C 3OJMB 3T4YA 4PG9A 1YEHH 2C3VA 3W0WA 1OWWA 4ETYA 1Q9WA 4PGCB 4RMUA 1TQBB 4XNUL 3VWKC 5IHUL 4BQCA 2GY7B 5CLWA 5ETUB 4DVRH 2IANA 4WY7H 4I5BB 4E0RB 3HC0A 1TVBA 5IP4A 3BDXA 3LS4L 1JGEB 4XZUB 4Y19D 2VJXA 3VWJD 3CGTA 3EDDA 4HS8L 1A6AB 1AR1D 2E9IA 1T20A 1J11A 3GMMA 3B9KC 5F1IB 2HTLD 5KSUA 4X6DE 3GMLB 2ATKB 4LSSL 2CRMA 3MCLH 4AIOA 2VXTH 4GSDL 3G6JE 2VZSA 4OZGE 1RUKL 4K7FB 5I74B 1F45A 3BH8A 4FFZL 2WP3T 1FV1B 4XMLH 1T7WA 4QLRA 4LKCA 4NGHL 4YHOH 4S1SL 2WLYA 2CKNA 1F58L 2F53E 2YPLD 1EGJL 3EGSB 4HF5H 4QCIA 4AEIL 2ZJSH 4GKSB 3BD3A 4HCRH 5I1LB 4G42B 3WBDA 2K9UA 1FC2D 3IFPA 2J1KA 4KHXL 4GXVL 4PR5A 4XWGL 5DEGB 4QXUH 1OQXA 1JWMA 1T3FA 4U1SB 3MXWH 1TNMA 1I4FB 2HWZL 3KLHC 1T03L 1J05B 5CMAB 2XZQL 4YBQD 4W6YB 5F44A 4ODSL 1T5XA 3WN5C 4P5MB 5EPMA 5KSAC 1HQ4B 4UNUA 5DS8B 4OLVH 3W0WE 5GS0D 5CSGA 5GS2D 4ZUWA 3VFSA 4RWYH 3DUUA 3CDFA 4HUVB 1PZ5B 1RJLA 3V9FA 3GJEB 3JWOL 3DSNA 2B39A 3PXJA 2FCBA 4PS4L 1CGWA 4R0LB 3QWOA 2UV3A 1I3GH 4BKLA 1S9YB 3JVGA 1L0QA 4EN3B 1FP5A 3TLRA 2H8PA 3OG4B 2A6JB 3AGVA 3KPRA 3V5DA 4BQ6A 5SWQB 3KPSA 1JZ4A 1FORL 4LCIH 4G6KH 1D5XB 2H32A 5JXED 1JPFA 1UXWB 1J1PH 3QUKA 4JKWA 4CNIB 1KIQA 5DT1H 4FXLA 2QR0A 5ALBL 5E2TH 3RJQB 1G9NL 3BQUA 3ZYIA 5AWNH 2QQLH 3SN6N 1SYVA 2V2WB 4MA7L 5KJRL 2FJFB 3WLWD 3VI3F 4YUEH 1P2CB 1HSAB 1IGTB 1R5WB 3SJVD 4L8SA 1OAQL 3EDEA 3R1GL 3S3SA 2JJTA 2I9LB 1JZ7A 1IQWL 1DSFH 4OB5L 2PYED 4HXBH 4MA8L 3GGWB 1RIUH 2DM3A 2YUVA 3UYRH 1UEYA 4IDJL 3VGFA 2VQ1B 1AGBA 3TFKC 1CCZA 1IT9L 2VL5B 5D2LB 5IJVA 4YFLI 3RTQB 5A2FA 1U8OA 1G7IB 3BT2L 2C3XA 2YA2A 4HIXH 5HDQL 4Q58C 2BVOA 2WIIA 4R26L 3HMXA 3QDMB 5EU6D 3D3VA 3HC4H 3UO1H 1FGNH 3UYPA 3MZGB 2BNRB 1JNJA 4MVBC 3OZ9H 2VRAA 4L9LB 1C12B 2JTDA 3KPRE 5FYLH 5E6IA 5EO0B 4AIZA 1U8QB 2N7BA 3QWQB 5JLZA 4PJHA 5LVEA 4JFYB 3OKKB 2XFXA 2A9MH 4AENB 4CVXB 15C8H 3SGDH 4UNTA 2C1OB 4PJ8C 3C5SA 3S5LA 4XNQB 3LKSB 1WK0A 1N5AB 2J8UB 2ADFL 3ZKSD 5F1KC 3E6HA 3ISWA 1RUQL 2AJ3A 1G9MC 1Z0MA 2ILLA 2YUXA 4ODHL 5D1QB 4ZUVA 1SM3H 4I0PB 4XHJC 1QSFB 2CIIA 3UZEA 4MJ6B 1NCAH 4UT6L 5C8JA 4J3OC 4PBWD 4WV1B 5IMLB 3LEYL 1EO8L 2G5BB 3HPJB 1SHMA 2FBJL 3K8KA 2BNQD 3PP4L 1J0YA 1MELA 2IJ0C 4YHLH 5HHQA 4WTZA 1WZLA 2N1KA 4Y89A 5KVGH 4B7IA 5LGHL 3VFMB 3PL6D 4F7MA 3MOAL 4Y4HD 3GMNB 3MRGB 3OQ3B 4JQXC 1AGDA 5KSVA 5EOCH 1A3RH 4C58B 3GI9L 3PP3H 3D3VE 3L3KA 1AXSB 2NLJB 1MHEA 1CD1A 4V2BA 3RWEA 4C54A 3O3BA 1S3KL 5BW7C 1ZS8B 4XBEL 3D85A 2UVFA 5D2LF 4Z7WB 1MI5B 1OVZA 4GUPA 5JW5A 3FO9B 1BD2D 1OCWH 2W0PA 2X4TB 3BISA 4YPJA 3P4MB 3IYLW 4QRRB 3MOBH 1QFWH 2X1OA 2HT3D 4EIGB 2CPCA 4LF3A 4FFWD 1T4KB 1YNLH 3LAFA 4LPVA 3WIHA 5JOFB 1WCBA 4KKNA 3ZL4L 4MNGB 2DD8L 5MENA 2P5WB 3CFCL 4IRSC 1CLYH 5DK2B 3PHOA 4GLRH 4U31A 2R2HA 4KGJA 1U3HB 1GZQA 1HQRB 1JN6A 3HUJA 4OLZH 4AEFA 5IV2A 1FPTH 3MRKB 4GBXA 3HS0A 5MEOA 2HFEA 4M5ZL 5I76A 5IB4B 4GW1B 4HZLB 3IDXL 4U6XA 1CZ8H 3I50H 5CBAB 1AE6H 3BP4A 6CGTA 3S35X 4PJXF 1I3RB 3ARBB 1I7TA 2J4WL 3MNVA 3QP3A 2PO6A 4JO1L 2XV6B 2KDGA 1QPPA 3G04B 4YE4H 1V7NL 3NABH 5TE6H 1G0DA 3QEHB 1QA9A 3MFFB 3BGFB 1QBAA 1A9EB 1V5JA 3RUGF 1G1CA 3TA3B 2YUZA 3UPRA 3MUJA 5ITBL 4PGEA 1UWGH 1MCCA 2R56L 4XX1G 1C5BH 2EO1A 1DQQB 2R1YB 2FD6H 4DW2H 3F7YA 4ZAKC 1N3NB 1WZMA 3IXAA 4QGTA 2VABA 3OKOB 4IOIA 1CDJA 3DETC 5MENE 5HJ3B 4G7YL 4LLAA 5BV7C 2X4RA 3D0LB 4NP4L 5E5MB 2IPKB 5E2VL 2ZG3A 4C83A 4IOFC 1U8PB 1T1YB 3V5KB 1JMZA 1RURL 3VMNA 5HYSB 4OLEA 3V6OA 3OB8A 3JTTA 4KWUA 3DX9A 2VB5A 4GH7B 3O3EB 4ZTOL 1QFHA 5EDXA 3QJFA 5HGGS 5C3TA 4NHUB 2VR5A 5KSBA 5IW6B 4DN3H 4TRPL 1MCKA 1HH6A 4PJCB 1Z2KA 1KCLA 1NGZB 3OTTA 2XWBB 5I1JH 5GZOD 4X6FB 3MOQA 5L88L 4PPTA 1X7QB 2VISB 1VGKB 4ZFZA 4UDUB 1D5ZB 5IFHL 3V4VH 2PW1B 5HI4C 3QUZC 3CDYA 5L7XL 4R2GC 4P5KB 4OGYL 3V52H 1LP9F 2BJMH 3UJIH 1YEGL 2IBZY 5T3XD 4ZTPH 4I18B 4YO0B 1VEMA 3PDDA 1AGEA 1P5UA 3DTXB 4OQTH 2NY6B 4ALAL 1FFNB 3C08H 3MV8E 3OPZH 4L3CA 4XBPA 4Y19A 3VWJA 3QWRD 3MRMB 3K4DA 4OF3A 5F3HA 4OI9A 5FUCE 1RMFL 1B0GB 4HKBA 3O4LD 5DZOA 1U93B 1ZTXL 1P9MA 2QLVB 5TH2A 3WUWB 1H8OA 1G7HB 3RWGA 3H3PL 1HKFA 3IVKA 3GSWB 3S36X 4LLUA 2EIDA 4I3SL 3U83A 4YEFA 3L6FB 4X9HA 5HYIA 2YPLA 3L3OA 4X7TA 4KK8C 3BEVA 3STLA 5CD3A 4W81A 1ROWA 4JQIH 4MB3A 3AROA 3SKNB 1NGPH 1EMTL 4OM1L 3QFJD 1ZHLB 5FDYA 1T0MA 4U4BA 2EDRA 2GSIB 3TBTB 3VD7A 2XZZA 4RGNE 2GK2A 3IU3B 3TYGL 5HYJB 4XC3H 1BQHA 3VI4F 4H88L 3T4AB 3PWJB 3DURB 3FB8A 2VQUA 1JPTL 4KKBD 1JFQL 4KTYA 2WP3O 1H15B 2EDDA 3LRSA 3NH7L 5JTWA 4O2EA 5CGYC 4RQQA 4Y19E 3EDJA 4D9LH 4MDIA 5F9WB 1KTLA 4U1HA 1ZGLP 3PNWB 2APBA 1BX2A 1RK0A 3WFHA 5D7SL 3QDJA 5E00A 3RWCA 1A1NA 2EYTA 4IOSD 4P23D 4I2XB 1MEXH 3SDCD 3B8SA 3HI1A 2ZOLB 4BZ1H 3GJFB 3HAEG 5DO2D 3UJTL 4TUJB 1CXHA 4X7EC 5HDLA 4FNLL 2YPLE 2IQ9H 3GNMH 4LLQB 4A6YA 2ORBL 5C2BH 5D7IA 3KS0H 1KELH 4MHHG 3UDWA 1JK8A 4L4TA 4YDIH 3RU8H 1XH3A 3UTSD 2CLRA 5A43C 2AK4B 2JELL 3TJHC 4Y4FC 2F58L 3SJVA 1DVFC 3V6FA 1GGIL 4BA8A 2B7DT 3FN0L 4ZODA 5J13C 1TPXB 4Y8AA 3VMOA 5E95B 1ORQA 2PYEA 3U4BH 3V0AC 1ZHKB 3PV7A 1G9EA 2C4XA 2Z31B 2HKHH 3ABZA 1NEUA 1VA9A 4DTGH 3NVQA 4I48A 2ZOKA 4NO0D 1WWCA 5EZOL 3VXSB 1AIFB 4M1CD 1B0WA 4MS8D 1UA6H 2DM4A 5CEXB 4EZMA 4ZS7L 4LFHD 5EU6A 4LGPB 1F4AA 5D9SB 4LHUB 4FQXB 2D9CA 4MSWA 4BSVA 2R8SL 1A1MB 3T8XB 3CPLA 4JR9H 4C56A 1YEIH 4GMTH 5B3JF 1HHJA 3ULVD 4WI3A 3KYOB 3T65A 4X8XA 1IAOB 1C08A 2NW2A 1PJ9A 4WFED 4M6OH 3L3JA 5D7IE 4K55A 3RKDC 2ESVD 3C2AH 1CTOA 2D0HA 3GBMH 4JFXA 3MRPB 5K33A 4U1JB 5GGRY 3JUYA 3MJ6A 2DIJA 3O9WD 4AH2A 1CGUA 3SJVE 5TGBB 4KJQD 3VFNA 4F9LA 1S7TA 5HDOA 3ZHDA 3PE9A 5GRYA 5JZ7D 4FQQA 1T22B 3SGJC 4WY7L 4OCXL 2PYEE 4M6ML 5FUOH 1CD9B 3VD3A 1Q38A 3FQRA 4M1DL 5IBLC 2BNQA 4PV9B 2WWMC 4WO4D 1AGCB 1U8NA 5LBSL 1Y6KR 5F9JA 5KANI 1S9WB 2VXTL 3I9GH 1R3JB 4G8EA 1RK1A 3PL6A 2Y72A 4DGVL 5E9DA 1A1OA 5EU6E 3T2NH 3DBXA 4YHOL 3CCHA 1IZJA 1I9RH 4X80H 1ED3B 2ZJSL 2X05A 3H42L 2WV3A 4WI9A 1JNHA 1TZHB 4RISL 4X7FC 3FO2A 4F7TA 4G9FD 1GIGL 4UAOC 1BD2A 1JV5B 4QXUL 1N8ZA 4DKAA 3MXWL 4KI5F 3H6JA 3WS3A 1HSBA 4XTRC 4F33B 2ADJA 5GGQH 3TVMB 1VADA 5HY9A 1AO7B 1HHHB 1ZA3B 4W6WB 2DKSA 5F9OL 3V7AE 4ETQB 5J1TC 2DJSA 3O6MH 5DJ0B 4DN4H 4QRQA 4GS7B 5JIKA 1S7UA 4OLVL 3HE7D 4PP1D 3GMRA 1B88A 1X4YA 4WGVB 5D96C 4HJGB 3KPMA 3QUYB 1HHGB 3C09B 1WEJH 4F3FA 3QQ4B 4R9HA 1N59A 4MWFA 4AK1A 2BNQE 4XP1H 4LVNC 2FLRT 4WHCA 2VO5A 3K80A 3WJJA 1ND0B 2EEDA 5DYOB 2NY1C 1RD6A 1PSKH 3FQXA 1YJDL 1HHKA 4G6KL 5SWZD 3RX7A 4JJ5A 3B9KB 1AXTH 3C5ZC 4X6EB 4CW1B 1BFSA 1J1PL 2X4SA 3S3JA 2XPGA 5DT1L 4YIQA 5FA3A 5E2TL 1ZSDB 3E2HC 1H0DA 1LO2L 4ONGH 5AWNL 4M7JH 2QQLL 3NTCL 2F15A 1EHXA 1BD2E 4ZXBC 4QT5A 1U8MA 1TZIA 1JUFB 2Q6WB 5CIPH 3QQ3B 4YUEL 3SDAB 5AUMB 3VFUA 3MBED 5JOPE 3C9NA 3DLQR 3CVHL 2MWCA 3FN3A 1EX0A 1G7PA 5ESQA 5CJXC 2W0FB 5I1AA 2JE8A 3PWPD 1DSFL 1U95A 1XCTB 4WHTB 2YS4A 3AM8C 4HXBL 3QEQB 2EICA 4QXGL 1MCRA 3UYRL 1WCQA 5EIIB 1OP3H 3BVNA 4I0KA 2I24N 5IROA 5JW4M 4JB9H 4WI8A 5GS1C 5FV2A 4WIQA 5HD8C 1G0YR 2DLTA 5IVXF 4JZJB 4MX7A 4P48A 4HKXA 5DWUL 2W07A 3VXQB 1FZKB 2FRGP 5C07D 3RDTC 2CJUH 1CVSC 3UO1L 1FGNL 2IFFH 3AAZA 5CP3H 5EO1B 5J7CC 1PZUB 1MFDL 3OZ9L 1B0RB 1FDLH 1MSPA 4FFYH 4RZCB 1JPGA 1KJ2H 3HPLB 4BFBD 5GRJH 1ES0B 3VXRE 3NCCB 2A9ML 15C8L 1SY6H 2ITDB 4NPYB 1WUNT 1NH6A 1R3KB 2DIAA 4XRCB 2ZNWA 1JZ6A 4JRXB 4PJ5B 1J8HB 3VG9B 1T0PB 1F13A 1I1AD 1MCOL 3OKLA 1VFOA 1WISA 3SDXB 1OTTC 4P2OB 3GSRB 4MQTB 3UROR 4TSBL 3ARPA 3QWRA 2J6EA 2AEWA 1NCAL 3ARRA 4PGZA 4PLKD 4PRBB 3BD4A 2EXWD 2L7JA 4HK3J 2DQJH 3O4LA 4ONFH 3MRHA 3I3DA 4YX2H 3B4NA 2FYYA 4X83A 5DTFA 1Z5LA 2HVJA 4HPOH 2EIZA 2JLLA 3P9LB 2P5EB 1RZ7H 4XWOC 1A3RL 4R3SA 2AJZA 1J87A 1FIGH 2V5SA 5KS9B 1ORSB 3QQ9C 1VGEH 2FJGB 1YEJH 2A2QT 3QFJA 4P4KC 3TF7C 3F5WB 4EEEA 1MFEH 1FFQA 3ET9F 1JGLH 5H37H 1A0QH 1EV2E 5FOBB 4JN2B 1INEH 3MOBL 5IKCA 1BZ7A 3VFWB 1BF2A 4N8PA 4NQCA 1NKOA 3PQYE 3SE9L 5T3XE 2CDFA 1INDH 4NCDA 5C9JA 1CLYL 1RSFA 1O5DT 3DVFA 4Y1AE 3CVIH 1PKQA 5CJ5A 2G5RA 1PG7X 2A6KA 3WUWG 4RA0C 2PETA 4DJMA 1FCCA 4P4RB 4N0FB 3QO1B 1C7TA 4JCLA 4OLZL 4PIRF 2A38A 4D0CA 4E5XB 4X6CE 1KTDB 4I3RL 5IB3B 1OQOA 2X9YA 2P48B 5JW4N 3CVHB 4P23A 3SDCA 1I8KB 2MQ0A 5HGBB 2DKUA 4D0BA 5IFAH 1CBVH 5JHDD 5HI5C 3LSOB 1IBGL 2X7LB 4EUPG 1AE6L 4WFGE 1QZ1A 4Y5YA 3BGMA 5EU5B 3BP5B 1AD9A 1IC5L 1FVEA 2HG5A 3QFJE 3UTSA 4YE4L 5TE6L 1YPZB 3MRJB 1FVCA 1T1ZA 5DEZA 3D25B 1ZA6B 4YDKL 3PGCA 1ACYH 1Q9LA 3CH1A 5T33L 1MFBH 4CUCA 3CZFA 4NM8H 2OR7A 4XCYA 5CEZD 1NC2B 4DW2L 5HGHB 4PJIB 3F7VB 2C5DC 1HIMH 1ZHNB 2Z8SA 3QEGH 2L0DA 4LDEB 2BOBB 3FT3A 3S37L 5EO9A 4CADB 4I9WD 3RZCD 3QQNA 5JPMB 5DHYA 1PKQE 4XCEB 4NO0A 2AEIT 2CO6B 3LKOA 3F7QA 1T7XA 1S7WA 4DFHA 2ZG2A 1PDKA 5C6WH 1M1SA 1A6ZB 3MRQA 2BX5A 8FABA 3DMMC 5F7DA 1R3LB 2QQNH 4QNPF 4U7KA 4IRSB 1FL3B 3FFCD 4RBPH 4S1DC 1OPGL 4LHQB 1LE5B 1KBGL 4OZHB 3FAWA 1J8KA 1KIRA 5EIVA 4X4ZA 2UWEB 4QRPB 4X5WA 2VXUL 4EQ3A 3EAKA 4LCUB 3WFZA 4GKNB 4JFFB 4JLRA 4M02A 4WFHD 5H94A 1WWAX 2JB6A 4ZFFB 2ESVA 4ZO6A 1XMWA 3UTSE 4QKXB 1KENH 3V4VL 1EUUA 2ZSWB 3QIUD 4KDTA 3ARYA 3O9WA 2H6PA 2QSQA 2VDLH 3UCRA 3L3DA 4ZTPL 4KY1H 4ZDHB 4OIBA 5L2JB 4OQTL 1VFUA 1RY7B 4O02L 3U9UB 4KJPC 5L2KB 4ZPVA 4JKMA 2Q86A 4NFDA 1KLGB 3GM0A 4WUKH 4OD2B 4WO4A 3TP4A 3ROLB 3CX5J 3KPQB 3OXSB 4CL7A 3E3QE 3GIVA 4B5EA 2H32H 1JF5A 5H35B 3DIFA 1NLBH 1H3UA 1DFBL 2HJKB 3PGDB 4PJBF 4U1KB 3EJZD 1EEZB 5C0IB 3ULVE 2VQTA 4F7EA 3MBXH 3QDGD 4RIRB 5CKAA 4GAJH 1N5YL 3X3GH 1NGPL 5B8CB 1RZFH 4WFEE 1JPST 4WENB 3KPLA 4PRHB 5DA4A 1I7UB 2ESVE 3BIAX 4XP5L 4XC3L 3IDNA 4XI5C 4BELD 1F6AB 5IB2A 4K3GA 2R0LL 1JZ3A 3P30H 3BXNA 1Y6NR 5I66B 3FB5B 2KQNA 4WI4A 4PJDE 5EG6C 5GRZA 1XGQB 3TCLB 3HE7A 3C87A 4ZFOA 3JWNC 2X4PA 5DD0L 4PJGE 2KKQA 3IJYB 2V7NB 2PF6A 3LS5H 2I9TA 35C8L 1A2YB 1OF2A 4NJ9H 1TCMA 3TH3T 3JVGC 4XPHH 4UTBH 4D9LL 2AQ2A 3QUML 3HMXH 2B20A 1YMME 1T1WA 4Z5RB 2W92A 3ARDD 3MRCB 5F97E 3U0WH 1S7VB 2Y5TB 3MV9A 5DD1H 3BW9A 3QA3B 5DQ9B 3IB4A 1CS6A 3QAZC 2Z0BA 4MD0B 1SEQH 1MLBA 5SWZA 4OIIL 4L29A 3SE8H 1LEKA 3ZSTA 1AD0B 4OBRA 5L9DH 4DEPB 3BQUC 2OCFD 2GCYB 1KELL 1H3GA 2VLJD 5EFIB 3U36B 4YZFE 3VFVA 5A2KH 5EA0H 4YHYC 4YDIL 3RU8L 3MLUH 3IU4H 3QEUB 2O61A 3SY0B 4G9FE 5JR1H 1QEWA 3RWHA 12E8H 5EN2A 5J0BA 4L8SC 5DJZB 3JV6A 4MXQD 5CJQH 3MBEA 4IHOA 3FCTB 5DDHA 4NYLA 3IFOA 2VZVA 5J6HB 2EECA 5DEFB 1QFPA 4P57A 4LBEB 3PWPA 2Y7QA 3OF6A 3L7FA 2RJMA 3E8UH 1D5BB 2OI9B 3O4OB 2ZPKL 1ZOXA 2W38A 3RWJA 2DL2A 1LO4H 3GO1H 3EO9L 4X9GA 4M8QA 4WUUA 4NQVB 3L3HA 4OKVB 3U4EA 4U1MB 2HMID 3D69B 5GRVK 2H2PD 5DXWA 5C07A 1UA6L 3VFTA 5ESAA 1NJ9B 3P9WB 4NCC1 4Z7VB 1BGXL 2W65B 4JY5L 1R0AH 4BFGA 4L4VA 2W91A 2IG2L 3NGBB 2BY3A 2VLMD 1YEIL 4JR9L 2QADC 5E7BA 1A14L 4NKMB 1KCSH 1HH9A 1MCLA 1J5OH 1O7VA 5IB5B 5DMJB 1JYVA 1I8IA 1PVHA 2I26N 2ZWLT 1IEBA 3C2AL 4X7DC 3WIHH 1MCQA 4HWBA 5AG9A 5KG9B 4MNHA 3DX6B 5CBEB 1I8MB 5ID0A 3IXTB 4ISVA 2AEQH 5I1IH 1I1AA 1L7IH 4NUGH 4NQXA 3GUTA 3S3PA 4RAVA 4XPBL 1W0VA 3TZVB 2GTWB 3BE1L 3VE0B 3UBXG 3OJVC 3QFDB 4MCYA 3PWPE 1S8DB 1MCSA 4GOSA 3HAEA 4ZS6C 5FUOL 3OKMA 1CK0L 1FNSL 3FB6B 4Y4FB 3CDGA 1RIVL 4PRNA 1L7TH 1SJHA 3I9GL 1AHWC 4U1GC 3VRLE 1A8JH 3REVA 2BXYA 1U91A 1Q94A 3RL1B 3RWFA 3WLBA 3S6CA 5DMYA 4XPAL 2B1AH 1AKJB 1RPQA 1KC5H 1VKXA 4X80L 1DP0A 1WBZA 3QUMB 3WIFB 3Q6GL 3C5JA 3EJYD 4JPIB 4QRUA 3K8LA 3O2VL 1JRHI 4M43L 2NTSP 4DOHB 2NY0B 4YXHH 4ZOCA 4UINH 3VG0H 4TOYH 4Z7VF 1K4DB 4RMRA 3SQOH 3CX5K 3O6ML 3T0EE 2L4OA 4DN4L 3B3IA 4WI5A 3VRIB 1JHLH 1S7QB 2H2SD 2XQBH 4XAWH 1MVFA 4A2MA 1UZ6F 4GBXC 2G9HB 1RAMA 4Z18A 2IH3B 2O26U 3MYJB 4HMEA 4XP1L 1YJDC 3U7WH 4WCYH 3OL2A 1VFMA 5F9AC 4GAGL 4U1LA 2ICWI 1JGDA 1XIWB 2FWOB 4YDJA 3ZKMD 1XR8B 1IEAB 4U0RC 4HT1L 3ILPA 2NY2D 3CUPA 5I16A 1WFUA 4OAWB 4F2MB 5BRZD 2HJFA 4X9BA 5FB8A 2FX7H 4JREB 3U46B 3H9SD 5KVFH 3WXVL 4HXAH 3KNBA 1X4ZA 4M7JL 5I2IB 4JPVH 4OZFA 3F65A 5EU3B 1UQSB 4V1DB 4ONHB 2CDGA 5F8QC 4K8RC 1MH5A 2DMCA 2X4QB 3QJHB 4GT7A 4QOKB 3X14A 3LQZB 4YH6A 2OP4H 1JWSB 5B22A 5T1MA 5IW1A 1R5VB 4IJ3B 5EUKA 4W4OA 3VJ6B 1Y0LB 1Q0YL 5C0JB 1NFIB 5FO8B 1PYWB 5T1KD 4TTDD 3TN0B 1A5FH 5FYJD 1CIDA 5JNYA 3RVTD 3UJJH 1OLLA 1S7XB 4EI5D 5IHZA 4JB9L 1SQ2N 1QSEB 4ZQKA 4HJJH 2OM5A 3CFDA 5EU4B 5IWLC 3W9DB 5E24E 3FFCA 5BQ7B 2Y06H 2XKNA 2YC1B 4FXKB 3STZB 5GGVH 3CC5B 3P4LA 4J3UA 1GOHA 4MD5B 3TIDB 1NDGB 4M5YH 2CJUL 2DI7A 4MDJB 3UAJD 1IGIH 2ATPB 4KKCC 5C0AB 2IFFL 3L9RA 5F7EH 3GJFK 3ILQD 5JHDE 1FDLL 3VXNB 5I19H 4FFYL 2FO4B 4RGNC 4FABL 5BZDA 3GSVB 1GL4B 4YNYA 4QRTA 4PJAB 1WAAA 2NXZC 1X5LA 1AGFB 4PRPD 3U9PH 4H26B 5DUPH 3TJEL 5J1AA 3GRWA 1BEYH 1FO0A 4OD3L 2YSSA 2AI0H 3KLAB 2DWEA 4DCQB 5L8LB 1ZLWH 1FZOB 3QIUA 3VH8B 5GS0H 4MA3A 2BSED 3MRDA 3TYFA 3CSBA 2O5XH 5DD6A 4ZMAT 3EYVA 1AY1H 1YY9D 3GB7B 4HK0B 3K74B 1NCTA 3VWJC 3LH2H 1AR1C 2LV4A 3MLZH 1A6UH 3LDBC 2HTLC 2BOCA 3HI6L 1LDSA 4YDVA 2CH8A 4I9WE 4G8GB 3T77A 5JQ6L 4FQIH 4F58H 4TPRL 1CD0A 1EHAA 1Q72H 1NEZB 4JPKH 2PW2A 5EOTA 4UV4H 5E4EC 5BJTA 2FB4H 3GBNH 5BVPH 3BPCB 4JQVA 4HWUA 1YNTB 4A6YH 1V05A 4BH7A 1RZ8B 3PWLA 1RZ7L 2W1NA 3ZDZE 2ZNXA 5IMKB 2FBOJ 3QDGA 3KPOB 1UWXH 3NFSL 5FO7B 3CFKA 4HIHA 1YDPB 3T2PA 1AI1L 1KCVH 5GS1B 4M3JA 4WFHE 3QIBB 1MJJB 3Q6FA 1WC7A 4YBQC 1WAAE 1MFEL 3VXOB 1K9TA 2BSTA 4FQLH 3PWUA 2BY2A 4P99A 2EKSA 4Z78B 4WNQB 1INEL 5GS0C 1MCNA 1GXEA 4N90D 2FNBA 5EBWB 1F11B 4R97C 3DROB 3RY6A 1K2DA 4MMXC 4LRIC 4DZ8B 1TTGA 1K3IA 5JO5B 4X5XB 1NGWA 2Z92A 5BS0E 5IQ9B 4F9PA 5F89B 2EIEA 2PTTA 5D4QA 4EDXB 5F9DC 2QQKH 2D7MA 3KYNA 5CUSH 2VLKD 2HTKD 1BOGB 3CAFA 1UM6H 3VW3L 1IKNA 4N5UA 2VMFA 5CIPB 3ARDA 5FDWA 4QTIH 2K7QA 3GMQA 5JXEC 3LD8C 3LKPB 5LQBH 1LK3H 3FFDB 5DI8A 5KW9H 1BQUA 3BDYL 4RNRA 5IFAL 1TZGH 4C59B 5AEAA 2P24B 3FT2A 1RUPH 3AS0A 3OGOE 1Q9OB 2VITB 2VLJA 2A0LD 3QDGE 3QISA 1FGVL 2NXYB 3F58H 2IALA 1BQLH 3WLWC 1EBAA 2R2EA 4PJEB 1NGYA 5D1ZD 5DRZB 1U8KA 2EYRA 3IDUA 3HC3H 1UM5H 4PP2A 2F8OA 4OLXH 1RJYB 2XI9A 2ZZUT 2ZCHH 5ANMA 5E2WH 4NM8L 4YC2C 4DGIH 1WZ1L 4MZ3A 5ACZA 1OT2A 1KJ2B 1HIML 5B39A 1A7OH 3O6KL 2EH8L 4M03A 4XCNA 5IG7A 3P73B 5FM4A 4CU7A 1OSZA 2EIBA 1RHFA 4E41D 1D9KD 1T7VA 2YPKA 3U4AA 2MNUA 1N7ML 4X0KA 4M7KL 3BUYA 4HBCH 4S1QL 3H7BA 3PWNA 3MRBA 2EC9T 2QQNL 5EZLB 3MR9B 1ETZA 3TT1L 3S8WA 2W9LA 1F3RB 4CMMA 4JZNA 2B0SH 1DUYA 3FT4B 3T0XA 4XP4L 1JRHL 4U33A 3UP1A 1LO5B 3MNZA 3V0VA 1A6VH 5IT2L 5K9KA 3TBWA 4LOUD 5FECA 4M7LL 2QSTA 3SKJL 1KLUA 1T04A 3Q0HA 3CU7A 3PG2A 1J0HA 5C08B 2VLJE 3DGCR 2X1XR 3LEVL 3IDMB 3BWAA 4Y2DD 4PJ9B 3ES6B 4EDWH 3ALWA 1UM4L 1FL5B 4BH8B 2PKDA 4F9LC 5C09B 5ISZD 4J8RA 4PJ7A 4JG0L 2VDLL 2C7UA 2R23B 4NM4H 2B8OT 1DCLA 5DJ2B 5ANME 4CVZB 4KY1L 2SEBA 2A9NH 3E6FA 4Y16B 1FAIL 5JUEH 3D87B 4NO3A 4YHNA 2UY6A 4WUKL 4HEPG 1BZQK 1OW0A 1T66D 1IAKA 1DBML 4Y4HC 3FQTB 3DX8B 3EHBD 3LQMA 3BKJH 4TUOA 5DJAB 4Z77B 5DMIH 3OWEA 4NC1E 1NLBL 1NBQA 5EUOA 4U3CA 3OJDB 5F96H 5AZ2H 3EFDH 4HV8A 4K3EH 3W11D 3FB7A 4HGWA 4XH2A 5D1XB 5FYKD 2VLME 3MPCA 1MREH 5DVOA 1F8TH 3MBXL 4JFOB 3GSXB 4GAJL 1QRNE 1HYRC 4OT1H 2BVYA 2HT3C 2Y1VA 1Q0XH 4Y5XA 4UILH 5DJXA 4FFWC 3WSQL 2BVUA 1ITBB 4P2RB 5CHNB 1MNUL 5C0DB 2EC9U 3TNNA 1H5BB 5FUZH 4PJ7E 3ZE2E 1RZGB 1BZ9A 3I84A 4CN1A 1Z3GH 2DQHH 1OGTA 3ZSSA 3LS5L 3MCKA 5TDOA 4KRPD 1DZBA 5EU7E 4XXDA 2BFVH 4L1DA 3QCUH 4JEGB 4JDVA 2C3VB 3JV4A 4NJ9L 4LPCA 4OZIA 4XPHL 4FQHB 2FH8A 4NRXA 1FLRH 1EZVX 3HMXL 3WJJC 5FAAA 3CSYA 2IANB 3VGAC 4CBPA 1YEDA 1TVBB 3FHQA 1MUJA 2GAZB 3DGGB 4UNVA 5KSUB 7FABL 1YEEH 1WTLA 5FCUH 2VXQL 4ZD3L 1DQDL 2V17H 3FN9A 1EK3A 3L95A 3P4NA 5E8NA 3WMSA 5L9DL 2FL5A 5FGSA 3BP6A 5BRZA 4ZUSA 2BMKA 3BH8B 2QTEA 1ZV5A 1BF8A 2WW8A 4LKCB 3IU4L 3H9SA 5T3XH 1FJ1A 4ERSH 4QCIB 4BFIA 4ORGB 2ZUWA 1XGPA 3BZEB 3IFPB 2HLFD 3EO0B 4X6DF 2CK0H 1A3LH 4QRSA 1Q1JH 1JWMB 4OLWL 4OUUA 1X5FA 2X1PA 3BESR 4MB5A 2MCPL 4G9DA 2DWDB 4U6YA 3V4UH 5IROC 3T0VA 5T1KA 1T5XB 4ELMB 1RZIA 1HKLL 5E5UB 3MO1A 1S5IH 3VU2A 1UJ3B 4EI5A 2X4UA 1F00I 5TE7H 3VFSB 4ZUWB 3RY4A 4OFKA 4OZIE 3DUUB 3TO4D 2DQTH 1DQML 1FG9C 4R90H 4BQ8A 4OI8A 1NBYA 2AQ3A 3EOAB 1NCWH 3W2DH 5D6DA 2AP2A 1DUZA 2ICWB 5GZOC 3NA4A 3IF1A 4YLQT 4O2FA 2YUWA 1R24A 4PRPA 2MTPA 2H8PB 2R0WL 2WUBH 1T2XA 1QLFA 3O2DA 3UTZA 2ZUSA 3V5DB 3KPSB 3WFEL 1MHPH 2H32B 5EZIH 3WIHL 3H9SE 4PLJD 1JPFB 3ZKND 1KF9B 3T3PE 3AXLA 3QUKB 4KZDH 4X98A 2QR0B 4YHPB 4MQ7B 4NN7C 3H9HA 2LU7A 3MC0A 5ADPH 1L9NA 5I73C 4NOBA 2IGFL 2PR4L 4RRPG 1KJMB 3O0RL 4PJFB 5C0EB 1PGRB 5GGRA 4HW6A 3LZFH 5FYJE 1T7YA 2K7PA 5IVXA 2DLFH 4P9HH 1A7PL 3TIEA 3GSNL 4TVPD 4OV6F 2R1WB 1AGBB 4XB7A 4HC1H 3CNKA 5IJVB 3A6CL 1U8OB 4NRYA 5B38A 4Z76A 3WKML 4J3SA 1JJUA 3LRGA 1XF2A 2D7PA 1AJ7H 5HHXL 4JO2L 2BVOB 2WIIB 1CLZH 1QR1A 1BFTA 1QSVA 1KIUA 4LSQL 4KRLB 3OMZA 5E6IB 3VWKA 1T21A 4P2QD 4X6BA 4M62L 4PJHB 3VG0L 5JQHC 2XFXB 4TOYL 3SDYH 3PP3K 1KFAH 1J12A 2IWGA 1TCRA 2HLAB 4JHBA 2OSLA 3F12A 2Q7YA 4POUB 3C5SB 3VFOB 5E8OB 4PRAB 5ESVB 3DVNA 1U2CA 3ULUE 5HPMA 2NR6D 3OX8A 3UEZA 4HFUH 2XQBL 5K9QG 3NCFB 2KUTA 2VLKA 5DF0A 3LIZH 2AJ3B 4KK5D 1NSNH 1ZHBB 1X5KA 4ZUVB 3SDCC 1N6VA 1KG0A 5LAXA 2CIIB 5CZVH 4OZ4B 2A73A 1PY9A 4RGMB 2Y6SD 3KS0J 2HP4A 4K9EH 5DO2C 3U7WL 4P2YA 4WCYL 5SWSB 3RPIA 4D9QD 5ICZB 1ZXQA 4Y5YC 4AMKH 5C9KA 2HRPH 4Q97A 2QKIA 5HHQB 3S35H 2OJZH 3T08A 5E4IA 1XR9A 4F7MB 5ITFA 4TULL 4DAGH 5KSVB 4WU5B 4RSVA 1I9IL 5D1ZA 5KSAA 1EFQA 3L3KB 5KVFL 5DRWA 4HXAL 1CD1B 3O3BB 4NN5C 5FYKU 5C0RH 1P4BL 4YHKL 3D85B 2Q1EA 5E56A 2JF1A 4N90E 3MNWB 4FQJL 1DR9A 4WRLA 2OP4L 3K3QA 2CLZA 2GJZB 3Q5OA 3KPPA 4E41A 3SE4A 1D9KA 4M1CC 4LF3B 1WCBB 4OJFH 4TN9A 1A5FL 4K71B 2Z93B 4L8BA 3DXAB 1HEZB 2VLKE 3UJJL 1QKZH 1II4E 3PHOB 5F6HI 3HG1D 2HFGL 1NCCL 2R15A 3LEXA 3BP7A 4FZ8H 4HJJL 1GZQB 3MYZA 3L5HA 1HCVA 2Y06L 5IUSA 3ULVC 5GGVL 1QNZL 3ALXA 4JO3H 2BSSB 1RZJH 1JHKH 3HUJB 4M5YL 3WHXB 5F93C 4B53A 3HCVB 1IGIL 5DLMH 4LSTH 4GBXB 5F7EL 3HS0B 5ID1A 5MEOB 3RGVB 2VWEE 2DM7A 2F19H 4EVNB 3DX7A 1I85C 5I76B 3T0DA 3U9PL 1INQA 4Y2DA 2R29H 5EOQH 2OR9H 3HNTH 1F4WH 4LRNH 1I7RA 3O9WC 1TQCB 3BP4B 1NFDA 4NRZA 2AXFB 2FR4A 4KJQC 1I7TB 3MNVB 5ISZA 3X11A 1FYTE 2PO6B 4B41A 1JHTB 1W8NA 5JZ7C 2IEPA 3PIQB 3HB3D 2O5XL 4NKIH 2EEBA 4LLVB 1Z0NA 4NBYB 1AY1L 2A6IA 4R7DB 2BK8A 5HHNA 3NAAH 4X8JA 4HWEL 5CILH 3B6SB 3MLZL 1A6UL 4GAYA 4WO4C 2X4OA 5CSBA 3NFPA 5E1HB 3KAAA 1NDMB 4HH9A 4E41E 1RUAL 3S7GA 4FQIL 4JO4H 4F58L 2GFBA 1SBSH 1NBZA 2VABB 4LU5H 4IOIB 2FHFA 3WNKA 1J1OL 1CXLA 4NBXB 4IIQA 4UV4L 3NFNA 3GBNL 2X4RB 2B2XL 5D8JL 2DIBA 1XAUA 2OZ4A 3S36H 5F7YC 4H1LB 1RZJC 4A6YL 1JTPA 1HI6A 3S4SG 1D6EB 2VDPH 3RTQD 5EC2A 3D39A 5IMMA 4OTXL 5D71H 3JTTB 5FK9B 3DX9B 5F7WC 5DUBB 2MPAH 3QJFB 3QDMD 2DMKA 4IM8A 4DQOL 1NAKH 4LCYA 4FQLL 4R4ND 5KSBB 4U1IA 2XXCB 4JRYB 4K3JL 4QWWD 1HH6B 2Y4SA 3BPLB 4O58L 4XPTL 3HE7C 4PP1C 4UQ3A 4FQ1L 5ISZE 3HUJF 5I8OH 4ZNEA 2EDHA 2BDNL 4P46D 3MGTB 5H37G 5F6IB 1FNHA 4ZFZB 5F3BA 1ZANL 3IFLH 1A7QH 1PX3A 1KEGL 1D6VH 3NZ8A 4QHUA 3TV3H 1P6AB 4MLSA 1CFNB 3BPOC 4APQB 1YZZA 2QQKL 3ORJA 1K85A 4M61A 3WHE1 5CUSL 1AGEB 5DQJA 4ENED 5D1QD 3JXAA 1QQDA 4K23L 3CFJA 4Z8FH 1QSFD 4L3CB 3UTTE 1NKRA 1J18A 5BW7A 3NA9H 3QR2A 4PRIE 1QO3A 5KW9L 4HKBB 4HAFA 1TZGL 2I25N 2W9DL 3CSGA 3REWA 2XZAH 2BHZA 5TH2B 2Z8RA 5FYKE 4XVUD 1TVHA 1RUPL 4HWBH 3IVKB 1QD0A 3QI9C 4OFVA 4LLUB 2CUHA 1ZLUH 5GRWA 3F58L 1BQLL 4HUNB 1LEIA 2ITCB 5EBMA 3BEVB 1NCNA 3MBEC 3STLB 4OV5A 1G0XA 3HC3L 3SOBL 1BIIB 4FQCH 1QFOA 5ERWA 2AQ1A 4F7CB 2PN5A 4OLXL 1T0MB 2B1HH 5C7XL 3LKNA 3A67L 4P49A 1MI5D 3C6SA 4QY8A 3HAEH 4ZNEE 2VXVH 3O3UN 4BZ2H 1BQHB 5DJCB 1A7OL 5DVNA 5ENWA 4DKEH 1JMXA 5SX4H 2JCCB 4QRRD 1U8IA 1FL6A 5GGSA 5HVFB 3FB8B 1U8JA 2OTWA 2ICCA 1MWAA 2P5WD 1M6OA 3TO4A 5B21A 4R97B 3LRSB 1IILE 4WTXA 3MRNA 1H3TA 4Z0BH 4Y2OA 1U3HD 1OAUL 3BKYH 3N9GH 1FAKT 4KROB 3RA7H 3BPNC 4MDIB 3SKMA 2FO1A 5FGCB 5GIRB 4U1HB 1A6VL 4Z7UB 5C86A 4ZPTB 1CDCA 4M9OA 1BX2B 1CYGA 1RK0B 2BSRA 2VLLB 3QDJB 4BSJA 5A2IH 2EYTB 2DYPB 1MRDH 4ZXBD 1G6RH 1MLCA 3S96A 3G9AB 3ZE0F 1QHPA 4KXZH 3LD8B 3EYOA 2X41A 2VL4A 3O6FD 1BWWA 2ZUYA 4Q74A 4EDWL 1OAYH 2DBLH 2QL1A 5T1LD 4A6YB 1BOYA 1JK8B 3EO1A 4L4TB 3L7EA 1XH3B 1XGYL 3KXFD 2H3NB 4HKJA 4JVPA 5JXAL 3ZHKA 3IAQA 2I27N 4PLKC 5FFLA 1OGAD 2EXWC 3ULUL 2HVKB 1MHCA 3TA3D 4HG4K 1YEKH 8CGTA 3SJVB 4G6JH 2GUOA 5JUEL 3V6FB 1A9BA 4MAUH 1ORQB 4YC2B 3OAUH 1E4XH 4FTVA 1MJ8H 1QFWM 4XX1E 2DL9A 2Y36L 3LKRA 4ESKA 4I48B 5DMIL 1CDYA 4GG6A 5CWSA 1HHIB 1K4CA 2NPLX 2PCPA 4M4RA 5AZ2L 4IMKA 5I15L 1OL0A 1FFPB 4QXTA 2E7LA 1NQBA 4K3EL 1CL7H 5C70A 4Z9KB 3JWDH 1FC1A 4LKXB 1FRGL 5EU6B 5HHOA 4TNVF 4YHIA 3G5YA 5C0BE 4OT1L 4URTB 4BSVB 1RU9H 3QHZH 3HZYA 1Q0XL 4C56B 5CEZH 1MCHA 3U2SB 2VR9A 2NW3A 2VDML 25C8L 3EYQD 4LVOC 4KRMB 3T65B 2RIKA 5GJSL 2NW2B 1TDQA 3LN4A 4BM7A 4KQ4H 3OR7A 2Y07L 5ICXB 1WT5A 2YRPA 1DLFL 1Z3GL 2XQYK 2ADGA 2J8HA 3WFCH 1ZEAH 1U92B 2DQDH 4AJ0A 4JE4B 5E03A 3TWCL 2DAVA 4AH2B 4PGCA 4NWTH 5F1SA 3VFNB 3CMOH 2IAMB 1S7TB 3O2WH 5DSCB 1FLRL 4G80A 3EIFA 4WWKD 5D7IF 2DLEA 4FQQB 4E0RA 2WMPA 3O11B 4F80A 4TVPE 2IF7A 2HRLA 1YEFL 5H2BA 1NBVL 1A6AA 3WO3B 1UACH 5LGJA 1GC1C 3NPSB 2IPUG 1I1RA 1YEEL 2VDOH 4GG6E 4GQ9L 5ILTL 1QVOB 5F9JB 4KMTH 3D2UB 3GRWH 2V17L 1FO0H 1TJHL 4OF8A 4G8EB 3PL6B 5IQ7H 3F62A 2Q3AA 4HMDA 2XN9D 3VFRA 3S34L 5E9DB 4MMZC 3DBXB 4N0YH 5IOPB 1U3ZA 4AQ1B 3CCHB 5MP6H 3S5LG 4GKSA 5I1LA 3IJSB 4G42A 4P2QE 2F74A 5JA9A 3FO2B 4F7TB 3KLDA 3K7UA 3EYSL 3MXVH 3RZCC 2NX5B 4W4OC 4U1SA 5D5MB 1Q1JL 3FMGH 5C71A 2E9BA 3OG6B 1WIPA 3WS3B 5CMAA 1IGMH 1VADB 3V4UL 2ED9A 4LQFH 5HY9B 1VACB 4P5MA 2AK1L 5IVZB 2E7CA 3HG1A 3M17B 3K1DA 2V2XB 5TE7L 2D0FA 2WIMA 2DQTL 1PZ5A 3KPMB 2VDNL 4WTZG 1A4JA 3P0YH 4D9QE 2HYMA 1CFQA 5E8PA 1NUNB 4G6AD 3KR3H 1YQ2A 1N59B 3W2DL 1R3IL 2R0ZL 4WI6A 1S9YA 5E94B 2EDXA 2WWKT 2ZP0T 4U2ZA 1GPOL 5BVJB 1W72A 2W9EL 3QIUC 2P43B 4CN6A 1DVFA 5KOMC 4OM0L 1HHKB 4N1CA 2XTJD 4HLJA 3W39B 2ICWJ 3HNSL 3ZE1E 2B4CH 1MCEA 1MPAL 4KZDL 5FA3B 1DANU 4IMLB 3CLEH 5CCKH 3V4PH 3CMGA 3NN8A 4QHKI 1BECA 2AK4D 1DJSA 4LCCA 4QT5B 1U8MB 1TZIB 3V8OA 1AFVH 3MLTA 1HSAA 1IGTA 2NY5C 3VFUB 4UBDD 4ZSOA 3KWWA 2MKWA 1R6VA 1FSKC 1G7PB 1NLDL 4PBXA 2I9LA 2FSEB 4JQVC 5I1AB 5MI0B 2ZUXA 2DLFL 1U95B 4P9HL 1YECL 3EJZC 5FGBA 2I60H 2APWA 4KDWA 2VQ1A 4MHHI 3ARFC 3PWVA 3BVNB 1CDHA 4HC1L 3RTQA 2YK1H 3RZWA 2LTQB 3Q1SL 1G7IA 3RNQB 3IDYB 3VXSD 4K07A 4UT9H 1P4LA 3FQWB 4RMWA 4MX7B 4HKXB 4AYFA 4JRWA 1NCDH 1FG2A 3T2OA 3QDMA 2D31A 2VZUA 4LHUD 2A1WH 2VDQL 3AAZB 5I0DA 3ZLQC 4M6NH 1U8QA 5CP7A 3RY6C 2J88H 1BJ1J 3SGJA 4P46A 3SDYL 4JM2D 4F9PC 4LL9A 1JE6A 2C1OA 2CXKA 4QO1A 4WW2C 1M7DB 4WVRA 1KOAA 4KXZI 4O4YH 3LKSA 4HBQA 1CDIA 1PG7H 2V2TB 4N0UB 3HTLX 3B2VH 4JFEB 1IKNC 2VAAB 4YXKH 1EGJA 1S9VA 3ARDC 1H8SA 2YEZA 3LIZL 4X4ME 1EHNA 1QSFA 2WUCH 1NGQH 5JMOC 1X6NA 1UFUA 4KHTL 5CZVL 4NN7B 1P7KA 1FIEA 4WV1A 3P0GB 4K9EL 1BMGA 4JGUA 1MY7A 4G6MH 2G5BA 2AABH 3MACH 1GGCH 3O4LB 1L4IA 3TM6A 5F7UA 2YD8A 1A7RH 3S35L 1OTUD 2P8PA 3BZFA 4JY4B 4LVHB 4NFCA 3VFMA 1E4XI 1DN0A 3HNVL 1D5IH 4HS3A 1VFBB 4JFZH 3GMNA 1SMAA 4K94H 3I85A 3WNNA 5D7LD 3QDME 4R3SB 1AXSA 2AJZB 2BNRE 2NLJA 3S97C 3RAJH 3IGAA 5KVEL 3V6ZA 4NNYB 2HH0H 4GJTB 3C2SA 1MI5A 4Z7WA 2VH5H 2P45B 3I6KA 2NTFB 1E4WH 2X4TA 43C9A 5DHXB 4CRPA 3P4MA 4QRRA 4U3XA 1T4KA 3QXDA 4NO2A 3TVMD 4NQCB 2H2PC 5JOFA 2J8UE 2ICEA 4OJFL 5EC1B 2P5WA 4O2CA 3A6BH 4NC1C 2CDFB 2EZ0D 4Q9CA 5C9JB 1MFCH 2YD6A 1QKZL 1L6XA 1F4HA 3P4OA 3RIFF 1PKQB 1U3HA 1V3KA 3ZYZA 1QSFE 3MA7B 1T5WB 3QUYD 3WXWL 4JO3L 5DLML 3MRKA 2NZ9D 4HIJA 1NMBL 2H9GB 2W60B 4CGTA 5LWYH 4LNRB 2X6MA 4P23B 2VOTA 4ZXBA 4OCSH 5IHBA 2F19L 1I1YA 2CIKA 4LEXL 5IB4A 4D0BB 3K0WA 2R29L 3R0NA 3O6FA 5EOQL 3HNTL 5GSRB 4LRNL 5T1LA 4RBPK 3VXMB 4M9PA 1WZKA 5CJXA 1BQHG 3KXFA 4O9HL 1BFVH 1O7SA 1FVEB 1S9XB 4X6CF 5C92A 2HG5B 3G04A 2EDQA 4NQED 5EU7C 2HN7A 3UTSB 5HVHC 1FVCB 1T1ZB 4JFHD 3VD5A 1ZGLB 3CXHJ 1MI5E 1OGAA 4UUJB 4Z7WE 4M48H 3V5HB 9CGTA 2DQCL 2V7HA 3DI2B 3PGCB 3TA3A 1Q9LB 3CH1B 5CILL 4YBLC 3CLFH 4NQUA 1OW0C 1WGOA 1DQQA 4QRRE 1B90A 2JJWA 5L8JB 1H3PH 3G5VB 1A02N 4PGBA 3SDAD 5EWIL 2Y9RT 4NSKA 4N8VG 1SBSL 4MD4A 4MNGE 4LU5L 4K7PX 2P5WE 1K8IA 5C0FB 3R8QA 3FT3B 1RVFL 3D0LA 5E5MA 5EO9B 5DHYB 1U0QA 1CE1L 4NO0B 1OP5H 3LKOB 3S36L 1PX4A 1U8PA 1S7WB 1T1YA 2YOCA 3V5KA 2VDPL 3EJYC 1YQVL 5F7DB 3D48R 3O3EA 5AYUH 1FNFA 1GH7A 3INUL 4NHUA 1KIRB 2J5LB 4LCWA 4F8TA 1OB1A 2Y23A 3TBSA 1K6QH 1P53A 1NFKA 4JLRB 1NGZA 5H94B 5GPRA 2XWBA 2H2SC 3U6RA 5I8OL 1X7QA 2VISA 3I02B 5EORH 1VGKA 1EVUA 4UDUA 1D5ZA 5FYJH 1CGTA 3Q48A 2PW1A 1EFXA 4NJAL 4P5KA 4JRXD 4H8WH 1A7QL 3P0VL 4X7CC 1BVZA 2H6PB 1EO7A 1T80A 3TV3L 2FECI 1DBBH 3RNKB 1MQKH 2H26B 2OJEA 2FHBA 3DTXA 3QZWA 4WWKA 1BM3H 1FFNA 4N9GB 4P2OD 4ZPVB 2Q87A 4Z8FL 3ZKMC 5D6CA 3RGHA 5EZJA 2GHWB 4W6XB 3NA9L 2NY2C 1UKSA 1MCDA 3DHMA 3SCMB 4F8QA 4XNYH 4UQ2A 4EXKA 1B6DA 3O2DH 5JIHA 2ENSA 1U93A 1U3JA 4GW5A 4KPHH 3G5XB 1V3LA 2XZAL 3S37X 2Q8AH 4NNPH 1ZVYA 3GIVB 3GIZH 2DQUH 2XN9A 3GSWA 3DIFB 2X89D 4GG8B 1MCWW 2IPTL 5TF1L 1HWHB 5CS7A 1E4JA 4LGSB 4UIMA 3ESVF 3QG6A 3SKNA 4FQCL 2AJYL 3V7AG 1ZHLA 4PJCE 5ICYB 1LK2A 1NMCC 3B5TA 2B1HL 3TBTA 1J7VR 4M8VA 3MMEB 1TENA 3IU3A 2Z8VC 2VXVL 4TTDC 4LHJB 4HWZB 3T4AA 3QH3A 3RVTC 3DURA 4EI5C 1T6VN 4H8WC 5FKAA 2YRZA 1LD9B 2R4RL 4XVTH 5CJOL 4QYOA 2Q76B 2A74A 3ULVF 2AJXH 2V6HA 1OSPL 3HE7B 5BZWA 2X4PB 3WS6A 3WNMA 3BIKA 4MLIA 3QHTC 1H15A 3AB0B 4F7PA 3UAJC 2I9TB 1Z9MA 2YD9A 4XMKL 3ILQC 3MRIA 1OF2B 4LPXA 5D6DC 1IKFL 3BKYL 2ZUQC 1SJEB 3N9GL 2ZSVA 4N1EA 4JDTL 1KJ3H 2VXSH 4KV5F 3PNWA 1PEZA 1NGXA 2E9WA 2AEPH 1BJ8A 1B4JH 2RB8A 1MRDL 3MV9B 3F7RA 3ZYJA 1I1FA 2ZOLA 1G6RL 3NBNA 2P44B 3MV8D 4DWHA 4YAQA 2AJUH 1NC4A 5SWZB 2BNUB 4AEHH 1OARL 1YY9C 3EUUA 3WD5L 1RZKH 1OAYL 2DBLL 1F2QA 4X6DA 5I6XC 3MRFB 4RFNC 3VFVB 2F5BH 4Q9RL 3G6JA 2FIRT 2O61B 1J0JA 4OZGA 5JPNB 3TC9A 4ODUB 4TNWF 1XGUB 4OFIA 5DR5H 2WQ8A 2AK4A 2CD0A 3ARGD 3JV6B 1YNKH 4N0RA 2WK2A 3DMMA 1S7RA 1OAZH 2G60L 3MBEB 5DDHB 4RCAA 4NYLB 3KPTA 3IFOB 1CDBA 2NY7H 4X7SH 4MAUL 4OFYD 5F72S 3PHSA 3L1OH 4RFOL 4YZFF 1IVLA 4KKCD 2YZ8A 3OAUL 3L7FB 1E4XL 1P4IH 4LSRH 5C0CB 4PLNC 1QBLH 4MJIB 3P3YA 3IDGA 4M8QB 1UB6B 1AIFA 4WUUB 1QRKA 3U4EB 2EXYD 4DUXA 2Z4QB 2LU4A 4LARH 4NZRL 5C07B 4LSUL 3JWDL 1CFVH 2MHAA 3HZMA 4X99A 5IB1B 4LHUA 3CXHK 4ZG1A 1SBBA 2ICES 1A1MA 5FIEA 2W0LA 4I2XE 5SX5H 3T8XA 1MCBA 2P49B 4L4VB 1CLOH 3SGEH 2HKFH 3KYOA 3BPNB 1HH9B 4QRPD 1RZKC 1IAOA 2XTJE 3Q5YA 3QHFL 3GDBA 3FZUD 4XNZC 5TE4L 4JM2A 3FRUB 1I8IB 1W8OA 1F6LL 3HLAA 1M7IB 3CK0H 3H9ZA 1IEBB 1MY5A 1BLNA 4ODVH 3MRPA 1CTNA 2LAGB 4JKPH 4U1JA 43CAB 3GHBH 4MNHB 3N0PB 3HE6B 3MJ8B 3SO3B 3QNXA 3LB6D 2HTKC 5I71C 1X5ZA 5GHWL 3WFCL 1ZEAL 5ID0B 2AK4E 1A6TA 3AMKA 4J3VA 1I1AB 1QYGH 1X5YA 1W0VB 2YMXH 5TGBA 5I75C 4LDOB 1GSMA 3CMOL 5L0QB 3O2WL 1ZE3C 2FX9H 3KJ6L 4KTDH 1T22A 4XVSH 2CDEB 5L2KD 3HAEB 1E0OB 1TMCB 4JHZA 3T0AA 2VWEC 2OQJA 4B7LA 4OD1H 3K2MC 4PV9A 3HA0A 2A0LC 4HAGA 1VCAA 1UACL 1AGCA 3ECBB 2PYFA 2VDOL 3C8KB 4PRNB 3VXSE 3D0VA 4KMTL 4JFPB 3GRWL 4OLUL 1SJHB 5D2NB 1FO0L 4DK3A 5D1ZC 1X9QA 3PV6A 3U1SL 5IQ7L 2O5YH 4KI5E 5JW4R 1U91B 2DQGH 5D7LA 1Q94B 3PF2A 3RWFB 3WLBB 1MRCH 1MRFH 5GGTA 3ZMRA 4N0YL 1NL0H 3RI5F 5MP6L 4ZFGH 1VKXB 5IBUB 2ZKHL 1LILA 2IADA 2EDBA 3TT3H 2FHCA 1IAMA 2JK5A 5GRUL 3SE4C 1D9KC 1G6RB 5I30H 4KFZC 3T2QA 3TVMA 3FTGA 3TNMA 4D2NA 1HHHA 3RHWF 3THMH 4LQFL 4ETQA 1JCKA 3BKCL 5DJ0A 3OR6A 3B3IB 1EEYA 4JHAH 4G8IA 5E2UH 4HZAA 4OCLC 3RX5A 2YPVH 4NDMB 3M1BB 5B4MD 1DBKH 3QUYA 1HHGA 4LOUC 4MCZB 4NKOA 3P2TA 3SEPA 3QQ4A 1WQVT 5INDA 3KR3L 1AQKH 4OCWH 3UC0L 1SYSA 3HR5A 4KH2A 4Y2DC 1RI8A 1R5IB 3B43A 4Z95L 5GRVL 1RJZB 1WBYB 2GKIA 4G5ZL 4MXVE 1G9MH 4YGVA 4U1LB 5I1CL 2RFXB 4YDJB 3IJHB 5D7LE 4S1RL 3ILPB 1N4XH 1ADQH 4X6EA 3CUPB 5I16B 4CW1A 3KPNA 4KUZL 4NQEA 4AG4H 3V0WH 2FECL 4KKAD 3MJ7A 2B4CL 4F37F 1ZSDA 1KB5A 1MFAL 3QYCA 1MJ7H 3KNBB 4N0CC 3I2CL 1EUTA 3MCG1 4KAQH 1T66C 3RVXD 1GAFH 4JANA 2YD2A 3EHBC 1MH5B 3KHOA 3QQ3A 4IIQC 2OTUB 1AO7E 5F1NA 1ZLWK 3X14B 1DQLH 1IC4L 4GRLD 1C8PA 4LASH 5IW1B 1MJUL 4WHTA 5EUKB 1Y6MR 3W11C 4JFQA 4X4XB 2I60L 3KJ4C 5JNYB 2YK1L 1K8DB 1I3UA 1XGRB 5IVOA 4ZQKB 3CFDB 4UT9L 1YYMH 4ZO7A 3FFCB 3VXQA 5DQDL 1FZKA 5FM5O 3U30C 3BRFA 5F6HJ 1FLTX 2A1WL 3L9RB 1FZJB 1WSST 4PJXB 3SHSA 4RZCA 4M6NL 1NMAH 5INCA 5BZDB 3N06B 3MJ9A 1C16A 2IBBA 3L5XL 4G43B 1LE9A 3HPLA 2AAVA 3MLWH 2X9XA 3T1FB 1CXKA 1U41A 2ITDA 2XY2A 4KRPC 3MRLB 5KTEH 1FO0B 1VENA 1UWXK 4NQEE 3RUGB 3NIFF 4XRCA 2WSKA 4JFHE 1UVQA 4JRXA 4O4YL 3DWTA 4NUJA 4MA3B 1MWAH 3MRDB 5I1HH 1PG7L 4HH8A 3TYFB 1AHWA 5DD6B 3B2VL 1FFOB 4YXKL 3TGXA 3MLVH 2Q7NA 4Z7OF 1WVZA 3JTSB 1JZ5A 3SDXA 2WUCL 1NGQL 3T0BA 2CRIA 1OT1A 1LEGA 5D7JB 2ERJC 2BZDA 4LFHG 5MHSE 3QEQE 4AQOA 3T77B 3DNKA 4PGDB 3MACL 2AABL 4CN4A 1GGCL 2VSCA 4I4WA 2OK0H 1ZLSL 5EOTB 2EEAA 3AFLA 1WIOA 2OR8A 5JOPD 1L0XA 3BSZL 2CMRL 2X89A 1TETL 3P9LA 4O00A 4JFZL 3MUGA 4BH7B 3IS0X 3N1PC 3PWLB 4FP8H 4K94L 2GY5A 2HLFC 4LSVL 4OUOA 4WHDA 5BV7H 3GI8H 5KS9A 2VNCA 1AKJD 2AV1A 3BEWB 4ZOAA 3UBXI 3RAJL 2FJGA 2FATL 4HIHB 4ZNCD 2F5AH 1T2JA 1JGVH 2E8YA 1WC7B 2HH0L 2J8OA 4LSPH 4NFBA 1KXQE 3PWUB 1E4WL 4KZEL 5FOBA 4R7NA 1LP9B 2BERA 2NY0D 4JRXE 3VFWA 4TVPH 3TO4C 4KQ3L 2C1PA 3HZKB 2ARWA 4JPWH 1BAFL 1EHLH 2UYLA 1J8HE 1K2DB 5I1DA 3A6BL 3QG7H 1MFCL 3VXRD 2Z92B 1WLHA 4X9FA 2R69H 1WAAF 1RFDL 3SDXE 2PTTB 4YPGA 3BJ91 3SPVA 1M05B 3KYNB 4N0FA 5CSZB 4PYHA 1MFNA 2XZCL 5I1GH 2QBWA 1QBBA 4E5XA 4QGYA 4U7SA 5FDWB 3U7YH 3CVHA 4PLJC 1I8KA 5GGVY 4OCSL 3IKKA 3MV8A 1DBJL 4LIQH 3ZKNC 5JHLH 1KPUA 5DI8B 3O45B 4RNRB 5DRXA 2P5EE 4U1NB 4XVJL 3GMPB 3LSOA 3RIAK 3T1WA 1YYLH 2FZ3A 1I9JL 5KS9E 1EJ6A 3BP5A 2OBGA 2VLJB 1G1YA 4YDLC 2IALB 4LQ1A 1YPZA 4BK4A 2R2EB 5GJTH 5IBTL 1NGYB 1ZA6A 3ARGA 3M8OL 4M48L 3WNLA 3GMOA 5I1KH 2EYRB 2WBJB 3L3GB 5TQ0L 3DSFH 4L3ED 5IWLA 4HEME 1CXIA 3DYOA 5HGHA 1F3DH 4OFYA 4QOKD 1ZHNA 3U79A 3RFZC 5B39B 3FO1B 3UPCA 2BOBA 4XCNB 1V7MH 4YQXH 2DRUA 1OSZB 3GKWL 4UIKL 3AVEA 2XICA 4IMKC 4YHZL 1XEDA 2YPKB 1ZWIB 2E7LC 1BVKB 3C8DA 4L9DA 3TN0D 3S98A 1A6ZA 1QBML 3BUYB 5BXFA 1CICB 2JIXD 4RFEB 3H7BB 1R3LA 3PWNB 3MRBB 3PQYD 3EYUH 1ETZB 1CGSH 4L8DA 1HINH 1LE5A 4CMMB 5J11C 4Y1AD 3MNZB 1OM3H 4LLYA 1E6JH 3OBAA 4WW2F 4LCUA 1XF4A 1K6QL 2R0KH 1FNEA 1KLUB 1T04B 1WT5C 5TDPB 4ZFFA 2NR6C 5GGUA 1YUHA 4GMSH 1UXSA 4IBLT 4OCNC 2CKBH 3BYTA 3QPXH 3SDDB 1YPZE 4K2UL 5CINH 5CFHA 4KK5C 3B83A 1QLEH 1ZKAA 1TQBC 4J8RB 4K3DH 1CGXA 4TQEH 3G6DL 4WFGD 2Y6SC 5FYLE 3FQUA 1DBBL 3VXTA 4IS6A 2EDJA 2OL3L 4PJIE 3ZTNL 4CMHB 2SEBB 3QIWD 1BM3L 3WE6A 2BCKB 3PDOA 5L2KA 2VN4A 5EULV 5HHMB 1PQZA 3QB7C 4NO3B 4EUPB 4YBLB 4G8GD 4OD2A 5LG1A 1A21A 5IM7A 4YHMH 4OSUL 1IAKB 5I74C 4XNYL 3D5OF 1W72H 2P8LB 3P77A 3BHBA 3QNYB 2Q8AL 1JF6A 4WDIB 4TUOB 3LQAL 3SGDI 5EUOB 2HJKA 2VDRH 5T3ZH 3PGDA 4FQ2H 3K4AA 4OZHE 2VC2H 1IARB 3TEUA 4HGWB 4XH2B 1EEZA 3OKYA 3D18A 4KRNA 3DRQB 4LRIA 4H0IA 1J88A 2UWEE 4NQSA 3ZDXE 4QRPE 1PG7W 4HPYH 4KJYB 4N8VA 5B8CA 2GJJA 5DC0A 3VA2C 3QIBD 5J12C 3NZHH 4EOWH 5DJXB 4Y5XB 2WANA 4YXLH 2D7OA 4Q6YA 1GGBL 4EXPX 5E8EB 3FQNB 3ZT6A 1JL8A 2ARJB 5IR1B 2UUDH 4PBVC 5TQ2H 2J7LA 4PV8A 3TNNB 1H9VA 5I66A 5JXEA 4AIXA 4XVTL 5LKNA 1XGQA 4P5TB 3TCLA 3T0WA 1OLZA 4JFDB 2YZ1A 2V7NA 4HUUA 4R0LC 2DTMH 1ULVA 5TDOB 3BJLA 4XXDB 5L2KE 5TJWK 4JDVB 3JV4B 3MLSL 4XNUH 3A0OA 4L5FH 5F8RC 5IHUH 2VXSL 4NRXB 3B2UD