4NCC1

Neutralizing antibody to murine norovirus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
210
structure length
210
Chain Sequence
QIVLTQSPAIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab fragment light
publication title Flexibility in surface-exposed loops in a virus capsid mediates escape from antibody neutralization.
pubmed doi rcsb
total genus 53
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc102
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ncc101
1EV2E 4JFYB 1UJ3C 3UAJD 1P5UA 4UBDD 3IJSB 4LEXL 1TQBB 2XXMB 3VCLA 1NLBH 2O5XH 1Z5LA 1KELH 2NY5L 4IMLB 4HKBA 2DQTL 4CBPA 1P4LB 1QNZL 4HJJL 2G9HB 2J8UA 1FC2D 1KIPB 4ZUTA 2P4AB 4R4FL 3ZE0E 1QO3B 3MA7A 5KVGH 1PZ5B 4QRUA 4OIIL 4HF5L 4XPHL 3R0MA 3TPUA 3PQYA 2APWA 2W60B 3MMEB 1KIRA 4WU7A 3ARTA 4P2OD 5HYEA 5LCVL 4LSUL 4Y5VC 3V6OC 1I7UA 4A6YA 5JMOC 3K2UL 4OV5A 5F6IB 1EEZB 3RUGE 3VXOA 3X12A 2NY2C 5BRZA 3P9MA 1PG7W 3BEVA 4KVNH 4F7MA 4KTEH 4NSKB 3S34H 5I1LA 2XA8L 1DSFL 1AIFA 1A6WL 4QWWD 5E1AA 3DUUB 2ICCA 1Q0XL 1RURL 5DMGD 3RWHB 3MNWA 4LARH 2YD9A 4AG4L 2ZJSH 3ZE1F 2H9GB 1F4YH 3CH8A 3RIFK 5DLMH 3SPVA 4Q0XL 1BREA 1OD7A 3MODH 2O5YL 3CVIL 3MXWH 1MJ7H 4KKAD 1T3FB 5H35B 2PXYD 2ZKHL 2P5WB 4G9FD 2DYPB 1FO0A 4PUBL 5JUEH 3DX6A 2YD7A 2HKHH 4I0PB 3WKML 3QI9A 1NBYB 4LSRL 1UWEL 3NIGF 3NTCL 3E8UH 4NJAH 1LVEA 4W4OC 5FK9B 4M9OA 3NA4A 1I8MB 4MHHI 2YD1A 4HMCA 5GSRB 4LCCB 4TUOA 4LPXA 2E7CA 1K5NA 1D9KA 2AJ3A 4ZAKA 1DQLL 3UTQB 4H0IA 3HI1B 4PRPD 4AEIL 3DHJA 2FX9L 1ROWA 1VFAB 5JW4R 3PWNB 1MJJB 1HHIB 4A2LA 5DRWA 3FB8A 1JYXA 4PJGB 5A2FA 1JTOA 3RDTC 2VLRB 2EE3A 4DFIA 5BW7A 3GJFA 4FQJH 4OB5H 4YDIL 4JFYA 3BZ4A 2VZ1A 3BVNB 4ZMAT 3TBYB 2CLRA 3IJSA 2H2PC 3FN0H 1TZHA 1B90A 1XGQB 3BEWA 3ULVH 2X4PA 2LAGB 3VMPA 5DK2A 4IMLA 4IHOB 3DVNA 3HZMA 4PJXE 1ZA6A 2G9HA 5I17B 1KIPA 3U30B 2BZDA 3H3PL 4PJ7F 3CDCA 1NCCL 2VLLB 3I50L 4R97C 1EIBA 5BV7H 1AQKH 1RFDL 1JGUH 4UDTB 4IIQC 5KTEH 2A9MH 3QWRD 4AEHL 3VXQB 1EEZA 4RMWA 3PGDB 3TH3T 1EHNA 1R0AL 4IOSD 4PBVC 4W6YB 3O3BA 4B7IA 4NSKA 2D0HA 3PDGA 3TO2B 1FPTH 1AI1H 1IGTB 3MLTA 1V7NH 3DUUA 1C5BH 3BD5A 3ULSA 4ZFFB 3K46A 4XRCA 1MAMH 1QLEH 4UIKL 1A8JH 1PEZA 2PYEA 2GSIB 3SJVE 5K9KA 4WFEE 3JVGC 3RY4A 3S3PA 5DI8A 4X6DB 2YPKB 3HNSH 5TF1H 4DKAA 5DO2C 1O7VA 2NTFA 4DTGH 4HPOL 4Y19B 43CAA 4F8QA 5H35A 1T3FA 1KXQE 4P9MH 2DYPA 4KWUA 3VD9A 2PKDA 5D2NE 1JVKA 2AJZA 1WWAX 1U2HA 2X4TA 3C60B 4JN1L 2CMRH 1AHWC 1JTTA 5ANMA 5FK9A 3VE0B 3MOQA 1JTPA 3A67L 1I8MA 1E28B 5GSRA 1R24A 1AO7A 2Y07H 4OZHE 4RAVB 2BVUA 2ZSVB 1K6QH 4LCCA 2V7NB 1SY6H 4XHQA 1FGVH 2W9LA 5DJ2A 4RMUA 3D2UD 2VLKE 1RUAL 5C2BH 1HQRB 1VFAA 1S7XB 4LNRB 3PWNA 1MJJA 1HHIA 4O2EA 4D94A 4JZOA 3T0EC 3O6FC 4YHML 1KB5B 25C8H 3WKNA 4UNTA 3T4YB 4PRIB 2R29H 2EIDA 2D7QA 3RVWC 3BVNA 4LIQL 4P4RB 5F72S 5DZNA 1WSST 2V5YA 3K81A 3TBYA 1J05B 1G7IB 1ACYH 4OZGE 4P3DA 1P1ZA 1JZ5A 3VG9B 1EZVX 4IHOA 3SDDD 1QG3A 1YEDA 1NMBH 1MCNA 5BZWB 5I17A 4JG1L 3EO9H 1CTNA 1VSCA 2WSKA 2PTUA 4ZNEA 2AQ2A 4KRPD 1B0RA 5GGSY 5T1MB 2VLLA 2ICWJ 1F58L 4R26H 3B2UC 5IVXE 5F7LB 2IWGA 4U49A 1QP1A 2YA0A 4ETQB 5J06A 4PY8I 5DRXB 4OSUH 3LY6A 4KTDH 3EOTH 3VXQA 1LDPL 4XH2B 5H37G 3PGDA 3KPRD 5DF0A 1UWXK 2EYSA 1BD2B 1CXEA 3PP4H 3ZDXE 4YHOL 4EDXA 3F62A 4LSQL 3FFCE 5CP7B 2NZIA 1EDQA 2OL3A 4UQ3B 4ODWB 4Q9CA 2GSIA 5GRXG 5GS1B 2CLZA 4X6DA 2WMPA 3V8CA 2YPKA 5TE7H 4KKNA 4H0GA 3Q1SH 5ICZB 4Y19A 3T0VA 1RZJH 3WFEL 1NFIA 4KY1H 1ED3B 5C6TH 1JWMA 1PY9A 2DIBA 1CLOH 2C3GA 5BZDB 1FVDB 1NGYA 3C60A 2CGRH 4KMQA 1GC1H 4WI3A 4L4TD 3LEVL 5H37H 3PV6B 3O6ML 4Y4FC 1DANT 3CD4A 2PO6A 3IJYA 2EDTA 3VE0A 2Y1VA 4YDLC 1E28A 4S2SB 2D7TL 1S7RA 2YRLA 4OT1L 2DLFL 4RAVA 1KPUB 3I2CL 1G7PB 4GKNB 4HH9A 4MZ3A 3HZVB 1C08B 5FYKL 1HQRA 5E5MA 1S7XA 4LNRA 3B9KC 4WTZG 3FHAA 4IJ3C 1IQWH 3QZWG 3NFNB 1PLGH 5EU6B 1KB5A 3KYAA 4X4XA 3C6LB 1QSEB 3MRJB 1BJ1H 3T4YA 1U8LA 2YUZA 4KK6C 1QBBA 4P4RA 1FNSH 4XVJH 1ZXQA 2FD6H 4MWFA 5FYJU 1S78C 4N0CD 3QEGL 1FFNB 5DURB 3VI3F 3FOLB 2Z92B 1ZTXL 3EAKA 1CGVA 1HE7A 5BZWA 3FL7A 2RGSA 4K7PY 5C3LD 1N0XL 4LLDB 3ZDZE 4GQ9H 1YDPA 4DVBB 2I5YL 3BGAA 4HULB 5IM7B 4GXVL 5EOCH 2ADFH 4ETQA 3HC3H 3DMMC 3PDOB 5KS9A 3JTTA 3UJJH 4XPGL 1NCWL 2ZOLB 1A22B 4OF3A 3SDAC 2HLFD 3OKDA 2VB5A 3ABZA 1UKTA 1IGMH 4M7JH 4KDTC 4Z18A 4LDLB 4W6XB 1EO8H 2IQ9L 4H1LG 1QOKA 3QT2A 4P5MB 2OXGA 1KG0B 1DBAL 4UQ3A 5IFAH 5CBEB 2W92A 4TVSa 2DF3A 3V0VB 3RY6A 5ICXB 2W91A 4AEEA 2VXVL 3BX7C 1IT9L 4HBCL 4X7DC 3W39A 3X14B 4QOKE 5BVJB 2R9HC 4TNWK 5IB3B 4OAWB 2R4RH 1GAFH 4MLSA 5DMYA 2H8PB 5T1LA 2HRPL 1ED3A 4APQD 1XF4A 4ZS7L 5BZDA 5JHDB 4OCRH 4PRAB 3I6KA 1M7DA 4ODTL 4WEMB 3PV6A 2VZVA 3BKYH 4JHWH 4KZEL 4V1DB 2Z31A 2X09A 4LDEB 1KPUA 4LPCA 4H1LH 1YNTB 4NFDA 4OLVL 4ZOEA 4QT5B 4WDIA 3TJEL 1Z3GL 2WP3T 1MPAH 4JKWA 4LKCA 4G43B 1S3KH 3RWEA 1PG7X 5CEZL 2DQHH 3C6LA 4MA8H 3MRJA 5GRJH 2AEIT 3W2DL 5DFWH 4X5WB 5IQ7L 3LKQB 1DBJH 3O6KL 3TCLA 2J4WL 3EIFA 3LN5B 4L3AA 4Y8DC 1LEIB 3ZO0A 1FFNA 3FMGH 3FOLA 3B83A 5J6HA 4CVUA 3QI9C 4LOUC 5CINL 3QIBB 4K7FA 5I8KH 1E27A 1JHKL 4FQCL 1OOAA 5LKNA 2EECA 4CJ1A 2E9IA 4MDJA 3PDOA 4NN7C 4C58B 1D9KC 2CUMA 5IBTL 5J9PA 4ZAKC 2MQCA 2ZOLA 2GUOA 1YMMB 3C8HA 1E6JH 4HGWB 2X7LB 4KV5F 3TBSA 4TUKL 3UBXG 3S35H 3FQUB 5LGKA 4G5ZH 5KVMC 4M5YL 3CFEB 4P5MA 5D71H 5ITFA 3JV6B 4BJLA 1JPST 1ULVA 5BW7C 1KG0A 4ZFZA 4P23A 5CBEA 4LSTL 1MCRA 1MFAL 4HIJA 2UZIH 1TQBC 2IQAB 5ICXA 5JW3H 4P5KA 5ALCL 3VH8A 1MHEA 4OAWA 2H8PA 5C08B 2EE2A 4OZFB 4OCYH 2J12B 1G1YA 4N5EC 2HVKA 4M48H 4OFYA 5B3JE 4JM4H 1W8NA 3OXRB 4JCMA 5FAAA 5IEHA 1SJHA 5FYLD 2FBJL 2WWMD 2NY3B 3OBAA 1YNTA 4NKIH 3DV6B 4EOWH 4LNVA 1E4XI 1IGJB 3CXDL 3HA0A 3SE9H 3LQZB 2EIZB 4WW2F 2A6DB 3MRQB 1JZ3A 4IDJL 4G43A 4U1KB 5CBAA 2FNBA 2ZG1A 2EH8L 4HKZA 4JKKA 4HLZG 5AD0A 2ORBL 4FXKB 4ZO8A 5SX4I 4PBWD 4NM4H 4U3HA 5EUOE 3SKMB 3LKQA 4N0UE 3HC4L 1ZEAH 3QXDA 4P4KD 2VXTH 1DTUA 3LN5A 5CS7A 2X1XR 5H94B 1FBIL 4YEFA 2LU4A 2VN4A 3K74B 1RAMA 3MLUH 1MCFA 2F19H 2IBZX 2W59A 5LWYL 4X7SH 4M1CD 1I3GL 5J7CC 2XQYK 1NGQL 3BE1L 5A2JH 3JWNC 3DVIA 2LABA 5LJYH 4LCCC 1G0DA 1T80A 2JB6B 3V7AG 1YEGL 2NXYD 1KJ2A 1YMMA 3D0VB 1JF1B 3PP3H 4XBEL 2HT2C 4HGWA 2X7LA 4HLZH 4QXUL 5LBSL 5C1MB 3FQUA 3FRUB 1G7HA 2E7MA 1XMWA 2EDEA 4U1JA 3CFEA 5DR5H 1CD1B 1C16B 5D4QA 3FB7B 3RAJH 4PV8B 1TQCC 1P5VA 2IQAA 2W9DL 1MCPH 3CVHH 4GG6E 3C6SA 4D2NA 1F13A 4PJBE 1WGOA 3BRDA 5LAXB 3UP1A 1FQ9C 1LILA 4YUEH 2IPUG 1UYWH 4UV4H 5CD5D 2FIKB 3ARSA 3FT3B 3K1KC 2DMCA 3P0YL 1CQYA 2I25N 2F54E 2AEQH 4MA3A 2LU3A 4KK8D 1OGTB 2E7BA 5JW4N 1WWBX 3DV6A 4E41B 3RUGA 2VABB 1A1OA 3V8OA 4I0CC 3LQZA 2BSED 4BQ8A 2HJKB 3MRQA 4NM8H 5GGRB 2AI0H 3ROLB 4W6WB 2QKIB 3GNMH 3MRGB 3P30L 1JHTA 1K85A 1J8HE 4G7VL 1CE6A 1UENA 1MH5A 1RIHL 3SJVB 4FXKA 1OLLA 3P73B 5EU7C 2VN7A 3S98A 3SKMA 4QXTB 2Z0BA 4YHKH 2HJLB 4U1HA 5H94A 3ILPB 4LCWD 1ZSDB 1YECL 3UPCA 4YXLL 3ALPA 3C60C 2DLGA 3OX8A 5K9JL 2PO6C 3DLQR 3LS4H 4XP1L 1KENH 1ZHNA 3PGFH 1RK0A 4PS4L 3MZGB 2VERN 3RTQB 5B3NA 3HE6B 4HT1H 1BZ7B 3IXAB 3MNZA 4P5TB 3VRJB 4FMKA 2OK0H 1KTKE 3GMPA 2IANE 2JB6A 3W5NA 4OZHB 2J8UF 3WLWC 3PV7A 3D0VA 4FHBD 1JF1A 1RUML 3O3AB 4K2UL 3SGKA 3FRUA 2R0KH 3DUSA 4UB0L 1W0VB 4CAGA 1F4WH 1EERB 1N64L 1C16A 2OM5A 3I3BA 3QFDA 4NQDE 4LL9A 3V0WH 4OCLC 4MGXA 2RFXA 4FQLH 3VG9C 1JBJA 1FDLH 4UU9B 4JFDD 1NSNL 5D1XB 3BWAA 1W72B 1II4E 4X9IA 5ESQB 2AK1H 4JRXE 1AE6L 4ZFGH 5I1GL 4G8FB 5LAXA 4PJXA 2OX5A 1FE8H 3HLAB 3GSWA 3MJ8A 4JFOA 4P2RB 4X80H 5JW5B 3TFKD 3D3VD 4PRHD 4MQ7A 2R56L 2ZCHL 3BXNA 2FL5A 3BDXA 3BPCA 3HCVA 1JUFB 5IVXB 3B5TA 3L3KA 4J4PA 4CMMA 4UT6H 1ZLWK 3WUZA 5DVLA 5HGBB 4YZFF 5JHLH 4NCC1 3QRFM 3BPOC 1OGTA 2DICA 5DTFA 5E7FA 4OUUB 1OPGL 1ZT7B 4QRQB 5GGRA 5KVEL 2Z93B 1BAFH 5BJTB 4HHAA 1QBAA 3HRPA 4M7KH 5DMKB 4NOFA 4MCZB 1Y6MR 3FFCB 4Y4KB 5KSUA 3BPLB 5SWZD 5CCKL 1CK0L 4WI9A 3GHEL 1LO2H 2BVYA 4L1HA 3UO1L 4HUVA 3SJVA 5E08L 3P73A 1ZGLB 2WM0A 4FFVD 4PG9A 2HJLA 1RI8A 1Q1JL 5MEOB 5EZJB 4G8IB 1ZLVH 1SEBB 5JOFA 4FXGB 4WU5B 1CL7H 3WS6A 5EORL 4OTXL 4B0MM 1NAKL 5I16B 3NA9L 5MHSE 5D2NA 2DBLH 2W0FB 4UTAL 5BS0D 1NGWA 3E6FB 3RPIB 3TVMB 3VXRE 5HHME 2Z31C 3RTQA 3IXAA 4P5TA 4CN6A 3VRJA 2DI9A 1PX3A 1KBGH 1S7WB 3IGAB 1EGJH 4ISVA 1J1XL 4OZHA 5I71B 1VACB 1ERNA 3BJ91 1YNKH 1MY7A 4YHZL 1A7NL 2VLKA 4ODHH 3QNZA 4NKMB 1W0VA 3ARDB 3C6LC 1DBMH 3PHSA 1OM3H 4IOIB 4N9OB 1CGUA 4XMPL 5EC1A 5C0CE 4XCEB 4MD5A 4PFEA 3Q3GB 3TT1L 3W11D 3A0OA 3LIZH 5E7BA 2CD0A 4UU9A 2VQUA 4KKBC 4IRZH 4OZGA 4M9PA 3K8MA 5D1XA 4KK9C 2VL5A 1W72A 5D1QD 3QQ3A 4Y89A 1YYMH 9CGTA 5ESQA 3UDWA 4G8FA 1WCBB 4OCXH 1G9NL 1YC7A 3HLAA 4LLVB 1F4XL 1Q9OB 1FG2B 2EDRA 4GXUN 3QFJE 3AY4A 3EZJB 4PG2A 2R4SL 3M17B 2GFBB 2FHBA 4KKCC 5IVXA 1UCBH 5ADPH 4I48B 3KLAA 3SGDI 5HGBA 1B4JH 4LSVH 2AJXH 5T3XL 4JPKH 1TITA 4OUUA 4HAGA 1TENA 4OM1H 3H7BB 4NNPH 5DXWA 1ZT7A 4PY7B 4QRQA 3IRZA 2Z93A 1MFDL 5BJTA 4NIKB 4MNHB 4RFNC 1T04B 4P23C 3EYFB 4NP4H 5EO9B 3R1GL 4MCZA 3FFCA 4G7YH 4C55A 3ARZA 2BJMH 4FTVB 1I9RL 3WYRA 3WFDH 5JIHA 3LMJL 4WFFE 2OJZH 4QOKB 5EBGA 5MEOA 1MCOH 2DQIH 3QJHA 4G8IA 1S5HA 3HPLA 1SEBA 3LV3A 2AEWA 3O9WB 4FXGA 2ZCKH 5J6GB 4L8CA 3RGHA 3LB6D 1CU4H 1I4FB 2C3HA 5L2KE 1CGXA 1S9XA 5IW6B 3FFDA 1B9ZA 3MRPB 2RQ8A 4RGMB 1NKRA 5EG6C 2WLYA 1C8PA 2W0FA 5SV4A 2XXCB 3E6FA 2UYLA 3MXVL 1F00I 3TVMA 3V6FB 4YIQB 1I1AB 3PWJB 1MNUL 1YY9C 4Q74A 2W0LA 1BFSA 2BY0A 4WI6A 1GIGL 3DI3B 3MLYH 4R0LB 4MNQE 3T2QA 3RWDB 4WVRA 1J0IA 2AXHA 5FGSA 3ARDA 4RZCA 2OZ4L 4RCAA 3DIFB 5DUPL 4IOIA 5F1SA 4XNYH 4XCEA 1ORQB 4YJZL 1KLFA 1CDGA 4BFGA 5T5FL 1TNNA 5ECJE 4OI7A 4P2QB 3O2WL 3LKSB 3CSYA 1MCLA 4LHUG 5MEPA 2IPTH 2HTLC 2VLJD 4BH8B 3QIBC 1NC4B 1WCBA 4LKXB 1T2JA 4LLVA 5CKGA 5HTSA 5MI0B 1Q9OA 2FO4B 3QUMA 4YHIA 5GGUB 5GGVY 5I75B 2Y7QB 3IFPB 3M17A 2GFBA 3TNNB 2WLZA 2P48B 4LVHB 2PYFA 1FZMB 3IJHB 1JNLH 5IMOA 5F9DC 2NNAB 4I48A 4Z7UE 4BKLA 4HAFA 5FYLH 3RWJA 2GJ6B 3JWDL 1BEYH 5HI3C 4HBQA 2WINB 4PY7A 1T0NA 4EDWH 1MAKA 4G80B 1ONQA 4AY0A 3EYFA 2VTFA 1RUQH 3QIWD 5EO9A 1EFXB 4JFZL 3OV6A 4LSSL 3UMTA 1QYGH 3CLFL 1UB6B 3G6DH 1E4KA 5EFIA 4QOKA 4Y16D 1N7ML 3BKML 5J6GA 4M1DH 4XPFL 1KCRL 4PYHA 2IADB 1FV1B 3WXWL 4HKXA 4NQSB 4JFQB 1JF6A 4FP8H 2D31A 3DHMA 3QEQD 4DQOH 4XP9L 1KIQA 5CHNB 3HN3A 4YWGH 5IT2H 5C2UB 1MVFA 2IEPA 3V6FA 4R8WL 4YIQA 4OBSA 1I1AA 3PWJA 1IC1A 4HJ0C 2C4FT 4OLUL 2NY3C 5TDPA 3FTGA 4YBQC 4R0LA 5CMAA 5C92A 1T7WA 4PJEB 3VD5A 3CX5J 3F7QA 1NCDL 5CLTA 1I1YA 1ADQA 2EYTB 4KI5D 3UTZB 3QIUA 4OCWH 1WJ3A 3T04D 5GS0C 2D2OA 1YN7B 2HG5B 5KS9F 4HWUA 3ZHDA 1EEYB 1ORQA 1MJ8L 4K3HA 5TQ0H 1WWCA 3SBWA 5GHWL 2ZPKH 2I26N 2MHAA 4N0UB 3LKSA 5EA0H 2APTA 3HMWL 4H8WC 1T03L 4AZ8A 3L7EB 4ZUUB 4RIRB 3MQIA 4LKXA 3SDCB 2FO4A 2GJZB 3LH2L 4U3XA 4POYA 5C71A 4XAKD 1IJ9A 5E94B 2A6IA 4KDVA 1UWXH 4B7LA 4K9EC 3HI5H 1AKJA 5DZOA 4QGYA 4ZSOE 3IJHA 4K94H 4NHCH 3H9SE 2FJGA 4PLKC 2NNAA 3PWPD 1U92B 5F7FA 1JWUB 5GGSB 4G8GE 1DQDL 3UCRA 3B5HA 1H15B 1VENA 5IW1A 4M6MH 2WINA 1CXLA 1UA6L 3I3EA 2DWEA 1OARL 3RWGB 1FNFA 4EI5D 2VDQH 4RGOL 1AGEB 3T0AA 1KCUL 3LKOA 4B50A 5K59E 1SMOA 3RVTD 1A6AA 1MVUB 3WBDA 3GO1H 5IHZA 4OGAC 1U3HD 4Z95H 4ZXBB 1R3LB 2BVEA 4NBXB 2YKLL 4PJAB 2BNRD 3MBXH 1LP9E 4BK5A 4HXBH 1CVSC 1FV1A 4NQSA 4JFQA 5IJVA 4IOFD 2AABL 2GSGB 4S0TD 1T1ZB 4LSDA 5IESL 2B4CL 3BRFA 4PB9L 5JXAH 4J4PC 3NVQA 4XCFH 4OUOA 4U1NA 4K71B 4U1LB 3WFCH 3O4OB 4RFEB 3KPSE 2HVJB 2F54B 3V5HA 4DN4L 1S7SB 4LCYB 1VHPA 1AY1H 2Y06L 3NZHH 3G9AB 4E5XB 4TRPH 3OKLB 3UTZA 1GZPA 1DL7L 2VDLL 4JO1L 1OP9A 2HG5A 3BGMA 3GMNB 4O2FB 3U1SL 4LEXH 3TWCL 1OAUL 1EEYA 1OTUC 4TOYL 5ISZE 1IGCH 5TPWH 3Q5OA 5EUOA 3SKOB 2ZNXA 4BFEA 4N0UA 1QNZH 3WS6C 2XRAH 4DKDC 5L8KB 1EJ6A 4R4FH 5A16B 4H88H 3BKJL 5D2NC 2F8XC 1IKFL 3ALXA 4HF5H 3SDCA 1FH5L 2GJZA 1IE5A 2BSSB 3T3MF 3W81A 3OR6B 3HPJB 2YSSB 3RTQC 3QQNA 5CGTA 5E94A 3HE6C 2A6JB 3ZYIA 3BP5B 1YY8B 3SGEH 4P5TC 4L4VD 3ZDYF 3K2UH 1A02N 2EYRA 3WL9B 4WHYG 1JWUA 2HLAB 2VDPL 1RU9L 2XA8H 5E99L 1NFDE 3BMWA 3VI4E 1L6ZA 5F9OL 4NQCE 1Q0XH 3D69A 1GZQA 5F97E 2LQRA 3HG1B 3S36X 4AG4H 4P2CG 1BVKB 4PJHE 5D1ZD 2FATH 3SDYH 1AGEA 1JNNH 1RZKL 3BFOA 4Q0XH 5HPMA 4NQDB 5JQ6L 1NL0H 2LVCA 4I5BA 1MVUA 5FFLA 2O5YH 5ALBL 3CVIH 3TA3A 4LLYB 5D1XC 2P8MB 4GG6A 3RZCD 4NKDA 2NZ9C 3UDWC 2A77L 4PUBH 4ODVH 2R0WL 3VFUB 2DI8A 3VRLF 2B39A 5ENWA 3WKMH 4AIOA 3UTPD 1KXVC 3CU1A 4PJBA 5C0JB 4PG2C 1UWEH 3TIEB 3NTCH 2AJSH 4WHYH 2R69L 1RUPH 1I85A 1T1ZA 3QG7H 1PSKH 4GRWH 4WJ5B 4ZYKB 1DR9A 5C09D 1E4WL 3DVGB 4U1LA 2HVJA 4M6NL 1UM4H 2F54A 1MHPL 3SCMB 1S7SA 3G5ZB 2Z35B 2JTDA 2N4IA 1RJYA 1XZ0B 1KN4H 2HMIC 1NANH 4E0RB 3QO0B 4MQTB 3GUTB 3OKLA 1OAKH 1T2XA 3E1F1 4KROD 3BPLC 4WI8A 1Z9LA 3QJFB 1SJEB 1KCVL 1J8HA 4O2FA 1JNHA 2V2WB 1I1CA 4JHZA 3SE3C 4DKFL 1SEQL 3P4MB 1GHFH 1PQZB 3HNVL 1OF2B 3K4AA 3SKOA 4JPWL 2E8YA 5EZIL 4ENED 1NEZA 5DC0A 4OF0A 4YDVA 4ZS6D 5HHQA 1NCCH 3I50H 5FYJL 3TVMC 3HPJA 5DJCB 2YSSA 4L3CB 2A6JA 5T3ZL 3A6CH 3T3PF 3ULUE 4PJCA 4TTDD 4WI7A 3VXRB 4AEHH 5HHMB 4XVUC 3FO9B 4HCRA 3DRQB 3RY5A 2A9NH 4RNRB 5L0QB 5I71C 3DURA 3QPQD 1R0AH 4NZRH 3L3JB 3N06B 1JMZA 2CIIB 2IANA 3MO1B 4P0DA 4PJ8A 4NHUB 1ITCA 1GL4B 1X4YA 3ARDC 4S1DC 1CFSB 4WWKB 4FQIL 1K4CB 4UIKH 1RJZB 4C4KT 1HIML 1BVKA 3ZTNL 2CDEA 3MBED 2QEJA 1D6VL 4NQDA 5C07E 2X6MA 3GKWH 3D85B 4H20L 1X6NA 5E2UH 5DDHB 3F58L 2X89D 3O0RH 1L7IL 1VGEL 4NO0D 3VFUA 5D5MF 1WZ1L 1MLCB 2B1HL 3H9ZA 7FABH 2EC9U 2CH8A 1MOEA 4J3SA 2RIKA 4JRXA 4UDUB 5C0JA 4JN1H 3V79C 3TIEA 2XQYG 4OGZA 1KLUB 2B7DT 1CZ8L 5D7LE 5IG7B 4LASL 1A3LL 1YUHB 2GY5A 3CFIC 5EPMB 1M71B 4WFGE 1Q9LA 1R3KB 4P48A 5DT1H 1RUAH 3SCMA 3MJ9A 1C1EL 2Z35A 5DFVC 4OKVB 3B4NA 1MELA 1XZ0A 2XI9A 5HI5C 3QO0A 1KPVB 4YHMH 4UV7L 2E7HA 2YK1H 1S7QB 2I07B 4D9QE 4FFZL 4OZIF 3LKNA 2V2WA 1TETL 4IRSB 4AM0A 2NY2D 4HWBL 1E4KC 1IBGH 4AJ0A 3P4MA 1PQZA 1H5BB 4WTXA 1X6LA 1P7KB 3I6LD 1OF2A 1DQJA 5D2LF 1BQHB 5DD5H 1S9VB 4JG1H 1WVZA 1JRHL 4LVOC 3BYYA 4UINL 3OZ9H 4QRPD 3QUYA 1YEIL 4D9LL 5DJCA 1G7LA 1I1AC 4ZPVB 1JCKA 2D7OA 1OCWH 4JZJA 3VXRA 1C7SA 4NUGL 4XP4L 1LDPH 3GSUB 3DRQA 2YA1A 4R0LC 5A2IH 1U6AH 4Z77B 1SBSH 1D5MB 1NJ9B 1WBXA 3L3JA 2GJJA 4PJXF 2UVEA 3G6AB 2HT4C 1QD0A 4MNQB 2WBJB 4NHUA 5FO7B 2WUBH 4MQSB 1AR2A 5BQ7B 2A73A 5I73B 2BERA 1CFSA 1WC7A 5BMFH 1RJZA 1OWWA 4QRTA 1NCTA 1INEH 4MJIE 4G42B 4YO0A 3KYMA 4K8RD 5EDXA 3RVXD 3SBWC 5C0CA 5C0EB 1M05B 4TUJB 4QEGA 2CKBB 3D85A 4J3UA 5E9DD 4J2XA 3V2AR 2A0LD 2C4XA 4R9HA 3OKMA 1MLCA 3B43A 5MI0C 5I75C 3FRPA 3RDTD 3F12B 3LEVH 4F7PB 2H2SC 1KLUA 2GI7A 3QFJA 4G6KL 4LVHC 2BHZA 3BAEH 3O41A 1IM9A 2H2PD 4XMKL 5IG7A 5L2JB 2DLFH 3RI5K 3I2CH 1YUHA 5EPMA 1M71A 2B2XH 1CXKA 1FAIL 5HJ3B 2DIJA 3GJFK 3BWUC 4OKDA 3UTSD 3LKRB 1G9MC 4MJ6B 4OKVA 1SJXA 3VRIB 5K93A 1QRKA 3V5DA 4WUUD 1S7QA 1CG9B 2NY6B 5C0IB 1AQDA 3ARXA 1JGLL 1N26A 4FG6C 3PL6B 4IRSA 4EIGB 3CDYA 2GT9A 2PW2B 3ALWA 1ZTXH 4AIZB 4NZTL 1BQHA 2CKBL 2OTWB 1S9VA 4NQEB 4F2MB 4AT6B 1F11A 5CJBA 1Q9KA 3MACL 4XAWL 2X4QB 4D8PB 1MQKH 5HHXL 3TF7C 4JDTL 5L2KA 35C8H 2A1WL 3EBAA 2I5YH 1HXYA 3U36B 1A7RL 1HI6B 4ZPVA 2E9JA 5KSVB 4NZJA 2IMNA 3OL2A 4X6CA 2QBWA 3RKPA 5SWQB 1OD9A 3MRNB 4XPGH 3GSUA 2AJVH 5IB4B 1D5MA 1NJ9A 3NFPB 4MNQA 4XWGH 1OAZH 4FNLH 4PJIF 5FO7A 4M43H 2IQ9H 5TDOA 2DKMA 2WW8A 1GXEA 3RL2B 2B8OT 2Z8VC 1VEMA 4HFWB 3FB5B 3KGRA 3L5WA 4JO4L 5TE4L 2WV3A 4U6VH 4EEEA 4GS7C 2EXYC 2NX5B 1IT9H 5EN2A 1M05A 3SDXE 1BFTA 3PWLB 4HUXA 1Y18B 3WEXB 4XB8A 3VXTB 1BM3L 1IAIM 1SM3H 3SDCC 3T0ED 3N85H 3F12A 1ZK9A 1ZLWH 1INQB 2XA3A 5JDSA 3V6ZB 4J12A 1A6TA 1NLBL 4JZNB 5JA8B 1KUMA 2P5EE 1SHMA 4JFED 1KELL 4G6AD 4Q2ZB 3GSXA 3G6JE 2W65A 3GSNA 3QUXB 5FECA 3SN6N 5L2JA 1S9YB 4ZSOB 3H9SB 1J1PH 5KVGL 4JM2B 3JV5A 4FQ1H 4JR9H 3TJEH 2AERT 1Z3GH 4Z7UA 4DEPB 2AV1B 4MJ6A 4MYWB 1DVFA 5E8OA 3PNWB 2VAJA 4NQTA 5CEZH 1ZLUK 3B2UD 4M62H 1EK3A 4U1IB 3QDMD 1CG9A 4BSVA 5C0IA 5CGYC 4CNIA 1MLBB 1RHHB 1FLTX 1UQSA 3P4LA 3WIFB 3HFMH 1F5WA 2DD8L 2MQ0A 4KTEL 1DEEB 3S34L 3TA3C 2JIXA 3O6LL 3O2DA 5DVNA 4D0DB 3C5ZB 5HHNB 4AIZA 2OS7A 3V9FA 3CAFA 4LARL 4F2MA 3O8XB 1F4YL 4OIBA 2X4QA 5EU4B 5DLML 2FX8H 1ZT4B 5IUSA 1I85C 1X5KA 1XCQA 1HNGA 3MODL 3TNMB 3U36A 5AAMA 1F3RB 4KJPC 3MXWL 1MJ7L 1HI6A 1BF2A 2R23B 3G5YA 4TVPL 5KSVA 3O4OC 4N9GB 5JUEL 3V7AE 4TULH 3MRNA 2HKHL 3GI9L 3KPSB 5IB4A 3T0DA 1FCCA 1ZHKB 3NFPA 4JY6B 4NJAL 2EEDA 5D6CA 3EYSH 2R1WB 1S7TB 2HN7A 3HMXA 2GCYA 4M5YH 4K3GA 4O9HH 4HFWA 5DGQA 3FB5A 1MFAH 1A1NB 2L7JA 1BZ9A 4N0YL 5SV3A 1FNAA 4AQOA 3EOAB 4UAOB 4P3CL 5DWUL 3ESUF 3P4OB 5TH2B 2GAZB 1RZ7L 1A4JA 5J11C 4LPVA 1Y18A 3DYOA 3VXTA 4RGNB 1DUYA 4FQJL 5C70A 4OB5L 3G9VA 3FN0L 1MI5D 3V6ZA 3ULVL 1KCLA 3ZE2E 3B8SA 3X13A 2CPCA 4L3EA 3SKUD 3QQ4B 3BH9A 4XP5L 1Z0MA 4XZUB 1TJHH 2Q6WA 1VFMA 3IDJB 1J5OH 3QUXA 4ZQKB 2HFGH 1S78D 5DK0B 2OMNA 1P7QD 4ZSOA 2FGZA 4XTRC 3H9SA 1U3ZA 3VXSD 3CXDH 4P3WA 5KG9A 4G8GA 3FHQA 5BV7L 4GG8A 2AV1A 4JFFB 1QFUL 4NWUH 1NFDB 3ZT5A 5KTEL 1JYWA 4BZYA 5I66A 3C5SB 2EH8H 4U1IA 3S4SG 2Y4SA 5KANG 3DMMD 1MLBA 1A14L 1RHHA 3WIFA 1M7XA 1TTFA 4CW1B 1FPTL 1AI1L 4D0DA 1IRAY 3FQWB 5GISL 1C5BL 1FBIH 1JF5A 2JF1A 5HY9B 3QISA 5LWYH 2EEAA 2P1YA 5EU4A 1LP9A 1I3GH 5F7MC 4HZAA 2XZZA 3BE1H 3HNSL 3AC0A 5TF1L 3TNMA 4X7CC 1JK8B 1VEOA 3DBXA 2R23A 4P9ML 3NABH 1FNHA 1ZVHA 5AG9A 4Z76A 4CGTA 3WHE1 1YEGH 2FH8A 1CD9B 3KNBB 4NO2B 3FO2B 4U05A 3KPSA 3SCMC 3TO4D 2AKRA 1TCRB 4XBEH 1ZHKA 5LBSH 4O58H 1TJIH 4KRMB 3PQYD 2R1WA 2GQHA 1S7TA 4MJ2A 2OI9B 3SE4C 3MX0A 5DEFB 3BHBB 1KYOK 4YE4H 2Y07L 4U1MB 1SY6L 1FGVL 5C0BE 2W9DH 3KPPA 1P9MA 5BRZD 4PJ5E 3EOAA 1EVTC 5I9QB 5JOEA 3P4OA 4XVSH 1T7XA 3U9UB 1FYTB 1FORH 1RJLB 5ISZA 4C54A 4LEOB 4YHNB 4DN3H 3IYLW 25C8L 1RK1B 5L9DH 1MCIA 3TBWA 1D5BB 3QUKA 3QUYC 3PIQA 1ACYL 3TC9A 2CJUL 3QQ4A 4XZUA 5HDLA 3B9VA 1CVRA 3EDDA 4Y4HB 5E6IA 3CC5B 3EO9L 2QL1A 1HK6A 1QKZL 3QCVL 3QI9D 5AYUL 2V17H 3KYNA 5KSBE 1FP5A 1YZZA 4KAQH 2J6EH 3FQXA 3F6IA 1QSVA 5D6DA 1UKSA 1OL0A 4Z7WB 1NFDA 1CL7I 3MJGX 3EFFB 4NQCA 4KTDL 4OSUL 4G7VH 3C5SA 5DUMH 5B3JF 4DW2H 2HWZH 5TQ2L 4X9FA 1SYVB 1YQ2A 3GHBL 4PJHA 2COQA 3QEHB 1D9KD 4ZAKD 1VGKA 1LK3L 4GBXB 4CW1A 1OP3H 3FQWA 4I3SH 4P9HC 1KULA 3THML 1HHJB 2B5IB 2VE6A 1MFBH 2KQNA 4YXLH 1BPVA 3ARFA 5LXGH 2BFVL 4QHKI 5B38G 4XP1H 3EGSB 1EBAA 4GKZA 2WIMA 4PS4H 2DL9A 3Q1SL 1JK8A 5ADOH 5HGAA 3O2VH 2FHCA 4WHCA 4KY1L 5C6TL 2ZOKB 5D7LB 2EH7H 3CFCH 5EUOF 5I18L 5FIEA 2GTWB 5ID1B 3PABA 3PGCA 1GC1L 4OM0H 4WHTA 4XX1E 1YJDH 2XN9E 1HSBB 1YPZE 4UB0H 5TE6L 4N5ED 5DEFA 1N64H 3QZWB 1QBMH 1TNMA 4WGVB 4OFPA 4WY7H 1VEPA 2NLJA 4IRSC 4CN1A 4X5LA 2VXQH 1BOYA 3RRQA 2QTEA 1IEBB 3U9UA 2Q86B 3BIAX 4K8RH 1FNGB 5HXMA 3SKJL 4YHNA 1CR9L 1PLGL 1AE6H 1GGUA 2VQ1B 1IKNA 3RNQA 2PYED 4JANB 4QTHA 2R56H 1FNSL 1XIWB 2D7PA 2ZCHH 3ARPA 4ZD3L 2EDXA 2FD6L 4CL7A 2DLTA 4LFHD 3N1MC 3L9RA 4P99A 4XCCH 3W9EB 1KGCD 1BJMA 2HT3C 1GOHA 4Y4HA 4GG6F 4XP6H 3CC5A 2DYPD 1YEKL 4ZFOB 4WNQB 1OPGH 2WBJC 4PJBF 1PDKA 5KVEH 5IMKB 4H1LB 5I0DA 3HC3L 4MXQC 2DS4A 3ARED 2W38A 4FS0A 5CCKH 1AO7D 4E42B 1BHGA 1SYVA 3UO1H 1U3YA 5E08H 4OFIA 4NDMB 2NYYC 3O4LE 3W82A 3HR5B 5I2IB 4JFHD 2VYRE 3LOWA 4L1DA 4M7JL 4MJIB 1ZLSH 1Q1JH 5C07A 1EO8L 2RJMA 1NH6A 3HZKB 2HT2D 1QEWB 2KL6A 5IKCA 5IFAL 4NNXB 1MQ8A 4N1HB 3WNPA 2FZ3A 5K9QG 3ECBB 3EGSA 2FWOB 1X7QA 4L29B 1QFWH 2O5ZH 5HYIA 3MLVL 3P9WB 5EULV 5C6PB 1FZOB 3MLWH 2R2CA 4RRPG 5D7LA 3BQUB 1BX2B 5ID1A 3MLPA 1G7MB 2J7LA 1XGRB 2BY1A 4IDLA 1DVFC 4HIEB 4EBQH 4ZFOL 1JPFA 3BKYL 4P2OB 4JHWL 4M7LT 3U7WL 1HSBA 4FQXA 5I1AB 1V05A 4WTZA 2NY6C 1BBJB 4DJMA 4PJCF 1A6ZB 4XMPH 3DX9A 2D3VA 5TFSH 5D9SB 4A2MA 3A6BH 2XKNB 1WFUA 5KSAD 1D5XB 1XCTB 1MCBA 4Q7DA 4U7SA 1MPAL 4MX7B 1T0PB 1S3KL 1I8LA 1P4IL 4H25A 4UQ2B 3W0WE 4W68A 3IDGB 4U6YA 3MRBB 3UYPA 4HFUH 4MA8L 1G9NH 4JREB 5GRJL 2KZWA 2FJFB 3MRDB 2R4SH 2ZG3A 4R4BA 1VFUA 3RWIB 4L8DB 1DBJL 3HZYA 4ZUWB 1BIIA 4MB3A 6CGTA 4Y19D 1AXSA 4FXLA 3ZKSD 4AH2B 5LGHH 3QULA 1R3JA 4WNQA 5I8KL 1H3XA 4CJ0A 1FCGA 3C60D 4M6AA 3UBXB 3ARGB 1A3RL 1QHOA 1F6FB 1WEJH 2PO6D 1MFDH 5IMKA 5SWSE 4ONOA 4PGCB 4HWEL 4H5SB 1LE9A 3R1GH 5E95B 5C0AE 3MCKB 2XV6B 3RKDC 5FB8B 3OF6A 1ZA3B 3C08L 4PRPB 1E6JL 4MJIA 4WTWA 2A74B 3RX5A 3HZKA 4KJQD 5F7WC 3RX8A 5D71L 1XAUA 1QEWA 3SDXB 5HYJE 3IXTA 1A2YA 4D0CB 2UZIL 3KHOA 4R7NB 4CDGC 1UM5L 4BUGA 4NC1C 5D7IE 3MXVH 5I8CB 4OGXH 3QUXC 1MNUH 3T09A 1HHGB 3G6JB 1FZOA 3D18A 1GIGH 3D48R 3BQUA 3D9AH 1BX2A 3BMVA 1U95B 2X4OA 3HAEG 1G7MA 3BZEA 3GBLA 1DBKL 5CIPH 4DEPC 3Q6FA 4HIEA 5C8JB 1CGWA 4YFLF 4DOHB 4X99B 4AQ1B 3QNXA 2BVPA 4KHXH 4Z7NE 4U1GC 1FGNH 4LSPL 3EYOA 1BBJA 4J3TA 5AWNH 4NNYB 5HHOE 5HVHB 1A6ZA 4N0FA 4NKIL 5H2BB 4EOWL 2VDKH 5D9SA 1DJSA 5E24E 1D5XA 1XCTA 5T5FH 5GGTA 2GY7B 3C5ZC 2QR0A 1ACZA 5JIKA 1X44A 1EMTH 3IDGA 3O8XC 3ULVC 3CVHB 2ITDB 2FJFA 1KOAA 1ZHLB 2E6PA 3MRDA 2ZP0T 1A7OL 2RAMA 1PX4A 4L8DA 4K23L 1ZEAL 3HAEH 4Y1AE 4F7EA 1U93B 3DPBA 2AQ1A 1FAKT 1B0WA 2I27N 3RU8H 1OSPH 5T1LD 3MLUL 2F19L 4AH2A 4X7SL 1UEMA 2NW2A 5B4MC 1T6VN 2FECI 1EEQA 3ARGA 1FN4B 1URLA 5JXEC 3UX9B 5MEQB 4O02L 1CIUA 4J7RA 4FZEL 4PGCA 1X5XA 2EDJA 4MB5A 4RISL 2Z31D 1JWSB 3ZKMC 4YR6A 1KC5H 4H26B 3MCKA 2PN5A 4UAOC 3D2UB 4NYLB 3CLFH 1T1XA 3V4UH 1ZV5A 1KPRB 1EAPB 2BNQE 4Z7QF 2FX7L 1YYLL 5DR5L 5E4IA 3SDXA 2DQFB 3HUJE 1KCRH 1LDSA 3WXWH 3C6LD 4X9BA 4D0CA 4YGVA 3P2TA 1MCPL 1LEKB 1I9EA 1TTUA 5F1NB 4ZUVB 3SDDB 1YMHB 2P5EA 3I84A 4OLUH 5E6IC 1QRND 3CPLB 1HHGA 3G6JA 4R7DB 4M3JA 2BNUB 1EO5A 1S7UA 3D3VE 5IMLB 4PLJC 1U95A 4YUEL 4KRPB 1UYWL 2X4RB 1NCDH 3FT2A 1FVCA 5D6DC 3MRCB 1D6EB 1IC7H 2CO6B 1YEEL 4X99A 1M7IA 1IARB 3SKNB 4HUWA 4K3JH 3KJ4B 4KKCD 5F7NC 4NNYA 1DUZA 4X6CF 5H2BA 4A6YH 4ZO6A 3T1WA 1PD6A 4CKVX 3SGEI 4NM8L 3BPNB 1UXSB 2C1PB 4PD4J 3HMWH 3QNYA 3AM8A 3ARFC 1T03H 3PWVA 5DUBA 4TTGA 1QR1B 5ACMA 2YC1B 3CVHA 5I1HH 1BIHA 3PXJA 4I3RH 1MREL 3LH2H 1ZHLA 4P23D 1DDHB 3MFGB 1FL6B 1VFBB 1L4IA 4Z7VA 4K7PX 1U8PA 3BRGC 1U93A 3OGCB 1G7JB 4GRWE 3BIKB 3ILQC 4LHQB 1Q72L 1FO0H 4L4TB 1KENL 2OQJA 5E4EB 4I9WD 3V5KB 2E8ZA 1UA6H 2OI9C 4Z7OE 1OARH 1IZJA 1MCJA 1GOFA 3MUGB 4OFYD 5C0NC 5MEQA 2BXZA 1A7PH 2VWEE 4X6EB 2UWEB 2OK0L 4RGOH 3C9NB 1KCUH 5FO8A 1YY9D 3DTXA 5HDQL 2DMBA 4NYLA 4FFYH 4GAGH 5C0BB 4Q97A 5I9QC 4XNUL 3FKUS 4PJ5B 2CDGB 1J10A 1KPRA 2HFTA 1EAPA 2R0KL 4Z7UF 3BP6B 3O3EA 1BJ8A 3WJJA 5L88H 1IKNC 1F4WL 3BJLA 1F90H 3CMGA 1RV6X 2V2TA 3VFWB 3GIZH 1GVIA 3AXLB 3V0WL 1EA9C 3JSSA 3SQBA 1RZJC 1LEKA 4MQXD 2P5WE 5IESH 1JPGB 1FDLL 3GJFH 4D9RD 4WHDA 5F1NA 4Y4HC 3SDDA 1YMHA 2OR7A 3ULUC 1IC5H 1GC1C 2AK1L 4R7DA 4ZFGL 2Z8WC 5E8NA 4Q9QH 1MWAL 3RVUC 1FE8L 1JP5A 5F9AC 2EXWC 2HTLD 2X4RA 2XOTA 1PAMA 2G5RA 1BFOB 4LFHG 2HRLA 2P46B 1D6EA 5B39A 4JJHA 5KSBB 1N5YH 8CGTA 1X4ZA 3SKNA 1UXWA 3K2MC 3U1SH 1HCVA 3TWCH 2H1PH 4ZG1A 4GBXC 4PJDE 4TOYH 1I1FB 5DSCB 4N90D 4PJGE 1UM6H 4L5FL 3CFJB 3WNNA 1BJ1J 2VLRE 2P8LB 1BAFL 5HI3D 2C1PA 5I1DB 4C59B 3OHXB 3QO1B 4F9LA 4ONHB 1HH6A 5F89B 4JJ5A 1NDGB 1QR1A 1I3RB 1NGXB 2AXGB 2YC1A 1UVQA 2W07A 5E5UB 1FH5H 3TH2T 5F1IA 2G60H 1T22B 43C9B 3KPOA 4DUVA 1DDHA 2Y6SC 2P45B 1NCNA 1UT9A 3E3QE 4HX1B 3OGCA 4APQB 1CL7L 2V5RA 1NQBA 3ZHKA 5EOCJ 2CK0H 2DBLL 2P7TB 1HKLL 4R3SA 4U7MA 5F9OH 3GSVA 4FQXC 2OR8A 1I3VA 3MA9L 4LLUB 2MJWA 5F7KC 4WENB 3VFVA 4X6EA 1EGJL 1RZKH 1A6UL 4HJ0D 5JQ6H 1IAIH 1CDHA 5ALBH 5C0BA 4YBQD 5JNYB 1YNKL 4L8SA 2QADB 5ERWA 5DQJB 4PJ5A 4GSDH 4LIQE 3BP6A 4KK5C 2A77H 4QHUB 1DBML 1IAKB 3U48A 3BN9C 1LO4H 4JPVL 4OCNC 3D39E 1SYSB 5GS0D 3MRLA 3D0LA 3VFWA 1WAAE 3AXLA 2R69H 4P46A 1JPGA 3OAYK 4IS6B 5K59F 4KQ4L 4EI6B 4HH8A 1YYML 1GYAA 3FJTA 1KEML 4OCXL 1ZLUH 5IFHL 2EKSA 3SE8L 1JGEB 3OKEA 4I8DA 3BISA 1LP9F 4Y7MA 3UTOA 1WZMA 4KGJA 1CLZL 4RA3A 5J1TC 5KSBA 3WHE0 4QY8B 5DQDH 5FOBB 1UCBL 5ADPL 2YOCA 3FOMA 4YAQB 1B4JL 4LSVL 2AJXL 1KCVH 4JPKL 3T77B 1T20B 4PLKD 1A7BA 4ZO9A 4OM1L 4DKFH 1SEQH 5CILH 1ES0A 5DSCA 2WQ8A 3O4LB 1EFQA 3MTRA 3HNVH 4MXVE 5FF6B 1OAQH 2P8LA 5FA4B 4PRIE 5GJTL 4J3WA 3OHXA 5EZIH 1AR1D 2QSQA 4ONHA 2NXZD 4JY4B 5A40E 5I8EB 4G7YL 1I3RA 1KB9J 2AXGA 2E7LA 4XXDA 2BJML 3WFDL 1T22A 2OL3H 5GXBB 1CDBA 5T3ZH 3IAPA 1CDUA 1MCOL 2DQIL 4YDJB 1A9EB 2ZCKL 3GMRA 4OGAD 1R5IB 3BQUC 4HX1A 3S36H 4GW1A 1CU4L 4I0KA 1C5CL 2OCFD 2MOVA 2A2QT 5DHVH 4GAYB 4P2OC 2IG2L 1T7ZA 2ATKA 3L3OB 4LCIL 4LLUA 4JPIB 4EXPX 3OKOB 2XN9A 5FYKE 1YPZA 4ERSL 5HVWA 1HIMH 4HGMA 1UFUA 4J4PD 3MLYL 4HPYL 2YMXH 4MCYB 2R0ZH 1UZ8A 3VMOA 5E2TH 5JNYA 4QWWC 1VDGA 5DQJA 3WFHB 3F58H 1VGEH 4LHUB 4LRIA 4ONFL 1IAKA 1IGFL 3LSOB 4JREC 2B1HH 3VI4F 4JGJA 3CX2A 2FBOJ 1FL5B 3JVGA 4J6RL 4XNYL 1OW0A 5EOQH 4HIIB 2X4UB 1XR9B 1KB5H 3ZLQC 2VIRB 5KZCB 4KKAC 4PJHF 1CZ8H 4P4KB 4WFED 2P24B 2P8PA 1A3LH 1OTUD 4IS6A 2A83B 4L8BB 2J2ZA 4UUJB 3DXAD 4MVBC 3MV7E 2K3TA 2KDGA 5IIEA 1CICB 2P44B 4LAJH 3LKPB 3ARGC 3H9HB 5IHLB 4QY8A 4UV7H 2Q20A 5FOBA 1JI1A 1JNLL 5SWSB 1FFQA 4P5TD 1TPXB 2EZ0C 4YAQA 3DROB 5FYLL 2NXYB 5C0AB 3T77A 3WIHL 4HWBH 4X4YB 1ZWIB 3O4LA 2DQEL 1QSEE 5FA4A 3N1QC 4O2CB 2VLKD 5HD8C 1ZVSA 3O6FA 3VWJA 1RUQL 5I8EA 4EXKA 4UINH 3HI6H 3QA3A 5EBMA 5I0ZA 1RIVH 4C56E 1QYGL 5I1IH 1YEIH 3B9EA 4D9LH 3EYQC 3G6DL 4XC1H 4AL8L 3NIDF 4AIXA 2C3VB 2IBBA 5D7IB 4NUGH 4YDJA 2VUOA 1IM3B 1A21A 1A9EA 4WCYL 1R5IA 3GJEB 3NIGE 4M1DL 5D1XD 3VW3H 3NN8B 5HYSA 4TQEH 2NZ9D 2IGFH 2HFEA 4OF8A 1XGPA 1T5XB 4FP8L 4GAYA 4DQOL 5IT2L 3VXUD 1U41A 4P2YA 2CSPA 3L3OA 2X1OA 4JPIA 5T5NF 3OKOA 1CE1L 2X9YA 1DLHA 5HVHC 1OWRM 2ADGB 4S0SD 5CEZE 2PW1B 3ULUF 2E9BA 5I76B 3VFPA 1TZIB 2Q8BH 4KUCD 3TBVA 4WIQA 4OF5A 3AM8C 3MGTB 4OCWL 4GMTH 4LHUA 1BFVL 2VISB 2AGJH 3QCUH 1DP0A 2QJDA 2HMID 1NAML 2QHLA 3W0WA 1L9MA 3BYTA 4HC1L 1YQVH 3Q6GH 3FFCD 3CH1B 3FQTA 2X4UA 2APXA 4G6KH 4LCUB 5EO0B 1OP5K 2P24A 2J8OA 2ZPKL 4YBLB 2XACC 4PB0H 4LCWB 5JHDE 3PHQB 4PJ7E 4QTIL 5E6YA 3UZEA 1CICA 1C12B 3LKPA 2D9CA 4YHLL 4OIAA 1ZS8B 3FQRB 3H9HA 4HK3N 3QDGE 4V1DE 5D70H 4Y4FA 5IVOA 5CLWA 2ICEA 2XKUA 4OLWH 3VH8G 4QNPF 4PPTA 3HI5L 5DVMA 3TVMD 4K94L 2I9TB 5SWSA 4I4WA 4KU1A 3DROA 1JGLH 4XVUD 5C0AA 5IB2A 1HYRC 4IBLT 5LGJB 1U8OB 3Q0HA 5I74B 3WUWG 4M6ML 5E1HB 4F37F 2X1QA 1IAOB 4X4YA 1ZWIA 3WJJC 4NZTH 3B9KA 5FA3B 2BNQB 3HB3D 1J1OL 5GRVK 3S96B 2V6HA 3ARDD 2WIIB 5HYJA 1RZ8B 4S1DD 5HHXH 4YC2B 2MPAL 3HUJB 3GO1L 1XGTA 3SDDC 2I9LB 4QHNA 4JFDB 5D7IA 4LLWA 1V3KA 4KMTL 3GBML 3MBXL 3V52L 1DQTA 1IGIH 3GJEA 4KRPC 4HXBL 2H3NB 2I60H 4MSWB 2NY1B 3D3VB 4PRHB 1UZ6F 4C83B 4F3FB 2VKWA 1WTGT 5I8OL 1CF8H 2JKXA 5C09E 4D0BB 5JXAL 3KJ4C 4XVTH 4XNQA 1CWVA 3WFCL 3BW9A 4YXKH 3REVB 2ADGA 5F44A 1TJGH 1N6UA 4LPUA 2PW1A 2ED7A 5E70A 5HHOA 4XNXH 1CFQB 5IEKA 3BPNC 2HTKD 4LLQA 5A2KH 1INDH 5EOTB 4TRPL 4F9LC 3CFBB 4KI5F 3VFOA 1BM3H 5DFVD 3MLZH 2X4NB 5LVEA 3MROB 2VISA 5HI5D 5SWZB 2BOBA 4JB9L 4POUB 3KYOA 1RULH 1O7SA 5BOPA 1VKXB 1IGCL 5C08E 4LCUA 5TPWL 1XF3A 2ICES 3BGFB 2XIDA 4F7CB 2XRAL 4Y1AA 5I1EL 5ID0A 4NRXA 1WFTA 4H88L 2NY7L 4JO2L 2FGWH 4O4YH 4FABH 3VA2C 3P4NA 5C0RH 5E4EC 4GRWB 1CLCA 5IVZA 3F7VB 3FQRA 5BS0B 1NCAL 3KJ6L 3EFDH 5AZ2H 3QH3A 3FZUD 4ORGB 3JTSA 4XHJC 1V3LA 1RQ5A 4DKEL 2I9TA 1I1AD 3BD4A 5JPNB 1HDMB 2DD8H 4JHAL 5IR1B 2MSPA 4L8SC 5F9JB 3O6LH 1U8OA 5HGHB 3TYGL 5AYQA 2JJSA 4U6TA 1KJ2H 2HT4D 4JDVB 1TMCB 2WBWB 3UTTE 2BNQA 3VDAA 4DZ8A 1CT8B 3QIUD 3S96A 2FATL 5GQBA 5IF0B 2BY2A 2WIIA 3R06B 1JNNL 3SDYL 5KANI 5I30H 4P46C 3HUJA 1NL0L 1C5DB 4N0CC 3F5WB 4BFIB 2I9LA 4TVPH 4ODVL 2BXYA 1XF5B 2EDQA 3TBTB 1AP2B 3CXHK 3GI9H 4Z5RB 2H3NA 3CSBA 1N59A 3WE6B 4MSWA 5F9WB 1XGUB 3D3VA 4MD0A 1AD9B 2AJSL 4X98B 4F3FA 4Q6IA 1RUPL 1E0OB 1VFOA 3QG7L 4PP2B 2UUDK 1PSKL 4R96B 5GIRB 1EVUA 2H2SD 3CDGB 4LGSB 2RCSH 4KI1A 1AGDB 5KVDH 1AKJD 2J5LB 4X5XA 2XG5A 4QHKJ 4XNMB 1DQQB 1UM4L 2RHEA 3V7MA 4N0YH 4L9LB 3U4BL 1MCHA 1QR4A 4Y2OA 3OWEA 5HPOA 4P3CH 1CQKA 2EIBA 5DWUH 2R1XB 1AGFA 2HH0L 5GPRA 1KN4L 1RZ7H 4PJDB 5EOTA 1OAKL 2V5TA 3CFBA 3EZ8A 3KXFE 5F8RC 2E7LC 1K2DB 2FLBT 3IDMB 4M7ZB 4N8VB 3BKCH 1KN2H 2NY4B 3VI3E 3WN5B 3T2NH 1U8IB 4XP5H 1VKXA 1GHFL 2AXJA 4FG6D 1P4LA 3MRHB 4F7CA 3NIFF 1K9TA 2UVFA 1KTDB 4UZGA 1QO3A 1XEDA 5D7JD 1PZ5A 3OKYA 1Z2KA 5IQ9B 3DX8B 4BSWB 3ZSSA 1KIUA 2W60A 3MMEA 1EEUA 3F7VA 2ZUXA 1QFUH 3A6CL 3TEUA 4H8WH 3PHOB 3WJLA 3VFGH 4ORGA 3RL1B 3D87B 4JVUA 1HYSC 2DQCL 4E41E 2Y9RT 2A9NL 1A14H 5JPNA 4NZRL 5FO9B 4K9EH 5F9JA 1QFOA 2QADC 3PUCA 2F8OA 5HGHA 2FHFA 5GISH 4LRIC 1ZOXA 4JDVA 3RWHA 1SVZA 4MXWL 5DRZB 2H9GA 3HC0B 4JDZB 1OW0C 3R06A 2JCCF 1LWRA 3AS1A 3AS2A 5DJ6B 3L3HB 5J8OA 1MF2H 2JJWA 3IDNB 3D39B 4DAGL 3GKWL 4XT1C 4S1SH 5E2UL 4WO4B 4BFIA 4HG4J 3CK0L 3S88L 2P5WA 4IEFB 3O0RL 4ODXB 3KDMB 2IF7A 1PJ9A 2VLJB 2C1OB 5ELIA 7FABL 1XF5A 1NKOA 2ESVE 4I0PA 1AP2A 3TBTA 2K1MA 3J8F7 1NBYA 4N8CL 4Z5RA 2FH6A 3WE6A 1MFNA 1K3IA 1XGUA 4RX4A 5FKPB 3SDCD 4X98A 1BVZA 4R96A 1EPFA 4Z7VF 2DLEA 3S97C 1AGDA 2H32B 3ROOB 1U8MB 4XNMA 1DQQA 5BO1L 4LHJB 5E2JA 3UTQA 4L9LA 3HI1A 3I3DA 5DT1L 3DO7B 3ZYOA 1N3NB 4PJDA 4G6FD 4PJGA 5GRWA 2L4OA 3VWJC 2VLRA 2YK1L 4WUKH 3WFZA 1K2DA 1H8OA 3MLRH 3P9LB 3IDMA 4N8VA 4HUKB 3HRZB 4Q9RH 1BGXH 1XGQA 3BDYH 5CGYD 2E6JA 1IBGL 2CJUH 1U8IA 2CIKB 2G75B 3TA3D 3AB0B 2JK5B 3RA7L 4ELMF 5DEGB 5DD5L 2EDFA 2VDMH 4P2RE 2APBA 3DECA 4Z0XB 1QKZH 3QCVH 4NO3B 5IQ9A 5AYUH 4YDKH 4KZDH 3OZ9L 1EUTA 3DX8A 2CR6A 2L0DA 2YXMA 3IETB 3O3DB 4TSAL 3H8NA 1OQOA 4TSCH 4Y0GA 4UDTA 3PHOA 1OCWL 3RL1A 3JV4B 1VCAA 3BIBX 2WWMC 4KJPD 1GRWA 3ZE2F 5TQ2H 4KV5E 3QHFL 3GHBH 1U6AL 2ADIB 3BT2H 1SBSL 4RAUB 2X1WL 3REWB 4DVRH 1QFWI 1T7YA 2F54D 3U46B 1CFTB 5CP3H 1LK3H 2N56A 4EQ2A 1ZMYA 3TO2A 2DJ4A 1K8DB 1IGTA 2WUBL 5E03A 2FJHB 3THMH 3CLEH 4ZFFA 4TSBH 2XNAB 2YN3A 5BMFL 3OG4B 5DRZA 2BFVH 3RVVC 5D7SH 4JDZA 3FCTB 5DJ6A 1INEL 3L3HA 4ZDHB 3D39A 2DL2A 4Q9BA 1J8HD 1L0YA 4P4KC 1IGYB 1UH3A 3WSQH 5HHVL 1WAAA 2YA2A 1LHZA 1X9QA 3LPFA 4WO4A 2YBRB 4ODXA 5I18H 1P4BL 1PBYA 3EOYG 2C1OA 1CICC 2CK2A 4EN3B 2UY6A 3INUL 3IKKA 1VA9A 3MV7B 1W72H 3OAUH 3VJ6B 5K9QI 4CDHA 3Q2CA 5TE6H 5T3XE 2XY2A 3BAEL 2Z8RA 4PJFF 5IB1B 2XTLA 1WBZB 2ZSVA 2H32A 2V7NA 3ROOA 1NUNB 1U8MA 2B2XL 2PUQT 1U0QA 4FQHB 4D3CL 4CADB 4YGAB 4HKJB 2OTUB 5J12B 2IAND 4RMSA 4PJ8D 3UJIL 3SKJH 1CR9H 1X5ZA 4NFCA 4EI5B 4PRIA 3T0XA 3UXFA 3HHRB 3HKFA 1UB5B 1J05A 4ZD3H 1G7IA 5E0QA 4NQDD 4C56B 3KS0H 5IBLD 1OB1B 4PYGA 2G75A 3IS1X 3CCHB 4BA8A 2JK5A 4HIHB 5DJ0B 1GGYA 1YEKH 2R2HB 4Z0XA 5CD5C 1MQKL 4YHYC 4G6JH 4UILL 5T1MA 2P49B 3T08A 5CZXC 4QHMB 35C8L 4WEBH 3STZB 4JRXD 3IETA 4OJFH 5HYQB 3RHWK 2MFNA 5I1JL 3VXPB 5DRXA 3VWKB 1JNJA 2GITB 4KK8C 4XH2A 2E9WA 4BZ1L 4FRWA 3MRRB 1H3TA 4XPBL 2AJVL 2ADIA 3U46A 5AAWA 1CFTA 1BD2A 4XWGL 1OAZL 4FNLL 4M43L 1K8DA 2X4SB 2IFGA 2NR6C 5CP7A 1BF8A 1T1WB 5J13C 2YZ8A 4ODWA 4FTVE 1MIMH 4U6VL 5HDOA 5GS1A 15C8H 4OQTL 6FABH 3WHXB 2CR3A 3WCYA 1HINL 1PY4A 4YBLC 5ICZA 3MLVH 1AGCB 1F2QA 4M03A 1SM3L 3G08B 4EN3A 4PJ7B 3NACH 1MI5E 1BQLL 5MP6L 1FVDA 3N85L 2QQQA 3MV7A 2HFFB 3VJ6A 5JR1L 4HMDA 3QB7C 3X3FH 3QUYD 3U7WH 1MFEH 3BUTA 1S9KC 5MHSD 2F15A 1BOGB 3KPTA 3QDGB 3QUMH 4L4VB 4S2SA 5AUMB 1H3VA 1WBZA 3VXSE 3VXRD 3M8OH 1G7PA 5HHMD 1CBVH 4KVCH 4OLXH 5KJRH 5I1CH 1J1PL 3NPSB 4GKNA 4FQ1L 4JR9L 4FQHA 1QQDB 5I74C 4BH7B 3TESA 3HZVA 1C08A 2JJSC 3PWUB 2FEEL 3P77B 2CRIA 1P4IH 3S37X 4MAUH 3VFRB 1T66C 3NFNA 5EU6A 3OXSB 4M62L 1QSEA 5D1ZB 4EI5A 4YC2C 3RJQB 2NY5C 1YPZF 2CXKA 3HFML 4KFZC 1I75A 4P2QE 2BVTA 4C56A 5C0CD 3RZCB 2Z92A 5FDWB 4S1QH 5DJ0A 4XNZB 2NY1C 4LLDA 1OTSD 2FX8L 4Q6IC 5D72L 1A3RH 4DVBA 5A3ID 5HYQA 1N6QH 5IM7A 5ITBL 2AEPL 3S3JA 3QFJD 1CN4A 4X8XA 5C09B 2J8UE 3AFLA 1IM9D 4HWEH 3VWKA 2GJ6E 4HUUB 4TULL 1M6OB 3OJDB 1Q0YH 2IH1B 3C08H 3DETC 4B41A 1HILB 1RZIB 3ZYJA 1X5AA 3EYSL 2X4SA 1U8KB 2FYYB 5L8JB 1MCKA 2Y5TB 1G6RL 4O9HL 4KROB 3B5GA 4XMLL 2F74B 3V0VA 1ADQH 3K4DA 4KPHL 3U7YH 3TM6A 1UM5H 2HP4A 3X14A 5BVJA 5I1KH 3BGFC 4IRSD 4LPTA 5IB3A 4ZTPL 3IDUA 1H3PL 2D0FA 2WUCL 4WFFD 2VAAB 5JHDA 4PRAA 3G08A 4PJ7A 1W2KT 2FR4B 3L5XL 1DBKH 4FA8A 3M07A 3LRSB 5L2KD 3B3IB 4RDQG 3WJLC 1TJHL 1RZFH 4F8TA 1T21B 2M26A 1BOGA 3QDGA 4V1DA 4LSPH 5F6IC 1PG7L 1J5OL 1EH9A 2HFGL 2VWEC 4PJEE 3S4SB 4QT5A 4NC2B 2HT3D 4DGYL 4HGKC 1QQDA 4BH7A 1QVOB 5J0BA 2VKXA 3PWUA 3P77A 2YEZB 4NWUL 2XG4A 1VPOH 5FDYA 3VFRA 5E8EB 5D93B 1MRCL 2ZUYA 5D1ZA 4ZODA 4Y2DD 3UTTB 1OY3B 4MXQD 5DS8B 1LO0H 4Z78B 4X5WA 1A7OH 1QBLL 4K23H 1IEHA 1KFAH 3DV4B 3V4PH 1LEIA 2IALB 4QYOB 5FDWA 5CJ5A 3LD8B 1I9JH 4I0PC 3SQOH 3UPRB 3QIBA 4BQ9A 5F9WC 3KYKH 4LPYA 5EU3B 5IW3A 1RVFH 4O02H 4U3CA 4FZEH 3AGVA 5C09A 4RISH 2J5LC 3NABL 1IL1B 4MAYD 4HUUA 4L9LC 2CLVB 2IH1A 2YD2A 1J7VR 4O58L 1H9VA 1TJIL 2YWYA 2FX7H 1YYLH 2VITB 5F21B 1DVFD 3JV6A 4YE4L 4M7ZC 2F74A 3F8UB 3KXFB 3ME0A 3IB4A 2NY4C 1CD8A 3MV8E 3JZ7A 3NCCB 4BZ2L 2NY2B 4F37K 4XVSL 4PJAE 1Z9MA 2JIXD 1FORL 2JLLA 1S5IL 2VXSH 3U30C 5C08A 4DN3L 1JV5B 3H42H 5CUSH 5CWSB 3E3QC 5L9DL 3SGJA 2VAAA 4OZFA 4L9DA 2AJUL 1CI5A 4QRPB 3QXAB 4JRYD 1FFOB 2YPLE 1KGCE 4B5EA 3B3IA 1YEEH 4AENB 5T33H 3OXRA 1H8NA 3F7PC 5M94B 5JOPE 1ZANH 3GMMB 3GRWL 3I6GB 3S4SA 3BO8B 4JG0H 1IGJA 3G04B 1FG9C 1KXTB 2V17L 3G5VB 2QSCL 3IDYB 2EIZA 4XPAL 2A6DA 2Y5EA 4KAQL 2J6EL 1AXTL 2YEZA 2MWCA 3L6FB 4U1KA 2A6KB 4LLAA 5DUML 2PR4H 2HWZL 4DW2L 3KPMB 3UTTA 3P11H 1MREH 5DS8A 1XGYL 5B38B 5CJ8A 4WO4C 3RKDD 3DV4A 4PIRF 5J1AB 4I3SL 4HUMB 2EIEA 3X11B 1MFBL 1T1YB 1BWMA 1WUNT 1U8JB 3H0TB 1QACA 4N8PA 5LXGL 2R2BB 3RDTB 3AAZB 3C2AH 5FM4A 1Q72H 5KBNC 2ESVB 2X5PA 3QSKB 5EU3A 5LG1A 1AD0B 1NUGA 2ARJB 2XTJE 4PJ9D 4M6OH 5ADOL 4L3ED 2AK4E 3O2VL 1F97A 2EH7L 1IL1A 2OBGA 3CFCL 3QUXD 3NMEA 1NEZG 5HDQH 1XF1A 1Q38A 4Y5YB 2CLVA 2AW2A 3H9SD 1JMXA 4JRWA 4OM0L 2BDNH 1MY5A 4S10A 4XNUH 1CYGA 1MJUH 3HG1E 4JKPL 1YJDL 3BESR 3MNVB 4G8GD 2VITA 1UCTA 4R97B 3S9DB 1CD1A 1QBML 1OP5H 3FB7A 3AMLA 5IFJB 4WY7L 4PV8A 3KXFA 4X0KB 4G3YL 3LAFA 2VXQL 2YD6A 4Z0BH 3ARRA 3B6SB 2EDNA 4K8RL 4XCNB 5CKAA 5J4MA 1I9IL 3MRKB 5FYJE 2MTPA 5CWSA 5T3ZE 1MWAH 4OF6A 4K3DL 4OGYH 4POZC 2FIKA 5EBWB 3WDJA 3FT3A 3QXAA 4PGDB 1FFOA 1OAXL 4XCCL 1FRGH 2W9EL 3VG0H 4XP6L 4RWYH 5IHUL 1UEYA 3I6GA 3NCJH 3BO8A 4E41A 1NMAL 2VABA 4HWNA 2EDYA 3G04A 3KPSD 5HGDB 4HCRH 2HJKA 4L5FH 3ROLA 4FQ2H 5B4MD 1KCSH 3S8WA 1HEZB 4HEME 2QKIA 3MRGA 4LVNB 1B2WL 2A6KA 5GS1C 4QRRE 3KPMA 3ZYZA 4G9DB 5B38A 4QXTA 3O81A 1MCWW 1ZLSL 2B0SH 3NBNA 2XKSA 5J1AA 5J56B 4NGHH 3CIQA 3ILPA 1U36A 1F2XK 3IAGC 4BQBA 3X11A 3ZL4L 1T1YA 1ZSDA 3RI5F 4EN3C 5ISZD 2R1YB 3H0TA 4YEEA 2VR9A 3AAZA 1OHQA 1HKLH 2ESVA 4BK4A 1VADB 4WEUD 4HS8H 1QFWL 2O5ZL 3MA9H 4JFEB 4PP1C 3S6CA 3HE6A 1BZ7A 4FQPA 5FGCB 1D5IL 3MLWL 3BUYB 4X4ME 4KGLA 1A6UH 4RQQB 5E6ID 5CSBA 1JFQL 4WW2B 5J12C 3O3AA 4MA1B 4PLJD 4EBQL 4NFBA 4RFOL 5CZVL 3MNVA 3QR2A 2VUYA 4ORZC 5EUKB 4EI5C 4JPVH 3IFLL 4P57B 3QDMB 5IFJA 4NQCD 4GUPB 5C6WH 3BZDA 3RVTC 4Z7OF 5TFSL 3L1OL 3WLBB 1SJVA 4MB4A 3A6BL 1NGPH 4R2GB 5DJYB 3B6SA 4JVPA 5CEYB 5DQ9B 1U91B 4XCNA 4G8EB 4KQ4H 4NKOB 5LQBH 2NPLX 4HFUL 1KEMH 5IFHH 2KQMA 2VLME 3SE8H 5JW5A 4P2RA 3ARFD 5EBWA 3QUZB 4PGDA 1CLZH 1FL3B 1JUFA 3VWKC 1JRHI 1D3CA 3OJ2C 3ARUA 4HV8B 1FJ1B 3VXNB 5LGHL 1P7HL 4GW5B 5HGDA 3ILQD 3M1BB 1OGAE 2BMKB 1V3MA 1WEJL 5GJTH 3STLB 1KNOB 5HDBF 1HEZA 2BK8A 5DMKA 1WF5A 3OPZH 4Y4KA 4YDLB 3BZFB 3ZKQD 2F58H 4J8RB 1LO5B 3H3BC 4OD2B 4JY5H 1ZGLA 4JFPB 3SE3A 1F3DH 5EZJA 4M8VA 2CO7B 4WU5A 5MENE 2DRUA 2UUDH 4PJGF 1C5CH 2R1YA 5I16A 1IAMA 2DJUA 5FM8A 5INCB 3HAEB 1MI5B 2FEDD 2IG2H 3SGDH 1HHKB 3RPIA 4U2ZA 2AXFB 1G84A 2HJFB 4LCIH 1QRNE 4OGXL 3EW3B 4ERSH 1S7WA 1HN1A 2OSLB 3IGAA 3BUYA 1V7ML 5ILTL 1P7QB 3D9AL 3NPSC 4HPYH 1T5WB 4Y4HD 3ULUD 4RQQA 2VSCA 3VXSB 2IH3B 1VACA 1AH1A 4OCSL 4LQ1A 2RR3A 12E8L 4MZ2A 4F58H 2EXWD 4GH7B 1I7RB 5EBLB 4KHXL 1KTLB 4NKMA 1HWGB 4ONFH 1FGNL 4FMFA 1IGFH 5D1ZC 1U8QB 5AWNL 2OR9H 3ISWA 3L3GB 4GAFB 4J6RH 1WZKA 1NPUA 3WLBA 2VDKL 3Q3GA 4WV1B 3TN0B 3FAXA 2WAHA 1AGBB 5CEYA 5DQ9A 5C07D 4G8EA 1RIUH 1EMTL 1Y0LB 2YR3A 4XBPB 4XNZC 4XGZB 5IMMB 1A5FL 1FG2A 5DFTA 3EYVB 1N8ZB 3ARQA 2VDNH 3QUZA 2ZNWA 3ZDYE 3TJHC 4X6DF 3QWOB 3AROA 1FIGL 1MIEH 1I7ZB 1TVDA 5CSZB 1M4KA 1Z5LB 4HMEA 2Y6SD 2DQDH 1IMHC 4I77L 1P2CB 4HKBB 3RU8L 3MCG1 1OSPL 2J8UB 4L4JA 1UH2A 4ZUTB 1FJ1A 2C3WA 5D7LD 3TO4B 3MA7B 3WIHH 1K4DB 3H7BA 4Z8FH 4QRUB 5DZLA 4X7FC 3PQYB 2OZ4A 1J87A 3M1BA 2DQEH 4WU7B 2BMKA 1YC8A 3LS5H 2BHUA 3STLA 4MNHA 4KROC 1T04A 2VZ3A 4FQXD 4A6YB 4K3EH 3GI8H 1KC5L 1U3JA 4HZLB 2DM7A 3VXOB 4FTVA 4OD2A 4CN4A 3P9MB 3BEVB 2ZG2A 4JFPA 3V4UL 4AL8H 4F7MB 1LEGB 5I1LB 3VRLE 2EDWA 4NRZB 4NQEE 1AIFB 3O9WA 4WCYH 3SGJC 1REIA 5F70A 1I4FA 1LE5B 2X40A 3QDAA 4U0QB 3MNWB 5IW6A 4KK5D 4ZS6C 3MRPA 5INCA 4PRNB 1TLKA 3U0TB 1MI5A 1R3HB 2AXFA 2CRZA 1CE1H 2EEBA 1FO0B 1F6LL 3QPQC 4NWTL 1T5WA 2DWDB 3DX6B 3GSNH 3VXSA 3QI9B 1NBVH 3RWDA 3MR9B 1JGVL 5DVOA 4MA7H 1IC7L 1G6VK 1ZLVK 2IFFH 1I7RA 1KTLA 1BFVH 4K3JL 1NAMH 3LEXB 2NX5E 3DIFA 1GGBL 4HC1H 5ACLA 3L3GA 1K5NB 4A6YL 3OQ3B 3OF6D 4WV1A 3TN0A 5IWLC 1KJ3H 2VZSA 4P2QA 1I8IB 3QCTH 1AGBA 4MJID 3TT3H 3BP4B 3GBNH 1Y0LA 4QTIH 3O3UN 4XBPA 4BH8A 4XGZA 2R39A 1NC4A 3O2DH 3BH8B 2QQKH 3EYUH 5I1HL 4TVPE 5GGUA 4I3RL 3P40A 3GJFB 4NC1E 3T3PE 4YHLH 3EYVA 3BZ4B 1N8ZA 2Y7QA 3SOBH 3WNOA 4DGIH 3IFPA 2CLRB 2O26U 1TZHB 3BEWB 2ITCB 3QWOA 4GJTB 3TNNA 1I7ZA 3K0WA 2X4PB 5CSZA 5AEAA 5DK2B 1FZMA 4N1EA 1G0YR 1I1RA 3DVNB 4F9PA 3FT4B 1CDIA 1ORSB 1P2CA 3HZMB 1ZA6B 3CZFB 5D7KE 4UT9H 2GJ6A 3TO4A 3BQUD 3EDEA 1FO0L 1K4DA 1HNFA 3VFMB 1Z9SA 4G80A 1A7PL 3D1MC 1J1OH 5CAYB 1EFXA 2NQCA 2MPAH 4HZLA 3HMXH 4FFYL 1QSFE 4GAGL 1UB6A 3O3BB 3MV8B 4N1CA 5EIQA 1LEGA 5D5ME 4GMSH 4NRZA 4KMTH 3MLTB 3GBMH 5L88L 3ULVE 3V52H 3ULSB 1LE5A 1F90L 4XRCB 2IADA 5K9KB 2PYEB 2ZUTA 4PRNA 3GIZL 5DI8B 3U0TA 5I8OH 2AP2A 2UY7A 5CHNA 5GGQH 1R3HA 2YPLB 2NTFB 1IC5L 2VR4A 2MCG1 43CAB 4Q9QL 4EUPB 1YJDC 3TZVD 2DWDA 4PJEA 3IDYC 5DA4A 2AJZB 1VESA 4MVBD 3MR9A 5C7XH 2X4TB 2ENYA 4KHTL 1N5YL 2EYTA 3ARGD 5ANMB 2I24N 4OZIE 1AFVL 5IK3B 3AREB 3LEXA 4HG4K 1YN7A 3K4ZA 4OF7A 1R24B 1AO7B 4JB9H 1HWHB 3WO4B 4O51B 2JJUA 3EO0B 2H1PL 1CLYL 4K8RC 3RVXC 5DJ2B 2EZ0D 1TVBB 2J88L 4RMRA 5D2LE 5IV2B 3QQ9C 1UM6L 2ID5A 3VD4A 2A0LC 4RGNE 4XB7A 1I8IA 2FRGP 3U9PL 5I1EH 5I6XB 4YFEA 3BP4A 2WWKT 4O2EB 2NY7H 2FO1A 4JO2H 4JZOB 1RZGB 4LF3B 4EZMA 3L7EA 4ZUUA 4RIRA 5IVNA 4I13B 3BH8A 1GGTA 5HD8D 2G60L 3GEWB 1P6AB 1TQCB 1NCAH 3KJ6H 1H3WM 3FO0L 2ITCA 4P3DB 1P1ZB 2XTJB 4FOMA 5FUOH 3EYQD 4DKEH 2P5ED 2AK4B 3FT4A 1ORSA 1U92A 1YEDB 3EDJA 4Y5YC 4JHAH 3CZFA 5GGSA 1CGTA 4ZNCD 4M3KB 4JFFE 2CK0L 1B0RB 1H15A 4I18B 4ONGL 3TYGH 4JHBA 4M1GH 3RWGA 3VFMA 3LHPL 3SO3B 5C0DB 1RUKL 1OQXA 1FNEB 5L7XL 2UV3A 1IAIL 4WI4A 2JB5L 4JQIH 5KSAB 5F3HB 1QFHA 2EYSB 3MV8A 4WFHE 4GSDL 4ZXBA 1R3LA 4HIXH 3GKZA 4GAJL 5GZOC 3VXME 4PJAA 4EDXB 4CRPA 1LO4L 5E2VH 4X6FB 2OL3B 1MCSA 1EHLH 3DWTA 2E27H 2GSGA 2CLZB 5DRNB 2YPLA 4QHLB 3DXAE 4RFEA 1WIPA 5DHVB 1NFIB 3IDIB 3OB8A 5FXCH 1JWMB 4EUPA 3U4BH 1QLFB 2LU7A 2LFGA 1K8IB 1HCFX 1NGYB 2F5AH 4LCYA 2BRQA 4TYUA 4LAQH 2HH0H 4MMZC 4ACPA 4E5XA 2ZUSA 2PO6B 4LVNC 3IJYB 5HBBA 5DQDL 2FIRT 3M45A 4Y4KC 5IK3A 3AREA 1S7RB 3U6RB 3GMNA 4O51A 3EO0A 3ZTJG 4QRRB 1FYTE 4JQXA 1TVBA 4FZ8L 4HH9B 5CILL 5IV2A 1G9NC 4J3XA 1OAQL 3ARWA 5E5MB 2YRPA 3WV0A 1BQUA 1LQSR 4JE4B 5A16A 1RZGA 4LF3A 4X4XB 1F4HA 1U8LB 2BSSA 3OR6A 3V95A 3RBGA 2OL3L 2VC2L 2A38A 3MV9D 4G6AC 3BP5A 1YY8A 4MWFB 1F8TL 3S36L 2DQCH 3WL9A 1ZAGA 2AK4A 5JW4Q 3LPWA 4LK4A 3NH7L 2HLAA 4PJIE 4WW2C 3H6JA 4MA1C 3VXUE 4Z7WE 2YRZA 4I18A 3VDCA 1YDPB 4UTBL 3ZT6A 3ZE0F 1F3JB 5T5NG 3ZTJH 2F53D 4MXWH 3HG1A 4MS8C 4V2CB 5C0DA 2LVEA 1FNEA 2YMXL 5KS9B 3JTTB 2R0ZL 5E2TL 4DAGH 4OI9A 1HOCB 4R2GC 3BPOB 1E6OH 4O5LL 5F3HA 5KSAA 3RUGF 3OKDB 1Z9OA 4LLYA 2P8MA 5FUCE 3S88H 3CK0H 1BWWA 2ZCLL 4YPJA 4MDIB 3EHBD 2DKSA 2N7BA 4KQ3L 4X6FA 4GRLB 4N8CH 3QUZC 5EOQL 1KB5L 5GSVB 3W39B 5DRNA 4WJ5A 4ZYKA 4QHLA 3DVGA 5M7QA 2BOCB 5JW4M 5L8LB 5DHVA 5T1LB 5BO1H 3IDIA 1XF4B 2WANA 3QRGH 2DIAA 4OQ1A 1MRFL 1QLFA 5F7EH 3G5ZA 3JWOH 3I6KB 1M7DB 1K8IA 3IRPX 3ULUH 2RB8A 2MCPL 4E0RA 1PVHA 2Q87A 5GGVH 3GUTA 1DCLA 3SE4A 1OGAB 2Z31B 1A4KB 3BSZL 4XHJD 3QJFA 3U6RA 4PGEB 1SJEA 3DO3A 4QRRA 4JO3H 4WDIB 4YFDB 2DTML 1L6XA 4F33B 5C0BD 2BSTB 3O9WC 3DOSA 3RA7H 4PJ5D 3QDJE 4LKCB 3RWEB 3BOVA 1JZ7A 4RGMC 5MENB 5GS3A 3F6LA 3HI6L 1RIVL 3LDBB 4TSAH 5I1IL 3NCYP 4L3CA 4XC1L 1DQMH 2D7MA 4P46D 1CFVL 2DAVA 3TCLB 3JWDC 1L0QA 4G6MH 1QRNB 3FO9A 4KTYA 3VW3L 5J6HB 3QHFH 4RNRA 4TQEL 3WD5L 2IGFL 1CDCA 4X4MA 2CIIA 3MO1A 4K7FB 3DJ9A 2X1PA 1E27B 4HWZB 1F3JA 1FLRH 3H2WA 3MZTA 4LDOB 2B1AH 4WWKA 1K4CA 3VU2A 3KLSA 4MDJB 2QHRH 1A9BB 4HWBA 1GPOL 5J9PB 2M1KA 2GUOB 4WV1C 5DYOB 3WMSA 3TN0C 4E9LA 1IC4H 1HOCA 1BBDL 5HHVH 3TBSB 3SHSA 2Q8BL 5DDHA 4MDIA 4WI2A 1P4BH 4GMTL 5DEZA 2AGJL 2XQBL 3QCUL 3UZVB 5ITFB 5KVFH 4RFNB 4GRLA 1YQVL 4UDUA 3INUH 3Q6GL 4ZFZB 4P23B 3DRTB 3NCEB 2ZUUA 4HIJB 2H45A 5GSVA 2X70B 4P5KB 3VGGA 4F9PC 3VH8B 4PB0L 1MHEB 2ATPB 4PBXA 2BOCA 3TO4C 1R3KA 4D3CH 1MFCH 3OGOE 3MCLH 2EE6A 2KKQA 5D70L 3RFZC 3WUWB 2HVKB 3UJIH 4ODBD 4OLWL 3I85A 1JN6B 5D8JH 1KPVA 3VDBA 1NCBH 1OGAA 5IEHB 3UYOD 1SJHB 2I07A 2XN9D 3OAZK 4MMXC 1DZBA 1A4KA 4PGEA 4KJYB 1HYSD 3QHZL 1KJMB 4OZHF 4Q58C 1B0GB 2Q3ZA 4UOW0 4KKLC 4F33A 1H5BA 4EVNB 2BSTA 4YQXH 1P7KA 1A64A 2QADD 4P49A 1M1SA 2APVA 5CBAB 1TTGA 5AG8A 5MENA 4UILH 4HKZB 4M61B 5AD0B 3GSRB 2IC2A 1NFKA 4G9FE 4CU7A 3ZHLA 1HSAB 5I1JH 3QXDB 1CD0A 2CXGA 5DO2D 1QRNA 5J3HC 4HW6A 2OMBA 1IGIL 4OZGF 2AVGA 4BZ1H 5I19H 4XPBH 4Z77A 2I60L 2J1KA 3S5LG 3G6AA 1KEGL 1HZHL 3DSNA 1NLDH 2GEEA 2WBJA 4ELKB 1CF8L 4LGRB 3LZFH 4HWZA 3O11B 5BQ7A 5DA0B 4XVTL 3IDXL 3S3SA 4YXKL 5IVXF 4PRPE 1A9BA 1TJGL 4OQTH 3UPAA 2NW3B 4G42A 5DYOA 4XNXL 1KJ2B 3PDDA 3K3QA 5C0EA 1YEJH 4TUJA 3UBXI 1HINH 1GGCL 2CKBA 4S1RH 2QSTA 1INDL 4KUCF 2WZPD 5C0GB 3QAZB 1EUUA