1IFHH

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhH01
3EO0B 4YDIL 1MCLA 1RZIA 5D7JC 1AKJD 4JFEA 1HI6A 3BH9A 4NQDA 3OKOA 1NMBH 2VLLB 5T1LA 3ARXA 1AQKH 1SJEB 3CU1A 3W9DB 5K59F 3IDJB 1RHFA 1FGVL 3NFNB 2Z0BA 3ZHKA 3OZ9H 1KCVH 3CVHA 3B8SA 3JWOL 1U8JA 4QHNB 5JOFB 5J7CC 2AK1H 4PR5A 4OZFB 1Y6MR 4WIQA 3REVA 1WBXB 2WBJD 4QOKA 3ZT5A 4JFFB 1YQVH 3C8DA 2Z31C 1FYHB 5J8OA 3OKMB 4P5TB 1MVUB 3I75B 4YXLL 4M9PA 4M6ML 3C60B 3T0EE 2A83B 5C9JB 3Q5YA 5C0EA 3QDGB 4YFLF 2XKSA 3QIUD 4G8GA 5D2LB 2VDNH 3UEZA 6FABH 3J8F7 1DQJB 1ZANL 3FO2A 4OFVA 4OFIA 1BAFL 2CJUH 3V4VL 3TZVD 4MXQC 4OCNC 4ERSH 4FQ2H 4M6NL 4WWKC 2NR6D 3X11B 3VD9A 2XY1A 3KXFA 1C5BH 1Q9KA 3VFUB 1C08B 3PGFL 1HILB 3U1SL 1JPGB 1CK0L 3EOTL 2P49B 3FT2A 4FQXD 4GMTL 4ZOBA 2H6PB 5C7XH 1OGAB 1SY6L 1EERB 2OI9C 1U8HB 5MEQA 4R7NA 1SJHA 3HG1D 3K1DA 4FMFA 3NIFF 1PLGL 3MV8A 3PWPD 3NZ8A 5DURD 4D9QD 4DGIH 2D0GA 1U3YA 2IPUG 4PJBA 3O41B 5GGQL 4G8IA 4HZAA 5DI8A 3ZTJH 3RU8L 1T66C 4F2MA 1NBVL 2QEJA 4JQXA 2JK5B 5F3HA 1P2CB 1U8LA 2OXGA 1FFQA 4OF6A 3PGCB 3MQIA 2BFVL 2DYPB 4CN4A 3JVGA 1JYXA 1DLHA 3NMEA 4LNRB 2LAGB 3O8XC 5EZJA 3ARTA 5FGRA 1I9RH 3GJFK 4OGAC 5C07A 4JGMA 2ICES 1RJYA 4KKAC 1UM4H 4Y4KD 5KJRH 3FQXA 4Q74A 1J8HE 2VQTA 4MA1B 3TP4A 2FSEB 1G9NH 4PJXF 4O2FB 3U46B 5F9OL 4WTZA 4JRYA 1K8IB 3QISA 1M71B 3EJZC 3UTTA 2MSPA 1PQZA 4Z5RA 2ICWJ 4JN2A 1K8DB 4I4WA 4LLYA 3P9LB 1RZ7L 4HWNA 4TOYL 1FVCA 5IESL 1MFDH 3RVWC 5C6PB 3EFDH 1KN2H 4XNZC 1G9NC 4BZ2H 5TQ0H 5HYJD 1R5WA 4HCRH 4YR6B 3KYAA 1S8DA 4KZEL 3CLEH 1J1OL 3BE1L 5D1QD 1RK0A 3QQ3A 4LQ1A 3GMMB 1IGIL 5L7XL 3RA7L 5T33L 1RFDL 2IANB 4Q6YA 1LEGB 4K55A 5D7JB 3VFTA 4HMEA 2JKXA 3IDIB 4PGDA 3ZDZF 2DIAA 4OT1L 2R56L 1JBJA 4U1LB 1AR1C 4X98A 2PO6A 4ZXBC 1YY9C 1VFAB 4QXGL 1HHHB 2OP4L 4WCYH 3QULB 3QUKA 3B2UC 2X4QB 2YPVL 2WIIB 1MJ7H 1NAML 5D7KD 1SEBA 2ZKHL 4NCC2 3D85B 3RL1A 4WHCA 2IQ9H 4XAWL 4PLKC 3EJJX 1NAKH 4KJYB 1GC1C 3WE6A 2ADIA 3TFKD 4GSDL 5J9PB 1G7HA 4J3UA 4POUB 5JOEA 2ZJSH 4W6YB 4WTZG 4GFTB 4R90L 3LDBB 5F97E 1HINH 1BJ1J 3UPRB 3T0WA 1I1CA 4A6YB 3C08L 1Q9LB 5GGTA 2YZ8A 3FOMB 3ULUL 43C9A 4UOJA 1OD7A 3E6HA 1XCQA 4PRHE 1T89C 1NC4B 1NBYB 2FSEA 3QDGE 4JM2B 4MDJB 4MDIB 4JFEE 4GMSH 5D70H 4FTVB 3TO4A 1JMXA 1AI1H 1H3TA 1WCBA 2VH5L 3NPZB 3QAZC 5IWLC 5GGSA 2WQRA 4JZOA 3TA3D 4XCNB 1KC5H 1SEQL 1IQWL 3PL6D 1J1PH 2ESVE 1I1RA 3LV3B 3HNSH 5JIIA 2CQVA 3VRJB 2DQEH 2XI9A 5C2BH 2N7AA 4M7JL 4XRCA 5B8CB 3MRDB 5L2JB 4RFOL 4NUJA 5HDQL 2EXWD 3KYNB 1CLZH 2X5PA 4NKMB 2X7LA 5T1KD 5DJ2A 1ZAGA 4PJGB 3DUSB 1ZMYA 4MHHI 2OLDA 2JJVA 1J1XH 4NKOB 5DMKA 3TNMB 2B4CC 1H9VA 5T1KA 4RFNB 2HVJA 2WUCH 4CKVX 4QT5B 3BWAB 1ZHKB 5FEBA 3BPCB 3MTRA 4JZJB 4PJAE 5KVGH 3RGVB 4KZDL 1Z5LB 1KCVL 3V0WH 1TJIH 4LIQH 3SDDC 4Y2DD 4D9QE 3JWOH 1RU9L 4LRNH 5FHBL 3S35L 4LCCB 1EZVY 1WAAA 2ILLA 4XVTL 5HHOE 1YEFL 4WWKB 2XZAH 5HGHB 4PUBL 3JTSB 3WXVL 5KVDH 1EBAA 5GGRY 1QACA 1UCBL 4M6MH 3VGHA 2H41A 4ODXA 3O4OC 1WICA 1KOAA 2VR4A 2X4OA 4WHYH 3E3QE 3WUWA 1X4XA 4D0DB 3Q5OA 2OR8A 4KRLB 4NQXA 5M95B 5I15H 1K4DA 5EFIB 4LHUD 5EPMB 1RMFL 3V4VH 2KDGA 3NBNA 2B1HL 5ACZA 4P3CH 1UQSA 3V6OE 1UKSA 3SQOH 4JKKA 4G80B 4TTGA 4FQ2L 4M6NH 1LO0H 4I77L 5DRXB 4H25A 1XF4B 2Q20A 3ARGA 5I1AA 3UBXG 3UAJD 4PJIF 3OG6B 3CC5B 3TBTB 1S9KC 3EOTH 5KTEH 4PJHB 3AGVA 5J1AA 4PFEA 4MNQB 4P23B 1MHHA 1CD1B 5LBSL 1XH3B 4DEPC 2BRRH 4AEFA 2VXUH 2MHAB 4FFWC 4FFVC 4NBZB 3GSWA 5KSVB 5C0FB 1MJJB 1GZQB 4ZYKA 3LIZH 3SJVB 5IHBA 2RAMA 4JFHD 1ZHBA 1NBVH 5DJXB 6CGTA 2FHBA 3DXAB 2CO7B 2L7JA 5E4EC 4JVWA 3R06A 3FO9B 4GAGH 1MCIA 4HJJH 4HS8L 4KPHL 1MCFA 5ITFA 3GSOA 4JQXC 3O6KL 5EIIB 1UM4L 4I9WD 1YMHB 4GW1A 3AS3A 4OZFA 5IVXB 2JJSC 5F9OH 2VRAA 3SE3C 2BCKB 1A7QL 4JFFA 4U6TA 1SYSB 4PJCE 1ODAA 4D8PB 4FQHB 3X14B 5C08D 2MCPL 3ARPA 4P46B 4XCFL 2OK0H 5C0RH 5DUBA 2V5TA 5SV4A 2R9HC 3SDAC 2XTJC 2UV3A 3BZEB 1Q0YH 1B4JL 2O61A 5TQ0L 2IH3B 1FSKB 5HI5C 5H94B 3CLEL 3QXAB 1J1OH 3BE1H 2A6KA 4RWYL 3H0TB 3WO3B 3NPSB 1IGIH 5C0AE 5F8QC 4JFOB 2X4QA 4Z78A 1DZBA 3OXSA 5FM8A 1KG0B 1OSPL 4X7TA 4JG1L 3X3FH 4ZAKB 3BW9B 3DYOA 3BSZL 4PBWD 4OT1H 2WWMC 3GEWB 4JFHE 3MBED 2YA0A 3GMLA 1M4KA 4JFZL 4PLJC 3NZ8B 1XIWA 3RWEA 4JFEB 1I4FB 4JAMB 3C6LD 5ESAB 4YEEA 5KSBA 4XWOC 4EXPX 2P8LB 1NAMH 1CFVL 1HH6A 4I0KA 4OCMC 5JXEA 1JHTB 3IKKA 2PCPB 4YBLC 3GSNL 1ACYL 2NYYD 5IFJB 1NGWB 4LHQB 5CBEB 2ZJSL 3GSRA 4R90H 4OIBA 5CLTA 1HINL 2NX5B 1K2DB 4N0FB 3F7YB 4Y4HB 3C08H 4OF7A 1BFVL 4KTDL 4XBPA 1BOGA 4NZJA 3EHBC 1Q9WA 1IGYA 5BV7B 5KSUB 1QA9A 4MXWH 1EK3A 1M05A 4MD5B 2B0SH 5E2TL 3QUYB 3E0GA 4GMSL 5D70L 1IC5L 1AI1L 4LCWB 5FYJH 5IB5B 3VH8G 1LEKB 3ARRA 4RDQG 1BLNA 5AZEH 3E6FA 32C2A 2Y07L 1FN4A 1R6VA 3N85H 3QEGL 5IOPA 4E0RB 4BKLB 5FKAA 3QEQD 4H88L 3CZFA 2ESVA 2FD6L 4MCYA 4NQEA 1TVHB 1U91B 2ZUSA 4PLNC 1CLOH 1ZHKA 1B4RA 1RUKH 3VWKD 5GRWA 1EFXD 4RFOH 4QXWA 1J8HB 3ILPA 1OHQA 3E2HC 2VR5A 4RA0C 3NACL 2DKSA 1A21A 3BEVB 2R8SH 2VKWA 3T4AA 1RZ8B 2OJZL 1QG3A 4AYFA 3HR5A 1UWXH 5F6HI 3JTSA 5D2NE 2DDQH 1CGTA 4GAJH 4JCMA 4KWUA 5DHVB 5DJCA 3IJHA 3UC0L 1QFWH 1W0VB 1CFTB 4Z7UF 1EFQA 3ARBD 1MHPL 1J0YA 1FZJB 1KIQB 1VKXB 5F7NC 4KZDH 4MA1C 4G7VH 4P0DA 2HA1A 5JZ7D 3V0WL 1TJIL 4LIQL 4J4PD 5BVJB 4K3DL 5FKPB 1VEOA 3NA4A 4XAKE 1RU9H 4LRNL 5FHBH 3S35H 3SCMD 1L7TL 1A22B 2X4NB 2NW2B 1A3RH 1NGYB 1OSZA 2VXVH 2XZAL 4PUBH 3JV6B 3WXVH 3GKWL 3QXDA 5KVDL 5DWUH 4F57H 4JJ5A 5CSBA 2DL2A 2IBBA 1X5XA 3QFJE 1INDL 3REWB 1G1YA 2OL3B 4Z76B 4NPYB 5D1QB 1H3PH 5GGVH 3W9EB 5GGVY 4PRAB 2K7PA 4PJHA 1U8IB 3RWCB 3T0AA 3SPVB 4R3SA 1LDSA 1BOGB 1QBML 2IFFH 5BRZA 5SX5K 3SQOL 5CJXA 1LP9B 4UBDC 4PPTA 3PG2A 3H8NA 4ZFFA 4AMKH 1F6AB 4N90D 1RJCA 2WSKA 1K4DB 3CDGB 1WT5C 1T6VN 2HFGH 3KLSA 3C09C 4OD1L 1S7XA 4JPWH 4IIQB 1FVDA 1YEHH 3MBEC 4ISVA 4LARL 3SGDH 3GMRB 3ULUC 1P4IH 3GKZA 2K1MA 3CDFA 1XGYL 5LBSH 3RVUD 2BRRL 2XQYK 1YEKL 2VDQH 5EORL 1I3RA 3MPCA 4YHLH 5DC9B 4RDQF 4NC1C 2C4FU 2R2BA 4K3HA 3QG6B 4RFNC 1RUMH 2CDFA 4LASH 3BRFA 3W0WB 1W0YT 3VWKB 4XH2B 4HGKC 4RGND 1RPQA 2DMKA 2KPNA 4XBGA 2QR0A 4HJJL 1X9QA 2ITCA 3O2DA 4KPHH 3EFFA 1YY8B 2Z91B 3BRGC 2F74B 4K2UL 4FRWA 3O6KH 1B2WL 5INCB 4YXHH 3CVIL 1FV1A 1IGFH 3QEQA 1NCTA 4HMCA 4YO0B 2IADA 5EUOB 2MQ3A 1SJXA 2X2YA 2V2WB 4TUKH 3QUMH 3C2AL 1YPZE 4WDIB 5D71H 5IG7B 5C0RL 4NO3A 3RTQC 2FR4B 2AJ3A 4G9FD 1R3LB 1KG0A 3QCUL 3TYFB 5MENE 2OMNA 3CSYA 4MGXA 3OJDB 5DHVH 1B4JH 2W9LA 5E94B 4U1SB 1I1YA 1MQ8A 5ERWA 1S78D 4CRPA 2A0LD 4LCUA 3UTOA 3QWOB 1LNUA 4AENA 1KCRH 3VFPB 3QA3B 1LP9A 1I3UA 2D31A 1X7QB 4Y8AA 2QV2A 3RVTD 2XNAB 2IBZX 3AVEA 1OT2A 2KL6A 4OUOA 4KU1A 3LPWA 1A6ZA 4YGVB 2Q8AL 1X4ZA 3IKCA 3FOLA 1X5IA 4EXKA 4K23L 1HYSD 2YPLD 4E41E 3FAWA 1OWWA 2YD9A 2YN3A 4N68A 1T1YA 1FFOB 1HHKB 3MV8E 3MA7B 1IQDA 3X12A 1NUFA 3SKUD 3VRLF 5C8JB 1CFVH 3OF6A 1B90A 4X8XA 4D3CH 1XIWD 1JPST 2VLRA 4BH7B 1SYVA 5BV7H 4MXQD 1MCWW 4P23C 3HAEG 4PJ5D 5EO1B 3T65B 2FBJH 2YK1H 3IFLL 1HSBB 4KTYA 1JUFB 4WW2A 4YDLB 4EDXB 1P7QB 3O3BB 4PRIB 3A6BL 3WIHL 1BFVH 3TNNB 5KW9H 3O3EA 2FYYA 1AP2A 1JK8B 5J13C 3UJIH 5IF0A 4WHYG 3UBXA 1KCUL 4NN5C 1IVLA 3LHPL 4ODSL 1PSKL 5ALCL 5KAQF 4P99A 3UTQB 1J8HA 5FYJL 1F4XH 1YEDB 2W60B 4PJHF 3VWKC 2Y07H 3RUGE 3FFDB 3BP6A 5BO1H 2V5MA 5IJVB 2IPTL 1YEGH 2HKHH 5ID1A 1UZ6E 2VZ1A 5GSVA 2UY7A 3VXOB 3MUHL 3G9AB 4JFFD 2YD5A 4MNHB 3NIDE 3PF2A 1CBVH 1D9KA 1M6OB 4R4ND 3VFSB 1CE6A 2FB4L 2N4IA 4HUWA 3AY4C 1I1AB 4BK4A 1OOAA 3VFMB 2FGWL 2E27H 3OKNB 4NKIH 1FH5L 1FSKC 5AD0B 1F11A 4ZFZB 4IDJL 2ZUXA 4YGVA 3R06B 1Q9KB 5IBLD 3UC0H 3U9UA 1AD0B 5HYQB 2QLVB 2LE9A 2X4RA 2DIBA 2PCPA 4G7VL 5EB9A 2VDRH 4QEGA 5F1NA 4ZFOA 5K33A 3FQTA 2C3XA 3ARDB 3CMGA 1HE7A 2NX5E 2Y72A 3IF1B 3QUZB 1CFTA 1FZMB 1OP3H 3TT1H 3HFMH 4YDLC 3C6LC 1HZHH 3KLHC 2N7BA 1OP9A 2LFGA 4KUZL 4MA3B 4P4KA 2XKUA 1IEAB 3U0PB 1T0NB 5GGVL 1QSEE 1BVKA 4C83A 3E6HB 3U9PH 4LLMA 2EH8H 3SBWA 1GPOH 2FYYB 4KKBD 3WIIH 2GJ6B 4K7FA 3L3IA 4MCZB 5DGQA 3BGMA 3HZYA 2VQ1A 3EYOB 3B2VH 5CD5C 3H9HB 3H0TA 4AMKL 2A6IA 3KPSA 3HZKA 3WIFA 1FG9C 5D7LD 2NY6D 1P7KA 3LEYL 4E0RA 1RSFA 4L3EE 4BQBA 2JJWA 4JPWL 2WINB 1BFOB 3MLWH 5A3ID 1KEGH 1P4IL 5A40E 5F3BA 1L4IA 1XR9A 2D4DA 2JB5H 3DGGA 3P77A 3CXHK 1YEKH 2VDQL 1DANU 5CP3H 5ID0A 4PY8I 35C8L 4JAMA 2X4UB 3VXME 4YHLL 4FP8L 5KSAB 5TQ2L 5JA9A 3DWTA 1RUML 4OCSL 1NCWL 5MERA 5ALBL 1HEZA 5C9KA 3IDJA 1ZT1A 1CFQA 1HOCB 4HD9A 3LRGA 2PF6A 3MC0A 1M7DB 1D6VL 2Y7QB 3ES6B 5FV1L 5IM7B 1IC7H 3T2PA 2OZ4L 4YXKH 5FO9A 3ZKQD 4Q9CA 1TZIA 1UCTA 1B2WH 1IILE 1MREL 2ZSVA 3BFOA 2GSIB 3QUYD 4L5FH 1U41A 3CVIH 5HYQA 3Q6GL 4U1GB 1IGFL 3MLPA 3D6GA 4HC1A 5I18L 2RBLA 3DX7B 4XZUB 3QUKB 3QULA 1INQB 1FFPA 3QA3A 1NDMB 2I9TA 4KKAD 5HYFA 3MV8D 3UROR 3JUYA 5CGYC 2IADB 2XWTA 4WV1B 1IEAA 5HD8D 2UYLB 1CIUA 5ENWA 4HBCH 5D1XB 4XPTH 2JJSA 3CDCA 3QNZA 3PJSA 1OAKH 1DQMH 1KCRL 5IQ7L 2Z31B 4KI5C 43C9B 2ZP0T 1EO8L 1AGBB 3U48A 4ZOAA 3LZFL 5I1DA 5CKAA 2QSQA 7FABL 4HKXB 4UB0H 3VWJC 4DUXA 3STZB 3K81A 4X0KB 1EIBA 5TH2B 3B9DA 5EOTB 1NFDE 5DQJB 2JTDA 4AK1A 1JF5A 4HLJA 3STLA 3DGGB 3P77B 2XWBB 1OY3B 3WS6C 5F7HA 5DUPH 1FO0L 4LSTH 5E1AB 1QD0A 2I9LA 2Y06H 5D5ME 3DVIA 3REVB 3C6SA 4D3CL 3S36H 2ARJA 4MJ5A 4Z7UA 1MF2L 1ZVSA 5HJ3A 3IFLH 4PJ8A 1KENL 1H8NA 3WIHH 2P43B 5KW9L 3SDDB 3WEXA 4PRAA 3HZVB 4PJAB 2P5WA 3OR6B 4NM4L 5CEXB 2F53A 4ODSH 3F12B 1S8DB 4M43L 1HILA 2MQCA 2EDJA 1N8ZB 4YHIB 3FT2B 2NY3C 1TJHL 4K94H 3D69A 3D39B 5BO1L 3VXMA 1XGPA 2GITB 2XXMB 3RPIB 1E28B 5J4MA 1EEZA 2DLGA 2DQCL 1RIUH 5CGTA 5GS0L 4AM0A 2DLTA 5EC1B 1ZA3A 4O51A 1FNGA 4RFEB 4ZO6A 3MBXH 1SBSL 4IOIA 4TSAH 5CSZA 4XCEA 4ZD3H 3FQTB 1VADB 2E27L 5IMMB 4ALAH 1I9JL 2JF1A 2G5BB 1XIWB 2ZUVA 2IJ0C 2H32B 2YSSA 1GAFH 2PW2A 5EZOH 1BF2A 1I4FA 1V05A 1S7VA 4IDJH 2QQLH 3IXAA 4JO4L 3LPFA 5F9WB 4OM1H 1PEWA 1SHMA 5CFHA 2ZUQB 2OJEA 1CDCA 3ROOB 3FFCE 5J6GA 1BD2A 4PJ9A 1NANI 1R24A 2I9LB 2P45B 3K2UL 3PWUA 4M7ZC 1D5MB 4OZIF 1YN7B 4Z8FL 3ELAT 3MGOB 1P7KB 1XGTA 2XICA 2CKBL 2NZ9D 4HKBB 3LQZB 2R69H 1KPRB 3A6CL 3MROA 3ALXA 5IROA 5DMYA 4XMLH 3DXAD 3QUZC 5HGDA 2H1PH 1GPOL 5EZIL 4WW1B 1ED3B 2V9QA 2W60A 2DLIA 5CIPH 3S5LG 1OPGL 2VIRA 3FMGL 4CU7A 3H6JA 3VRJA 1AXSB 5CEXA 4KRPC 2HN7A 3SBWC 2WK2A 3LEYH 3P4LA 4DTGH 2COQA 2DQDH 4OGAD 5BV7C 4JKPH 4CVXA 4PGZA 5I1HL 1NDGB 2NCMA 4OQTL 1ZVYA 4C56A 1PZ5B 3GIZH 5DT1L 3BMWA 3RUGF 4EI6B 4OD2A 1A47A 2GJ6D 1JMZA 5EU5A 1DP0A 4FP8H 1FL5A 4WTWA 1L7IH 5FV2A 4JPKL 4TNWF 1MCEA 5CJ8A 3JXAA 3W2DL 1NCWH 4L4VE 4JDVA 4FABL 5AD0A 3IU3A 4IOIB 5L8KB 2YMXL 1JWMB 5FK9B 1QYGH 1IAIH 3CFCH 1PBYA 1D6VH 3FB8A 4G6FB 5J56B 2FH8A 1IC7L 4YQXL 4EN3D 1QKZL 1AIFB 1R0AH 4DN4H 5A3IC 3TVMA 4L4VD 4L5FL 2LABA 2W59A 4LNRA 5I1GL 2XT1B 1KJ2H 1C1EL 2X10A 1TQCB 2UY6A 2HT2D 3K80A 5DJXA 4OZ4A 4Y16A 4OZHA 3MRGA 1GOFA 1X5HA 2BJMH 3HAEB 4HIXL 4DVBB 1P9MC 2VDML 1BIIB 5E2VL 3I2CH 2OL3A 2AI0L 5EO9A 1I8KA 4JE4B 3NPSC 3UTQA 4QCIA 4A6YL 5FECB 3G5YA 1XF2B 1T83C 3RZCB 1YMHA 2L0DA 4GW1B 3VH8B 4IMLB 3GIVB 5E4EB 3VWJA 3P0YL 3O6FC 1N5YL 3TPUA 1LE9B 3H9HA 3QFJA 1WFUA 3TBTA 4OZIE 4MSWB 5IB3B 3P9MB 2MPAL 5EOTA 1OAKL 1VEMA 5IQ7H 3QUYC 3ZL4L 2VXQH 2VN4A 3TIDB 1EO8H 3SE3A 1J87A 3MYZA 4K9EC 4OCRL 4TUJA 5C0CB 2IGFH 3LZFH 4NKDA 2Q7NA 3SHSA 2YD1A 4ELMB 1F3RB 3S88L 3PJSB 4XP4L 4NUGH 2R0ZH 1VESA 4OLYH 3MRJB 4I3SL 2X1OA 4J3WA 4H0GA 3RY6C 1H8SA 4YZFF 3WDIA 4PS4H 1M1SA 4XH2A 3CZFB 5HGHA 2Z9TA 3BW9A 4P2CG 3S36L 1ZLWH 1UYWH 1CVRA 5F1NB 3FB6B 2AXJA 3CXDL 5B39A 2DWEA 2HJKA 5AEAA 4QRPE 3V5DA 1G9ML 5HHQA 4RMRA 3L7FA 4XVUC 3NZHL 5I9QC 4H1LH 4YIQA 5T3XL 1EGJA 1O7VA 1BEYH 4XB7A 1X5KA 1LVEA 3MR9A 2X4SA 5JPNA 4A2LA 3BUYA 4LIQE 1JI2A 5GRVK 3FOMA 1WCQA 2BOCA 3TYFA 1GXEA 1JNNH 2P5ED 1RHHB 1XCQB 5IEKA 2P48B 5MENB 1DFBH 3X13A 5ICZA 3VDAA 3FFCA 1E4XI 1MHHB 2O26U 4AQ1B 1T20A 3RP1A 3MSPA 3REWA 2DQCH 1X5GA 2OX5A 5LVEA 1RIUL 4LLWA 2AXGA 3KYKH 2W9DL 2EIBA 1B6UA 3ET9F 2WQ8A 3HMXA 1GCFA 5D1QC 2G75B 1T5XA 1X5AA 25C8H 4LGRB 2R15A 4PBVC 1I7RB 1SBSH 4MNQD 4P23D 4TSAL 3MRFB 5KOVC 1M7IA 4NFBA 4Q9RH 5C71A 2BNQE 5DD6A 4JFDE 2ZCLH 3G6JA 1WZKA 5HD8C 2QQLL 3HB3C 4HFWB 4KKLD 2E7MA 4C4KO 4MB5A 2A9NH 1I1FA 4B53A 4Y2DB 4M93B 3CXHJ 4UAOB 2WIMA 3VWJD 4POYA 1OQOA 1ZV5A 4XNXH 2VLLA 5T1LB 3WFHB 3DSFL 3TCLB 3S98A 1X6LA 1QLFB 4H1LA 1T80A 4IRSC 4HEPG 3OHXB 1WBYA 4F15B 5DRZB 5E8PB 2IG2H 5F9JA 4YHYB 5JNYB 1U58A 4BZYA 4Z8FH 3ROOA 5KVFH 3E2HB 4MZ3A 4X7DC 5J6GB 1FYTA 4L9LB 5IR1A 4L4JA 1EH9A 3TYGL 2VLJE 5ANMA 1U8NA 2BNRB 4UDUA 4XMLL 5E8EA 1I8MA 1EXUB 4IRJA 1K8IA 3BIKB 4I3RL 5GGSY 3FMGH 3UTTB 5I1JL 4JFPA 3TM6A 1EUUA 4XMPH 4PTTA 1S7RA 5GQBA 3T0BA 4Y5VA 1A6AB 1MWAA 3IU3B 2NPLX 4X6EA 2C4FT 1ERNA 5FGCE 4FG6D 4KV5E 5CGMA 4M93C 3HCVB 1MFCH 2DWDA 2Z92B 4KDWA 4R26L 3EO1A 3TPKA 4PIRF 1NGZA 2E7CA 2HKFH 1OT1A 4Z0BL 3FL7A 4LEOA 5M94B 4GAYB 2GYSA 4PG2A 3ZKND 5TF1L 3LN4A 1L7IL 3Q6FA 3AAZA 4L8SA 1MCPL 4PP1C 3IJHB 1NDGA 1RZGB 4U4BA 1CD1A 3W2DH 3RDTD 4ELKB 2HG5B 3Q1SL 4LCUB 4M6OH 3D48R 2BXZA 3LN5A 1FVDB 3BYYA 3RL2A 4G42B 3VGFA 1A3LH 3BVNA 3MO1B 1WUNT 5J1SC 1BZQK 3RIAF 3GSUB 4XCYB 2VERN 1HHGA 3MREA 3F58L 4KKLC 5F3HB 4FQCL 5IFAH 3MUGB 4OM0L 3HB3D 4Y7MA 2YWZA 1ETZA 3G9VA 3MLXH 3ORJA 1C1EH 3IJYA 3VXMD 4L1HA 5DD5H 3QO0B 5IB5A 2WWKT 2QSCH 3HNTL 1T5WB 5E2VH 5FDYA 5EBLB 2YS4A 1NCBL 2XRAH 2Q76B 3MLRH 4GKOA 3OHXA 5D2LA 3S37L 2Z91A 4Z18A 1Q0XH 4JN1H 1OP5K 3AFLA 4XI5D 5CEYB 2V5SA 1UWEL 3MLVL 1KB5L 2G60L 4HWUA 4NFCA 1QR4A 1BQHG 3P0YH 5EBWA 3PP3K 3O8XD 1JUFA 4MD0A 3ZYOA 5FF6A 4P2OA 2OR9L 1I8MB 3OMZA 1U8JB 1GGBH 1T7ZA 3GJFB 4PR5B 5DFWH 4KVCL 3HLAA 4OZGF 1H0DA 4KTEH 5DD1L 5MEOB 2QSTA 5F1SA 4EQ2A 4P2OD 4TNVF 4XP4H 3I84A 1QSFA 3O8XA 4F7MB 4PJEF 2R0ZL 5CD5D 1A64A 1YDPA 4I3SH 4FOMA 1HQ4B 3G5XB 3QI9C 1EA9C 2QR0B 3O3DA 4N0UA 4XVUD 4ZUVB 3MLSH 3QFDB 2LV4A 3RWEB 1NGYA 1FPTL 2BVOB 3CXDH 1I3VA 3DV6A 3V0AC 1NLDH 4X9IA 2BOCB 2RR3A 1RV6X 3B5GA 4ETQB 3GRWL 2FO1A 2E9BA 1F00I 2P5WD 3FCTB 5T3XH 4Y4KA 2R4SL 2AJSL 4LVOC 3H9SD 3UZVB 4X6CB 2RGSA 3ULUF 4HUKB 3PWPB 5DURB 2VAJA 3JWNC 3BPOC 4ESKA 3M8OH 5DO2D 4QNPF 1XEDA 1P7HL 2LVEA 1P84K 2CRIA 2PXYB 4RAUA 4XVSH 1H5BA 2ERJB 3RDTA 3QDAA 2XZQH 4DOHE 1WEJH 1WFOA 1YNLH 2P8PB 3NCJH 3QQ4A 4F58H 2JB6B 2CDEB 4PP2B 4ZSOE 3RUGB 5GPRA 4GXUN 5DD6B 3BKYH 3HN3A 3MCKB 3QIWA 1IZKA 2Z35B 4YDKH 4OLZH 1D5ZB 4CN1A 1CDGA 3H42L 1AHWA 2EDOA 1CVSC 5HYIA 2NY3B 2CKBA 2OCFD 2F5AL 3VFVB 3BKJH 2NXZC 4LVHB 1DBKH 1NEZA 3AS1A 4UAOC 4WV1C 3I9GL 3N06B 5D8JH 1DVFA 4X98B 3HUJA 3GSVB 2EDYA 5EG6C 1T04A 1B3JA 2YXFA 2ZCLL 3WIFB 2HLAB 3VFGL 4LBEB 4OCXH 3HS0A 4CGTA 1ZHNA 4GKNA 1DVFD 3VMPA 3EGSA 5EOQL 5BS0B 2DTSA 3T1WA 1QZ1A 1YDPB 3C5SA 4Z7QF 2EIDA 4XTRC 3O3DB 1RY7B 4N0UB 5EZLA 4LSVL 4XNXL 3DSFH 3VD4A 3AREB 5CJQH 4JZNA 3PL6B 1I7UA 2X4PB 4JO3H 2GIYA 1JK8A 2VR9A 3HA0A 1A6PA 3RVTC 5HJ3B 4GKZA 2G2RA 3VGBA 3KYMB 3WLWC 1BJ1H 3TV3H 1FGNL 4QRPA 1OSZB 4NRXA 1FNSH 4TUOA 5IW6A 1UC6A 3TYGH 2HTLC 3O3UN 4Z7UE 2E6PA 1T7VA 3Q0HA 4G8GB 4ZOCA 2FO4B 1PDKA 1K85A 4U6VH 1YA5A 5DR5L 1QEWB 4PRPB 4WUUD 5IMLA 2ZSVB 4LLUB 3VXQB 1JNLH 1G1CA 2HMID 5I17B 4ELMF 3C8KA 5C1MB 2OS7A 2A9MH 1S7QB 4KKNA 5D2NA 4GRWE 3V9FA 3VXSB 1G7HB 4KI1A 2X42A 1PJ9A 4NRZA 3IRPX 1QFWM 3VJ6A 1JPTH 1G6RH 1EBPA 2ITDB 1I1AA 1T2QH 4LVNC 4G9FE 3ILQD 1KFAH 3N0PB 1XF4A 3RVXC 1MFCL 4R26H 1VENA 4PJXA 5DJYB 1E4XH 4RMQA 2VYRE 1MRFL 1U8PA 4XCYA 1GSMA 2P8MA 3MV8B 5TF1H 1YMME 1A2YB 4U1JB 3B9KB 3MUGA 2P5EA 3HMXL 3SDYH 2VDLL 3Q1SH 1JGUL 4MZ2A 2YA2A 4M61A 4HLZG 3HPLA 3DTXB 2R2CA 2X4TB 5AYUL 4KGJA 3D85D 3KPSD 3QDJD 1MNUH 4EN3B 1JZ8A 5T3XE 3VI4E 2HRPL 5H35B 5JTWA 2F58L 1U8OB 1KXQE 3QNYB 1BPVA 4FQCH 5IF0B 3KPNB 3UTZA 3CFJB 1AO7B 2E7LC 3QJHB 1TVBA 3V6BR 3AXLB 4G6MH 4MJIA 5DRZA 5E8PA 1RUPL 2G9HA 3BDYL 4LDOB 4XP1H 2ZPKH 4BYHA 5D7IA 1PD6A 4HX1B 5E6IC 1KLUB 4YHOH 2QSCL 3HNTH 3LKSA 3CX2A 4NDMA 2VMFA 5IM7A 1NCBH 5IFJA 3MLRL 5D5MF 1Z9MA 5IVXA 3QWQB 3S37H 4N0UE 4CW1B 3TBVB 1Z3GL 1E6OL 2HFFB 1WF5A 1AY1L 3BXNB 1UWEH 3O4LB 2GQHA 3A0OA 4LHJB 2EO9A 5TDOA 5DRXA 1MIEH 2C7UB 2XZZA 1C7TA 1CLYL 5IQ9A 2VB5A 3CH1B 1FZKB 1FNAA 1QLRB 4OIAA 1AGEA 4X4ME 4KVCH 3MZGB 4K7PY 2AQ1A 1EHNA 4WEUD 4D9LH 4DUVA 1F11B 4ZFZA 2YD4A 1BLNB 3VFPA 2FBOJ 3HRZA 5C09B 5HGBA 1DDHB 3KJ4C 3QFJD 5HGGS 1OVZA 2AEIT 3RHWK 4JRXB 3ARBC 4QLRA 1FQ9C 3MLTB 4R97B 3TBSB 4V2CB 4CMHB 3HG1B 4X7FC 3MLSL 4KQ4H 3KAAA 2W07A 4U1NB 1A2YA 4U1JA 2ICWB 4TQEH 4DCQB 1FPTH 2BSRB 3QRGH 4FFZH 3FT4A 4YBLB 4IRSA 4XXDB 4MA3A 1NLDL 2I5YH 3U0PA 1U9KA 1WV7T 3GSQB 4MNQA 4P23A 4AEHL 1U3HA 2R4SH 2AJSH 4Q6IB 3MRGB 2EDWA 3BHBA 4WU5A 1IGTA 3T4YA 3ZYIA 4DN3H 3M8OL 2BY2A 1NGPL 5BOPA 2J12B 4Z7UB 3O3EB 2QQNL 2BC4B 3FT3B 3GBML 4U05A 3OR7B 2H26B 4P9ML 4RQQB 3I50H 1K4CB 4HX1A 2X40A 3DV4A 3PXJA 3B3IB 4UIKL 1FYTD 5F21B 3D0LB 3MRRA 4P2OC 1AFVL 5E6ID 4MAYC 5JDSB 1T0MA 3IXTB 1G6VK 3V2AR 3SQBA 1TJGL 4MD0B 1JHLH 1J5OL 1P5UA 3BKYL 3FONA 4JFOA 4FN0A 1AH1A 1PEZA 4O58H 3C5ZD 3LQZA 5I75B 4LEXH 2F5AH 1W72A 1WAAF 1DBKL 5EIVA 2DRUA 3SDAB 1E4JA 4LP5A 1HSAB 3PWNB 4M1GL 4NKDB 5JPMB 3I9GH 1NCAH 1CXLA 1QLRA 3AAZB 4MNHA 1C12A 3G5VA 4MCYB 4NQEB 3ZYZA 2X1PA 2ATKB 1IEHA 3LKNA 4OZGE 3IDUA 3RGHA 1VGKB 4G43A 2UUDH 1MWAH 4WI2A 1ORQB 4P49A 4R2GC 5EU6A 3WUWG 4R97C 3GDBA 3MMEA 4S11A 3U4EB 1MLCB 1UKTA 2P24A 2QSVA 4KRNA 3B9KC 4GKNB 5CJQL 5I66B 4J1UA 2BOBA 2DQGL 4JO3L 2Q1EA 1BD2D 4PJ9D 3SDDA 4HEME 4GLRH 4UT9H 4RMSA 4PJXE 1GGTA 4Y4HA 5LQBL 1FC2D 4MAUH 4B7IA 3P0GB 1PKQE 4OLVH 1FNSL 1NJ9B 2X4NA 1VHPA 5IHUL 5L2KB 4O00A 3L5IA 2G2RB 5EU3B 5A2LH 5DR5H 1G84A 4NZTL 2FJGA 1RJYB 3MRIB 4ZPTA 1A9BA 1IGTB 4ORGB 3T4YB 3SDXE 1LO2H 2GFBB 1BZ7B 4RSVA 3NCYS 4P59L 1D9KD 3MXVH 4WFED 3CNKA 3EJZD 4PJEB 4RGOL 2JJUA 1BIIA 3P9LA 1KFAL 2D0HA 4YDVB 4G7YL 2AJYL 5JUEL 1OAUL 1CG9B 3WHE1 4UV7H 1E4XL 3CMOH 1W0WB 4BQ6A 2V7HA 1FNEA 5EIQA 4XPAH 1KJVB 2LAAA 3MRFA 4JY6B 2Y36H 1LO4L 3O45B 4K71C 4KROC 3UP1A 2GKIA 1FLTX 4L9DA 1LEKA 2Q6WB 1EHLH 2BP3A 3JZ7A 3LKSB 5AYUH 4HW6A 4WUUA 4QHMA 3D0VB 1LO5B 3VG0L 3C5SB 5I71B 1EFXA 2HRPH 4HPOH 5DC4B 3SGEH 1ZA6B 2DQFA 4JG0L 4U1LA 2V17H 2W1NA 3GMQA 5JIPA 3QUXD 3RWFB 3MRBA 2AVGA 1MJUL 4LLQA 4N0YL 4MXVE 2ZCKH 4YEFA 1EAJA 1RUPH 1NEZG 1NCDL 1B0GA 4PJBF 2GSIA 4YHOL 3OKOB 1LE5B 1KACB 1UB5B 4XHQA 2KUTA 1NMAL 3DRQB 3H3PL 3MJ7A 3PP3H 3O2VL 3L3JA 1Z3GH 5IV2B 4K3EH 1L9MA 1AY1H 1ZT7B 3QWRD 2MWCA 2VDOH 5KSBF 1QFHA 4EBQH 4ZS7L 3NN8A 1MIEL 1OTTC 5JXEC 1CLYH 4HJ0C 1RK1A 4OZGA 1R3JA 4GXVH 1VADA 1Q1JL 1CXKA 5A43C 2V9TA 1KB5B 1HCVA 3BUYB 1DVFB 4LCYB 3MV9B 2W0LA 1VDGA 4PJEA 4YC2B 2JIXA 3BP5A 4OD3L 4WEBL 1MCKA 3T0ED 5HXMA 3WNMA 2P5EB 4H26A 5EU4B 1KCKA 3QIWD 4KQ4L 1KIPA 2E8YA 3VFUA 3WS6A 4G9FB 1KYOJ 1PKQA 1F6AA 3IDYC 4TQEL 1J86A 3VRIA 3QRGL 1YN6A 5JW5B 4FFZL 1YN7A 4NZUL 1TZGL 4PJ7A 5FA3B 1JL8A 1A6VH 2ADGB 2I5YL 3H9YA 4GRWB 3WNNA 3TWCL 5TE6L 4JDZB 4XP6L 1PVHA 3ALWA 1A9EB 1OAYH 4AEHH 4YUEH 2I26N 4P2RB 4QRUB 5B22A 3WFDL 2NY0B 5J6HB 4RRPA 3HZMB 4RAVB 2DLHA 4HC1L 5CEZL 4ZFOB 4DN3L 1UH3A 1NGPH 2E6QA 4LQFL 2Q76A 3GBMH 2QQNH 2HH0H 2DI7A 2DLFH 2ORBL 1TPXC 5T1DL 2EKJA 2F54E 4P2QB 4YPGB 3MJ9A 1A7BA 4UIKH 3OGOE 1MJ8L 5C08A 3QEHB 3MNVA 4XC3H 4KFZC 2F53B 2F5BH 4DFHA 3HKFA 2AKRA 1HNFA 1J5OH 2OQJA 1Z2KA 5FO8A 3I6LE 4NWTL 2VQUA 1YEDA 3SKNB 1YEIH 4U1IA 2A74B 4LEXL 4PJCF 4R4BA 3EO9H 1XCTB 1PGRB 2VLKB 5EU6B 4PJDF 3DYMA 3ZMRA 5D7LA 3L3KA 3V6ZB 3HUJF 1NCAL 4O5LL 2XTJE 3X13B 4TVPL 3QDJB 3ZE2F 1RJZB 1JGEA 5FUCC 1QSFE 5C0DA 3N50A 2IFGA 2ADIB 4LPCA 1CL7H 3T0EC 4DVRL 4D0BA 4KJQD 4O2EB 5IHZB 2V2XB 1BD2E 1VGEL 4OV5B 2HFTA 5KANG 4S1SL 2ED8A 3P11H 2CLVB 4HFUH 3TA3B 1U6AH 3DETD 3OBAA 5D7SH 5DK2B 3FQNA 3ZDYF 2OJEB 1I8KB 2NZIA 2JLLA 1A8JH 1KXTB 3N9GH 3VXNA 3LKRB 1CGXA 1AE6L 3C2SA 2DTML 2VSDA 3B83A 4K3GA 4MAUL 5LQBH 1FIEA 2XWJB 5I8CB 3W5MA 4U1MB 4XMKH 2Y5TB 5IHUH 4BZ1H 1BJ8A 4TVPD 2D0FA 3P4NB 5IEHB 2HFFA 2Y25A 2YR3A 1LD9A 3WLBB 4BM7A 5IEKB 1NL0L 4L8BB 3WMSA 3OR7A 3S96A 3O9WB 1NC2B 5ITFB 1ZGLP 3U0WH 1U93A 5LXGL 4WFGE 1A6TB 3LS4L 1FAIL 5BW7A 2LU3A 4P59H 4ZPVA 3SGKC 4JY6A 4AG4L 3G6DH 4ZS6D 1ED3A 5EOCH 2VOTA 3O45A 3MXVL 3BGMB 3HZYB 3ESUF 3ZDXF 2DL9A 3UTSE 1UM6H 1UVQA 4KRPD 4LKCA 4MQ7A 3O3AB 4G7YH 5DUBB 3NCEB 1E27B 2ZNXA 4U6XB 3ULVF 4UIMB 2XTJB 1GL4B 3CMOL 5CBAB 1IKFL 2R1YB 4GQ9L 3B9KD 2PW1B 1C12B 1J8HD 1J8KA 4J12A 1N7MH 4ZTOH 1A7NL 1GHFL 4UTAL 5I1KH 4QTHB 2HLAA 2V7HB 1J7VR 3F7QA 1EHLL 4U7MA 1H15A 2EYTA 4FHBD 1N0XL 5JLZA 5GHWH 4J8RA 3A6OA 4IRSD 2QKIB 4C59B 1H3UA 2IANE 3RTQD 1N3NA 4PREB 1MH5B 5IWLA 2V17L 3M1BB 4LSSH 2EYSA 4APQB 3D18B 4PJ7F 2NY6B 1MJUH 1QFOA 2ZCKL 3CK0H 1J88A 2V2XA 2MQ0A 5E6IB 3CD4A 1RHHA 3FN0H 4X99B 2W9EH 2X70A 4ORZC 1XF3A 1NMAH 1XGRA 2DQHH 4FQIH 1Z5LA 4WJ5A 2XIDA 3WN5B 3QH3A 3WNPA 5KS9B 3GI9H 1NLBH 3BPLC 2VLME 4K7FB 4MCZA 3L5WB 4C55A 1IGML 2V6HA 3V52H 2VDOL 4U1SA 4ONGH 4OJFH 3LOWA 4ZS7H 3V7AE 5DJZA 1S9VB 3PQYB 5DS8B 3VWJB 3R1GH 1Q1JH 4MNQE 4MSWA 4G8FB 4AEIL 1RZKC 4GO6B 2DD8H 4WUKH 1MSPA 4LAQH 3VJ6B 3MODL 4HDIB 2GK2A 4WW2C 1K5NA 3FQRB 2UWEA 4NJAL 3QO1B 3BT2L 3PWJB 4OGZA 2UWEE 4WI8A 4PY7A 4BQCA 1CS6A 2VE6B 4N0CC 5B8CA 2V2TA 3B9KA 4U6YB 4PYGA 5E8DH 3VXRE 4LVEA 12E8H 2ICWI 2LU7A 4N0RA 5IW1B 3DMMB 2DLEA 1A1MB 5GJTL 5A2KH 5F9JB 1ZLSH 1R3IH 4ZNCD 5TE6H 4XP6H 1INEL 1RZ8A 3TN0B 4KJYA 3KWWA 1HIML 3DBXA 4KJPD 4XPFL 5I1EH 4FQQA 1MH5A 4X80L 4HK3J 1HXMA 1YPZB 5HPOA 2QJDA 4HC1H 4LCCA 2C3GA 2DQIH 5JQ6L 3IVKB 3U2SB 4OKDA 2X89A 1BF8A 3CLFH 3S37X 1Q9LA 5F7KC 2F9BT 4P4RB 5T1DH 1WLHA 1MJ8H 4F33A 4RISH 4MJIE 1YYLL 1DEEA 2Z8RA 1TETH 2ARWA 2F5BL 3WBDA 2AEPH 1MQKH 3IDNB 1KLGB 1MIML 2WP3O 4HGWA 5I8KH 1UXWA 1GGIL 4ZUTA 5DMIL 2EDDA 4I2XE 4N8VG 2J6EH 4N8CH 4XNUL 1S7TB 1FNFA 2OYPA 1KB5A 2FX8L 5GS2H 4WUUE 2HFEA 4X4MA 4O5LH 2UZIH 3KXFB 2JCCA 3WIHA 4MLIA 3QFDA 1TENA 1YJDL 3HMWH 3VFWA 3W82A 4B5EA 4WY7H 5BQ7A 4G3YH 5INDB 4MNGA 2AJVL 1QHPA 3BIAX 2FX9L 1NFDA 2GHWB 4Y19B 4UDTA 1H8OA 4TNWK 3P4NA 5IEHA 2X4RB 1UA6H 1VGEH 5HYJA 4OBRA 2NTFA 1AJ7L 1S5IL 4L8BA 1NBQA 3WFEH 1TCMA 2E9JA 5D7SL 1ORSB 1SM3H 3O2DH 3DHMA 4HAGA 1NGQH 2IH1A 4HWZB 1B0RA 5DUML 1HXYA 2IAMD 1LDPH 1U8MB 3ARDC 1JWUA 3QHTC 3NGBC 3EGSB 4DQOH 1GOHA 4DZBA 3HE6C 4XMKL 3ZTJG 4BZ1L 4KVNH 5DK2A 5EBWB 3HR6A 3ZE0F 2PTTA 3SO3C 5JNYA 3SE9H 2Q87A 3FQXB 5KBNC 4EN3A 4PB9H 4WFHE 1LGVA 2CD0A 2BMKA 3NIGF 4QTIH 5JHLH 3WJJA 2R1YA 5ANMB 3DV4B 1IAOB 5A2IH 4JRYE 2ZCHL 3HZKB 4AG4H 1TVBB 1FIGL 4I0PA 5EO9B 2KZWA 5DQDH 1R3HB 1VCAA 1EEZB 2J5LC 3EDJA 5IW6B 3QZWA 1JNHA 3IB4A 4L29A 1P5VA 2YXMA 4JFDB 3RVXD 3EYFA 3TJHC 4Y5YB 3A67L 2LQRA 3ARUA 4CMMA 2EO1A 3BQUD 2MNUA 5BVPL 4GQ9H 4YHKH 5IKCA 4Z78B 5HHNA 1S7QA 1NKOA 3OR6A 4OFDA 2YUWA 4OZIA 3S5LB 4U0QB 1ADQH 4Y1AB 1LEGA 3MLZL 5D6CB 5C0AA 3WXWH 4CADA 4Z7NE 5BS0A 1EVTC 5C0DB 4HIHA 5I1KL 4OUUB 4HIEB 4NQTA 2J88H 5F1OB 2ZG3A 1KV3A 1DL7L 3DSNA 3E8UL 3RPIA 1ZHBB 3KR3L 5B3JF 4X5XB 4BFEA 3W81A 4HT1L 4JANA 3RWHB 1KELH 1CXHA 4BSJA 3T0DA 5CEZE 2CLRB 1FL6B 1FL3B 1CDHA 1YYML 1A7PL 4G8GD 4MXVF 1H3XA 3NTCL 1HHGB 3LH2H 3MREB 1T1YB 3MA7A 5CP3A 5JW3H 4J3TA 2IAMC 3VXTA 2W9EL 2EYSB 4XPHL 2PTVA 3CFEA 1D6EB 1T4KB 1K3IA 1CT8A 2NQCA 2O5ZH 4HS6A 1JWSA 3RUGA 4G6AD 2X41A 2WBJA 3C9NA 3MJ9L 4QOKD 2EIEA 1J0ZA 4ZFFB 3QEHA 4ONFL 4U3XA 3HAEA 5K9JL 3TJEL 4DVBA 1BIHA 4HF5H 2A77H 2BSED 5KOMC 5EU7C 1IGMH 4HJGA 4KJQC 3LMJL 2JK5A 1OF2B 1FC1A 1N59A 1RZJH 5DK3A 3GSNA 3L5HA 1PYWB 3VFNB 4PY7B 3SEPA 4I9WE 1G0XA 2GY5A 1FNLA 4RGNB 1JGDA 1PY4A 3ILQC 4CDHA 3JWDC 4DGYH 2IPKB 4NQDD 1FRGH 5L88H 1OGAE 2NNAA 5HDBE 3O6MH 4NPYA 5D1QA 4BA8A 4U0RB 4P2OB 1JN6B 4LAQL 3PWUB 4WUKL 5K9QG 3MODH 3LVEA 5CIPB 2B5IC 4OLEA 5E24E 1MRCL 4JRYB 3TO2B 2ZOKA 1TQCC 3BDBA 3BT2H 5FGBA 1KJMB 3K8KA 3IAGC 1I8LA 2EDRA 4PD4K 1ES0B 4Y5XC 3FB7A 1LO3L 4M48H 4WGWB 4J4PA 1UZ8A 3T0VA 1GRWA 1AR2A 2O93L 5E8DL 2AK4E 5TE7L 2FNBA 2MKWA 2Z93A 2A6DA 1JF6A 3S9DB 3QCVH 2IF7A 1KPUB 1P69B 2VE6A 4OGXL 3BEWA 2WM0A 4ONHB 3W9DA 3H7LA 1UG9A 2FRGP 5GIRB 5DHVA 2C4XA 4M7KL 4BUHA 2Y6SC 5SWZA 1CICA 4ODHH 1HIMH 1ZSDB 2IMMA 2CSPA 2O5YH 1D3CA 4P9HL 4XPFH 3GMOA 3KGRA 3FRPG 5I1EL 3VWKA 4IRZL 1MVUA 5MEPA 1MFEH 5BRZD 4F15C 3MX0A 5IP4A 3U30B 3WJLC 1R3KA 3UDWA 3OTTA 1F4YH 3F12A 3KLDA 1I85A 2HFEB 4QXUL 3F6LA 4Y4HD 4RISL 2YPLB 5KVEL 4ZPVB 1U58B 5INCA 1TETL 1C5DB 5ETUA 3RL1B 4LCWA 4FQXA 1KEMH 4M3JA 2YOCA 5FB8A 1FBIL 5E5MB 1NFIA 3MRKA 4KI5E 5I8KL 4EQ3A 3MRNA 4XB8A 4XNUH 2JJTC 1WQVT 3W0WE 4PB0L 2VLRE 4ZDHA 4JY5H 4UIMA 4BQ8A 1R3LA 4U3HA 5GRJH 1PY9A 3WKML 4A6YA 4LKXA 1N5AB 2BNQB 3ULVE 4NQVB 4RAHA 1JTPA 4JHWH 5E08L 3SKOB 2GTWA 4M7LL 1BFSA 3NCYP 3HMWL 2OTWB 4PRBA 4JVUA 4IOFC 2XA8H 3OAYK 2YSSB 1JGVH 4WY7L 4EUPH 1LNUB 4AENB 3R4DA 2R4RH 5JXED 1R5WB 4YR6A 5BS0D 4JDTH 3QPXH 1WCBB 1KULA 3FO0L 4QYOA 1FE8H 1VB9A 4NN5B 3C6LA 1MUJA 1UA6L 5FO7A 1VFBB 2DYPA 3EYQC 4PRIA 1CG9A 3WFEL 1BQLL 5MEND 1JRHI 3TIDA 2ESVD 4F9LC 3D39E 4F8QA 3BESR 1FZJA 1S78C 3EIFA 4NJ9H 4ZG1A 1NGQL 3IJSB 4P5KB 3LS5H 2I60L 4Y2DA 5DUMH 4NN6B 4LPTA 2PTUA 1JCKA 4UNUA 4O2FA 3ZDZE 4WFEE 1HXMB 4JFED 2Q6WA 4UU9A 1EPFA 2QBWA 4WWID 5C8JA 2GK0B 3SCMB 3KS0J 1E0OB 2Y7QA 2QADD 4OKVB 4PB9L 3IS1X 1LP9F 3L7EB 5F8RC 2X9YA 1HWHB 1BJMA 4QTIL 5JHLL 2EDXA 1Q94B 1DN0A 2APXA 5E6ZA 3MOAH 4EI5C 3MRBB 2PTTB 5E8EB 4LRIA 4NM8L 4F3FA 5DQDL 3DX7A 2OSLA 4ZAKC 3D25A 4LFHD 3RI5K 3L7FB 5GS1A 2IAMA 5EBMB 4OBSA 2J4WL 3A67H 5EULV 5HTSA 1I75A 1RIHH 1ZT7A 3GFUA 3L9RB 1J05B 4F9PA 3ROLA 5JOPE 3RQ3A 4QHUA 4L4TA 3TBYB 3RNQA 5D7LE 3DURB 3MLZH 3WXWL 5A2FA 4TNVK 4JDVB 5T3ZL 2GUOB 4NQVA 5C0ND 4YDVA 2OTUB 1C5CL 2YRPA 1G7MA 4ZNEA 1LILA 3RTQB 3KR3H 4JCLA 5I75C 1BQSA 4ZNEE 1WTLA 4HT1H 1RI8A 5IVNA 4WU5B 4F80A 4K3JL 3MV9D 3OX8B 3WO4C 5D4QA 3MOBL 1T5XB 4JM4L 4W6WB 3OJVC 2RFXA 1I3GL 4H26B 4NQSB 3NTCH 3LH2L 4UT7L 5C3TA 4HH9A 3GSUA 3GSXA 3QR2A 2OL3L 4M5ZL 3T04D 3I85A 3EYUL 4GG6F 2PYFA 2AV1B 4DOHB 4CDGC 4R8WH 1H5BC 3RDTC 3L3OA 5BZDA 4BK5A 3ZHLA 1DEEB 4QHNA 2D7TH 1P1ZB 1J0JA 2PO6D 3HC0B 3DECA 4NO0B 5CMAB 3SDAA 1EMTH 2B8OT 4XCNA 3L3GB 1I1YB 1R3HA 4MD5A 1QLFA 4H1LB 2QQKH 1CFNB 4YDIH 3V7MA 3R0NA 3UX9B 3VFNA 5I74C 1AGEB 2JB6A 4IOFD 2X4OB 3MRDA 4E42A 2ZG2A 4OLXH 1ZT1B 2FECL 5IKCB 2VQ1B 5E9DB 3OKYA 5ICXB 1ZS8B 3QEQE 1LO3H 3QXVA 1NAMB 5DVLA 4B50A 1PW3A 3ZT7A 5TE7H 2FATH 4W68A 1YQVL 4JFQB 3WDJA 3QCVL 2D7MA 2NTFB 3UTTD 4C57C 3QG7H 2VLKE 1RZJC 4JRYD 2AEQH 1SVCP 1FVEB 6FABL 3OKDA 2B7DT 1BAFH 4LPXA 4RWHA 1S7UA 1YNTA 3RZCC 5HVWA 2K7QA 4APQA 2ICEA 4IS6A 2Z31D 5J11B 1WVZA 1RULH 4CU8A 3RGVC 3LRHA 3SOBH 1P7QA 4H20L 4PJ5E 1L6ZA 3MJ6A 1JNJA 3G6JE 4LHUA 5IMOA 4I48B 1JWSB 3U1SH 4JPIB 4Q2ZA 1F4YL 4M5YL 1NBZB 4QXUH 3OAZH 4PYHA 2JJTA 2CLVA 3QH3B 3TA3A 1A9EA 1SY6H 5D5MA 3QDMD 1AGCA 3I3BA 1HH6B 5GRVL 4NN7C 5JQHC 5F1KC 1JHKH 1PLGH 5L6YH 4UQ3B 1FBIH 4P3WA 2YC1A 3RWGB 2DBLH 5I1AB 1KJVA 2YPLA 3U4AA 3UTPD 5BRZB 5AAWA 4MD4A 1CU4L 4JY5L 1JV5A 1U8QB 5GSVB 1CDUA 4XPBL 4UNTA 3BKCH 3X3GL 5CWSA 4OF8A 3QIWB 2BFVH 3GJEB 2C1PA 2AK4B 2KQNA 3U7WH 5E9DE 3QDJE 4G6AC 1HHJB 3DXAE 1DUYA 3ECBB 3L3DB 5C0AB 5E1AA 1LO5A 4M7LH 5DMJB 4IMKC 2F53E 3TZVA 2XA8L 4QRSB 3GMRA 3QNXA 2R2EB 2R4RL 3RHWF 2C3WA 5DYOA 4JDTL 4HFWA 3UJTL 3FO0H 4M8QB 3JUZA 2P8MB 3ARWA 4JDZA 1P4LA 1NAMA 3FO9A 4ZFGL 1BQLH 1L6XA 1SMOA 5CBAA 4MJID 1KLFA 4ETQA 1HHIB 1HHHA 1QSEB 1ZWIB 3EFDL 3G6AA 2HJLA 5JMRA 4BZ2L 4HCRL 2AXFB 4PV8A 4XX1G 2J1KA 3D85A 5IGXL 5LJYH 2A1WH 3K46A 3QPQC 3C6SB 3NIFE 3RA7H 3WFBH 4N8PA 4PJHE 2D9QB 3EYSH 2X1WL 1F3JB 4RA3A 3NABL 1INQA 1DCLA 2ADJB 1NDMA 2I9TB 4TSBH 1PG7X 2AJZB 3JV4A 4PJ8B 5I1LB 5F93C 4Y16B 5C3LD 4X9BA 3UTPE 3MRKB 4QXGH 1BM3L 5B21A 5FKPA 3ZKXB 3AMLA 3VXRD 2J4WH 1I1AD 3VFVA 5C9JA 1CGUA 2HTLD 2Z92A 3QDME 2G5BA 2ZKHH 2Y9RT 4QO1A 3WN5A 5KS9A 4XAWH 5D2LE 5FYKE 1NAKL 2SEBA 2VL5B 3F7PC 1FJ1A 5HI3C 5DJAA 3HE7A 5CJ5A 4GSDH 1X4YA 4WI7A 2DI8A 3MRQB 5I73B 1HNGA 1W0WA 5D2LF 2AERT 2H32H 4S1RL 2X4UA 4X0KA 3FOLB 2OBGA 4LPWA 4Z7VA 1VACA 2A38A 3KXFE 1FORL 3RNKB 3HPJA 1MUJB 1URLA 3LKRA 1T3FA 4FZ8H 4Y5XB 1BFTA 2ZUYA 4W4NA 3ZKMC 3AREA 4F37F 4K3JH 5FUCE 5T1KB 4JFXA 5FFLA 4FQJH 1I3GH 5CMAA 1TZIB 5DTFB 4Y4FD 4GRMB 3LPGA 1KC5L 1DUZB 1R3KB 3FT4B 3GB7A 2CMRL 2ID5A 3EYUH 2Q3AA 1Z9LA 1EEYB 2GK0A 4MJIB 3SCMA 2VSCA 3BPOB 5ADOH 3OAYH 2KH2B 5I30L 4EDXA 1ZHNB 5C2BL 4M7JH 2D7TL 1MI5A 4JHBA 4XTRD 1A7OL 1DBAL 1BGXL 4DZ8B 3QJFB 3HI1A 1ZTXH 3H3KA 2NY5C 4DW2H 1CLZL 3HZVA 3MYJB 1XCTA 2PYFB 2VLKA 3DPBA 4LK4A 4LSPL 5FB8B 3AS2A 4KHTL 5DD3L 2OI9B 1KTLB 5DZLA 1J1XL 2VZVA 2YBRB 2GCYB 1OW0C 5C07D 5C0EB 1IJ9A 4PJEE 3MXWH 4LGPB 5E2UL 4JREB 3RWDA 3KPTA 3CIQA 4KK5C 3CJJA 1UADC 5FCUH 1NCNA 3CUPA 1SMAA 1E28A 4IBLT 5DJ8B 3MCG1 3QHZL 1RVFL 4WW2F 3UJJL 4KY1L 3MRPA 4HKZB 3RNQB 2H9GA 1P53A 1YEFH 1F4WL 3RVVC 1WFTA 4QRTB 2FATL 4YBQD 3FQNB 4WHTB 4LLUA 5EU4A 3QG7L 1MCHA 1XH3A 2Z8WC 3EO0A 3OKEA 2AEQL 1CGVA 1A7RL 1PKQB 4X5XA 3BZ4A 4ISVB 4NNYA 1LQSR 1RMFH 5BJTB 2B1HH 4N0FA 4P3CL 4ZYKB 2APTA 5FA3A 4QRRA 3PV7A 5F7LB 3PP4L 5I71C 4TVPE 3SOBL 1MAKA 1R5VB 1ZKAA 4G8EB 4R4FH 4H20H 4M6AA 5E99L 5ESVA 4WI4A 3PNWA 4LLAA 2HP4A 3VXTB 3VXUD 1IAMA 4KQ3L 1CT8B 4KUCD 4CJ0A 4B0MM 3RVVD 2VAAB 1AR1D 4RAVA 4JO1L 1DUZA 5E5UB 4HH8A 1PG7W 1D5BA 5D7KE 4RBPK 5JORA 2HWZH 4YE4L 3B6SB 2VXUL 5SWQB 1JZ6A 2DS4A 2N1KA 3QIBC 5L6YL 3FQUB 4GW5B 3FJTA 5E56A 4OZHB 4LOUC 3OAUL 4LSRL 3TFKC 3MNVB 3QT2A 4M00A 1TVHA 4ZUWB 3LIZL 4P4KC 4UT6L 4XPBH 1F3DH 2EXYD 3QUXA 4F33B 2UVFA 2HT4D 4D0CA 1I1AC 4X4YB 4GAGL 3K74B 2XTJD 3GIVA 3GMPB 4HUNB 1OWRM 4IIQC 3TPUB 4MA8H 4MLSA 3HRPA 3OKMA 4P5TA 4BSVB 5D7LB 2E8ZA 5CZVH 3C60A 4QRQA 4JM2F 3GMMA 4QXTB 4M62H 3S7GA 3ZYJA 5JXAL 1A6UH 1J11A 1CE1L 2WZPD 1FL5B 1DUYB 3ECBA 3L3DA 4C56E 1D5XB 5SX4I 1FZKA 2MCPH 2OK0L 4P5MA 3PQYD 4XCFH 4Y4KC 3GMLB 4PJFF 3WCYA 1YECH 3OJMB 4U1KA 5DMGD 4Z7WF 5JPNB 3KYMA 2X9XA 3LKQA 2FHCA 2FWOA 5L0QB 5L9DH 4RWYH 5T5NF 2A1WL 5BZDB 1KIRB 4G42A 1U42A 2HJFB 4GG6E 3HE7C 5IMOB 5AYQA 4QF1B 1ZLUK 3EYSL 4GRLB 3NCMA 5GS0D 1OSPH 4JG1H 4HMDA 3X3FL 1X6NA 1CDYA 1T0MB 5F6HJ 1U8MA 3MUZ1 2C1OA 5D1ZB 1BBDH 3S4SB 2OR7A 4WWKA 2HT3C 3SDCA 1DQLL 3BPNB 3N1PC 4GG8A 2I07A 1F3JA 2NY0C 4JHZA 3T3MF 3Q5TA 1DVFC 2FH6A 2R1XB 4N1HB 3B8YA 1FNHA 3SDDD 1NUDA 5SWQA 4CVXB 4E5XB 4ZQKA 2HT3D 3K0WA 2BRQA 3VFWB 3TN0C 4HULB 3P4OA 4Z9KB 3GSNH 4HHAA 1QBBA 1KCLA 1ACYH 2AQ2A 5CGYD 5EU6D 3IETB 1T7XA 5IBTL 1A02N 3W0WA 4S1RH 5DVOA 1U91A 3VI4F 4DKFL 2AAVA 2ADFL 4AIOA 3ZSSA 5J1TC 5A2JH 4PJ5A 2XFXB 1FORH 2D03L 5F6IB 2VWEE 4LNVA 4WI6A 2M1KA 5EU6E 3JSSA 2B0SL 2BOBB 1D9KB 5E2TH 4NNPL 5F1IB 5GZNC 4QHMB 4L1DA 1CE6B 4HUWB 4P3DB 3C5ZA 1L0XA 1WIPA 1T3FB 4W70A 1YC7A 1I8LC 3M17A 2EC8A 5E6IA 3LB6D 3WHXB 4LU5H 3DIFB 1A7OH 1XGQA 4ZXBA 1DBAH 3NCFB 1BGXH 4KRMB 2CIKB 1ZTXL 5DJ8A 1QO3B 5E95B 4YHZH 5TDOB 5K59E 3GUTA 3TLRA 3WEXB 3NH7L 2YC1B 2R8SL 2OJZH 3D3VE 5BW7C 4F7EA 1JPSH 4PRPD 2D31B 1KT2B 2DDQL 1U3HD 5K93A 5DHXB 2EC9T 2AXHA 4L8CB 5DDHB 1VFMA 5INDA 3SO5A 1MHPH 5T5NG 1BHGA 1IARB 1GC1L 1RVFH 3CCHB 4K3DH 3UJJH 4KY1H 3B2UD 2GSGA 3KLAA 3QO1A 4ZODA 2GJ6A 1S7RB 1A3RL 2EYRB 2VXVL 1E6JL 4C56D 3GKWH 4X4XA 3DETC 3MRJA 4F57L 1MAML 1AHWB 3L5XL 1INDH 3V0VA 4G8GE 1T6WA 1UACH 3QYCA 2NXZB 4LVHC 1PG7L 2HYMA 3O2WH 1GGCH 4PJDB 3KG5A 3T8XB 1A7RH 4IDLA 3SO3B 4MVBC 4DUWA 2ZOLA 2DWEB 3IF1A 2XFXA 5B3JE 1WIOA 4FQLH 3MLYL 4X4ZA 3HS0B 2WBJB 1U36A 4R4FL 3AU1B 3UO1L 2NY7H 5I6XB 4ZUWA 2FL5B 5CILH 3C5ZB 3LRSB 1WBYB 4QHLA 4YBQC 4OD1H 4J2XA 1N64L 4G5ZL 5FO7B 1YEHL 5FM4A 4L3EA 4ODXB 5J6HA 3K8MA 1M7DA 5EA0L 3WUWB 3QUMB 1XGYH 1HYSC 3O9WC 1F02I 2WMPA 4XVJL 1JPFB 1IM9D 5FOBB 1QPPA 1NPUA 1SYSA 1U2HA 1NCCL 4NZDA 3S34L 1XGUB 1WIUA 4LASL 1BVZA 4NGHL 4UT6H 4ODTL 4RMUA 5TDNA 3KNBB 5EWIL 1PZUB 4HIEA 5SWZE 3EBAA 4X6EB 3EZJB 4LSDA 1G7PA 4K2UH 4P57A 4ZUUB 4WHDA 2PNDA 3GZKA 5MP6H 4WV1A 1MRDH 3BO8B 4YXHL 4M62L 5C6TL 4RGNC 3O81A 4WHTA 2FWOB 4U6XA 1OAXL 1CE1H 5GS1B 3EOYG 3GSWB 5KSVA 1S9WA 2MFNA 5EU5B 3P30L 1KUMA 3D39A 4TUKL 1BQUA 1FFNA 4I3GA 2ADGA 4K94C 1V7ML 4QF1A 4NT6A 1GZPB 4YH6A 1FG2B 2EE2A 1Y6KR 3P4MA 1FLRL 2YD3A 4QTHA 4D0BB 4M8VA 4LCWE 4HLZH 1YNTB 2IQAA 5DQ9B 4MQSB 1IC1A 5T1MB 2A73A 1F6LL 4MQXD 1UB6A 4UV4L 4PGCA 4I1NB 4QY8A 4MA7H 1D5IH 1KCSL 4LHUB 4N5UA 1OW0A 3ZTNL 4MJ4A 3DO3A 5HHVL 1KNOB 3QIUC 1DLFL 1LP9E 4YPJA 1V8HA 4P5KA 4HK0A 4LLVB 3TVMC 4PJ8D 4PRDA 2ZUUA 1BBDL 5MI0B 2Q8AH 4JB9L 4PJ7B 1TPXB 5GZOD 4OCWL 4K23H 1HDMB 1XGRB 4L3EB 4MNGE 4AT6B 5ADPH 3R0MA 1JIBA 3HG1E 5AG8A 3DOSA 4I18A 3PWPA 3ZKNC 3CUPB 5KN5A 2MJWA 3TF7C 1I8IB 3FO1A 3OSKA 5IVZB 3VFOB 3U30C 3BXNA 4U1HA 5EIIA 2YEZA 5I73C 1F45A 2BERA 3FFDA 1JGLL 3QIUB 4D9RE 5IBTH 4LMQE 4CUCA 2YK1L 4NUJB 3CPLB 3KXFD 4BFBD 2GTZB 1RJLB 2DM2A 3FB5B 2ESVB 3A6BH 5LGJB 2ADFH 5ICYA 4FQPA 2HRLA 4XGZA 2WBJC 1WFNA 2D03H 1KCUH 3LN9A 3KJ4B 3LHPH 1PSKH 5ALCH 2ZG1A 3BVNB 3MO1A 3MZTA 3O6LL 3QXAA 1F4XL 3UZQA 1ZVSB 3DMMA 3KPLB 1ZHLB 4MAYA 3G6AB 1HH9B 4MYWB 2NY4D 1SJVA 1CXEA 4OLUH 3EJYD 3MBEA 3R8BB 3KPQA 4J3SA 3V8CA 4LU5L 4JPVH 3IXAB 4Z0XB 1AGFA 4Y89A 1CBVL 4FQXC 5J06A 1QPXA 4HS6B 4FQQB 1RUQH 4PJ9C 4ZDHB 4MB4A 4YHZL 1XF3B 4NQSA 3VFRB 2ITDA 3QXDB 3MUJA 5T1LD 1AKJA 3PABB 4F9LA 2Q86A 4ETYA 3IDXL 4NKIL 3V5KA 4OZGB 1FH5H 2AJUH 1DE4A 4YAQA 5CKGA 1ACZA 1QUNA 4CN6A 4E9LA 5I76A 4FXKB 5B3NA 2P8PA 3QQ4B 4HPYH 4PRBB 2X1XR 3MJGX 2P1YA 4ZO8A 2BC4A 3FT3A 1FCCA 3GMPA 3MACL 4OZ4B 1K4CA 2YKLL 2VLMD 2GUOA 1Q72H 2VDRL 3ARYA 1KJ3H 3Q3GB 4KH2A 5KN5B 2ZOKB 4TN9A 3IFPA 3QIBD 3STLB 4S1QL 1D7FA 4NO5B 8CGTA 1NC2D 3LQAH 3HFML 4NBYB 3PHOA 1HI6B 4NYLA 4LPVA 5IJKC 3MV01 1MAMH 3L5XH 2HN7B 4TVSa 4KUZH 3BN9C 1W72B 2XTLA 15C8H 1UACL 4GBXB 2AABH 4QHLB 2Z93B 2AJXL 1I7TB 2QHRL 3JV0A 4Q97A 4XPGH 4P2QD 5CAYB 2IAND 4LKCB 4Y5XA 1HHJA 4X7SH 1OTTD 5ITBH 4LVNB 2H2SC 3B2VL 3MLYH 1A3QA 4M61B 1NCUA 4Z7VE 3MGOA 5EOCJ 1DBML 3UO1H 1IQDB 3CFKA 2BNUB 3QDGA 4X9HA 5BZWB 1JWMA 4Y5YC 2CR3A 2O5XH 5EA0H 5DEFB 3E3QC 3MFFA 2J7LA 2JB5L 1JWUB 1YUHB 1QTYT 3OKKA 5ISZB 4X7EC 4F8TA 1PFCA 2CGRH 4K8RD 3DMMC 5T3ZE 3AXLA 35C8H 1MHCB 2XG5A 1GH7A 2FO4A 4YO0A 5TQ2H 1HK6A 3S3JA 4HIIA 3V5HA 3V6FB 3S34H 2RJMA 1NKRA 4OCSH 4PRHB 1EXUA 4X9FA 4ODTH 1W8OA 1N2RA 1OTSD 3VCLB 5E9DA 4CW1A 3V95A 1JVKA 3S8WA 3GHEL 5EWIH 2Q8BL 3DNKA 1N26A 1S7TA 2D9CA 1RZKL 1WTGT 5GS1C 1T22A 4JM2D 1RJZA 4M1DH 1MREH 4YHML 3RWIA 1ZXQA 5C6TH 2NY2B 1L9NA 3JWOC 5E6YA 5IW1A 1OAXH 5I18H 2CPCA 2VZSA 1A14H 1QSVA 2PN5A 4WFFD 3KDMA 1NFKA 2MKLC 2GT9B 2AS5M 1V7MH 2J8UA 3P40A 4TPRL 1S9XA 2VZTA 5IT2L 2EDTA 3GM8A 1OAQH 3ARZA 4CADB 3PHOB 4NYLB 3DTXA 2EZ0D 3H9SB 1JE6A 4Q0XL 2R0LL 2R0KL 3O0RL 2UWEB 1D5MA 3DX9B 1XR8B 2DOCA 4XPTL 2DKMA 2F74A 3VXSD 4IHOB 3KYOA 1KTDB 1J12A 4J6RL 3SN6N 1DQML 3BP4A 4UV4H 5GGTL 4MA7L 3ZTNH 3QDHA 5HHVH 3RBSA 2MMXA 4XP9L 4NWUL 1F5WA 2ATPA 4OAWA 3QO0A 1IMHC 7FABH 4RX4A 4TSCL 3W39A 2VISA 1AXIB 1CQKA 4QY8B 3BQUC 1T1ZB 4LF3A 3QFJB 4E42B 1WZLA 1F90H 4AL8H 3VXQA 4L8SC 5DHYA 3ARDD 3MFFB 2P5WB 5D2NB 3KJ6L 3ULSB 3EKCA 1KB9K 4JY4A 3OF6D 4HSQA 5IK3A 5DUPL 3U46A 4K8RC 2Y06L 2XN9B 4PD4J 3G04B 3I6KB 5FOJA 4MQTB 3F7VB 2X4SB 2H2PC 2P44B 1JGDB 3VI3F 1UWGH 2F54D 2PXYD 3OGCB 1ND0B 1U92B 1EJOL 3KPMB 1A6WL 4JQVC 1LHZA 1HYRC 1KBGH 3RAJH 3SGJC 4NO3B 1UEMA 1I9IH 4KK9D 5FUZH 2EDHA 4Y0GA 2F8VA 5GS0C 4O02H 1I85C 5B39G 1OGAA 4KDVA 1HQ4A 3G5XA 4UZGA 2ED9A 3TJHD 5LGJA 2XOTA 4PRNA 3NIDF 3O6LH 4OIIL 4J3XA 4XGZB 2YUXA 2YRZA 1KPUA 4FFYL 3QEUA 4K94L 1KIPB 1IM3B 1G7IB 1Z9SA 5MERB 4GAYA 2B1AH 4ODUB 2R23A 3JBG7 5SWSE 3LN4B 3Q6FB 5I76B 3OV6A 4GBXC 1VFAA 4RIRA 3RZCD 1KNOA 4NN6C 5I1LA 2R0WL 1KTDA 1WJ3A 3RJDA 3EUUA 5I66A 4Y19D 4L4TE 2ERJC 3G6JF 4IOSD 3P9MA 1XMWA 5MHSD 4CMHC 3U6RB 1I9JH 3LKOA 3MNZB 2P46B 5EZOL 1GAFL 1V3LA 4TUJB 2FCBA 4Y5YA 5C0CA 2P7TB 4HPYL 4PG9B 4KDTC 5IJVA 4JO4H 2BCKA 4HCRA 1X5LA 3BAEH 4JM2C 4OM1L 5L2JA 3MACH 3VXOA 5FHAH 1HKLH 3T65A 5I8OH 5IR1B 5DSCB 1QRKA 3DX8A 2APFA 1Q72L 2BNRA 4UDUB 4ZSOA 4N9GB 5J0BA 1KJ3L 5HYSG 2LTQB 3AY4A 3MRNB 4Y1AA 4XT1C 5FM5O 5EUKB 2UYLA 5FYKL 4NKOA 5FGCB 4S1QH 2I27N 3GRWA 4I5BA 4FTVA 3LQAL 4XBEL 1NEUA 2B20A 3U4BH 2F8XC 4E41D 3WSQH 2Y5EA 4YX2L 15C8L 5B39B 5J12C 5CD3B 2R69L 5FDWA 1I1FB 1FG2A 3A6CH 5C0JB 2EC9U 2QHRH 5DZNA 4XNZB 4XPGL 1RIVL 3V5DB 3MRPB 4Q9QL 1TQBC 2DMCA 5ITBL 2IALA 2APWA 5I1IL 3OKDB 3DUHA 4N8VB 2VITB 4GJTB 1UB6B 2OXHA 1VFBA 2VLRD 3QUZA 4OSUH 1JZ7A 3O4LD 4ELKA 4IS6B 2DQDL 5IROC 2FZ3B 4JKPL 2HVKA 4Y88A 5C70A 5MI0C 5ILTH 1N2RB 2O5XL 4NOBA 4NOFA 5I1HH 1WITA 3I02B 4X6FA 3EYVA 1YQ2A 3FQWA 3HNVH 2YA1A 1UQSB 3GIZL 2EIZB 5DT1H 4F7PA 1HDMA 2CGRL 1IBGH 2AJ3B 1NFDF 3UYRH 4RMWA 4OQTA 1NBZA 3NOIA 3VU2A 4F7CA 3LCYA 5CZXD 1T20B 4RRPG 1J18A 4JN2B 1VEPA 2H8PB 4JPKH 4PGBB 5JHDA 4Y16D 2RIKA 5BOZG 1B9ZA 4YHYC 1ADQA 1CGSH 4KROB 3BD4A 3VXPB 4BUGA 4FABH 4CVZB 1KIRA 3L1OL 1K3ZA 4L4VA 2B4CL 3CFCL 4KK6C 3GHEH 3VH8A 5J1AB 1NFIB 2Q8BH 2EEAA 2GI7A 1LMKA 1CGYA 5MHSE 4NBXB 1U93B 4X6CA 3MV11 5FGSA 1RZKH 4WU7A 4YQXH 1R0AL 4M1DL 3IDGB 4ZS6C 1AQKL 4L8SB 3AB0C 3SDCB 4QGTA 4NC0B 1UKQA 1JI1A 2DIJA 4J7RA 5TE4L 3GK8L 3HC4H 2NXYD 4KUCF 2BJML 3WJJC 4I13B 1U0QA 1J0HA 1F4AA 2RB8A 4HIXH 2F54A 5BJTA 4OZHE 1ONQB 5DYOB 2AK1L 5F71A 5DFTA 4TPRH 8FABA 3WFHA 4Z6AT 5K9OA 1I7TA 5IT2H 3OL2A 4A6YH 4PJDA 2P5EE 4BSVA 3GSOB 2J8UE 2E6JA 2R0LH 2R0KH 4YXLH 1MLCA 5M7QA 4XCEB 2UVEA 3BOVA 1F42A 3F62A 1TVDA 3LD8B 1ZANH 4XHJD 1EEQA 5I2IB 3AREC 4Z0XA 3ZL4H 2VXQL 4MQXC 4WRLA 1FCGA 1MCJA 3OX8A 2IALB 3S6CA 4ZAKD 2W91A 1J10A 4HBQA 4OCRH 5J13B 1B0GB 4XP9H 2IGFL 4YHNB 5HHQB 3ME0A 4XNYH 5KG9A 4WI9A 3DXAA 3CVHB 4TSCH 3EYQD 5J57B 5EO0B 3S88H 3VGEA 1E4KC 3PGFH 4I2XB 1NANH 2I25N 1MWAB 1F90L 4FTVD 4QRUA 4AL8L 1CZ8L 4GMTH 2PR4H 4DAGL 5C7XL 4JZNB 3SGKA 4AIZB 3JV6A 1EHXA 1DQQA 2FJHA 3FZUC 3LD8C 3WHXA 5HPMA 3W5NA 1T1ZA 4LF3B 3G08B 1UYWL 2BY3A 1S9YB 2C1OB 1ITCA 5KSAD 5E03A 2YWYA 3RU8H 1RZGA 3NFSH 4U7SA 4LLDA 3ARGB 2V5YA 1G9MH 1A6WH 2WWKO 3NZHH 5JO5B 1FAKT 2JIXB 1UZ6F 4NNYB 5C07E 1DDHA 5JIKA 1I9IL 4U1IB 4HZLB 5FUZL 2G75A 3DO7B 5E5RB 1I9RL 3H2WA 4O02L 4OFYA 1OAZL 4P2RD 5H94A 1TIUA 1HQRB 5DJ2B 3QI9B 5JMOC 5KJRL 1WISA 4NO2A 3P2TA 4S0TD 4XP5H 3VE0B 4NRZB 1IEBA 1G9NL 4Z7OF 2VLJB 2CKBB 3DV6B 1T1WB 5F7EL 4OIIH 3RNKA 4FXLA 1FL3A 5FAAA 2ICWA 1LK2B 3IRZA 3PWLA 3OAZK 3F7YA 1FO0A 4H5SB 3U6RA 4LLQB 4BH8A 1HKFA 5IESH 3V6OC 3ARBA 2R2HA 3VMNA 1P6FA 3PGCA 4PJ7E 1KN2L 1IAKB 4RNRB 3O6FB 3WLWD 2AEWA 5DEFA 2VC2L 3BP7B 4PJIA 2X1QA 3DRQA 25C8L 2NXZD 4N1CA 5TH2A 4S10A 5I2IA 1AIFA 3VRLE 4WFHD 5IBLC 1RFDH 5HY9A 4NQCE 1EGJL 4ODWA 1W8NA 4X5LA 4YPGA 4Q9RL 4YHIA 5FKAB 2PW1A 1AO7A 2QTEA 2GITA 4KMQA 2A9NL 4WW1A 1HKLL 2NR6C 3IETA 5FHAL 5I8OL 5FDWB 4I8DA 1KJMA 3AROA 2GJ6E 5SX5H 2A74A 4AZ8A 3ARSA 3RWIB 3RWGA 5FYKH 3RKDD 2Y6SD 1QRND 5DA0B 5KVMC 4KMTH 4ZUVA 2A6KB 3B9EA 2YRLA 4V1DB 1TFHA 1RURL 3KPMA 2IQ9L 1HSAA 3PWNA 3U4BL 2IG2L 3UBXI 3WSQL 4N9GA 5DXWA 7CGTA 4GBXD 3O3AA 3BEWB 5EUKA 3BKML 3TZVB 5BVJA 4S2SB 3ARGD 4N5ED 1KGCE 3IFOB 2C3VA 4JZJC 1GOGA 1KJ2B 1B6DA 3HI6L 2BZDA 3D1MC 3KPSE 4XCCH 4GRLA 5I1IH 4Q6IC 5E00A 5FO9B 5C0JA 3GHBH 2VDPH 3QI9D 1T1WA 5CJBA 3HR5B 3RY4A 1ZA3B 2Z4QB 5F88A 4P46C 1U95A 5ILTL 4OAWB 2I07B 3PHQB 2VITA 3MCLL 3HNVL 1J1PL 2HKFL 4Z0BH 3IJYB 2DB8A 4PRIE 1IBGL 2EH7L 5HI5D 3HNSL 1U8OA 4KV5F 4D8PA 2EE3A 3GMNA 4EI5A 5J89A 1VSCA 2PETA 5L2KD 2BVQA 3MJ8B 5HDQH 4HUVB 3B6SA 3L1OH 2YUZA 2P7TA 4IIQA 4PLOB 1UGNA 5HY9B 3SKNA 4HJ0D 2XN9E 2WWMD 2W38A 2DJSA 5C0CE 4Z76A 5EU7E 3D3VA 5JR1H 4RGNE 1U8PB 2WUCL 5GGSB 1FHGA 1UM5L 3F58H 4BQ9A 5IFAL 4OM0H 5DVNA 1BBJB 4LBEA 3CFIC 3FHQA 5IFHL 4R3SB 3IFPB 4DEPB 3STZA 1JNHB 3QXTA 5KVGL 3HC0A 5TE4H 3GK8H 3HC4L 5DD5L 5GZND 5GS2D 1PAMA 1FZOA 2A2QT 2DQTL 3T3PF 3HE7B 4XVTH 2XRAL 5B38G 3VG9B 4Y4FA 3QXWA 1FVEA 4HAFA 3FONB 4JN1L 3C5JB 5J3HD 3T4AB 1EO5A 1UCBH 1KB5H 2EDNA 3HRZB 4WNQB 5C09A 2G60H 1A4KA 4QGYA 1NGXB 2J6EA 2YPKA 3TO4D 3LRSA 5C09E 1RD6A 5AUMA 3SE8L 3G6JB 5I15L 5K9KB 3GUTB 5JOFA 3TT3L 4KRPB 1VKXA 3GSRB 1LO0L 4I77H 2KKQA 1JPFA 4XNYL 3RIAK 4NNXB 2FIKB 1S9YA 2PO6B 4LSUH 3TCLA 2IMNA 3BGFB 1BWMA 2EXYC 1G0DA 2OMBA 5ERWB 5D1XD 5BCAA 3MJ7B 4P4KD 4WJ5B 4MAYB 5KTEL 1CZ8H 3GSQA 2PR4L 4DAGH 4L8DB 5JO5A 1LE9A 2ZUWA 3S3PA 3D69B 2WBKA 4G9DA 1ZLVK 4OF3A 4GG8B 2EYRA 4HGMA 3TCXA 3WD5H 2XACC 4X4XB 4MQ7B 4PRDB 4PP1D 4S0SD 5ACZB 1W72L 4NSKB 2VLJA 1C08A 1R3JB 1DQTA 4WDIA 1MFAL 2H26A 1UXSB 2EE9A 3NFSL 1MI5E 3IDGA 4ELMA 1T22B 1TTFA 3J7HA 3RWDB 2PYED 5F9WC 3H9ZA 5CSZB 2DJUA 4POZD 4HS8H 5GXBB 4XHJC 1IL1A 1G6RA 1OAZH 1P4LB 1F97A 2VLRB 3FHAA 3BRDA 1U3JA 5IMKB 4XP5L 3RY5A 1A7QH 5F7EH 4XVSL 1HHIA 5D6DA 3HE6D 4Z7VB 4GW4A 3PDOB 1G9MC 1YNLL 2PKDA 4F58L 3UTSD 5IHLB 4HS3A 3KPOB 2NTSP 1Q0YL 5KS9F 4YDKL 2VL4A 5DTFA 2VC2H 3MFGB 3BKJL 4OCYL 1DBJH 4PJGA 2NMSA 4WFGD 1OTUD 4GKZB 4B7LA 3IDMA 4KK5D 5GGUB 1QQDA 5JDSA 2NY1D 4APQC 1ETZB 1IFHL 3BP6B 1EGJH 1G7QA 2JCCF 1FFRA 5DRWA 4CVZA 3BSZH 4KK8D 4LDEB 4ACPA 3VFGH 4JZJA 3X14A 1X5ZA 3SPVA 4ZMAT 4AIZA 3VA2C 3RPKA 4HIJA 5J9PA 3OWEA 4JFZH 4U2YA 5HPMB 4H8WH 4X83A 5E70A 5EOQH 1EEUA 5JOPD 3MLTA 4KMTL 4MX7B 4C56B 43CAA 4M03A 4P5TC 5FYLH 1RURH 3CAFA 2EE6A 3TH3T 5F96L 3RWHA 4X4YA 3BDXA 1FGNH 3TV3L 3GJFA 5FIEA 3HCVA 3SDXF 5JW4N 3BIBX 5J12B 1MCBA 3BKMH 4XXDA 1RZFH 4OV6F 1A6ZB 4POZC 2Z31A 2PXYC 3DROA 4U6VL 3HI6H 4KTDH 2CDFB 3B9VA 3MV7B