1CDBA

Structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
105
structure length
105
Chain Sequence
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags T lymphocyte adhesion glycoprotein
molecule keywords CD2
publication title Structure of the glycosylated adhesion domain of human T lymphocyte glycoprotein CD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1993-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cdbA00
5DXWA 1AE6H 3CSGA 1R3JA 5DMGD 1MRCH 4J1UB 2VAJA 2Q6WA 2DAVA 4EIZC 1RUML 4YO0A 1KGCD 3LQZB 4PRNB 5I1CH 5IW3A 3C08L 5GS1C 3T1FB 4Y7MA 1K3IA 5JOEA 2F19L 1KTLA 3V5DB 4F58H 3CFKA 3N1GC 3MCLL 2A74A 2QQLH 4MJID 4Y19A 1MFEL 4XAWH 3VCLB 4HC1H 2XQYG 4ALAL 1BFOA 1PQZA 1XAUA 4FQIH 2XT1B 3E8UH 4X80H 3QXTA 4BQBA 2YWZA 4J3UA 1IC7H 3VXPB 3KHOA 4JLRB 3LS5H 3EYSH 4JGJA 5DRZA 4WEUD 4Q6IB 2QQNL 3IS0X 3L7FB 1HQRB 4CVWA 3LKPB 2H26B 5K9JL 3I6KA 4YHYC 3UJJL 1J0ZA 2AJUL 5DD3H 1NC4A 3SDXB 2H2PC 3KYOB 4NO2B 1KJVB 4NZTH 1IQDA 3OR6A 4X6DE 2YRLA 4PGEA 4D8PB 4YGAB 4GRLB 5F1IA 4YWGL 3MNZA 3FQWB 2EDWA 1K5NA 1WFNA 1ZHKA 3G08A 3MCKB 4WY7H 3OG4B 3K4ZA 3NVQA 1QOKA 4WW1A 1UJTA 5E7FA 2EEDA 3W5MA 3S98A 2LTQC 1YEFL 4U6YB 4Q9CA 3NCCB 2EIZB 4JFYA 4RAUB 4WI5A 3UPRB 3F6LA 2BVOB 2EKSA 1MFDH 5EBMB 1E28B 5C08E 3RDTC 1MFCH 5KAQG 1EBAA 3LH2H 1MCKA 4XNYL 3U9UB 2I9TB 4YEEA 4HKBB 2IAND 4XNUL 3P11L 4XNXH 3KDMA 1XR8B 4RQQB 4AEHH 3IGAA 4O4YH 1MAJA 1MREL 1AGDA 4DZ8B 4Y4FA 2J8HA 4U1KB 4D9QE 1EXUB 5EUOA 3KPPA 2W9LA 5EZOH 3UX9B 4ZFFA 3QUKB 4S11A 4F37K 2WSKA 2XZAL 2ZOKB 2YOCA 4Z7NF 4PJBB 4FTVB 4PB0L 4EVNB 1ZMYA 3GSXA 2QSTA 3L3GA 4KTYA 3OQ3B 1RPQA 3IRZA 4X7FC 2OSLA 1D9KA 5J3HC 5BVPL 4WGWB 2BNRE 4Z5RA 4JJ5A 3TBTA 1NAKL 3VRIB 3EO1B 3QDJA 1CDJA 2Z92B 2ADIA 1RZJL 3RDTD 4W4OA 2Y25A 4GAFB 1ETZB 5DHYB 1YEJH 5KANI 2IALA 1CD0A 3P4OB 1MVFA 4MJ6B 5T33L 2B1HL 2Q76A 1INQB 5BZWA 1T04A 2BMKA 3MNVB 4FFVC 3VRLE 2NR6C 3VGGA 4IJ3C 3UZEA 2OJEA 3O4LA 5DZLA 3ZYZA 4R90H 5DHVH 5EULV 2Y7QB 2FHCA 1G6RL 2Z8SA 4Z76A 3HG1E 5F9WB 5DJYA 4PP1D 1MVUB 2K3TA 5CP7B 2EDBA 5JIPA 5EORH 5GGQL 3QAZC 1X6NA 3PV7A 1DBKH 2EZ0C 5C0GA 4FFYH 3OX8A 5J3HD 2IH3B 3S88H 3VE0A 3QCVH 4KFZC 1HH9B 1KBGL 1BD2A 3M07A 2ZCHL 4JQIL 4M7KH 1J8HE 5HYJE 1MIML 5E94A 4OIIH 1WCBB 4WWKB 4Y1AD 2C4XA 3ZTNH 3ECBB 2G75B 2OZ4L 4QRRD 5F6HI 3TYFB 5FIEA 3TCLA 1X5KA 3MA7A 4TRPH 4HUXB 2E7MA 1JP5A 4HCRA 5J6GB 4FQJH 1V7NL 2R2BA 3LN9A 2NR6D 4K8RC 3NA9L 3LPGA 2NX5A 4GG8B 4S1RL 4HV8B 4QOKA 1JF1B 2CDFB 3ABZA 4XP5H 3MRGA 2E7BA 2WLZA 2XFXA 5D1QA 3QR2A 5E8DL 3KPMA 5KW9H 3DARA 1M7DB 3ZLQC 1VDGA 3PIQA 4MA8L 2EZ0D 3MBEB 3TNMB 4RRPA 1BZQK 1KLGB 3HCVA 2VC2L 2CKNA 3GMLA 5SX4I 3CXDH 5I1DA 3RPIB 3TO4A 3GSOA 3BSZL 4LQFL 5F6IC 2P8LA 3CH1A 1T7ZA 3CPLA 4OGYH 3LHPH 3O11B 4NRZA 3SKOB 2R0KL 3S34L 2JJTC 4LPCA 4ENED 2BZDA 1D5XB 4D9RD 1T83A 5D7KE 1ZT7B 4HK0B 1I3GL 3ZDZF 3HNVL 4K8RD 4OLXL 2FX8L 3MC0A 2XZQL 2R2HA 3QCUL 5GJTH 5FYKU 2CUIA 4G9FA 4YXLH 3H3PH 3F7VA 2PTVA 3RUGE 3UTTD 5CKGA 2M2DA 4MZ3A 1ND0A 3DURA 3GMPB 4NGHL 2Z0BA 5DA0B 3MV9D 3DWTA 3O41B 2X44D 1TZIA 4PRIE 4HXBH 3RVXC 3QDME 4FQPA 4O2CA 1JGDB 5FHBH 3O8XB 3BW9B 4KZEH 3N85L 1B0RB 3FT4A 4R97C 1DQQB 1T22A 3AU1A 1A9EB 3O3EA 1OSPH 1X6LA 1PW3A 2YMXL 2BNQE 3U2SA 2AQ2A 5IJVB 5E7BA 1AXSA 1UACL 1QACA 1HZHL 3WIHL 3D0VB 1EZVY 2HLAA 3H9ZA 3MXWL 4MQTB 4YPGA 3VFTB 3SY0B 1LE9A 1K4CB 5CMAB 4KHXL 1Z0NA 5IG7A 5I1IH 5JIHA 3IFNH 3TH4T 1A3LH 1W8OA 3QI9B 4HWZB 4IRJA 4B7LA 3UBXB 4H20H 4U1LB 1PLGL 1QLRA 5D96C 1LK3L 5AZ2H 1FCGA 3DX6B 1FLRL 1IQWL 5GGSY 4NZUL 4TQEL 5DD0H 2HJFB 4MNHB 1MCPL 3RVXD 4ZG1A 4NQCD 5TQ2H 4J8RB 1WQVT 1B2WL 3GI9L 3WO4C 4LSTH 2Y06H 5BMFL 1E6OH 3I75A 4R7NB 1GH7A 2R9HC 3PL6B 5IVZA 3U4EB 4BK5A 2OP4L 5DQ9A 1WC7B 3QA3B 4LCYB 4DUWA 4Z7WA 5BO1H 4G8EB 1FNSH 1OD7A 1T20A 3C6LB 4LCWD 5T3ZH 4PJIA 3WLBA 3KPSD 4I18A 4P57A 2H6PB 1L9NA 3QFJD 1JNNH 3FQNB 5IFJA 3MRCB 2OL3L 3MOAH 4C57C 3BH9B 4OFYA 4ZPTB 2FEEL 4ELKA 1TVHA 1C7TA 4X6CE 4BZ1H 4RGMC 4LP5A 3O6ML 4PJBF 3LZFL 3GK8H 2YPLB 5FGBA 4OLVH 3ULUF 3QHZH 3ZSSA 2G5BA 5FO8B 5LGJA 2WAHA 4TVSa 1T2QH 4UILH 3TA3A 3V5KB 2F54D 1RHHA 4K23H 5J11B 2DQIH 4APQD 2R9HD 3CMOL 3NTCL 5MENE 4WUUA 3O0RH 4L3CA 4XCYB 2YSSB 1AGEA 5I18H 3FRUB 5I1JH 3UJIL 5F7YC 5I1GH 4FQ1L 1UEMA 3HE6A 4H0HB 4Y4FC 4ESKA 1KT2B 1E0OB 4OLYH 1ZT4A 5D9SB 3CVIL 3PWLA 1BHGA 1UA6H 5D1XA 5FM8A 2FJGB 1MI5E 5HHPA 4WTWA 2AS5M 3CFDA 4X9GA 2B0SH 4M5YH 2FJFB 1RJZB 1XGUA 1IEBB 5CILL 3RKDD 3QDGD 4K7PH 3QEQA 4OKVA 4AZ8A 4HJGA 1MCDA 4LRNH 4OFKA 5GGTA 1DR9A 3EHBC 5FYLH 3FQTA 1NPUA 5F97E 1OVZA 4P2RA 3PNWA 3HE7B 1KPUB 5L0QB 4W4OC 4OI8A 3F7PC 1P7HL 1N6QL 4HZAA 2C1OB 4MQXC 1UH4A 1HINL 4K94L 5CBAA 1NFDA 2R0LL 5EDXA 4UV4H 2H1PL 3RVUC 4XWGL 3UTQB 4AJ0A 4TSBH 1QSEE 1ZWIA 4KQ4H 3QP3A 3JV4A 5JTWA 4X4ME 2VXUH 5ID1A 4OD3H 1KCRL 4JO2H 3LKRB 5ID0A 2CDGB 2JB5L 5C0FA 1IKNA 1T5WA 1E4KC 4YDJA 1I1AD 3GGWA 3SJVD 4M8QA 1GOFA 4N0UB 2R8SH 4F7CA 2BVUA 3SDDA 4M62H 1JRHL 1KOAA 2AW2A 5C07B 3BUYB 3A6CL 1FVDA 1VFOA 3VWKA 3EHBD 3RWFA 5GISL 2BOCA 3HZVB 5C0CA 2W0PA 4Z7OE 3T0EA 4ZYKB 1K6QH 2R69H 4MQXD 4OV5A 1IEAB 1YMMD 2DWEA 1C5BL 4QT5A 4JFXB 4MHHG 5L6YH 4R96B 1PEZA 3AFLA 5I19L 4TVPH 5BXFB 1IL1B 1YUHA 1F5WA 5IBUB 1OAQH 1NC2B 4ZTPL 4NBYB 5GGVL 4KJPC 4G9DA 1MIEH 1U8MA 2VZSA 1AO7E 1BZ9A 3CVHH 5IB1B 2GW5A 2XWJA 3NH7H 1ZGLB 2Y5TA 4EJ1C 2E5EA 5E8OB 2DKSA 1DBJH 2DQHH 4UV7H 3GSUA 3D25A 1A7NL 4PP2A 1CL7L 5D1QC 4KXZH 2RHEA 3RY6A 3VXRB 1BIIA 4DGYH 1XGPA 4PGCB 3QO1B 2A6IA 5B38A 4CJ0A 5T1DL 4KUZL 4MAYC 4AT6A 2XA8L 3MLXL 3GSRA 5FK9A 3IDXH 1LP9E 3SDCC 5ICZB 3MRHA 3R06B 4L1DA 3RI5F 3G6DH 1VKXA 1CD1A 1KB9J 5TE7H 4NQXA 1LGVA 5GJSH 1IT9H 1FFOB 1BEYH 2NW2B 2NXYD 5SWQA 3MRFB 4LSQH 4ZOEA 3WD5H 4Z7VA 4EBQH 1LEIA 1WLHA 4OD1L 4UIKL 3VXSD 2XKNB 1IC4H 4OCSH 3FZUC 4OGXL 3MJ9H 4BH7A 4W6WB 4YZFF 4P5TA 2YD7A 1S7TB 3MMEA 5KSBA 2X1PA 5KVDL 3LQAL 1HQ4A 1H3GA 1FBIH 3VXMB 1PKQE 3SGKA 3TBSA 2EYTA 4M02A 1PKOA 4NPYB 2BDNL 3CX2A 5GSRA 4MAYD 1I1FB 2AK4B 4JGMA 3O3BB 3VXUB 1E6JH 3DUSB 4IMKC 2LVCA 4H1LG 4JDTL 1TENA 5DYOA 1CGVA 1QA9B 2YZ1A 3ARPA 1FQ9C 1S9XB 2DM7A 3SDCD 3JWDH 3BOVA 3U6RA 1T7YA 2APTA 2B39A 2Z31B 4W81A 1A1OA 5BZDB 4F7MB 5HY9A 2X7LA 3HA0A 4PJFB 3RWCB 5I1KL 1QFOA 5AZEL 1F6AA 1UWGL 3LDBC 3RNKB 1OSZB 3V7AE 5CP3A 2DF3A 1AHWA 2BSSA 5CSZB 3ZT6A 1JPGA 5TGBA 4HS6A 4IRJC 4BUGA 3FZUD 2AI0H 5J9PA 4QHLA 4MJIB 3V4PL 3MGOB 1Y6NR 5ELIA 4F33B 1A6AB 3LN4A 3MV8A 2GTWB 4YEFA 2FBJH 4XPBH 1RK0A 1YN6A 2DQGL 3ZKNC 3S35X 5E8PB 3HUJA 5JZ7C 4QNPE 1U58A 4JFQB 3NCYS 4NNXA 4D9LH 5F7NC 4M1GH 3NCJH 4JZNB 1MEXH 2EE6A 4KUCD 4LGSB 2NW3A 1A6ZB 4YR6A 1FYHB 3PDOB 3FQUB 3RL2A 4PV9B 4N1CA 5GRYA 5D93C 1JHLL 3EW3B 5TE4H 4C56D 4LLWB 4AG4H 4IOIA 2RFXB 1JNJA 4RGNE 1FIEA 4MD5B 1S5IL 1TJHL 3BGFC 4BQ9A 5F7LB 2OBGA 1MRDL 3OKNA 1IAOB 5CD5C 5GS1B 3S35H 1BECA 5D70L 3W82A 4TTDC 3VFVA 1CF8H 2AJ3B 4JFFA 4R2GC 1RIHL 5H35A 1JWUB 5F7DA 2Z9TA 4NSKB 1BZ7A 4O5LH 1X5FA 2WWKT 4FZ8L 1KN4H 5CSGA 1FFNA 5C8JA 2EH7L 2HJKA 3HC3H 1YDPA 4ZO7A 2FGZA 5EWIH 4NWTH 3ZKND 5FGBC 2FX9H 1CFQA 2IANB 2AEPL 4TULH 4ONGL 5JZ7D 3PGFL 2G2RA 3TA3C 1FPTH 2V2TB 5HD8D 4KMTH 4LAQH 2IAMD 5IHZA 4PLKC 4YHYB 2D7TH 4KGJA 2GJ6D 5DURD 5FYKL 2IPTL 2ATPB 5C0AD 3QT2A 1EV2E 3LD8C 4XP4H 3WO3B 1BOGB 5F21B 4UU9B 2DQEL 3LIZL 2GITB 3P9MA 5TDNB 3PF2A 4RNRA 3ZE2F 4FA8A 5EUKA 3PQYA 1JMZA 2PYED 2LTQB 5L2KD 1FDLH 1JCKA 4R2GD 2CGRL 4GT7A 3C9NA 3TZVD 4BZ2H 3PGDA 1F3RB 4KDTA 3RDTB 5C2BL 2ATKB 5F7EL 5FO9A 1GAFH 3GNML 1KC5H 4AQ1B 2VLKE 2FDBP 4MWFB 1HOCB 2P24B 3TJEL 5ECJE 1MY5A 1M7XA 1U8JB 4KDVA 4E0RB 4FG6D 5IF0A 3C5JA 4Y8DC 4ZS7H 5D2NE 3ZYJA 4PY7B 4HIHA 1E4XL 3J7HA 3SKJH 1Z9MA 4X9FA 2NY1C 3NGBC 5EZIL 1S7UA 1F3JB 2I60L 5JXEA 2J88H 1SEBB 4YX2L 2GSIA 1CLYH 4PJDF 4UTBL 5EU5A 4PGJA 5J6HB 5DFVC 4U4BA 4HMCA 2BCKB 4HC1A 2HWZL 1L0YA 3PABB 1AGFA 1PZ5B 1IKNC 1MH5B 4R4BB 4M61A 3QCTH 4N8VG 5CGYD 4QRUA 5ILTL 5I9QC 2BSRA 1K4DB 2ICEA 3C60A 3CFJA 2DYPA 4S1DC 4DW2H 1A2YB 1OAZL 3C8KB 3SDDC 2LABA 1AP2B 3OJDA 5D71H 3S3JA 1EEYA 1W0WB 4Y1AB 1UCBH 4XCCL 3OKKB 4QRRB 2RAMA 4Z78A 1I8LA 1Z6JT 1KIQB 2WMPA 2AAVA 3WFBL 4BSWA 1OGTA 1DN2A 3T0EC 5ALCH 1RZ7L 4IJ3B 4PRHA 3D3VA 5ICXB 1JHKL 4JM4H 5FUOL 1TFHA 1MQ8A 4V1DB 1A4KB 1QLFB 2NY1D 4G80B 1A4JB 2VZUA 3KPOA 4OIAA 1NGQL 3B4NA 3X12B 3FQXA 3VXOB 3QXDB 4XAKD 5F6HJ 1U8KA 5JHDA 2RCSH 4ELME 3MRMA 1MWAB 1G0DA 5DFVD 2BNUB 4U31A 3QAZB 5BRZA 5DJXA 2HFFB 1JNLL 1ZLSH 1BQLL 2R4RL 3LSOA 3I6LE 5KJRL 5C7XL 3RY6C 5JW3L 4S1DD 4HQQH 5ENWB 3ISWA 3TF7C 3I2CH 4NDMB 4HG4J 5HHOD 2DMBA 2XG5A 4HZLA 3LEYH 5MHSE 4G42A 3DTXA 3QJFB 1V7MH 4ZMAT 4NJ9L 3GSNA 4G6KH 1FO0A 5ACMA 1AQKH 2ZZUT 4X9HA 4XWOC 2VDPH 3UPCA 4FQ2L 3DSFH 3UTTB 2MPAH 5IVXE 4G8FB 4G7VL 3VFGL 2D4FA 3GKWL 3HS0A 3MV9B 2R56H 4HW6A 2Z93A 1EUUA 4Y5YC 4P5TC 4YFDB 2H8PB 3O6LH 4DN3L 5LBSH 3BPLC 4PJ7B 5DQDL 3FAXA 3WHXA 1T0MA 3SGKC 4YHML 1OM3H 1WBXB 1XGYL 4P2QD 4HS3A 5F6IB 3CFEB 3BDXA 3MRPB 4OZFH 3QUML 4U3XA 5D7JC 2VLRD 2VDLH 5SWZD 5CJXA 3QUZA 1QBLL 1FL5A 1WAAE 4Q9QL 5HVWA 4KROD 4QRPA 1X5ZA 3KPTA 5EIIA 1LWRA 3MJ8A 1RSFA 3PWPD 5GXBB 1KEMH 2VH5H 4XWOD 2JB6B 1FIGL 5ACZA 3MFFB 4J23A 1MJ7L 3W0WD 3FHQA 4WCYL 4CW1A 3DMMA 5CCKH 4ISVB 4UOW1 2EXWD 2CJUL 4KH2A 1CN4A 4NQCB 3RWEA 3MR9B 4QGTA 4S0SD 5DJAB 3SGDI 5BS0E 4XVSL 3P73B 2AXFA 3GMRA 4PJGB 4R97B 4U0RC 1E27A 1U8IB 3NIFE 4A6YH 5D5ME 4MXVF 4ZUUA 5JW5A 1R6VA 5D7JD 2C1PB 1K9TA 3U0TB 2DIBA 1NCNA 1E4JA 1N7ML 3MLUL 4M6NH 3I9GL 3KPSB 1JFQL 3S4SB 4QHKI 2NTFA 3QFJB 1NBVH 3FFDA 4NT6A 3TFKD 1F4YL 4LASL 2ENSA 1VFBB 1R3IL 4CL7A 1W2KT 3SCMD 2HVJB 3LQMA 1LO3H 1G7LB 5D96B 4JO1H 5C70A 3ROLB 1R3JB 5TPWH 2AJYH 4HLZG 2N4IA 4ZUSA 5DMYA 3IFPA 2X2YA 5D4QA 4YO0B 1OP5H 3OKMA 1F8TH 2EDTA 3HLAB 3BDYH 3RGVA 2X4SB 3FQRA 5DMIH 3GMNB 1D5ZB 3ZMRA 4ZPVB 4JN1H 5GZNC 1BX2A 1KJ2L 2F54B 4CKVX 4ODSH 4HIJA 2JCCA 2QR0A 3I3DA 2AERT 2M1KA 4E5XB 2PKDA 3GHBL 5DC9B 2ZSWB 3HNTH 1C5CL 4YFEA 2IBBA 4LEOA 1DN0B 4WFFD 3EYOB 3AREC 2O5ZH 3ARFA 4FQHB 15C8H 4NC0B 3WFEH 5FKPB 1I1YB 4N5ED 3BN9C 3CLEL 4RFEA 4WI2A 1JZ8A 4JY6A 4ODHH 3ZHDA 2GJZB 4RRPG 2ICWB 3X3GL 5AD0A 2EIDA 1HYSC 3RA7L 2V5TA 4W70A 3H9YA 4NO0D 3ROOB 5ITFA 2V2XB 4AMKL 2AABH 5JW4N 3QDGB 4RGMB 4XXDA 4KPHL 2DDQL 5A16A 3PG2A 1FNFA 1OGAD 1R3LA 3LEVH 5HYQA 2SEBA 5D7LE 3VH8A 3MRDA 4KDTC 5EZLB 3ULVC 4ZOCA 3IDIA 2Q8BL 4LEXH 4JN2A 5T1MB 3P0VL 3HRPA 4EDXA 5I1HH 3RU8L 5C6PB 4JRXA 3VXNA 2ITDA 3ARED 2WP3T 4Y4FB 4LF3A 4NQDA 1J1OL 1RZGA 4TUJA 3MRJB 4WW2A 5EUOB 3KPPB 4X7TB 1RULH 2HT4C 5A40E 4GOSA 1INEL 1QFWH 2IG2L 1JV5A 2DQUL 2NY4C 4F9LA 5JLZA 5B22A 5JXEC 4IM8A 4XCNA 1C12A 4LMQI 1SVCP 5D2LE 3NFNB 3RNQB 3E1F1 3S36H 2YBRA 4N9GA 5F93C 3VD3A 5ALBL 2CMRH 1NKRA 5INCA 4Z5RB 4JJ5B 1Z0MA 4CUCA 1QD0A 4KI1A 5IQ7H 2IBGA 1VHPA 3C6SB 2P8MA 1FCCA 5J06A 1JTPA 2KDGA 3L5XH 1BFSA 1YMMB 4OIBA 4GKZA 2ED7A 2IALB 2DL2A 2FEEI 4GAGL 3JWNC 4JY5L 2Q76B 3H42H 3ZHLA 4P2YA 4F7TA 1X7QB 3GSWA 4U1MA 2DQJL 3GIZH 5J1AB 2BMKB 3T4YA 2HT4D 4HJJH 5IESH 4XNQA 3GO1H 5C0BA 2OJEB 4MLIA 2MTPA 4NN7C 3TO2A 1M71A 3BVNB 1FYTE 3OB0H 1WVZA 3BP5A 4I4WB 5CEZL 4U0QB 4OM0L 3U4BH 4KK9C 4X5XA 4DCQB 4YDLC 5AWNL 2X4TA 3OX8B 1RZKL 4HPOH 4OLUH 1G7HA 1A3RH 4NM4L 5DJCB 4CNIA 1FL3B 2E8ZA 1FFQA 3O2DH 4JFOB 4XVTL 1BD2B 3PJSB 2D03L 4UNVA 1Q0XH 1S5HB 2P7TA 3OGOE 4MNQA 4NC1E 4I0PA 4PJ7F 2YS4A 3IDMB 2XXCB 2LVEA 2Q86B 1BLNA 4HPYL 3VXSB 3BQUD 3W11D 4NKMB 5EU4B 2WUCL 3V8OA 5CZVL 4XPTH 3TWCL 4DVRL 5D1QB 3ULUL 3SO5A 4PJAA 4E41E 5I15L 2CLZA 4HBCL 4MAYB 1UJ3C 2P5ED 5GGUB 1W72B 1DQJB 2FB4L 1KYOJ 2IFFH 5DSCA 3UZVB 4X6BB 1P53A 1MCWM 2V7HA 4XC1L 4U6TA 3GMLB 1T66C 3HI5L 4YPJA 5GRWA 5FA3B 5GIRA 3SDCB 1XF5A 1F4HA 4DFHA 5HHNB 2HH0H 4F2MB 1B4JL 5JORB 1OPGH 2YC1B 4WJ5B 4PJGF 5ETUB 5CJXC 3QUZC 1IAKB 1OARL 3FN0L 3FFCE 1NDMB 1RUMH 3AAZB 4OZIE 1WFUA 4N0FA 5TE6H 3WXVL 3WYRA 4YHPA 3SO3B 2FWOA 4PRAB 4XVJL 1WIOA 5CZXC 3RIAK 4M00A 3MCLH 3IAQA 3GB7A 3F7VB 3ZSTA 1HSAA 1MFEH 2GCYA 4YBHA 4RDQF 3DURB 1GGTA 1D6VL 3DMMC 5HDOA 5C3LD 4FXKA 4H25B 4P3DA 4WRLA 3RWJB 4LP4A 1GGYA 1TZIB 1KNOA 2ESVE 4X6FA 4ERSL 3H7LA 4XMLL 1V8HA 2X4RA 3BH8B 4H0IA 2VUYA 2QQNH 4O2CB 5L88L 4L3EA 5EU6D 5IMMA 4OZHE 3FT4B 3UJJH 4P2CG 1T22B 1FZJA 5DLMH 1JYVA 5HDBF 3TBVB 1D5MB 1FL6A 5IROA 1P2CA 2QHRL 4JFED 3GRWH 3U2SB 1S7XA 3D9AL 3CVHA 1AXSB 3LDBB 4C56B 4XPHL 4WHDA 4M4PA 5F89B 1LE9B 3G6JA 1D5BB 2UVEA 1JGVH 1U0QA 3KPRA 1KFAH 3LKOA 4AL8L 4KRMB 1YEFH 4IRJB 4OUOA 4GXUM 1QSFA 3Q5OA 1A0QH 1ES0B 1T6VN 4LPUA 4GUPA 4XNUH 5MERB 2R0WL 2P49B 2VOTA 3QIBA 2QBWA 4JPKL 5IIEB 3GJFH 5HJ3B 5IWLA 5E4EC 1J1PH 1P5VA 5IMOB 2J12B 3HZKA 4CDGC 4JZOA 4JKMA 2IAMB 2R23B 1NCCH 1ED3B 1YEIL 1WTLA 3EJYC 4PV8A 1SJEB 3MTRA 3A0OA 2GJ6B 3C8DA 5DURB 1PFCA 5D93B 2EYSB 5DRNB 3ARQA 3WXWL 1T20B 5C0AB 3R8QA 3WLBB 3MJ9A 2PTTA 5B38G 5IFJB 3BGFB 3H0TA 1WICA 3ARBC 4LGPB 1EO8H 4UB0L 4D0BB 1ORQA 5EUOF 2R0ZH 4JM2A 5L2KB 4R2GB 4WFGE 4ELKB 2A2QT 4N0CC 1JE6A 4NHCL 3TZVB 4J3VA 2XN9E 3DGGA 2JK5B 1U8NA 4GAJL 2A73A 2EDHA 2VWEE 5T33H 1FRGL 2CIIA 3DROA 2LFGA 4ZUVA 1NL0L 5LGJB 2W9DL 1NCAL 5D7SH 5IB2B 4L4VE 3TA3B 3EGSB 2FO4A 1S9YA 2X05A 1IM3B 1CDGA 3KLAB 5D7IA 3EJYD 2HTLD 1AH1A 1S9KC 2I26N 4WDIB 1G6RH 3GSQB 2X4PA 1UEYA 1HH6B 3MSPA 4Y4KD 1N5AA 3LD8B 4UIMA 4WW2C 4JHZA 4LFHD 3ARBD 3UP1A 4RMWA 1XCTA 3MODH 5HHPB 3OAUL 1AXTL 3CFDB 3K4AA 3V6OA 4N0CD 1S7SB 4NCDA 4NO3A 1N2RA 2A6KA 1XGUB 3L9RB 5F1NA 1P84K 4YGVA 2OZ4H 4HJGB 1QBML 4L8SA 2XKUA 1GGBL 1LO5A 4NRXA 2VQ1A 1Z9OA 1H9VA 2EIBA 1V7NH 3O3AA 1LEGB 2R1XA 3NA9H 3N9GL 4S1RH 1Q94A 1WITA 4HS8L 5DJ0A 1DUZA 4UT9H 5CBAB 2PETA 4XB7A 1F6LL 5E2VL 2NY1B 3NGBB 5HHVL 1NFDB 4JRXD 4K9EH 2DLTA 1JF5A 3D0LB 3DUUA 4OF5A 3JV4B 4RISH 3IAPA 4MA8H 3AB0B 2AV7A 1ZVSA 2FSEA 1DQMH 5JOFB 2ERJC 5C0FB 4OCNC 2V5YA 2VZTA 3FB7A 1FVEB 3OXRA 2L7JA 1BP3B 4XP6H 5I9QB 2XTJC 4LQFH 4WHYG 5AUMB 2C7UA 2VITA 3FN9A 4GW1A 4UDUA 4E42A 4F7CB 4PRDB 3H6JA 1H3PH 4L29B 1Z5LB 1RFDH 1XZ0A 2X4OA 2Y23A 4ZTOL 5HHOB 1R24A 1GIGL 3KNBB 2APWA 3RWFB 3T4AB 2HKHL 5GRZA 4FOMA 1LNUA 1CDHA 2NNAA 3SE3C 5JHLL 4HGMA 4LRIC 5E9DA 2FX8H 5T3ZD 4XT1C 4N1HB 3VW3L 3DJ9A 3LKNB 3P4NA 4I0PC 1KPVB 3BIKB 1BBJA 4HIXL 3X14A 3CXHJ 3P4MB 3WJLA 2PUQT 5TFSL 5E56A 3WN5A 1GJIA 3TH2T 4JPIA 5HHXL 3LV3B 1IZJA 3GBLA 1F13A 1A1NA 3GBNH 2XWJB 3GSVA 1U3YA 1RD6A 2P45B 3HB3D 3D25B 2P5WD 5EOCJ 4KK8C 3ZT5A 1JK8A 4H8WL 4PP2B 1LEKB 3IYLW 1CGUA 3N1QC 4L4TA 3ALPA 2K9UA 2YMXH 5SWSE 1XGPB 2XPGB 2BVPB 3BAEH 5GS0L 2Z8VC 2A6IB 4P2QB 1BVLB 3MBXL 3T8XA 4DZBA 3IDNA 4X7EC 2BVYA 2VLRB 2ZP0T 5SWZB 1NGZB 1DFBH 5FK9B 1D3CA 1YA5A 4KMLB 3H3BC 4P2OA 1KPRB 1YC8A 5J56B 1MJJB 3L3KA 3PWPB 1Q38A 2F74B 2FIKB 4KUCF 3DI2B 1LQSR 3OF6D 1TZHA 3G5VA 1K8DB 1JPFA 4HWUA 4MLSA 1Q9OB 1LEIB 3RTQD 1IQWH 1J8KA 4NZUH 4TQEH 4O9HL 2V6HA 1MCPH 1QEWA 3EO9L 2UZYB 3BXNA 1B2WH 4GLRH 4UT6H 5BMFH 4Y5YB 4F7EA 4KK8D 5BVJA 2IQAA 3ZKMC 4PRIA 4WHTB 3S37L 1ZEAL 1HQ4B 3BPLB 1TDQA 5FYLD 2OP4H 5IB5B 1G7QA 1D7FA 5D7JB 4X7CC 3JZ7A 1UM6L 4ZUTB 4LPWA 2OL3H 4MMXC 2UZIL 3L6FA 1K8IB 2XA3A 3R1GL 5IROC 4XGZA 4QHMA 1FZOA 3SCMB 5FV1L 4L8DA 4DQOH 1MCOH 1ZSDA 2DLEA 3O6MH 3VJ6B 1JPGB 4OZ4B 2AKRA 1IGIL 3RHWK 2AK1H 5TGBB 6FABL 3VFOA 4QHKJ 3O45B 4ZO9A 2AJVH 1YPZE 4O51B 5I1EL 1MAMH 5I8EA 1G7MA 2UVFA 3OAYK 2WBJD 3QXWA 4KRLB 4CAGA 3WIFB 4U0RB 1ZHBA 1YN6B 3QIBC 3ARGA 2FGWL 5F72S 5TH2A 1S3KL 1N0XH 4CBPA 2ZG1A 1Q0YL 4YLQT 1QFPA 2F9BT 3U7WL 4TVPD 2Q7NA 3BT2L 4K2UL 4W68A 4Y19E 3CVIH 4JPWH 3RIFK 1NUGA 1YN7B 4ZNCD 4OCYH 3FTGA 2FLBT 4YAQA 3A67H 4P23A 1CU4H 2VABA 4NO0B 1A7OH 1AY1L 5I73C 3MV7D 4AYFA 2OQJA 1O7SA 1XF2A 4J3XA 5HBBA 1HHKA 5JXAH 2IMMA 3U83A 1UZ8A 4GG6A 1OGAB 5BJTA 2J8UA 2H9GA 2X89A 3QZWB 2EDEA 1YEGH 2C3VA 4KAQH 1HINH 4LIQL 3REWA 1OP9A 3EYQD 4LOUD 2P46B 2VNCA 4KKBC 1EO5A 2R0LH 2IPUK 2H1PH 1R3HA 3WFDL 5MENA 3PWNA 3WIIH 1M6OA 1SM3L 4AEFA 1T3FB 4G6ML 4D0DA 3AREB 2J7LA 3ELAT 1MCBA 1LK2A 4M1CC 3IU3B 3SOBL 1JGUL 1MHCB 4XHJC 5B8CA 1I3RA 4KJWD 3M1BA 4PJ5A 2P43B 4QCIB 1H5BA 2UWEB 1DQDL 4LSRH 3MA9H 1N64L 1AC6A 1QFWM 3BIBX 3EYVB 3C5ZD 3RWIA 2NY6C 2FHBA 1NFDF 3U48A 4EKXA 1GZQA 1JRHH 4U1NA 5IKCA 1KB5B 3A6CH 3BIAX 4L9LC 5E5MA 3NBNA 1GC1L 3PQYB 3VWJA 1DTUA 3FOMA 5EN2B 3NCYP 4BFIB 4GBXD 2J6EL 3T3MF 5I16B 1NANH 2ZUUA 5E2TH 2HN7B 4XP1H 4J3TA 4RIRB 5IUSA 3DYMA 1C5BH 5C08D 4KKBD 3KPQB 5I76A 3SE8L 5I19H 4JAMA 4ZTPH 5GGVH 3OHXA 1S7VA 4RMUA 2W60A 2Y9RT 4L8CA 5JDSA 4MQ7A 5DEZA 5DK3A 1F4XH 1QSEA 3L95A 5F3BA 1CL7H 1GGCH 3OGCB 1V3JA 1BVKA 1S7UB 4QYOA 5CHNB 3VI4F 2GSIB 4HBQA 2NY6D 1VEOA 1KJ3H 1UB6A 4N90E 4HFWB 4KUZH 4LLDA 4JJHA 5MEQA 1U8OA 1ZA6B 3MLXH 4M61B 4XMPL 1AKJA 3O4LE 2Q3AA 3THML 1OD9A 4GFTB 1G9NL 2ICEB 5GRVL 2YA0A 5TF1L 1MELA 5IMLA 2BNRD 1FP5A 1LMKA 3HFML 4ODVL 5KVEH 3BWUC 3OJDB 2YPVL 3EO0A 2UYLA 4DN4L 3UTZB 4P9HL 5L2JB 1DBBL 4Z78B 4OD1H 4UIKH 1NFKA 3RL1A 5E5UB 1HHIB 2VDOL 1JGEA 1NBZA 1NLBL 1MLBB 1UXSB 3MLTA 5C0RL 4IRZH 3D2UA 1MQKL 1JYNA 3BQUB 3AM8A 1B3JA 4IRSA 5E6ZA 3DIFB 3LQAH 4NN7B 2HG5B 2WIIA 4OTXL 2IADA 1G7IA 1GHFH 4P4KC 3WN5C 3X11B 3Q48A 1UXWA 4X98B 5C0DA 1DUYB 3MRMB 1JZ4A 4MD0B 1TQCC 3HG1D 4IDLA 5DJXB 4EZMA 4YDLB 4CVXB 5DFWH 2NX5E 5BQ7B 2P5EB 1Q9KA 4QOKE 5ANMA 3RWHB 3SDXE 1AQDA 1JZ2A 1AC0A 3Q6GL 5KSBF 2BSTB 1UWGH 4C55A 4IMLB 4P9ML 12E8H 1FZMA 5CEZE 1C7SA 1J8HD 3DECA 5HYJD 1I8MA 4ETQB 3OWEA 4PB9H 3HKFA 4QF1A 1IGTA 4LARL 3SGJC 1JGLL 1ZVHA 1P6AB 1QSVA 4P2OC 3OAZK 4RAVA 1MCCA 2EDDA 1UENA 3ES6B 4EN3D 2DIAA 1SJHA 3VH8G 1CQKA 1AD9B 5HGDA 3KWWA 3V4PH 2A6DB 3QSKB 1BVZA 2NQCA 4P4KD 4ZQKA 5KSUA 5DEGA 1G9EA 5EC2A 4FP8H 4X6EA 4JHAH 1HHJB 3GDBA 4BM7A 2DQGH 5DK0B 1FZKA 2EDQA 4H5SA 5IEHB 1U8LA 1CK0L 2V7NA 2FZ3A 4Y2DA 3CDGB 3HPJA 2Z93B 2CR3A 4MZ2A 3TN0A 1UJ3B 2VIRB 3LKQA 1CXEA 5DJDA 1SHMA 3X3FH 4LCIL 3CJJA 5EU6B 3WHXB 1XF4A 5DQJA 5K33A 3W5NA 4KRPC 2IC2A 3OPZL 2DN7A 4XH2B 2YRPA 1NCTA 1P1ZB 4JFEB 4FTVE 4GH7B 5TF0A 4ZXBA 3QUZB 3L7EB 5DMJB 1FL5B 1BJMA 1JPSH 2G9HB 3STLA 1S5IH 1TJHH 3LN5B 5DHVB 1BJ1J 4QRPB 1A6TA 5D70H 3WFHA 4K3HA 2YEZB 5D7KD 4D0CA 1FAIL 3QQ3A 1VGKA 1CFSB 1RIHH 1KCSL 2F15A 2HFEA 4U6VL 5K59E 3H2WA 4FZ8H 4GRWE 1XIWA 1MWAL 3MRLA 2ADGA 2ORBH 4OF0A 1VFMA 3FONA 4M6ML 1Y18A 4PJXB 3SQBA 4ONGH 2V5SA 5JMOC 3PGFH 1OAKL 1ONQA 3V5HA 1A7PL 3X17A 1FHGA 2DD8H 3DHJA 4HUVA 3L3IB 5CEXA 5H2BA 3MACL 3QDMD 4GMTL 3T0WA 1I1RA 1RU9L 3NIDF 4BZYA 4JY4B 2BK8A 1BBDL 2IPTH 5EBLB 3BYTA 4UTAH 2AJZA 1WTGT 4GW4B 1A1MB 1ADQL 2QTEA 1YYLL 2BNQD 1R3KA 1T4KA 4JFPB 3R0MA 3MJ7A 4QHUB 4R8WL 3LIZH 4LKCA 2A9MH 2NTFB 5CGMA 2GT9A 4K8RL 1QG3A 3MV01 4NT6B 4RFOL 4ORGA 4HDIA 5DZNA 3O3UN 3EOBB 4LSUL 5EO0B 4YHLL 3DRQA 2CGRH 2KL6A 3MUZ1 1VFAA 5IMKA 5IBTL 4Z7WE 4YXKL 2LU7A 4LBEA 1N26A 4PJIE 4PRBB 2ZSVA 2UWEF 2VKWA 3FQRB 2Y72A 4X83A 5IQ9A 5E4EB 3QFDB 1NEZB 4WFHE 1J0KA 1BX2B 1UM5L 1E4XH 2BFVL 3CX5K 4PJ8C 2MHAA 4LLYB 3MROA 3MPCA 3WNLA 4M6OH 1BQUA 2YKLH 1EAPB 4X7SL 4LEOB 3ULVF 4GO6B 4Y4KB 2K7PA 3PWUA 4G3YL 5FM4A 5FGSA 3RVWC 4UTBH 2OTWA 2A83A 1DLHB 3MUY1 3ARBB 4LVOC 4R3SB 2VDQL 5AD0B 2FJHA 2P8PA 5ILTH 2QADC 4N0YL 1H5BC 4Z9KB 1CE1H 2FYYB 5F88B 3AGVA 2FECL 1PSKL 1IEHA 4K71C 3IFOB 1PGRB 5F96L 1WEJL 2X09A 4OCRL 5I17B 5J89A 1S8DA 3GKZA 2HA1A 3O9WA 5TDOA 4KC3B 3VWJC 1JZ6A 5HYQB 2VXSL 4Z8FL 4MDIB 1MF2L 2JIXA 3WFBH 4NWUL 1GYAA 5GSVB 3MRDB 1JWMA 1RZ7H 4PJ8D 1JHKH 5FUOH 2VQTA 3PHQB 2W65A 4GQPH 5T1KD 4PJEB 3QEQE 4HIIB 2MQCA 2HRLA 2XWBA 5EFIA 5DJ2B 4JRXB 2ITDB 2NY2C 2MQ0A 4LF3B 4PGBB 4NN6B 3MUHL 2O61B 4TOYL 1QYGL 4WW2B 4P2RE 2LU4A 4RWHA 1PG7L 4Z0BL 1DL7L 2X4QB 2QADD 2R4RH 4KK6C 3E6HB 1ZTXH 4B7IA 1JHTB 4BELD 5C7XH 3U36A 3IDUA 5JW3H 2Q20A 4XCNB 3RKPA 1Q9WB 3ZKSD 1MI5D 4X8XA 1FH5L 4NBXB 1WWBX 3K1KC 3T08A 4YHNB 1L4IA 1KV3A 2YBRB 4ZOBA 3T0XA 1CFTA 4GAYA 2JF1A 5SX5H 3VWJD 2XNAB 3FO1A 3MO1B 2A77L 4MCYA 4NJ9H 2NXZC 2WLYA 1T80A 5KTEH 4BKLA 1Q8MA 4LCCA 4FQ2H 1A9BB 3Q2CA 4G7VH 3VFGH 4H26A 1BGXH 4F7TB 2N7BA 3GSWB 4U1MB 1MFAL 3CU7A 4QXUL 1AFVL 2GSGB 4X4XA 3T4YB 1HEZA 2DI9A 1XGRA 4NJAL 4KI5E 4P5KA 5C0CE 3AM8C 4O58L 2EDJA 4QTIL 2ERJB 1JWSB 2I24N 4IRSC 2WWKO 3MLRL 4DN3H 3TO2B 2HT3C 2P5WB 5DQDH 3RJDA 3IJSB 4J4PC 3CUPB 2GTZA 1G0YR 2XTJB 4YHMH 4UQ3A 3WCYA 1XGYH 3NZ8A 3HZMB 1JPTL 3NFSL 3NMEA 3QUMH 4X5XB 2BY0A 2VR9A 1SYVA 5CINL 4PJCB 1G7HB 4ZAKC 3RPKA 5HYSA 1XH3B 2VXQL 4CNIB 1AGBA 1I7UB 4WU7B 2IGFL 3G5YB 1G6RA 5E08H 2NXZD 1B0WA 4H88L 2GKIA 2P7TB 2F53E 2CIKB 1S7RB 1FIGH 5DT1L 1EGJL 1R0AH 4M9OA 5EO1A 5JPNA 2YN3A 3V8CA 4HHAA 3STZA 3RTQB 3TVMA 3V4VH 1G7JA 1VACA 4DGIL 1OQOA 1AO7D 1QTYT 5MEPA 2OZ4A 4P49A 1EFQA 1KCUL 4J4PD 5EC1A 4MCZB 4GXVL 4PJAB 3BKCL 4Z7VE 1WT5A 3H9SA 5MP6L 4ZSOA 4ONHB 4Y2DC 3ZE0F 4NKDA 3GMMB 1N7MH 3PV6A 4JO3L 3MLUH 1Y0LA 4ZAKD 1JNHB 4PFEA 4PJXF 4P46A 3TBYB 1XF5B 1G7PA 3HI1B 4LL9A 4BUHA 3OKDB 1WAAA 3U0PB 4I8DA 4LPTA 1G1CA 3HZYB 5C0JA 1EZVX 3DRTA 1EJOH 4MA1C 2FEDD 4YDVB 2E6PA 2ITCB 4EI5D 4JFDE 5KS9E 4OJFL 1H3TA 1M05B 4KKNA 5I0DA 1HSAB 5T1LA 2D2OA 2WBJB 4I13B 4CVUA 2HKFL 5F1SA 1XIWC 5EZJB 5BS0A 4P59L 4FXKB 2VQUA 3MZTA 4NUJA 3FMGL 5FGCB 5AG9A 3BFOA 4JQVA 1J1XH 4R4FH 4QWWD 5A43C 3DX7A 2HVKB 1RK1A 3VXTB 2GFBB 4TNVF 3KR3L 3QO0B 4X99A 1FE8H 1Z3GL 1S7XB 2W59A 1MJUL 3MV8E 2PW2A 5LQBL 2JCCF 2CKBL 3PWVA 4AMKH 1PEWA 1KIPA 3HUJE 4AH2A 3U7YL 4BQCA 2H3NB 5C07E 3MV7B 1QHPA 4GQ9L 3VFSA 2EECA 4GKSB 1YYML 5IM7A 2YD9A 5I1AA 5FM5O 2F5BL 4YE4H 4DKFH 1QVOB 5ISZD 1K3ZA 4GW5A 4L9DA 4XMKL 3WIHA 5IFAL 2E7CA 1XGTA 4GUPB 4MNGB 5ADOH 4M7LT 2ED8A 2VLLB 1WBYA 3P0VH 3UPAA 1CDUA 3KS0J 3QIBB 3GBML 3UTOA 1EHLL 1W72L 3RU8H 3QUYA 1MHHA 2DMCA 3RZCA 3SBWA 1FN4A 2J1KA 4X9IA 4P3WA 4HWBL 3CK0L 3IKKA 2VUOA 1M4KA 3DV4A 1YNKL 3X13B 5BOPA 5DD1H 4X5WA 1B0GA 2WK2A 3CLFH 3OJ2C 4I0KA 5E8EA 1V3MA 2FX7L 1KTRL 1N0LA 4PJEF 1RVFL 1I8KB 4X6DB 5I73B 3C5ZB 3BPCB 1WZKA 3IU4L 4FNLL 4RGND 2FBOJ 4XVUC 3IXAA 4WW2F 1JZ3A 1UZ6E 4RX4A 4GBXB 1RMFL 5D7LA 3O9WC 2OL3A 5C08B 4PG2A 4GRMA 3DROB 4ZUVB 2GAZA 2QQKH 3D69B 3TJHD 4PGZA 2DQJH 2FO4B 2AJSH 5JOPE 1HN1A 2IH1A 4XBPA 4WEMB 3ARDC 5EIQA 1KF9B 5TDPB 3WL9A 3MLVL 3O6FC 2X4PB 4QLRA 3VXME 4LHUD 5CEZH 2E6JA 2PCPA 4Q74A 2YR3A 4KVNL 4G43B 1NGYB 5JPMA 3UJTH 3IJHA 5C2UB 1EA9C 2NY6B 4P48A 5FYJE 3VXUE 4QEGA 5FDWA 1W8NA 4XVUD 4NM4H 4L9LB 5IT2L 5D2LA 1H3WM 2XIDA 4LCUB 4XVTH 3QDAA 3QEGH 4PJFE 5ESQA 2A6JB 1FV1A 1OTUD 3RAJL 3EDEA 2BNRB 3CC5A 1T5XB 3ARWA 4DKEL 3O9WD 3CCHA 4UINL 3WS3A 1RJLB 2VLKD 2VQ1B 4UUJB 5DUBB 2ZPKH 2F5AL 3O3AB 1YNTB 3LKSB 4U1SB 4MSWA 1W0VA 3EDDA 4HKXB 4POYA 4HPYH 4PJCF 2NY7H 4CMMA 5DJ0B 2WUCH 3ARDD 4MJIE 1I7ZB 1GPOH 4K3GA 4J6RH 3TWCH 5LJYH 3O6FD 1IM9D 4I3RL 2X1QA 1A22B 1YZZA 4FXLA 2G5RA 5HDQL 4Y0GA 3DUUB 4LLUB 5BV7B 5EA0L 1XF3A 2IF7A 3P2TA 2AV7B 1ZVSB 1FYTA 1F97A 4AIXA 2FB4H 3HG1B 2DLFL 3KXFA 1ORSA 4MX7B 4PRHE 3D3VE 3QNYB 3OXRB 4F3FB 1A5FL 3JTSA 4GRWH 3EFFA 2PO6D 1ACZA 1KYOK 3K8KA 5DC4B 4BSVB 5CJ8A 4CMHB 3OKLA 4PJAF 1J8HB 5BRZE 5HYJB 3WXVH 2F58H 3MNWA 2NNAB 2X9XA 4QHNB 5DD6B 4XVJH 3BZDA 2DQTH 4EN3B 4G5ZH 1BBJB 4OZFG 4RAHA 4U1HB 1I8IA 3ZE1F 1S9VA 1U93A 1YNLL 1CWVA 4P4KB 3WN5B 2WINB 5J13B 3KLDA 4FQXA 1FGNH 2E3VA 4BFEA 1TQCB 3S3SA 3QXAA 4HFUL 5E00A 5D1ZC 3S5LB 5L88H 1C1EL 1J87A 4Z7UA 4Z77B 1JK8B 2W92A 3BEVA 3I6LD 4HUWB 4MD4B 3D9AH 4LSVL 4IBLT 3IDNB 1EH9A 3TNNA 4I48A 2WQ8A 5LCVL 2E9WA 3CNKA 5DTFB 3FCTB 4P46C 5ADPL 3FO0L 3SPVB 1JF6A 2HFGL 4K9EC 3GUTA 4DOHE 1AI1L 4U6XB 3DOSA 3MBED 1N8ZA 2Y6SC 4OZIA 1QO3B 1LO2L 1QRNE 4WV1A 3NN8B 1TJGH 4ZFZA 1U92A 3K2UL 3F65A 4OQTH 1T1WB 3BZ4A 1N6VA 4HXAH 1I3UA 1S7QA 5TQ0L 5C9JB 1MHPH 3PHOB 2FR4B 1GGUA 3RUGB 2R0WH 2IBZY 5FM5M 3DO7B 1ZHNA 2W0LA 4NHUB 4LHQB 5D1ZD 2YRZA 4K7PY 3VI3E 3IF1B 4F7EB 3BWAB 1CR9L 1WUNT 5BVJB 3D39A 4C59B 1EERB 1F90H 3B6SB 3QDMB 5A2FA 2HJLA 4UOJA 3WFZA 3EOYG 1CXLA 1VADA 4OZHA 2EEBA 3V6FA 1CFVL 1AIFB 3WXWH 5KSVA 5I66B 2CRMA 2Q8AL 5F9JB 4YDIH 5ESAB 2BNQB 1NSNL 4DGVL 3B8YA 2DBJA 3IXTA 4JQXA 3L6FB 1PAMA 3T77A 2Y6SD 3LMJL 4OI7A 3MLYH 3HPLA 3QQ9D 2GEEA 1CLCA 3CSBA 1FZOB 2NY3C 3BP6B 3HAEA 3EJZC 3BP4B 1ZLVK 5C09A 2R29H 1FFRA 4GAJH 4ONFL 4PGDA 4LVHB 4YHIA 2V9QA 1NL0H 2W9DH 1NCAH 4X6DF 5I8EB 1KJMB 1NAMH 1H15A 3Q6FA 1U91B 4DVBA 2C3WA 5HYFA 3QNZB 1ZHBB 3T2NH 1B6DA 4LLQA 5F9AC 3QG7H 3WNOA 3FO9A 1KUMA 3BJLA 3QUYC 4FQLL 5E1HB 3NIGE 3MUJA 2L0DA 4L5FH 5CBEA 3T65B 2O5YH 1T89A 4YC2C 1I85A 1KSRA 3TBWA 3P77A 4MDJA 3LS4H 3HRZA 4HKJB 2DBLL 2NY3D 2JCCE 1AXTH 2WANA 2GK0A 1NFIA 3RWDB 4AIZA 3W9EA 5C92A 2GY7B 1K2DA 4CN1A 2PYFA 1XF2B 1QBMH 2E7HA 2BVQA 3T2OA 3AS0A 5A1AA 4X6CB 4QTHA 5FUCE 4S10A 4OZFB 2V5RA 3VFNB 3N9GH 3QUXA 5HI3C 4OZGA 5D8JH 4PJ8B 1IGML 5I1LA 4L4VA 1TJIL 3NAAL 1QR1B 1NBYA 3MLWL 5E2VH 4PG2C 5T1KB 3CZFB 1KN2L 3SQOL 1GOGA 1URLA 3EYFA 2BC4A 4D0DB 3PE9A 1EFXA 4NNPH 4ZFGH 3G5XA 3L3DA 2YPLD 4LVOB 4UT7H 1CZ8L 5MEOB 3OR7A 1HIML 3M1BB 2QADB 1ZS8A 1QP1A 3C09C 2VLJD 3FOLA 1EMTH 2B4CH 4PBWD 2EXYC 3VRLF 1J05B 1GXEA 1MI5B 2AQ1A 4NQDE 1FGVH 3O3DB 1GIGH 3VWJB 4WI3A 4A6YB 5JHLH 5H37G 3SN6N 4JANA 3VW3H 1NGWB 1SMOA 1U6AL 4HIXH 4WO4A 2VSDA 4MA7H 3WNPA 1AD0A 3VFRB 4U1IB 3GMQA 2H2SD 1S7VB 4JDVA 1CCZA 1DZBA 1IAII 3CFCL 5JDSB 4L8CB 1F3DH 4MQ7B 4WTXA 3CXHK 3V0WL 3QWRA 1ZHLA 1IZKA 3B3IA 2E7LA 5F3BB 1F6FB 2C9AA 4MS8D 1YMHA 5GS0H 3BZEB 5DD5L 2D7QA 4WI8A 1CT8B 1RUKL 2P47B 3QQ4B 3LRSB 4CGTA 4QRTB 3G5ZB 4LCWE 5MEQB 1U8OB 3WUWA 1U8QB 5C0BE 1N3NA 3S37X 5F7HA 4K3JL 2NXZB 5IMLB 5KSAA 1J86A 5CP3H 4OUUA 4F8TA 4LHJB 3MRRA 4FXGB 5T5FL 3SDAC 1G0XA 1FG9C 4NC1C 1ZK9A 3WKNA 4O9HH 3RL1B 4NM8H 1KG0B 3D18A 2OTUB 3EO9H 2VDKH 3G6AB 1I75A 1H3XA 4MNQE 1AO7B 1TNNA 1F4AA 1OY3B 5DO2C 4Z0XA 7CGTA 2WIIB 1C8PA 4MAUH 4QRSB 1DVFC 1D6EA 1FG2A 4P4RA 4R7DA 1UXWB 5HGBB 1UCTA 3VD9A 3ESUF 1KB5L 1IC5L 4I9WE 3MRKA 3NACL 3WEXB 4YXHL 2B20A 2MNUA 3KJ6L 5GS2D 5SWSA 3RUGF 1UM6H 5E99H 4ZAKB 1AGCB 4LPVA 4WHYH 32C2B 2UZIH 4DAGL 5DJ6A 1FNLA 1RJYB 2D7PA 3B9DA 3R0NA 3E2HC 4LLMA 1B88A 4PTUB 3ULVL 3MRIB 5DUMH 1LP9B 5IR1A 3C2AL 3W2DH 3SDAD 3HI6H 5E1AA 4OB5L 4QKXB 2AGJH 5JUEH 5F7MC 4Z95L 1IGIH 6FABH 1ZANL 1AE6L 2Y07L 1UQSA 4RAVB 43CAA 2EC9T 2YUZA 3QH3B 5I1EH 1SJHB 4WV1C 3BZFB 3WLWC 5I1CL 3Q5YA 1VERA 5DO2D 2E27H 1IFHH 4P5MA 1JTOA 5FKAB 3VGFA 1LE5A 1DVFD 4WU5A 5I74C 1HSBA 4LSDA 1DDHB 3ILQD 4XAWL 5DRWA 2FGWH 1FZKB 4NQUA 3VMPA 1S3KH 5DK2A 5GGRB 4JDZA 1RZIB 4AENB 1Q0YH 4E41D 3LKQB 1PKQB 3E8UL 5DHXB 5FECB 3QIUA 3FB6B 3U7WH 4POZC 4NKIH 3BT2H 3LS5L 4NUGL 2BY2A 4UDTB 2WZPD 4JG1H 4RFNC 3KYNA 5DQJB 1A14H 2ICWI 1FVCA 2XV6B 4L8BB 1Q1JL 2QV2A 3SJVE 3W39A 3BHBA 2PW1A 4U7SA 2ADJA 1DCLA 3STLB 1AY1H 3FN3A 4OAWA 2X70A 3DV6B 3MOBH 3FFCD 4JQXC 4L3EE 3OTTA 1PG7W 5E70A 2EDNA 4XCFH 4D0CB 1OB1A 5HHME 3OKOA 4JPVL 1VGKB 4WY7L 3QUMA 2MWCA 4F9PA 3T2QA 5ISZB 3IVKA 3BKJH 3UTSA 3GEWB 3F5WB 3SKNA 1C08A 2YD6A 3ILPB 3G6JE 3MRLB 2Q87A 1MFDL 2A38A 1CXFA 1MFCL 3LH2L 3KPRE 5FYJH 1ONQB 3V5HB 3VFPB 2CUMA 3FRPA 1U3HA 1VESA 4XX1G 2FL5B 3O2VH 1U42A 4POZD 3VFMA 2ESVD 4XNXL 1QSFE 4XBGA 3JSSA 4AEHL 2FCBA 1QLEH 3SOBH 4O4YL 4X6CF 5IGXL 1FNEA 4QRQB 2D7MA 5CIPH 4PBXA 5EZOL 1TCRA 1I7TA 1DQDH 5DRXA 4PR5A 1N64H 3V0VA 4Y16D 1WWWX 4W6YB 3O4OB 4MXWL 1T89C 1CE6A 3DBXA 4LNRA 4BQ8A 2EEAA 5F9DC 3JUZA 3WHE1 4MB4A 5FA4A 3MRQB 4YUEH 5HYSG 4GKOA 4RGNB 5LVEA 4KKLD 3EYUH 4JRYA 4PPTA 4AQOA 1TXKA 4G6FD 1QPXA 4YHKH 3FAWA 5EPMB 3DX9B 4G7YL 4LBEB 3WKMH 5KVFL 1KXTB 3AXLA 1I9RH 3KPLB 4O2EA 4OD2A 3SE8H 35C8H 2F8OA 1YEJL 5IQ9B 4XZUA 2VWEC 3GJEA 3W9DA 3FO2A 3QUXC 1O5DT 2BOBB 3IDGA 1QNZH 2R4SL 5IB4A 2X4NB 3ZO0A 1PYWA 5A3IC 3DO3A 4U49A 3K4DA 4LHUB 3PWUB 1U8PA 2PXYA 3BGMB 3UYRL 1C16A 5L7XH 3TH3T 5C9KA 5D7IE 4PS4L 5EORL 4WI6A 2AV1A 5FAAA 1DBKL 3M17A 3THMH 4FFYL 1G9NH 3JTTA 5TF1H 5IV2B 3S88L 4G8GD 3QCVL 2ZUSA 2H2PD 4WFGD 4P9HH 1BIHA 2XN9D 3O9WB 2XYCA 4M7KL 1GZPA 1ACYH 3GSNH 4NQEA 1FO0H 2DTML 4PJHE 3ZTNL 3DXAA 1ZKAA 1NMCC 2VLKB 1IBGH 3H7BB 4PRPA 1BQSA 3QUXD 5EOCL 1YJDL 1MQKH 3V6OE 4ZDHB 4O2FA 4TNWF 4FQJL 4WO4C 5GGSA 1YY8B 4WHCA 3ARDB 3AS1A 2QKIB 4Y5XA 5D2NB 4HK3N 1A7QH 2XWBB 3O6FB 5EFIB 1IM9B 3QNXA 5DR5L 4XP5L 4EQ3A 3NCFB 5E6IC 2DWDA 4Z7OF 4Y4HC 5IEKB 4YNYB 5KW9L 1UVQB 1WISA 5GRJL 4DEPC 2E7LC 2OI9C 4Q9RL 5J12C 1EEQA 2CK0H 3SKMA 4WWID 3GJFB 4OF3A 3Q6GH 2NY5L 2PO6B 4P9MH 3REVB 3I6GB 4XCEA 1HCFX 1CFTB 1NDGB 4OGYL 1FNGB 2W38A 3HMXH 5CZKA 1H8SA 2VE6B 5CJOL 3VG0H 5KSAC 4FABL 4WO4D 2X1XR 4DKAA 5FCUL 4WI7A 2YD1A 4XI5C 3CD4A 4YXLL 3H3PL 1LP9F 4H26B 5IW1B 3AY4A 5E6ID 3GMOB 1HHHB 3VCLA 4TN9A 4X4XB 4Y4HD 4IOFC 4P5KB 5E9DE 3J8F7 2PTUA 3S97C 1WFOA 2J3SA 3I84A 3KLSA 5CJBA 4KQ3L 1YEHH 4ELMB 4HXBL 4JLRA 3ULSA 4Q6YA 1NCBH 1XGQB 4Q6IA 4U1JB 4FFVD 5FHBL 2GTZB 3LKPA 4HGWB 2H26A 4KZEL 4V1DD 2QSCL 3OAYH 3SDXA 2W0KA 2MSPA 1OSPL 3KYOA 4WI4A 4NO2A 1H3UA 1SYVB 1OLZA 4D8PA 1NH6A 4BH8B 1S9WA 4GRLA 1T0NB 3T04D 3FQWA 4U6HB 2IPKB 2PYEE 4L4TE 5I1IL 4FZEL 1KCSH 2IQ9L 3MCKA 3PGCB 3IFNL 1A3LL 2J4WL 3MUGA 5EO1B 1KCVH 2EIZA 4RAUA 3UPRA 1BWWA 5JPNB 2VZ1A 4K7FA 5EBMA 1E28A 5CD3B 3B9KC 4EOWH 1GVIA 3U9UA 3S3PA 2VAAB 2I9TA 5IVXB 1XF1A 5D1ZB 5MEPB 5DD0L 3GIVB 1XR8A 4RQQA 4GMTH 4QXWA 5TQ2L 3KLHC 4DZ8A 5HVFB 4U1KA 1E6OL 1EXUA 1A6WL 3WE6B 5AG8A 1BBDH 1I1CA 4NP4L 3QUKA 1ZLUK 1HWHB 3PWJA 1YYLH 2VXVH 5L8KB 3PV6B 3L3JB 4I2XE 2EDLA 4R8WH 5BO1L 1GGIH 3QWOB 2ZOKA 4P46B 4PREB 4FTVA 4HMEA 4RFOH 5T3ZL 4MGXA 1U41A 2DQCH 3DSNA 5LAXB 2CLRB 3MOAL 5IBTH 3TIEB 4QNPF 1S7WB 1JVKA 4ZOAA 4YXKH 2KH2B 2QEJA 1U95B 3VRIA 2Z92A 5J4MA 3B9KD 1X44A 1WF5A 1ETZA 5DHYA 1PY4A 4MYWB 4BZ1L 1IGCL 1XMWA 5HI5C 4HH8A 3P4OA 4F9PC 4GS7C 3GK8L 4OLVL 3IFLL 3KLHD 2BFVH 4UQ2A 1KIRB 1INQA 1R5IB 3BE1L 4UILL 5BS0B 1HKLH 3MNVA 2K7QA 3L5IA 2DQIL 4X7SH 5GGRY 2DLIA 3O0RL 1U3HC 5I18L 3D85D 4G3YH 4B5EA 1KLUA 2Y7QA 3O6KH 5D5MB 1CD9B 1RK1B 4OCXH 1H8NA 1SYSB 1T1ZB 4X99B 1MVUA 5CP7A 3V6ZA 1WZ1H 5C6TH 4N0YH 5HVHB 2Q1EA 4KJYB 3U9PH 2NY3B 4ZNEA 1UA6L 3EOAB 2YPKA 1BAFL 5F96H 4AH2B 1HH9A 3VD5A 2DMKA 1MUJB 1BF2A 4M5YL 1DSFH 1PG7X 5HI4C 1IGYB 4K7PL 1WCBA 4GXUN 4WWKA 4Z8FH 1M7IB 3ECBA 2A9NL 4NWUH 2AJXH 3TYFA 1G9ML 2VL4A 1JTTA 1C5DB 1L9MA 4HUXA 4LVNB 1MCLA 5EOQH 1NGPH 5IVNA 5FYLL 3KHQA 1XGTB 1OF2A 5J6GA 5CWSB 5FOBB 1TVBB 2RIKA 2HLFC 1BFVH 4HV8A 2I07A 1PVHA 3KVQA 3QUYB 4OCMC 1JF1A 2CDFA 1MHHB 1QYGH 2E8YA 1FN4B 5GRUL 1MCSA 4X8JA 4GG6E 2J8UE 4YC2B 1RV6X 3DYOA 1M7DA 4OQTA 1CXIA 2X9YA 2XKSA 4KQ4L 4CADB 4LSPH 4OD3L 4Y19D 4JO2L 2EDKA 3T3PE 3TNMA 5E8EB 1KLGA 1FJ1A 2PXYC 1BQHA 2VLJB 5KOMC 3U4AA 3RPIA 2RGSA 5HGAB 2VLRE 5HI4D 1QQDB 4ONOA 3SKOA 5C0EA 4M62L 5AAWA 4OLWL 1D5XA 4PJ5E 4GSDH 1NC4D 3KJ4C 1ZT7A 4BQ6A 3PWPE 1IRAY 2VJXA 4NQSB 4JKLA 1EEZB 4YDKL 4Q2ZB 3W0WE 7FABL 3HMWL 4PTTA 1MFAH 1Q9LA 2DI8A 4KY1H 4TVPL 2IH1B 4NJAH 1ZT1B 1LO4L 4TSAL 1J5OH 1OAQL 4NQVB 43C9B 1MIEL 1TNMA 1D9KC 3O41A 3QHTC 4LLVB 2X5PA 3NH7L 2MCPL 1JGDA 1NJ9B 3MJGX 2DQHL 3O8XA 3OAZH 3C09B 2PXYD 3BW9A 4UV7L 1JI1A 4M7LH 5I8KL 3SEPA 5JPMB 3QB7C 1B0RA 2BVEA 3IJHB 3KGRA 3BO8B 3WDJA 3NFSH 1KULA 1DQQA 4XPFH 1NAMA 5DEFB 2LQRA 1A9EA 4MB5A 5KOVC 3VA6A 1OAUH 2EC9U 1OHQA 4DGYL 1T21B 5GPRA 3H9HB 3E3QE 2O5XL 3AS2A 1SBSH 3VGBA 4Y4FD 4CU6A 5IJVA 2BRRH 5D2LB 1HDMB 1KENL 4DTGH 4H88H 3VFTA 3SY0A 5TJWK 4Q97A 2DRUA 1K4CA 5CMAA 2OXGA 4ELMF 2ARWA 3IDXL 1AR2A 2OK0L 3HAEG 1UC6A 4XP9L 3CCHB 5DT1H 5EH1A 3WS3B 2DQFA 2GUOB 1QBAA 2WWMC 3QI9A 4IIQA 3UBXA 4U1LA 3KYKL 5TE7L 3B5GA 5GJSL 3WUZA 4LSQL 1IVLA 4ZFOB 4MSWB 1W0VB 1BMGA 3DX6A 1D9KD 2HJFA 4MNHA 1EBPA 3ZDXE 3QDJD 4J8RA 4OCSL 5LXGH 4GXVH 3AY4C 1QHOA 5BW7A 2Z35B 2CD0A 4R7NA 4G6JL 3I02B 4WENB 3U4EA 4M48L 5DUPH 4WFFE 4JO3H 4NZRH 4PJDB 3VFUA 1WC7A 3QA3A 3GFUA 3IJYB 4LCYA 2ZOLB 4CRPA 2OXHA 3RVUD 4G8EA 2ID5A 3ZL4L 4HEME 4N90D 3UO1H 1QRKA 2BY3A 3C6LA 5IVXF 4OF8A 3FQNA 3BDBA 4Y88A 3O4LD 3MRCA 3ZTJH 4KKCC 2WWMD 5F7FA 2EDFA 3SDAB 4TUKL 1X4ZA 5KAQF 4ZPTA 2F53A 3I85A 1V05A 4OJFH 2X6MA 5ANME 1YY9C 5FV2A 1I4FB 1ZA3B 1BD2D 1I8IB 1WAAF 2HKFH 4M9PA 3TO4C 2AI0L 1DVFB 2APVA 4KMQA 2WIMA 3BPNC 3CFBB 4PG9B 3FT3B 4XCYA 1A47A 5E00B 3FRUA 1TETH 5L8LB 4E41B 1ULVA 1T83C 4KJPD 1CFNB 1KT2A 3RGHA 2NX5D 5FCSH 1Z3GH 4D9LL 3UZQA 3E2HB 4M1GL 3NCJL 4QOKD 2YD8A 1MEXL 4RGOH 1CXHA 5D9SA 1MJUH 5IK3A 4IHOB 5I8CA 4KKCD 5LQBH 1NLDL 2CKBH 1WJ3A 2FJGA 2EO9A 2XY2A 5D1QD 4DFIA 3BRFA 5SX5K 1IILE 4XC3H 3U7YH 3T1WA 1WGOA 4GQ9H 4N0RA 4YIQB 2FJFA 1RJZA 1IEBA 1MLCB 1YY9D 3FFCB 3NIFF 4OZIB 1UADC 5D5MF 5J57B 4WV1B 4XMKH 1U92B 5IW6B 2ICWJ 3C5SB 3QEHB 4JFDA 5IFAH 5KS9A 3TO4D 3BZ4B 2YD3A 3K74B 5BV7L 2JJUA 3HE7A 1KPUA 5I74B 3ZDYE 1F2XK 1OCWL 1JN6B 4M8VA 2X4UB 1EHLH 3GBMH 2C1OA 4JVWA 1KN4L 2D0HA 3HC3L 2FH8A 5EWIL 4NWTL 4FQCH 4Q7DA 2EYRB 5ABDE 2VYRE 4TULL 3P9WB 3V52H 2ESVB 4HWBH 5DVLA 3U1SH 2VERN 3UTQA 4ODWA 1TTGA 1I7RB 1FPTL 4G9FD 1A6PA 4OZHB 3LKRA 2D7TL 2I5YH 2CDGA 3NABH 1MPAL 5EO9B 1IE5A 4CVZB 1UYWH 4Y16B 2A0LC 3U30B 4YK4C 4XP4L 1H8OA 3JWOL 2Y36H 3MYJB 3WUWG 2ZKHH 5C07A 1RURH 1RZ8B 3BUYA 2VISB 4G6FB 4X7DC 2BJMH 1FDLL 3HZVA 4PGDB 4BZ2L 3Q1SL 4ZYKA 1T6WA 4D94A 1IEAA 4JFXA 4I18C 1VENA 1SY6L 2D9QB 4X4ZA 5BXFA 1IL1A 1H15B 3IDJB 1DEEA 1F45A 3MRNB 4ODTH 1NC2A 3WS6A 4IRJD 2IMNA 5IB1A 3EZ8A 1T1XA 1ZGLA 5E8OA 5DDHB 1DE4B 1XCQB 1DBAH 2BVTA 3I50L 3VXRA 4M7JH 2J88L 3EIFA 1CGWA 3P77B 4PGCA 4KGLA 1CLYL 3FKUS 3QO1A 1CDCA 1N4XL 5IT2H 3HRZB 5SX4H 5M94B 25C8H 5INDB 1VB9A 4LDOB 4Z7QE 2B7DT 1X5IA 4TYUA 5F7KC 4HX1B 3QCTL 1HNFA 3W9EB 4F37F 1K2DB 4G8GB 1P7QA 4ODXB 5ICZA 4DKEH 3S9DB 2BVQB 2EO1A 1B6UA 2XN9B 3HE6C 5M95B 1FFOA 3K8MA 1RUPL 2NW2A 3MRFA 1QFUL 1UCBL 2Z4QB 4G8IA 4WIQA 4F7PB 4HKZB 3MLZH 3QUXB 2DLHA 4V2BA 5CD5D 5D2LF 5D1XC 1AR1C 1R5VA 2LAAA 2OR9H 4GMSH 4TTDD 4OFYD 4WFHD 4L4VB 2XKNA 4M1DH 4JM4L 5HGHB 1JZ5A 5HDQH 2BERA 3EYFB 3SE9L 1S7TA 1CLZL 3V0AC 1EFXB 1YEDB 5KN5B 3HR5A 1LDPL 3L3DB 3JV6A 3VXMA 2DLFH 4NPYA 1I1FA 2AK4A 3INUL 3TA3D 3DX8B 3VXUA 3DUSA 3OXSA 1QA9A 2ZG2A 3FOLB 4PLKD 1S9XA 4WUUD 1ZLSL 3QJHB 1L7TH 2Z31A 4NO5B 4F7MA 3FB5B 4PJFA 4HQQL 2D31B 2R1WB 3HE6D 3RWCA 3KG5A 5CIPA 2QL1A 4H1LB 3RNKA 1OSZA 4RMQA 2GQHA 4U7MA 4MJ5B 5B3JE 3DVFA 5CSZA 2KZWA 1AR1D 5D1XD 1V7ML 1YEEL 4WO4B 5IB3A 3BN3B 4G6KL 3QI9C 4IIQC 2QHLA 3IB4A 1UWXK 3FHAA 2VDPL 2G60H 4MJIA 3DSFL 1DBML 2J6EA 3QEQD 4F33A 4DJMA 1A6AA 5E6IB 2MPAL 5EOTB 3VFWB 4Y4HB 2VZVA 2GTWA 3FRPG 5ITBL 3VWKC 1ZHLB 3CAFA 4AEIL 4DEPB 2E9JA 2OI9B 5E8PA 4P2RD 5J12B 5J7CC 4KI5C 2V17H 2JELH 5IBLC 4HT1H 4HEPG 3EOTH 5BW7C 5CS7A 1F4WL 4LSVH 4HIEA 1A6ZA 4XX1E 1FLTX 1HXMB 3FQUA 1NMAL 3PDOA 4U3HA 1IGJA 5DI8B 2OM5A 3DVNA 4PV9A 1CGYA 1RIUH 3WUWB 3CDFA 1OTSC 1JPST 4JR9H 2HFGH 4LLWA 1N3NB 2RFXA 4PLJC 4MD5A 4XNMB 5DJZB 5DA4A 4TUOA 4Z7UF 1X5GA 5L9DL 1IAOA 5F3HA 5GS1A 3QDHA 1Y6MR 4KWUA 5HYIA 1RUAL 2AJ3A 2W0FB 2VLMD 5TQ0H 1TPXC 4ACPA 1JWUA 4NSKA 2DLGA 3SDDD 1Q72H 3D18B 1TLKA 2B4CC 3SKUD 3VWKD 4HUUB 5F44A 2IANA 4AEEA 5C0CD 4KI5D 4LKXB 3IKCB 5SV4A 4OZIF 3BESR 3OKYA 4NYLB 3T0ED 1D6EB 1F58H 3QRGL 3B5TA 3LB6C 3L5HA 4F57L 2Q8AH 4A6YL 3E6FB 3ORJA 1NSNH 1OTSD 2ATPA 4DGVH 3B2VH 5DJ6B 2J8OA 4M6NL 4JKPL 4UU9A 2H32B 2XZCL 4ZUWA 2GITA 5H94B 5TDNA 1NUDA 2Q7YB 5IR1B 1NBVL 3H9SE 4ZSOE 2YUXA 1P4LB 2W9EL 3MCG1 2APXA 1A21A 4ONFH 4OZHF 1SJVA 1QRNA 1LO3L 4JO1L 1OOAA 3RDTA 3RVVC 3B9KB 2OLDA 1UQSB 1CG9A 5GS0C 2RB8A 5HPMB 1F8TL 4PYGA 1HOCA 5GHWL 2P24A 2VO5A 3CSYB 1UH2A 4YHZH 2HRPL 3LPWA 1U8JA 1LE5B 4XPGL 4E0RA 3HMXA 3OKEB 3WHE0 3LB6D 4JG0H 4PY7A 5DRWB 4XRCB 2OCFD 2CUHA 3A6BL 4FQLH 4UMGA 4JDZB 2OJZH 3HC0B 4OF6A 1MCFA 3MLSL 1AHWC 3D85B 1F3JA 3MREB 1SEBA 4D3CL 2O5ZL 2B2XL 15C8L 5GGVY 1KCLA 1QFHA 2DBLH 3WFEL 4P5TD 1RZFH 3PABA 4J3OC 4ODHL 3W39B 1PZ5A 3Q3GB 1EHXA 1CDIA 5C1MB 1P6FA 1K4DA 1MNUH 3B9EA 4R6UA 4NRYB 2UY7A 4AM0A 1A2YA 4YHOH 3K7UA 1QUNA 4XPAH 4QXGH 2AXGB 4NZJA 3OKOB 1T03L 4Y1AA 4JFDD 4GS7B 4N8VB 1O0VA 2R2EB 3LEVL 2LV4A 4NOFA 3ARVA 1YPZB 2PR4L 3VXQB 1IGMH 3ARUA 4PIRF 1E4WL 5ICXA 1KN2H 2JKXA 3KPNB 3SQOH 1A4KA 1QLFA 4G80A 4IDJH 1A4JA 2Q6WB 2OS7A 3X12A 3VXOA 3BD4A 3QXDA 4XBGB 1CLOL 3WS6C 3HNSH 1N5YH 3MGTA 4MJ2A 1KTLB 4DUVA 1I9IH 2BNUA 3CFKB 1TCRB 1QR4A 4YFLI 1RULL 2A74B 1I7TB 3WO4B 4Y19B 1J0YA 5DRXB 2HFFA 3V4UH 3MV8D 1RUQL 1BFOB 1PQZB 4OV6F 4EDWL 5ENWA 4M6AA 3HR6A 2NY0C 4NDMA 5J8OA 4LQ1A 2DM4A 5DRZB 3UTPD 2X1WL 3S36L 3IS1X 1ADQA 1P4IH 3I6KB 5C0IA 4LSSL 1BWMA 1NC4B 3F58L 4KZDH 5IQ7L 4OD2B 5T3XD 1IQDB 3OR6B 3EDFA 4PGEB 3LAFA 3G04A 5F1IB 3MNZB 3L5XL 5SV3A 1K5NB 3UTTA 3IDYC 2VXTL 1ZHKB 1MJ8H 3GJEB 3B2UC 4I5BA 3V0WH 3H42L 3G08B 2NZIA 4WW1B 3GIZL 3IDGB 3MV9A 4JFFD 3JVGA 1OL0A 4HJJL 1LO0L 4JFYB 5GZND 3GO1L 4BFBD 2EKSB 1MFBL 2R39A 2PXYB 1CGSL 1RUKH 4PJ7A 1CVSC 1WBXA 4JO4H 3U4BL 1C16B 2NY0D 3KDMB 3CFEA 3R4DA 1JI2A 3IGAB 4JCMA 5K9QG 5LGHH 1AGDB 3M17B 3TC9A 2JJTA 1SEQH 3JTTB 4K3JH 3BN9D 2E9BA 1A3RL 2PF6A 1WWAX 3KJ4B 4ZFFB 2Z31C 3O2DL 1HYSD 2YWYA 3F7RA 5AEAA 2JB6A 3RI5K 3GSXB 1QBBA 4P3CL 3MFFA 3L3GB 3B2UD 4YQXL 3OSKA 4R4NC 2I27N 4O2FB 3PQYD 3BPOC 4ISVA 2OSLB 1D9KB 3TBTB 4NQCA 3QDJB 4XHQA 2ADIB 3MR9A 3C60C 5DJAA 3P73A 2DOCA 3ULVD 4PJGA 4B41A 1KB5H 1IC5H 4R0LA 3NACH 1U8IA 4YXHH 3KJ6H 1I8LC 5LGKA 1F11A 2C1PA 5FYJD 1HWGB 4M5ZH 3U0TA 4TPRH 5BZWB 1T04B 2IFFL 4LCWA 3TT3L 5FUZL 4OLEA 3S4SA 5IHLB 4XB8A 4WEBH 3QFJA 1I9JH 1FORL 2NY4D 3O4LB 2KZ1B 4OB5H 1VFBA 5JXED 5H37H 3MV7E 4Z76B 3KXFE 1ZANH 4WFEE 5DJYB 3ROLA 1OQXA 2Y07H 4R4ND 5E24E 4PJ9A 5C0GB 5TE6L 4OKDA 2GK2A 2OR7A 3HLAA 1U2CA 3VE0B 2X4SA 5EU7E 3BI9X 4KHTL 4MNGE 3GMNA 1D5ZA 3C60D 4MMZC 2ZCLL 4ZPVA 2DYPD 1U8HA 2F54A 5F8RC 1G9NC 3QULA 5E94B 4APQA 2JJSA 1NCUA 1ZVYA 1ZLVH 4E5XA 3EBAA 5KVMC 3TCLB 3MA7B 4W6XB 4P9HC 3UMTA 4OGAC 2ZSWA 5D72L 3ULSB 1DN0A 4NUGH 3BKMH 4OSUL 1OT2A 3EYOA 2R2BB 4FQHA 5EU3A 1EO7A 4PRHD 3D3VD 2NX5B 5FKPA 1I1YA 2Z91A 1Q1JH 4QOKB 3ARRA 2GJZA 4ZD3L 2ICWA 5DLML 3GHEH 3MRGB 1BQHG 2XFXB 3EFDL 3GRWL 5JHDD 3KPMB 4KV5E 1L6XA 1S9WB 2ARJQ 3ROOA 4K3EL 4KK9D 1J0JA 2V2XA 4Z7UE 5BRZD 3PIQB 1J12A 4KXZI 1JGVL 3QDGA 4JPVH 1KFAL 3HCVB 3MUGB 5I1DB 1WBZA 4BJLA 1EX0A 3TO4B 2HFTA 4QXTA 3GSOB 5EZLA 4K7FB 2P8LB 3CH1B 3CPLB 1A0QL 4CJ1A 4NRZB 4C4KO 2MMXA 3BPNB 5JR1H 1CBVH 1PBYA 5T1MA 3QXVA 4OGAD 2W91A 3STBA 1EGJA 3C08H 1J1PL 5IGXH 3OZ9L 2F19H 4OT1L 2R2HB 3MRJA 4X7TA 3P30L 4G9FB 5DF0A 1NCCL 1YPZF 3PWJB 1UKQA 1ND0B 5HVGB 2X42A 4MXWH 4ALAH 1I1AA 3SJVA 3D39E 3NFNA 3DVGA 4PP1C 3RNQA 3G9VA 4Y2OA 1EO8L 1T66D 5K9JH 2AJUH 4G7YH 5KVFH 2R0ZL 1QRND 3AU1B 3O3EB 1DLFL 3O81A 2GY5A 3UBXG 3QUZD 3C6SA 5D6CA 4GRWB 4YWGH 5FXCH 1YMMA 2HLAB 1OAYL 4YPGB 1ZLWK 4QRPD 5IG7B 4UQ2B 1WSST 5D7SL 4S1QL 6CGTA 1X7QA 5CZXD 5J1AA 5C09E 2R4SH 1QLRB 1WZMA 2YD5A 1RI8A 3CDYA 4XNYH 5DWUL 1KLUB 4F8QA 3BVNA 1E4KA 3F7YA 4WI9A 3DMMD 4I4WA 3UYRH 3P11H 4YK4B 3RGVC 4PS4H 3V6ZB 4DCQA 1MREH 1OTTC 4NFDA 2ED9A 1P84J 1LD9A 3I75B 2YPKB 5JA8B 4OCLC 3S8WA 3MODL 5DJCA 1FL3A 3VU2A 5IVZB 4JFOA 3PJSA 5GQBA 5DQ9B 1MCWW 3VG9C 3BP7A 1S5HA 1EEUA 1MAKA 2XZAH 4WUKL 4Z7WB 2XACC 2DTMH 4PB0H 2P44B 2RQ8A 4HJ0C 3ARFC 1NBQA 4PJIB 4I18B 4P57B 1CYGA 3IDMA 4QO1A 4C54A 4ENEC 2CKBA 1RIVL 1YJDH 5EOCH 3K2MC 1OF2B 2P42B 2Q86A 5FUCC 5BVPH 3VXSA 1NAKH 2I07B 1RZJH 2EE2A 4NKMA 5DR5H 5EU4A 1TVHB 4UT9L 2YD2A 4X8JB 4K9EL 4F15C 4KTDL 1TZGL 5MI0C 2ZCKL 3ME0A 3I3EA 3RGVD 4LGRB 5GRJH 4LPYA 2B1HH 2G5BB 3JVGC 4RISL 1OTTD 4OZGE 4Q9RH 4Y89A 4CU7A 4MAYA 1H0DA 5GGUA 1W72A 1DQJA 1RHHB 1DQML 4Q0XL 4X6BA 2V9RA 1FJ1B 2NY5H 1BQHB 5FA3A 4WUUB 4XP6L 4L3CB 3SDCA 4RMVA 1AGEB 4ZODA 4HWBA 1TVDA 5HHNA 4O02L 4F2MA 5JORA 4M43L 4HF5L 2YC1A 4WJ5A 5C0EB 4HJ0D 3ARFD 3HE6B 5ETUA 1H3PL 1IAKA 5CJOH 1RFDL 2XTLA 1DEDA 3ZKXC 1NDMA 5GGQH 3AAZA 1ZT4B 4FABH 2D4DA 3K80A 3PWLB 4PJHA 4I1NB 5D1XB 5FCUH 5HHQA 4PRAA 4F9LC 5ACLA 8FABA 1KBGH 2ZCHH 2EH8L 4PTTB 4JQIH 4UZGA 1MIMH 1Q9LB 2BSED 3QEQB 5FYKE 4OKVB 4DKDC 3SGDH 4H25A 4KQ3H 3RWJA 3QISA 3FT2A 3GBNL 3BH8A 3FQTB 3PDDA 2CRIA 4P2RB 3PNWB 3DLQR 4IMKA 5K9OA 3IAGC 2QSCH 1NAMB 4R0LC 3CH8A 1X5YA 3TBVA 1D5MA 3BAEL 4JFZL 5JW4R 5E8DH 4NQDD 4JFHD 4C56A 1GCFA 1ZWIB 5F89A 5I71C 1D5BA 1DFBL 5ID1B 4FZEH 5ID0B 2IQ9H 1TCMA 1UG9A 1NUNB 5DVOA 1T5WB 2DQFB 2J4WH 2VC2H 4IIQB 4YDJB 5JW4Q 4OFVA 3GGWB 4M8QB 5AYUL 4HUMB 3ARTA 3BSZH 1L0QA 3SDXF 1ES0A 3PDGA 4OBSA 2DTSA 3SDDB 2R0KH 4PJ9C 4WNQA 3S34H 1P7KA 5MERA 3N1MC 1FVDB 3VWKB 1PD6A 5IIEA 5HJ3A 5IBUG 1I3GH 3HNVH 2BOCB 5C0CB 4UT6L 2D7NA 2Y1VA 4OLXH 4M03A 2XZQH 5IMOA 1A8JH 1A6WH 3QCUH 3T0EB 4NP4H 2O26U 2ZUVA 1FNHA 4APQC 4OV5B 2JJSC 2IAMA 4M3KB 2DWEB 2R23A 3F7QA 3OL2A 1ED3A 4QT5B 1SJEA 3VFUB 2GJ6A 4X9BA 4KJQC 1YUHB 3TT1L 4NGHH 2EYSA 5DRNA 4G9DB 2L7UA 5C0AA 1U8MB 1BZ9B 5GRVK 1JUFA 3RZWA 5C0BD 3LPFA 2Y5TB 4S0TD 3NA4A 4PY8I 1T2JA 3GSUB 3N85H 3B5HA 4D0BA 2XTJD 3NFPA 2PYEA 3VD7A 5L2KA 2F53B 1TPXB 1BIIB 3TZVA 5B38B 4PJ9D 4DQOL 1MCOL 2JK5A 3RKDC 1UACH 1IGCH 4Q9BA 1HZHH 3WIHH 4AT6B 2DKMA 3MXWH 2AK1L 1FC2D 3GSRB 3IFLH 4KHXH 2AJVL 1IGFL 3BE1H 1MAML 5GZOC 5IB2A 3MRHB 3EGSA 4MNQD 1IM3A 1VKXB 2IBZX 4I0PD 3LVEA 1CD1B 1PLGH 1TIUA 3KLAA 4NQXB 5SWQB 4E9LA 4K7PX 1X5JA 1LK3H 4OF7A 4KJQD 3U79A 4WDIA 1VGEL 4Z7VB 5K59F 1NMBL 3GSQA 5JNYA 2B8OT 4I9WD 1HH6A 1FLRH 1N0XL 4GRWF 4I77L 1PY9A 4V2CB 2VDML 2ZJSL 2NCMA 4LK4A 4I2XA 3GI9H 5IK3B 4BH7B 5I8CB 3TV3L 4JPWL 1BREA 4P5TB 3MMEB 5KSBB 1BAFH 4OCYL 4ZFOL 1I1AC 3A67L 3MJ6A 1S7SA 1CU4L 3TBSB 4WTZA 3CU1A 2EYTB 3L9RA 5GSRB 1A7OL 2A9NH 2VSCA 5DYOB 1G9MH 3I3BA 1CVRA 3Q0HA 2UUDK 5JXAL 4JFDB 5KS9B 5GZOD 3U6RB 4WGVB 1A1OB 1LEGA 4A2MA 5HY9B 2X7LB 3VDAA 1OAXL 4RMRA 1F6AB 1HILA 2VDNL 1YEGL 4KAQL 1M1SA 4OLZL 2YN5A 1UM4L 5GRUH 1AHWB 2BSSB 4Z7WF 5DGRA 2MJWA 3WIIL 3LZFH 3D0LA 4HS6B 4ODWB 4PJIF 1W0YT 3TPUA