5A3IC

Crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFSDYWIGWVRQMPGEGLEWMGIIYPASSEIRYSPSFQGLVTISRDKSINTASLQWSSLKASDTAIYYCARHASCSARSCYWGPVDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HEMAGGLUTININ
publication title Structures of Complexes Formed by H5 Influenza Hemagglutinin with a Potent Broadly Neutralizing Human Monoclonal Antibody.
pubmed doi rcsb
source organism Influenza a virus (a/vietnam/1203/2004(h5n1))
total genus 39
structure length 226
sequence length 226
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a3iC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5a3iC01
4OFKA 2PW2B 5F3HA 1MQKL 3V4PH 4M9PA 2ICEB 3MYJA 1A1NA 4XVSL 4YDIL 4W70A 3ZO0A 2NLJB 4RWHA 3STLB 4YO0A 4OCWL 5T3ZD 1SBSH 2IMMA 4Q6YA 4LLMB 3CGTA 3MNVB 4HWEH 1Y0LA 4AH2A 5E7FA 3EGSB 3NH7H 1INEH 4Q97A 4S1DD 2RAMA 4TSAL 4YHLL 4I0PC 4XVJL 3QIBB 3PWUA 3TBYB 3RTQA 5A2JH 5I17A 1ZA3A 4OLYH 4X4YB 1EDQA 1CFVH 2D7MA 3CVIL 4Z7UA 3WUWG 1AO7E 4P9ML 1N8ZB 4WW2F 5CEXA 1U8OA 2F8OA 3M1BA 3EO0A 1IILE 1M4KA 5FCSH 1RZIA 1FVEB 4R96A 3KPRB 1FL3A 5JHDE 5FM4A 2CDFA 3H9SA 4LSUH 3PGFH 3LPFA 2EIDA 2I24N 1JF1B 3JXAA 5F7HA 4A2LA 1KJ2B 5C2BH 4QXTA 2AQ3A 4QTHA 1A8JH 2E8YA 4KKLD 4QHLB 2NMSA 1BF2A 4P59H 3RX5A 1HH6B 2FB4H 2FX9L 4ZUSB 2DQIL 1OWRM 4RMWA 4GRWB 1BVLB 1M1SA 2AJSH 1OTSC 1BQLL 3DVFA 2WM0A 1XIWA 5D9SB 4C57C 3C6SA 2FRGP 4PJFB 1LGVA 5CJXA 2PKDA 4G9FA 25C8H 2X9XA 3QDJA 5GS2H 2CXGA 4HIIB 5C08B 2R23A 2PO6A 3GNML 1QBAA 1JL8A 1R5VA 5FYKH 3MLRH 1IM9D 3ESVF 3QRGL 4JVWA 4N5UA 4XWGL 1CFQB 4E41A 4JQIL 5T1KD 1CXLA 4QGYA 3A6CL 2XA8H 4RZCA 1KCRH 2HVJB 4Z77B 4MJID 3KLHC 4IM8A 5ACLA 4RISH 1EXUB 3BEWB 1CLYL 1U91B 3BVNA 4H1LH 4PJXB 2X6MA 2A6IB 1XR9A 4NPYA 4QRTA 4DKAA 3PWLB 5IM7A 1MHEB 3VFWA 2V5RA 1AQDB 4XPAL 1XCTB 2SEBA 1J8HB 5F7EH 4FP8L 3NACL 1C1EH 4S0SD 1J1OL 2YD5A 3H2WA 1RIHL 2YD4A 4KDTA 3VXTB 4ISVB 3FQWA 2B0SL 1G7QB 2O26U 2NW3A 3W82A 1AGDA 4LVNC 5T1LD 3RWEB 5ERWB 5F1KC 1VESA 5GGVL 2HFEB 1Q9OA 1G6RA 1FNFA 3IDNB 3V6ZB 1OP3H 4OM0H 4ZS7H 1JRHL 1EGJL 4G7YL 4PTTA 5DJDA 4R2GD 2VLJB 5KANI 3CIQA 5DUBA 1OP3K 1QACA 2W9DH 4IJ3B 1EVUA 1LHZA 1X5AA 5DEZA 4KKAC 4FABH 4YWGH 1OWWA 5MENB 2BHUA 1JNHA 3ZDZE 3CC5A 4WI5A 5MHSD 2I9LB 3NFSH 1N5AB 3GMOB 3N9GL 1OAYH 3VRIB 4QOKD 3UYOD 1AGEA 2GT9B 4PJGF 3MROA 2FECI 5HGDA 1CICD 3F58H 4LEXH 4RFEB 4JN1H 4NJ9H 4FXKB 4XHJD 3D18B 3MRPB 4I3GA 5ECJE 5IB3B 1AR1C 2R69L 5FB8B 3V95A 4JHWH 1VFOA 3BP4B 3TFKC 3GSVA 2Z35B 1OOAA 2VL5A 3P73B 2FHFA 1UXSB 3CFIC 3QUZD 4DUXA 2VDPL 3GMPB 3KR3H 4QNPF 2GCYB 1W0VA 3V7AG 4YBHA 3OJDA 3W9DB 1D5BB 1U6AH 1CTNA 3NCEB 1A02N 4K9EH 1I1AB 3RTQC 1J1XH 1NSNH 5EU7C 3BKCH 1IQWL 1P7HL 3C6LA 1Y18B 1FDLL 4DVRL 4TUOB 3Q5OA 1ZT4A 4HUUB 4JQXA 4RIRB 1T4KB 4LCIL 1SY6H 3VI4F 2D7NA 4Q58C 4NHUA 3WD5L 3V0WL 4KROD 4IBLT 4N1CA 1YPZF 2WBKA 1TVDA 4HV8A 3X3FL 5FYJH 5GHWL 1NUNB 2DQUH 2FGWH 3HG1B 3IDXL 4W6YB 4WEBH 2GSIB 1J8KA 1A3LL 3FQRA 5DRZA 3GO1H 1DVFA 2YZ1A 1FFNA 5CILH 1PG7W 3SBWA 2PW1B 4KVCH 3WSQL 3HZYA 4JFHE 4IRJB 5GGSY 1JWUB 1CFSA 5L2KD 3L5WB 1LK3H 4ZOCA 4LLYB 3BO8A 2J8HA 3O45B 1I7TA 2EECA 5IHUL 2IGFL 5IKCA 2C26A 4MDJA 5SWZA 4A2MA 4EEEA 1RV6X 4KTDH 4I18A 5CJXC 1QRNA 5MEQA 3CMOL 1BVKB 2QQKL 2DQHL 2P8MA 5C0BB 1G7LB 4Z7WA 2PO6C 3BW9B 5CIPA 2NY3D 3D39B 1K3ZA 2CUHA 4PGDA 4I13B 4M43L 3GSUA 2OP4H 4ODUA 2HFGL 4U4BA 1VPOH 1WBYB 1KXVC 1HXMA 2H9GB 1SVCP 1XCQA 4OIBA 2J2ZA 2NXZB 5I74C 3VXSA 2V5TA 1TVBB 1A6VL 4YDJA 3CSYA 3SKJL 5IHBA 1YMHA 5F9OL 3DX6A 2ARJQ 4M61B 1FG2A 5DMGD 4LGPB 1K6QH 1YN7B 4PRPE 5EBLB 1JTOA 5I0ZA 2R4RL 1BBJA 3H3PH 4PRIE 4EIZC 3TH3T 3OMZA 1KJ2H 5F9JA 5C6WH 3HCVA 3DROA 4NZRH 3QJHB 2I07B 5E8PA 5DVLA 1CDBA 2Q1EA 1GGCH 5GJSL 1T83A 3VWJD 1P2CA 4OFIA 4Q0XL 1WBXA 4WY7L 4UV4H 2P5EA 1QSFB 1E4JA 4GW1A 1BAFH 5DJZA 5DVMA 3CZJA 4K7PX 3BGFB 1XGRA 1FZJA 2NZ9D 3HAEB 1XGPB 1QRNE 3TN0D 5I1DB 3UTTE 4HMDA 4OLZH 4FQIH 4PJGE 5IEKB 4GLRI 3GSOB 3GSXB 3WO4C 4HF5H 3M8OL 1I3RB 1X5GA 5E6IB 3VXPA 1EO8L 5IVXF 1UVQB 4QHUB 5M95B 4L3EE 1A21A 1RPQA 4OZGA 2YUWA 3EYQC 1EZVX 2QR0B 3MO1A 4OKDA 5DZOA 4UIKH 5JNYA 1V7ML 1GSMA 3CK0H 4MNQD 2GAZB 1NFDF 1JPSH 3WXWH 5EA0L 4MA7H 1FQ9C 4Y2DD 4QNPE 4NZTH 1EHXA 3QZWA 3VFVA 5T5NF 4V2CB 9CGTA 5D5MB 3K46A 5HDBF 1BGXL 2ICES 2Q6WA 2VLRD 3TBTB 3LH2L 4GSDL 4UTBL 4R4FH 2JK5B 3O4OB 3AXLA 2DI9A 4JKKA 5IQ9A 3BP5A 3MRRB 4WNQA 3QUKB 3VI4E 1MCQA 1KPVA 1DEDA 1NBZA 3T8XB 1YPZE 2P5EE 3S4SG 1CGSL 4M6ML 1WBZA 1ZGLM 2OR9L 3RDTD 4TSCL 4KMLB 1EA9C 1JHKH 5DMKB 4X8JA 1SJXA 3KPSB 1DVFC 3U1SL 4K55A 4KRNA 2W1NA 5F71A 4IRJC 4XCYA 3K1DA 1UCBH 4KK9C 1IL1A 4CNIB 3SOBH 1DUZA 4YE4L 4I1NB 1N5YL 2EZ0D 2NY0D 4OZGE 3DI2B 1XGQB 5I1LA 2J7LA 3RUGB 3SCMD 3SY0B 4ZOBA 2E6JA 4JY5H 4M9OA 1Z3GH 4UINH 5IGXH 1IEHA 1LO4H 3MXVL 1EX0A 4UDTB 1HYRC 1ZEAH 4KWUA 1E4XI 2ENSA 1C16B 2F8XC 1XGTA 4HJ0C 3NCJL 3D69B 4XMLL 1EAJA 1GGBL 2DDQL 4S2SA 5DD6A 1LMKA 4LSTL 1B6UA 1N0LA 5E2WH 1DSFL 4HUWA 2FBJL 3MV8E 4QRPB 4JLRA 1FORL 4F9PA 1FFQA 4Z18A 1EO7A 1MLCA 1Q9WB 4AEHH 3ULSA 5DJ0A 4F7EA 4L4TE 4JG0H 4HIJB 1L9NA 2HRPL 3QXAA 1SHMA 4M7JL 5TFSL 1MAMH 4XT1C 1IC7L 1RZ7L 1XH3B 3JTSA 5KVFH 1C7SA 5CUSL 2W92A 3WJLA 3ZHKA 5AG8A 2BNRD 3OAYH 2XWTB 1DEEB 2P8PB 2XQBH 4AL8L 3FO0H 4DVBA 3O6FA 1RJLA 3L5HA 4S10A 3F7VA 3OX8B 1FLRL 4KJWD 1I8IA 2YWZA 3BXNB 4K8RH 4GKNB 1XF4A 1CFTB 3OAYK 4YXLH 3T77A 4MAUH 1PZ5B 4PRHE 4WU7A 1MFDL 2H6PB 5DGQA 3BGFC 2R56L 2UY6A 4WI6A 1JPGA 3MLTB 3QUXA 1D6EB 1NL0H 3VGFA 4NIKB 4CN4A 3Q5YA 4MGXA 4OLVH 1D6VH 3GI9H 3UZVB 3C09C 1MAJA 2VITA 1BLNA 2XN9B 3PV7A 3DSFL 4OBSA 5ESQB 5DI8A 1EFQA 2YN5A 2F53E 5EU4B 4WWID 5IVXE 4OCSL 5J13C 2EDNA 1NUGA 1BOGA 4G6FB 4G8IA 4ZYKA 2O5ZH 1VB9A 3TA3D 3IB4A 4BELD 1NFDE 4XCFL 3V8CA 1NC4A 1YJDL 4TSBL 4WTWA 5DD3L 3RWHA 1WCBA 4XX1E 3O9WD 3V0AC 2WW8A 3MREA 3C5ZB 2R9HD 3QPQD 1BF8A 4PB9L 4U1MB 5E4EC 1OGTA 4MCZA 4GAJH 5F93C 3V8OA 5IBLD 5CGYC 3RWFB 2VDQH 5E2JA 4YXKL 2E7LC 3EFDH 2FLRT 1WUNT 3TBWA 1TNNA 4JFDE 4KI5F 1AQKL 5JXAH 1R24B 4JPVL 3GZKA 5I30L 1DBJL 4F9LC 1KCSL 1YEGH 4WUUD 1VEPA 4XCEB 5B39A 3HA0A 3KYMB 4FG6C 4PLNC 4J4PC 4MQ7B 4WHDA 2HG5B 5FUCE 4UQ2A 5LWYH 4TVPH 5KS9B 1MF2H 4G80B 1KPUA 3TBSB 4NKOB 3PWPD 3ULVC 5TDOA 3SGEI 3NGBC 2NXYC 4NC1E 3NCFB 4WI3A 2XZAL 1A7OL 1J12A 3HAEH 4MHHI 2P5WB 2XNAB 4X6FA 4YFLF 4JFXB 1HYSC 2DQDL 1RJZA 2CSPA 2XI9A 4RGNB 1VADB 4OZFH 1RK0A 4PJ8A 4OLEA 5T3ZE 5L8LB 2GYSA 2PETA 4WENB 1F4WH 1P84K 3ECBA 3QIWA 1HKLL 1HE7A 1U8JA 1V7NH 3NIFF 1ZA6A 2X4QB 4LLQB 1T04B 1N2RB 1NCWL 4OCXH 3HI5H 2A6JA 5FV2A 5BZWA 1MCBA 3QXDA 1Q0YL 1E28B 1HEZA 1VDGA 5CEZH 3BISA 1KULA 1D9KB 1O0VA 4ELMA 1ONQB 4HUMB 4B5EA 4UQ3A 3QPXL 1RHFA 5BV7B 5AWNH 2VXVL 3T4AA 5CP3H 2KQNA 1A3QA 4PJCB 4YAQB 4LKXA 1B0RA 1RU9H 3GJFK 3BZEA 3IT8D 4RGMB 1TZHB 3BN3B 4I77L 1Z9OA 3TEUA 4CN6A 4R7DA 5JW4M 1I1FB 4JM2A 4TUKL 4J6RH 3WIIH 3VFSB 1FCGA 3M17B 4KZDH 4P46A 3QEGH 1BIIA 1ZSDB 2O93L 4L8BB 5ICZB 4TNVK 4XP6H 3CFDB 5E2UL 2VDKH 4J12A 2F5AH 3D2UB 4DGYL 3EOTL 1T03L 4KMTL 4NQCE 4HULB 4Z7VF 1CG9B 2EYRA 4KQ4L 2AKRB 32C2B 4BH8A 2XFXB 3WJLC 4XZUA 3V4UL 3GBMH 1D5XA 1IAII 4G9DB 4PRAA 1F4XH 3GIZH 3KLAB 1DBBH 4HK0B 3EFFB 4GQ9L 5F89A 5LGJA 1T20B 1H3VA 1I9JL 5C0AB 3O6FC 3T0VA 1A7QL 3QEQB 4TVSa 1HHJB 4LLVA 2FEDC 4ODWB 5DA0B 4APQB 5HYJA 3MJ7B 1KYOK 1HQRA 5D1ZB 2QADB 4OGXH 5DQ9A 3VFOB 2W9EH 4N90E 1S7TB 1ZS8B 5TDNA 5E8EA 4GQPH 3QUYA 3P77B 3QUXC 1LP9B 4H20H 3HC4L 4U7SA 2ITCB 3KPQB 4MD4A 3OKEA 3WHXA 3SPVB 4PJ5D 1H3WM 1FIGL 1ZLVH 5L2JA 2YPKA 2VL4A 2GFBB 4MYWB 3QUML 4OIIL 4ZD3L 5FYLH 5BJTB 4GBXD 1EO5A 1F2QA 4BQBA 4NKDA 2A6KA 4O9HH 5FO7B 4XP1L 5DGRA 2PCPA 1NPUA 1QSVA 3FB7B 1ZLVK 4JFFD 1JZ3A 3HB3D 1INDL 4BQ6A 5IWLA 2FHCA 2CKBL 4ODVL 1JZ8A 1HSAB 1P7QB 3NVQA 3C5ZC 2VDNH 4PJBA 4OD3L 3LDBB 2JCCF 4RGOL 4MB5A 3AGVA 5IW6A 1UEMA 4DTGH 2WZPD 2E9BA 4KI5E 4LKCA 1P84J 2AJZA 5F3BA 2UYLB 5FA3B 3P30H 1S78D 2V6HA 1YECL 1HHIA 3K4AA 3E3QE 3EJZD 1IGFL 2QHRL 5EUOF 4R90L 4JE4B 1G7JB 4KC3B 3DBXA 3ZE2F 1V3LA 4LBEB 3W9EA 4D3CL 2HJKA 3F6LA 5KW9L 4M1CD 2YWYA 4U6TA 3RL1B 4M62L 3OXSA 1D5ZA 2A77L 1K8IB 3FONB 4ZPTB 5D7IA 3IETA 4WHYG 5IQ7H 3K74B 3CD4A 3LKOB 1CGXA 2H1PH 1M6OA 4QOKE 3RWGA 1RQ5A 3DECA 3RWDB 5HD8C 4RGNC 3SKNB 1MI5A 3I50L 4PJ8C 3WFEL 5KSAC 3X11B 3NIFE 2CRMA 3FQXB 3KNBB 4XAWH 3QIWC 5ESVB 5HHOD 5ISZA 3S5LB 2IALB 2XACC 5FOBA 2VDMH 2NR6D 4HWBL 4P3DB 3VXOB 1Q0XL 5IHLB 3QWRD 3KWWB 2ITDA 3WO3B 1JUFB 1G7PA 4Y0GA 3Q0HA 3D3VB 3UZQA 1BPVA 2R4SL 3RVUD 5BV7C 1KENL 1OTUD 4EN3B 4NDMA 4ZTPH 1MCCA 4OUOA 4RGMC 1QSZA 4KUCD 3QDGD 1K4DB 3ZTJG 2ORBL 4XNYH 1YEEH 3D85D 3BQUB 2J12B 3AB0C 3GFUA 1KPRB 3L9RB 1JZ7A 3RQ3A 4Z7VE 5I8EA 4OKVB 2VLKD 4M7KH 3FTGB 1VFBA 4Y4HB 1U8KA 3LCYA 1KELL 4JJHA 2IFGA 4K3JL 5KN5A 4XNMA 4M6OH 4JM4H 5F9AC 5L88L 5DHVB 2QSCL 4XRCA 3UDWA 3RRQA 3QUMA 1H15A 2X4SA 3G5XA 5C0CB 2BRRL 5GGSA 1NGPH 2FZ3A 1NC2A 1Z0MA 3O3EB 3QHZL 5GRVK 2VXSH 4LF3B 4L3CA 4AYFA 3VH8A 1JHLL 4APQC 1CZ8H 2OTWA 5F1OB 1YJDC 2CKBA 3WHE0 1YMME 4M6NL 4NZDA 4YQXH 3SDAD 2VQ1B 3FT3A 3LN4A 2AJYL 3U7AA 4J7RA 4P57A 3DXAB 3C60D 2WSKA 1ZHNB 4ZSOE 5I15L 1FVDA 5KJRH 5IMMA 1PKQB 2Q76A 1M7DB 3BSZH 5DC9B 2JKXA 3SDXB 2IH3A 2CKNA 1MAKA 3PG2A 1DE4A 4DOHB 5LQBL 1GOHA 3VWKD 1F8TL 1UJ3A 3QWOB 4RSVA 4MJ4A 1I1YA 3SDDA 1UYWL 4BQ8A 4J1UA 1KTDA 5IWLC 1MRDH 2JCCE 3GI8H 3TV3H 4HKJB 1DN0B 1XF3B 4JR9H 4OV5B 1S7RB 3P4NA 5GRXG 2PXYD 1Z9LA 3VD7A 1NAMB 3L3JA 1J0YA 3PGDB 1QR4A 5EUOE 3TYGL 2AJ3A 3CX2A 3KPNA 3RJQB 1QLFA 1S9XA 3B9VA 2DQFB 5H2BB 2GITA 3ZE2E 4RX4D 1HQ4B 4MX7B 4Z5RB 4KVNH 1W2KT 2GQHA 5J1TC 4ZAKC 3GSNB 2BOCA 4WFED 1UC6A 5E2TH 5GSRA 12E8H 3MTRA 1OD7A 5DURB 3DURA 1ZGLB 4ZFFA 3HRZA 3MV9B 5GS2D 1MRFL 1TJHH 3JWNC 3HNTL 3K8LA 5FYKD 4MXWH 1DQLH 1F3DH 3LKRB 5C6PB 3K4ZA 1QHOA 3NOIA 1HHKB 3MV11 2Y4SA 1YY8A 4JY4A 5CS7A 3HMXH 4V1DB 3MJ8A 3ULUC 2PTVA 3TVMB 1JP5A 1F3JA 4I3SH 1R3LA 3PNWA 3BAEL 3CSBA 5HVHB 1G6VK 3P9MB 1OCWL 2IPUG 1IT9L 4I4WA 3HC3H 5F88B 3MR9B 5JO5B 3GKWL 5GGQL 3OJ2C 3K8MA 5HGBA 1RD6A 1MJ7H 4C83B 2X4OB 3QH3B 4MA3B 3PWVA 3I6KB 1MHCA 4K2UL 1J5OL 2DD8H 4CAGA 1EAPB 3V5KA 1A1OB 3DSNA 5EPMA 4JKWA 3GDBA 2ZOLB 2P4AB 1QFWI 5CD3A 2HT2D 3ARDB 4UOW1 1ZANL 2W0FA 4X98B 3V52H 2VB5A 3G6JF 3CU7A 1RZFL 1JGVH 5EOTA 4KRPD 3IU3B 2VN7A 3ABZA 3U0WL 4NUJA 4KKCD 3WE6A 2F54A 4KDVA 2HT3C 1A4KB 2R0LH 4NO0B 1YZZA 2CLVA 1YYMH 4MA8H 4ZNCD 3DUUB 5HDQL 4NO5A 3MX0A 3QFJE 4Y4HC 2VR4A 4KPHH 4R3SA 1TQBC 4UB0L 1LVEA 5C07D 1L0XA 1VACB 5L9DL 5DDHA 3MXWH 2OQJB 3DYPA 5A3ID 1AO7B 4F7TB 5LXGH 1JK8B 4GRLD 3PHSA 4NNPH 2Y72A 5C0RH 4KFZC 3Q1SH 1E27B 1U93B 2X1XR 1D5MA 1U3HA 2W60A 1T1XA 5AG9A 1IGYA 4YEEA 4EDWL 5JHDB 1FLTX 4MWFA 4PTUB 2DLFL 2A9MH 4OUUA 1UWEL 1YEFH 2EXWC 4QTIL 1FNEA 1TDQA 1CT8A 5INCB 2GY5A 4ZQKB 1F42A 3KVQA 4HK3N 1SM3H 1BM3H 2VXTH 4PUBH 4MXQD 4P3CH 5DUMH 4Y89A 4CRPA 4I3RL 3VXQA 5CD5D 3S96A 2OJEA 3VXRB 4LU5L 2WBJB 4M3JA 3OPZH 3LB6C 1OP9A 5IFJB 5DYOA 3GSWB 2NTFB 1NKOA 4Y5XB 4Q74A 5A40E 3DX7B 5DFTA 2JIXA 5DFVD 4GW4B 3T2OA 4DZBB 4JHBA 3DOSA 3QCVL 3CCHA 3QO1B 4L4VD 2BDNH 4OZ4A 4PJ9D 3CH1A 1GXEA 3CDGA 3RI5F 4P5MB 2F54E 3C2AH 3QQ3B 1EBAA 5DUPH 1CBVH 2ADIB 3NMEA 3ZSSA 4PJHF 1CGWA 4XVTH 3EYSH 1PG7H 1XF1A 4PS4H 3VA2C 2H32B 3LZFL 5D96C 5JW3L 3O3AB 4JPIA 4F8QA 3HR5A 2DYPB 5IVZA 5DHVH 4P23D 1RZ8B 3DRQA 2C3HA 1J7VR 2NNAA 3TPUA 3AS1A 1Q38A 3PF2A 5JMOC 1T66D 2YKLL 5DD5L 1JMZA 4R96B 1J9CT 5JPNB 4PP1C 1NDGB 4YHZL 3RVXD 2EKSA 2CDGB 3BUYA 4U1JB 4D0CA 5EBWA 1DUYB 3RPIB 4LCWB 3Q5TA 1NCDL 2HVKA 3DGGB 4WWKA 4ZO9A 4L8SB 5IHZA 3MRMB 5GRUH 5HGAA 1I7ZB 3QI9D 3RZCA 5H8DA 2I26N 1F02I 3GB7A 3V4VL 2I25N 2IAMD 2X1PA 4JANA 4H25B 1FYHB 1FVCB 4CMMB 3TVMC 2NTSP 2JELL 4OFDA 4HSQA 2CR6A 5GGTH 5HVHC 5ETUB 3KPRD 2P8LB 2VTFA 5JHLL 4YDKL 3F12A 3BT2L 3S34L 3SJVD 2ESVA 3MRKA 4OCLC 1MFBH 3ARVA 1OARL 1RURL 4PV9B 2FSEB 3B6SB 4YC2B 3SE9H 1CFNB 2HKHH 1NAMH 3BIAX 3ARBB 1NEZA 1CU4L 4XP4L 5E8DL 4X6CF 1UH3A 3NAAL 3SDCA 2RBLA 1E0OB 2B7DT 1MVFA 3G6JE 4NPYB 2XKNB 4WUUE 4FQCL 1CD0A 3WFCL 5IM7B 2EH7L 1X5HA 1M7XA 1KIRB 2NYYD 3WLWD 4C56D 3TBVA 1JWMA 4HKBB 3GSNH 3B9EA 1EMTH 1L6ZA 3S98A 4PJHA 4QWWC 3OSKA 2D3VA 1UWXH 3QULB 5C08D 5H35B 4LMQI 4F57H 4U7KA 1GHFH 3LD8B 4WW2B 5TE6H 2FWOB 5BOZG 4N0FB 2H8PB 3KS0H 4G8FB 4JFYB 1ORQB 3JV4A 3QCUH 4JHZA 3T08A 2IH1B 1T5WA 1QLRA 2AK4A 2YC1A 3OR6A 4QRQA 4P2OB 5IB2A 5DFWH 5D8JH 3MLZH 1U3HC 1FFPB 3MNWA 2NY1B 1GIGL 1SEBA 5FF6A 1S7UA 1J18A 5DK3A 4Z0BH 3VJ6B 3WFBH 2HKFH 2XY1A 1QLEL 3X12A 4NNYA 4B50A 4YUEH 3B9KA 2DLHA 1J8HD 3UYRL 3EJYC 4U1KA 2ESVE 4W4OA 3O2WL 2P49B 3FB6B 4KJQD 2Z0BA 4KV5F 1NGXB 3HZMA 3LKQB 5A2IH 2AEWA 4OD2A 4HCRH 4HJJH 1JMXA 2LFGA 5IIEA 1B4RA 5C0GB 2FJHA 4NZUL 1A7NH 1JI1A 1DP0A 2EDQA 4KUCF 3LIZH 3IDIB 4MDIB 1JWSA 3GRWL 3IRZA 2YBRA 3LEXA 2VL5B 3D25A 3V6OE 1KFAH 1OAKH 3BWAB 5CP7A 1KIQA 2QSQA 4JKLA 3ZKMD 4PJHE 3ARGA 2XPGB 4NQEA 2R1WA 5A2FA 3SE4A 2GEEA 1ZHKB 4F33A 2HN7A 5HDOA 4Y4FB 5LAXB 2GJZA 1RUML 3R1GH 4NSKB 3WFDH 1UM4H 2BP3A 3L1OH 1ZT4B 4JFEB 3CLEL 1QP1A 3LHPH 4H88H 4K3DL 5I6XB 4BZ2L 4JFPA 3IFNH 3VDAA 2OSLA 5GIRA 1X5ZA 4X0KB 3V6BR 2AK4E 1P5VA 2X4RA 2MKLC 5DS8B 5I1HH 1MUJA 4QHNA 3PL6B 3PHQA 2B8OT 4PRPB 5I19H 1S3KL 4PRIB 3AU1A 4BUHA 4PRBB 4Y19A 3IXTA 4OZIA 2HFTA 5J3HD 1QSEA 2LE9A 3TC9A 2BSED 5ABDE 5ESAB 2AV7A 1OM3H 4L8CA 4L8SC 1A6AA 1IFHL 5ANMA 2J5LB 3L3DA 4QCIB 5BVPL 4JDVB 1UG9A 5ITFA 3RZCC 1TCRA 3RX8A 5DJAA 2VO5A 5ADOH 3VW3H 3CSPA 4HQQL 1UWGL 2LV4A 5DJXA 1ES0A 3ESUF 3GHBL 4EJ1C 1J86A 1UXWB 1OF2B 1JHTA 1EJOH 4QHMB 1F97A 4H8WL 1I7RB 1QRNB 3O3BA 3UTTB 2EC9U 4XPTH 4IHOA 4PJGB 5CFHA 4N0YL 2O5YL 3QCTH 3VFPA 4KK5C 1U95B 1UA6H 1U8QA 3EDJA 5DK2B 1P9MA 3GMNB 2H32H 4JZNB 4EOWL 1X5FA 3EYOA 1MJUL 5DJCA 4L3EB 1RUPL 5IB5A 2DMCA 3FN9A 4FTVA 4K8RD 3MBXH 3B2VL 3HNVL 3DUHA 2HTKC 2VISB 4EI6A 4HHAB 3AAZB 3TNMA 2V7HA 4TULL 1T1YA 1PY9A 1BBJB 1P4BL 5CSBA 3FOMB 1IARB 3RVVC 3AVEA 5EOCL 4Y19E 3EO9H 2WUBH 4OT1H 3T0EC 3OB0H 3O6LH 2DI8A 4KDWA 3RPKA 5HI3D 3O41B 3IGAB 1BZ9B 1T5XB 3PHOB 2G5BB 2KQMA 4U3HA 1WZ1L 1WEJH 5D72L 2B1HL 1JPST 3CFJA 1QNZH 3TIEA 3LD8C 3HUJF 4WW2C 4EBQL 3D39D 2I60H 3PP4H 4L9LB 2ZCLH 3OB0K 3WS3B 3ZHDA 1YPZB 3U0TA 2J8UA 4GAGL 5EZIH 3OKLA 1FV1A 4XGZA 5HHOE 1D5IH 2A0LD 3G08A 4Z7NF 2NY1C 4JGJA 2L4OA 2MFNA 2NXZD 3GRWA 4PJAF 3NFNB 3CMGA 2NY4B 1RJYA 2MQ0A 2IANA 2AEQL 4D94A 4R8WH 5DZNA 2ZCKH 3C5SB 4XPGH 5F7DA 3MA7B 4EVNA 4KV5E 4IRZH 4IOIA 5DWUL 4DAGL 4W4OC 3BUTA 1OAQH 1VGEL 3BZDA 2UWEA 4QF1A 2Q8BH 4NO2A 3WL9B 3HI1A 5E00A 2BY2A 3FRPG 3QDGE 3U36A 5JDJA 1KJ3H 4O02L 4MLSA 1YEJH 1J10A 2FO4B 3D1MC 1B0GA 1GAFH 2XZQH 3P9WB 5IP4A 3FO9B 4OV6F 5D7SL 4TVPD 5F6IB 3OG6B 4LSRL 1BBDL 1PG7X 2IQAB 5E2VL 3PV6B 3NIGF 4PGBA 4MAYA 1BMGA 3L6FB 2MCG1 3ARGC 5DEFB 2YPLD 3SE4C 3TWCL 4UOJA 3QQNA 1BQSA 3MV8B 3PQYB 3LEYL 1DBAL 2BNQD 2I5YH 2Z92B 4Y4FC 4I0CC 1G84A 1MQKH 2MQCA 3G6AB 2EDDA 2M2DA 2FD6L 1KF9B 1CLCA 4L4TB 2VAAB 4OCWH 1AC6A 4N8VA 4NQTA 4Z76B 5E6ID 3WEXA 5I6XC 1YY9D 4JRYD 5FUZL 4PR5B 4TTDC 4GW5B 1RJCA 2YEZA 4PJDA 1KIUA 4X5WB 4MQXC 4YHLH 2VABB 5CEZD 2PYEA 3WMSA 1I8KB 1C5DA 4ONFH 4WV1A 3MRJB 5CWSB 1BP3B 2OI9C 4XCYB 2NY6B 5E99H 2J5LC 3OKDB 2MNUA 3MFFA 4X4XA 5J12B 4MNGA 4PRHB 1PX3A 4E0RA 2HMIC 3FAXA 4HS3B 3C2SA 4LIQE 5CJ5A 2R8SL 1AI1L 1S9WA 15C8H 4H26A 2R1XA 4CU6A 3PWNA 5HI5D 2EXYD 3VFMB 1U8PB 2WWMD 1NBYB 3P4MB 2C1PB 4UBDC 2F53B 1PYWB 5IVXB 5JW5B 1AJ7L 1T0PB 4OFYA 3KPSD 4R6UA 2JLLA 2X42A 1FN4B 1LE9A 4B0MM 1QR1A 3MJ9A 2R2HA 1NFDB 4U1LA 4P49A 5I8CA 5ICYA 3HKFA 4PRNA 1L7TL 4OI7A 2VH5L 1BQLH 2UY7A 4PJ7F 1BREA 5IJVA 2ZG1A 1HDMA 4LARH 1C5CH 4XBGA 1MQ8A 4MSWA 4NC0B 4YR6A 3NCYP 2Z4QB 4P0DA 3VXMA 1Q1JL 4M1DH 1NKRA 3GNMH 5MI0B 1ZWIB 2YA1A 1P6AB 2PYEE 2X41A 3U2SB 3HUJE 1RZKC 4JFDB 3RVWC 4XWGH 4JQIH 2H41A 2ZCHH 4XPFL 3A6CH 2E9WA 3GMQA 3DHJA 4I9WD 2BC4A 2BSTA 3U30B 3I84A 2V17L 4L9LC 5AD0A 4QRPD 5EU6B 2QKIB 1DLHA 1CLYH 2EE3A 4HX1A 4Z7NE 4UAOC 1K4CA 1DANT 4PJAE 5SWQB 4R26H 2ADGB 5JXED 4OCNC 1Y6NR 2XQYK 5DEGA 1U58A 4QRSA 4XPAH 1ZGLP 2NY4C 4TPRL 1WSST 4FP8H 3NACH 3S88L 1J1OH 4LHUA 1RIHH 5DO2C 2VITB 5LKNA 1W8NA 3BN9C 2ICWB 5DJ6A 5HGHA 4MCYB 3C87A 5GGVH 3ZKND 1BOGB 5C3LD 3EYUL 2ADFL 2D03L 4FFWD 4E5XB 5D7KE 1EGJH 4G7YH 1N3NB 4NO3B 1OD9A 4NCC2 3QG6B 4TUJA 3SGJC 3RKDD 2VIRA 1LO3L 4P4RB 4X6EB 2FL5A 4HIHA 4GKZB 2R39A 5GQBA 1L4IA 4HC1L 4U0QB 4YHPB 5FGBA 4ODXB 4KJPC 4UU9B 4AM0B 1TENA 4JY6B 4MAYC 4Y4KB 1A6ZB 1RZKH 2AJVH 3N9GH 1EHLH 2Y06L 3RGVA 4JREB 5CAYB 4ZTOL 3ARPA 5HHXH 4DZ8A 3JWOL 3VXNB 2WLYA 4XC3L 2RFXB 5B39B 1CGTA 2AABL 2BERA 4DKFH 4G6FD 1HXYB 2Y5EA 5EIIB 1Q94A 5JDSA 3V5DB 4NQCB 3N85L 2NX5A 2Y6SC 5K59F 1UT9A 4GAYA 1MHHB 3K8KA 4OF6A 5F96L 4G5ZH 3WUWA 2LTQB 1ZLSH 4HW6A 3JVGC 1CIDA 1P7KA 2NY6C 1IQWH 5TH2A 5KZCB 3BH9A 1FDLH 4JVUA 4P5TA 4RAUA 5KVMC 1FZKA 3D9AH 2UV3A 4MS8C 3KPLB 5J12C 1MPAL 2DKSA 3A6BH 4LCIH 2Y5TB 4L4VE 3WD5H 1R3KA 1M7IB 3V0WH 5TQ0L 3MRHB 2DWDB 3HE7D 2OM5A 3TYFB 2R0KL 3X14A 3X3FH 4WI9A 1MCOL 1IM9A 3IDXH 3ARZA 1MSPA 1A3LH 5FKPB 5T1KB 2VDRH 4ZOEA 4PJEF 4G8GA 1JV5B 3RWCB 2NY2C 4MJIB 4CADB 3WSQH 3MBEA 1G9NC 4OIAA 4RFNB 3BZEB 3NN8A 1BD2D 1R3HA 3G5ZB 2DQCL 5DSCB 2BVPA 3CVHL 5AUMA 1I1RA 1YEIH 3KXFE 4NQDE 4PJ7E 1QFOA 1MREL 2IGFH 4HFUL 2X4UB 3KPPA 3F7RA 3KYKL 3UC0L 1EEYB 5C9JA 1R3JB 1FJ1A 5HI4D 4QT5B 5EZJB 3O2VL 2XG4A 3RNQB 4E42B 5T1LB 1A14H 2DQHH 5FO9B 2ARWA 2YMXH 3D87B 3P4LA 1AXIB 1RHHB 3RNKA 5T1DL 1F6LL 4M43H 2HRLA 1I9IL 5DJ2B 1GZPA 1JRHI 4R2GB 5JW4Q 5CBEA 2XZZA 2CLRB 1OAZH 4XBEL 5GZOD 1MCPL 5FAAA 5FUCC 4U33A 1G7HB 2K9UA 1A6VH 1MFCL 1TMCB 4NGHL 1S8DB 2G5RA 5KVGL 3SKJH 1J0JA 3QO0A 4M48H 5F9OH 3RU8L 5C0DA 1NCUA 3QUYB 5IJKC 1KCKA 2R4RH 3OHXB 3SJVE 2XT1B 2J3SA 3MMEA 4QOKB 2VKWA 2J1KA 1U92B 4ONGL 1CICB 4PB0L 4NJAL 3IDMA 3UTQB 1IAIL 2DWEA 3T65B 2A6DB 1UZ8A 2ZNWA 4WGWB 4J8RB 2VLLB 2P7TA 5GJSH 5SX5K 5SWSE 4OQTA 2Z31D 1S7QA 4Q0XH 1IEBA 5C0AD 4WY7H 1KC5L 3IFPB 5D6DA 4XTRD 5LBSH 4S1DC 5I8KL 4TRPL 3QUZB 3Q3GB 4X6BB 3GIVA 3IFOB 4MJ6A 1HSBA 1H8NA 4YGVA 2QADD 5D1ZD 4HKXB 3U9PL 4EUPB 3ZTNH 1AIFA 1UZ6F 3I75B 4PRDB 5E0QA 5I1KL 5LGHL 1TJIL 4JRXD 5IB1B 3M8OH 4JREC 4XH2A 4TQEL 1EO8H 4AT6B 1NGYA 3S3PA 4KROB 4YX2L 1T22B 4K7PY 1U0QA 4YPGB 5CCKL 1MH5A 4HGMA 2AV1B 5MEPA 4O2FB 1V7MH 4Z7VB 4DW2L 5HPMB 3P11L 5E7BA 1LDSA 1MCWW 5KG9B 3N0PB 1ACZA 4KK8D 4PPTA 2E7MA 1F6AB 4CVXA 4Q9CA 3HZKB 5L2KB 1BGXH 4F7CA 5J9PB 3LH2H 4GSDH 5D7JD 4UTBH 4U6HB 5T3ZH 4ZFZA 4RNRB 5BRZA 3GSRB 1PDKA 5DT1H 1EZVY 2HTLD 3NZHL 4QLRA 3TH4T 3CVHA 5FHAL 5E8OB 2F74B 5TDPA 3E6FB 3FHAA 5E08L 5J11B 4NFDA 3FB5B 1OGAA 4B41A 1YMMB 1LNUA 2HWZL 3N1FC 1G1CA 4P2RD 1CGSH 4M6MH 1SEQH 4TSCH 3AUVA 2NY3B 4ZSOB 1KJVB 4U1NB 5FFLA 2AQ1A 3S35L 5F1IA 2YSSB 3FFCA 2FIKB 4NWUL 2FGZA 4UT6L 3U1SH 4O00A 3MBEC 4MB4A 1XR8A 1IAKB 2XWJB 3VMOA 4P4KD 2EIBA 4OD1L 4YE4H 3UBXB 1BFOA 1CK0L 5J6GB 2P48B 1T0MB 1OPGL 1N5YH 2E7BA 3VFNA 1AKJB 4RAVA 3BD5A 3KDMA 2JCCB 3ILPB 4HUVB 2W91A 2CQVA 5I2IB 4KHXL 3CFKA 4YH6A 2ICCA 4HD9A 4R4BB 3S37L 3MXVH 5DVOA 2ADJB 1L0QA 3WKNA 3SQBA 2BCKA 3NCJH 4ZFGH 4LPUA 4XMLH 2DDQH 2COQA 3VWJB 5EUOB 2V5YA 5D6CB 1JJUA 1RZGB 2FBJH 1FFOB 1VFAB 3HE6D 3MLYL 5BRZE 4EN3D 2YUVA 5IMOB 1NC2B 4R2GC 1PGRB 3HN3A 4UDUB 4PJIF 4FXGA 4ZODA 1NDMB 2CKBB 2UVFA 4JN2B 4N9OB 3TN0B 3VG9B 3SE3C 1IC7H 4D8PA 1W72L 5I1EL 4AEIL 5H37H 5CZVL 2AEPL 4BFIA 2AP2A 5CUSH 5I1CL 2APFA 1S9KC 2IBGA 4S11A 3VA6A 4WUKL 5L7XL 3FFCE 3MOBL 3JV6B 4LLWB 4LCUA 3WHE1 4M93C 4AL8H 4XHJC 4KXZH 4BH7B 4JDZB 5M7QA 4HJGA 1OB1B 1CCZA 4G6AD 5ITBL 3TNNA 4MNQB 5D1XD 5T1MB 3LN5B 5DRWA 3C8DA 3PE9A 4LNRB 3TP4A 4Y2DB 5CJOH 1KTDB 1MFDH 3PXHA 1VKXB 4WW1B 2BX5A 4P2QA 4Y16D 2R56H 4Y1AD 3FRUB 5IMKA 2VLRA 1TETH 1UZ6E 3C9NA 4BK5A 4F2MB 4K71B 4GOSA 2GSGB 3T0XA 1LK2A 5IESL 1JPFA 2H2SD 3DXAD 2M26A 8FABA 3DSFH 3BKYL 3AROA 3VMNA 4OCSH 4LQ1A 4ONHA 4H5SB 4X7FC 4PY7A 4X7CC 2VWEC 4U1IA 1AXTL 3PDOB 4GT7A 5EO0B 4KROC 1WQVT 4L9DA 4LCCA 3L3KB 5FCUL 4TSBH 3RDTB 3J7HA 5EC2B 3OKNA 1B88A 3NABL 2P44B 1NGZB 3QFJB 2YOCA 5GS0L 2NY5C 3JWDC 3S97C 4PB9H 4PP2A 3QIUB 5BS0E 4JHAL 1MJ8L 4NRYB 5FKAA 4JQVA 5K9JH 6FABH 4YZFF 3ZYZA 4YXKH 2XRAL 3VCLB 4YHMH 3W2DL 2P46B 2CO7B 3C5JB 4R7NB 1AD9B 2IJ0C 4Q2ZB 3GUTA 3OR7B 4JPVH 5F1NA 1JGLL 3SCMB 1DBJH 3O0RL 2X7LB 3T3MF 3UX9B 3CXDL 4W4NA 1N64L 5D1QD 1T1WA 5J11C 43CAB 4RFOL 4L29B 4XNQB 3BPLC 1JZ2A 1U8IA 2O61A 5L8KB 5CZXD 2W0KA 4M7ZB 4TTGA 5C8JB 2PTTA 3K2UH 2XZAH 1A7OH 4JZJB 5C09E 5DURD 3DX9B 1S5HB 1M71A 4EUPH 1H3PL 3FB8B 2AJXH 2H3NA 3C08L 2BNQE 2DQDH 3C8KA 1OQOA 2IG2L 5F8RC 43C9A 5F7FA 3U0PA 1RZJL 3EDKA 2G75A 3H7BB 5B8CB 1CXFA 1HKLH 1N59A 4JRYE 4F7MB 4NUJB 3FCTB 4V1DD 1LO5B 4YHOH 5DMGC 4JFZL 1PBYA 2EO9A 3WIHA 1P69B 2W9LA 3JWDH 3LQZB 1W72A 2EKJA 2X4NA 1I75A 3U82B 1T3FA 2VXVH 3FT4B 4HPYL 4M8QA 1R3IH 1FBIH 5GS3A 3EIFA 3IKKA 3ZYOA 5AZEH 1BJ1H 5J57B 4I77H 4HIXL 1CL7L 4LHQB 5CEYB 1Q8MA 3MCG1 4PJIE 5GRJH 3L3OB 1IVLA 3GGWB 4OF0A 3QRFM 1CT8B 1J05B 3MV7D 4G3YL 1ZHLB 1VEMA 4XVUD 2NZ9C 3WFHA 5EU3A 5E2UH 2BVOB 3TN0C 4DGYH 3BH8B 2YK1L 3EOTH 4RA0C 1T03H 4KMTH 4NO0D 3VXQB 4KQ4H 3LQAC 4AY0A 3QNXB 4WJ5A 5HY9B 4W68A 4WGVB 3TA3B 3D0VA 1DQML 3E0GA 3MOAH 1XGYL 3O6ML 5HHMD 1AO7D 3CLFL 5I1GH 2DM2A 3W0WE 3DLQR 5HHVH 2FEEI 5AZ2H 5TPWH 3O9WB 2HAZA 4FFYL 1CR9H 4QRUA 2C7UB 5CKGA 4YFLI 2P42B 4AK1A 3AMLA 5HHQB 4Y2DC 3A6OA 1YN6A 2UZIH 4ZXBA 4WFFD 2J6EL 1S9VB 2UZXB 4L5FH 5I1IL 2BMKA 3LEVH 3STZB 5L6YH 2IPTL 5EUKB 3HC4H 5HSFA 1Q72L 2ZOKA 5D2NE 4CN1A 5AAWA 3UTSD 3G6JB 4WUUB 1FIGH 5FO8B 4LAQL 1FSKB 1KIPA 4OIIH 3W39B 3QUMH 4NM8H 4HMCA 4NWTH 3ROOB 1ZVSA 2R0WL 4HGWA 2V2TB 4PYHA 2IADB 3MGAA 3G5YA 2B39A 4LFHG 3FQNB 3VD4A 1KBGH 4LCCC 5LG1A 1INDH 3RDTC 5BQ7B 3V2AR 2CKBH 3MLXL 4U6VL 1ZTXL 2HFFA 4XHQA 2IF7A 1X5XA 4OD3H 5CLWA 3NA9L 3AREB 2XXMB 4YZFE 4JZOB 4JQVC 2CMRL 1B4JL 3RTQD 1A9EB 2AXFA 1W8OA 3MRFB 4X7DC 4XNZB 4P99A 1F11A 2EZ0C 2NY0C 2A74B 2FX8H 2QHRH 1Z5LB 3LMJL 3SCMC 3KYNA 2BNUA 1H8OA 4R90H 4CMHC 3LKNA 1WCQA 4PV8A 1HH9B 1FZMB 2R2BB 4D3CH 3LS4L 1K9TA 5KW9H 3H9SD 3WXVL 1G7IA 4NRXB 1FGVL 4M62H 3QDHA 2F19H 3P40A 2A77H 5TF1L 4HKZA 3F7QA 2GK2A 5I76A 1U8HA 4JZJC 3P4OB 2PF6A 5DQDL 7CGTA 1CLOL 5F1SA 3EYFA 1CF8H 5DK0B 1P4LA 1A6PA 1KLGA 3P0GB 1INQA 5BXFA 2Z93B 4D9LH 1A7BA 4Q9QL 1IQDB 3I50H 1LD9A 4IMLA 5GSVB 4O51A 1QO3A 3WFEH 1K5NB 2ILLA 2M8XA 4NQVA 5DD0H 3L3IA 3AFLA 5EZOL 4IIQA 1QKZL 4U6YB 4NM4L 1ZMYA 2XG5A 4POUB 1XIWD 2V2WB 1CE6B 4HWBH 4XB7A 2PNDA 4PJHB 3BPNB 2EC9T 3L95B 4LQFL 2E5EA 5E9DA 1QRKA 2VZ1A 1OHQA 5T3XL 2ATKA 3QDJD 4GJTB 4YIQA 1I9RL 3WIFB 4G8EB 4U7MA 4PGZA 1IAOA 1RUAH 2R4SH 4KJWC 4E41D 5CINL 1KENH 2CDEA 2XIDA 4Y8DC 1DQJB 3UBXI 4QRRE 1LO0L 5MERB 5JR1L 3BZ4B 2AK4B 5I9QB 3AC0A 3R8QA 5F9WC 5E1AB 4J3VA 1G9ML 4UV7L 3U7YH 3W11D 4ETQB 1IKFH 1RIUH 3QDMA 3MCKB 1EJ6A 3MGOB 5D2LA 3IJSA 4K7PL 5EU5B 2D31A 5TE7L 3IVKB 1HNGA 1HIML 1MCHA 5EO9B 5DJ8B 5J8OA 1GC1L 3L3GB 4PJ5B 2A83B 3NZ8B 1FNGB 3K2MC 1XF2A 4X4ME 1KELH 1TPXB 4H0IA 4K3JH 1MCDA 1BQHA 5IOPA 4GG6A 4GBXB 1PEWA 4D0DB 4N0RA 3ZKXC 3M45A 4JPKH 5L88H 1BD2E 4UT7L 4R0LB 5EORL 2QSCH 3TO2B 1X5JA 1I7UB 5DJYA 4JFFA 2B4CC 3E6HA 1X9QA 3U9UB 2OL3L 3QHZH 4N0UA 1SYSA 1ETZB 1RI8A 2R9HC 5E8NB 1JHLH 1UB5A 3MOQA 3QPQC 2Y7QB 4LSPH 5T33L 3S7GA 1TTGA 2LAAA 4N9GA 3O4LE 1MRCH 3P3YA 4Q6IB 5IBLC 4HEPG 4OM1H 1HI6A 5GS0C 2AJYH 4GKSA 1FL6A 4X6CB 2X1WL 4G43B 4JFHD 4RDQG 5JIPA 3EYVB 3U46B 2OJZL 2EDOA 1A9BA 1NANH 3OAZH 4JJ5B 1MWAL 4U6XA 1ACYL 3PWJA 1N7ML 4ZUTA 4O5LL 4LSUL 5LQBH 1VERA 1F8TH 3PGFL 2EDFA 3UP1A 3QDME 2B20A 2E9JA 3REVB 4FZEH 1AHWA 2A73A 2HJLB 3K1KC 3O8XB 1A4JB 1YNKL 1QFUL 4X6DF 4QYOB 1WF5A 4NBYB 1PQZA 2FB4L 4FS0A 3BP7A 3WNKA 3P9LA 2MPAL 1RK1A 3F5WB 1MY7A 1P6FA 3V6FA 5CJQL 3D6GA 1LO2L 2AJSL 3C6LD 3TYGH 5HHOB 4ZUUB 5K9OA 5D7LA 4G7VL 5DRXA 4PG9A 4RMUA 3T0WA 4CW1A 25C8L 4N0UE 4TOYL 3PL6D 4PRPD 2EICA 5EIQA 5J1AA 4L1HA 4OJFH 1FNAA 2PR4L 5DQJB 2IBBA 1HZHL 1MRFH 1DQQB 1XF5A 1S9YA 1DVFD 1JGUL 1AH1A 3LS5H 4QHKI 5IK3A 3ME0A 2GTWB 5LVEA 3MRQB 5DD1L 5GGUB 3CPLA 4KK9D 3FO2B 3QDGB 4QHKJ 4IRSB 4NP4H 3D85B 3DETC 2DLGA 3DYMA 2NW2B 1F13A 1X5IA 2DOCA 3R06A 1CD1A 4EI6B 4UILH 1FO0L 1TJGL 5F7EL 1QBMH 1OVZA 2VLKA 2GTZB 4QY8B 1P1ZA 1I4FA 1OCWH 1R5WA 3BPNC 3H0TB 2W59A 2ZUUA 3SO3C 1RMFH 1QRND 5GGQH 2AXGB 3KLDA 1CFBA 2X4TB 3RA7L 4BJLA 2VKXA 2DTMH 3AY4A 4ZNEA 4B7IA 4F58L 2QJDA 4NKMB 4K2UH 1G7MB 3B3IB 1NUFA 2BSSB 4OM0L 3B8YA 4YLQT 4KKBD 4KY1L 4L3ED 3U6RA 5IR1B 1ZVYA 5I9QC 4ORZC 1GOGA 1ZANH 3THMH 2OL3A 4JFOA 3D0LA 1OSPL 1RZFH 1E6JH 3CH8A 3RVTD 3U0WH 3VXSD 1T0NA 3BIKB 4YWGL 3BKJL 3SDAB 1OY3B 4BSWA 4P2RE 2VC2L 3NFSL 5MP6L 2CIKB 3C60B 4Y5VB 3IDGB 3FOLA 2DLEA 4L4JA 1OAYL 3VFRA 1Z6JT 5HHPA 1ITBB 2GIYA 5L9DH 5JOPD 4MVBC 4LEXL 1CLZH 1NANI 3ZE1F 2V9TA 4GBXC 2MSPA 2W65B 3L7FB 1KTRL 4R0LC 3FQUB 2RCSH 3VWKB 3RAJH 1MWAA 2EIEA 4NNXB 1AGCB 3H3BC 3MUZ1 1BFSA 5MEOB 1ND0B 5EFIA 2E6QA 2P5ED 2Q3AA 4QTIH 5CBAB 1EEZB 3BEVA 2R29L 1WAAF 3OKMA 5J1SC 2BZDA 3KR3L 3RI5K 5KSUB 4LPYA 1A22B 4Q6IC 5EOQL 4FQHB 1AGBB 4YPJA 2NZIA 2DBLH 2KPNA 4K9EL 1A64A 2FJFB 4FQXA 4GUPB 4HDIA 4AENA 4JB9L 3IDYC 1IGTB 3OBAA 1S78C 4LMQE 3O6KL 4ZNEE 5ICXA 2RQ8A 1MVUA 3QXVA 4AMKL 3WS6A 3T2QA 1BHGA 4CGTA 1H0DA 3MGTB 4LASL 2AGJL 5IROC 2X4PB 2VR9A 1SJHB 3QQ4B 2DQUL 2ZKHL 3MRGB 2XOTA 4I0PA 4AG4L 3ISWA 4J3WA 2APTA 2BRQA 3GO1L 3Q48A 1KTKE 4MJ5A 2APXA 1H9VA 4DJMA 4X6DE 3EO1A 2DM3A 3HUJB 4F7PB 5FECA 2DQJH 4OGYH 3FO1B 5AYUH 4K3HA 1LK3L 5B4MD 2GUOB 3TCLB 1WZLA 1S7SB 4H1LA 1MJJA 4OAWA 5EZLB 3T0AA 3RJDA 4UTAH 5JOFB 2LU3A 4PJAB 2YPVL 1WWCA 1YNTB 1NCAL 5I73C 4L4TD 1H3GA 2NR6C 5F7WC 2YKLH 3EZ8A 2XKUA 5DD5H 1FO0A 1UEYA 1J0IA 1Q9LA 1YUHA 3FQTB 3LQMA 4YHZH 2JJUA 1YEDA 4GG8B 2BVTA 1ZXQA 2MOVA 4Y1AE 4DFHA 3I3DA 4JAMB 3VXUA 2R15A 3F7PC 4Z78A 1DDHB 3MZTA 1UACL 2ATPA 3SKMB 3DVIA 2VJXA 1HYSD 5C0FA 1NCDH 3LRSA 1GZQA 1OTUC 1J0HA 4JO3L 3IKCA 4BZYA 3JTTA 2GJ6A 4ODTL 4HXAH 4D9QE 4K94C 2PYFB 3VFUA 1HWHB 3SO5A 4KRPB 4U1HB 3V4VH 1CVRA 2H45A 1IJ9A 2K7QA 3GSQB 3VRJA 5CMAB 1J87A 3GM8A 3V9FA 5TGBB 4NYLA 4LNVA 1A6TB 4NBZB 2JELH 2YR3A 4Z95L 4J3XA 4PGEA 4MSWB 5T5NG 3OL2A 3TH2T 4HZLA 3BT2H 3ORJA 1OSZA 1IBGL 3DIFA 4GRLA 3BGMB 1OARH 4KK6D 1RURH 1FYTA 3GMQB 3PABA 3AY4C 5IW1A 3MODL 1CU4H 3A67H 4XP4H 3DV4B 5E8DH 3MNZA 3O3DA 4G6KL 4LSVL 4UI2A 3NTCL 1DLHB 4QXUH 3KPOB 1DBKL 4FQCH 4YBLB 4Z7UF 1FZOB 3UJTL 3WFCH 1LE5B 1GCFA 1KV3A 5HHNB 3T2NL 3BZFA 2EDWA 4ZFOA 4YHNB 3R0NA 2CK2A 4MZ3A 1IZKA 1KTLA 4PIRF 1C12A 1GGIH 3LRGA 3CFEA 4P3WA 4FQIL 3C60C 4Y5VC 1KEGL 1CS6A 3VXUE 5GXBB 5INDB 2OZ4H 1URLA 1RVFH 3DUSB 4ZO7A 5ID1A 3MLSH 1NMCB 2GJ6E 4K23L 3SKOB 1T21A 4N5EC 5CHNB 1N6UA 1VA9A 3VWKC 1BZ7B 4PJ9B 4L4VB 5JORA 1JPSL 1JF5A 3IJYB 4M5ZH 3WXWL 5J6HB 5BO1L 1G0YR 2HP4A 3DX8A 1SJEB 3JBG7 4ZDHA 1GIGH 3UXFA 5GZND 1WAAE 4F3FB 1PVHA 4XPBH 2DLIA 4DCQB 1QLEH 3IFLH 2BXYA 3REWA 2PXYC 4XMKH 1K8DA 4OFVA 3UYRH 5CKAA 2ZUQB 3ZDZF 2GHWB 4LLDA 3MRDA 2PTUA 4Z0XA 2C3GA 2IC2A 2PW2A 4NQSB 4P23B 4Y88A 2ICEA 3O2WH 4FZ8H 4G42B 3MLUH 2NLJA 3L7EB 1G6RL 3STLA 1CDUA 1E6OL 4YHYB 3KXFB 4N0CD 4NQDB 4PJ7B 3MNVA 3WS6C 3EUUA 4NZUH 4V2BA 3EGSA 3MV7E 5DHYA 2VXUL 3GRWH 1IEAB 3QIBA 4MXVF 2QQNH 2WK2A 5IFAL 1X5KA 3TBYA 1KB5B 3QI9B 4X4YA 3DTXB 1QEWB 3SOBL 1AR2A 3LRHA 3WFZA 2IAMB 4Y4KD 5EO1B 4BZ1H 5TH2B 1I9EA 1RUMH 3ZYIA 1N8ZA 1BECA 3MACL 5HHME 2XWBB 4K3DH 2I9TA 1VFMA 3BP6B 1N6QH 3ZE0F 1V3JA 5EC1B 3BPOC 1FVEA 3K4DA 4JY5L 3KPRA 1FAIL 4LIQH 4NQXB 4ODSL 4UT9L 1AD0B 3SJVB 5C92A 1JF1A 4WFFE 1KJ2A 3HTLX 4XXCC 4NQCD 4F37F 5C0JB 4MA1B 3IS1X 2J88H 3Q6FB 5H37G 1WWAX 2A1WH 4QHLA 5FUOH 3GMRB 2R2CA 3UTSE 3OKOB 1HH6A 5BVPH 5SWSB 4ZUSA 3K80A 5FM5O 4CJ1A 4PJ8D 6CGTA 4C56B 4KRPC 1BVLA 5KZCD 1U8MB 3BE1L 4HQQH 4KKCC 4WU5B 5D9SA 3QIWD 4ZPVB 1ORSB 3GHBH 4H0HB 4PJFA 1T2QH 1TTFA 5FGSA 1QD0A 3U4EB 4KJYA 3BI9X 2LVEA 4H8WH 4HIIA 4N90D 4F15B 4C4KT 1IZJA 2V5MA 4OQ1A 1S7WB 3SGDI 2BY3A 2XQBL 1CFQA 3FO0L 4N0YH 2O5YH 4X5XB 5A3IC 1NUDA 1OP5K 2HVJA 4GRLC 4Z77A 1TTUA 5IT2L 1ZT7B 4MD5B 5EU7E 4EOWH 2DQTL 1EXUA 3BEWA 1U91A 4PJXA 4X9HA 2XYCA 2A6IA 5CSZA 4Z7UE 3ZSTA 2DBJA 2X10A 1T1ZB 3PWLA 4O2EB 1MHEA 4JM2D 2KUTA 4JRWA 2D7TL 1AQDA 4YBLC 3IJHB 1HK6A 2A38A 4P46D 1XCTA 2X70B 1J8HA 3H9SE 2C4FU 3VE0B 1D6VL 1QPXA 3VXTA 2LABA 4ISVA 5CD5C 5EOCH 1G7QA 1O7SA 2C3XA 2R0ZL 1IGJB 3HPJB 3RWEA 4K9EC 1JFQL 5ERWA 4X7SH 4KI5D 1WZ1H 5D72H 1TLKA 2B1HH 2HFEA 4HUNB 1NFKA 4H0GA 3SQOH 3V6ZA 1ED3B 4J3OC 4X99B 2WP3T 3UJJL 5DFVC 1FPTL 4GRWE 4PJ9C 5JUEL 2VLJA 1X4XA 2DF3A 4X9BA 2BVYA 2Y36L 4S1SH 2CIIB 1C08B 2D4FA 5HYJD 5IW3A 4PJEB 3VI3F 5MENA 4HIEB 1BWWA 2AEQH 4G9FE 2I9LA 3QDJE 2D9CA 3IXAB 3ZLQC 3UPRB 4S1RL 3EFDL 3QUYD 4BQCA 1N5AA 3GMOA 1G9EA 5E03A 2ZUQC 5A16B 3VRIA 1BEYL 1S5IL 2GT9A 4EUPG 2WWKT 1AXSB 4E41E 3CFCL 5DWUH 1K85A 4Z7WF 4P23C 4WO4B 5BVJB 4PG2A 3L3HB 3DV6B 4RFEA 1XEDA 1VGEH 4FXKA 4PYGA 3D18A 4YHYC 4TYUA 1FH5L 3MRPA 1T66C 4PJXE 5FYKU 5IB3A 1DL7L 5LWYL 3S6CA 5FB8A 1MF2L 1RUKL 4DWHA 3BP4A 4O02H 3RVXC 2Z35A 4YHIB 3ZT5A 3P73A 3DVNB 2DRUA 4C59B 1UXSA 4MXVE 5D7SH 2X1QA 2GCYA 4OZHF 4BA8A 1BBDH 1CI5A 3QIBC 3UO1H 3W9DA 1D5BA 3BPCB 2EH8L 3GMLA 1I1AA 1RIVH 4K3EH 5A2LH 4HUXB 3TWCH 3I9GH 3SHSA 4XCCL 4GLRH 5B3JF 1Y18A 1DBAH 4TUOA 1F4WL 2IAMC 4HUUA 2BOBB 3ZE0E 1V7NL 1PLGL 2DJUA 4RIRA 5D70H 1T4KA 1HHHB 5ENWB 3HI5L 4X80L 5K9QG 2NCMA 2WIIB 5ACZB 3CDFA 3HG1A 4LVHB 2GSIA 3MRCB 3I02B 2HLAB 1C5BL 4YDVB 5AWNL 5GS1B 4HFWB 2PW1A 4MA1C 4IRJA 4PGCB 1JWUA 4CVZB 3GMMB 4KHTL 5JLZB 2D0FA 3L5WA 2EIZB 3LAFA 3WIIL 2NYYC 4S1QH 3O45A 1MI5D 3SDYH 3I6GA 3WLWC 2JTDA 3B8SA 5DC4B 1KLUB 4I48B 4GRMB 2VDKL 3ULVL 4OZGF 5H94B 5ISZD 4EDXB 2R8SH 3H9YA 1YMMD 4U1SB 1BVKA 1QVOB 4KTEL 4F15C 5C0BA 3T2PA 5E4IA 3GBML 1UB6B 3BW9A 5EOCJ 1KB5H 1VHPA 1JTPA 1LEIB 1WBYA 5E5MB 2H9GA 3CXHJ 3QHTC 5E94B 4I8DA 4HMEA 1TVBA 5ALCL 3FFDB 4Z8FL 4MNHB 5KBNC 1L7TH 2EYSB 1AKJD 4M61A 4OZHA 2HT3D 1YN7A 3KJ4B 2CJUH 5EBLA 3UEZA 1JPTH 4H20L 5BS0B 1CGVA 1OW0A 2EYTA 3TO4B 1MIMH 4JO2H 5I0DA 2N7AA 4KJQC 3CDYA 1H5BB 1MCLA 1Q1JH 4O58H 1E4XH 3QJHA 2I07A 1XZ0B 4XPFH 2MWCA 5FYJU 3UYPA 4O9HL 3CAFA 2ZSWB 2F8VA 1ODAA 2V17H 5BZDB 1QSFA 3QEHB 1M05B 1NC2D 4QGTA 1PJ9A 4WI7A 2DN7A 3VI3E 5HYIA 2M1KA 5SWZE 2WIMA 1A47A 4IJ3C 5F6HI 3HAEA 1XGPA 2RB8A 5C09B 4DTGL 5I1DA 1MLBB 2DIBA 2YPLB 3S88H 3QDAA 5F6HJ 5IEKA 2BNQB 3GSOA 3KPMB 4Z7WE 1DN2A 1KOAA 4OZFB 1R5IB 1I3RA 5E6IA 1NGQL 3FRPA 1UCTA 1UVQA 4PG2C 4QHUA 1UM5L 3A0OA 3ZHLA 4K7FB 4JRYB 2QR0A 2D03H 3HLAB 5KTEL 1LEGB 2GAZA 3VXSE 1XGUB 2E27H 1VGKB 1WFTA 4UMGA 1LO3H 1RULH 4HXBL 3SDDD 4OZHE 5IQ7L 1U3YA 5J3HC 3GJFB 2BVQB 4HC1H 1UQSB 2C9AA 5D5MA 5ELIA 2E7LA 5CP3A 1KGCD 4UNTA 4LEOB 3TBTA 5B3JE 5F97E 5JOPE 3IAGC 1IGCH 3LOWA 1NLBL 4O4YH 1I1AC 2JK5A 3W5MA 4F9LA 3MRRA 4ZTOH 4NT6B 2C3VB 4PJIB 4XC3H 3G6DL 3S4SB 2G2RB 3T8XA 4LP5A 4JG1H 2JB6B 4J4PA 2AABH 2VDML 2EE6A 1MNUL 1CXKA 3NPSB 1EPFA 4OF7A 1W0YT 1A7RL 4YBQD 2P24B 3ZKQD 2ZPKL 4LVHC 3N85H 5FK9B 5DMKA 1AE6L 2V9RA 3NCCB 3QFJD 3KPSA 2A9NH 3QIUD 1W0WB 4ENED 4BKLB 5F96H 2LU7A 2D4DA 2BJML 4CNIA 1AP2B 3W0WB 4Y5YB 2G75B 3PDDA 2OTUB 1YEEL 4K8RC 1NCCH 1XGQA 3RUGA 3SY0A 3CZFB 1CXEA 4ORGB 2D0HA 1NMAH 4M7KL 1ZKAA 4M1GH 5K9KB 3QEUB 4UDTA 2R0KH 1C16A 3SGEH 5HI3C 2ID5A 2X4NB 3D69A 4PD4J 3JSSA 5D2NB 5GRVL 3MRLB 5JPMB 4NFCA 5E1HB 1HHGB 4QRPA 1NFIB 2EDTA 5C0IB 2Q7NA 1Q9WA 4AIZB 3QFDB 4BFEA 2DQCH 2V2XB 4XBPB 2VXSL 3BMWA 4PBWD 3CVHH 2A0LC 4HIJA 2XTLA 2NXZC 1NLDL 3RWJB 5ID0B 3QNZB 4OF8A 3KYKH 3WN5B 4GO6B 3ULVE 5FHBH 1JYWA 2F54D 3KJ4C 1XH3A 5BV7L 3NPZB 3O2VH 4OLUL 1OW0C 1U36A 4KUZL 5KJRL 1ZT1B 2XWTA 1DEEA 2P8PA 4PLJC 1A2YB 1FL5B 3OX8A 2WINB 5T1DH 3T4YB 3W81A 1WIOA 4OSUL 3BXNA 4GKNA 1NAKL 1I9IH 5HVFB 1CFTA 2DQEH 2QBWA 2FYYB 1PZ5A 1MCEA 4RBPH 3RUGE 1MRDL 1QYGL 2H6PA 1SBBA 1MFCH 4U3XA 3QXUA 5KVGH 5JW4R 3MLTA 5JTWA 1D6EA 2VZTA 4OCMC 1OTTD 4WEUD 3RU8H 2VLME 1DLFL 2P43B 2IQ9L 4RBPK 2OBGA 3RKPA 3V5HA 5I18H 3ARWA 2XN9A 2V7NB 4FHBD 5ESQA 4ELMF 5EU4A 3CNKA 4PB0H 5IB4B 4NJAH 4X7TB 1IAIH 4LVEA 2HYMA 5E6IC 1ZVSB 2Q86B 4KVNL 2IFFL 1YY9C 1ITCA 2FEEL 4JM2F 1KC5H 4N8CL 2JIXD 4OLWL 5F72S 3C5ZA 5I8KH 4TRPH 2R2EB 4U1MA 3P0YL 3TLRA 3NCMA 1U8LB 3QXTA 4MXWL 4WCYL 3RWFA 1ZHBB 1CD8A 1X4ZA 1DQLL 1FHGA 2FX7L 5C0EA 5I1KH 4QRRB 5B38B 1R24A 3R0MA 3O4OC 4WDIA 1JNNH 4XCEA 4I3SL 5DTFB 1PSKL 4LCYB 3KYMA 4YX2H 3HE7B 4P5KB 3LSOB 4MQ7A 1D3CA 1FCCA 4NUGH 2HG5A 2H26B 2AXHA 2ZSVB 1VFUA 5KS9A 4G80A 3FKUS 3TBSA 2BSRB 4NKOA 4DW2H 4HLJA 5HI5C 2EXYC 4UZGA 1S7XB 2HJFB 4JCMA 5IMLB 3P11H 1DZBA 3QWQB 2VERN 1ZAGA 1JCKA 2P5WA 2XNAA 2WWMC 1L9MA 4ZUWB 1S7VB 4JFXA 2DD8L 4BM7A 4JFQB 4WWKD 1BD2B 1VADA 3ARED 4MD0B 3CSGA 4BSVB 1INQB 3PUCA 3KYOB 5KSAA 1REIA 3V52L 4IOFD 4Y5YC 3NZHH 4EXKA 5FHAH 3HFMH 1T04A 4LLQA 4ZUVB 1N2RA 5E08H 1Z2KA 3O4LB 1E28A 2HWZH 2NY7L 3MLPA 1D9KA 3ARFB 4HUKB 1ONQA 1MFNA 1SYVB 3GJFH 3U4BH 5B3NA 3MXWL 4NRZB 4PJBF 4WHTA 4KK5D 3DVGB 5D2NC 2ESVD 4PJCA 3S35H 4YAQA 5LXGL 4NWUH 5C0RL 4UT6H 3Q1SL 1TZHA 4NKIL 1YA5A 1GL4B 4ELKB 1I1FA 5AYQA 4ONOA 3ULUL 4J2XA 4KH2A 1Z9SA 3EOBB 3SDCD 2R1YB 4OD1H 3VFSA 2VR5A 3M17A 3TIDB 2A9ML 1YEFL 1CK0H 1DANU 5JXEC 5IV2B 1ZSDA 5LCVH 4L8BA 2UVEA 5ICZA 2B2XL 3CFDA 3IJSB 5BMFH 3FT2B 3TGXA 1LDPL 2Q20A 3D2UA 1BM3L 2VXTL 3MRIB 1F5WA 3O2DH 3F7YB 5DUML 2VUYA 1CG9A 2YHGA 2AKRA 3S37H 32C2A 3DO7B 2XFXA 2VN4A 5EDXA 4G9DA 3OPZL 3KLAA 5D7IF 4HK0A 3EFFA 3ZKNC 1T20A 4RGNE 1N0XL 4J23A 5C0AA 1BQHG 2Z31B 3BYTA 2RHEA 3QEQA 5IBUB 4FFWC 1HHJA 1JBJA 4XXDA 4XPHH 2LU4A 1A5FH 5CLTA 2EDRA 4I5BB 1KLFA 3HS0B 1JGDB 4APQA 3RKDC 3MJ7A 2AK4D 4ZMAT 1BX2B 3C2AL 1I1CA 2C4XA 2EDKA 3IAQA 3PIQB 2IPKB 3VFOA 1S7TA 1ZS8A 1QFHA 3HNSL 1IM3B 3P77A 4IDLA 1LP9A 3EYSL 3QQ9C 1W72H 4EIGB 1PG7L 4PS4L 1MCNA 4AEIH 5CZVH 4ELME 3B9KD 3DYOA 2ITCA 1QUNA 3KPQA 2IBZX 2MHAB 4JRXB 3SPVA 5CGMA 3U7WL 3LPGA 5L7XH 4WUKH 2GFBA 1KXQE 3LV3B 3EHBD 3OGCB 3HMXA 4PREB 5FO7A 1I3UA 3VU2A 2FH6A 1CWVA 1FE8L 5ITBH 2VE6B 3FB7A 3DMMB 4U49A 1CVSC 5I1JL 3VDCA 2NPLX 5EN2B 3HPLB 1HSAA 1P7QA 5IG7B 5EULV 3EW3B 4HLZG 5IF0B 5IUSA 2G9HB 2X44D 5C1MB 4GXVH 4KAQL 4I2XB 3V0VB 5D7JB 4EI5B 3P9LB 2UYLA 5FA3A 3AM8C 4FFVC 3GEWB 2AK1L 1I3VA 3QB7C 1X7QB 2E3VA 4LDEB 5FA4B 2GK0B 5DRXB 1G7JA 1AXTH 4RWYL 1BOYA 4XCNB 4ZAKA 5J4MA 3HE7C 4LBEA 2LVCA 4P2RB 2WLZA 5FCUH 5HYJE 4Y7MA 3RFZC 1BFVH 3RL1A 2Q8AH 4DEPB 3NABH 2X5PA 1K8IA 3FONA 4ZPTA 5HYSB 4MQXD 1KCUL 3LKOA 4Y19D 2JB5L 3BRFA 1NAML 2ERJB 1MJ8H 3TZVB 1U41A 3O8XD 1WFNA 1GPOL 3RWDA 4P2YA 2IEPA 2CXKA 4P4KB 3SKNA 3MRNB 1L0YA 3UCRA 3OKKB 2XRAH 3GJEB 4LSSH 3LKPB 3X11A 1AGFB 3W2DH 3MUGB 4RA3A 3ELAT 3TM6A 3FQXA 4HWZB 3KNBA 3G5VB 5ESVA 3S5LA 2AI0L 3CXDH 2IALA 1NGWB 1EUTA 3WDJA 3UMTA 1EMTL 2P45B 2HA1A 5DMIH 5C71A 2ARJB 2IWGA 2ZP0T 4P3DA 4RFOH 5HI4C 3VXOA 3KWWA 2CRIA 2D2OA 5HDLA 3WNMA 5JZ7D 1A1MB 3IDJB 1JUFA 3LKSB 4PJBE 4F57L 4IDJL 2WMPA 1TZIB 1GHFL 1D9KC 1GOFA 4NN7B 2L7UA 3D3VA 5DRNB 3BJ91 4G6JL 4HH8A 1H3PH 2XY2A 4HPOH 3B2UD 3NFPB 3C08H 3HE6B 1KXTB 4EN3A 5IBTL 3TT1L 5D8JL 2IG2H 3MLZL 3H9ZA 1XAUA 1K4DA 5GZOC 1RZJH 3BQUA 3KG5A 4IRSD 4Z9KB 5E95B 3R4DA 1JN6B 2HKFL 3K7UA 3VG0L 3D5OF 4ZOAA 1KPRA 3L9RA 2C1OB 4YUEL 3UJIL 4JFZH 5KANG 4OKVA 4X6DB 1HILB 4LRIA 4Y4HA 2CLZB 4HBQA 3ES6B 5D7IE 4HH9B 2OYPA 5DHVA 3M07A 3H9HB 1CE1L 3QNYB 4U31A 3C8HA 5C0CA 2EEAA 3G04B 5D1XB 1MI5E 3RHWK 3NBNA 1H3XA 4XTRC 3O3EA 3ULUE 1QBLL 1CL7H 4LF3A 2ED7A 1QFWH 4LSDA 1OAKL 1JYXA 5ISZE 4Y16B 4Y1AB 4OF5A 5D1ZC 2QADC 3HRPA 4JPWL 1UENA 2VQ1A 1FNSH 2RGSA 3DXAA 1WVZA 3PGCB 1ZHNA 5DO2D 3D3VE 1T7XA 2WQRA 4C55A 2B1AH 3L1OL 3O11B 3LHPL 3AMKA 1PKQA 4BQ9A 1KNOB 1M7DA 1YDPB 4WTZG 1NBVH 4HG4J 5I16B 3ILQD 4P48A 1DQMH 1XGYH 5I1HL 3PJSA 1CXHA 3CLFH 3PXJA 1MEXL 4DGIL 3QWOA 5GGRB 5EWIL 5GGTA 3T1FB 5KSVB 4HKJA 3QJFB 1YQVL 4X83A 1DN0A 1JZ5A 4KK8C 1XF3A 4OV5A 1DQDH 3LDBC 1OM3L 4LLUB 2J6EH 5KVEL 1NAMA 1QA9B 3HC0B 1KG0B 2X89D 3DGCR 4FQQB 1Q72H 1KT2B 3PGDA 2HTLC 4UIMB 1J11A 2DQFA 5DF0A 2P47B 4H1LG 5D1QB 5H2BA 4U3CA 1AC0A 4Y2OA 1HQ4A 4MX7A 4Z5RA 1FO0B 2O5XL 3GSNA 4D0BB 4XPTL 1KEMH 1PKOA 3IAPA 1O7VA 1ZGLA 3MV9A 3MLXH 4U6VH 1UA6L 2Y6SD 1ZTXH 1RFDL 5KVDL 3BKML 2ERJC 2PYED 3JTTB 2OXHA 2XV6B 3CUPB 2BVUA 2CMRH 3MYZA 3LKRA 1B4JH 1HHKA 3GKZA 3MBXL 2H2PD 4V1DA 1X4YA 3BMVA 3VDBA 3TVMA 1IC1A 4LRNH 2YXFA 3BESR 5JMRA 3MRBB 1FRGL 3ALXA 3P9MA 4DN4L 3EDEA 1HKFA 3CFBB 4PGEB 3LS4H 2EEDA 5F88A 3MR9A 5JO5A 4A6YB 3S35X 1WEJL 4P9HC 2X4OA 1FGVH 3VRLF 3QH3A 1EFXB 1QNZL 4NN7C 1KGCE 4MA3A 5TF1H 3I6KA 2WAHA 2I60L 3PP4L 2AJUH 4HCRA 5EBGA 1EAPA 1TCMA 5IW1B 4XP5H 5DQDH 1N4XH 1CLOH 1A1OA 1HNFA 3HE6C 4OFYD 4EN3C 4HS6B 3RWIB 1OT2A 1CL7I 4Q9QH 3ARDA 3PP3H 4ERSL 4X98A 3IU3A 3MV7B 2FJGB 5D7KD 3Q6GL 3IYLW 3BQUC 3WJJA 5EZOH 1QKZH 4R8WL 1A4KA 3QG7L 2ZCKL 3PP3K 5HJ3B 3S37X 4NO0A 4NZJA 1WTLA 3DUUA 4IRZL 2OR7A 4LRIC 1JGEB 2V9QA 4LVNB 3P0VH 4RQQB 1VACA 1KN2L 3VXMD 2OQJA 2Q7YB 2L0DA 1L6XA 1LEKB 1AO7A 2OR8A 5HHMB 1JK8A 3ZT6A 5CINH 1P4IL 1KJ3L 1NCNA 1E27A 1U93A 1YEJL 1LO0H 5D1XC 5JR1H 1NMBH 5JHDA 2XZQL 4PTUA 1G9MH 4O2CB 5INCA 4ZQKA 4Y16C 2C4FT 4ESKA 5TE7H 5FDWB 2HT4C 2VZSA 5HYQB 2FR4B 1HIMH 5DHXB 4P9HH 1GC1H 3ALWA 3UTSB 3WLBB 2H2SC 3VXRA 1C7TA 4LHUD 5F3HB 1DBML 2WBJA 3MYJB 1A1NB 2FH8A 1OT1A 4YO0B 3NCBB 4UT7H 5EORH 3ZTJH 5IFJA 1KSRA 3GSWA 4KGLA 2NTFA 4Y5XA 3MV01 3MJ6A 1T6VN 3DX7A 1IRAY 4DZBA 4GW4A 4WVRA 1Y0LB 5TQ2L 8CGTA 2OL3H 4AH2B 3QO1A 3S3SA 4R4ND 3VGBA 5DHYB 4P5MA 1EEQA 1Y6KR 3X13A 3QQ3A 1XT5A 1SMOA 5T33H 2BXZA 1V5JA 4RMQA 2ADIA 4Z7OE 4ONFL 5C70A 3PWUB 2J4WH 3RTQB 5E99L 5I17B 5IVNA 1ZA3B 2QQLL 5IFHH 2H32A 3O3AA 5GJTL 2DYPA 1RZ8A 4Z7UB 2OJZH 3RGVD 2I9TB 4KQ3L 3TJHD 5CEXB 1U8OB 1MWAH 3M1BB 1UH4A 1XMWA 2VZVA 1ACYH 3EO0B 4XC1L 5D1QC 3KXFD 1N7MH 4O5LH 4OTXH 4NQDD 4FQ2L 5EIVA 1RZIB 5JPNA 1NDGA 1FL3B 15C8L 2CDFB 3H9SB 5CZXC 2CDGA 4U1JA 2DL2A 1DUYA 1JVKA 4GXUN 4QXTB 4QTHB 3RPIA 4LCWA 2NX5D 3DGGA 5KOVC 4L8SA 1YNKH 1QFUH 3MRMA 3VXRE 1I7ZA 4M3KB 1PEZA 4GMSH 3UZEA 2MPAH 3F8UB 5CJQH 1YEHH 4H25A 1LO2H 4P5TD 4CUCA 1FVCA 4CMMA 1XIWB 1GJIA 3C6SB 4LARL 4G7VH 3V7MA 1C5CL 2D7PA 3S3JA 4NHCH 5E24E 3MQIA 4KJYB 5ETUA 2P8LA 4G9FB 3QDJB 5F7KC 4TOYH 2R23B 4M1DL 3VRLE 2PO6B 2CK0L 5FM5M 4WI8A 1R5VB 4FFZH 3BDXA 2PR4H 4PV9A 2ZCHL 4E41B 1HZHH 1O5DT 3HI6H 2FSEA 3B6SA 4RZCB 1CFNA 2LAGB 3ARBA 4G8GD 1JGUH 4RDQF 1GYAA 4QEGA 3MBED 5DD1H 5J0BA 5CSZB 3BVNB 2XKNA 1XR9B 5I74B 4QRTB 3QYCA 5SWSD 4R26L 1KIRA 3ARDC 3B4NA 3VFWB 2DJSA 4HK3J 5A1AA 4XVUC 1FO0H 3F6IA 4HKBA 2SEBB 4GMTH 1TJGH 5I71B 3KGRA 3WJJC 3SEPA 3TJEH 3DNKA 3T0EA 3QXWA 3QULA 3FQWB 5H35A 1K2DA 1VCAA 2NW3B 4LCWE 1AGDB 5FV1L 4WW2A 3RA7H 2FWOA 4OZIF 3K0WA 4N0FA 2H8PA 1CQYA 2GJJA 4QXWA 4F58H 4G8FA 4JFYA 5E70A 1Q9OB 1G6RB 1ORQA 2IH1A 1A6WH 2HH0L 4P2CG 4P2OA 4KY1H 4PTTB 5DJDB 1FFPA 3RIAF 5DUBB 1OSPH 3VJ6A 4FA8A 1ZK9A 2DIJA 1NH6A 3BKJH 7FABL 1JNHB 3CC5B 2VC2H 3FMGL 5MP6H 1MFAH 1T7WA 5FM8A 4A6YH 1RZKL 2IPUK 2XXCB 2AJVL 1EHLL 3VMPA 3WO4B 3FB6A 1NGXA 1AGEB 4POYA 3MROB 1F4YH 3LKQA 5HGDB 5HHXL 4R9HA 4XMPH 2WBJC 2OX5A 4DKFL 3BRGC 5C0GA 5C3TA 1B90A 1CGYA 4Q9BA 4Y5XC 3IDIA 4MDIA 4LPCA 3GSVB 1BVZA 2EDHA 3BWAA 2R29H 1SMAA 2F9BT 2XPGA 3T0EE 4G5ZL 1W0VB 5EOQH 1MIEH 1ZHKA 3OJDB 3RZWA 1ZLSL 3GMLB 4WRLA 4Y4FA 5LAXA 4MHHG 1QBBA 4JB9H 4NSKA 3C6LB 2VYRE 4JFEA 1YYLH 3O6KH 3D9AL 3FJTA 4WO4D 4AMKH 5D93B 3A6BL 4X0KA 2Z8SA 3WUZA 4NHUB 2Q3ZA 5DS8A 3PL6A 4PRPA 5JA9A 4LASH 2AGJH 2G60H 2Z8VC 4HV8B 1GVIA 4PRIA 2J8UF 2ZKHH 3G9VA 4PRBA 1OLZA 2GKIA 3G9AB 2VDRL 4AG4H 3FQRB 4NQUA 5DRZB 1B9ZA 1DVFB 1FFNB 5ESAA 3HZYB 1BFTA 1DJSA 2QV2A 4QCIA 1CFSB 2PN5A 4JDVA 4YFEA 2YS4A 1YEIL 5KAQG 3BO8B 3I6GB 5BRZD 1I7TB 1FNLA 5D71L 2UWEF 2YPVH 5IKCB 1NCAH 4M5YL 4MDJB 5SWZB 1UXWA 1OF2A 1XIWC 4QHMA 4M7LH 2YD3A 1OGAD 3BGAA 1I7RA 4I18B 4M4PA 3UTTA 2YUXA 1T6WA 5MEQB 1JF6A 1A14L 3GK8L 4PJGA 2WV3A 3OTTA 2P8MB 2YMXL 4Z7WB 1U95A 4NQEE 5CIPB 1KCVL 1UACH 1RUQH 5DK2A 4PGDB 3GMNA 3GSUB 3CJJA 1JNJA 4JZNA 4JO3H 2AQ2A 3ARQA 1FFRA 3FFCD 4ODUB 4ODTH 4YC2C 4L3EA 3ARBC 2Z91A 1HXMB 4JFEE 1XCQB 1OAZL 1EGJA 3HMWL 3W11C 3VXSB 2DQGL 4WFHD 4YDJB 2VISA 4Q7DA 3CSYB 3AAZA 4HHAA 4M48L 4DQOL 1YMHB 3INUL 3DX6B 4OZHB 1FG2B 5ADPH 5I71C 4Z95H 3H3KA 4FQJH 3FOMA 2XA3A 2EYTB 3UTZA 4PJDF 3O41A 3IGAA 1BZ9A 1T5XA 3PHOA 4KDTC 2G5BA 5F9JB 1G9NL 4OZIE 1QSEE 4LVOB 3HCVB 1IBGH 3DROB 5E8PB 4L9LA 5ANME 4ZS6C 3WS3A 2ZUYA 3MJ9L 1P2CB 3MODH 1WBXB 1YPZA 2C5DC 4G6KH 4LSVH 5LBSL 3NTCH 4GRWH 2P5EB 4GW1B 1JZ6A 4P2OC 1DBKH 3UJTH 5DJZB 3RP1A 3T2NH 5J06A 3NFNA 4FN0A 1XGRB 1FZJB 4JDTL 2QTEA 3C5SA 1X6LA 3U48A 3ZTNL 3C09B 5TF0A 3MA7A 5BS0D 3HAEG 5E5RB 1KEGH 3TO4D 5J13B 3OZ9L 4M02A 5I75B 4OZFG 3VXPB 4K23H 4LDLB 3WL9A 4LPXA 4OZGB 2DAVA 3MO1B 3SGJA 1IGIH 2VDOL 4FTVE 5JNYB 2FO4A 4OB5H 5BO1H 1J1PL 4HT1L 3FO9A 5E4EB 1EH9A 2OCFD 1WICA 2IQAA 3PV6A 1OAXH 3QZWB 4P2QD 3VFVB 3L6FA 3U79A 2FATH 3ALPA 5DEFA 4YDLB 3UTPE 5C09D 2YRPA 2Q6WB 3MV8A 3PQYA 5T3ZL 2Z92A 5DT1L 3G6AA 3AXLB 4XVSH 3C6LC 4YDIH 5IQ9B 1G6RH 1FP5A 3BP5B 3OXRA 2VAAA 4L4TA 4WNQB 5ILTL 4JQXC 3IF1A 1KPVB 1E6OH 4Z76A 1NBZB 5D93C 3CU1A 4PR5A 2J8UE 3NGBB 2NXYB 3PL6C 4GW5A 1WBZB 1SEQL 2VXUH 2YD9A 4X5WA 2IANE 4TSAH 2VABA 2CUMA 3LN9A 1L7IL 4XVJH 1I8KA 4WEMB 4X8JB 3TESA 4Z7QF 3KAAA 3SBWC 3MRJA 4LGRB 5CWSA 5IFAH 4F37K 3ARUA 3JVGA 4DGVL 4U2YA 1IL1B 1I3GL 1DUZB 3CVIH 5CZKA 3OKDA 1RSFA 5EG6C 2UWEE 3MACH 4P9MH 1IE5A 4PRHA 2CGRL 5I1LB 4RMRA 4HS3A 1FAIH 3EKCA 3R8BB 1QHPA 4RMVA 4KZEL 4ODSH 4I18C 3RX7A 3VFMA 4UT9H 4YK4B 1U8PA 5JQ6L 4QO1A 4ZFGL 3BDBA 1XGTB 1NBYA 3P4MA 2C1PA 4S2SB 2F53A 5DD6B 1PYWA 5IVXA 5JW5A 2F5BL 2GI7A 4XWOD 3PQYE 4HUWB 1FN4A 3LPWA 4JLRB 4KKBC 1MLCB 3IU4L 2FX9H 1NFDA 3ULSB 5DJ0B 5DLML 4F7EB 3W0WD 2DQIH 3RVTC