1CDBA

Structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
105
structure length
105
Chain Sequence
b'KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2
publication title Structure of the glycosylated adhesion domain of human T lymphocyte glycoprotein CD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags T lymphocyte adhesion glycoprotein
total genus 10
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1993-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdbA00
1AR1C 4RSVA 4J3OC 1ZA3A 4HS3B 2YBRB 4HLZH 4LOUD 2WIMA 3MROB 1NEZA 4RGND 1F6LL 5TDOA 1WC7B 1HCFX 4WWKD 1DL7L 3ARBC 1WAAF 3PHOA 4IDLA 3UAJD 4WV1B 1KLUA 1PDKA 3VGHA 1XF3B 2E27H 3QDJE 3PGCB 1QRND 5KSUA 1T2QH 1Z6JT 3RWIB 5DFWH 1FC1A 3P9WB 2A6DB 2YPLE 4UDUB 2VLME 3SGDH 1WK0A 1RZIA 1U8JA 4OIBA 2R1XA 3MLWH 1RZKH 4NJ9H 1HINL 4HJGB 4Q0XH 4P2QE 4HF5L 4UTBH 1JNLL 4XNZC 3CDGA 4IHOB 4E41A 4PJXA 4UIKH 3SDXB 3IFNL 5FKAB 1EBPA 3VFPA 2I07B 1NDGB 3BDYH 1BLNA 2H3NB 4KUZH 2JIXB 3WFEL 3UPCA 5MP6L 2BNRB 3F5WA 4UNVA 5DUBB 1VERA 1BIIB 4PLKC 4PJHF 4F37F 1TCRB 5T5FH 1KC5L 3JWOC 5FUOL 4NO5B 2ORBL 2DTSA 5JHDA 4JFQA 5EU5A 3CH1B 4HPOL 1GOHA 4ZQKA 5C92A 4C56D 2HJFB 5GSVB 1P5UA 4GKZB 4Y4KC 4JKKA 5CGYD 4DGIL 5LQBL 3E2HC 2ESVD 1BQLL 4NQED 3FB7B 3OKMB 1KEGH 4M6AA 2R9HC 5CD3A 3V4UL 3ZKND 2FEEI 4GRLB 4HMDA 2JB5H 1DLFL 4TTDC 3T3MF 1RJYA 4HXAH 3MLZL 3MBXH 3U82B 2VDRH 4S1RH 2CRMA 5KVFH 2BSRB 3KAAA 1EH9A 1S7WB 2DQTH 3WD5H 3S88H 32C2B 2HVJB 4OLVH 1A7RL 1KCUH 4YHKL 3OKEB 4XCNB 1XGTB 1QSFB 2FCBA 2RFXA 4LPYA 4JPWH 4U7MA 2B20A 5LXGL 1BQHA 2EE9A 4NSKA 1DVFD 4RNRB 1MFDL 4EI5A 1DQJA 1JF5A 2WWMC 5D2NB 1H9VA 2C1OA 5EU6E 1P2CB 5EIIA 5SWSA 2VLKB 2RHEA 1FAIH 1OF2B 3CD4A 4YC2C 3RJDA 4H1LH 1WZLA 1UT9A 4XBEH 3C8KA 4GG6A 4GJTB 4PUBL 4M7JL 2OQJB 5EZOL 5F7LB 4QF1A 5DZOA 3GGWA 4WO4A 5DSCB 5HBBA 5HY9A 3LDBC 4MD4B 1RIUL 4LASH 2WLZA 4ELMB 4HC1L 5C0JB 4TNWF 2B2XL 1F3JA 2QHRL 3RL1B 4PJ9C 2ZOLB 4HXBH 3B2UD 4Y16C 2IPTH 1NQBA 2FEDD 5DEGB 1LEKB 2Y07L 2LAGB 3KPMB 2P7TB 4XPFH 2EE2A 4U1NA 1UM4L 3WLWC 4XBPB 4L4TE 5TQ0H 4MWFA 3L3IA 1KJ2L 1IZKA 1NJ9B 1CLZL 4GS7C 1R5VB 2DQJH 3LD8C 1KF9B 4KKBC 2F5AH 3PABB 5I1GL 4WU7A 4PP2A 1I8LC 1T20A 2IG2L 5IVXA 3DX7B 4OB5L 3BQUD 1G7IA 4G6KH 3BWAB 1HH6B 1YMME 4EQ2A 2WBJA 2X1WL 4OUUB 4NDMA 1FIEA 1LEGB 2IGFH 5J6GB 5DJDA 2BOBB 5DT1H 1CE1L 3VWKD 5D1ZD 3D2UB 2ADGA 2Z35B 4NFDA 1FZOA 1RZJL 4RWYL 2KBGA 4MB4A 3T3PE 5K9OA 2X1PA 3IU3B 4HIIA 3MGTB 1CD0A 1V3KA 3RVWC 4NT6A 4QOKA 1NPUA 4G43B 3ULUF 1UM6L 2GHWB 2BHZA 3T0EB 1GZQB 1GZPA 2QQKL 2Q76B 4NO3A 4M5YH 3BPOC 3TNNB 4JO2H 3RNKA 1MRDH 3DVGA 2VSCA 3PGFL 3Q6FB 5CP7B 1T0MB 1T1XB 1HHKA 5C0RH 2WUCH 4R3SB 4RAHA 5SWSB 2XOTA 5IUSA 2WWKT 5B22A 3SPVB 4PJAE 2NLJB 3MXWL 5DZNA 2VQUA 2G2RB 1K4DA 1MCFA 1QFWL 2VERN 2VDOH 2K9UA 4URTB 1EHLH 1FYTE 2VDQH 3T8XA 3RTQD 5HYSB 1H3WM 2P8MB 4QHKI 2AEPL 2FJGA 5E94B 1BIHA 3REVA 4LEXH 1UH4A 2VN7A 1C08B 1BEYL 4F33A 5HHXH 4PJFA 2W38A 1SY6H 1T89A 5C0AA 3C6LB 2ITCA 1NMCC 4NKOB 3SE9L 3RWHB 4KZEH 1PG7W 5GIRB 1JFQL 3NCFB 2ADJB 1NCCH 4JFHD 5MHSD 3F7QA 3QDGA 4WUKH 4MWFB 3LB6C 3RZCC 4CVZA 4NUGL 3VXQA 5EBMA 4ESKA 5ACMA 2BCKB 4LSQL 1RUAH 3P11H 3PV6A 2P1YA 1KCLA 2FB4H 3EOYG 1QQDA 5J3HD 4H25B 5I9QC 4C57C 4FG6D 3V5DA 5KBNC 2BRQA 1FV1A 1KB5A 1I3RA 5K59E 4PBWD 4HH9A 3VXSE 4WHYG 1I8KB 4R4NC 3U48A 1WIUA 2CK0H 5J06A 4ZFFA 2QADC 3B9KC 3HI6H 4IDJH 3BMVA 4U7KA 4BJLA 5LAXA 3MGOB 5CCKL 1MEXH 4KU1A 1BBDH 3BHBB 2ADGB 2G9HB 4XNXH 3KPOB 3LS5L 4H0IA 3TYFA 2APTA 2EICA 3D9AL 3K7UA 1B0RA 2CK2A 1K5NA 2E5EA 4LU5H 4WJ5B 4JG0L 2A2QT 3NZHH 1IEAA 3HG1B 2Q3AA 1MCOH 4PV9A 1AO7E 3WFDH 3TJEH 2HKHL 4PRDB 4R0LC 1YN7B 5HYEA 2CD0A 2W60B 5IHUH 3TT3H 2FX9H 4U1IB 1RUKH 1FGNL 4XZUA 1FFOA 3F7RA 1WEJL 2IANE 4M7LH 4PJBE 3C8DA 3DIFB 5EO1A 1KNOA 1SBBA 4PRPD 1TLKA 3QNXA 3MV9D 2H8PA 1XGRB 2RR3A 3TZVD 1FDLH 3HNSL 3SKJH 3QJHB 3RPKA 3BKCL 3GKZA 3ARDB 1BQSA 3T8XB 4RFNB 3HE7A 3HMXA 3IJHA 4LHUB 1L7TL 1YNTB 4GKNA 4OD2B 2C1PA 3MLSH 4D8PB 3MRJB 3TBVB 3FT2A 3WS6A 2Z93B 1K8IA 4I9WE 3UTTA 4AH2B 4EN3B 1ORQB 4PJCF 4OZFA 1XR9B 2P8PB 4XP1L 1ZT7B 1ACYH 1JJUA 3QZWB 4RGOH 2L7UA 3PWPB 2AJ3B 2W0PA 3VRJA 4WNQB 2R8SL 4F7EA 1JNNL 4CNIA 4LSDA 4LP5A 5E8DL 2EDLA 1EZVY 5FOBA 1IC7L 3SDYL 2ZSWB 5F6HJ 2EH7H 3VFWB 1RZGA 1RJZB 2D7NA 4KI5E 1AJ7H 2OR9H 3JWDL 4O58L 1NMBH 5T1LD 3KPQA 3QEGH 1CFVL 5IFHH 5CD5C 5HI5D 4D9QD 2ZJSH 3KXFB 4JPKL 3HFMH 3T0WA 1OW0A 2NY0D 4Y1AB 4XB8A 4YK4B 4LCUB 1ZAGA 2EDWA 3OGCB 3DMMB 1JK8B 2CLRA 2H9GB 4XVUC 4RA3A 3HAEA 1H0DA 3QFJD 1NGZB 2APFA 4QHUA 1OAXL 5DD5H 5GGSA 4UV7L 1Q9OA 5FHBH 4FFWD 1MCHA 4XC1H 1LO4L 4PJ8A 2P43B 1OAYH 4Y4HD 2IJ0C 3MLVH 1V7MH 4OI8A 1FZMB 3ILPB 4PRHB 1CGYA 4DFIA 1JGLH 2BK8A 4XHQA 4HH8A 5DA0B 4AT6B 2W9LA 3A6BH 5J8OA 1KCRH 5ERWA 1OSPL 1WBYB 3MRRA 1K8DA 2CKBL 5DDHB 4KQ4L 4ZFOA 2BVQB 1SEBB 2GJZB 3KJ6L 4I5BA 3UJIH 3RA7L 4GBXC 1ZHLA 5GGRB 5C0CE 1DBBL 5F21B 3SDXE 1KB5H 1T80A 3N1MC 1EJOL 1MIEH 4RCAA 1VADB 3U9UB 5MEOB 1PKQA 1MCWM 3R4DA 4FTVD 3RWFB 1Z0NA 2BNRE 3REWA 3H9ZA 3L5JA 5FV1L 5DK2B 1RD6A 3EYUH 4O2CA 4RBPK 2FL5B 5DFTA 4GG8B 3PXHA 4J3XA 4CRPA 4DFHA 4V1DB 2LE9A 5EN2B 1E6JL 4XP4H 3QIBD 4NNPH 4CW1B 3V6OE 2GSGA 3HA0A 3FN9A 3PP3K 4F7EB 4FQ2L 1U8OB 1S9KC 3ARGC 5ESAA 2X4SA 3BW9B 2X4PA 5D5MF 1VHPA 5FUZH 3V0VA 4AEIH 1J05A 1AE6L 1W72L 2V7NB 5J6HA 1P7QB 4ZD3L 4OLUH 4HIHA 5JXED 5B39G 1FLRH 3JXAA 4P4RA 4HS8L 3JSSA 5EZIL 4ZTOH 1E4JA 4L4JA 9CGTA 3NN8A 1QSFE 5BXFB 2R0LL 3GO1H 5EFIA 3DX9A 3P0VL 2XTJB 4MXVE 5F7DA 4KI5C 1D9KC 5GGVL 1JF1A 1H5BA 1U8HB 3TVMC 3DX6B 3GUTA 2DMCA 3HMXH 5GSRA 1W0WA 5I17A 3EJZD 4X6DA 5BVPH 2VLKE 4W6WB 5ITBL 3SOBH 4U6VH 3MODH 1IAOA 2D7QA 4WUUD 5JR1H 2DLGA 3DHMA 1FL5B 4UMGA 4I0PA 1MRCH 3GSRA 5DJ2B 4OZFH 1EEYA 4U4BA 1CK0L 1RSFA 1CDCA 5E2UL 2OR8A 1H15B 1MJ8L 2VE6A 1MWAA 4WVRA 4FQHA 1IEHA 4JQIL 1X5FA 4PS4L 5JDSB 2Z92B 4HZLB 1SYVA 1OAKL 1FVCA 4M48H 4E41E 4KAQH 2PN5A 2BC4A 5CMAB 1NMAL 4LSRL 3QUKB 1FNAA 1IL1A 3DO7A 4HS6B 4Z8FL 1R3HA 1U8KA 5DC0A 4Y5XA 4LL9A 5GGTL 4FQQA 3ULVF 2IPKB 1G7HA 1RIHH 2HG5A 3SE3A 4YBLB 5FB8A 4OZHB 4KROC 5IESH 5LCVH 2HP4A 4X4XB 1KXVC 3TT1L 2V17H 3BP5B 4PRID 4TUJA 1J88A 2DQDL 3IXTB 5D7JA 5JPMA 4X7CC 2DYPB 4N0YL 4KGLA 4OFDA 4P5TB 3HAEH 3G04A 4MJ5A 4GKSA 1IAKA 1U93A 2C7UA 2X41A 4MS8D 2O5XL 1DN2A 1UM5L 2HT4C 4AMKL 1R3JA 1NLDL 2AXFA 5E2JA 1T5WA 5D7IB 1FCGA 1LO2L 3QNZA 1IAMA 4UT9H 5EC1B 5DMJB 1WBZA 4Z7WF 1D5BA 4MQ7A 1TTFA 2WINA 2H2SD 1U8IB 1SEQL 1PVHA 1R5IB 4WTZG 3V6OC 2PO6A 2MPAH 3UTZB 2N4IA 2VDNL 3UTPD 2BZDA 2YS4A 1T1ZA 4PRNA 5B8CB 3X3FL 4YDIL 3T0EE 1CIUA 4I3RH 4BZ1L 3DETD 1DSFL 2VNCA 1PJ9A 4R97B 3WIFB 4UUJB 1NKRA 3M8OH 1AXTL 1NC2B 5HDQH 4MNHB 4U1MA 4PY7A 2H1PL 5DQDL 4Z76B 4XRCB 2FD6L 1BQUA 5SWSE 3VFOB 1PKOA 4LLYA 1C5CL 4X6BB 5CWSB 4YWGL 4OFKA 5B38B 1IFHH 4XCCH 1KEML 1GGTA 1A4KA 4TQEL 4Q2ZB 3GMMB 3MRKB 1JNHB 4PGDA 4XMLH 1ONQA 1JIBA 1GGIL 5C08A 4JAMA 3UBXB 3ZKMD 3MX0A 3WNMA 3RI5F 4HCRL 4RAVA 4IOIB 1A02N 1G0DA 3N85H 1FG2B 3H0TB 2VZTA 1FZJA 5K9KB 2YR3A 2B1AL 3SE4A 4W4OA 5F9AC 2F58H 5IBUB 3IDJA 5EZJB 4JPIB 2EIZA 5IVZB 3V4VL 5BVJA 1K2DA 4QRSB 1HKLL 1QG3A 2P5WD 1OTUD 4L3EB 5E6IB 3TM6A 1ZVYA 1B4JL 4JANB 3CPLA 1CE6B 1WT5C 1D6EB 4CL7A 2XN9D 1RJLA 4N8PA 3P30L 1P4IL 3TIEA 3KNBB 4L8BA 3VG9B 4F37K 3DV6A 3GMLA 3LN4B 1Q8MA 1JWMB 4HV8B 4ZXBB 1KCSL 1MQKH 4WCYH 5FYJD 3O3BB 3K1DA 3QIUB 2EE3A 2VDMH 2DQCL 1MWAH 5F1NA 4QOKE 4YHYC 1T66D 1WFOA 5F1SA 2VLRA 5C07B 1ITCA 4PJDF 3HG1E 1ZLUK 1FO0L 2WIIB 3ZDXF 5HVGB 5GRXG 4DN3H 3JZ7A 3QJFB 5L8KB 1HDMB 1X44A 1UXWB 4HG4J 4PY7B 1NCTA 3OXSA 4OGAD 5BV7L 3ZDYF 1GOFA 4NFBA 5IBLC 1I1AA 4PYGA 1UZ8A 3GI8L 3T0EC 4IIQA 3HZVA 3ZKSD 2X05A 3TA3B 1E4XI 2CPCA 2IFFL 2NY3D 5FYLL 4F57L 1NFDF 4HSQA 3ROOA 3TO4D 4EI5C 3CFBB 3OPZH 3GMQB 5CEZL 3RWEA 2VTFA 4QRRA 4QY8B 5FYJL 4J2XA 4OLEA 1TVBA 1ODAA 1MJUL 2J6EA 5HHOA 1SM3L 3KPLA 3IDIA 3Q1SL 1RU9L 2E6QA 3GHEH 1ZVHA 3QB7C 5BZWA 2PR4H 2XXMB 1U8QA 1NAMA 3O4OC 4WO4C 4ACPA 3BVNB 1XGQB 5DMKA 3NACH 4XAKD 5ICZB 4JFDD 3IFLL 2A1WH 1BGXH 4TNWK 4N0CC 4CBPA 1G84A 3QP3A 1IARB 4ONFH 4KK9C 2PKDA 3QUZD 4PJGB 2FNBA 4Y19A 1L7IH 1YEEL 1F4HA 5DI8A 3PQYD 3WYRA 4CUCA 3C6LC 3DPBA 1KELL 1VFBB 3NCYP 3CGTA 3RAJH 4X7DC 1BP3B 2F53D 1F11A 1D6VL 1A6AA 1U6AH 4ZAKB 2DQIL 3H42L 3T1WA 4MNGA 4NC1E 4KPHL 3ULSB 2OR7A 4MCYB 4UNUA 2AJVH 4Y1AE 4F8QA 2X1QA 5F7FA 5BO1L 3AM8C 1CG9A 1RZ8B 4TVPH 5DYOB 3L5IA 1X9QA 4HUUA 5H37G 2R2EB 4J4PA 3QQ4A 5CSZA 5C0BB 1VPOH 3SKOA 2O93L 3EJYC 4AL8L 2HFGL 1E4XH 4ZS6C 3LHPL 4MCZA 2IAMB 4N9GB 2B7DT 2XRAH 4QCIB 3RX7A 1JPGB 3QEQD 5D7SL 1OGTB 1ZANL 4PRHE 1NL0H 4LSPH 4Y5VB 4OM1L 1T2XA 5FO7A 3WFHA 4MZ3A 4GMTH 1MAJA 4K8RD 4KJQD 1CGWA 3LEYL 5KSBA 1IGIH 4JKPL 2OSLA 4G6FB 4J23A 3S34L 1P7KA 2PXYD 3STBA 1R3KB 5D8JH 4NZUH 4C58B 3CLFL 3ROOB 3O41A 5E00A 4FP8H 5ENWA 4HWEL 5BMFL 5I1KL 2RAMA 3EYSH 3ZSTA 1OWRM 4HK3J 4KRLB 4JN1H 3I9GL 3V4PH 5GISH 2CXGA 5BQ7A 2A83B 4OI9A 1ACZA 4S1QL 5IOPA 3UTTE 4F7MB 2BRRH 2JCCF 4HDIB 4ODVL 3BDXA 2A6JB 2Y72A 3ARDC 3PL6A 4V1DE 1J10A 1Q9KB 3MLYH 4KTEH 1YY9C 2RJMA 3LKOB 2CJUL 2APXA 5I2IB 4U0RB 5GGUB 4K8RL 5DO2D 1XGYL 3BIAX 3M17B 4WENB 4YBQC 4EN3C 2V9TA 4FZEL 4JY5L 5HHME 1QBAA 5JORB 3BP7A 4KK6C 4WU5A 5AWNH 2WK2A 4NO0B 3O6KH 4X7SL 3X14B 1A2YB 1DDHB 4IRJA 3D0LB 4S1DD 3MA7A 1JVKA 3VGDA 2K7QA 3E3QE 1AXIB 5EUKB 5MEND 1U9KA 2WMPA 2L7JA 2DKUA 5ISZD 1ULVA 2XTJE 2ZCHH 3CSPA 4HK3N 3BZ4B 3D48R 4Z7QE 2XA8H 4ODTH 1ZEAH 4U1HA 4GKOA 3Q48A 4HUXB 3CFJB 2J6EH 4RAUB 3VRLE 2EIBA 5DUMH 1BPVA 4JGMA 3WUZA 4YK4C 1NAMH 1HOCA 1JGEA 1H3TA 3V7MA 2FX7L 3DMMC 5GGQH 4KRMB 1AKJB 2H26B 4MJ6B 4BKLA 1MCIA 4JO4H 5GRUH 2DLFL 4ZFGL 3C5SB 1WICA 1FH5L 5HGHB 3D6GA 2GJ6B 3IDYB 3QDAA 3GI9H 4DGVL 2AJZB 4MNQA 5I8KH 1ZV5A 2DJ4A 3CFCL 1LE9B 3R0MA 4S0SD 1JGDA 3LVEA 2XZCL 3UP1A 4R4FL 1KFAH 1T04B 3VI4E 2VZOA 1PKQE 2ERJB 3I2CL 3DUSB 4LLVA 4NKMA 1F02I 2R23B 4PGCB 1DJSA 5C0EA 1A7NL 1A6WL 2FH6A 1I8MA 2JJSC 2IPUK 4P9HH 5AYUH 1IMHC 2CLVB 1QYGH 2FBOJ 1CICB 2A73B 3MJ6A 3O11B 1A3LH 2DMBA 4U1LB 3BT2H 3KPRA 2R69H 2CSPA 2R29L 2ZUWA 4FXGB 3T77A 1QFWM 2OBGA 4OFIA 1IRAY 4QRUB 3Q5YA 5I71B 2X4RB 3UZVB 5JOEA 2C4FT 1WUNT 3UTSA 4Z77A 3WS6C 3ARWA 5DRWA 4KWUA 3VXMD 1PYWB 2B39A 4RRPA 1C1EH 4YPJA 4BM7A 4UQ3B 1XIWD 4JCLA 3LKRA 4RMUA 4NNXA 4P2RA 4MAYB 3QCVH 3TPUA 1CIDA 2M1KA 3U36A 1CXHA 5KVGH 4NQCD 4Z0BH 4H20L 1JGVH 3FRPA 1R5WA 3JTTB 4A6YL 4NM4H 5GJTH 5D7KE 1FE8H 4U05A 4PJEB 4KJPD 5I74C 1HI6A 1NBZB 2GFBA 4LCWB 3TBYB 2YRZA 5I1DA 3V6FB 1E6OH 1P69B 1ZA6B 3VE0A 3C60B 4DGYH 4XXCA 4X6DE 5CKGA 3MLRH 5T1DL 1OW0C 1EFXD 2X70B 5CZVH 4MDJB 4NKDA 3OHXB 5TQ2L 1FNFA 3L95B 3GMPB 4HXBL 1MI5D 4KZDH 2XTJC 4L9LB 4NKIH 1RIVL 5IB1B 4C4KO 1MRFL 2Q6WA 3TF7C 4YGVB 5EPMB 5L88H 3EOBA 3KHQA 3O3EB 2CDEB 4PJ8C 3NIFE 4CMHB 4MNQB 4RFOH 1D3CA 2DQHL 3G6AA 2CRZA 1AQKH 4LAJH 4BK5A 5FM5M 4Z7VA 3BUTA 4KDVA 4LSSH 4ZTPL 4BSJA 1A6VL 1BM3H 3SGKC 5GS1A 3O4LA 3DVNA 5FK9B 1EVTC 4JPVH 2OTUB 3JUZA 2VUYA 4BFEA 4L3EE 4E5XB 4HD9A 4HUNB 5JA9A 2JK5B 2IGFL 1MFCH 4Q9QH 1I8IB 1NGPH 3WNPA 1T0PB 3D39A 3HC3L 2H45A 4LCYB 2Y06L 3MBEA 2DM7A 4JM2A 1Q9WA 4DUWA 3FO9A 5LGJA 1J5OH 2EZ0D 5H94B 2XWTA 1BAFL 5F7NC 1DQLH 3C5ZB 2NR6D 3UTSB 4YHLH 4KRPC 4M1CC 2SEBA 2ATKA 4OLXL 1YDPB 3QPQD 3TGXA 3OTTA 1J1PH 5C09B 4P5TC 3MFFA 4YUEH 4U31A 3PJSB 1YEGL 3VXPA 5B4MD 3CXDH 3O9WD 1JHLL 5C07E 4UIMB 4AIZA 5I19L 2NXYB 3T3PF 5IFAH 3IJYA 4M61A 4QTIH 5GRJL 1PX4A 3GSXB 4P2OA 3O6LH 1ZHKA 1RUPH 5JPNB 3DOSA 3VE0B 1U3JA 4FQCL 1A6TA 1YQVH 4HX1A 1C8PA 2ZOKB 3GK8L 4NNYB 2CH8A 5B8CC 2HT3C 4R97C 4PB0L 5BW7C 4OCSH 1IKFL 4K7PH 4TVPE 2FJFA 1N7ML 3FAXA 3QUMB 1UB5B 1CL7I 4DVBA 3PGDA 3QCTH 5E2TH 2YD1A 4GH7B 5C08E 5CEXA 3IXAB 1S9WB 2H32B 5D6CB 3WS3A 4XC3H 4D9LH 4DK3A 1JTPA 1S7RB 3RVUD 2VH5H 3JV6A 1BOGA 4TN9A 3L9RA 3P77A 3O3AA 3SDDD 1OVZA 2NY1B 3UDWA 3RVXC 4JFZL 3OZ9L 2X5PA 1D5IL 3QRGH 3T2PA 4UILL 1FL6A 2FH8A 2XZAH 3MRPA 1IC4H 3KPSA 1FVEB 1HZHL 1INQA 3BDBA 3I02B 2X4OB 4LLUB 4YAQB 1EMTH 2R1WA 4BQCA 1HH9A 4DKFH 2ENSA 3LKNB 2RGSA 2GT9A 3D3VD 4JFED 1Q0YL 1UB6A 5E6IC 1YEFH 5F88B 2X4QB 5GRZA 5K59F 3AU1A 5I16B 5D7JC 1V8HA 4ODHL 3DV4A 3C5JA 4NBZB 3AFLA 4WI6A 2EEAA 4HHAA 5EIQA 2W65A 4DVRH 2OJEA 3K2UL 2FLBT 4FXKA 4D0CB 3V52L 2LVCA 5D70H 2R0ZH 4JQVA 5HYSG 3VG9C 4HEPG 3VWJA 2H32H 5C0BE 4M8QB 2UY6A 1MCWW 3O3DB 4R96B 3WJJA 1W8OA 3UJJH 3ZTNL 4ZXBC 3ZTJH 4XCYA 4LPVA 1N5YH 2DI9A 1T1YB 4BQ8A 1CL7H 3SKJL 1QKZH 3QEUA 4Z7UA 2YPVH 3QIUC 3G6DL 2Z4QA 4HPYH 1LWRA 4HX1B 1V7NH 2Q7YA 2B0SL 3HE6D 2EKJA 1HILA 3CZFB 1G7PA 3GNML 2NTSP 3NCJL 1LE5A 2AGJL 3QG6B 5EOTA 1PSKL 4L3CB 4X5LA 2R1YB 2PCPA 4PJBF 4N0FB 3C08H 1MFEL 4QRRE 3SCMD 1MCPH 3KYOA 1OP9A 1ZT4A 1LO3L 5JW4N 4IOSD 1VB9A 4JN2B 1JWSB 5GPRA 4APQA 1DBKL 2BVOB 4P4KD 2CRYA 1OP3H 1CBVL 3HC4L 1IM9D 1T5XB 2P46B 4FZ8L 4OQTL 2Y23A 3TA3C 2A6KB 4ETQB 5C7XL 2FO1A 5LWYH 3KYNA 3IETB 3QQ9D 1M7DA 3KDMA 4B0MM 1I1CA 3D85A 5IMLA 1CXKA 5SV4A 2NX5B 3RI5K 1HXYB 5IKCA 1NAKH 5FV2A 4HKXA 3RU8H 2VJXA 3FOLB 4Y19E 3PWJA 4LBEB 5DQ9B 3TJHC 5E9DB 3MLXH 2BJML 4OAWA 1VFMA 3TBTB 2NW2A 1NH6A 1KOAA 4X6CA 4PV8A 2R1WB 1G9NL 1YN6B 1MOEA 3I6LE 5FA3B 3WDIA 5B3NA 2VLLB 5DJ0B 4TPRH 1C5BH 4MNGE 3QHFH 1JBJA 1P5VA 3MA9L 1NGQL 1ND0B 1KXTB 1A14L 4KMTH 3WLBB 1CXEA 1DTUA 1KACB 2ZUVA 3P73A 2HFFA 4KI5F 4LP4A 5D1QB 2ZSVB 4HKJA 3CVHA 4BSWB 2NTFB 5KVEH 2JELL 5IM7B 2BNQD 3HPJB 4ZAKC 1JYNA 4LHUG 3VWJB 3RUGB 1F42A 1MF2L 3TN0B 1L6XA 2BSSA 4LNRB 4YDVA 1QO3B 2Y36H 3ARFB 3HRZB 1VEOA 3RPIA 2V5MA 2KH2B 1IGMH 2AJSH 4WFED 3HZYA 4EDWH 5F72S 3C9NB 4QTHB 1D5XB 3QZWG 2OJZL 4U1JB 5C9JA 4L8CA 5IJKA 4F7PA 1G7PB 2HLFC 1AD9A 2IAMC 4Z78A 1ZK9A 5KSBE 1OPGH 3FO1B 3BUYB 4MLSA 2OS7A 5ICXA 1XZ0B 3NBNA 1AGDA 4XNQA 1RURL 4I8DA 4V2CB 4Y5VC 3CSYB 4JO3L 2KPNA 4HIXH 2F8VA 1S7TA 3F65A 2YC1A 1OGAB 3RWJA 3GB7A 3MRCA 1QLRA 5GS0D 1JGUH 3SDXF 3LIZH 3OBAA 3HUJA 4QO1A 4HGWB 3WIHH 5HHNA 1KJVA 4LHQB 4ZO8A 4CMMB 5I8CA 2CR3A 4YHML 3MRNB 3T08A 1HKFA 3KR3H 5I1AB 5IB5B 5GJSH 4HIJB 5FF6B 1P4BH 4OAWB 3RIFF 1MIML 3EUUA 3IDMA 1CU4H 4P57A 4M03A 1EAPA 3U7YH 1FHGA 4QRPA 3QXAB 4U6HB 4ZUUB 3KLHD 4H5SA 2GITA 3MJ7A 3LEXA 5DRNB 5GS0L 2FATH 2P45B 3H7BB 1IEBA 2V2XB 3X12A 3H3KA 4XPTH 1XH3A 1I4FA 4F2MA 1ZS8A 3MRQA 3VXUA 3CVHB 4LCWE 4PJHB 4Z95H 3VA6A 1EEQA 2MMXA 1EO7A 4ZOEA 3BPLB 3SDCD 1PG7L 3H7LA 3PDDA 3DRQA 4P9HC 3WV0A 5FUCE 1TQCB 2QQLL 1KENL 1DN0B 1UVQA 4MXVF 5KZCB 4Q6YA 4PIRF 4X4YA 4ZUVB 4I48A 1NSNH 1M1SA 5DJCA 3PDOB 3TYGL 3FO2A 1DUYA 2HTKC 1DEDA 4JZOB 3QO1A 3W2DL 4YGAB 4JHWH 1WCBB 4NM8H 4G9FD 1DQQB 4XAWL 3LSOA 3ARBD 1I85C 4HWNA 5IW1A 3MRFA 1U8PA 4I13B 4MNQE 4KMQA 3O8XB 3VRIA 2NY5L 1EIBA 1IBGL 4F7TA 2QSCL 3QDMD 3W0WD 2YD3A 1MFBL 3S37H 4U6XB 4RMRA 3WN5A 5F9JB 3HNVL 4UZGA 4XPAL 4JRYA 1MHCB 1UH2A 1KPVB 2YD4A 1CR9H 1WFNA 5JDJA 4JFXB 1B9ZA 1I7UA 2FSEA 2JJTC 3CMOL 4MVBC 3B2VH 3S4SA 4GMSL 1OSZA 1GC1H 1S7QB 3LMJL 1BHGA 1N5AA 2PYEA 3CVHH 4FMKA 3DO3A 5HHPA 1ETZB 3FCTB 3KPRE 5GGSY 1FL3B 3TNMA 2GYSA 3C2SA 1DZBA 5I76B 5IW3A 4NQDD 3V5HB 5KSAB 1QSEB 2KKQA 1F90H 3H9SB 3UTSE 4ZMAT 5DK3A 3T04D 3VFSB 1CICC 4PLKD 1IGYB 3IDXH 3MNWB 4YE4L 3QA3A 4JR9L 1CLOL 4DTGH 5ESQB 3K0WA 3DXAB 2ZZUT 3MPCA 4LAQH 4WFHD 1A1MB 5I71C 2CMRL 3G5YB 4JDTL 2E6PA 2Z9TA 3OJDB 4Y4KD 5BS0A 4OCRH 1JPST 1N0LA 4OKDA 5IEHA 1U8LB 1I9IL 1F3DJ 5E24E 1Z5LB 3VXTA 1XF5B 4Q74A 5E2VH 5JW4M 1PLGL 2F54A 4K94L 4KDTA 4D0DB 4TTDD 1KBGH 4IRJC 1TMCB 2VR9A 1WBXB 3QUYA 3G6JA 4MSWB 3VDBA 1QR4A 4NQVA 2FYYA 1EO8H 1JZ7A 1JF6A 4M3KB 4OCWL 4CU8A 5I1EH 2YPKB 2VRAA 3TWCH 5E8OA 2X2YA 4DQOL 3VI3E 3NFNA 2A74A 1A21A 3C60C 5DVKA 2X4TA 3NGBB 1NGWB 2F58L 1ZGLP 2WWMD 3GMRA 5FUCC 4L4VB 4GG6F 1TJGH 5A3ID 3TCLA 5AAMA 2JE8A 5DD1L 3K81A 3LZFH 1BMGA 2MQ0A 4G3YL 4CVUA 5TDNA 4FQXD 3FOMB 2VXTL 2WNGA 3L5WB 1IGFH 4Z7VE 1A7PL 4HEME 3MRBB 3TEUA 1M05B 4HBCH 5DR5L 4CMHC 2AK4A 4GQ9H 2R39A 2ARWA 2ZNXA 4X7TA 5BOPA 3QDJD 1KV3A 3MLUL 4Y16D 3QNYA 1J1XL 4LNVA 2YPLD 4QXUL 4ISVA 1X6LA 3I6GA 2Q86A 4OZGA 4GAYA 3X13A 5F9WC 4GAJL 4PGEA 1YJDC 3S98A 1K3ZA 1KJ3H 3KPNA 1UXSB 4WGVB 1VKXA 4CJ0A 4GW1A 4P2QD 4JY4A 3QXDB 2ADFH 1IVLA 1I7RA 2VXSL 5K9JH 5B38G 5IVXF 1KN2L 4JKWA 1F2XK 2Z91A 1A4JB 2KQMA 1PG7X 4JREB 5HYIA 3QWOA 1Z9SA 2GY5A 5A2JH 1OB1A 4U3CA 4BH7A 3NFSL 1F6FB 2F74A 2Y4SA 2ZCLH 1KN4L 2VABB 3C5ZC 3G08B 3UBXG 3BGAA 3BMWA 4Y2DA 3L1OL 4D3CL 1N64H 3S35L 4NUJA 2LU4A 3MUGB 4XP5H 5EWIL 2X89A 4R6UA 4K3JH 3VXTB 4GXUN 3ZE0E 1CZ8H 2VUOA 4N5EC 4H8WL 15C8L 5LGHL 5IQ9A 5T1MB 4XP9L 3VDCA 2AQ2A 2CIIA 2OL3B 4B7IA 2ARJB 5IBUG 1ZHNB 2AEQL 2VDLL 5CJOH 2AQ3A 1J0YA 3AS0A 1J1OH 3RVWD 2AKRA 3CSBA 5LG1A 4RZCA 4AM0A 3MNVB 2IWGA 2Y5TA 1R6VA 3WE6B 5I18H 4XBGA 4L8SA 1QA9A 3AY4A 5IIEA 4GW4A 3HLAA 5HDLA 4J6RL 4TULL 3VGFA 3HZMB 4PG9B 3L5HA 2E7HA 4DKDC 1OARL 1GH7A 4M02A 1CXIA 3GKWH 2VL5A 3STZA 1ORSA 4U1KA 1BX2A 3UEZA 3U7AA 4OTXL 5ALCH 4MAUL 3V5KB 1KB9K 1RZFH 2PF6A 3CCHA 2C3HA 4WWKA 2NX5E 1GGBL 2VC2H 4ODWA 1MH5A 2YZ1A 3NIDE 4G8FB 3KPSE 1NLBL 1E27A 5A1AA 1DQDH 3U30B 5DHYB 1KG0B 4Z9KB 5E9DE 1QRNA 2DDQH 4X4ME 4XTRC 5FAAA 2QQNH 2NY1C 4O02H 3DYPA 3OKLB 1IILE 3SDAB 3GDBA 5EU4A 1SBSL 5GS1C 1MCBA 3TBWA 3LB6D 4ORGA 1YNKL 3TO2B 4N0UA 43CAA 2GIYA 2IH3B 5FYKU 4F3FB 2EH8H 1CCZA 2B5IB 4OT1H 4YPGA 1A9EA 2IQAA 4I3SL 1XR8A 5CINH 4JE4B 3GSUB 3MRHA 4JJ5B 4WDIA 1NCDL 3DGGA 1X7QA 2DBLL 3TH3T 2CDGA 1B3JA 2X1OA 4OLYL 1AY1H 3ZHDA 5D7LB 4OSUH 4JM2C 3L6FA 4PJCB 4YO0B 43C9B 1T0NB 1FAKT 4R4ND 3RUGE 1IGCL 2R2HA 4Y2DB 1F58L 4WY7L 5F8QC 3N9GL 1WQVT 2QADD 3B9KD 5JUEL 4JQXC 1BJMA 4PJ5B 3U6RB 3HI5L 3D18B 4LLWB 3FB5B 1I3UA 2IH1B 1HHGB 4LCIH 2E9IA 1X5KA 4K9EL 1AP2A 3IFPA 4Z7UE 3S3SA 1GGCH 3GEWB 4C56A 3L7FA 2XNAA 3MV8B 5DVNA 1ZLWH 1P84J 5HGGS 3CMGA 1YMMD 2ESVA 4NQEA 1E0OB 3FMGH 1AFVH 1Y18B 2AK1H 4XP6H 1JE6A 1RMFL 2Y7QB 1JHTB 4OFPA 4N90E 4W70A 4OLWL 5H35B 1E4WL 1IM3B 2DF3A 1I3GL 2Q8AL 2NW3B 4OLZH 2BSTA 1VGKA 2DQFB 4P2OC 3WFBH 4HC1A 1NUFA 1ZSDB 3FQWB 1AGEA 5IT2H 3UPRB 2F15A 4NO2A 2OTWA 4JFYB 4LFHG 4F8TA 3H9HB 3LEVL 2DQGL 2AJUH 4JRXB 4M6ML 1OM3L 3DBXA 4WHTB 1MLBA 2BDNL 4S2SA 3HCVB 5C6TH 2GTZB 3BEWA 3SKNB 2NY7H 1DVFA 2HH0H 2DQEL 4X99B 4O9HL 3H3PH 4XVJL 1KJ2A 1RFDH 4XGZA 2BVYA 1UCBL 1E27B 3QH3B 3DX8B 4LLMB 3O81A 3V95A 4HT1L 1SJEA 3UDWC 1OT2A 3QAZC 4M93B 5LJYH 2BVTA 2VDKL 3O6FB 1H3PL 3TH4T 1Q9LB 1U41A 3W11C 3GIVA 4R7DA 1DL7H 3AS1A 4OI7A 1FYTD 3NA4A 1FYHB 4MQXD 3S35X 5DVOA 3ETBF 5HPOA 1C7TA 1BJ1H 3ME0A 1UJ3B 5FYJU 3O6ML 1OY3B 1ADQA 2MNUA 3GSOB 5TH2B 2ADIB 3LKSA 4G7VL 3EYOB 1WLHA 3WO4C 5IB4A 1HINH 5HHQB 3Q6GL 1GXEA 4HF5H 5CD5D 3ZYOA 1M71B 1JNLH 3WUWB 3B5GA 3DUUA 1G7LB 1CGSL 3U7WL 5I66A 4N8CL 5JLZA 3BD4A 3IFNH 5D1QC 1Y6KR 4AIXA 2HJLB 4ZUTB 3FJTA 5ICYA 3VRLF 3WFEH 5MP6H 3BGMB 3OR6B 1HQ4B 3VXSD 2V2TB 4GSDL 3VWJC 1BVKA 3BQUA 3PNWA 5C8JA 3K8LA 3PXJA 3WJJC 4A2LA 3ARFC 1KC5H 1U2CA 4XB7A 5FUOH 2ORBH 5CSBA 1XGUB 4P23B 3VXNB 3VWKA 3CFDA 5DC4B 1F13A 4M1DL 5D1ZA 3FQTA 4HPOH 2AAVA 1J7VR 5KSVA 5KVDL 3OAZK 1BD2B 1BVLA 4DGIH 5LQBH 5C2BL 1GJIA 1AIFA 1BQLH 2AQ1A 3RFZC 3MUHL 3MO1B 1U3HB 3G9AB 3V4UH 3P4NB 3QEHA 2C3VB 5CFHA 3HUJE 2VDPL 3VI4F 1DLFH 3ARED 3GSNB 1FSKB 1QNZL 3I3BA 1AXSB 3MLZH 4CAGA 1S5HB 3ZT7A 3HPLA 2NQCA 3VJ6A 1Y6MR 4APQC 1A7RH 4XWGL 4YHKH 4CJ1A 2IAND 5ITFB 5JHLL 1QR1A 4PRBA 4XHJC 4GXUM 5HPMA 3STLB 1GVIA 4XNUL 1L0XA 4UT6L 3MCKA 5LXGH 5F7UA 3P9MA 3BAEL 2EC9U 1MFDH 3B6SA 3GIVB 4TOYL 1NUNB 5IW6A 3F8UB 2AJYL 3NA9L 3RTQA 4QRPE 1J8HB 5MI0B 1T6WA 3T65B 3EZ8A 2HN7A 1HCVA 1NDMB 3MREB 5HYJB 4PUBH 1ZT1A 4UDTA 1ITBB 2BOCA 5EZOH 7FABL 5FKPA 3ARGD 4O5LL 1RIUH 2ZP0T 4HC1H 5MERB 5CJXA 2ICEB 2B2XH 2QHRH 1YEKL 4X6FB 4RWHA 4LLQA 1TZIB 1ZGLB 4ZODA 2Y07H 4R8WL 4U1GC 1QFWI 3JTSB 1X5AA 1FC2D 1UM4H 5F93C 5LKNA 4X6DF 4YDLB 2NXZB 5F1OB 1DUZA 2G75A 4KI5D 3BPLC 1KJ2H 3HTLX 4YEEA 4KKNA 5E7FA 3U4AA 3RRQA 1U91B 4Z7WB 5I8OL 4MX7A 1CLZH 1TQCC 3MCLL 2EXWD 1FNEA 1I7ZB 1LGVA 3PHQB 1HNFA 5I1GH 2XWJB 3F7YB 1TTGA 5I0ZA 2IG2H 2YOCA 3INUL 4F9LC 4OB5H 4JRYE 1WTLA 3MMEB 3JV0A 2E3VA 1D5MA 2GUOA 2JB6B 1LEIA 1A9BB 1F6AA 1FFNA 5D6DA 4BYHA 5BRZB 5MEPA 1CE1H 3O8XC 4XI5C 5T5NG 3VFRA 1OLZA 2Q87A 2UUDH 2X4NA 1RZJH 7CGTA 2PYEE 4RWYH 5DD6B 5T3ZL 1UM6H 3B9DA 3EFFA 1WZKA 3VH8A 5FO8B 4PRPA 4X8JB 4CVXA 2QQKH 1CQYA 4G8EA 3RWCA 4GRMB 2XICA 4MMZC 5JNYB 2IBBA 3M1BA 1A1NB 3I75B 4RMWA 3L3GA 3TZVA 5FA4A 4XNMB 5L2KB 3PGFH 1N3NA 3IDNB 4JHZA 3BFOA 5F7KC 5CLTA 2P42B 1P4LA 2JIXD 5KSAC 3RIFK 2BNRD 3MXWH 5BS0E 2YXMA 1QFWH 1WJ3A 2HT4D 3EYFB 3IDGA 3AMLA 1MLCA 2IQ9L 3BZDA 3SJVB 2F54E 2AEPH 1VDGA 1BEYH 3R0NA 2VLJB 3G6JE 2AV1A 4Q6IB 2PYFB 5IHZB 3GJEB 3BZFB 5F1KC 1HYSC 2XT1B 4JVWA 4NOBA 1FQ9C 4WEMB 4LDLB 2P24B 5IV2A 2WZPD 3SE9H 3RKDC 3AVEA 4GRLD 1JFQH 3HI1B 3GJFB 5T1LA 1DUZB 1T1WA 4NUGH 2CKBA 4LSQH 3MRGB 1SVZA 4N8VA 3P4MA 5A16B 1B0GA 1TTUA 4PG2A 1QSFD 1PW3A 1UH3A 2ICWJ 3L7EB 4PJDB 2BVPA 3DI2B 5EOCL 3QFJA 3NGBC 4PPTA 1I1FA 4KK8C 1D5MB 1Q72L 4N9OB 1N8ZA 4RGMB 1CD1A 2AK4E 2Q1EA 4JFFB 2VLKD 4S10A 5CCKH 2GQHA 3EYVB 3SY0B 4Y4HA 4WI4A 4JHAL 3QO0B 3LS5H 3GIZL 3WN5C 3F58L 3L3JA 4FRWA 3D9AH 5HHVL 3GSVB 4JZJB 4OZGE 1U92A 5D1XB 3MACL 5SWZB 5IWLA 1NFDB 4JG0H 1RULL 1CDJA 4E9LA 2EDYA 4YDJB 3K4ZA 2EYRB 5IR1A 4D2NA 3JVGC 1SYSA 3GMOA 2HKHH 4G8GB 5CILL 1W72A 3O45B 4HKZA 5FA4B 2A6IA 1ED3A 1IKNA 4AENA 5H2BA 3GJFH 1ZLVH 1FGNH 4HWZB 1WEJH 1EHXA 4FTVA 5D7LE 5GRVL 3C09B 4P0DA 1OT1A 4BSVA 5I0DA 1TJHL 1MHHA 4EUPA 2ITDA 4LKCB 5CBAB 4LQ1A 5I75B 5TDPB 5F1IA 5A2LH 5JZ7D 3HNSH 1D5ZA 4PJ5E 3UZEA 3BKCH 3IDGB 4NJAL 1ZHBB 2YXFA 4O2EB 4JREC 1ZWIA 1L7TH 2AERT 4LPUA 3MR9A 3QIBA 2D0FA 1HXMA 3MV8E 1F8TL 4J8RA 1XF4A 3VFVB 3TC9A 3P4OA 4XMKL 4R26L 3BKJL 4KVNL 5EBWA 5IBTL 4X5XB 3MRIA 3E6HB 4M6NL 3KPPB 3EOAB 3N50A 4XP1H 4YDKL 1UYWL 3D2UD 1KB9J 1M6OB 2Q3ZA 1CT8B 3LKPA 5MEQB 2YD5A 3WCYA 2R2CA 4KDTC 4LKXA 4NN6C 4PP1C 5JXEA 3S5LB 3NCYS 4MA3B 2EYTA 2K7PA 5I1LB 2R8SH 4E42B 4CADA 1JNNH 4QXTB 4JKLA 4Q9RL 5E8DH 5IG7A 2Z8RA 1N4XH 1NAKL 2JKXA 3ZE1F 1L9MA 3T0ED 1KPRB 1LK2B 1IC7H 2DWEB 3FFCB 3SDYH 5CGTA 2D31B 3JWDH 4O58H 4UU9A 5DJYA 1CFVH 4QEGA 2E9WA 3QFDA 5GGTA 2EIEA 4OZIB 2D7TL 4JPKH 5SX5H 5D71L 5HI3C 3LQZA 3DVIA 4OJFL 4NQUA 1KPUA 1KTLA 5SWSD 4HQQL 4JG1L 4LPTA 2E9JA 1QRNE 2CLZB 4WUUA 1OAQL 5DMGC 1OAXH 2GEEA 3D5OF 2F9BT 2HJKB 3NZ8B 2H6PA 4KJWC 4UV7H 1EDQA 3UYOD 1S9YA 1LO4H 1S7XB 3VXRB 4N0CD 1NCBL 3W39A 3U30C 1R24B 5I6XC 1WGOA 4KK9D 1X5GA 4NRXA 3RGVB 1H3UA 5CHNA 4NZTL 5D9SA 4TSBL 3WHE1 3C6LD 2NY2C 2YEZB 1HSBB 1OAUL 3NFPB 3TIDA 1OSPH 4BQ6A 5GRWA 4JDZB 1EK3A 1OCWL 2JCCB 3EO0B 3Q3GB 2CKBH 1CDGA 2AXGA 4KQ4H 2XQBL 3KJ6H 2JJUA 3CJJA 4P5KA 5EIVA 4MXQD 5I1IL 3RA7H 2EDDA 2B5IC 4X9BA 4CN6A 2UZYB 4ENEC 4PRIA 1DBBH 2XFXB 2FDBP 1EJOH 1FNSL 5CSGA 1K4CB 2YHGA 2OCFD 1W0YT 3D0VA 5AD0A 5HJ3B 4XMPL 4NQXB 3BKYL 3U46B 3ESUF 4NHUB 4RIRA 4Y2DC 4ELKB 1OL0A 3EJYD 2ZPKL 4ZS6D 4QRQB 1A6UL 4ZG1A 1E6JH 3MLTB 4OF5A 3T1FB 3IKCB 5HDBE 3QIWB 3CUPB 5KSBF 4NWUL 4P5MB 1Z9LA 3R06A 3WIIL 4HCRA 5D4QA 4FQ2H 1JZ8A 2KDGA 4W4NA 3HN3A 1N26A 3HG1D 1QTYT 1AE6H 1W72H 3DLQR 2ZUXA 1NFIA 4ZD3H 1FJ1A 4WI5A 3CX5J 4ZNEA 2EKSA 3LDBB 4HS8H 5EZIH 4O51A 2E6JA 3KVQA 5F3HA 4EUPH 1QLEL 2R0LH 5E5UB 4PJ9B 2J8UA 1IQDB 1CGXA 3P0VH 2DICA 2V5TA 5GGVH 4HAFA 4YXHL 1LDPL 2PETA 2WWKO 1A64A 2YD6A 3ARDD 4WFFE 5K33A 1J8HE 5ITBH 4LHUD 4UQ2B 4Y4FB 1YY9D 3K8KA 4G42A 4NRYB 3FQUA 1TZGL 3MV7A 4PJIA 1N6VA 2MTPA 2VZSA 4HFWA 4ZDHB 3ULVE 5B3JE 4M93C 5D9SB 5IVNA 3K4AA 1MJJB 4EN3D 1CK0H 3QXTA 3K8MA 2Q8BL 3TIDB 2CIKB 3ZDZF 2F8OA 1F3RB 1MJ8H 3O0RL 1J0IA 5T5NF 5C0FB 4LSTL 3L3HA 4JQIH 3W9DA 1N2RB 4PS4H 5IJVB 1UJ3C 3PWPD 4LVNB 1FO0A 4HUVB 2P5WA 1OAKH 1B6UA 3WXVL 2Q20A 1AGCA 1KLFA 2VZ3A 1NMAH 4LSRH 1EV2E 4IS6B 1U95B 4PGBA 1YEDA 2XN9A 4Z8FH 4PGJA 5GGTH 4LPCA 4J1UA 4Z7WE 1PZ5B 2QEJA 1FNGA 2EE6A 3F12B 3KXFD 4P99A 3TT1H 3SGJC 4M7ZB 3SKMA 1Q1JL 4AQOA 3W9EA 2DQDH 4KKLD 3VFTB 5BZDB 2E8ZA 3GM8A 4Y1AD 3OAYH 4K2UL 1U0QA 3BPOB 2VXUL 4N0YH 4WFGD 3DMMD 3WJLC 3S8WA 1S5IL 1SJVA 1RUQL 4EI6A 4WW2B 4K7FB 5DS8B 3WXWL 2O5XH 5CGYC 1UM5H 4AMKH 1NLDH 3UYPA 1U58A 5BRZE 1LO2H 3U79A 8FABB 2YSSB 3ZKNC 1H8OA 1UQSA 4P23C 1Z0MA 1F4XL 4YXLL 5HYQB 1JHKL 2BX5A 1SEQH 4PRHD 1Q94A 4ONHA 1MREL 3S3PA 3WEXA 2VDNH 4M1GL 4UINL 4MQTB 3RX5A 1XCQA 5EU6B 2I27N 1FN4A 3X3FH 4YDIH 4BZ1H 2QKIB 1I7TB 2HFEA 4BA8A 1DSFH 1RHHB 2FIRT 3EW3B 4WI7A 5C0IA 1FSKC 1TXKA 3V79C 1AXTH 4JFPB 5C0DA 2W07A 5IMOA 4DCQA 4PREB 2H1PH 5DQDH 3TO4A 3T0XA 4GT7A 3QBTB 1A6ZB 2FD6H 2D4DA 2N7BA 5T3XD 3RZCB 1INDL 1QFOA 3MNZB 1C5CH 3MV7B 4YWGH 5HVWA 1VFUA 4HFWB 1MCEA 5I1JL 2MQ3A 1CFNB 1TVDA 1KEMH 3AAZA 3UTOA 4TQEH 1U8NB 4FFVC 4X80L 3ZHLA 3SJVE 4JFDA 4Y5YA 4V1DD 1GGIH 1U3ZA 2DTML 4L4TB 4LGPB 5MI0C 2VQ1A 1N6QL 2VLJE 4JGJA 4HCRH 1T22B 4ZUSA 5J13B 3QUZA 3NAAL 4ZFZB 3ULVC 3PQYA 1C16A 5EBLB 4EDXB 1K85A 3ECBB 1NCWL 1LK3L 1KLGA 3OJVC 2B1AH 3CFKB 3FQNB 3QWRD 5FDWB 2F53A 2FWOB 4MD5B 1P7QD 3V4VH 1H8SA 2W59A 4J1UB 4M5ZL 1IGFL 2XY1A 3PWVB 1HKLH 3MSPA 2AI0L 2B4CL 3U0TB 2BFVL 2MWCA 1MFAL 5T3XL 2H2PC 4ODUB 4PLJC 3DYMA 5DRZB 3T4YB 1B4JH 2Y5EA 2AV7B 3VI3F 5FIEA 4OD3L 1NGXA 1MQ8A 3P30H 4QRTB 1P4IH 4WI3A 4PJDE 2NXZC 4YDLC 2XTJD 2NY4B 3O2WL 5INCB 4EI6B 1G7MB 3BSZL 3DROB 2YN5A 5J1AA 3MJ8B 2UYLB 3LAFA 3ESVF 4DZ8A 4XH2A 4FQJL 4C83A 4Z7VF 1KCSH 3SBWA 5EUOB 3QI9B 3QEQA 4HK0B 1P6FA 1RK1B 3BIBX 2DQCH 3ZT5A 3BD5A 1FZKB 5CBEA 4Y8DC 2UWEA 1FO0H 5D2LA 3U2SA 4UOW1 1WWAX 4LLDB 1X5IA 5IFJA 2PXYA 2PTTA 4P46B 5E4IA 1HHJB 4NYLA 2PW1A 4JM2F 1P1ZA 4XPBL 2P49B 1S7SA 5BV7H 5E08L 1OQOA 3B43A 4NGHL 2VAAA 4QT5A 3MYJA 2B1HL 3GI8H 3IVKA 3KLDA 1R3LA 5HD8D 4MMXC 1G6RB 2F19L 2UVFA 2IFFH 3DNKA 4LARL 5FYLH 4B53A 2YA0A 4M1CD 5EU3B 4F57H 4Z18A 4QKXB 1IGTB 5CEZH 2HRPL 5FYJH 2DYPD 2QHLA 4IMLB 5DLML 1MJUH 2IALB 3DSFL 1RAMA 3MUY1 1CWVA 2DLEA 4P5TD 2GK0A 1SM3H 2EO1A 3Q1SH 1RU9H 3ELAT 2V7HB 2BNUB 3S96B 1VACA 4NZDA 4ZPTB 4XCEB 3ZE0F 5EO9B 2UZXB 4EVNA 3VFUB 2EDNA 5TF0A 3LN5B 3IFLH 5AZEL 3L3DA 3A67L 5F7MC 4ZPVB 5CJXC 3MRDA 2GCYA 1F4WL 2RCSL 1IT9L 1YEEH 3FQXB 4ZSOB 3C87A 5DRXB 4PJ7A 5MENA 4HIEA 1KELH 3QUXB 4NC2B 3FFCE 2HT3D 4HFUL 5D7KD 5AUMA 5ISZA 4C54A 1D6VH 3LOWA 5C86A 1ZVSA 5IHLB 2FO4A 3PWNB 2DQIH 1NC2D 5F8RC 5J9PB 4OZIE 3H42H 1VFAA 4D0BB 3C6SA 5DFVC 4KPHH 1UA6L 4ODXA 5J4MA 4XH2B 1LO5B 1NKOA 3MQIA 3DYOA 5IB3B 1O7VA 5BO1H 1JN6A 4TVSa 2EH8L 4GBXB 1RY7B 1AO7B 4ZUWA 4H26B 5FM8A 1KJMA 1XAUA 3NIDF 3RVXD 3I84A 2ICCA 3MUJA 1E4KA 2EDHA 3OR7A 4AL8H 4RGMC 2HFGH 3RY6A 2X09A 3LHPH 1NANI 3ROLA 4NZJA 4W6XB 4NWTL 1PEZA 5D7SH 4YHPA 1ZANH 1QEWB 2HLAB 2P4AB 3L3OA 3T4AA 4OM1H 3MRLA 3AGVA 4JZJC 3PWLA 2PTVA 5DK0B 5D1XC 3MRMB 4RMSA 3ARXA 2HFTA 5K9QG 2EDOA 5DJZA 1BF2A 4EZMA 3LEYH 5BJTA 1DCLA 2HT2C 4JKPH 4A6YA 3S34H 4KC3B 1CD9B 4R4BB 2ID5A 4WHCA 4L3ED 5E6ID 4IRSB 3P9LA 5ID1B 3CLFH 3JWDC 2GAZA 5BMFH 4HWEH 5I1KH 2M2DA 4LIQL 1X5HA 5DMIL 4QGTA 3RUGF 3C09C 3WHXA 3I9GH 4NPYB 4BFIB 4X6EA 5EB9A 1VFOA 4B7LA 3BO8A 2BXYA 4S1QH 2M26A 5EO0A 4DZBA 3G5VB 4KY1L 5C6PB 1QBML 3PIQB 3VXMA 3DURB 4ODVH 4Z7UF 1MVUB 2I5YL 4ZXBD 1XIWA 1G9MC 4CGTA 5HGAB 4PTTB 2G60L 1D9KB 3TVMB 1S7VA 2CJUH 3KLAA 2IADA 3HKFA 3QIUD 4OBSA 3FONA 4K8RH 4NQCA 4PBVC 4GUPA 1XGYH 4RFEB 5C07D 4FZEH 4JY5H 1NC4D 1XGPA 3GSWA 3KYAA 3V7AG 4R90L 3HS0A 2LTQB 1J0ZA 3CDCA 4X7SH 5GZOC 5HI5C 3WL9B 3EGSA 1NANH 1NBYB 2XPGB 4QHKJ 1GIGL 5L2JB 2NY0C 1EFXA 1HHHA 4I77L 3IJSA 2E7MA 4YHIA 4PG2C 1HQRB 5DVMA 2A77L 1AD0A 5HSFA 1MPAL 3TA3D 1MI5A 3OKKB 1WZMA 5E8NB 4TVPD 4HUWA 1IQWL 4PRAA 2BMKB 5E5MB 1KTDA 2VIRB 2HMID 2LV4A 2E8YA 2XKNB 3IFOB 3U1SL 4X6CF 3BOVA 3E6FB 1AGFA 4KROB 2FX7H 3TJHD 5C0GA 2FZ3A 1S9XB 1HSAB 2P48B 5F3BB 5C0CB 4QHLA 4I0KA 2DLFH 4ZFGH 2P8LA 2VXVL 4PFEA 1FH5H 2ZKHL 2VXQL 5D72L 3VCLB 5IWLC 1I3VA 3RL2A 4DGVH 1Z3GL 3CFCH 4A6YB 4HMEA 5KW9L 2KZ1B 4H1LB 2EYSB 3RGVC 1IE5A 1UWEL 2XZCH 5F7EL 4R4FH 3UTQB 3I2CH 5E99L 3OKDB 2MCPL 4UAOC 2GSIA 1A7NH 3BH8A 3VU2A 1A6WH 3UYRL 2HVKB 5IK3B 4I2XA 4NHCL 4ZAKD 4WW1A 3RDTB 2CUIA 1YECL 4RQQA 1P7HL 4LFHD 5HGBA 5DF0A 2DLIA 4Y0GA 4BH8A 3G5XA 5I73B 2Z0BA 2MHAB 4KUCF 1HHIA 2R29H 4DW2L 2AEWA 3QIBC 3DRTA 1EXUA 4HULB 3LV3B 5ID0A 3O9WA 3B3IB 5KANI 4GUPB 5C0BD 5CIPA 1UWGL 4BQ9A 4JY4B 1MUJA 2IAMD 3VDAA 5FGRA 1ZA3B 4L29A 3UO1L 2CO7B 1MELA 2Y9RT 5TDOB 1CFSA 1NEZB 4JFOA 5F7HA 3QIWC 1T4KA 5D5MA 3PHOB 2ZNWA 3HUJF 4DKAA 4H20H 1KLUB 3VGEA 4YHIB 5F89A 4A6YH 2UZIL 4V2BA 2I60L 2J8UE 3WUWG 5KSUB 3PWUA 2AEIT 4G6FD 2W0LA 3MFGB 1YUHA 4CDHA 1FCCA 5INDA 4OZ4A 1LHZA 3HR5A 5IMMA 1JWUA 5T1DH 1RZIB 4M6OL 1U8JB 2R4SL 2R1XB 5FECA 1JMZA 3LQMA 2B8OT 5TQ2H 3MV7E 4PJIE 3EKCA 4ZO6A 1GPOL 3BISA 3X11A 1YY8A 3SDDA 1RIVH 3CDGB 4QHLB 1KIUA 4E41B 3D25A 1MRFH 4PJXB 3VFPB 1BLNB 3VMPA 4Y4FC 2X9YA 3F5WB 2QR0A 3ZL4L 5KJRL 4LDEB 3FT3A 2DQHH 2P5WE 1FVDA 1OTSD 1BBJA 1DFBL 1I1YA 3KWWA 1CFQA 1TFHA 4R2GB 1A7BA 5JHDB 3QULA 4JFQB 5EU5B 4K55A 1JPFA 3PG2A 4ZTPH 1A6VH 4ZQKB 4NO0D 4POZD 1TVHA 1S7UA 5JOFA 4YHYB 4LVNC 3D3VA 1TZHA 4JFEA 4X5WA 5FYLE 3ES6A 2P5EA 5CUSL 5I8EA 5CD3B 5CJ8A 1ADQL 2HWZL 3OXRA 5CEZE 2XKUA 4OGYL 3VFMA 3HC3H 5FYJE 1RJYB 2Y06H 4F15B 1BAFH 1PBYA 3BP4A 4I18A 4OQTA 4HJ0C 1F3DH 4M7ZC 4OLXH 4X98A 2RFXB 5HVHB 5EUOE 4LRNL 3E0GA 1BQHB 4NSKB 1AKJD 4EI5B 1YEGH 2VR4A 4WW2C 4Y7MA 1DQJB 2OYPA 2WP3T 4JZNA 3V6ZA 1CI5A 3AS2A 1A1OA 2C1OB 4GRWH 4YX2L 1R0AL 1JHLH 2YN3A 4TSCL 5EIIB 3HE6A 2GJ6D 3OJ2C 3ZKQD 3A0OA 1QPPA 5I19H 3U4BL 3C8KB 4GG6B 4MVBD 2M8XA 3O4OB 4JDVA 4QF1B 5GRJH 5J89A 3GGWB 4WO4B 2E7LA 3GBML 2AABL 2IF7A 5HY9B 4FQCH 2YUZA 3SCMA 3GK8H 2ICES 4ZS7L 4OCYL 4P4KA 2YWZA 1F3JB 2FX8L 4JLRA 3U83A 1EERB 1ZLSL 1IM9A 4HWBL 4EOWL 4PB0H 1IKFH 4YHOL 1CICD 2V5SA 1N7MH 2D3VA 2DM4A 4LVHB 2YRPA 2HKFL 4JFDE 1X5YA 5HDOA 4U1NB 3BIKA 5A43C 3L3IB 3BXNA 5CIPH 3LQAC 3PQYE 2I9LA 4JFZH 3OZ9H 1D5IH 3IB4A 2F53E 3G6JF 4PP2B 4WU7B 4UILH 1T20B 4G5ZL 3CSGA 5IVXB 4MAYD 1HZHH 1G7IB 4YXKL 2UY7A 2D0GA 4KMLB 4TUOA 5J13C 1CGUA 4ZSOE 2GW5A 2WBJB 1GHFL 1KIRA 3DARA 4NDMB 2R0WL 2P5EB 5HYFA 1RK0A 25C8L 1I75A 3FTGA 5DJDB 4BZYA 2CO6B 5JW5A 3NOIA 3O2VL 2DMKA 1EGJL 1T3FA 3Q5TA 4G80A 1FZOB 4LCWD 5M95B 1OTTC 2BNQA 5K9OB 4HIIB 4NN7C 2XA3A 1Q0YH 3C60D 4NT6B 5J0BA 4QOKB 1DANT 5CJQL 3C8HA 3DWTA 2N7AA 5BCAA 4ODHH 4P3CL 1GZPB 1PD6A 2Z31A 4R7NA 4NO3B 5ABDE 4JGUA 3K2UH 3RNKB 2NY4C 3V52H 3DVGB 1X3DA 3I6KA 1KIQA 4OUOA 1HHKB 4BZ2L 3CK0L 1QVOA 2UWEE 3DTXA 2EDFA 3ZTNH 2VISA 5D2LE 4MNQD 1T21A 3QI9C 4OZGF 1K4DB 3RWDA 3FB6A 4KQ3L 3ZLQC 4O4YH 1TCMA 3G6DH 4AEFA 2VITA 5DEFA 3V2AR 2B0SH 2FJGB 3REVB 4ALAL 3GNMH 1YEJL 4FQIL 3NCJH 4F33B 2AGJH 3FHQA 1PSKH 3CU1A 4M62L 3S3JA 1TETL 4PJFB 2NY3C 4DKEL 4P46C 5C0AB 2ITCB 1T7XA 5ANMA 2DB8A 1MFEH 5JIIA 1VESA 1LP9A 1LO3H 5IB2A 3QDGB 2A38A 4CVZB 1DBKH 4LSUL 3VXQB 3LKQA 5EBMB 1CBVH 3HC4H 4MB5A 1P9MA 3PV6B 4FZ8H 4OQTH 2IFGA 3OX8A 1QQDB 3C5ZD 3UTSD 5C7XH 1IC5L 1LO0L 1N4XL 3V5DB 4LRIC 1FV1B 3QQ3A 1KB5B 1G6VK 1I3RB 1HK6A 4Y5YC 4N5ED 2O61A 4HH9B 1N59A 1YNLL 4KDWA 5C09D 4FS0A 2BVEA 4PR5A 4OF3A 5GZND 2J8HA 4TUOB 4ZFFB 1BZ9A 3QUZC 5A40E 2BJMH 5F6IB 5LAXB 1QLFA 4FQLL 1C12A 1YJDL 1G9NH 3ARPA 2DI8A 4TRPL 2NXYD 3FRUA 2A9ML 3TYFB 1UACL 1B0RB 1K5NB 3SDCA 2DD8L 1IC1A 3MA9H 1NGQH 3Q0HA 4IMKC 1A14H 1A6PA 3QUXC 1IEAB 2Z31B 4PV9B 3RY4A 3K1KC 2JELH 4KTYA 1IAIL 4OIAA 2L4OA 4WHYH 3RX8A 2FJHA 1FFPA 3NPSC 4XZUB 1MF2H 1FFOB 4G9FA 4ZYKA 3ARBA 5EO1B 1KNOB 4LMQI 3QNXB 3IRPX 2H8PB 2XXCB 4XTRD 3QDMA 3W0WA 2NY1D 1AC0A 3CC5A 3ZZ1A 5EBGA 2OJZH 3HE7B 3IJHB 4S0TD 3N1FC 5KS9A 3S5LG 4GKNB 1FGVL 4K8RC 1WWBX 1X6NA 2DN7A 1R3IL 3PDGA 3RNQA 5E8PA 2C1PB 2QSVA 1CLYL 3EDKA 3FT2B 1K8IB 1C5DA 3UTTB 12E8L 5DUPL 1RURH 4U3HA 1OP3K 4JO3H 4MA8L 4OZFB 5KN5A 3BRFA 3EOTL 1B90A 1NGYA 4YIQA 1AQDA 5B39A 4MJID 4WEBL 3QUML 4NQDA 1BZ7A 4M7LT 1AHWA 2UV3A 1G7QA 3VRJB 4IRSC 1FORL 5E8EA 4CNIB 4AZ8A 2R15A 1MCLA 4PTUA 1CTNA 3OKNA 3JBG7 5HHMB 5FOBB 5I74B 2W0FA 1RZGB 1WFUA 2YD2A 4GW5A 1U2HA 4LQFL 3KPQB 4YHMH 3V8OA 8CGTA 3L3KA 1RZKC 5DD3L 3LRSA 1UG9A 5E1AA 2DWDA 1OLLA 4Y4KA 2D9CA 1G0YR 1MIMH 3IAGC 5DO2C 4TUKL 1Y0LA 1EUTA 3PUCA 5HDBF 1XF2A 4PB9L 2CLRB 1F2QA 4HUMB 4XPHL 1U8MA 3HAEB 3WBDA 5D96B 1H0DB 2VSDA 4K23L 4QHUB 3UCRA 3FZUD 5GGSB 5GS0H 1Q9OB 2AJXL 5SX4I 3HMWL 4PJ8B 5GGVY 3SEPA 1MI5E 2LTQC 1YZZA 3WSQL 1PG7H 2FBJL 5ERWB 3MRRB 1G7JA 5C0NC 1K8DB 2QQLH 2WBWB 1KENH 4L1DA 4KJYA 4ZFOB 4I5BB 3U0PA 1RV6X 3TYGH 1ZHLB 4DWHA 5IF0A 3GSQA 3FFDA 4PJXE 4FQXA 4F7CA 2EEBA 3RQ3A 3W2DH 1BVZA 3W11D 1PKQB 4XAWH 2I9TA 4GRWE 2NX5D 3REWB 2DKMA 5JOPE 5B3JF 2NY5H 1IBGH 2W9DL 2C3WA 5ADOL 1VEPA 4EIZC 6FABL 2QSCH 4KRPB 1MFBH 1DBJL 3QDJA 5E9DD 4KH2A 4O2CB 3NTCL 3HNVH 4Y16A 5JHDE 3TLRA 1FIGL 4U49A 4XPAH 2YPLA 1JP5A 4YIQB 4LCCA 1DE4A 2XZZA 1EX0A 4U1SA 5KG9A 4WTZA 1WSST 4Q58C 5F97E 3CMOH 2OXHA 4WHDA 2GSGB 3OKYA 2MQCA 4KVCL 4GMSH 3BH9A 4QXWA 3FB8A 4P2QA 1JZ2A 3GBNL 3LMJH 2X4SB 5ESAB 5ALBL 3RVVC 2X4PB 1SMAA 3V0VB 4NZRL 4WWID 1J05B 5J6HB 5D1QD 5HGDA 5FYKD 3ZYIA 4HIHB 3HB3C 4G8IA 3TBSA 1I8LA 3L3KB 1ZXQA 2CDFA 3RIAF 5EZLA 5SX4H 3RDTC 2DWDB 4P4RB 1CDIA 4FOMA 5J11B 1KSRA 3TN0D 3NN8B 3HZKA 1FNLA 4NRZA 3BZEA 5LVEA 4YE4H 3ARFD 4JR9H 5EFIB 5I73C 4JO1L 3DX9B 5CEYA 1CLOH 5F7DB 3HHRB 4OKVA 1JF1B 1I9EA 1H5BB 3KYKL 3GUTB 5GSRB 1W0WB 2CMRH 5H8DA 5A2FA 5DJ6A 4JDTH 5I17B 3UPAA 4X6DB 3VA2C 1HEZA 1I9IH 1IAOB 3ZT6A 4GG6E 1JPSL 4W81A 4N90D 5E6ZA 2F5BL 3F6LA 4YHZL 3FN3A 4I0PB 1PLGH 3GSRB 3PE9A 4K94H 1EEYB 4EBQL 1FG9C 2QV2A 2D0HA 5FYKL 5FCSH 2VE6B 1OGAD 1MWAB 4FQHB 3ALXA 4OCWH 5JW3L 5F44A 1AI1L 1SYVB 4XHJD 4TTGA 1FVCB 2J3SA 4DQOH 1VEMA 2BC4B 2OZ4L 4F7CB 4P3DA 4WEUD 1W0VA 1IL1B 2G5BA 3DO7B 1R3HB 1U8KB 2FIKA 3CFEA 4Y5XB 4FQQB 1Z2KA 5L8JB 1G7HB 2HG5B 3DUHA 5DD1H 5FB8B 1YYML 4KKAD 4G3YH 3BP6A 5EOQL 35C8L 4TUJB 1D7FA 1SVCP 2VXTH 5D7JB 5JPMB 4G6JL 1ZMYA 1A7PH 3S7GA 4X9IA 3U4EA 5IVXE 4U1SB 3G04B 4MJ5B 3G5ZA 5DR5H 4GKSB 1IAKB 1U93B 3GMNA 5SWQA 3ZKXB 2C7UB 2LVEA 3D3VE 1OHQA 1R3JB 2AXFB 3MLUH 1T5WB 2MSPA 2P5EE 4G9DA 4R2GC 4J3VA 3QNZB 1J1XH 3N1GC 4QXUH 4MJ2A 1EA9C 1WBZB 1D5BB 1DEEA 4MQ7B 4X9FA 2WINB 4M3JA 1YPZA 3KJ4C 1DLHA 4L5FL 4GAJH 5EZLB 3RZWA 2PO6B 3KYMA 2D2OA 1X4YA 2NR6C 1AGBA 1T1ZB 2VXSH 4PRNB 1BFOA 1KIPA 3B9KA 4OIIL 3OKOA 1KN2H 4KK5C 5ACZA 5KZCD 3TFKD 3IF1A 5DGQA 3T0DA 3FN0L 2JJWA 4MA7L 5ETUA 3UJTL 4F15C 1LNUA 4U1MB 3NFSH 1KN4H 1URLA 3VXOA 4G6AC 5IMKA 3MXVL 3OV6A 3L1OH 4D3CH 3S35H 4LLYB 1YMMA 5EWIH 5DJAA 3FT4A 2WBKA 4MYWB 5HVHC 3O8XD 2FECL 15C8H 2FHFA 3HC0A 4H8WH 4XI5D 5LGHH 4XP9H 4GLRI 1JPTL 1YMHA 1A4KB 4YEFA 4KKCC 1KUMA 2AEQH 3E8UL 1S78C 2QLVB 4R0LA 2VDLH 3D69A 4PGDB 1ONQB 5C08B 4E0RA 4JAMB 3BEVA 4EXKA 1LVEA 5ESVA 4RAVB 1IGJA 4PJFE 1K6QL 3AXLA 4K07A 5TE7L 5KAQG 3EYQC 3CIQA 3NCCB 5C0AE 1FZJB 4LDOB 4UV4L 4J6RH 3CLEL 4TULH 1ES0A 3IDJB 3LN9A 1XCTA 2EIZB 3QDGE 5BVJB 1OARH 1K2DB 2NZ9D 1WZ1L 5KSAD 1QSED 1G9EA 3H9SD 4GFTB 5I1HL 3SDDC 4PJAA 4OTXH 4FMFA 1UCTA 3CPLB 4LVHC 2COQA 4MAUH 1EEZA 3KS0J 4XWOD 4YNYA 1RJLB 5I30L 1UJTA 1EO5A 3TIEB 1FYTA 1GGBH 4L8BB 1NLBH 1ZOXA 4QXGL 3DXAD 4LF3A 3SKUD 2ATPA 3DV6B 5DQJA 3GMLB 3MOAL 1HYSD 2CR6A 4MD0A 3RKDD 1PQZA 4O2FA 1SBSH 3MC0A 5IEKA 2BNQE 1YNKH 2W0KA 3VFNA 2PW2A 5F1NB 1H3VA 3LH2L 1KT2A 2WBJC 4I3SH 4Z0XA 2VLRB 3AUVA 1QSVA 4GLRH 4XT1C 1NCDH 2DKSA 2V2WA 2EIDA 4JHBA 3X17A 2IC2A 2DBLH 4WFEE 4OZIF 1JL8A 2NNAA 4OLYH 4GAGL 3OWEA 4YHNA 3OGOE 4KHXL 2XWBA 3OQ3B 3OXSB 4OGXL 2CKNA 2X6MA 3VXSA 1IGCH 1F58H 4WY7H 1I1AB 3N9GH 5JUEH 1UZ8B 4L4VD 5TJWK 1SJHA 3HI5H 4IIQB 3HZVB 1NBVL 1KCKA 4K9EH 4XVSL 3ULUD 4MDIA 1F45A 2X7LA 3RWEB 4QRRB 3P3YA 5TGBA 1LILA 1TVBB 2RBLA 4XXDA 3VG0L 1M4KA 4QHNA 5HHOB 5ILTL 3KPLB 3IDIB 1RMFH 4NFCA 4OLWH 1E4WH 3EFDL 5BZWB 4KTDL 1A5FL 1I3GH 1U8QB 1NAMB 1TITA 1KGCE 2Q8AH 3AREA 3JV4A 2E7LC 5ANME 5DMKB 1CFTA 1LP9E 5CGMA 3MOBL 2ZUUA 5FGBA 5JO5A 4OV5A 5JXAL 2IANA 4PJBA 2NMSA 2R0KL 3LEVH 3MV11 2DQGH 4YH6A 4I4WA 4M6MH 1OM3H 4Y19B 2APVA 4KI1A 2BDNH 3SE8L 5DI8B 1T89C 3QG7L 1S8DA 4L8DA 3L5XL 4OCLC 2DQEH 4O9HH 4XVJH 3ULUL 1F11B 3BESR 3QRFM 1FPTL 1A6AB 4LGSB 1UCBH 4Z7NE 1BWMA 3IGAA 4MNGB 4U6YA 4HT1H 5L7XL 1UC6A 3MLPA 2VDKH 2X4UA 3MV01 1H3PH 2AS5M 1LDSA 3ARGA 5FO9A 1CG9B 4GXVL 4OQ1A 4HLZG 5E2WL 4HUUB 2FR4A 1L6ZA 1OWWA 4NC1C 3QQ4B 3O6MH 3IDUA 5CSZB 3SKOB 5JQHC 5F6IC 3N06B 4MCZB 1JV5A 4G7VH 1A3QA 1B6DA 4PY8I 1L0QA 4YHNB 3Q6GH 4ZOBA 1AH1A 1E28A 4ZO9A 5FO7B 4G9FE 3S36L 3WFHB 5DURB 1F5WA 1B0WA 1CGSH 3U7WH 4N8CH 4AEEA 2O5ZL 2Z31C 5KSBB 1QFHA 2OSLB 1ZLWK 1P7KB 3QDME 3W0WE 4HS3A 2YBRA 3O41B 5E00B 5ENWB 3T2NL 4GSDH 3QXWA 3MROA 1WC7A 5E03A 5KS9E 3MZTA 1I9RL 2OL3L 5BQ7B 4WV1A 5HTSA 5E6YA 2VKXA 1KULA 4M1DH 5IOPB 1XF3A 3PGCA 2X10A 2W91A 4OD1L 3RWIA 5KVDH 2A6DA 3PL6B 4UDUA 5E95B 5C6WH 5C2BH 3HE7C 5J7CC 3SDAD 5GS0C 2VDPH 4HJGA 1QNZH 4FNLL 4IHOA 3BP7B 4WU5B 4HWUA 5FKAA 2I07A 1NDGA 4XWGH 2H3NA 2JIXA 2BY1A 5D7LD 4IRJB 5JHLH 1P9MC 2WSKA 3MA7B 2BNRA 2XZQL 1DBAL 2D9QB 5DUBA 1T83A 4XNUH 4PD4K 4UT6H 1BIIA 2AW2A 5JIKA 3BAEH 4PJ5D 4TOYH 1TCRA 1QUNA 4N1HB 4WW2F 1BFVL 2AJYH 4NO5A 3NA9H 3CH1A 4TSAL 1YEHL 4JEGB 4U1HB 1PFCA 2HJFA 3MV8D 2NY5C 5GSVA 4GKZA 3V6OA 3E3QC 2VWEE 7FABH 1A7QL 3FB7A 3OKMA 4H1LG 4O5LH 1HOCB 2HTLD 1JGEB 4GRLA 1FFRA 2R4RL 4BKLB 4UT7L 2WLYA 5D96C 1PY4A 2J8UF 2BSRA 1YEKH 3OB0H 1S7WA 32C2A 4LEOA 2HVJA 2R56L 4R8WH 3OKEA 4XCNA 1XGTA 1QSFA 1TJIL 4JRXD 3VD7A 1JGDB 2YKLL 4EEEA 4LLVB 5C0EB 4HZAA 4NKMB 4PJIF 4RNRA 5I8OH 3MCLH 5D2NA 5TE4L 1I8MB 3BN9C 5F9WB 1P2CA 2VLKA 3THML 1OF2A 5HI4D 4Q97A 3WKNA 4OFYD 2OX5A 3INUH 2FHCA 2OQJA 3O6FD 2ZG2A 2C9AA 1ZE3C 5DSCA 1NEZG 3KPRB 4KXZI 4MD4A 1JRHL 3T77B 3BKML 5KANG 5GHWL 1REIA 4ELMA 1MCSA 5C0JA 4Z77B 3RL1A 5DRWB 2ZOLA 1CLCA 3U0WL 5E56A 1FRGL 4K94C 5DEGA 3LKRB 1LEKA 1WT5A 5T3ZH 4NNXB 3KPMA 4P2RB 2P7TA 5JQ6L 1FLTX 3TPUB 1QPXA 2P44B 4XBPA 5CZKA 3ZO0A 4KHTL 5KAQF 3U36B 1AHWC 3O2DL 1RI8A 2J2ZA 4L1HA 1R5WB 1NJ9A 1R5VA 1UEMA 1HI6B 2GFBB 4CN1A 3S36X 3A6OA 3OAUL 4K3EL 3G9VA 3PABA 3S97C 4L3AA 5I1DB 3RP1A 3DX7A 3MTRA 4J7RA 5FHAL 3BWAA 1HH6A 1VCAA 5EUOF 1JUFA 4NKDB 5J11C 4ZOCA 4JB9L 3EAKA 4OUUA 1LEGA 1YC8A 5J6GA 1SY6A 2IQ9H 4P23D 2BOBA 5C71A 4NOFA 3D2UA 2Z35A 1GAFL 1H5BC 2Q6WB 5TE6L 3DJ9A 2YK1L 3EOBB 1BD2D 2BVUA 3PP4L 3IU3A 3R1GL 1VENA 3MGTA 2VWEC 4LEOB 4G43A 2ENYA 1U3HD 2ED9A 3G6AB 3T0EA 1GZQA 2EDKA 3EO9L 2Q76A 4I0PC 5DA4A 4DEPC 5IGXL 4KXZH 3TNNA 2C4FU 4Z7VB 3IU4L 3Q6FA 5CP7A 4U3XA 1T0MA 1T1XA 3AC0A 5GS1B 3O4LB 5I15L 3DVNB 4R3SA 1IAIM 5A3IC 3SPVA 2NLJA 5DJXA 4FQXC 2G2RA 5EOCH 4FFVD 3CAFA 1BQHG 2WQRA 1Q72H 3D39B 4Y5XC 2I24N 2UUDK 4WFFD 3MBEB 4FXLA 4EIGB 5HYSA 4JM2B 4ORZC 1Q9WB 3SE3C 1J8HD 2P8MA 3FO9B 5E94A 5LGJB 2XWTB 1C08A 4JHAH 3ALWA 1CDHA 5HYJD 5L9DL 2SEBB 3GIZH 4G7YL 2ATKB 3F58H 4H8WC 3ULVD 5HHVH 1T6VN 3C6LA 1RVFL 4NKOA 1XF1A 3N0PB 3GSNL 4LCCC 3RWHA 3MACH 1YPZE 3MFFB 3BPNB 5GIRA 1RULH 2ADJA 3VXPB 3ZKXC 5CLWA 1TPXB 2J88L 2BCKA 2VLRE 4JVPA 5CILH 2H2PD 5TF1L 4PLJD 3GRWL 4AIZB 3HRPA 2Z8SA 4H25A 1TQBC 3IJYB 3RIAK 3AM8A 4M61B 2NXZD 4P2OB 1ZHKB 4O4YL 1DBML 1WIOA 1TJHH 1A6TB 2PO6C 2OLDA 1I8KA 1JUFB 3IT8D 3QHZL 1MY7A 3NMEA 4NJAH 1P53A 4OM0L 2VMFA 1CF8L 3MGOA 3BHBA 3ULVL 3ZE1E 2G9HA 2D7PA 2FJFB 2DL2A 1HIML 3KPOA 4M9PA 3WKML 2UWEF 1F8TH 1MJ7L 4B41A 2JTDA 4DVBB 4TNVK 3PGDB 5D2LF 5CEXB 4XMKH 4R26H 3BKJH 4KVNH 3WS3B 5HHOE 4WJ5A 5IBTH 4M6NH 5BRZD 2NPLX 3JV6B 1BOGB 3L9RB 4YDKH 1UYWH 3P77B 3HG1A 3O3AB 5C9KA 5A2IH 2AXJA 3QAZB 5KTEL 4PRDA 1YN7A 2W60A 1MNUL 1FL6B 1WFTA 4U1IA 2EXYD 3OL2A 2MOVA 4Q9RH 3T0BA 3MRPB 3KPSB 1INQB 4XVTL 5EA0L 3DIFA 1GRWA 4EJ1C 1RUML 4P9ML 1XGRA 5DJXB 4MA1B 3SQOL 3SE4C 3QJHA 2D7TH 4W4OC 5L2KD 5DD0L 3WO4B 5D71H 3ARDA 4OJFH 1HH9B 2BY3A 4CKVX 4HG4K 4LHUA 4HQQH 1YNTA 2GT9B 4JG1H 2ZCKL 1UB6B 1OAQH 4OD2A 4D8PA 3AU1B 3MRJA 1UWXH 3TBVA 4ODSL 3HNTL 4K9EC 3DV4B 2Z93A 3B83A 3C5JB 4AH2A 4EN3A 2AXHA 1ORQA 5GS2H 1M7IA 4HHAB 5AZ2L 2NYYC 2W65B 1XR9A 2P8PA 2OJEB 3SJVD 3RGHA 2P47B 4FXKB 1ZT7A 3QZWA 3ISWA 1OP5H 3MJ9L 4PJ7F 1NCBH 1CTOA 2IMNA 5IQ7L 3GJFK 2VLJD 1EVUA 1ZLVK 5F9OL 3PWPA 2AJ3A 4NZTH 4WNQA 3LY6A 4TSBH 2V9QA 4XCYB 1OAUH 1OCWH 2ZSWA 3VFWA 5FCUL 3QEUB 1RJZA 4Z7UB 2XQBH 3X3GL 2Z4QB 5I1IH 2Q7YB 1EEUA 5DFVD 1F4AA 3KXFA 1HILB 2E7BA 1FNSH 1VSCA 1LE5B 5EOTB 3RVTC 3TV3L 3F6IA 4Y1AA 4LVEA 4LCUA 3OGCA 2PCPB 2OK0L 4XMPH 5DGRA 3DMMA 1JK8A 3BKYH 2H9GA 3MYZA 2J7LA 2HYMA 3KYOB 1ZT4B 1NGZA 1I1AC 4APQB 4M9OA 2ZPKH 1YEIL 4JFFD 4IIQC 2YA2A 1CYGA 1WITA 1A6UH 4YZFE 3WNLA 5M7QA 2DLTA 3F7VA 1JYWA 3KYNB 4FQ1L 1FZMA 3ILPA 1M7DB 4PRHA 3EHBC 3KDMB 5IMLB 3D85B 4LSVL 4NWUH 3WIIH 4I1NB 2X44D 4AT6A 1MCKA 5D1XD 4D9RE 5SWZD 5IKCB 1WBYA 3FO0L 4HKXB 2YUVA 5ADPL 2JJSA 3PWJB 5DDHA 2BVQA 5SX5K 1SEBA 2HT2D 2GJZA 4G8GD 2NW2B 4X6CB 5GGRA 4PV8B 3VGAC 3IAQA 1OAZL 2J8OA 5T33L 1VADA 1AC6A 3U9UA 5MEOA 4OF8A 4OCXL 1QLEH 3RWFA 1AR2A 3ZDZE 2D4FA 3MJGX 4YXHH 3P73B 2HFFB 3ILQC 1LDPH 5DK2A 4HKJB 4U1GB 2FL5A 1M7IB 1CGTA 4GG8A 1V3LA 1RZ7L 4V1DA 2XACC 4DK6A 1A3RL 5EN2A 4MQXC 1N0XL 4XPGL 4OBRA 1TZGH 4WGWB 3VGBA 4CW1A 4HGMA 3CVIL 2BSSB 4X9HA 4YDVB 1ZTXL 3RPIB 1U8OA 3BW9A 3NCBB 3HZYB 1C7SA 2Q8BH 1AR1D 3LRGA 3QWRA 3O0RH 5T3ZE 2GI7A 2V7NA 2VZUA 4LSTH 4OZFG 1P7QA 2EDBA 1WISA 1FBIL 5GZOD 4J4PC 5C9JB 3WXVH 4L8CB 3ALPA 4F7PB 1AD9B 4K3DL 4Z78B 4N0RA 5L6YL 3S6CA 3OF6D 5BXFA 3FFCD 5ICXB 1AGDB 1U42A 4G6ML 4RMVA 4XNQB 5T1KD 1U8HA 3DX6A 1S7TB 1NUGA 2YC1B 1G9ML 3RWJB 3GB7B 3MRCB 1QLRB 4ZNCD 1Q1JH 2E7CA 1YYLL 4PJXF 2ZWLT 3HUJB 4K2UH 2VXUH 3F7VB 2NY6B 1FL5A 1S5IH 5HHNB 1DP0A 1NFKA 4GRWF 1RUQH 1KJVB 4GO6B 5DJ2A 3WXWH 1FNHA 5I8CB 2AVGA 3HAEG 1H15A 4PD4J 5GRYA 1A7OL 3SGKA