5A3IC

Crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFSDYWIGWVRQMPGEGLEWMGIIYPASSEIRYSPSFQGLVTISRDKSINTASLQWSSLKASDTAIYYCARHASCSARSCYWGPVDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMAGGLUTININ
publication title Structures of Complexes Formed by H5 Influenza Hemagglutinin with a Potent Broadly Neutralizing Human Monoclonal Antibody.
pubmed doi rcsb
source organism Influenza a virus (a/vietnam/1203/2004(h5n1))
molecule tags Viral protein
total genus 39
structure length 226
sequence length 226
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a3iC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a3iC01
4OZGB 3D9AH 1Z0MA 4GAYB 5E4EC 4RA3A 4RQQA 1NMBL 4TVSa 5I1DA 4HKXB 1QLRA 4X5WA 4NN5B 2A6IA 1C16A 2XN9A 3EOAA 3L3IB 5HGGS 3WHXA 1G7PB 2DDQH 5E8EA 3FMGL 1KN4H 15C8L 2XY1A 4KJYB 4XBEL 5IHLB 1YPZB 4Z78A 4IDJL 3H8NA 3W9DB 4NZJA 1BHGA 3NMEA 2I9TA 4DGIH 1X4XA 1Q38A 5EBLB 2YUXA 2WLYA 5EZLB 2Y36L 3DV4B 4XPAH 1QKZH 1INDL 4D2NA 2NY6B 1NLBL 4LL9A 4DN4L 1XAUA 3KHQA 3ZZ1A 5IIEA 4U0RC 5E2VL 1PY4A 4XB8A 1CFVH 4EUPA 2D7PA 2A9NH 5C0CB 4LCWE 3T2QA 4QRRD 2YPLA 4S1DC 4UAOB 5A40E 4QY8A 3TM6A 1IM9D 1I7UA 4F3FA 3WFDL 2YRLA 1WT5C 1GZPA 4XNXH 1LP9A 3RP1A 4KC3B 1RUPL 2G60H 4U7SA 2C1PB 2E9WA 1KENL 1NFDF 1Q0YH 1N8ZA 3VFWA 5C9JA 4LHJB 5HGBB 3LN5B 5EO9A 1IT9L 1G7LB 2PYEB 43CAA 4JAMA 5JXAH 3AROA 4G8EB 3T3PF 2WP3T 3ARFB 4JCMA 2J88L 4HCRA 3DJ9A 3ZKMC 3GJFA 4KJWC 3ZTNH 1SBSH 4A2MA 4LDOB 4PRPD 4XHJC 5JOEA 2GAZB 3S3SA 4BZYA 1QRNB 1ZANH 3ARGC 3QRGH 1CCZA 2ZOLB 4HWEL 5KSUB 3L3JA 3RTQD 4C83A 2GTWA 3U36A 3EUUA 2QHLA 1RZJL 5EZIL 2ZJSH 5IMLB 3PIQB 3MJ6A 4QHNA 3DECA 5I71C 3QIUB 1BEYL 1RSFA 2E27L 2EYRA 3B9VA 2Y5TA 3JZ7A 2XXMB 2V7NB 5BRZB 5IW1A 1I85C 1FGVH 1FP5A 2IANE 1U8JA 2J1KA 3IXTB 3MRFA 4MA8H 4EDXB 3BH8A 5SV3A 1J1PL 2DIBA 4GBXD 1CFQA 3W11C 4X7TB 3ULSB 3PWPB 1YQVL 3EZ8A 4FQ2H 1G9NL 1P9MA 4K2UL 3QXUA 2NCMA 1LEKA 1ZXQA 1EDQA 2BNQD 3DSNA 3EYUH 4MVBC 1W2KT 1NL0L 5J6HA 1JFQH 3BMVA 1Z0NA 4Z7OE 5C09E 4TOYH 1BQLL 3IDYC 5DRXB 4AM0B 5J4MA 4HFUL 1PYWB 3MYZA 3EBAA 3KPNA 4KKLC 3TWCH 1NSNL 4YHKH 4L9LC 2NY0C 3K8MA 4H5SA 1W8OA 3RVTD 2GI7A 1UWGL 4MNGB 3DV6A 3G6JB 3EJZD 3MBEB 1CFSA 3QWRA 3MOAH 4Y2DC 1VKXB 1CL7I 5D96C 2PCPA 3HFML 1MHPL 1ZLUK 1TDQA 3MLTB 4YHNA 5DJAA 4RFNB 5KVGL 1WJ3A 3VXSD 5GJSL 2IAMA 3C6SA 3Q6FA 5TQ0L 1AO7A 4JY4B 1RZIA 3AFLA 1B4JL 3BPOB 1A8JH 2WQRA 1BWMA 2G9HB 4PP1C 4X7EC 2DF3A 2VISA 3ZT5A 2V17H 4B50A 5F9WB 5HVHB 1CXIA 2HFGH 3K2MC 4JFDB 5I16A 1RMFH 4AH2B 1FN4A 5J7CC 1EO5A 3KDMB 2BDNL 5HYSB 4NBZB 3MQIA 3NOIA 2DTML 2VXTH 3MYJA 1TVHB 1U93A 5CIPB 4O4YL 3RWJA 4JZJC 4G6AC 5D93C 4F7TA 1CF8H 2CIIB 4Y16C 5A3IC 4PRHE 4PJFA 3PHOA 3JTTA 1NCCL 2IEPA 3FB7A 3DX7A 2A6DB 3FO9A 4MAYC 4BUHA 2HN7A 4E9LA 1S9WB 3O3EB 1F45A 3OXSA 2DM3A 3S37L 3MO1B 3D2UA 2IBZX 3QUYC 1JZ3A 4GKNA 3CPLB 4ODWA 3RWGA 1JIBA 3T0EA 3WIFA 4PJBB 4R9HA 4XC1L 1JYXA 3FQUA 1IFHH 4PJEB 4AQ1B 4M6OL 4NN6B 4ODXA 2FJFA 5D7SH 3VI3F 4OLZH 4RBPH 1YY8A 1LK2B 5F7WC 3HZMA 4RISL 1QUNA 2YPLD 2X42A 4K55A 1QSFA 4RIRB 1UJ3B 2LVCA 4FFVC 3LIZL 2DLFH 3QDJB 5DFTA 5FK9A 4D9RD 4OF3A 1A9BA 5ESAB 3QCVH 4AENB 1N64L 4LMQI 1IEHA 3ARRA 3H0TB 1HEZB 3EFFA 1U2CA 3MGOA 3U0PA 4J1UB 4ZTOH 1I8KA 1WAAE 4RGNC 3NBNA 3ARWA 3Q6GH 5EU3B 5I76B 4P48A 4OM1L 1EIBA 3IAPA 1INQA 1EFXB 3EYOB 3EO1B 1KB5B 5I18L 5DZNA 4LRNL 1EA9C 5I9QB 3W39B 3C60B 3DRTA 1T0NA 3ULVD 4HT1L 3Q5YA 2VDOH 3DYOA 5T33L 5DD5L 4XCEB 4KK9C 3SKJL 3KPMB 3OMZA 4NJ9L 1CR9L 4U1HA 4LDEB 4PG9A 4CADB 1VACB 5HYJB 2OJEA 3LMJL 4XCNA 4NQEA 4DN3H 5K9OA 4YGVB 5IEKA 2ID5A 5D8JL 4LPXA 4YLQT 3GSRB 2LU3A 4YDKH 1T20A 1OAYL 3HC0B 1JWSA 5DUPL 3BEWB 1JZ7A 4KXZH 4OCYL 4POYA 2AJZA 2G2RB 1Q72H 2BY2A 5M94B 1RV6X 4F7PB 3TH3T 4NWTH 5FYJL 3GMRB 2Z31B 3NZHL 5ANME 1NEZG 4LBEA 4HIHA 4M8VA 1WZMA 3A67H 1QEWB 2X44D 2OR9H 3TV3H 4PJDE 2ZUWA 3MRPA 4WWKA 4P23C 3VH8B 4OJFL 3LRSB 5KAQF 4FQHA 4I77H 4AIZB 3D48R 5DA0B 3V0VA 1LEIB 2AJXH 5FDYA 2NY7H 3T77B 1IM3B 3G5YB 5HHNA 1UH3A 1KFAH 4ZFZB 4PJXE 3GBMH 2YD9A 3NCFB 3D0LB 4LCUB 5ID1B 3P4NB 3BEVA 4PJGB 4WTWA 3QHFL 3QH3A 5DRNA 4HGKC 4DGIL 3BVNA 3R0MA 3LKRA 5DUMH 5I0DA 5FF6A 4NM4L 3L3KB 4JPWH 4OZ4B 1ORQA 1QKZL 3O11A 3QG6B 4TSCH 1I7TA 3QIBC 2CIKA 3TP4A 4FQLL 2J4WH 3MV7B 1U0QA 3MFFA 1AO7D 1N6UA 4AT6B 3FQXA 5J12C 4MCZB 4P46C 4K7PL 5BXFB 1FG9C 4X99A 1F3DJ 2R56L 4JRXE 1MPAH 3CFIC 4L8SA 5D1ZA 4K7PY 4P2YA 3RVUC 4Y4KA 1DBBH 2D9QB 2DYPB 2R29L 4J2XA 4G9FE 3P4LA 4HIJA 5IMOA 1A3RL 1J10A 5T3XD 3VD5A 3VGDA 4P9HH 1WZ1L 2OJZL 5D7LD 2IALB 1JMZA 2D03L 3P73B 3UTSB 4OGZA 4DUVA 4XP9H 5IW3A 3QYCA 2DQDH 4JJ5A 1QR4A 5GGSA 4DK3A 4LCIH 3HE7C 2G5BB 3K1DA 1XGUB 3P30L 3G5XA 2P5EA 3D2UD 3VXTB 3T0ED 4DW2H 4OSUL 2ZJSL 5HHMB 1IQWL 1PLGH 3HE6A 4R90L 1F2XK 3NACL 2BNRD 5H35A 1LILA 2CD0A 4ZXBC 4WTZG 5SWSE 3VXSE 3TN0C 2ZUTA 5JPMA 2MOVA 3IFLL 2P7TA 3A6BH 4UT6L 5DJXA 1QSFD 3SQOH 1S7XA 1F4YH 1UB6A 4PBVC 4UDUB 5IGXL 2VZOA 1UEMA 5EBWA 3REWA 5DS8B 5FOBB 1MCFA 5LQBL 3D18B 2X89D 5I2IB 2AK1H 3P77B 5DO2C 4Z0BL 3S3PA 1NCAL 5EC1A 3C09C 1O0VA 3BN9D 3FB8B 4I48A 3S98A 1K2DB 2XN9E 2MHAB 5HHPA 2VLKA 4QNPF 2EIZA 3QPQC 2XNAA 4D0DA 1Z3GL 3FTGB 3RKDD 2A6JA 3C2AH 3MCLH 4U1SB 1KB9J 4B41A 4GG6B 2D31B 2CO7B 3GMMA 5IK3A 4RAVB 1TCRA 2WINB 5K33A 4HWBA 4P9HC 3BP5B 4HS8L 3B9KA 3I6LD 1P2CA 3F7YB 3TESA 4Z7QE 5MENA 1RU9H 3S36X 3ZL4H 4HIIB 3IDGB 2ZKHL 4BH8B 1DLHA 4C4KO 4NQED 2GTZB 2XICA 3ILPA 1NBQA 3E2HC 5ICZA 25C8H 3EJJX 5GZND 1YEEL 1U8HB 3LKQA 1T89A 1LGVA 4XP4L 5E1HB 4ZO7A 5I8KH 2J2ZA 2AERT 1D6VH 1C7SA 3DX8A 3CZFA 3D25B 1ULVA 2VDRL 1N4XH 1MCHA 1IGIH 1UACL 1L7IH 4KRLB 4WHYG 1AE6H 3QUMB 4FZ8H 3RPKA 5HDQH 2E7HA 1MRCL 5J13C 3ME0A 1ZLWH 2OL3B 5B4MD 3T65A 5C0RL 2O61B 3VXRE 3HC3L 4UBDD 3MROA 2OZ4L 4LCCA 1DSFH 1IGYB 4YDIH 1DANU 3P3YA 1A6WL 4Q6IB 3QWOA 2R23A 1MAML 3UO1H 1CLOL 5DJ6B 3HNSL 4H1LG 1CF8L 1A7OH 4TUKH 4W70A 4KROD 2X4TA 1T7VA 3ULVE 1AGCA 1WITA 1EHAA 1MLCB 3OJ2C 1Z5LA 2FEDC 1T03L 1PSKH 5INDA 1CS6A 2Z92A 3KYMB 3U7WL 1S7QA 5IBTL 1L0QA 3G04A 3I2CL 4KK6D 3ARBA 4P4RB 1NAKL 5I75B 3K2UL 3Q48A 1MHHB 3FB6B 2ZCKH 1JCKA 5C07B 1URLA 4RNRB 4XI5D 5TFSH 1N0LA 3V5DB 4TUOB 1SEBA 4NUGH 3GBNL 1NEZB 1QSED 4XXCA 1LNUA 1I7RB 4UB0H 2VABB 3MV01 1N5AB 3QA3A 4IMKA 4A6YH 1HYRC 4DZBB 3MZTA 5D1ZD 2VE6A 4JZOA 1KIUA 2IFFL 4HJGB 1JK8A 1OPGH 3L7EB 4M7LH 2ADGA 3NAAH 3X13A 4WW2A 1FGNL 2O93L 5C0GA 3UPRA 4KQ3H 3DX6A 4L8DA 4O2CB 1FNEB 2YXMA 4GRMA 1FZOB 3LEVL 3QUZA 2PXYD 4JFYB 4K23L 2EC9T 1CZ8H 4ZS7L 2AAVA 1P4LA 5C6TL 3V95A 4OD2B 3IKCB 1KXVC 4X6DA 1RUAH 5CD3B 3ZE0E 4JHWL 5ELIA 5A43C 4NYLA 4R7DB 1TMCB 2JJTC 1W0WA 1FLRH 4PGZA 3RGVB 3QDMD 3HE6D 3QO0B 2WBJA 2MCPL 4UINH 4Z8FL 4CVXB 2R2CA 1DUYA 1KUMA 1U8IB 4FXKB 3BPNB 5E8OB 3VXPB 3ULUH 4KKAD 3VWJA 3C5ZB 4Q7DA 1IGFH 2VZ1A 4LEOB 1AO7E 1EERB 1J88A 4HUXB 4PJ8B 1LO3H 2DRUA 5FYKD 3FFDA 4LU5L 4M5YL 6FABL 4NC1E 4PG2C 5C0FB 5JQHC 4YNYB 3DXAA 3D85A 5D70H 3QQ4A 2HFEA 4JN2B 2VZUA 2HJLA 1OAKL 1CGSL 2WWKO 4QEGA 3F12A 4P4KB 4GKZA 3O6KH 2YRZA 3QXDB 1MCCA 1ZGLP 5T3XE 1MI5A 2FATL 2VLKD 5E95B 4Y5YA 4BFBD 1WEJH 3GSWB 4PIRF 5F7UA 1C08B 1KXQE 4U1NA 3PHSA 4IRSA 1K4CA 4HMDA 1CBVL 5C8JB 1EXUA 2AK4B 4PJFE 4PBXA 4DK6A 2VZVA 3BGMB 1NMAH 1F90L 4XAKE 3BP7A 1NUDA 2XV6B 3J8F7 4N8VG 1B4RA 5IUSA 3TYFB 2V7HB 3T0EE 1C5BH 3FFCA 5SWZA 1R5IA 3X3GH 2X9WA 3BE1H 3UYPA 3PUCA 1P53A 1SM3L 5FYKU 3QNZB 1MNUL 5D6DA 2Z4QA 4RAHA 1D6EA 4UIMB 1UYWH 2AXGA 2KL6A 3KS0H 3MACH 3S34H 1PX3A 4U33A 3FRPA 1OSZA 2HKFL 2ZSWA 1OOAA 2Y1VA 4PJ5B 5I30L 4D8PA 1BBDL 3RIFK 3MJ8A 1NLDL 3RBGA 5ILTL 3ULUC 1P7KB 4LKXA 3PWLB 1YEJH 4F2MB 2AXFB 5HGHB 4U1KB 1D9KC 4NKIL 1YY9D 3WLWD 1DZBA 3QIWB 4TVPL 3VCLB 1KEGL 4M3KB 3H9SE 2OYPA 4KVNL 1EGJA 4DKFH 1T1WB 2GITA 5DZOA 5IWLA 3LB6C 5KTEH 5GS0H 3RIFF 4FMFA 1IAIH 1E27B 2PO6C 2A6KB 4M9OA 2GEEA 2P43B 5C2BH 3HRZA 3DURB 2OS7A 4JY5L 4JPVH 3ARBD 5IF0A 3K8KA 3JWDH 4Y4HB 3CU7A 1FH5L 1OTTD 1H5BC 1ZTXL 5T5FL 2AW2A 5B3JF 4CVWA 3GHBH 4XXDA 4XP5L 1DN0B 3GI9L 4G80B 1TPXB 5IVNA 12E8L 3RI5K 5CP3H 3CGTA 2GJ6D 3WXVL 3O6ML 4PRBA 4G6JL 5H2BB 4ZG1A 2OI9B 3N1FC 2OTWA 3SQOL 4MB5A 1IC5H 1HYSD 4MX7A 3RAJL 4NSKB 3KR3L 1B0GA 3B6SB 3EGSA 1JUFA 3AAZA 4NHCH 2HH0L 4H1LB 3AREB 1MREL 2AK1L 5I74B 1Q9OB 3CFJA 1BPVA 4P2CG 3RI5F 3X12A 4WCYL 2AABH 4J4PC 4MXWL 4OLXL 1EAPA 1IC1A 4GXUN 4M00A 4AEHL 2P44B 2AJUL 5TGBB 1BD2E 5K59E 1TJIH 2VDQH 5LGHL 3R06A 4N5ED 3TVMB 4GMTH 2VIRA 1HH9A 3U2SB 3DMMC 4KDVA 5D2LB 2VLMD 4NUJA 2EO9A 1JNHA 1AY1L 3BKYH 3S96B 5KVEH 2XTJB 4XMPH 4LEXL 5DURB 2UVEA 2EKJA 2CLRB 3SDDA 1KPRB 2BRRL 4F37K 4QRUA 3OKDA 3BP4B 2WBJD 4TRPL 2EIBA 1ZT7B 1IQDA 3KPRD 5GS0C 2V6HA 1RZFH 3SGKA 3MJ9A 1WF5A 4JFZH 1YMHA 4KMTH 3PGFL 1QQDA 4OLWH 4MNQA 3TNNB 3HMXA 1J0HA 4ORGB 5CAYB 2VR5A 2CDFB 1S78C 4Q9BA 1N5YL 4F57H 3JWDC 4ELMF 5HGDB 1N59A 3D85D 4UT7H 2YZ8A 4F37F 5LBSH 4GAJL 3MA7B 3KPPA 2WV3A 4ONFL 5AAWA 3WS6A 3WNPA 2VDLH 3TH2T 1S8DB 2QJDA 5D72H 3RU8L 2IFGA 2XZCL 1MI5D 1T5XB 2Y23A 4NT6A 2FH6A 5L7XH 3PWUB 5HYQB 1Y6KR 4FQCL 4IRSD 4WV1C 3KLSA 4R7NB 5MERB 3FT2B 4UZGA 3VGFA 1WCQA 3STLA 1EHLH 4PYHA 3V2AR 1DVFD 3MREA 1ERNA 5D1XA 3QI9C 4LLQA 4UT9H 1DQLH 4DCQA 1IEAB 2HT3C 2K1MA 4LVNC 5DEZA 4UUJA 3VGGA 5ITBL 5JR1L 2P24A 4HMEA 1A02N 2P5EE 4ODUA 1GGCH 1KJ2B 2ED7A 4P57B 4W4OC 1SBBA 3OGOE 4HZLA 4XPFL 3H7BA 3FFCD 5L2KB 5SWZD 4C56B 4HAFA 5IROC 3CVHB 1P1ZB 3QNYA 4OIAA 4MWFB 3CFBB 5CILL 2P8MA 1E4XH 4IRJB 3CU1A 4POZC 1U8OB 4QHKJ 5TFSL 4XWOC 4YHOL 4QYOB 5LAXB 1S9VA 2EDNA 1E4WH 4QHKI 1F4HA 1KT2A 5JDSB 4JN1H 3OF6A 4HJJH 1XGYH 3TBVA 3CCHB 3IRPX 1HWHB 4Q9RH 1IGCH 3EDFA 5KZCB 3R8BB 4Z7WB 1RJLA 2H6PA 3U6RB 5IG7A 3IGAA 2FSEB 1IC7H 3C6LA 3UTQB 1B88A 1G7IB 4KHXL 1U91B 4M7LL 1QR1A 1HI6A 2Z8SA 3FAXA 3GHEL 4EI6A 3P9MB 4N8VB 1FG2A 4C54A 1DDHB 2E5EA 1HHIB 4YQXL 4K3EH 3HS0B 4O2FA 1ZHKA 1WFUA 4Y4FC 2R1YB 2DJUA 1UM5H 4M61B 1B0RB 5JNYA 3MUGB 1BJ8A 1DE4A 4OGAD 4U1GC 4PREB 1OTSD 2R2EB 4OZGA 4FTVB 4CMMB 2A0LD 2KH2B 4GAYA 2OR7A 1HHHB 4QRTB 2R9HC 5BOZG 5MENE 4D9QE 2BSSA 4ZYKB 3L3IA 35C8H 1G7PA 4YAQA 3TFKC 5A16B 5LJYH 4N90D 1G0DA 3W9DA 1A7QH 3E8UH 1OT1A 1LO3L 1RJZB 1T21A 3WIHA 4PUBL 1X6NA 5DJYB 4LCYA 2HMIC 3ZTJH 1KCUL 1HINH 1JRHH 4NFCA 4U6XA 5E4EB 3X11A 4LIQH 4PRAB 3LQAH 3S4SG 3RDTC 4DOHE 5HDBE 3P11L 4NQDB 3C8HA 5C0CA 1L0YA 5FA3B 5DK2A 3BD5A 2VC2H 4F8QA 3VWKD 1PBYA 2V9TA 1G1YA 5I1JH 4J6RL 5D7JA 5DA4A 5ISZA 3VU2A 1J8HD 5ECJE 3K4AA 3VXUB 4P2OC 1LO2L 5TQ2H 3KJ6L 3SBWA 3SDXE 2DQUL 3LN5A 1YN6B 4M5ZL 4ORZC 3REVB 1G7LA 1ACYH 4HW6A 4G8EA 2F5AL 3ARFA 1G7MB 3BE1L 4G43B 2YKLL 2RQ8A 4E42B 2IPKB 4U0RB 5T3ZL 3SPVB 1IC4L 1J9CT 1JGDA 2GAZA 2QBWA 3CDGB 3UTTD 1A3QA 1QRNA 1OARL 1H9VA 3BIKA 4LLWB 4YFLF 5JHDE 3ZE1E 5BS0B 3WD5H 3NZ8A 1RZ7L 2QSTA 1OWRM 3EYSH 5BMFH 1QFWH 5IMLA 1MJ8L 1U8LA 2R0ZH 3MFGB 2JELL 2EIDA 5DUBA 1C5CL 3IU4H 5DJDB 3QIUA 4I4WA 5DHYB 5GRWA 5MEOA 1CN4A 5L9DL 4PB0L 3IXTA 1JZ8A 4WI6A 5GHWH 5L8KB 5CZVL 2E3VA 3NA4A 4NZRH 1OF2B 2WW8A 4WW1B 4AY0A 3OL2A 4X80L 1K6QL 4Y1AA 5D1XD 3TT1L 5GS0L 3QPXH 4X6DE 3ARGB 2VLJA 4EI5C 1V3KA 2NY2C 2VZ3A 3LQAC 2VYRE 4KMQA 4V2BA 1W72A 4RBPK 5J0BA 4QRSB 1A6UH 5FGBC 3JWDL 1PGRB 1I4FA 4KPHL 1QLFB 1CE1H 3O6FA 1CGTA 5DK3A 5I1GL 2FX9L 1HIMH 5DRXA 4XVUC 5DWUH 4OF5A 5EUKA 1PYWA 2VL5A 2Q86B 5IB5A 4FQXC 4QRPE 2DWEA 2CRYA 1S3KL 1P84K 3FQWB 3OF6D 3OAZH 1TJHH 4MNGA 2PR4L 3DXAE 3MBEA 4JY6B 4I3RH 5GGRY 3W82A 4NO0A 3PDGA 2HJFA 1U3HA 1NAML 4TUJB 4FQQA 2CXGA 3I9GL 2LFGA 5D7IF 3QDAA 2AABL 1UXWB 4N1HB 2P5WB 4JY4A 1T1XA 4YXLL 5LXGH 5DC0A 4PRIB 3CH1B 3NIGE 4P5KA 3V4UL 1Y0LB 3F5WB 3IDYB 2HT4D 1TJIL 2DD8L 2G9HA 5TDOB 2VZSA 5EU5B 1QO3A 5EULV 4LSVH 3U7YL 4G8IB 3ARUA 2FX8L 2KDGA 4JFDA 5HYEA 4ZUTB 1BM3L 1ETZB 4K7PX 1OB1A 4X6FB 5C71A 4X7SL 3LHPL 2VDKL 3OX8A 4XWGL 4Y2DB 3VFNB 4HZAA 4PJ9B 5D96B 5SWZE 4HPOL 4P99A 5AZEH 3RUGB 3LS4H 3GMQA 1G6VK 4OKVB 1F5WA 3X14A 3SE3C 2EXYD 2H3NB 1JNLH 1LD9B 3DTXB 5GRYA 2QV2A 4K3JL 3ESUF 4LP5A 3OGCB 2A6DA 3BAEH 3CXDH 3E1F1 4XNYH 4LQ1A 2RCSH 1S9WA 5CBEA 1JPSH 1NANH 3SKNB 4OZFG 3CPLA 1A6VL 5FM5O 1MFCL 4PJBA 5T1DL 4PJEA 4KRMB 4NM8H 1E6JL 5IQ7H 2IADA 4YZFE 4DKEL 1KNOB 2AEQL 1LK2A 3SGDI 2GHWB 4OZIA 2X9YA 3CVIH 3B43A 1FNSH 3MODH 4JZJB 4KVCH 1A3LH 4RIRA 1XZ0B 5D93B 3KPOA 4Y16B 4R2GC 3V4VL 1EHLL 3QDJA 2WP3O 4MD5B 4OQ1A 5D7JD 4DGYL 3O4LD 5ESAA 5ISZD 4WFHD 5BW7C 1LE9B 5HYFA 4BSWA 1JWMA 4HV8A 4I9WE 1DQLL 4L3CB 4MAYB 1AGEA 4PLJC 4MDJB 2E9IA 2VWEC 4J1UA 4EOWL 3PGCB 1EBPA 3WKMH 5BVJA 3QUYB 1E6OL 2Y72A 2ESVB 3P4MB 5EU3A 1L0XA 2NY0D 2W65A 4KTEL 4ZUVA 4L4VA 1IAOB 4ZPVB 3GMPB 3Q5OA 1MCOL 1NBVH 3EO1A 5JOPD 2JCCF 1FO0A 5E6IC 5HHOD 1JPFB 1FJ1A 1QRND 3PJSB 5DEFA 3C60A 2F8VA 4ZUUB 2C7UA 3WFHB 2MJWA 5ICYA 1ONQB 2H2SC 3NABL 2N7BA 5TE6H 4JN1L 3KPMA 2E6QA 1OL0A 5KW9H 2GJJA 4CADA 2FO4B 4JO3H 5EU4B 2VQTA 4U49A 4GW1B 2DBLH 4KZEH 1E4KA 4QOKB 5F93C 1B6DA 4N9GB 3V8OA 1EMTL 1PY9A 4RGNB 3KXFB 2BJMH 3L7FB 5E9DB 3WO3B 3GSRA 3KJ4C 1RHFA 5CMAA 3UBXB 3RL1B 3CFCL 4JPKL 3HC0A 5FYLH 1HHGB 1I1FB 3N50A 4Y1AD 4YE4L 4QXGL 2G2RA 2NYYD 2QQKL 2FBJL 4LLMB 3VXMA 2VLJD 4HWUA 3MRNB 2YPVL 3VD9A 1VFMA 1A4JB 5GZOC 3B3IA 3OBAA 1V7ML 4LGPB 1NGZB 1F00I 1ED3B 3LRSA 4Z7UE 3O6FD 2PW2A 4AIZA 1TETL 4W68A 4MNQE 3GB7A 1P69B 2UY6A 2PN5A 3G5YA 1R3HA 4ZFZA 4JM2C 4ELKB 5DYOA 3D0LA 2YEZB 5ID1A 3I02B 5J9PA 3L3DB 1KELH 4PJGA 4NO0D 1MQKL 2X05A 4R96B 3DSFL 5E08H 1U3HD 4Z7VF 1JGEB 2ITDA 3L3KA 2V5YA 1BFOB 1INEL 4G9DB 5GXBB 2H26B 1JRHL 4XNUL 4BH7B 4P23B 2H32A 4I5BB 4AT6A 3K81A 3OPZL 5IVXB 1A1MB 1KN2H 3L5JA 3SJVD 3LSOB 4U6HA 1K4DB 4KJQD 3OAUH 1UADC 4CBPA 5BXFA 3IFNL 3KPSB 1FAIH 3GUTA 1YEFL 4ZUWA 4YHZL 5T1LB 5INCB 3MSPA 4WEBL 1Z9OA 3JV5A 5CZKA 4O5LL 1DLFH 4L3AA 2VLRB 2DYPA 4DKDC 4ZMAT 3MX0A 4RGOL 3B2UC 4LMQE 3RIAK 1MRFH 3H9YA 4UOJA 5DMKA 3O8XA 3NCJH 2IALA 2HRLA 3R4DA 3P73A 3UTSA 1OGAB 2Z93B 3QIBB 4K71C 1EJOL 3L5IA 1I3GH 4IS6B 4YEEA 4JKPH 4PJ7B 1U6AH 4PY7A 5J12B 2R8SH 1J05A 4P46B 1IBGL 1FNGB 1XGUA 1ZLWK 3RIAF 1CGYA 1ZMYA 3C5SB 4P59L 3UJJL 4CVZB 1YNTB 4PGDA 1S7VA 3AU1A 1TITA 5GISL 2DQHL 3VW3L 5T1KD 2X4QB 2ZCHL 2GT9B 1U8QA 2VAJA 4X6EB 2X7LB 4YWGL 2BP3A 1DANT 1BLNA 2X4SB 3R1GL 1EK3A 2W60B 1S9YB 5HHVH 4UDUA 3VFMB 4NQVB 3QDJD 2X70B 3D39B 1CIDA 3CFDB 5FGCB 5FOBA 4WI3A 4MD0A 3U4BL 3RNKB 3FOLA 3HE7B 3RWHB 3T3ME 2X4RB 3P77A 3JUZA 5L2JB 1JPTH 4EDWH 5J1AA 3RVWC 4OZGE 1DQMH 3TPUB 4LF3A 4O58H 1GPOH 4LOUD 2VNCA 1NCWL 1BZ9B 1U8KB 3OSKA 1XH3B 2DJSA 3FB8A 1CD1B 1DEEB 1K2DA 4OZFH 4UTBL 4U3XA 1YMMD 2JLLA 2P8LB 2MHAA 4OGXL 4TQEH 2F58H 4L4VD 3V6OC 4CRPA 5CEZH 2DQIH 3ARTA 4NO5A 1X7QA 4ZPTB 3NIDF 4ZXBB 3FTGA 5F9JA 1X5FA 1CE1L 1QYGH 2B0SH 3MV8B 4CGTA 1N2RA 4U1SA 1EO8L 4GG6A 1YPZE 2D31A 1WBZA 4OKDA 1SJXA 4NO3A 4RAVA 2JCCB 3BP5A 4I0PA 4F58H 1CGVA 4GW5B 3D3VD 4L1HA 1PFCA 5FV1L 5BJTA 4LGSB 4M4PA 1UXSA 3HG1D 1G7JA 4OCLC 1H0DB 3L6FB 2PYFB 5C0IB 2B4CL 3C09B 1U8HA 2RFXB 5GRUH 3D6GA 4PV9B 5EORH 3DUSB 1A6TA 5GGVH 2E9JA 3RPIB 5C0CE 4R3SB 1SY6L 3DRQA 1NDGB 5ICXB 1NBYB 3MXWL 4JGMA 3VXMD 1IGML 1JYVA 3OHXB 4ZUSB 1GC1C 4ZO6A 1EJ6A 3O9WB 3H42H 1FZJA 2WBKA 3F58L 2NY5H 4XX1G 2AXHA 5JIKA 3BKCH 2OL3A 1F11B 1MWAL 4IHOB 5DHVH 1Q1JL 1VENA 1OAXL 1PQZB 3THMH 5FUCC 3IF1A 5ADPL 4OUUB 4XTRD 2PYEE 3ELAT 5EUOB 3UC0L 4HMCA 4L3EB 3E2HB 3EYVA 4B7IA 4MJ2A 5DJ6A 1TZHB 3OAYH 2R2BB 1HN1A 1VFBB 1CK0H 4R26L 2E7BA 1RUQL 5FGSA 1QRNE 2YBRB 4KWUA 1JNLL 1O7SA 4KUZH 2JB5H 4BQ8A 2R0KH 1AR2A 3KYMA 2FECI 1K8DB 1KCSH 2QEJA 3DHMA 5MEPA 3ULUF 3TN0D 2DS4A 4M6NL 4ZFFB 1GL4B 1S9XB 3QXTA 4U6VH 2CK2A 3LZFH 1MHHA 3FB6A 3W2DH 4LSPH 5HI4C 5T5NF 5DTFA 4OLUH 3A6CL 2I5YH 3MLSH 5BRZE 4Z7VB 3V7MA 4HG4K 4NM8L 1NEZA 3VDBA 1ADQL 2VABA 2J3SA 1N5AA 4WEUD 3ZT7A 2J6EH 1B9ZA 4LAQH 3WYRA 1NCDH 4GQPH 4Y1AE 3PWPE 4LSDA 5DMGD 1IJ9A 1CG9A 3G08A 3L7EA 4P5MA 3T0AA 1UC6A 4HC1L 3V4PL 4XH2B 1MRDL 5E6YA 1IGJB 5E03A 3B9DA 4YO0B 4JKKA 5JQ6H 4O2CA 4ENED 1FNEA 1KBGH 3O8XD 1MHCB 5CEXA 4LSSH 2ZCLL 1OD7A 2E9BA 3VE0B 4JFYA 3O2WH 3VG0L 5E7FA 1TXKA 2NY5C 4OD2A 5AAMA 3IKCA 4XHQA 4YFLI 5DHXB 5CD3A 4YHML 2AXJA 3ARYA 1AC0A 2ZOKA 2X4UB 4MNGE 2LU4A 4ZQKB 3G6JE 5K93A 2X4NA 2CLZB 5HHMD 5KW9L 4X4XB 3IT8D 3MRQB 4ZS6D 4HS6A 5DD3L 5M95B 1U8IA 5C0BD 3UBXI 1ZHLB 3ZO0A 5E8OA 2EDKA 3SHSA 4X9BA 3C5ZA 2AI0H 1R5WB 4JCLA 4LEOA 4Y7MA 1FZMA 4HUXA 1A5FH 3VRLE 4PJ8A 5CJ8A 3S5LG 3VMNA 4PRNB 3UJTH 5C0FA 2H2PD 5I1IL 4YNYA 4YX2L 5DD6B 5C0DB 4JFDE 4H8WL 3OKNB 5KSAD 4P4KA 4XMKH 2NXZC 2UZXB 3BT2H 1FV1B 4UTAH 4MJIB 1YEHH 3QFJD 3FJTA 1WWAX 1C08A 3ARDC 3GI8L 3SGEH 1XGQB 4ZSOB 4LRIA 5F1OB 3EOBB 3WL9B 1I8LA 5DF0A 3T4AB 5C8JA 2AK4A 2CGRH 5FA4A 2EDWA 3SE9L 4WTZA 5SWQB 4PJIB 1W0YT 4S1QH 4L5FL 4I0PD 4RGMC 3VD7A 2QKIB 3IXAA 5EOQL 4DGVH 3ALXA 5ALCL 4Z76B 1ITBB 3BW9B 4ZOAA 2R1XB 4MDIB 4PJBE 4PJEE 1KIPA 1FDLH 3QNZA 4FZEH 3NFNB 4YR6B 4A6YB 4UIMA 4RAUA 4X5XB 4HQQL 4OZIE 3QUXB 2CKBH 2IMMA 3MRHB 3O6LL 3OAUL 4XCCH 5DQDL 3SDCA 1FAIL 4S11A 4PJ5A 4FABL 3QDJE 4NZUL 3U4EB 4F7CB 2ZUYA 4O9HL 4ODTH 3L5WB 5IEHB 1KPUB 4IMLA 4OFYD 3HLAB 3LKOB 1U8PA 1P7KA 4JFED 4RCAA 3QZWG 3PWLA 3WEXB 1U42A 1SJEB 4U1KA 4Y89A 4UU9A 3QIWA 1AD9A 3ARVA 4L4VE 2CDGB 3NCBB 5TPWL 1LHZA 3VFVB 4L4TB 2YMXH 3I85A 5KVMC 1KIQA 1YN7A 1T0MA 4JKPL 2V5TA 4XCFH 1DBJH 2A6KA 1T1ZA 4F9LC 4PTUB 1ZHNB 1ZWIB 3SN6N 3I3BA 4ONGL 3DURA 1F3DH 3GJEB 3TPKA 1LQSR 4Y4HA 4N0FB 5HYJE 5ID0A 3WUWB 1DQTA 2YN5A 1V7NL 4KXZI 3PP4H 3EDKA 3PG2A 1GC1L 1PZ5B 1IAKA 4XGZB 5H37G 4LPVA 2FZ3A 4N0UB 1D9KB 5IHZB 1H3XA 5EOTA 1JI2A 5HDOA 1A7NL 4H25A 3T2NH 4XCYA 4WI4A 1I1YB 1FNLA 1OP5H 1U3JA 2C3WA 4U1JB 3KLAB 4OCXH 4NSKA 3FQTB 4AIOA 5ERWB 4H1LA 3AREA 3TCXA 4FP8H 2E8ZA 4YBHA 2DL9A 5L88H 5JUEH 1EUUA 1JPGB 1Q9OA 3WLBB 3NFSH 4W6YB 2A77H 2IH3B 3FZUD 1H5BB 3DIFB 3L1OL 4N8CH 2IBGA 4JFPB 4K9EH 2Y4SA 4BSVA 3TVMA 3JVGA 4QT5A 1FFNB 1ND0A 1T83A 2FRGP 5GS1C 4GBXC 1YEGL 4JFHD 1MIEH 5JLZB 4NWUH 1D5IH 2IH1A 5AYUH 5F6HJ 3MOBH 2CRZA 4PJGE 2J7LA 2CLRA 1H8OA 3BP4A 2OSLB 4G5ZH 2CK0H 2L0DA 1ZT7A 5GSVB 5ESVB 2EE9A 5IB2B 2VDNH 5HI3D 1UWXH 3TNNA 4DVBB 1IL1B 3MV7E 1A14L 5F44A 4P2QB 3ROLB 5IJKC 1K3ZA 3HNTH 5FUOH 4ORGA 5C86A 4MA7H 2CDFA 1RFDH 4NQCB 5EORL 1FL5A 2NXYD 4NKMB 4DQOH 1KTDB 3ULUD 2UWEF 3CZJA 1B0WA 5GSRB 4HHAB 3DMMB 3F7VB 4OLEA 4EUPH 3RVTC 5GGVY 2DLTA 3MA7A 1S7TA 2G5RA 3EJZC 3TIEB 4XP6H 2XOTA 2XG5A 3GK8H 3U7AA 1JHTB 1B3JA 2NY5L 1CL7L 4KI5F 1QVOB 1WZKA 1BGXL 2E8YA 1J0IA 5E5UB 4X8XA 2PO6D 2JJSC 4M1GH 5GS3A 5HYQA 5DJZB 3SDAD 2Y06H 4HX1B 3UTSE 5MERA 3FT2A 1U8NB 2D4DA 4MXQC 4C59B 3MC0A 4JFFD 4HCRH 3GJFH 2AJ3B 1TQCC 5ENWA 1II4E 1LO4L 4O2EA 3QR2A 5HY9B 3BSZH 4G7VH 3TCLA 2AGJL 5E8DL 4P57A 5L2KA 3ULVH 4YHLH 5HHME 5IBUG 3CFBA 3W2DL 3AM8A 1RUKH 4IRJA 5F72S 2VDPL 2Z8VC 5FFLA 5GGRB 2VR4A 4XZUB 3MLSL 1K8IA 5JTWA 1G6RL 2XRAH 4Y8DC 1F3JA 3FRUB 3L3HB 4OF0A 3SDCD 3RBSA 4WV1B 2ARJQ 4YHPB 2D0HA 4X6CA 3LKPB 4GSDL 5AWNL 1P4BL 4M6MH 1CI5A 5HD8D 2V9QA 1V3MA 3QI9B 1X5IA 1CDIA 1OTUD 1R3IL 2FSEA 5JOFA 4LVNB 2X10A 5I1LA 4OQTA 4GG8B 4U1MB 4WO4D 4LARH 3PF2A 5FOJA 3BDYH 3BQUA 4UOW0 5FKPB 5JQ6L 4PJCB 4N8VA 5LWYL 1QRKA 1M1SA 1GGBH 5DDHA 1BIHA 5CUSL 4GAGL 4PGJA 3IDXL 5GS2D 1CGXA 4GG6E 4M61A 3S35H 1T1YB 1FE8H 1MJUL 4HWZB 1AI1H 5DJ8B 4IEFB 4PREA 2R2EA 1YNLH 5DJCB 1YYLL 3NCMA 4G8GB 3QP3A 3OKYA 2YUWA 5F7DB 1AC6A 3HAEG 3QUKB 5CEYA 4ALAH 5F1KC 4ZYKA 4MNHB 4G6FB 4Y19B 1NGQH 3FOMB 1NPUA 3O45B 1OAQL 5CSBA 3CFEA 2DQJL 4WI2A 1A5FL 1KCRH 1RJZA 3HUJF 3ULVC 5BZWA 4Y4FB 1FZKB 3IDUA 4PJAF 5BV7H 4KK5D 3QQ9D 2ICWB 4NNYB 2J8UF 5F7EL 4PJHF 4QHLB 1A1NB 3ARED 1L9NA 2F53A 2WUBL 3B2VH 1SEQH 3NIFF 4U1GB 5EA0H 4ODSH 4K8RH 1H8SA 2DAVA 4O02L 3OXRA 3BUTA 4PRAA 1AIFA 2IQ9H 1MCRA 3UDWA 4GRLA 4NQDA 2CMRH 3O4OC 5T3XH 2FD6H 5FA3A 4YDVA 3OAZK 4X8JB 3FN0H 3BXNB 3WE6A 5EU6A 5GGUB 4YBQD 1LDPH 3FO0H 4U7MA 4R8WL 1CGUA 3T0BA 4OCMC 3RZCA 1P9MC 1HKFA 1ZT4B 4NZTH 5HHQA 4Z77B 1UG9A 4Y88A 3QEQB 3EAKA 4QHMB 1PJ9A 3DYMA 3QB7C 5DT1H 3REVA 4R4BB 2IWGA 3JV4B 1GYAA 5C07E 3SY0B 3C9NB 4JM4L 1D3CA 4Z0XA 4HF5H 4JFOA 2IPKA 3RDTB 2C1OA 1FQ9C 5JW3H 3HZKB 2W0FA 2XKNA 4Y5VC 3MLYH 5BS0A 1JGVL 1AHWB 4PLKD 1TENA 2X9XA 1MFBL 2CLVB 2EH8L 3ZSTA 4JDTH 4NBYB 2OQJB 3VFPB 4GXVH 3WSQH 3FN9A 1GGIH 4JFQA 4P2OB 1L6ZA 1Q9WA 2ICEA 1JZ5A 3MGAA 2GSIB 1XEDA 2FLBT 4XNQB 5MP6H 1FPTH 1T2QL 2BSTB 4QCIB 4WJ5B 1BOGB 5IP4A 1AKJB 4QTIL 5MEQA 2B1HL 1YEKL 5BV7C 2NY1D 1OF2A 1S7RB 4WW1A 3S88L 3GMLA 4GRWF 3OZ9L 4K8RC 1QOKA 3ARGA 1JJUA 3EJYC 4JO4H 5FHAH 4XCFL 4JHAH 1DBJL 3PQYA 4GOSA 4R6UA 3TBSB 4TTGA 4WU5B 2X1XR 1GZQB 3RNQA 2WUCL 1FORH 4CW1B 2QSCL 3TT3H 1J5OL 3QEUB 1IVLA 1QLFA 4XPHH 5IFHL 3PP4L 5C08A 2Q6WB 3I6GB 5IFJB 1R24B 1I9IL 3O3BB 3FQWA 1FVDA 2HWZL 1KYOJ 3AC0A 4TSBH 4MXVE 1XF1A 4HG4J 5DK0A 4EI5B 1T04A 3T0EC 2NY2B 3KPLB 3OKEB 5KJRL 5GGTL 1EX0A 4DTGL 4TUJA 3LEXB 4TPRH 3TNMB 3VFUB 3BQUD 1JV5B 1UXWA 2UZIH 2P5WA 3LS5H 1XT5A 4LSQH 4PRIA 3CH1A 1Y0LA 1CTOA 3BWAB 4JM2F 2XZAH 5TDOA 5CWSB 5IBUB 5LGJB 3EDDA 5BCAA 3MBXH 2AK4E 3LD8C 2W07A 1PKQB 4G8IA 4P2RA 3SE4A 1H3VA 4KI5D 1ETZA 2CDEA 3BIAX 1N0XL 5AYUL 1BMGA 3MCKB 4Y2DA 3TJEL 3V0WH 3EYFB 4PJ9A 5IM7A 1LE5B 2ATPB 3BN9C 2H1PH 5B38G 3BKML 4OZHF 4XP1H 4PBWD 3RUGA 4OKVA 3S6CA 3MRIB 3RKDC 4Z7NF 1JF1B 1LD9A 2FX7L 5FUOL 1SJHB 5IHBA 3SE8H 4WDIB 1TZGL 3EOYG 4PJ5E 2V2XA 3OWEA 1A6AA 1BIIB 4BM7A 3OB0K 4V1DB 5FEBA 5KS9F 3SKNA 1G9MH 2F53D 4P9ML 1LEGA 4HKZA 1JF5A 4XPGH 4GW4B 4PJHB 3WFEL 4NDMA 5IB1A 1IAII 1DBAH 1NFIB 2DLHA 4O51B 1BZ7A 1KNOA 5GZNC 4LHUG 3CMGA 4GRLD 2RB8A 3HAEB 1DFBH 4KZDH 1ZT1B 4GKSB 5EU6D 3KG5A 4CU7A 3RWIA 2CUIA 7FABL 4U6TA 1CDUA 3RZCD 2GCYB 2PW1A 5I6XC 4MAYA 4L3CA 4XC3L 3B8YA 1DTUA 3VG9C 3PGCA 3VXQB 3QT2A 5B4MC 4FQXD 2XZQL 3MLRH 2R4RH 4S1RL 4X4ZA 5GGQL 5DSCA 1S5IH 1N3NB 2LTQC 3GGWA 1Q8MA 2YK1L 4HIXH 1B6UA 2Z91A 3K74B 3PJSA 2YC1B 1QNZH 1VHPA 3JWOL 4GH7B 3S4SA 4KROC 1DBKH 3P9LB 3C8KB 4R2GB 3MV9B 2CH8A 4MJ5B 3KYNB 5HTSA 2V2TB 4KK6C 1K5NA 4TNVK 3HI6L 5FYKH 2FO4A 5E00B 1MFNA 5EU4A 3W9EB 5I8CA 1FFRA 5HI5D 4NRZA 2GK0B 3LN4B 1NC4D 4N9GA 4XI5C 4F9PA 3GSOB 5FYJD 3RL1A 1SMOA 4JQIH 3SQBA 1G9MC 3E6FA 4HH9B 4NNXB 1I1FA 2HKHH 1YC8A 1BX2B 1XF2B 5E5MB 2AEPH 5E6IB 5D2LE 1CICA 1MWAB 2IPUK 3A0OA 4L8SC 5D1ZC 4TNVF 3PQYD 4NPYB 2XPGA 4G6MH 2MFNA 4GS7C 2OZ4A 5DRZB 1WSST 3S35L 2YUZA 3S3JA 1AI1L 1A4JA 3UEZA 1NGZA 4UV4H 3BUYA 4HWBH 4ALAL 1UB5B 2VXSH 1WCBB 5C08D 1OGTA 2XKSA 4HDIB 1E28B 1KB5L 4Q9CA 1YNKH 3OV6A 1GIGL 1M7IB 3KJ4B 4ELKA 3CLFL 5BVPL 2ZUUA 2YEZA 1DL7H 3I02A 4JANB 1EBAA 4HBCL 3TIDB 3U1SL 3KAAA 2GW5A 4JEGB 4JO1L 4R96A 5C6WH 1DUZB 1MIML 1JGEA 5TH2A 3MUHL 3HE6C 5FYJU 3BGFB 1BFOA 1EV2E 5J11C 3RX5A 1JGUH 5EIVA 3HHRB 3NFPA 3G5VA 1NC2D 1KLFA 5IVXA 1YECH 4JRYD 1A1MA 3LSOA 4KKAC 4M3JA 1K4DA 1HHKB 1CD0A 2CMRL 3KPSA 4I18C 3NA9H 1AQKH 2FGWL 5INCA 3KNBA 3FN0L 5D5MA 3HZYB 3OKOB 4P2RD 1I7ZB 4JM2B 4BUGA 1OAZL 1VPOL 1E4XI 3DX9B 4HS3B 1AQDB 1M7XA 2DI7A 3C08H 4Z7OF 1MLBB 1MCPL 5L2KE 5JIHA 1FIGH 4KAQH 4AEIL 1FYTB 1NBZB 4RMWA 2R2HB 4APQA 3O2DL 3W0WD 2HLFD 5EZOL 1OGAA 1OD9A 2XFXB 5E6ZA 4UILL 4PLNC 4PJ7A 4OZHB 3GSVA 3EO9L 1F2QA 5EU7E 5I17A 4P46A 5E7BA 4OLYL 3U83A 5F6IC 4X6CE 2DN7A 2F15A 3C5SA 2JIXD 4L29B 3DVIA 3M07A 1Q0XL 1WFNA 5E94B 3UAJD 4CVZA 4GXVL 4Z7WE 4V2CB 3UXFA 4NOBA 1CLCA 4FQ1L 2IG2H 2XZZA 5KS9B 4EN3A 1NMCC 2X4QA 3OAYK 4F15C 5DR5L 5F9OH 4X6EA 1RY7B 1REIA 5EC2A 2W60A 1S9YA 5ESQA 4K71B 1YUHB 4NQVA 1HNFA 1PG7H 2AKRB 3MLWH 4OD3H 5E2WL 2X70A 3D39A 2I25N 4LSUH 3PHQB 5C0AB 3RNKA 3HE7A 3MZGB 4K94C 2A74A 4U1LB 4W6XB 5L2JA 5CGYD 1AFVH 3VRIA 3WHE0 3PWVA 3TPUA 4FTVE 5ADOL 4KTDH 4JG0L 2DQFA 5TE7L 4GQ9L 5EFIB 4FQIL 2UYLB 3WFBH 3M8OH 1EEZB 1FVCB 1FORL 3QEGL 4ZPTA 4ZFOL 4ZXBA 1R0AL 1YY9C 3WLWC 2JE8A 4EBQL 1BJ1J 4MGXA 5B3JE 5CCKL 3B5GA 3I6KA 1C7TA 2DLEA 1J8KA 1JRHI 4KQ4H 1MCIA 3VFTB 1L6XA 3RWEB 4JZNB 5C09A 3L3OB 4WFGD 1FFOB 4KY1L 3LH2L 4X7FC 3ARBC 3FONB 2W9DH 3INUH 1OLLA 5DVNA 5T1MA 4L8CB 3BI9X 4EIZC 2Q8AH 3BYTA 1TVBA 4AL8H 1RIUL 2EDHA 4MD4B 2BFVH 1XGRB 3L6FA 2PYFA 1S7WB 5C0IA 4BA8A 3C5JB 4PV9A 2ITCA 4JB9H 1OSPH 5DQJB 4Q0XL 2BVPA 3DUSA 3ZKQD 4NQDE 2UZIL 2XKUA 4JVPA 3GNML 4FQJL 4HAGA 4R3SA 4XXCC 4IMKC 5K9KB 4S1SL 1NDGA 2CO6B 5K9QI 5I8EA 1CICD 1NBYA 5ACLA 5TDNB 1A6PA 2OBGA 4PP2A 5FYLD 4ZUSA 1HYSC 3QEHB 3O9WA 5IV2B 4XVSL 32C2B 1WAAF 3EO0B 4GMSL 4IJ3C 4NQSB 1ZVYA 2JB6B 3WN5A 4FNLH 1NDMA 1F11A 2R69H 5FCUL 1PQZA 5F88B 3FQRA 1J1XH 2NW2A 1H15B 2A73A 4OUUA 4EIGB 4OB5H 1CDCA 1JE6A 1MCJA 5EUOA 3QUZC 5I1AB 4L3EA 5AG9A 1WFOA 4XP1L 3KHOA 3MRJB 5F96L 1TZHA 4U6YB 1QFWI 2R2BA 4N5EC 1CFNA 4NNPH 1NKOA 2YBRA 1W0VA 3ABZA 5BS0E 3KYKL 2P48B 2WBWB 4GO6B 3RY6A 1JNNH 3WS3B 3O3AB 5DD0H 5IOPA 1JZ4A 1T66D 3VFGL 3HPJB 2FIRT 4ODVL 3MRCB 2VITB 1AXSB 3HTLX 2WBJC 1A2YA 2K9UA 3GO1L 3O41B 1J1OH 2MNUA 5FO7A 2VDML 4J8RA 5I1EH 3JWNC 4RFOH 3BHBA 3L3GB 3GDBA 3LEYH 4BKLB 3ZHLA 4MCYA 1RIVH 3G6DH 4TULL 5FUZL 1TTUA 3QUML 1EZVY 4LLYA 1T5WB 1UKSA 1EGJH 1JMXA 5E2JA 1RZ8B 3U0WL 4LCWD 4XH2A 3VD4A 2NY4B 5FDWA 1X5HA 1J86A 1IGJA 1BFVL 1ZAGA 5LCVL 5KSVA 4APQD 2H45A 4Y5YC 1CFTB 1MHCA 1U95A 4HKBB 5GGSY 1JWUA 4EXKA 1P7QA 4OIIL 1PD6A 5ITFB 4XNZC 4IRSC 5DVMA 1OM3L 3GEWB 2FJGB 5KVDL 1DVFC 4Q6YA 1FL6B 4ZFGL 2GFBA 1VESA 1F3RB 1YEIL 3FO2B 4FQPA 5GRJH 3TJHD 2CLZA 3H3KA 5DD1H 3GKWL 1H3PL 4FFWC 1CYGA 2QHRH 3IS0X 1LMKA 2NW3B 3MRQA 4EN3D 1T3FA 1RUMH 4H88L 1ZHLA 1GHFL 5IJVB 1CXHA 1T2JA 3H9HA 3DARA 3MLVL 3RL2B 2X5PA 1R5WA 4OGYH 2P5WE 4ETQA 2WMPA 4PRIE 1RVFL 4PRNA 1MCWW 5JMRA 4NJAH 4I13B 4MZ2A 5C2UB 1YJDH 2FR4B 2MKLC 5DD6A 1F4XH 1VEOA 2IAND 5TE4H 2R0WL 4YC2C 1NGPL 3GFUA 2D7NA 4OM0L 3MMEB 5CP7B 2EH7H 1FV1A 3QJHB 3N85L 2RIKA 1KPVB 4WY7H 4MA3B 4LSTH 3NCYP 5ALBL 3RUGE 4ZSOA 3ZKND 3KYOB 5ANMA 1OP5K 1NANI 2YD8A 3WL9A 5A2LH 5IWLC 3DVNA 3MJ9H 5SWQA 4PJDA 4JLRB 4PJIA 3DBXB 5C09D 3HMXH 4M7KL 3MRBB 4G3YL 2B2XL 4PG2A 2FIKA 3TZVD 4OGAC 4MAUL 1NQBA 1OTSC 3T1FA 5SV4A 2A0LC 4WUUB 1CFBA 3P0VL 2BMKB 3QCTH 4NP4H 1MEXL 2I60H 2AJSH 3PL6D 4NKQB 3BP6A 2CUHA 4PJXA 3DLQR 5E1AB 2NXZB 4CAGA 4K94L 3NFNA 5FCSH 4YR6A 2A9ML 4B5EA 3QUXA 3RRQA 2I24N 1EEYB 3MRHA 2XWJB 1MJJA 4LNRA 1FFPB 3U4EA 1AQKL 5J1TC 3MNWB 1XF3B 2XYCA 4QHUA 3L5WA 2OP4H 3MGTA 4BZ2L 5IEHA 1G9EA 1KPUA 4RGMB 4HLZG 3HLAA 1QHOA 5E8PB 1UWXK 4H0IA 1MFEH 1F58L 5DMIL 2ZG1A 2ESVE 5D4QA 1MCEA 3PWNA 2C9AA 1QFUH 2ADFH 4UDTB 2A38A 1CU4H 3HNVL 1SYVB 3VFVA 5CJOL 4L4TA 2NX5B 5EOCH 3MRDB 4X4ME 2CJUH 1RURL 1OAUL 5C92A 3VWKC 3MLUL 1N6QH 5CINL 1C1EL 1ZHNA 2YR3A 2OTUB 1P7HL 1BVZA 3GJEA 3SDDC 4PRHD 4KJPD 2K7QA 4N0FA 5CHNB 5HYSG 3GSXB 3LQZB 3SGKC 5F3BB 4QOKE 4D3CL 5E0QA 4RGNE 2AJYH 5E9DE 2M8XA 3GJFK 5IHZA 1MHEB 2W92A 1FNAA 4QXUH 1LP9F 3MV11 5FM5M 3U0TA 5C6PB 4QRRB 2ILLA 5L6YH 3MLWL 4IOIA 3EW3B 4KUCF 1IM9B 3FQTA 2VXUH 1I8IA 1S7UB 2BX5A 1RULL 3ARDD 3WS6C 1JPGA 3WLBA 1KJ3L 2BCKB 4ETYA 2IH3A 3DIFA 2VMFA 1OP9A 4BQ6A 2C3GA 1P7QD 3DGGB 5D2NC 4HUUB 3FQNA 4FFZL 3WFBL 4RWYL 5ABDE 3MNZB 3E6HA 4EJ1C 2MKWA 4XPTL 5BO1L 4JGUA 3ULVF 3SDYL 4PRPB 4FMKA 1DJSA 5D1XC 1I3RB 3JTSB 4YHIA 4YXKL 2EYTB 4HK0B 2F54A 4JO2H 3RTQB 4WUKH 2F5BH 5DC4B 3GIZH 2O5YL 5GSVA 3WFZA 2CR3A 3WIHH 3ZDYE 4G6KL 1NGYB 3MRLB 3IVKA 4DVBA 4J4PA 1F4WL 1LO0H 2R1WB 3VXOB 2CKBB 2FB4L 2C4XA 5IVXE 1FCCA 4JB9L 4NQCA 3QG7L 3RY4A 1KTDA 3KPSE 4JDVA 3VGHA 4M43H 4NO2A 5GSRA 1ZLSH 3HPLB 1UM6H 3F7VA 5D5ME 2XA3A 3BRFA 4XPBL 5GS1B 4GBXB 3L95B 3CXHK 3G6AB 4OD1L 3TIEA 2VLRE 5JA9A 2DQCL 1JHKL 1JHTA 3GSQA 4KV5F 4OAWB 5LKNA 1AR1D 4XMLL 4QTHB 2BNQB 1B2WH 1R3LB 2MSPA 1EVTC 1BBJA 3NGBC 2OR8A 5D71H 4HX1A 3Q2CA 4X6BB 1OGAE 1BQHB 3G5ZB 2C26A 1NGWB 4B7LA 5EZJB 4MA1C 3ZE0F 2HT4C 4PJ7E 2EKSA 3VXRA 2EDJA 3IJSB 3PWJA 4BK5A 1QA9A 2DQTL 4LDLB 2QR0A 5F7FA 3NVQA 2W9EH 4LLDB 5HY9A 5JORB 1MY5A 3S5LA 1PAMA 4NN5C 3TLRA 1M05B 4XT1C 5IT2L 1BF8A 3AY4A 3UJIL 4RFEB 3N9GH 1CE6A 5GGRA 3MPCA 3VH8G 2R4SH 1A7PH 1XF5A 3FRUA 1L7TL 3QUXD 2EXYC 1MF2H 5F7YC 3WFCH 3WBDA 3D39E 4ONHB 1NAMA 1MUJA 3IDJB 2MMXA 5FGCE 2Y07L 1TQCB 2ATKB 3T4YB 4X98B 3GIVA 3H2WA 5IB4B 2EDDA 4GG8A 4U1MA 2ORBH 2QQLL 5KBNC 4W4OA 4JRXD 1HILA 4RQQB 1AGBA 4FXGA 3CLEL 5FKPA 4PJCA 1CT8B 4X5WB 2SEBB 5I19L 3EOAB 3WHXB 4PJFF 1W72H 1GOHA 3MR9A 5E8EB 4G9FD 3A6OA 1LK3L 3MV8E 4ZAKA 2O5XH 2WIIA 1XR8B 2VXVH 5IESL 3BPCA 3LDBC 3GZKA 2HG5B 5D7JC 5GIRA 2JCCE 4JGJA 5I1KL 3DETD 5DJ8A 3TA3A 5C70A 4I1NB 4ODHL 4PB9H 1KJ2L 2YA1A 3AVEA 4ZOCA 4G8GA 2W1NA 4Q9QL 3SBWC 2ICCA 5F7DA 3BKJH 3QUKA 3BD4A 3STBA 2Q8BL 4OLVL 3CVHL 4MNHA 2LQRA 3RWFA 3DPBA 4Y19A 2OTPA 2I07B 3ARFC 3CSYB 1A6ZA 3FOMA 5EIQA 2DQGL 4M7JH 4RWHA 4TSAL 5IIEB 4BZ1H 1NJ9B 4XNMB 3QZWA 4EUPB 1IKFL 1MFAH 3V6FA 3V6BR 2YPLB 4QY8B 2DB8A 5E2UL 5SWSD 4H26A 4F3FB 4PY8J 3EFDH 1GZPB 5E99L 1LP9B 2ICWA 4XVJL 1D5ZB 1A1NA 1TZIB 3K1KC 3F7QA 3O0RL 3HI5L 4TVPE 4PY8I 5F89B 4ZNEE 4MXQD 1N8ZB 3QIUC 3ZHDA 5C9JB 2IGFL 3DI3B 5CLWA 5EO9B 5EUOE 43CAB 5D1QA 4JAMB 2UUDH 2PTVA 3QAZC 1I9RH 4L3EE 3D87B 1F8TH 2IPTL 3GJFB 4X8JA 1A0QL 2OX5A 1JF6A 4NGHH 5J56B 2NYYC 1YDPA 2XN9D 3CAFA 2QQNL 1BJMA 4Z77A 2F54D 3HMWH 3L3JB 4C83B 5D6CA 3ILQD 2GTWB 3MLXL 4QHMA 1ZEAH 3BZEB 4HXAH 4R4BA 1UM4H 4FN0A 4QHNB 3CMOH 4H20H 3SY0A 4WGWB 2YHGA 2X4PA 3O2VL 3BZFB 4M93C 3O6FC 3ARSA 1J0YA 1HQRB 2EYRB 2WZPD 2EC8A 1TJGH 3MRFB 3O4OB 4L4JA 1AHWA 1KIRB 1I9EA 4JPIB 4PGBB 3U9PL 1MELA 1CFQB 1ES0B 3QBTB 4U2ZA 4ZODA 3QJFA 3T08A 3PABB 3TO4A 3ZKXC 4P2OA 1U3HC 4MJ6A 3NTCH 4HPYL 3WIIL 4WJ5A 4QCIA 5FB8A 5K59F 4OTXH 3WJJA 4BK4A 2XXCB 1RIHL 1S7RA 4KUCD 4KJQC 4DAGL 1X5KA 5HSFA 1H3TA 2YPKA 3VXRD 2GSGB 3KPNB 3WXWL 5F9WC 4Y5VB 4P3DA 1NFDB 4KK8D 4OCSL 5AD0A 1FO0H 5TF1L 3TBSA 4H5SB 2HRPH 3H9SA 2BVYA 2Y6SD 1CFSB 1CXKA 4AJ0A 2OK0L 3Q0HA 2PCPB 3QEUA 1VFOA 2H8PA 2JTDA 2ZPKH 2B5IC 4YHNB 1DP0A 5DJAB 1ZS8A 2Q6WA 1GGTA 2ZSVA 3I6GA 5A2IH 5HYIA 1VERA 3ZSSA 5IFJA 3FKUS 2DKUA 2W0LA 3Q6FB 1R24A 1AO7B 1VGEH 1UCBL 3O3BA 1F42A 2XA8H 1X5ZA 3SCMA 2ED8A 2NTSP 1H3GA 2VTFA 5A2FA 3DUUA 4CN6A 4MLSA 4EI5A 1IEBA 5I16B 4BFIA 1KTKE 3RWCA 3KPLA 1FN4B 3OKEA 4M1DH 3DO7B 3OR6A 3SGEI 1J11A 4Z95H 2EDQA 1JV5A 1ROWA 4MJIE 3QDGA 5FGBA 5IFAL 3MYJB 3V52H 1VADA 4YUEH 4UIKL 1U93B 3NH7L 2WNGA 4ZAKD 3RWJB 5D7LB 4ZSOE 5EPMB 5CWSA 4UV7L 5LGJA 1KCVL 5IBLD 3NIDE 3D9AL 1PKQA 3WDJA 1GAFH 1AP2B 1NCBH 4PJIE 3TA3D 2EDOA 4NBXB 3FB7B 3DX7B 4I3SH 5HBBA 5GJTH 5IR1B 1BD2A 5JMOC 4YPGA 1QBLH 1CQKA 3MCKA 2DDQL 3OXSB 1FHGA 1HXYB 4KHTH 4QKXB 4ZD3H 3D2UB 1MCQA 3EYFA 4LOUC 4GKNB 4ODWB 3T0EB 1BAFH 1WIOA 3WIFB 1KN4L 1NCUA 2C4FU 2GUOA 2BNRB 3SKMB 3KLDA 1GH7A 4HIEA 3MRIA 4ODXB 2IJ0C 2HVJB 3QWRD 5I9QC 3HZMB 3OKKB 2X1WL 4WDIA 1TQBC 3GSNA 1QSFB 2A2QT 2FL5A 4XPAL 2H32H 2Y9RT 2IAMD 4V1DA 5TDPB 4S10A 5FK9B 5C0EB 1A9BB 5JW5B 4P3CH 1F6FB 3QSKB 3WDIA 2YD3A 2ZUXA 2V5RA 5C0ND 1CFVL 3EFFB 1FBIH 2W9LA 2A9NL 2DMCA 4GW4A 3MGOB 3U0PB 3VA6A 2QLVB 1E4KC 4O51A 2HFFA 5D1QD 4Z9KB 4K7FB 4K8RD 5IVZA 3EJYD 2WIMA 1OP3H 3HC4H 4XNXL 5LGKA 3HAEA 3D69B 4L4TE 4GKSA 2G60L 2ZZUT 1EHXA 1JHLH 5DJ0A 1Q0YL 5DI8A 2VR9A 4HUWA 1P4IH 3KLHD 5DRWB 3RVVD 4R0LC 5JXAL 1RJYA 2HT2D 4ZFOB 3OKMA 2NNAA 3ZTNL 1SBSL 1DCLA 3N1QC 4PG9B 4XTRC 2OJEB 4XCNB 2GY5A 4NQEB 5I1HH 1QPXA 1ZANL 4XAKD 4DUXA 3QRGL 5FO9A 5K9OB 3M17B 5IEKB 4XX1E 1HDMA 2YC1A 4N0UE 4YEFA 1T20B 1I75A 4CJ0A 1JWSB 1WWWX 3P9LA 5I8OH 1XIWA 4QRQA 4C4KT 2AJZB 1HSAB 4Y5XA 2FYYA 2FECL 3TO4D 5I6XB 1FGVL 4NFBA 4LQFH 2EEAA 3VG9B 1LO5A 5KANI 1BFSA 5CSGA 1BQSA 1SY6A 1TFHA 4MA8L 2G75B 3H3PH 3MRPB 5BZDA 4FA8A 1F13A 1A7RH 1KJVB 2R0LH 4FQHB 4TTDC 2LTQB 4FQ2L 5I15H 3IDNB 4DVRH 3V0VB 2BOCA 3B5TA 1W72L 4UQ3A 1BX2A 5E5MA 2BVTA 5F1IA 1S5HB 4DZ8A 1MWAA 3S36H 3D5OF 5HHNB 3TO2A 3EYUL 4NPYA 5DMGC 3MTRA 1JFQL 4KROB 5FM8A 1NFKA 4IOSD 3H9SD 2F54E 4MLIA 4TOYL 3QHTC 4OUOA 3MLZH 1I3UA 2ZG2A 3BVNB 1UFUA 3LKRB 5T3ZE 1AJ7H 1UB5A 1WCBA 4ENEC 4LVOC 2ENYA 3O8XC 1QLEH 3TWCL 3O11B 3AB0C 4AMKH 1MVUA 4HDIA 4YHKL 1I7TB 1X5YA 2D7TH 3ZE1F 4P2QE 2EXWD 3MFFB 1M7IA 4YH6A 3FQXB 4NQCE 2E6PA 3MOAL 4KMLB 4WWID 1QSEB 1T80A 2JKXA 5FHBH 3SCMD 5JIPA 1G84A 1MAJA 1DQQA 3DUHA 4JANA 4X99B 3V0AC 2APVA 5CBAB 4D0BA 4WW2F 5D1ZB 3GMNA 1DUZA 4XVTH 3EFDL 4K3HA 4GS7B 1ADQA 5HPMB 4P5TA 3TEUA 4ZS6C 5KG9A 5BQ7A 2IF7A 2NR6D 3QDGD 2DI9A 3TBWA 1I9JH 1QFPA 2V17L 3OR7A 4FFYH 1SHMA 3MUJA 2HFGL 2PXYB 2NLJB 4X6DF 3GRWH 1RMFL 4ZDHB 1VGKA 3BJ91 4HC1A 1IKNA 1AD0A 5GGSB 3OKOA 3HZYA 1DN2A 1I7ZA 2H2PC 2EEBA 4WWKD 3SOBH 5AZ2H 5E24E 3STZA 2VXTL 3DX9A 3G9VA 1XF4A 1BD2D 1JPST 1EZVX 5ACZB 4HS3A 3IAQA 4LLAA 4KFZC 5KSAC 4QWWD 1V3LA 2WSKA 4X0KA 1RJCA 2E7LC 3QDMB 1NBZA 2R2HA 3HE6B 1TVDA 3OKLA 2HJKB 5J11B 3CMOL 2FGZA 1UH2A 3L5XH 3UPAA 4RSVA 3FHQA 2VH5H 4N68A 5JPMB 1ZSDB 2P7TB 3SDXA 1X5AA 2ADIB 3BPLC 5B8CA 4I18B 4I0PC 4V1DD 3P40A 5CSZB 5JW4R 4L29A 4J23A 1VFUA 1IFHL 5DJ2A 5E94A 4J12A 1SYSB 2XQBH 5D7SL 1RPQA 3X3FH 4OLZL 4M62H 3B9EA 2E7MA 5JHDA 1DBMH 1KCLA 5JW4M 4JDZB 3T0XA 4HKJB 3NIGF 3K8LA 2YA2A 5H8DA 2HTLD 4PJCE 4Y4KD 2DLFL 2VLKB 1WBXA 3CXHJ 3OB8A 2XNAB 2BVUA 4D0DB 3QCVL 5CJXC 4X4YB 2A6JB 5B38A 3BFOA 2NZ9D 1YEDA 2VXQH 1XGTA 1HKLH 4ZTOL 1YYMH 4U1LA 3GMMB 2F19H 1T6VN 1TCRB 5F6IB 3Q6GL 3T0WA 5EBGA 3N1MC 4G8GE 2B1AH 4D9LH 1T7WA 5EFIA 1FC2D 3QHZH 4E41B 2UYLA 4JQXA 3VD3A 4FRWA 1DLHB 4Y19E 2F9BT 4AYFA 1NMCB 3ILPB 4ZO8A 4F15B 2VDOL 2P5ED 3LKQB 1F6AB 3V7AE 1RZKH 2B7DT 4PTTB 1C8PA 2F74B 3LKSA 3VFTA 2YS4A 4JZNA 1XIWD 4LHUA 3VGAC 3DX8B 3GSUB 1FFOA 4DN3L 5DEGB 5I75C 1UA6H 3ARQA 2RJMA 5DLMH 4L8CA 4M7ZC 4Q58C 4QRPA 4YZFF 4IRZH 4MD4A 5H94B 1XGRA 4YDKL 3C5JA 1BFTA 3ES6B 1AGDA 1Q72L 5D7KE 5K9KA 2BC4A 4NWTL 2R23B 4OI8A 4HXBH 2IQAA 3BZ4B 3A67L 3QEHA 1QD0A 2OR9L 2X1OA 3TV3L 3EO0A 2AV1A 3WO4C 4NQSA 1AGCB 2JB6A 3C87A 5INDB 3QEQE 3ECBB 1S7QB 4I77L 5F88A 3ARBB 1H15A 2EZ0D 2AJXL 2NY7L 2NY3D 1GJIA 5I1AA 3FZUC 2FEEI 1KFAL 3GBML 4NQTA 4CN1A 2EDYA 1QBMH 3B9KD 3CDFA 1QTYT 1E4JA 5AEAA 5HHXH 5MEND 1P5VA 4N0YH 4D9QD 4OCRH 2GJ6B 3AS0A 3QA3B 1HZHH 3CX2A 5DUML 1ORSB 1M6OB 3O3AA 4NKOB 4JPWL 3WS3A 2Q3ZA 3I75A 1PG7W 2VE6B 4PRDB 3F65A 1CXLA 4TSCL 5GRVK 2J4WL 3MRCA 4IJ3B 1AXSA 2EDXA 4P5TD 4R4ND 3X13B 5C0GB 2VUYA 3O41A 3WNNA 3UPRB 4WFFE 3PDOA 4M8QA 3BPNC 4L8DB 5HI3C 4OI7A 3FHAA 2CRMA 4GRMB 4K3DH 1MPAL 4BKLA 3AMKA 1XCTB 2CPCA 4HSQA 2NXYC 1DBBL 5MI0C 3CK0H 4LASH 1P4LB 5I73C 2PETA 4CDGC 1AXTH 1OY3B 2XQYK 5EBMA 1T5WA 2O5ZH 4X6DB 5JHLH 1JNJA 1RZ8A 4P9HL 1T0PB 3TYGH 1L4IA 1MAKA 4NYLB 1NMBH 5GS2H 5FV2A 1W0WB 3ARXA 4XP9L 2R15A 2DQDL 4HKBA 2WBJB 4N1CA 4LCIL 2EYSB 3KPRB 5EO0A 3FMGH 5ITFA 3SDAC 15C8H 5I1HL 4LRIC 4DEPC 2FWOB 1I8LC 1RHHB 4XBEH 1RZGA 4IDJH 4I0CC 4WHYH 2Y5EA 4DW2L 1WWCA 1PLGL 3FO2A 3FFDB 3D85B 2XTLA 2Y36H 1OQXA 3QQ4B 5FIEA 1INDH 2DOCA 2HJLB 5JHDD 3F12B 4NQXB 4GKZB 1NLBH 3A6BL 2VOTA 4DN4H 2M1KA 2FO1A 1F4YL 3QDGE 4H1LH 1MI5B 2JK5A 3UYRH 4Y5YB 4F7MB 1A7RL 2AJVH 4U1NB 4XNZB 4IRSB 1YQ2A 3SDCC 3WFDH 5FO8B 4UQ2A 1PKQE 1DVFB 1JP5A 1MFDH 1RUPH 5JZ7D 4OBSA 4OV6F 3QUZD 5HD8C 4EVNB 2XWTB 4P49A 3MLPA 1KENH 1FFQA 1OTUC 3MMEA 2W91A 3BP7B 4IDLA 1IT9H 5EO1A 4WO4C 2APTA 3FFCB 2GIYA 3MLZL 3UTPE 2J88H 3C2AL 3MCLL 5B22A 3LY6A 3U79A 2P1YA 2DWDA 3KYOA 3LAFA 4IIQC 2Z4QB 1D6EB 5CJ5A 4JLRA 4MS8D 3DBXA 4LHUD 4HWEH 3BISA 3FCTA 1RU9L 3ZL4L 1OSZB 2D0FA 2ZSWB 4Z7UA 1RZJH 5EZIH 4V1DE 1RQ5A 4WUUA 2DLIA 3VWJD 25C8L 2BMKA 3MJ8B 4YC2B 4QRPD 4GUPA 4XAWH 1G6RA 1KTLA 4NKDB 5J06A 1FL3B 1BEYH 2E27H 5I8KL 4WNQB 5CZXD 2Z35B 1D6VL 4PJHE 1KLGB 2RBLA 3DXAD 3NIFE 3FT3A 2BY1A 2HYMA 3RWDB 3PP3H 1N4XL 1IGIL 1X5JA 1L7IL 1J1PH 1AE6L 4FZ8L 1DQJA 4HEPG 2XWJA 5HDQL 3GRWL 1VSCA 1FFPA 2GITB 1YQVH 3K4DA 4XRCA 3QXVA 3DNKA 4OZGF 3MNWA 1G9NH 1V5JA 4K2UH 4YXHH 4KK5C 3QQ9C 1BREA 3IFOB 5DVLA 3AREC 1EH9A 3TBYA 5I74C 1DSFL 4YDIL 5DQ9B 5IF0B 3UO1L 3MOQA 1KJMA 4BFEA 1A7OL 4XXDB 2APFA 1BQLH 4D0CA 4TUKL 4U7KA 1KULA 2NX5A 4HFUH 3MRDA 3TVMC 1CD9B 1PSKL 1NSNH 4FFWD 4J7RA 3DROB 4YBQC 4H0GA 3DVGA 5E56A 3V9FA 1BOYA 2OTWB 2OTUA 3S97C 4N1EA 2ZCKL 4HGWB 3MV9E 4WFEE 2YUVA 1J12A 1ZVHA 4S2SA 3ZDZF 1T2XA 1MHPH 3EGSB 3HFMH 4OFPA 3AAZB 5CHNA 4NUGL 4TN9A 3IU3A 43C9A 1AGFB 5D9SB 5KVGH 2J8OA 1HE7A 2HA1A 2VWEE 4LVEA 5GJSH 5F3BA 4UB0L 3CFJB 3IJHA 4A6YL 5TQ0H 5F3HB 1HH6A 4OQTH 1KC5H 3VFRA 1RZJC 1B4JH 1N6VA 4BQ9A 4NRXA 1OPGL 1I1AA 2PNDA 3R06B 4PLKC 1R6VA 2VIRB 3QO1A 3NAAL 5KSBA 4U4BA 1IM9A 1BP3B 4LKCB 4NN7B 3VWKB 4KQ3L 1G7HA 1S7UA 4F9LA 1JNHB 1QSVA 2BDNH 1J8HB 4G8FB 3L9RB 4TNWK 2DKSA 2VAAB 3P4OA 5F7LB 2DTMH 4K3GA 2B1AL 2DJ4A 4D9LL 1CZ8L 3OKDB 4O4YH 4HUUA 1IQDB 2APXA 2Q20A 4I9WD 3MNZA 4GLRH 1RUAL 1G9NC 3ETBF 3I3EA 1YMHB 2NY1C 2BVOB 3T2OA 1CD8A 1NCCH 4PRPA 4HBQA 3H3BC 4BFGA 4HKXA 1FLRL 2GY7B 3UTTB 3JTSA 3UZVB 4TNWF 4HK0A 4NC0B 4UINL 4B53A 4KDTC 3RTQA 2OM5A 3KPPB 2MQ0A 2ZNXA 4LPCA 4XC1H 1Q9LB 4KJYA 3ULUL 1YPZA 1IGFL 1NGYA 1OWWA 3AM8C 4M6OH 4X7CC 1IMHC 5EBLA 5D2NB 5EZLA 5JXEA 5D70L 3DV4A 3ISWA 1CWVA 3HPLA 3LIZH 1BJ1H 1TNMA 4E0RB 3O6KL 3L95A 3G6AA 5D1XB 1N64H 2QADD 3S37X 1X4YA 4OAWA 1WEJL 2BERA 2ZUVA 2P24B 4ODUB 1WICA 4HZLB 1OCWH 1R3LA 3BQUC 1FYTE 3QNYB 1U2HA 1BQHA 3G5ZA 2BNUB 3ZDXF 5I66B 5I18H 4CU8A 1NGWA 2C1PA 4JKMA 5EZJA 4LRNH 5IJKA 2X6MA 3HCVB 3SDDD 1NMAL 3UBXG 5HGBA 4HT1H 5IHUH 2JJVA 3G6JF 2PYEA 1S9VB 3LPFA 5T33H 2UV3A 4OCRL 1C5BL 4LLDA 5DD5H 4KI5C 1KT2B 5JORA 3X3GL 3SKJH 3QXAB 4NJ9H 4KKBD 1CR9H 4MNQD 4WUUD 4Y2OA 1GXEA 3I3DA 3CSBA 3LMJH 1RJLB 3VFOB 2UUDK 3IGAB 3AS1A 1OW0C 1FCGA 5KS9E 2D7MA 1UYWL 3EDEA 5D8JH 3VRLF 1QR1B 2ZOLA 3MACL 3S34L 5KSUA 4UMGA 1MCDA 2JJSA 3NGBB 1J0ZA 1FG2B 1OAYH 3PIQA 4ELMB 1KTRL 4NC2B 4K3DL 5DUPH 4OCYH 4J3UA 1R3JB 4MA1B 5FXCH 5GGTA 5GRXG 2GJZB 1QPPA 4QLRA 5FYJH 2V7NA 1KOAA 5BRZA 5C0AE 3MJ7B 5JNYB 2ATKA 3NZHH 1YEJL 4X98A 1DE4B 3U4AA 4EDXA 2NTFB 3VGEA 1MCBA 2I27N 1ZHBB 4OJFH 4DKFL 4X7TA 3ULSA 1CT8A 3PWPA 2SEBA 2BSSB 3K46A 5KTEL 3UDWC 4GRLC 1IAIL 2NX5D 4YAQB 2Y7QB 5HXMA 1XR8A 5C2BL 1A21A 4YDLC 1KG0B 4JPVL 1HCFX 2HG5A 3RZCC 2R39A 3QHFH 1T21B 4PJBF 5I71B 3GHBL 4PJEF 4RX4A 4AM0A 4LCYB 4NM4H 1PX4A 1XR9B 2I07A 3CSYA 4J3VA 4FQLH 1ODAA 4U6XB 4OZIF 3X11B 4FHBD 3G9AB 3G6JA 3V6OE 1IC5L 1NJ9A 2KZWA 4XNMA 3UYRL 4K7PH 1VKXA 1UWEH 3CUPB 3C6LD 1I1AD 3GM8A 3MLTA 2R56H 4NHCL 5DK2B 2AJVL 3LDBB 4OBRA 5FKAB 1D5ZA 1TZIA 5D7JB 3O4LB 1MFDL 2R29H 1J0JA 1H3WM 5ISZB 4KRPD 8FABB 3T09A 1A3RH 5F89A 1GRWA 2KUTA 2VDQL 5HI5C 1WZ1H 4GMTL 2OJZH 2KKQA 1C5DB 2K3TA 2D03H 2YD2A 4LK4A 3B5HA 3BD3A 2D7QA 4L9LB 4AH2A 2NY0B 5FAAA 3BKYL 3N1GC 5KVEL 3KDMA 4XMPL 5C3LD 1EHNA 5HYSA 4PD4J 1A47A 1JGDB 5HHOB 2HTKD 1WC7B 1BF2A 5JPNB 3BIKB 4GRWH 1BZQK 3EZJB 3P30H 3NZ8B 1TVHA 1RD6A 5CIPA 3ALPA 1RK1B 1RZFL 4OSUH 4JFZL 3BZEA 1IQWH 2CIIA 4KMTL 4OLWL 4R90H 3NACH 5MHSE 2L7JA 3WJLA 1U8LB 4XAWL 2KPNA 5DUBB 3BZFA 1FVEB 1HQRA 4F57L 5E2TH 4I4WB 5FUCE 4IOFC 4N0CD 4HUVB 3O3EA 3IFLH 5MEOB 3JXAA 4UT6H 5CJQH 3CDCA 5JXED 4UT7L 3MO1A 3QAZB 2NY6D 5LBSL 1KIRA 4JPIA 5E70A 4PGBA 4FS0A 4MQSB 5IGXH 1XMWA 2VDLL 5DVOA 5LQBH 4Y1AB 5D72L 1ES0A 3E3QC 4PGCB 2VLJB 4Z0BH 4YXHL 3PABA 5C0CD 1QG3A 1NCAH 4YIQB 5L7XL 5CEZE 1T7XA 1UJ3A 1W72B 3UROR 2Z9TA 1MVFA 4F80A 2F8OA 3PNWB 1I4FB 1Z3GH 4AENA 4M93B 2C4FT 4UNTA 4UT9L 3O6FB 3H0TA 1HEZA 5EUKB 2VL5B 5IB5B 2GSGA 2PYED 1GGCL 4PJGF 2DWEB 4Y5VA 3SE4C 1NFDA 3ARFD 5F1SA 4HS8H 3PV6B 5I76A 1EFXA 5C0JB 3EYOA 4QGTA 1E4XL 1HOCB 4KKCD 1KB5A 2ZUQC 2ZKHH 4NO0B 4PJ9C 2HJFB 1A1OB 3I50H 1OP3K 3W39A 3ZKXB 1U3HB 1NGXB 2ICES 3V6ZB 1YEEH 3VI4E 1E4WL 4FQQB 2HLFC 3VRJB 4XP4H 2ZNWA 4XCEA 4HJJL 4JKLA 1XGYL 4Q9RL 3F6LA 4DKAA 1T1XB 1IGCL 4OQTL 1KC5L 3SJVB 1VACA 4O00A 5HYJA 4P5KB 2VDRH 3QIUD 1IC7L 1QO3B 4HH8A 1UACH 5BRZD 1S7SB 4YGVA 3RFZC 4Q2ZB 1MRCH 3UAJC 4YFEA 3DO7A 1OB1B 5C0RH 5GQBA 4JQVC 3HC3H 3BEWA 3OX8B 4K3EL 1C12B 3PWPD 2OZ4H 4F7PA 1A6WH 2B5IB 1MAMH 1UM5L 5D7LA 1CLOH 2Z31A 3GMRA 4I3GA 3HNSH 5EPMA 2LVEA 3GMQB 5ETUB 1QEWA 3SGJA 3X14B 5F71A 3OB0H 1AP2A 5AUMB 3SEPA 3VH8A 1T03H 2M2DA 1CXEA 5IR1A 3O2DA 3U7WH 5IBTH 5CGYC 2IC2A 3I2CH 35C8L 4RX4D 1NAKH 5CBEB 1LEIA 4WUUE 1HXYA 3K2UH 3T77A 1IM3A 4MQXD 1Q9KB 4WU7B 1KGCD 2BNRA 3SKMA 3ET9F 4LCUA 5DZLA 3P4NA 1A7QL 2IADB 3E8UL 1QFOA 3MBED 3GBNH 3HZVB 2HVJA 5T1KB 5J3HD 3OKKA 4U05A 5DFVD 2AEWA 1UCTA 1I3VA 1ZLVH 4OZIB 4OZ4A 5FM4A 1HINL 2BY0A 2B39A 3QG6A 3KPOB 4NHUB 4NIKB 4MHHI 2IFFH 5TDPA 1M7DB 5EOCJ 5C0EA 4OF7A 3MV7A 3MA9H 5JW5A 3ZT6A 4LIQL 1B90A 3LQAL 4BSWB 1JWMB 2X89A 3AUVA 1FGNH 4HV8B 4MCZA 1AGEB 1G1CA 5D7IB 2ARWA 3OG4B 4WI9A 4M6AA 5BVJB 2EDLA 3LEVH 4F9PC 1HSBB 4K7FA 2WWMD 2VC2L 1OCWL 4JFDD 2I26N 1YMMB 4K23H 1K9TA 2W65B 1XCQB 4ZUVB 1JYNA 4L4VB 3D69A 5I1JL 4ZS7H 4GG6F 4ZOEA 5C6TH 2NX5E 1CTNA 4QXWA 1FO0B 5TQ2L 1CICC 1FJ1B 5DEFB 4JHWH 2C7UB 5ICYB 5DRWA 1TQBB 5IHUL 1ACYL 4ZFOA 3CH8A 1GOGA 2MQCA 2EDTA 3D3VB 2V2WB 2MCPH 4Z8FH 3HG1B 1CLYH 2G5BA 3VFSB 3WD5L 3M17A 1FYHB 5DMJB 3VXTA 3EYSL 5CMAB 5BMFL 1QFWL 4LU5H 4M5YH 6FABH 4QRRE 2R0ZL 5KSBE 3AS3A 1HSAA 3QFDB 1EO7A 3IU4L 3VXMB 1OAKH 1CGSH 5EG6C 1T66C 4R0LB 5GHWL 2WM0A 4POUB 3B3IB 4NZRL 2G75A 2FATH 8CGTA 4MZ3A 2LV4A 5DS8A 1WGOA 5AYQA 1KJVA 1UKQA 1U9KA 3D18A 5SX4H 5I2IA 2PW2B 3QPXL 1EPFA 3IDNA 1CBVH 2RAMA 3GKZA 1S5HA 3GB7B 2YSSB 5FECB 4PRPE 1R3HB 5DYOB 1A6UL 4KDWA 1F90H 3RA7H 1EFXD 5J9PB 3IDMB 3TN0B 3IJYB 1HIML 3C60D 5DWUL 2FNBA 2ITDB 3BYYA 4LVHC 4APQC 1SM3H 2APBA 1Y18B 1MNUH 2WINA 1UQSB 2H32B 3F7YA 1TJHL 1WBYB 3RHWK 5HYJD 4U6HB 1EEUA 1QSEA 2HKFH 3IDGA 4HIIA 4I3RL 1UWEL 4BH8A 3GUTB 5I30H 2RGSA 3UZQA 2GTZA 4ZUWB 2N7AA 1BBDH 5CBAA 1NLDH 3WCYA 3TJHC 5ILTH 5HPMA 4EN3C 5LXGL 1F6LL 1JN6B 2BNQE 3D25A 2YD4A 3WUWG 3JV6B 3RHWF 4NKIH 1F02I 2EDRA 4TVPH 5DMKB 1KEGH 1UVQB 4LVOB 3O8XB 3QUMA 4LSVL 2Z31D 1QP1A 4KVNH 3AB0B 2PXYA 2NLJA 4ZDHA 5T5NG 1H3UA 2KQNA 2O61A 2DMKA 4PY7B 1VA9A 3GMOB 4JVWA 1J05B 3MXVH 1IGYA 4JY5H 4W81A 3GM0A 5ACZA 4M48H 1SVZA 4Q6I