1CDBA

Structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
105
structure length
105
Chain Sequence
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the glycosylated adhesion domain of human T lymphocyte glycoprotein CD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags T lymphocyte adhesion glycoprotein
molecule keywords CD2
total genus 10
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1993-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdbA00
4Z0BH 5T3ZL 4UILH 2PXYC 1FQ9C 1MPAL 4F8TA 5I71C 5HI5D 1I7TB 3OGCB 2HRPL 5HHOB 4PGEB 2B1AL 4JRYB 2E9WA 1TLKA 2BVQB 1U3ZA 3SDDB 2NXYC 1DQJB 5KW9H 3VWKA 3UTSB 1FC1A 5E2TH 5JORB 4GAGL 4X6CB 4D0BB 2JIXA 5FA4B 4M7ZC 3T0EA 3MA7B 3EFFB 1OTUD 5DQ9B 2DTMH 3OAUL 2OMBA 4PB9L 3K4ZA 4X4YA 5D7IE 4EXPX 3JV6B 2MCPH 4Y2OA 2VABB 5C08E 1XFPA 3FO0H 4G7VL 3OQ3B 5HI4D 1NL0L 5JOPD 1QLRB 1K3ZA 3O6LL 3PJSA 4JY6A 1AY1L 2C7UA 3RY6C 1JF1A 4R3SB 4KQ4H 4PRID 5K9OA 3RY6A 2Y7QB 5KSVB 1QSEE 1J88A 3GIZL 3HAEG 3QEQA 4OF3A 4Y5YB 4GKNB 4PRDA 1Z0NA 4ODUA 1OAUH 1F3JB 4KRPD 1GGBL 1C16A 3OKNB 5JPMA 3V6FB 5T1MA 3LPFA 2DIAA 3VXUA 3PV7A 1NLDH 2J4WH 2BJML 5D2NE 2VLLA 1M05A 3CSPA 5F7NC 2X4QB 3WFCH 5DQDH 5HI4C 5JDSA 4WTWA 5F21B 3TNMA 4EQ2A 1N6QL 1FIGL 1UWEL 2IH1B 5HGBB 3V8CA 3C2SA 1XR9A 4NKMB 4AH2A 3C9NB 1ZHNA 4DGIH 1G6RA 4P5TD 3JV5A 4YQXH 1ORQA 4ZNEA 4DEPC 1BZ9A 3KPOA 3H9SE 1I8MA 4NZUL 1NGZA 5ADPH 3T4AA 1UJ3A 3VXUE 5DT1H 2F54D 1UZ6F 4ELMF 1NAMB 1OB1B 5IB3B 3F8UB 2XI9A 2LU3A 1HSAA 4QT5A 5CEZE 4H25A 5JZ7D 4HUVA 3RVWC 3WLWC 5TQ2H 2P5EA 4XVTL 2V9QA 3RGVD 2HFTA 5KSUA 3M07A 1N6VA 1AQKL 2R9HD 5D1XA 5D2NC 3MRMB 3VXTA 3QH3B 1BOGA 1EEYB 1CIDA 3PQYB 4I77L 1GGIH 2EDKA 1N3NB 1E6OL 5JHDE 1MFBH 1NCDH 5ACLA 3PQYE 2HKFH 1DN2A 2F19H 4D8PA 3FT3B 4LAJH 3ARXA 3P4OA 4X4ME 4ZOEA 1BFOA 4O58H 2XWJA 3GSUA 4OCWH 4RFEB 4DFHA 2E9BA 1H3VA 2V2TA 2BCKA 3IT8D 4XC1H 1N7MH 4IHOA 4PJHF 5D7SH 2QR0A 1T1ZB 2I9TA 3QDGA 4BH8B 4MA3B 4PTTA 4TN9A 2Z8VC 1WISA 4POZD 2XYCA 3GRWA 1FFNA 3QXUA 3WNOA 2P43B 1GL4B 3QBTB 5HHME 5C09E 1QYGH 1EGJA 1S9VB 1XGUB 4UU9A 4WV1C 5DK2A 5DJAA 4WV1A 1W0WA 2YK1H 4DKAA 4QRSA 2ARJQ 4J3SA 4OZ4B 1J8HE 1G0DA 1A3QA 4M7KH 4LIQL 5K9QI 4X7DC 4J6RH 3RAJH 2X4RB 5IMKA 3QXAA 4MXVF 4P9HL 1FZKB 5IBUG 1OD9A 1P7KB 1B6UA 5IB2A 5BMFH 3ARDA 3ZKMD 4BZ2H 2E27H 1CFBA 4KFZC 4LLAA 4E41D 5JOEA 4MHHG 3UTSA 3QIBA 3W39B 5CEZL 4W4OC 4EDXB 3MV7D 3FFCE 3SGEI 1BREA 1T21B 3CFJB 4GBXD 1NFDE 3KYNB 3L7FA 1A1NB 5LVEA 3DYPA 5DJ6A 1KIPA 2PR4L 3GHEH 1VDGA 1OP5K 3RTQD 4K71B 4PR5B 4WFHD 3V6ZA 3TP4A 3VW3H 1PAMA 1U91B 3LQZB 5FYLL 3V4VH 1YY8B 1NJ9B 4GG6B 1CTNA 4KPHH 4JPIB 1IGJB 4G8IB 1DLFH 3SOBH 4LSQL 1MJJA 3VFSA 3D85D 1H3PL 3MFFB 3ZSSA 4KDWA 1E6JL 5C70A 4H26B 4EVNB 2VZ3A 3INUH 1T22B 4NC1C 4R0LC 3UO1L 3VFPB 5FO8A 2NLJB 4LDEB 3AS2A 2DQEL 3MV7B 3QIWC 2W91A 4J8RA 15C8H 3G08B 1IC7H 1IC5H 1J12A 4OKVA 3QULA 1MFDH 5GIRB 3A67H 5E99H 4D9RD 1RU9L 4I0PC 5A2JH 3I6GB 1RIUH 3GI9L 3T4YA 4JHAL 5SX4H 1CZ8H 2AJYL 4GAJH 2HKHL 2BVOB 4PJ7A 5IW3A 4BQBA 4PJIF 5ENWB 3IAQA 5C8JA 4Y4FB 5MEQB 3PWVB 3S3SA 5C0AE 3IU3B 1GIGH 1ZWIA 3FQUA 3OAZH 3UC0L 3VH8G 4L4TE 3S3JA 2P45B 1OOAA 1XGTB 1FL6A 1NAKL 2QKIB 3KPRE 5FOBB 4ZUVB 5DC4B 1J05B 3M8OL 4YHML 1J10A 3SY0B 1DQQA 4NFDA 4UDUB 2D31A 2KKQA 5F6HJ 3BSZL 3QIWB 4KKAC 3SDYL 1TTFA 1R3KB 3VE0A 5GISL 1RIVL 1F00I 1JGVL 1AR1D 2J8UE 3BVNB 5D1ZA 2PO6B 1OP9A 4FMKA 2BSSB 3HMWH 1QNZH 4JPKL 4PGZA 3ZDXE 1YEJL 4MB3A 3T2NL 2ZSWB 3T0VA 2ZP0T 2A6JB 3CH8A 2JB5H 4UDTA 3VFRB 3H2WA 4NWUH 3NBNA 4MNHB 4OKDA 4FN0A 1GH7A 1C08A 4YAQA 4PJIB 2HJKA 3K7UA 1S7UB 3K2MC 1Q0XL 1K6QH 2ORBH 5E9DA 1PG7L 3RHWF 1CFNA 5CZKA 5CUSL 4Z7QE 1LVEA 5IW1A 4I1NB 3UROR 4Q0XL 2H32H 3IYLW 3O6KL 4P46B 1E28B 2WLZA 1EO8H 2B39A 1AR1C 1CGTA 2O5XH 2DL2A 4XPBL 3BFOA 1S7QB 4Q2ZA 4YNYA 4G6MH 2EEAA 5CMAA 3EFDL 1J0ZA 2I5YH 4FTVD 4XVSH 2VXUH 5L2JA 1XIWA 1SMOA 4F15B 4WI5A 4YIQA 4KZDH 3VA2C 2VABA 5BOPA 4X7SH 1K2DA 1VFMA 3C5SA 5CEZD 5FUOL 1DZBA 5EU3A 4FXKB 4F9LC 5J8OA 1G1CA 5C07D 2C1PB 3IRPX 3P4NB 4S1SL 3W5NA 4B0MM 2K9UA 5F9WB 3QUMA 3CZFB 3HMXA 1B88A 4PY7A 4M8QA 1EFXA 3TGXA 1U9KA 1ZGLA 4KRMB 3KPNA 3W11C 1FFPB 1X5FA 3DNKA 1QLFB 4HMEA 1U3HD 4HEPG 3O4OB 4XCNA 1PZ5A 3QNZA 4KJPC 4MDJB 2FYYA 4ZS7L 3ARDB 2DQCH 3WXVL 4ONGH 2A9NH 1INDL 3VRLF 3WNPA 2GJ6E 5FOJA 1E4WL 1A2YB 3WXWL 2IH1A 1YQVH 3SKNB 4O51B 5E99L 1LEKB 1WITA 3MGTB 1YN7B 4PJEA 3W11D 5DURB 4FMFA 3VMPA 3MBXH 3QEGH 4PR5A 1JNNH 4XP5H 1WGOA 3V6ZB 5IEKB 4NSKA 2DQIH 5D7JC 4Z8FH 1FNEB 1QKZH 2A2QT 2XACC 1UZ6E 4RMRA 1MFNA 5T5NF 3V4PH 5L2KA 4Y1AB 1P6FA 3ILQC 1P9MC 1E4JA 2G9HB 4UOW1 2YD1A 1ACYH 4WUUA 3ZHLA 4QTIL 3QPXH 2C4FT 3BP5B 4WI7A 5EOTA 3VXOA 4H26A 4EVNA 3UYRL 3D85B 4OF8A 1BD2A 5DC0A 3G5ZA 1CIUA 4Z7OF 5MENE 1VB9A 3QUZD 1MI5D 4LQFH 1RIVH 4OCSL 1KJ2H 4QXTB 2VLMD 1MCQA 3VCLB 3MLZH 1SYVA 2VLME 1I1AA 4JJHA 3P4LA 5SWSD 3EUUA 4O4YL 2YD4A 4L8SA 3TH3T 1BM3L 1A0QH 3K8MA 3DRTB 5F9JA 3OKLB 4UOW0 3WKNA 4MJ6B 3NZHL 1PZUB 4MA8L 3N85H 3TN0D 2BXYA 3L3OA 4X80H 4KVNH 4RFOH 1CE6A 1R3IL 2DTSA 2FGZA 2HWZH 4I8DA 5EO0A 2YUVA 1HZHH 4KI5D 1H8NA 1MCRA 3F65A 4MZ3A 2AV7A 3KPRB 3MC0A 4DN4L 2YS4A 1AD0B 1VESA 2YPLD 3PWUA 1UYWH 3IKKA 4OZHF 3DXAE 1QFHA 1WC7B 5IG7B 4LVOB 3BVNA 5I8EB 1KJ3L 5AWNL 1T7XA 2LV4A 2BFVL 4NNPL 1ZV5A 2K7PA 1JNHB 2GI7A 3ISWA 4HF5L 4AL8H 2V6HA 5GZOD 4YEEA 5D4QA 3LKRA 5DFVD 1AHWC 4U3CA 2HLAA 4MDIB 1KTLB 4I4WA 3QRGL 4XP1L 4NKOA 4PFEA 1IC5L 4RGNB 2ARWA 1CXKA 5C2BL 4M6NL 3MV8E 4PRHA 4QF1B 3OMZA 2BNRA 2A6DB 5I66A 1FORL 5K9QG 5E00A 3RVTC 1T21A 2DQDL 3IDNB 4JZJB 3I3DA 2DLFL 1OAZH 1LP9E 1EUUA 1MFBL 1BMGA 3NPSB 3IFLH 2EO1A 3RX7A 3HR6A 1RJYA 2DJSA 1IQWL 3CX5J 4P4KD 1PYWB 2FX8L 4N8CH 2VDML 3U0PA 3D0LB 4Z77A 5KVEL 3ULUH 4ORZC 2VDLL 5IB1B 3C8HA 4FFVC 5IMMA 3BUYB 3UZVB 4F7EA 3CPLB 4L8CA 5GS0L 1XAUA 3BPCA 2XKNB 3B4NA 3GI8L 2ADJB 4OD3H 2EDQA 4M1CD 5SWSE 2NW3B 1MHHA 3TCXA 3TIEB 1U95A 1FC2D 4PG2C 1F4YH 2RHEA 1A6VH 1B0GA 5CD3A 5DDHB 3R8BB 5C0IA 3LMJL 2X70A 4NHCL 4FQJH 2AJSL 2GITA 1MREL 5IT2L 2ILLA 3OXSB 5CSZA 3OXRB 3NOIA 4BQ6A 2BHZA 3GUTA 2AQ2A 5IB4B 4DAGL 2FRGP 4JANA 4MQTB 2BRQA 3SDCC 1NBZA 1G7QB 3LKPB 5C0AB 1R24A 1U93B 4JN1L 2XN9D 4DKEL 1FNEA 4D9LH 1QR1A 1IEBA 3VXSE 1HKLH 2AK1L 2IGFH 1HNFA 3CIQA 3O6FA 4X98A 3KR3H 4UDUA 4IOFD 1I4FB 2G60H 5F9AC 3MA9L 3HE6C 4NO5A 3O2VH 1DJSA 1VADA 3QDMA 3PGFH 4TUOA 3WJJA 4A6YH 3BKCH 1SEBA 3SDDD 1G7MB 1T03L 1I9EA 2XZCL 4QXWA 4ZPTB 1CBVH 1RFDL 1M7DB 2QSVA 3IDXL 5D7JB 4WW2F 1QA9A 3QDJB 3LKSA 1UB6B 1C08B 4U7KA 4Q6YA 1NPUA 1Y6MR 1I8KB 1XCQB 4KKBD 5D7KD 1ZHKB 3SDXB 3B5TA 3CSYA 3SKMB 3WNNA 3B8YA 4D3CH 5E2TL 3QCVL 2VXVL 4K7PH 3MCKA 1PQZA 3RVVC 3BE1L 1C1EH 5CLTA 3OKDB 5D6CA 4BYHA 2NY1D 4X4ZA 4EI5C 1DCLA 3OAZK 3QEUB 1A7OL 3WJLC 5CEXB 4R9HA 3QUKA 1OARH 4F37K 1I9RL 4XNXH 1RK0A 4U0QB 3UZEA 2AV1B 1I1AD 5K9OB 2R23B 2OZ4H 1WWCA 2XZZA 1FHGA 2DBLH 4NRXB 5C6WH 4EJ1C 2IAMD 3EOBA 1N59B 2DLFH 1D9KD 2N7BA 3ROLB 2VIRB 3O9WB 4LSVH 5C09D 3P4NA 1KIQB 1F3JA 2X4PA 4C59B 4HCRH 2P1YA 3ULUL 5FA3B 2X42A 4LEXH 3QUMB 4XPGL 4P59L 2OR8A 1K4CA 5HHOE 1FG2A 2RAMA 2B0SH 1Z0MA 5K59F 1QSFE 3GSOB 2FLBT 5FXCH 1QBLH 3WKMH 5IJKA 2BY0A 2Y07L 3BZFA 4WI2A 2WINA 3MRIB 5JPNA 5EBWA 2W0FB 3WFCL 1R3HA 5DMGD 4LHUG 1VSCA 4X7TB 4E41A 1BQHG 2HT3D 3LN5B 5BVPL 4HWBL 2Z31C 2ZOLA 4LEXL 4MYWB 4UT6L 4KUZH 4ODWA 2FIKB 4LLUA 4OM1L 5HPMB 4KGJA 2LTQC 1NAMA 1I3GH 3O3EB 1INQA 4X9FA 1U8QA 5D7LA 4WU7A 4L8DB 3T0BA 1KTKE 2OI9B 4Y2DB 2APTA 2WQ8A 4M1GL 5EZOH 5L2KB 4IRJB 5E8EB 4ZFGH 1U3JA 4XBGA 3QXWA 1F4YL 1K5NB 2YEZA 1N3NA 2YUXA 3DO7B 2R1YA 4PJ8B 3U9PL 3IAPA 4U1JA 5T1DL 1PY4A 3D3VA 1N0XH 3DUSA 3QG7L 5D71H 2N56A 3LEXA 4PJBE 2BNQA 5H8DA 1A4JB 3DIFA 3HCVA 4JKLA 4MNQD 5DS8B 2OL3H 1VPOL 4LHQB 4S1SH 1BJ8A 1KEML 3IU4H 4GKSB 5ICYA 4KH2A 1I8LA 2XNAB 5DTFA 2AJ3B 4YHLL 5D7IF 1OAKH 2DF3A 1FH5H 4GKOA 3MLXH 4HSQA 4J4PA 3PJSB 4JY6B 1FORH 3GSNA 2RB8A 4XNZC 4FXGA 4QRPE 3UYOD 3QUXC 4YR6B 3PE9A 1B2WH 2OJZL 5GGRY 5JIIA 1ZAGA 2NY5L 3AS3A 5E5RB 1CDJA 4G80A 5FYJD 2FZ3A 4XXCC 3OJMB 5MEOA 1QPXA 2PYFA 5EZLB 1BVZA 3MOBH 1M4KA 1GZPA 4NFCA 5F1KC 1YEJH 1RZJL 2X4QA 1BVLB 1QKZL 1U58B 4K3GA 3S35L 3VXPB 3QWOB 4C56E 5DMIH 4J4PC 1MCPL 5AYUH 2VXQH 4U2ZA 2UWEF 1JZ3A 3G6AB 1ZT4B 4Z5RA 3L5WB 3VFGL 1EDQA 1G9ML 1U8JB 4G43A 3RWIA 2CD0A 1CLZL 3FAXA 3KPQA 2W65A 5JA9A 1MVUB 4PY8I 5E00B 4LLVA 2C5DC 3FB8A 3GNML 2CDGA 5D93C 2D7OA 3TCLA 3TV3L 3RI5F 1IRAY 4XB8A 5E6ID 1YJDH 3F12A 4HUKB 4PREB 4RISH 3JV0A 4RAHA 2MOVA 2R23A 3X13B 3WEXB 4RWYL 2V7NB 1ZS8A 5EU6B 1S7TA 3ROLA 4JLRB 4ZTOL 4RAVB 3KPSD 3L5XH 3RX8A 5I75C 5C0EB 3PIQB 3O6KH 5D9SA 4QKXB 5HBBA 4Y0GA 5GRYA 3BPLC 1X5HA 3WE6B 2B2XL 3D18A 5A16B 2VUYA 1HHJA 1ZKAA 2HVJB 4CW1B 4O2EA 1J7VR 4LHJB 3HE7B 4JB9L 3D69A 1NSNH 1NSNL 3BHBB 1T1XA 4PJXA 4XH2B 1TFHA 1CQYA 1CDUA 1C5CL 1S7RB 4V1DE 3FOMA 5HJ3B 3ULVC 1M7IA 2WW8A 5EU7E 5AZ2L 1FBIH 2PYED 2GK2A 3MRPA 3LHPH 4NQDE 4WWKA 3BZEB 1XGTA 2RFXB 4OUUA 2WANA 4Z0XB 3BOVA 3QFJA 1FO0B 4NOFA 4OF0A 1DDHA 1NC4D 3U9UB 2VERN 2VZSA 4FQ1L 2A9NL 4LEOB 4CBPA 4ONGL 1ERNA 4OLXH 2X4UB 2BSSA 2WWMD 4IRZL 3OL2A 1TQBB 4XBGB 1H5BB 1PSKL 2ADGA 5DLMH 1TQBC 5EUKA 2CLVB 4N8VG 4TTDD 4Q58C 3L3DA 5AAWA 3J8F7 3VI3F 1PBYA 3QDMB 2R39A 2YA0A 1SY6A 1Q1JL 3P9LB 4ERSH 1K8DA 2NX5B 4M7ZB 4RMVA 1I1FA 1IGFL 5KOVC 2A74A 5DMIL 3VFTB 5EU7C 1MCPH 4W4OA 1JRHL 1Y18B 3L3IB 4N0UE 5EO9B 4YPJA 1DL7H 2YRPA 5H94A 3IJYB 3NIFE 2YPLE 2BNRD 1NFDF 2Y25A 4DK6A 4XMPL 2AKRA 5DYOA 1TVBA 2BSRB 3LS5H 5EU6E 2XICA 1K8IA 1MUJB 4PJDF 2BSTB 4V2BA 5D1XC 2I07A 2X1WL 3P4MA 4APQD 4OLUL 4MS8D 2I26N 1YYMH 4CU6A 3QI9D 3VXRA 5TE6H 2IPUK 3VGHA 2RCSH 4XCFL 5DD6A 3EIFA 1S7SA 2AV1A 5BZDA 1JNNL 5IBUB 5E56A 4S1RL 5JOFA 3CK0H 2J8UB 4KQ3H 3TBSB 1E27A 3KPNB 3H9SD 5FO9B 3BZ4A 5IFAH 1KIQA 2X4PB 3H42H 1AKJD 4KHTL 5EZLA 4U0RC 5E03A 1H3PH 1YC8A 2FBOJ 3MUZ1 3N1GC 3T77B 3U7YH 1HQ4B 1JE6A 3EYQD 3MV9D 1FDLH 5K59E 3TVMA 4P2RD 4KUCD 4X6FA 3SO3B 1U8MA 5C0NC 5JPNB 3I2CL 1P6AB 5J11C 1U8HA 5CGMA 3QHTC 3P73A 3S5LA 3MO1B 4I5BA 2MWCA 1H9VA 2YPKB 1JHLL 5MERA 3QUXD 1P4IL 3RZWA 2EH7L 5J13B 2CJUL 2FD6L 3OKOA 1CFTB 5DEGB 3QIUC 3MRNA 4Q9CA 1KBGH 4AEHH 4R7NB 3QQ4A 4X6DE 3OHXB 3CXHJ 5IW6B 2W9EH 3IETB 2J6EH 1IGMH 1WBYA 4KU1A 1XF2B 2OZ4A 3RTQC 2OI9C 1AIFA 2GTWB 3BGMB 4XRCB 2GJJA 2X05A 4EIZC 1MFDL 2VR4A 4WU5B 4MX7B 1CG9A 4U1MB 2HFEA 2NTFA 1A4KB 3O3UN 4P2YA 4UTAL 4YZFE 3V6OA 3SHSA 1FZJA 1QPPA 5KS9B 3QFJD 4KC3B 5I15H 1UH2A 4GMSH 4PJIA 1S7UA 1YUHA 1FYTA 3O4LE 3UO1H 4PRAB 4K9EH 4QCIB 3PWLA 4LSSH 3NFNA 3VWKC 4C55A 1JPFA 3UTQA 3MOBL 2EIDA 3W2DH 1RJCA 5CZXD 4OZIA 5AUMA 2JB5L 4PJXB 2G75A 4M02A 3U1SH 4DKFH 1EBPA 2I60H 4ETQB 3U82B 1SHMA 1IL1B 2APXA 1JWSB 2YD6A 4HKZA 4TRPL 3NAAH 3BEVA 4LSPL 5FYJH 3BSZH 3SDYH 3VWJD 1FJ1B 3O8XD 4HKBB 2CKBA 3D2UB 4HLZH 2DLEA 1YC7A 1K2DB 3P30H 5EU3B 1J18A 2YD2A 5IMLB 4PRNA 1DLHB 5KAQF 3GO1L 3E2HC 4Q9QH 4NKDB 4J1UA 2GJZB 5C86A 4F33A 5KG9B 3WIIL 5JIPA 5MEOB 1HIML 3LQAH 1N2RA 1D5XB 3L3DB 4JO4L 1ONQA 4Z18A 4NUGH 2EDXA 4N5UA 1T6VN 5D1QB 3V7AG 5F7YC 3VXRE 3PWPD 4OCXH 1H0DB 4YXLH 3CFEA 5SX5K 2J5LB 3MACH 4ZSOA 1EJOH 2Q3AA 4Y4HD 4FQQB 5LBSH 5EU4B 3IJYA 4ZO7A 2XWBB 4I0KA 3FT4A 3MBEC 1IAOA 1L7TL 2G5RA 4LRIA 2V5MA 4XCYB 3PGFL 4U6XA 4P23D 5HHMB 4CAGA 2YZ8A 3T04D 4QOKE 5I8OL 1DE4A 4ZPVA 2BHYA 5DUBA 4U6VL 1ODAA 2CK2A 1P9MA 3VMOA 4YHYB 3UX9B 2ADFL 3SE9L 1KN4H 5F3HB 3O3DA 3FOLB 5D1ZD 2ZUVA 4PP2A 4JFEB 1AO7A 1SJEA 3MRQA 1S7TB 2H8PB 2FWOA 3MZGB 1OSZB 4YDKH 5EORH 1IM9B 1P4LB 3MUHL 1GHFL 5L2KD 4G9FA 4QXTA 3WIFB 5EA0H 1FYTE 1IARB 4UIKH 1SEQH 3GJEB 1JHTA 4MNGE 4ZD3H 3GMLA 3CMOL 4I3GA 3FO0L 5JO5B 1KN2L 4KZEH 2VZOA 5HI3C 1JL8A 3C08L 1KYOJ 3OX8A 4GW5A 4P57B 4XBEL 1MPAH 4NWTL 1CVSC 3T8XB 4HHAA 5D8JL 4P5TB 3MGAA 1CGSL 2GIYA 4GOSA 5DEFA 5GGQL 1NDGA 2VXTL 2E7LC 5DA4A 3FB6A 4OLYL 1HIMH 1TJGH 5KVEH 1S5HA 3NFPB 5DRWB 3FO2B 4CMHB 2ZCLL 1DBAL 3JBG7 4KZEL 1H3GA 3L1OH 1AI1H 2BVYA 5LQBL 5LG1A 2HP4A 5B39A 1KLGA 1XR8B 1EFXD 2DMCA 4KDTC 1UCBL 3ARBD 4HUXB 3TO4C 1XF4B 1AGDB 4K94C 4DZ8B 1VADB 3UTOA 3GBMH 4JVWA 5D7JD 4MJID 4LHUD 4LCCB 4YHNB 2HVKA 1SBSL 2IALB 1R0AL 5J13C 3VXRD 3A6OA 4GS7C 5DO2D 4AM0A 5LKNA 1TJIL 5IIEA 3QDJA 4HJJH 1T3FB 5DD1H 4YK4C 3N1PC 4YDJA 3FTGB 4H8WL 3JWDL 1I7TA 3OGCA 1T7WA 1ZHKA 3SDXA 4S0TD 1NAML 1TCRA 5J1TC 5DMKB 4X9HA 3SDDA 2BVPB 3K74B 4C54A 3MODL 1ES0B 3DTXA 3D87B 1HHGA 4JRXE 1D5MA 4P2QD 4ETQA 3LMJH 4QHUA 1LP9F 2H1PL 4N5EC 2HTKD 2M2DA 3U0TA 1EJOL 5F96L 1A9BA 4FQCL 5EU5A 4G8GB 5I73C 4MB5A 2Q1EA 4NRXA 4M1DH 3W9EA 3SQOH 2VE6A 2L7UA 3FO1B 4LPWA 1C12A 3PNWB 3SBWA 3O8XB 4Z77B 2BRRL 3NFSL 3B2VL 3E8UH 1GCFA 5IV2B 1XGYL 4QRRD 5HGGS 1FFOA 3DGCR 3ARBA 3TBSA 3DOSA 3QEQB 4Y5YA 5KG9A 2AEQH 4YGAB 4UT9L 4HUUB 4HKXA 5ALCL 3MLYL 4KI5C 1IFHL 1X5JA 4PUBL 2IBZX 4Z9KB 4N5ED 5GS0C 4H0HB 1CFSA 3RVXC 5EBMA 3H9ZA 3VRJB 2ATPB 1QVOA 3RBSA 4CN6A 4RIRA 2VITA 1CK0L 2N1KA 5FGRA 4ZSOB 3PHOA 3VGBA 5I1LA 4FA8A 1U8MB 3IDXH 5AZEL 5HVFB 2VWEE 3ZYZA 3T0AA 4NNXA 3QG6B 3PWJB 1KB5A 1YPZA 1DR9A 3HG1E 3ULUE 3MMEB 1HDMA 4YGVB 5JHDB 3DI3B 2YPVH 3ULUD 1UADC 1JUFA 4GRMA 2QJDA 4HH8A 1EXUA 3UTZA 4L8BB 3NACL 3JUYA 2AEPH 3V7AE 3UPRA 35C8L 4YJZL 3BKJL 3V4PL 5J4MA 5BVJB 2XQBL 4L1DA 3AGVA 4R7NA 4BK4A 3FOLA 5E5MA 1KLUB 4PP2B 4AG4H 5HYSG 5TJWK 1QG3A 4I18B 4JCMA 5CLWA 4U31A 1KT2B 2O5YL 5IHLB 1SEBB 4NQDD 3K81A 2B5IC 4MX7A 6FABH 1EEZA 3MV9E 3RFZC 1CGUA 2YMXL 1T83C 1TZIA 2J12B 3GIVB 1QA9B 4J23A 1LGVA 2EIEA 4JHZA 1TDQA 3MV9A 4G7YL 1ZLVK 3D0VB 4MLSA 3GJEA 3GRWH 4TNVK 2Q7YA 12E8H 1XF1A 5C0RH 1RK1A 4U1GC 3KPSE 2ZZUT 1I7UA 3RUGE 5B38B 5FB8B 5JHLH 1MWAB 1MHPH 1N4XL 3L7EA 3FFCA 4UV7H 3ARGD 1NC2B 4G9FD 3MRFB 3D2UD 1W72B 4IHOB 4WFGD 3JVGC 1MLCB 3MNZA 3QEHA 5D6DC 2V5RA 4BH8A 4TPRH 3TVMC 3QNYA 3U30B 4R0LA 1HH9A 3HG1A 1OAYL 2AXGB 4R3SA 4LRNL 5EN2B 4ZTPL 3SDXF 3WJLA 4NHUA 1U8LB 4ZUUB 5IFHH 1S8DB 2QV2A 2ZUTA 4BK5A 3LDBB 3H9YA 4HJGB 3SDAB 4GT7A 4HK0B 2GTZB 5IKCA 2HH0L 5EIIA 2V17L 1V3LA 1MFCL 5FYJE 3BAEL 3BKJH 3DROA 4I3SH 4Y16A 2Q7NA 3B9KA 5IESL 1I9JL 5BRZE 1IEAB 5DI8A 3LAFA 4JB9H 4ODWB 4MVBC 3SKUD 3AAZA 1T89C 4PJ5D 3JTTB 1JGLL 4Y8AA 2DQCL 5IVNA 1HHKB 4DW2L 4ZG1A 5DXWA 3QJFA 4UUJA 3Q6FA 2DQTL 5F7EL 1BZ9B 3KPOB 4BFIB 3MXVL 4XPFH 4OGYL 4ERSL 1K3IA 4WY7H 5FIEA 4JFQA 3GMQB 4QRUB 1BJMA 1X5ZA 1T2JA 4XXDA 1FSKB 2VUOA 5IBTL 1DSFH 3EJZD 4RWYH 4YXHH 5FO7A 1LO4H 5F3BB 3L95B 4IDJL 3RGVB 3ARWA 4MHHI 3S35H 4XHQA 2P5EB 3AREA 4NDMB 1JPSH 1BZQK 1UB5A 4HT1L 2CLRB 4JZNA 2EE2A 4HMCA 3DVGA 1M6OB 5DJZB 4ZFFB 1PEWA 4OLXL 3OPZH 4QXUL 3DURB 3DV6A 5JXEC 4JZJC 2NXZC 2MHAB 2YA2A 1CFSB 2I5YL 2Q3ZA 4YDIL 1IGCH 2HAZA 5IVOA 2E3VA 4JN2A 1NGQL 4OF7A 3G5VB 5CFHA 1JPTL 5DUMH 4MCYB 1T7ZA 3BEWA 3STZB 4XNUH 2DQHL 5F96H 3JWOH 5HHQB 2AJ3A 3DX8B 3HRZA 4WWKB 3BZEA 3RWGA 1PG7H 1N5AB 5ENWA 1RJZB 4UQ2B 3K3QA 5I1GH 4GH7B 4G8GE 1CD1B 3K2UH 1QBML 1CWVA 4XGZB 1T5WB 2PW2A 5JW5B 2J8HA 3FB6B 5JXED 2R0WL 3LEVL 4EDWH 4KJQC 3V4UL 4QHMA 4ZOAA 1CFVH 5D2NA 4S1QH 2O5XL 1HYRC 4KK9C 4XPBH 5EFIA 5ALBH 4AEEA 1OTSD 2X4UA 2B2XH 1Q94A 5CJXA 4HXAH 5MEND 3QEQE 4M4RA 2PR4H 3VD4A 5I73B 1HQRB 2J8UF 3OAYK 5B39G 5DJDB 3RY5A 4EOWH 1KIUA 3HB3C 1KULA 2BVQA 1VFAA 2IF7A 2W60A 5E7FA 4FQXD 5B4MD 2A0LC 4FFYH 2UWEE 2FX9L 2VLJA 1CR9L 2Y6SC 3KPPA 3MR9A 3G6AA 4Z5RB 1AQDA 3ULUC 1PKQB 3CGTA 4EEEA 1MFEL 3FL7A 1MRDL 5E9DB 1WAAE 3MA7A 3S36H 2Y06L 2XZAH 4JFOB 1AO7E 4XMKH 5CP3H 1DQTA 3ZTNH 3QIBB 1WZ1H 5CSGA 5BS0D 1RU9H 2AS5M 1G9MC 3C5ZA 3SPVB 1XF5A 3F7QA 4OD2A 5DD6B 5I16B 5I8KH 1VEOA 4RRPG 5CILH 1WZMA 1X9QA 4NKIL 2EC9T 4FFZH 3UEZA 5HHMD 5FKAA 3MNWB 5DMGC 4GXUN 1J1PH 4APQC 4QTHA 5DFVC 5E0QA 1AKJB 3G5YA 2DIBA 1SYSA 4K9EC 4N90D 4X4XA 4N68A 4HV8B 2PTVA 4JFFD 1DVFC 1M7XA 5J0BA 3KJ6L 1OGAD 1KCSH 5CHNA 4F57H 3NCYP 4NQCD 2HN7B 3T09A 5TQ0L 4KHXL 5EDXA 3G08A 4P46C 5T3XL 2C1OA 3QT2A 4GRLB 1UEMA 4MDJA 4MQ7A 4UB0L 4M93B 1S7RA 3B6SB 3FO9B 2FX7L 3E6HA 3C5JB 4POYA 5CEZH 1I8MB 3HAEB 4I48B 4JE4B 3VG9C 4R97B 2X7LB 4PRHD 1KEMH 5FYLH 5GJSL 2JJSA 5BW7C 4M1CC 7FABH 5SV3A 5KSBB 4OCXL 4PJHA 3BJLA 2W9DH 4M5YH 3NABL 5MENA 3C6LC 3LKQA 2XN9E 3ZKXB 1RZ8B 3NABH 4P3CH 2WWKT 1B9ZA 5DK0B 3THMH 4J3OC 3TZVB 4ZDHB 1ZMYA 4DJMA 3WIIH 1Q0YL 1BQHA 4Y1AD 1BBJB 3MLPA 3EYUL 4DVRH 1G7HB 4G6KL 5EBGA 2NZIA 1A7NL 4P99A 1A6TA 1GGUA 2H26B 3LY6A 2Y9RT 3MBEB 4P5KA 2VTFA 4RQQA 1L7IL 2A74B 4MNHA 3VFTA 1A1OA 5HYEA 5A1AA 5TH2B 4ZUTB 3QXVA 3NIFF 3GHBH 3MYJB 2Q8AL 4UNUA 5DFTA 4M48L 1OTTD 1JWSA 2LU4A 3D25A 2GSGA 5IGXL 3RUGF 4WCYH 2YD5A 4NQXB 2R2HB 2I07B 3P4MB 4ORGA 5MHSD 5J11B 1ZHLB 5IQ7L 1CD1A 3VD3A 1D6EB 3V0WL 2Y7QA 3P0VL 4YWGH 5GGTL 2CK0L 2A6KA 2CIKA 3BRGC 3CFDA 4N0RA 3MJ7B 2R2BA 5TF1H 1DQML 4NC2B 5ICXA 5CILL 5IGXH 3GBLA 4RX4A 5D6DA 2VZVA 2MQ3A 4UNVA 4HDIB 3SDXE 4AENB 4XNQB 1FAIL 4FQLH 1U2CA 4IIQC 3MRHB 2CIIA 2VLLB 3ZO0A 1F97A 3X14A 1E4XH 4JO4H 5H37G 1NGXB 4LSRL 2ENYA 1JGEB 1A64A 4KVCL 3WUWG 4XBEH 3L1OL 5ACZA 1SVCP 5I76B 2ZNWA 3K0WA 3FCTA 3KLAA 2HRPH 2C4XA 4PG9A 5KANI 1D9KC 4PGCB 3TBVA 1D9KB 4IRSA 1XZ0B 4C57C 3OR7A 5GGQH 3VXQB 2DWDB 3GK8H 4GAYB 4K94H 1HXYA 3TH2T 2NXYD 1QBAA 5DRXB 5DUBB 4P3DA 3VJ6B 1L6XA 1P84J 3EOTL 2DQGL 3C5ZB 4MNQA 3SGKA 4QT5B 3UDWA 1EAPB 3QRFM 4LAQL 3B3IB 1RULH 2XQYG 2DM3A 5GJSH 3IETA 3KYMA 3F58L 3ILPA 2BOBA 1FVEA 1YNKL 1IM9D 1AO7B 1WLHA 3RWFB 3VFPA 2VKXA 9CGTA 4QTHB 4TUJA 4A2MA 1NUNB 4EUPG 1D5IL 2HFEB 2NTFB 3B2UD 1BOGB 1EEYA 2H32B 4YZFF 5JZ7C 1N64L 4K55A 3EJYD 2KH2B 1CF8H 3I6LE 4JRXD 3RJDA 8FABB 2FX7H 2MMXA 4UBDD 4HWZB 5ETUB 4CADB 2VZ1A 3EO1B 3MLUH 2AK1H 1KJVA 2IGFL 4KDVA 1M6OA 1REIA 2Z0BA 3D1MC 4X9BA 5JO5A 5KS9E 1CD0A 4JQXA 4ZFOA 4D8PB 1MHHB 4M6ML 5AUMB 4NFBA 3MV8B 1CT8B 4JFZH 1ITCA 1ORSB 3U4BH 4PS4L 4JFXA 3WXWH 3MYZA 5DQ9A 3IVKB 5E8PA 4DGVH 3VDBA 3VFWB 3EO9L 4NZTL 1DN0A 4KVNL 1ZVHA 3WHXB 2X1QA 2IBGA 5HDQL 1MIML 3KYAA 1EO5A 4JANB 1U0QA 5H37H 4HIEB 1ZVSB 1H5BC 3MLSH 1ULVA 2FH6A 4FG6C 5CBEA 3KPRD 4LCIL 4Q6IC 4BZYA 4XP4H 1TXKA 3BT2H 2XN9B 1C16B 4ZAKD 1QFPA 5IEHA 5JPMB 5IIEB 5KVMC 1BQLL 2EDTA 2X4RA 1ZT7A 3ARBC 3CLFL 5IMOA 3Q5OA 3TO4D 3DX9B 2FJFB 4UTBL 4R26H 5D1QA 4EBQL 2NTSP 3I3BA 1M71B 5CZVL 5JDSB 5EH1A 5ILTL 4RQQB 4NO0B 3GMOA 3RPIA 3B9KC 4LPYA 1HHIA 5F1NB 1WAAF 1INEL 5KVDL 2DDQL 4JFFE 4YFLI 3WUWB 4I3RL 1J1XH 1S78C 1RUAL 2HJLA 5I66B 4OI9A 2R2HA 2HLFD 4R4BA 5GZNC 5TE6L 5IB3A 2EEBA 4FRWA 4P4KB 4JFDA 5L9DL 5C0CD 3MFFA 3BN9D 3HPLA 4YDIH 4ODXB 4OD2B 5E2JA 4Y5VA 3GMNA 3E1F1 5ISZB 1CLYH 4PLOB 4OZGF 2OTWB 3MJGX 3QCTL 1UKSA 2DKUA 1RQ5A 3E2HB 2DQUL 3ARBB 3OR6A 3VWJC 5E08H 3O9WA 1UYWL 4URTB 4JDZB 2XFXA 4Y1AE 1U92A 3WDHA 4N0UB 5LGHL 1MCLA 1PY9A 3EYOA 5JNYB 3L5XL 3QNZB 3X11A 1XGRA 1CDYA 2VO5A 5GGSY 2E7HA 4HC1L 5I1HL 5CKAA 3LD8C 4NC0B 1P7QA 2WINB 1EGJH 3W0WA 4Y4FA 1AJ7H 1WFNA 5T3XD 3I75B 5I18L 5B3JF 3WN5C 3S36X 3QISA 1XGPA 2VH5L 4UILL 5IJKC 2R29H 3OR7B 4HUWB 1WEJH 5HPMA 3MQIA 4JFZL 4NKQB 2J1KA 3CVIH 1IT9H 1I3RA 3MRBB 1AGBB 1FFNB 5J6HB 4GBXC 5HTSA 5C0AA 4PGBB 3KG5A 4Q6IA 4ISVB 2JELL 3DYMA 4Y5XA 4QGYA 1FNLA 1RZ8A 3HKFA 4X7SL 3TH4T 1KSRA 5EULV 4F7PA 1IGYB 1CICD 1KIRB 4WHYH 1E4KC 1WBXB 3TT3L 5I1EL 1T20B 3LB6D 4AEIL 4PJ9B 2BMKB 4NO5B 3LCYA 3U0WL 3BMWA 4G5ZL 4KJYA 3D3VB 3DUSB 2Y5TA 5EOCL 5A2KH 3QA3B 2V17H 1ZANH 3BIKA 3BP7A 3MBEA 4NRYA 1RK1B 5DMYA 3Q5TA 5D7JA 4HKJB 3IJHA 3DRTA 5F9JB 3RJQB 3WN5B 4RAUB 1F90L 4S10A 4UINH 3H9SA 1OWRM 3FQRB 3ROOA 4OCYL 3ZYJA 1N8ZB 3STLA 3ZE2E 3JTSB 5I8CA 3QUYD 2P5WD 3C09C 3LRSB 3LS5L 3G6DL 1UXWB 5HI3D 2HJFA 4JPWL 1U91A 5TE4H 3LB6C 5FUZH 3S4SG 4XMPH 5D7LE 1B6DA 5FAAA 1RZFL 1CLZH 4MQXD 4N9OB 4JY4B 3DO3A 5DRZB 4Y4HC 2YMXH 2AABL 4NQSA 4O00A 5I0DA 5DJCB 1NAKH 2DQFA 5BRZA 4HWNA 3FT2A 4M6OL 4UMGA 1JNHA 1QSFD 3DUUA 5ITBL 1AGCA 3DGGA 1FBIL 1T1YA 5C3LD 1P4BH 4PIRF 1ZLUK 3V79C 4XNQA 4I4WB 4NQEE 2NNAA 1MY5A 1KUMA 4TVSa 5LAXB 4POUB 4DGVL 2APBA 2J3SA 1IAII 2BNUB 4HFUL 4NYLB 4XVUD 3I9GL 4Q9RL 2WWKO 1JZ8A 1PDKA 2UYLA 1HI6B 2EECA 4KJPD 1QTYT 4OCMC 1HINL 1F6FB 1ZLVH 3RU8H 4RGMC 3QJFB 5C8JB 4KPHL 4AMKL 3WUWA 3TBVB 2J88L 5HD8C 1S7XB 3OJVC 5I1DB 4MVBD 4JZOB 1P5VA 2EYTA 4JGMA 1OWWA 3WNKA 1NEUA 5HY9A 5SWZD 1MEXL 2R1XA 5KTEL 3FB8B 1OVZA 3QFDB 5IFHL 3INUL 3UMTA 5CP7A 2DBLL 2D31B 3L95A 3RGVA 4L4VE 3FFCD 3NCMA 4L5FH 4PUBH 4PJGB 3ILPB 1PX3A 2V7NA 4MXWL 1MIEL 4R26L 1I1YA 2ZUUA 1QO3A 2PCPB 5IM7B 2GQHA 4P59H 4I18C 4YDVA 4Z7WB 3OKEB 5HD8D 4FTVE 3MV9B 1UWXH 4JFDD 2IMMA 3O3BA 4X9GA 3X11B 1FLRH 5KS9F 4ESKA 3ARVA 3NPZB 4O2EB 3VGAC 1LK3H 1I7RB 4Z78B 4DQOH 4WWKD 1UCTA 4G6FB 4ZFOL 3ESUF 5CSZB 2PUQT 4HIIA 4H0GA 1ZA3A 4MMXC 5FCUH 5TF1L 5T3ZE 2JJWA 1X4YA 1S9XB 4HFWB 3UJTH 3L3OB 3ZKSD 1NCBH 5DO2C 5MP6L 3IVKA 4TULH 1R24B 2F8XC 3V2AR 2NXZB 2ATKB 2UVEA 3PWPA 4YIQB 1Q9KB 4PJCB 4BKLB 4WHYG 4HC1A 4BZ1L 4GFTB 2O5YH 1OCWH 4QY8A 4JRWA 3S4SB 4UT7H 4DKEH 1JWUA 2ESVD 5EO1A 3MUGB 4GS7B 3NCFB 3O2DH 2OSLB 3FB7A 4YFDB 2D7QA 4BQCA 5B8CA 3QB7C 3GBML 1AD9B 4X7CC 4AT6A 5HYJD 3KJ6H 2EYRA 1UH4A 1JPST 2FECI 3BDYL 4L9DA 3TESA 4S1DD 3QUZB 2Y07H 3KNBA 5EIIB 2OR9L 4RRPA 5IVXF 3UCRA 4H8WH 1GPOH 3QHZH 1YNKH 1KOAA 1M71A 4TQEL 1HOCB 5GGSA 2EDBA 4JGUA 3V5HA 1QSED 4CNIB 4XPAH 5EIQA 2EYSB 2Y6SD 1ZT4A 2NW2A 2DI7A 3MRRA 2VB5A 4M9PA 3R4DA 3RY4A 2D03L 1A7RL 3P3YA 5T1DH 5IHBA 3OKYA 4W68A 1YEHH 4GG8B 4OFYD 4PJDE 4QRQA 3DX7B 4GXVL 1I9RH 4QOKD 4XNXL 1F11A 1BWWA 1OP3H 1AKJA 1CXIA 3G5YB 1QBBA 1T83A 3GKWH 4M1GH 1LDSA 1GC1H 1YEKL 3E8UL 5EBLA 1OAQH 3B2VH 4JAMB 4H0IA 4GAFB 4MMZC 3BUYA 3CPLA 4L8CB 3D85A 3ARUA 1FG2B 5GSRB 3SE3A 4NZRL 3W82A 5KVGL 4UZGA 1QLEH 3HMXH 3O9WC 4Z95H 3HNTH 2BOCA 4N0YL 4OZFB 4WFHE 2X40A 4TSCH 4JFFA 1BF8A 4A6YL 5J3HD 4KMTL 3E6HB 3RUGA 4KKAD 3SGDH 5E9DD 1OQXA 4K3EH 3IFLL 3OJ2C 4BSVB 3ULVL 4WHDA 2X1OA 4RBPH 3RWGB 1HI6A 2RIKA 1NL0H 3UTSD 5CJQH 2K1MA 1XGQA 1A21A 3RNKB 3V6OC 1CE6B 5B3JE 4HJ0D 3MJ9A 4Z95L 4NBXB 5I1DA 4JZOA 5K9JH 2DI8A 3BO8A 4PJAB 4F7TA 5E2VH 2BP3A 3Q3GA 1CDBA 3OZ9H 3HHRB 1FO0A 2IPUG 3AM8C 1V7ML 3PWUB 4RFOL 3DECA 1IKFH 1BQHB 1GVIA 4W70A 1IGIL 1J1PL 1S7WA 1Z9OA 2F53A 5H35B 2Z35B 3EYSL 2ICES 4WEUD 1T20A 2BMKA 3BN3B 4OLVH 3THML 4JHWL 3TN0A 2VDRH 1R5VB 4NNYB 3EYFB 1XEDA 3WS6A 2X44D 3MXWL 2HT4C 5D5MA 4QO1A 1T7VA 4NRYB 4U1IB 2PO6D 1YEKH 4LCWB 3VFMA 2XWJB 3P9MB 5D2LE 4X80L 3KPTA 1R3JA 1KCRL 3OKDA 5JXAH 3QZWG 4PV9A 2XA8H 3V5DB 2C3VB 3ZE2F 5HYSA 4XNMA 4I13B 4EKXA 4I0PA 2G60L 3QHFH 1F13A 3I50H 3FRUB 2D03H 4YR6A 3TM6A 3BD4A 2JJTC 3CDYA 5CD5C 3U0PB 3UTPE 2WIIB 5I1AB 3S4SA 1QRND 5EWIL 5LGKA 1YMMB 2X4SA 5E4EC 2XZCH 3FAWA 2GJ6A 4P2OB 2Z91A 3H9HA 2EKJA 1EZVY 4HBQA 3C6LB 4ODUB 3I9GH 1IGML 5GGTA 1U8OB 2C1OB 4PV8B 2W0FA 1FN4B 2O61A 1FZKA 4ZS7H 2Z31B 4DN3L 1C5BL 5FHAL 3CFEB 4PGCA 2BK8A 3HNTL 3F5WB 1BPVA 4XP9H 3O6FD 3W39A 5HYJA 2M26A 3KPSB 3LS4H 5J89A 5C07B 3MO1A 3GB7A 3CXDH 3FFDA 5F7DA 3IKCA 1MCEA 2BY3A 4LNRA 1XIWD 1GZQA 1EIBA 4XPFL 3SE4A 1Y6KR 2NQCA 4XCCH 4IBLT 5GS0D 4PJHB 4BSJA 3UJTL 2FX8H 4N8CL 4DCQA 3RZCA 3O0RH 3BISA 3BKYH 5T1KD 1T1WA 3O3DB 4JPWH 5I74C 1A0QL 4IDJH 3BKML 1TETL 2HFGH 4XHJC 3VFUB 3EYVB 1E4XI 4HS3B 3RWDA 1NGWA 4TUOB 3NMEA 4OJFL 4X6CE 4XBPA 1L0YA 1WZKA 3EDJA 3LEXB 5D1XB 4ENED 3FQWB 1G84A 2OTUA 1UM5L 1KJ2L 3B2UC 4LASH 1ZTXL 3TNNA 5DRNA 3OKEA 2RCSL 1FDLL 4WFEE 2AJZB 1X6NA 5D7LD 5KBNC 3CSYB 3SKMA 3U1SL 4D0CB 3NACH 1JPFB 3WYRA 4K7PY 1ACYL 3L3GB 1PQZB 4QTIH 3HE7C 4R4FL 2QQLL 3AMLA 4LKCA 2QADD 2ARJB 1QFWI 5C9KA 1LO0H 1ZHLA 2ICWI 1IL1A 4JKPH 3GSRA 4ELMB 1JGVH 1J1XL 2QQNH 5JW4Q 1NCTA 4PJCA 1YQ2A 2QKIA 2FHCA 3Q3GB 4PTTB 1OQOA 3HNSH 5L88L 4CUCA 2PN5A 2XN9A 3IDGB 4LRNH 1CLCA 1MWAH 2PYFB 2VXSH 4LCCC 1OAYH 3WS3A 4EQ3A 3F62A 1IC4H 1AGDA 1TTGA 3HE7D 3SKOA 3V9FA 3S88L 5DJAB 1KJ3H 3MRHA 3UPCA 3FONB 5FGSA 2NX5A 1U58A 3SE4C 2Q76A 2AJYH 3VFVB 3LZFL 4AM0B 4WJ5B 5C0JB 4DFIA 1W72H 3GMOB 4FQHB 5LWYL 3TN0B 3WFDH 2NY3B 5J6GB 4NBZB 3TWCL 5BV7B 4I2XA 4H1LB 1F90H 4S11A 1CGYA 2ZOLB 4ZS6C 3HS0A 1IC7L 3QAZC 3GSWA 3P9MA 3QAZB 4KV5E 4CNIA 3MRGB 3ZHKA 3QO1B 4IRZH 3EDDA 1C5BH 1RJLA 4P46A 2XPGB 1NC4B 4FQXB 4N8VB 4MNQB 4NGHH 1YEIH 3O3EA 4GAJL 4Q2ZB 1C7TA 4YNYB 1CZ8L 1WFOA 3MFGB 2FR4A 5C9JA 4BFEA 1BP3B 2C3HA 2WBKA 3AM8A 5L9DH 4K3DL 5EU6A 2NR6C 4BSWB 2VE6B 5C0BB 2HH0H 4Z8FL 2E5EA 2YPLA 2YOCA 5SV4A 3D39E 2XFXB 1A6AB 4N0UA 1BLNB 2GJ6B 3ARFB 4P2OA 2Z91B 3H9HB 1LO2L 3QIUB 4YE4H 3UJIH 2ICWA 2ORBL 1ZGLB 3SDCA 1IM9A 2P5WE 4BQ8A 1Q9OB 5HHXL 3MJ6A 3MREA 3OKMB 3P77A 4UOJA 3IB4A 5FHBL 4N1CA 1LO5A 3C6LD 2KZWA 3VXSD 5E8DH 4CVXA 4F15C 4PGDB 4X8XA 3GMLB 3MRJA 1QNZL 2XG5A 3MLRH 3CU1A 5GIRA 3VWKD 1A7BA 2Z8WC 2VITB 5T5NG 4KK8C 5EPMA 3ARQA 5E8PB 4EN3C 4J6RL 2VXTH 3QXTA 3SKNA 3OKOB 4P5TA 2J7LA 4HEME 1RZGA 4PJIE 4MA7H 3ULUF 1I3RB 2RGSA 3MRBA 2OK0L 3R0NA 5JHLL 1MHPL 2YN3A 3QFJB 4CDHA 2XKSA 3QWQB 2A1WH 4NSKB 3O41A 1WSST 2EXYC 4U1KB 5FECB 1EUTA 3MV7E 2YN5A 4MCZB 1HILB 1E4KA 4X7FC 5E2UH 5EU6D 1KJ2B 2WUCL 5GS2D 2F5BH 3FHQA 3HAEH 1EVTC 4J3UA 3A67L 1EX0A 5E6IB 4TOYL 1W0YT 1FGNL 3FHAA 4PYGA 3EKCA 3QXDA 3X12B 3FMGL 3UTQB 3KJ4C 4NQDB 5AZ2H 4XVJH 3KPMB 5MEPB 3TZVD 3IDIB 1I9IH 3AROA 2XG4A 1ZANL 3U79A 4JKPL 2DQEH 1YY9D 1DUZB 1OTSC 2XKUA 4NCC1 1G7LA 3HR5A 3PDDA 4RBPK 4F7MA 3R1GL 4OIBA 4HZAA 5IR1A 1CDHA 3MBED 2F58L 5DGQA 5DHYA 5A43C 3BIBX 3LPWA 1LE9B 5CCKH 4MJ2A 5SX4I 4AEFA 1DUYB 2J5LC 2YC1A 3KWWB 2VLKD 2Z93A 3NCJH 5A40E 2LAGB 1IE5A 2W38A 2F19L 3A6CH 3OR6B 1QSFB 3C60C 3K80A 4JKKA 3WLWD 2ZKHL 3DPBA 4FFWC 5H2BA 3RL1B 1ETZB 4OLVL 5TPWL 5HGDA 3DMMD 1T2QH 5E8NA 2JK5A 3BDBA 1GIGL 3MLYH 3EYOB 2BXZA 3T77A 1IAIH 4DEPB 1MNUH 4XNZB 3G6JE 3L9RB 4OFPA 1JYNA 1WIUA 4NQCE 4OIIH 4DOHE 1WWWX 4NZDA 1RURH 5F6IC 5IROC 5L0QC 3WNMA 5DQDL 4ZAKC 3BUTA 1IILE 4OZHB 4XP4L 4NJ9L 3HNVL 5MERB 4U33A 1NLDL 5J06A 4P2QE 5DWUL 1I1RA 4OB5L 2VQ1A 1OSPL 1XGPB 4OT1H 5HY9B 2H1PH 1DE4B 4R6UA 3MGTA 3WFHA 3UP1A 4P5MB 2DLGA 5J6HA 2C26A 4JO3L 5I1KL 2R0ZL 4MWFB 5IW6A 3U9UA 3V7MA 2P8PB 1NAMH 2ZCKL 5C3TA 4AQOA 4M03A 2J4WL 4ZUSA 5LBSL 4WWID 5D7KE 4XAWH 5I1IH 5F88A 4MB4A 4UT6H 3RZCD 5IB1A 1NFKA 4WHTB 1MLBB 2JJUA 4JZNB 2BNQE 2KQNA 3VGEA 5I8OH 2H2PD 4IMLA 3WL9B 1E6OH 1I3VA 1ADQH 1BBDL 1TZIB 3GIVA 3IJHB 3OKMA 4OZIB 5DMJB 4K71C 4U3XA 5DDHA 4O2FA 4D2NA 4JM2C 2AK4B 2VDPL 2QADB 4HCRA 3EFFA 1NDGB 3GJFH 1UXSA 4WWKC 4JVUA 2W9LA 2P49B 3DX8A 5BXFA 4OAWA 2KBGA 3ORJA 3VFOB 4EUPA 5D71L 4UQ2A 4X83A 2NY3C 3HZMB 3FKUS 4KROC 4ODSL 5DC9B 2NY4B 4IOIB 3ZTNL 4HWBA 2R2EB 2FO4A 3MUGA 3E3QE 4L9LA 1MLCA 1KELH 1U8PB 4X5XB 3UTSE 4YH6A 2WUBH 5GGTH 4LARL 1HH6B 2AXGA 1NEZB 3W2DL 2DL9A 3S9DB 3HRPA 5ICZB 3R06B 1BIHA 4P49A 5EC2A 4LLQA 4NHUB 2R0KH 4WGVB 4L3CB 5CEYA 4L3ED 1DBML 4XI5C 4CU8A 1UM6H 1BECA 4ZPTA 3KHOA 4LLYA 5BRZD 3KYKL 5C0JA 5FYKH 1P53A 1OAUL 4S1DC 2KL6A 1GGBH 2MQCA 1QFWL 2QSTA 3DTXB 3IDIA 4M7JL 3I84A 5DHVH 2X41A 3VRIA 2L0DA 4U6XB 1G7LB 5CS7A 1WTLA 2F15A 2D7PA 2A6DA 3BH8A 1YJDC 5DEGA 5JR1H 1JIBA 2ID5A 3QFDA 1RHHB 3G5XB 2E9JA 4MJIB 3CFCL 2DTML 5EB9A 1RZIB 2R0LL 4CKVX 1WBYB 3AS1A 5FKAB 3OAYH 4G8FB 4HWEH 2F9BT 3PL6C 4WUUD 2OK0H 3WBDA 3O8XC 1H15A 1WK0A 4HX1B 5FV2A 1ETZA 4AIZB 3BWUC 3EDFA 3SJVA 5D1ZC 5KJRH 4FQJL 2BC4B 1MFEH 4RA0C 2B1HH 3U7YL 1KV3A 4GW5B 5FYLE 3L9RA 1A6UH 3ME0A 4F2MB 3ZT5A 5CJ8A 3BE1H 2EH8H 3IDMA 1RUPH 3QDME 4L9LC 5F7UA 3ARSA 3JWDC 3SCMB 4LMQE 1LO5B 3SCMC 1J0KA 2X70B 3BPOB 4HFWA 5J3HC 1YNLH 1DFBL 5EPMB 2BVTA 4HKZB 1JUFB 1DANT 2ZUYA 3O6ML 3WDIA 1IQDB 1AGFA 1T0NB 3QDJE 1CGWA 1MQ8A 1KTDB 3RA7H 4UBDC 2A6IB 4G5ZH 1HINH 3RU8L 4MXWH 4LL9A 4DKFL 5FKPA 3QJHB 5I2IB 1PLGH 3R1GH 4YHKH 1T66D 3T3PF 2V2XB 2FEDC 4ELKA 4U6YB 3NGBB 4KTEL 2FIRT 1MCNA 4DZ8A 3F7YA 1QR1B 2ICEA 5MENB 3SCMD 4N0CD 5KTEH 1XCTA 4IRJA 3RPKA 3C6SB 4FFZL 2J88H 3BYTA 4FS0A 4PB9H 5JW4M 3T2PA 2P24B 4Q7DA 4ZQKB 4UT7L 4P23A 1LDPH 3GSXA 5GSVB 4HGMA 4JRYE 1Z5LA 5IVXE 5DJXB 1MCOH 1KC5H 4YHOH 1N5YH 1PW3A 1IGCL 1AP2A 5JHDD 3C8KB 1YJDL 4QHLB 2FB4H 5KW9L 4F9PC 1INDH 1EMTH 3KPPB 2EYSA 3CSBA 4O9HL 4IDLA 2YD7A 3QQNA 2DM4A 1O7VA 2WMPA 2X4NB 1QHPA 3GFUA 3IFPB 3QO0A 5D6CB 2YRLA 5E2WH 4LU5L 4JM2F 3VFGH 3VFSB 2NYYC 3W81A 2VLRB 3HZMA 3WCYA 3O8XA 2C1PA 4LSUL 2HFFB 2HTKC 3GSNB 4RZCB 3DJ9A 4JFPB 2F54E 3V5KA 5C0RL 4JFEA 5D70L 1MSPA 1MELA 3MRQB 1SJEB 3U7WL 2A6KB 2CIKB 1U8LA 1UH3A 4ZUUA 5FO8B 4A2LA 1NANH 1C5CH 2VR5A 2GSIA 1QLFA 1PKQE 2R1WB 4KTYA 1WCQA 3BGFC 5DSCB 4KHTH 4YBQD 5E8NB 3O4LB 3HI5L 4PV8A 4PRPA 3QR2A 1K4CB 1JWMA 4OV5B 3T08A 4NPYB 3KPLA 3OX8B 2VMFA 4KK6C 2CUHA 1NCWH 2R56H 1LE5A 1R5IA 1IBGH 3H3PL 3P0GB 4OZHA 3RX5A 3B6SA 3FO9A 4X7TA 4PJEB 3GZKA 2VQTA 1YQVL 3CFKB 4N0FA 5KN5A 2VH5H 1II4E 3HAEA 4I48A 1FZMA 5MHSE 3RRQA 1F8TH 2BFVH 4GRWH 2HTLC 2W0KA 3HZKA 4UTBH 5L6YL 5BVJA 3DETC 1CXEA 4BFGA 1HYSD 1CLOH 4BFBD 4OUOA 3X17A 1CVRA 1U3HB 1AGEB 1DSFL 3C60B 4OQTL 3FRPA 5F8QC 5BJTA 2KZ1B 3QUYA 2ENSA 2D2OA 4O5LH 3S96B 1N6UA 1FNSL 5DK0A 5E6ZA 5FK9A 4AJ0A 1RAMA 3MLSL 4K8RH 4O02L 4NN7C 5DRNB 1BFTA 2DM2A 4LDLB 3CFIC 3OPZL 4QXUH 3VCLA 4JR9H 2A38A 3M17A 1WJ3A 1CE1H 1I1CA 4PJBF 1CR9H 3GSNH 4NZTH 3L3GA 2DOCA 3MNVA 3NH7H 3IDYB 3PP4L 1F02I 3HI1B 4YXHL 5IOPA 2FGWH 1OPGH 1KLFA 2PW1B 1NGPL 3MYJA 4PV9B 1BJ1H 2OMNA 1NFIB 5I30L 4ZYKB 2DJ4A 3G9AB 3KDMA 3RWEB 5SWSA 4X99B 3OWEA 1XIWB 3KXFB 1DN0B 2OXGA 1MH5B 5I1CH 3MOAL 5EOCH 4K8RC 4EI6A 5JW4N 3HC0B 3PNWA 1JF5A 3LN4A 5I1AA 2R2EA 4HIEA 2HG5A 3M1BA 5TGBA 1R5WB 4NOBA 3RIFK 1V7NL 4Y4FD 3QCUL 2P47B 5CZVH 2NZ9D 5GRZA 4K3JL 2UZIL 2ZUQC 5EUKB 4ZFZB 1TJIH 2CLVA 4JFEE 4L3EB 3IXAA 2F54A 2BVEA 3D3VD 3CZJA 3B83A 5EBMB 3R06A 1RUML 2FYYB 1U8KA 4H5SB 2DAVA 5EUOF 2IPTL 2JF1A 3PHQA 3BXNB 1RVFL 2BNRE 3MLTB 4KRLB 4YHLH 4N90E 5DI8B 4F58L 2ZJSL 3N0PB 3T0DA 3EHBC 2BNRB 4R2GC 5HDBE 5GZOC 3BPNB 4D0BA 3TV3H 1NBQA 2B1HL 2IPKB 4Y4FC 4RDQF 3MMEA 3GM8A 4L1HA 4PG9B 3MGOA 1XF5B 4GG6E 2XY2A 4HLJA 2QSCL 3TBYA 1MUJA 1EXUB 4O02H 4U05A 2BRRH 3NFSH 3BH8B 5B8CC 4PS4H 1NGYB 3LS4L 4W6XB 3ARED 3ARGC 1T0PB 3ARGB 4NWTH 4WW1B 4TTGA 1PJ9A 5F7EH 5IMMB 1ACZA 3HI6L 1MIMH 3QSKB 4XZUA 1KCVH 1JPGB 2H9GB 3G04A 2WM0A 4X6CF 1Z9MA 5I74B 1Q9WA 2GY5A 4TSAL 5DSCA 5D9SB 5JUEL 2ZOKA 3N9GH 5IQ7H 3HC4L 4OV5A 3O3AA 1IGTA 4F37F 1J0YA 1PG7X 5ITFA 4MA1B 1AXSA 4NN5C 1B2WL 2OJZH 4JY5H 5IB5B 2FL5A 1MCBA 4X9IA 1KFAL 2NYYD 1P1ZA 5BVPH 1TITA 4D9QE 1MJUL 1XF3B 2UZYB 5CJQL 3WD5H 5M95B 3TC9A 1P2CB 3GK8L 4K94L 3TPUA 2M1KA 1QBLL 4HXBL 2DICA 3REVA 4IM8A 4Z7VE 2NMSA 1E0OB 3H3KA 4OTXL 1YYLH 3O6FC 3VU2A 3ZHDA 1I1AC 5JXAL 1F3DJ 4HS8H 4HUVB 3T0ED 5GISH 4H8WC 4LFHD 4HPYH 4LSVL 4NRZA 5DVKA 1HK6A 1FZOA 1AGEA 3C60A 2CKBL 3CXDL 3NN8B 2DB8A 3MRMA 3VXTB 5ID1A 4CGTA 3DYOA 1BAFL 2VOTA 2V9TA 3ES6B 3G6JA 5F1IB 3VI3E 5GS2H 4DGIL 4MDIA 4OTXH 4IJ3C 4P9HH 3TA3B 3P9LA 3FQTB 4PGEA 2LTQB 4HIJA 3BP7B 2H6PA 1W2KT 2P5ED 4LKXA 4M5ZL 1YDPA 3F6LA 5BS0A 1RPQA 3GSWB 4ENEC 3HI1A 1XH3A 3AAZB 1HWHB 4M6AA 1NMAL 2PW1A 4RFEA 1U8IA 3Q6FB 4OM1H 5I6XC 3LEYH 3KWWA 3MROB 1J86A 2PETA 4MJIE 4KXZH 4HULB 4HIHB 2HJFB 2WP3T 4NT6A 1A7QL 1FJ1A 4HKBA 1CU4H 1BGXH 4JO2L 4FTVB 4LPUA 4QRUA 3IAGC 3BKCL 1UKTA 2R2BB 2ZCKH 1NFDA 3P0VH 1JNLH 3NA4A 3BH9B 4JDTL 2OQJA 4D0DA 4FHBD 5I1KH 4K3EL 2APVA 1BLNA 3ARFA 3SGDI 1A14L 1KGCE 2WUBL 2ZSVA 5DJCA 2CIIB 2XA8L 4M61B 3IDJB 1E27B 3QQ9D 1OGTB 3SDCB 4WW2A 4XPGH 4KK9D 4PLJD 1CQKA 3HMXL 3VXUB 1HXMB 3A6BL 4LLDA 3BP6A 4PGDA 5IF0B 4YHIB 5GRUH 2DWEA 4MQ7B 3IFOB 4UQ3B 3NTCL 3G5VA 3KPLB 2J8OA 3O81A 4X0KB 3MLTA 1T89A 5D96C 3TNMB 4HK3N 1R5IB 3VD7A 4OIIL 3OXRA 2DWDA 4L4TD 4AH2B 4NUJA 2XTLA 3WUZA 1ED3A 1IAIM 1IAOB 3KYNA 2EDLA 4HS6B 3B5HA 4WU7B 2Z31D 4JQIL 2AAVA 2NZ9C 1LEIB 1UJ3B 3U46B 3ZTJG 4ZPVB 3EGSA 4OCYH 1FGVH 1S7VA 3NTCH 5GS0H 1NGYA 5E8EA 4A6YB 1W0VA 4FNLL 5E94A 4H88H 1UWXK 4PLKD 4GBXA 4JFYA 4NQUA 4KAQH 2EDYA 4LP4A 2EZ0D 5GGVY 3OF6A 3BGMA 1G7HA 1VEMA 4X4MA 2DQJL 1RI8A 5KVFH 2W60B 1AY1H 2VWEC 2GW5A 4JFHE 5L7XH 2IBBA 1L7TH 5DJ0B 4XPHH 1I8LC 5I1JL 3JXAA 3BIKB 3CK0L 3NCEB 1WZLA 3D39A 1DQJA 2AQ3A 1MJ7L 5DVOA 2IEPA 5F1OB 4NQXA 5IOPB 4G42A 3CVHH 2EXWC 1VHPA 2JIXB 1IZKA 4NJ9H 3IDYC 4JM2D 3UYPA 4X6DB 5EC1A 4HFUH 4GKZB 2J6EL 2Z9TA 2X10A 1D6EA 2OTPA 3JV6A 1SJVA 3OSKA 3CFDB 3RGHA 1QUNA 3MX0A 3ZL4L 1SYSB 4X4XB 3PP3H 3E6FB 4M4PA 5F72S 3L3KB 5HYQB 3DXAB 1DLHA 2CJUH 1X5GA 1W8NA 1YNTA 4ODSH 4MJ5B 3V0VA 4MA7L 4L3CA 5B8CB 2DQFB 5BRZB 4BELD 5ID1B 5DJYA 3G6JF 1YEGH 3CDGA 2OS7A 2EDJA 3PGDA 2E7CA 2IQAA 4WTZG 3UBXB 3ES6A 1ZT1B 1MI5E 1G6RL 3G6JB 4H1LG 5FM5M 4PRIE 1JF6A 1LEGB 4WNQA 4YBLC 3DBXB 2IG2H 2MQ0A 1MVFA 5DMKA 3HC3L 3L3JB 1DBKH 5HDBF 3WFEH 4R4BB 5DRXA 3LQAC 4P3DB 3VJ6A 1UC6A 2VSDA 3TCLB 1MRFH 4P4KA 1MEXH 1YEFH 5E95B 4KKBC 4GG6F 1BQSA 2DQIL 1JNJA 1YEEL 5B21A 2NX5D 1L6ZA 2ADFH 4J12A 2VDNH 2I60L 2AERT 1EEUA 1S9WB 1NGQH 1S3KH 5ID0B 1KCSL 3T0EE 2FGWL 5J1AB 4ZOCA 1FO0L 5BV7H 4AIZA 2CQVA 1K5NA 1U36A 2R8SH 4WHTA 3FZUC 4KKNA 1P69B 1UZ8A 2PTTA 4XZUB 1EFXB 2I27N 3IDJA 1LNUA 4APQB 1P4BL 3QH3A 3KS0H 1ZEAH 3QI9B 4NKIH 1DBBH 4EI5A 5DWUH 4JKMA 4QRPB 4DQOL 2JJTA 3VRJA 3G9VA 1TPXB 1D7FA 5A2LH 1FVCB 3GSUB 1KJMA 2B4CH 2AEIT 4MD4B 2H3NA 2JKXA 3WNLA 2FATH 1S9XA 3X3FL 2NXYB 4U1HA 1OGAA 4Z7VA 4KY1H 4GW4A 4GRMB 5D1XD 2GUOB 5TDOB 4ELKB 5IEKA 1G9MH 3BGFB 2HT3C 1RZKC 2ATKA 4L9LB 3EOAB 3BO8B 3ALWA 1V3JA 4BKLA 3NVQA 1MCHA 4XX1G 4ZUVA 2P5EE 2EDHA 4J2XA 3HFMH 4KQ3L 3I2CH 2VDOL 1SJHB 4FP8L 1JWUB 3UAJC 5B39B 4GBXB 4JFYB 3HUJA 4HXAL 3QP3A 2EDEA 4I18A 1MFAL 3B43A 5D93B 4QRTA 5F9OH 2DQUH 1OGAE 3WO4B 1BVLA 4RSVA 2EYRB 3MUY1 2C9AA 1TJHL 4NQCA 3RL2A 2CRIA 3MLVH 3CD4A 4RAUA 4Y4KC 3EYFA 1P7KA 1U6AL 1UQSA 4OCNC 2D7TL 4ONOA 5L8JB 4JRXB 1JRHH 3TA3C 4IRSB 4G43B 1KB9K 3LRSA 5JQHC 1UXWA 3QWRA 3LKOB 4UI2A 4EDXA 5I30H 4PRPE 4HBCH 2V2WA 4OCRL 4OFIA 2EDNA 1W72A 2NY0D 3I85A 5CMAB 3D6GA 4JDVA 1CDCA 1EFQA 2Z4QA 1QR4A 1PSKH 2BOBB 2EEDA 5LJYH 1ZE3C 4G8FA 3GSNL 1HE7A 2HLFC 3NCBB 2P8MA 5GZND 1QRKA 4FQ2H 2XTJD 1JTPA 4Z7UA 5HGAA 1G6RH 1ZLSH 2IQ9L 5IHUL 2GKIA 4D0DB 3NA9H 4HZLA 5EN2A 3RNQB 4LSRH 2YZ1A 1YNTB 3TWCH 2Y36L 3LSOB 3LOWA 1KJVB 1RD6A 3MRCB 5C08A 3RIAF 3HLAB 5DJYB 4GRWB 5D7IA 2X5PA 4LVHC 1BQUA 5AYUL 5LGJB 4HQQL 1ZEAL 1I8IA 3SCMA 1A6ZB 2ERJB 3MV8A 1W8OA 4JFFB 4WNQB 5EZOL 2YPKA 1G6RB 3EYQC 1H8OA 3I6GA 2A73A 5CZXC 3WV0A 4OIAA 1MF2L 3L3JA 3VFWA 1FZMB 5C0ND 3MRPB 4KKLC 3U48A 3PWJA 4J4PD 1KTDA 4BUGA 5I17A 2H2PC 1JN6B 5FUCE 4OUUB 3RNKA 3QJHA 5T1LB 5DD1L 4AG4L 1EJ6A 3T3PE 3KYKH 2O26U 5ELIA 4I3RH 3JZ7A 2DLIA 1RJYB 4G8EA 3MJ9H 2CDEA 3D39D 2F74A 4Y5XB 3K4AA 1AIFB 2GTWA 4XRCA 1RUQH 4Y1AA 1UVQB 3NGBC 4L4VD 3ARFD 1DQQB 5F3BA 3VXMB 3NPSC 5T5FL 2EH8L 5F89B 4YFEA 2FJHA 2Q86A 2CLRA 2O5ZH 1KT2A 4G6KH 1ZLUH 2V5YA 3WLBB 3U30C 3V4VL 4M7LT 2B4CL 2OL3L 5FM5O 4N9GA 4GQ9L 1CFQA 4P3CL 3B9VA 3BI9X 5DT1L 4IOSD 3T0EB 4PJDB 4UIMB 1IZJA 2AJVH 1QQDB 4PBXA 5LWYH 5J9PB 5HYJE 2HJLB 2IQ9H 2MKWA 4G42B 3AUVA 5INCA 5HDQH 2GT9B 4GSDH 3QUML 2VLRA 4Z76B 3HPLB 4ELMA 1JF1B 1NCCH 5EO1B 4I0PB 3V0WH 3TJHD 2BDNH 5DURD 1VEPA 4ZO8A 3MTRA 5KSAA 4HAFA 1YMMD 3U4BL 4PLNC 1S9YB 3QNXB 1F6AA 4GW1A 1RV6X 3HUJF 1PG7W 1QSEB 5EIVA 3EO0A 2ITDB 3QZWA 3AY4C 1UWGH 1MAJA 3BIAX 4O58L 4LSTL 2H2SC 2D7TH 1DTUA 1FV1B 2AXJA 1DBMH 5JR1L 4PJEE 4KKCC 3V95A 5LAXA 3LV3B 2IQAB 4FXLA 1PZ5B 2R0ZH 4WJ5A 3KAAA 3V5HB 4I77H 3RWCA 3LKSB 3W0WB 3MRRB 2DRUA 1VERA 4NKOB 4H1LA 4U7SA 4OB5H 1ZTXH 3PHSA 4QF1A 4XVUC 2I9LA 4KV5F 4YXLL 3NIDF 4EN3B 4HUWA 1YA5A 4CJ0A 5F8RC 4F8QA 1F11B 1UACH 4PY8J 3MJ8B 2MFNA 4QHKJ 2DQGH 4YUEL 1N0XL 3SKJH 1Z9LA 1A5FH 2VDRL 3QHFL 1O5DT 1BEYH 1RURL 2QQKL 1MCWW 1RUPL 5BMFL 3MZTA 4QYOB 3RKDC 2FATL 3CH1A 2ZCLH 1KXQE 4ZODA 2R69H 4MS8C 4HV8A 1A7RH 1UZ8B 5C0BD 1PFCA 1IGTB 2ICWB 4XBPB 2GY7B 4OI7A 1MAML 2R9HC 3A6BH 5TDPB 3QDHA 4M6MH 3T2OA 4J3WA 3I3EA 4Z7NE 5HVHB 3GJFA 2LVEA 2BVOA 3C08H 1MRCH 3K1KC 4PJ7B 3WFBH 1R3HB 1MHEA 2P42B 3QQ3A 5I19L 1T03H 4KXZI 2GCYB 1FVDA 5DEFB 1SEQL 5FYKD 5BO1H 2AQ1A 3C87A 1RZJC 3BWAB 5HHQA 1L9NA 1N0LA 2YKLH 2AXFA 3OG4B 4X6BB 3LRHA 4LGPB 5ESQA 5TDNB 1Q9KA 2D9CA 1S3KL 4ZMAT 1CU4L 4OCWL 1BGXL 1NBZB 4PJ8D 4GW4B 4NP4L 2ERJC 5DRZA 4NP4H 2CDEB 3IJSA 5EO0B 5EG6C 3RTQA 2AV7B 3KPRA 2BDNL 2Z35A 2OZ4L 3VD5A 3F7VA 3TBWB 4PB0H 1NBYA 3ELAT 3ZLQC 3ARDD 5HXMA 4NNYA 2I24N 1NUDA 4NHCH 5EUOE 5JDJA 3PQYD 1A6TB 3IS0X 3K4DA 4MNGB 4M7LH 3PDOB 3ULSA 3CMGA 1A9EB 2BNUA 4NYLA 3RL2B 3UPAA 1XH3B 5E6YA 5TH2A 3MR9B 3H0TB 1KTLA 1LP9B 1QRNB 3P30L 4NUGL 4PJ5A 3GGWA 4XCYA 25C8L 3MGOB 1EAJA 1ORQB 4HPYL 1MCSA 4KMQA 3U0TB 5IBLD 5AG8A 1I85A 1TQCC 4Y89A 4IRSC 4WRLA 4ODVH 2R1XB 3ARDC 2JCCE 2NY4D 4N8VA 5HVGB 5JXEA 2OR7A 5DUPH 4KK6D 2CXGA 5GS1B 1CFVL 4Q9QL 4HMDA 4WW1A 2JB6B 1BBDH 1FRGL 1DQDL 3ECBB 3SGJC 1GAFL 4OM0H 5DR5H 3EOBB 1I3GL 1X5IA 4F80A 4ZXBD 5D2LA 4I2XE 5IM7A 5KAQG 1LO2H 4LVNC 3MJ9L 3NAAL 4XVJL 1J1OH 1KN4L 3RWHA 4KHXH 3H3BC 4XWGL 3AS0A 4UQ3A 1SVZA 1A14H 1B4JL 3BZFB 2F53E 3AVEA 4KQ4L 4X8JB 3D48R 1BHGA 1K85A 5GRJH 4ONFH 5CD3B 5I76A 1A7NH 3ESVF 1A3RL 4I9WD 2XRAL 4E41B 4GMSL 4ZXBC 4MAUH 1LILA 2QADC 3NIGF 3UTZB 3MACL 3LKNB 4P3WA 3W5MA 4K7PX 4GAYA 3PWPB 3IXTA 1MVUA 4EXKA 4JPVL 4MA3A 4IIQB 1JN6A 3ZDZF 3ABZA 1UA6L 1ADQA 2QLVB 4P5MA 3EW3B 2ITCA 3CC5B 4K3HA 4L8DA 2FSEB 4HUXA 3M45A 3S36L 5DK2B 4IRJC 2XZAL 3W0WE 4JLRA 3S98A 4CMHC 1U8NA 5DHVB 3B9EA 5H35A 1OL0A 1VENA 3S5LG 4W81A 5DF0A 2YWZA 3HZYB 4NQEB 1VGKA 2XY1A 5F7FA 4K8RD 4HWZA 5ETUA 2ZG3A 3B8SA 5E6IA 5JQ6H 1KCUL 1G1YA 2VLJD 1MJUH 4IMLB 5GXBB 4V2CB 1GC1C 5IW1B 5JOPE 5BS0B 2ZCHH 1SMAA 2ARJA 1MHEB 3QQ3B 1U41A 1JGUH 3L5JA 2ESVA 35C8H 2OR9H 2JJVA 3GSVB 3MROA 4HAGA 1C5DA 3HR5B 3BWAA 4GG8A 2FLRT 4OAWB 3P2TA 5IR1B 5L2JB 5ESQB 5I1GL 3K2UL 4K2UL 1TVHB 2PYEA 1FNHA 1IAKA 1DUYA 4HG4K 2OJEB 2WIIA 3Q48A 3ZT7A 1DDHB 1MY7A 1UM5H 4XP5L 5E8OA 5IFJB 5DUML 3QUXA 1NDMB 3DMMB 1D6VL 1ZXQA 2G5BA 1H5BA 1G0XA 4UAOB 3F7VB 3TBWA 4NCC2 1U8OA 2GTZA 3JSSA 3X3FH 4JGJA 5JW3L 4YHIA 4DVBB 2CLZA 4C56B 3DBXA 2X9XA 1EEQA 4RMUA 3VDAA 4MA8H 1A6VL 3QWOA 1IEAA 3RKPA 4F3FA 3SGKC 4PRHB 3MRIA 3UDWC 1YECL 4GRLC 4U1SB 4M93C 5C07A 4E5XA 3QIBC 1YPZB 2FECL 1QRNA 3TT1H 3Q1SL 1UENA 5TFSH 4YDLC 3FN0L 5IROA 2FR4B 1A6PA 4K07A 4EN3A 2W65B 2PO6C 2LVCA 5BZWB 1Y6NR 4NO2B 3O2WL 4S1QL 2NY1B 5J1AA 2G9HA 4ODXA 2YPLB 2ZJSH 5HI5C 4PREA 2WSKA 4G6ML 1WFUA 3EFDH 2PXYA 3F7RA 4M43L 4RGND 1B4JH 1TVDA 1MCOL 1B3JA 3DVGB 4PJCE 5D1ZB 3BPCB 3WD5L 3BAEH 4CDGC 3BW9B 2L7JA 4OFDA 1A22B 5FO9A 4OFKA 1ZA6A 4JVPA 1GJIA 4M6NH 5CD5D 4NQVB 2IAND 5CJXC 1MRFL 4JEGB 5C0IB 4OJFH 1CFNB 3T0EC 3BEWB 5TDPA 2GITB 3HCVB 4AEIH 5ADOL 3PP4H 4S0SD 1HYSC 3NH7L 3H6JA 1IJ9A 5E1AB 4YDLB 4V1DB 1GYAA 4P2RA 4RGOH 2H3NB 4PLJC 1CTOA 3RVXD 3FOMB 5ICYB 3RVVD 1WICA 2JELH 3I75A 2HMID 2VJXA 5IVXA 4MD5B 1TJGL 1CK0H 5ITBH 1LO4L 3MNZB 4MNQE 4U1KA 1OLZA 1FNSH 2RFXA 5TE7H 1Q9LB 3VH8B 2WQRA 3CC5A 3IDGA 3HE6A 4ISVA 5GS3A 5CBEB 5T1KB 1S9KC 3ALXA 2XT1B 1RZFH 1FE8H 5FM8A 1S8DA 4H1LH 1U8NB 2KQMA 4RDQG 2FZ3B 1BFVL 3UBXA 2IAMA 3DWTA 3HZYA 4NQEA 4FQHA 3CCHB 4ZO9A 4UV4L 4LLQB 2HLAB 1D6VH 1ZOXA 1A1MB 1MI5B 2VLKB 1BFSA 1QEWB 5DD5L 2FBJH 4JM4L 3NFNB 1CGVA 3PF2A 5I6XB 1A9EA 4LQFL 1X5LA 4OCSH 4FQXC 1P7HL 2G75B 3P11L 3SO3C 5L6YH 3RBGA 2LFGA 3GB7B 1TZGL 4KZDL 4UUJB 4HGWA 1TIUA 2YC1B 4U6TA 3BRFA 1A02N 4Y4KA 4XVSL 1TPXC 3PABB 2Z4QB 1FL3B 4HUNB 3SEPA 5FCSH 3VA6A 4KK5C 2JCCF 1H3XA 1ZVYA 4OFYA 4ONHA 2BVUA 1MRCL 3WFBL 1CDGA 1F4AA 5I19H 5GS1A 2EXWD 2NY0C 3MSPA 3O6MH 4QLRA 2D9QB 3GSQA 2OTWA 1YEFL 3F7PC 2CRYA 3MBXL 2MTPA 4ACPA 5KSVA 4RMTA 3LSOA 2X4TA 1NGPH 1OAKL 3PIQA 4E0RB 2NW3A 2WAHA 2EKSA 2B8OT 3U36B 5T1MB 3TNNB 4JRYD 1A6UL 4WO4A 4RGMB 1F4WH 1AJ7L 4XPTL 1I1AB 4JREB 1UEYA 4CW1A 2NNAB 4TSBH 2CDFA 4G9DA 1O7SA 4O2CA 4UIKL 4ZUWA 2VQ1B 4JHAH 3BT2L 5C09B 1Q38A 5I17B 3FT4B 2YK1L 2X4OA 5CJBA 5FF6B 2X1PA 5FGCE 3QDGD 1VFOA 1U8QB 3AY4A 1QYGL 1U93A 2PNDA 3UC0H 3CVHA 3EYSH 5IWLC 3BRDA 5D2NB 3FQNA 5EFIB 1IEBB 2GFBB 5FUCC 3RI5K 3WJJC 1HSAB 2XZQH 2AJXH 1TNNA 5EA0L 4Y4HA 4IS6A 5D7SL 3MV11 4YXKH 3AB0C 4P9HC 1F2QA 1MCFA 4DGYL 1J0IA 4Y19D 3BQUB 4GUPB 3IDUA 2DQJH 4GRLD 3UTTA 3MLWL 3C6SA 1QFOA 4F7PB 1ZA6B 2Q8BL 5HYIA 4P5KB 5D1QD 4YDVB 4LGRB 5KSAD 3WIFA 5SWQB 4HWBH 2Q20A 4GMTH 1RULL 3BZDA 1AQDB 5FV1L 1Q0XH 2K7QA 1I7ZB 5L7XL 5J12B 3QA3A 3RDTB 3PWLB 1DQDH 1K8DB 2E6PA 2NY7L 3C8KA 5IQ9A 5DK3A 2WP3O 2R69L 3L3IA 2W1NA 3WHE1 1OP3K 5LQBH 1KF9B 43C9B 2BCKB 1KEGH 5HGHB 2AP2A 2AW2A 3FB5B 2DM7A 4ODVL 3QCVH 3W9DA 5DRWA 1BEYL 4P2CG 4XC3H 2PYEB 1S9YA 3QNXA 3VXRB 3SQOL 1A3LL 4HWEL 4NZUH 3S35X 3I6KA 4YBHA 4HZLB 3RNQA 1RFDH 2VDPH 3QUXB 1WT5A 4NKDA 1KEGL 3HLAA 3CDCA 4Y5VC 3EJYC 4GQPH 1N6QH 3MODH 3VG0H 4L5FL 2G2RB 1GXEA 3S7GA 5D72L 1G9EA 1G7JA 4KUCF 3HA0A 3N1MC 2HMIC 1ZHBA 4LOUD 5GRUL 3FCTB 3KLAB 5SWZE 5E2VL 1FAIH 5J7CC 1TCRB 4LNVA 4Y16C 3BP4B 4LSPH 3FZUD 5C2BH 2VSCA 2D4FA 1RUKL 5BOZG 4UTAH 3FN9A 2UYLB 5EUOB 2D7NA 2BNQD 4IJ3B 1ITBB 2CDGB 3GHBL 4OZFG 3QQ9C 5T1LA 4Y7MA 5DJ6B 5JTWA 3RVWD 3ULVH 4HF5H 1UCBH 5D72H 2OCFD 4Y2DA 4G8GA 2Z8RA 4YHKL 1KBGL 5FECA 3LKQB 4LLWB 7CGTA 4G6JH 4ZUSB 3PDGA 4M7JH 3ULVE 4XVTH 3WIHL 4OGXH 5CJOL 4N0YH 1XT5A 2VL5B 1G7PB 5KOMC 1OCWL 3ARZA 4U1JB 2X4TB 1RZKL 3GI8H 4OD3L 1OSZA 2HVJA 4ODHH 3X12A 2W9DL 1J87A 4G6AD 4HKXB 4ODBD 4PJFF 2EKSB 1M7DA 4LARH 2W0LA 1A1OB 1L9MA 1ZLSL 2VAJA 5KS9A 2BOCB 5DQJA 3I02B 4HUMB 5ERWB 3PGCA 4DK3A 1OAXH 3QULB 5B38G 3TYGL 5ITFB 3TYGH 2CDFB 4Q9BA 1TENA 3GMMA 2OL3B 1I7RA 4XWOC 4Z78A 1M7IB 4HXBH 4F7MB 3FRPG 4L8SC 1CCZA 4P2RB 4EUPB 5DHYB 5BV7C 4M5YL 1LWRA 1RUQL 1AO7D 4GQ9H 2XXCB 4U0RB 4XPAL 3RWEA 4RMWA 5I1IL 3QI9C 2I9TB 4Z7VF 3QDGB 3UPRB 1WIPA 5FOBA 2O5ZL 1Q9LA 3QRGH 4QHNA 1V7NH 2YD8A 4AYFA 1FIGH 1UWEH 2D7MA 4Y4HB 3L6FA