1IFHH

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhH01
1EAPB 5CJ5A 1N5YH 1MLCA 5FUCE 1RZIB 4NRZA 2HP4A 2V2XA 3KHOA 3VXRD 3WO3B 3PDOA 3DHMA 1AD0A 3LY6A 5FAAA 2AEIT 3VMOA 4LCWA 1CTNA 1G9NL 4AT6A 1P7QB 2R1YB 1TQCB 1U8HA 2IMNA 1OSPL 1KIQA 2NX5A 4C56E 1DBAH 5GGRY 4AM0B 2Z31B 1YEDA 5EORH 3HZYA 3LQZB 1RZ7H 2YR3A 3SCMA 1KGCD 4LCUB 3RWEA 4FQQA 4MHHI 4M7KH 2NY5H 4KVCH 2CKBA 1KENH 4P46D 4QXUH 5DSCA 5I1GL 5HI5C 1A6UL 1CQKA 4NJAH 3LS4L 4YGAB 5CMAB 3IKCB 1S9XB 4G8FB 1D6EB 2VAJA 1HQRB 2FEEI 1K8DA 7CGTA 3D2UA 3MV7E 3H42H 5CSZA 2BRRH 3TO4B 4S1SH 4JRYD 5D7IF 1WWCA 4XMPH 3LD8C 1DEDA 2K1MA 3SOBL 5DJZA 1LE9B 2ZCHH 2G9HA 1CFVH 1ZLUH 2X4TA 4PJ9C 1OW0A 5DEFA 5F1KC 5E1AA 3DTXA 2BOCA 5JOFB 1WF5A 5BVPH 2H1PL 2MSPA 4S1RH 4PY7A 4HWBL 1FNLA 5EZJB 5DR5L 4QRUA 3P30H 4RWYL 2HTKC 2DB8A 4K7PX 5JR1H 1I3RB 5EU7C 1NLDH 3MLRH 1KJ2H 1KULA 4FNLH 4X98A 1NGXA 5L2JB 4XMLL 5DHYA 1UM6H 3T3MF 4QXWA 1AJ7H 5FYKH 3G5ZB 5JQ6L 1NBQA 3B8YA 4D9QD 3N50A 5KVFL 2Y6SD 4NC2B 3DOSA 4PJ5A 5HYQB 4RQQB 2YBRB 1U8KB 2X7LB 4NO3B 1KCRH 2NY1B 3QDGE 4JFQB 1YN7A 4P23C 4P3WA 5I8EB 4M7LH 2IH3A 1AGBA 3V0AC 1N26A 3CLEL 5FYKU 4FABL 2AJSL 4S2SA 3FKUS 3HC3L 2DL2A 3HR6A 1J12A 3ARFD 3EYFA 1QOKA 2F54B 5JNYA 2EDFA 5SWQA 2P7TA 3S6CA 1T22B 3VFUB 3PNWB 1HSBB 4C4KO 4U3HA 3FRPA 5ANMB 2DQEL 2PO6B 1RZKH 1TQBB 4IEFB 4F15B 3INUL 1RURL 4K2UH 1R3LB 4YXKL 1XAUA 4PJGA 4GW4A 3BIBX 5DYOA 1NC2B 5D7JA 3X11B 4X6DE 3O45B 5IF0A 2X1WL 3OV6A 4M1CD 4HC1A 3KPOB 4LKXB 5HDQH 4NN6C 4OAWB 3SDAC 1QVOB 5BV7C 3L95B 2KBGA 5I15L 1A4KA 3L5XL 4LCWE 4IDJL 5CIPB 4A6YL 1C8PA 4Y5XB 3RNQA 4PG9B 1N59A 5EC2B 4JVWA 4EXPX 1XF3A 5E6ZA 1MJ8H 2M26A 4FQJL 4KTEL 3KPLA 3MLXH 2W38A 4M6MH 3RTQC 2A0LC 2WIIA 4IRJB 2GTWB 1J87A 1H15B 1I8MA 5C07A 1AGFA 4PJIA 1FORH 1WBYB 2R1XB 3VH8A 2VLRA 5FUCC 3EO1B 3IVKA 1GH7A 5GJSL 3WNKA 3OGCB 3RL2B 2F74A 5FECA 5GJTH 3IDIA 5HHOA 2LAGB 2H9GA 1KJ2B 4ZTPL 1EDQA 1R0AH 1JI2A 1VACA 2H2SC 1MFDL 3ARDA 3BKYL 4U05A 1A7NH 4M62H 3HN3A 3UBXA 4POYA 3U0PB 4PJDF 2Y07H 4NQCA 3UTQB 4HCRL 4RAUB 2BVEA 3LB6C 1AO7A 1AC6A 3NCJH 2ICEA 1U2HA 3HR5A 1BD2E 1CG9B 5D7KD 2B1AL 2XIDA 3HE6B 4K07A 1LO0L 1I4FB 5JDSB 2EXWC 5IVOA 2WWKO 3D0VB 5SWSD 3PV6B 2ITCB 5B8CC 1H3GA 3CX2A 4QYOB 4ZYKB 1F6LL 1CS6A 4PJ5E 1W0WB 5C3LD 5T3XD 1RIHH 3BP4A 4P0DA 1DQMH 1WAAF 3EYSH 2JIXA 4JO1L 1A6VH 4CN4A 1IGIL 3F6LA 1RHHA 4G8GB 2D0HA 4Q9QH 4OZIF 3WDJA 1EK3A 3DETC 4BFIA 2EE3A 1II4E 2YZ8A 2V17H 1AKJB 1T3FB 4KVNL 4N8CL 1MRDL 1GGIH 5SWZD 3WFBH 4NBYB 4PJCE 3LRHA 4JANB 1G6RL 2EDBA 2UZXB 3FL7A 5LAXB 3UROR 4WFGD 4YFDB 1PEZA 2I60H 3EZ8A 1A9BA 2FECI 1IZJA 1KXVC 3ZKQD 5MEQA 4QCIA 4UT9L 2P47B 1Z9OA 4HUKB 4XX1E 2Z8VC 1IEHA 3RI5F 1YDPA 1TTUA 2AI0H 2ZOKB 4OB5H 3PWUA 3V4UL 1I9RL 1PQZA 2VQTA 4PJGE 5FKAB 2DWEB 2P8PB 2VC2L 2UY7A 4JPIA 1ADQH 3MRGB 2X44D 1K2DA 3DJ9A 5B4MD 1R6VA 1XR8B 2RB8A 3KPNB 5DHXB 2BVOA 4FN0A 1B4JH 3JV6B 1JL8A 1MCJA 1X44A 1D5BA 4D0CB 5IEKA 4OZHA 1I8LC 4I4WB 5ILTL 5FGRA 4O2EA 1H0DA 4FP8L 3WFZA 4LSRH 4BFBD 5C70A 1P84K 1Q9WB 3KXFB 4JDZB 3JUYA 1Q72L 4J4PC 4J1UA 4MJID 5ETUA 3O9WA 1P7HL 4KXZH 3W81A 4M5ZH 2NW2B 4XTRD 3K74B 2E27H 3MXWL 1I7ZB 3FONA 4NKMA 5CJBA 2DMBA 2AJYH 8FABB 5J0BA 2OS7A 4PJIE 2LVEA 3FRPG 3CFBB 2VLRE 3FB8B 2FEDC 1DVFA 4EN3D 1CFSB 3QG7L 5HTSA 4S1QH 3ORJA 4NYLA 4ZO8A 5EH1A 4MD4A 4XNZB 3ULVD 5HHOE 2AABL 4PJ7F 3R06A 2ZKHL 3MNZA 1CLYL 1D9KB 5E4EC 4N0UB 1EUUA 3LRGA 2BFVH 4NWTH 5DWUH 5DA4A 3BW9B 1NANI 3SCMC 2W9DH 2HN7A 2DD8H 5D7IE 3ZTNL 4KK8D 4LHUA 4NQCE 4XNXL 15C8L 1EHXA 3QDMA 1AO7E 1X4XA 5CILL 4LLVA 2EDDA 1RZJL 1KIRB 4MZ2A 1MVUB 4JO4L 1JI1A 2KH2B 4P2RB 4YHPA 2ED7A 4ZUSB 4M5YL 5E6ID 3NAAL 3SHSA 3ULUC 3CFJA 2VZUA 4OTXL 3TCLB 4PJDA 4QHLB 3H9SA 1UQSB 3VH8G 1FVEA 2FX9L 2V9TA 5B38A 3AMKA 2W0LA 4R90H 4KI5D 4NQXA 3CSBA 3QAZC 4M61A 2AEPH 3AS0A 1MCOH 3RX8A 3TBYA 1OW0C 3EYOB 5D5MF 3ILQD 3T3ME 2JJTA 3I50H 1HILA 5CGTA 3UJTL 4O02H 4EI5B 3GK8H 4OQTL 4LFHG 1HXYA 2VDKL 2FGWL 3BGAA 2XXMB 1ZLVK 5IBLC 3FRUA 1WAAA 1IGMH 1KCSH 4WUUB 2Q3ZA 4H20L 3TESA 3V52H 5HY9B 1T2JA 4OZIA 4MX7A 4XBGB 1CTOA 4G9DB 3QUZB 5KVGL 4ZTOH 5EPMA 2J2ZA 4D3CH 3BHBB 1BQHA 1HH6B 3WYRA 1CDBA 2EDNA 3OKLB 3T0AA 2VLKD 3TVMD 4P2QD 4L4JA 1ED3A 1K4CA 4POUB 2P5WE 5LCVL 4P3CL 3MV9A 2FB4L 4Y16A 1J0JA 1XGUB 2Q86A 5DK2A 4V1DD 3HE7D 12E8L 3KNBB 5LGHL 3MNVB 4FTVA 2VXUL 5F6IC 5CD3B 5ACLA 1M05B 3MREA 4HEPG 2I9TB 4U6VL 2BSTA 1OAKH 3LEYL 3CIQA 3CDFA 2OL3H 3MODH 1I85A 5GISH 1Q38A 4U1MB 4LSTL 2NZIA 4Y8AA 3S36X 1JYVA 5B22A 4J8RA 5CZKA 3UTTB 4NNPH 4PR5B 2IBGA 4JFHD 5FO9A 2NY4C 2Z93A 4N90D 3I84A 1BFVL 4PB9H 1FFPA 3UTSD 4GAJH 4AMKL 1P9MA 5D6CA 5D7JC 3HC0A 2R39A 3IDJB 3KJ4C 5F7EH 1XGRA 3P4OA 5FM5O 5I19L 5CZVL 4NQDA 4JVUA 3QXDA 5I1AA 2CPCA 3GMQB 4F7CB 4JN2B 3CU1A 1T04A 4NDMA 4V2CB 5E8NA 1DLHA 1LWRA 3VW3H 5KW9L 2VIRB 3PHQA 1LEGB 1IC4H 1QRNB 1YEEH 2YPLB 1G9MC 3T8XA 5KVDH 4OF8A 2K7PA 3MV8B 4P23B 3UO1H 3OKMB 1RZGB 5I0DA 5H94B 3F12B 3BRGC 1CF8L 1DBBL 4OLVL 4HJJH 2H32H 3H7BA 4I13B 3O2WH 1C5DA 4PJ7A 5A2KH 1S7XA 3GGWA 1B90A 1FVDB 4WIQA 2DWDB 3QDME 5FYJL 1X5KA 1HINH 4OIBA 5C0IB 4A6YA 1XF2A 3RVTD 2F53B 1VKXA 1HHGA 2A9NL 3VXNA 3QEUB 1CLOH 1JNNH 2FBJL 3BYYA 4PJDE 5D8JH 5EO0B 3H9SE 3FZUC 4OLXL 2VITA 2HVJA 1XCQB 2X5PA 3TN0D 5T1MA 4KMQA 5J9PA 1INQB 1WIOA 1QSFB 3ARDC 3UTOA 4YBLC 2UVFA 4TN9A 4XPHH 1OSZA 4MDIB 1HHHA 4PP2B 1UZ8B 2NR6C 5BV7B 2IALA 2BHUA 4L8CB 1NBVH 1VSCA 2W07A 4LPTA 4BKLA 4R2GC 4RAHA 4OM0L 1UA6H 1XZ0B 1WAAE 5E8DL 3CK0H 5SX4H 2B4CL 4ODBD 4X7SL 4CW1A 1NGWA 2DM3A 4MD0B 4OZIE 1CBVH 1T4KB 3G6JB 4MNHA 1SEBA 1FN4B 5BOZG 4F57L 3FMGL 2VDNH 3VI3F 3F62A 3DXAD 4G6AC 2OBGA 3G5XB 5DQJB 5B38G 1W0YT 4HJGB 1A7PL 2OL3B 1IILE 1Q1JH 4NFCA 3GO1L 4PJ8D 2XFXB 2XWTB 1IGJA 1HIML 3OBAA 4DQOL 4ZQKA 1GC1C 5DZNA 3MV9E 2JB5H 3G6DH 1TJHL 3C6SB 5E03A 5EUOA 3TBVB 5BS0D 1GZQB 3MA7B 2MPAH 3FB5A 4JFOA 4K7PL 3T4YB 3WNPA 4X7TB 1LDSA 3PHOB 1DANT 1ZVSA 3EGSB 2DQDH 1RUKL 4LDOB 5I17A 5E24E 5EBGA 4HWUA 1MY7A 3MBXH 4XGZA 2QADC 5IROA 4GAYB 1MIML 4PJBB 2XZQH 2C4FT 1S7UA 3QISA 2BC4A 5DA0B 3VRIB 1D6VL 4ZNEA 4AEHL 1YYMH 3BKCH 3GIVB 1C12A 3MRCB 3MRNB 1HHIB 1LK3H 1YNTB 5B8CB 2EH7H 1U6AH 2QR0B 2XY1A 5TE6H 1AR2A 3ZDYF 3LEXB 4QRQA 3FOLB 4DKFL 3CVIH 2BVQB 5HYJB 1T5WB 4OZFA 3R8QA 3M45A 4EDXB 3L3GB 4TQEL 3F5WB 1R5WA 4WGWB 3BZFA 3O9WC 4WUKL 4KKBC 3JTSB 4FFZL 4Q6IA 4GKNB 5T33H 1URLA 1BGXH 5F9OL 1I7RA 4PJ7E 3GI8H 3RPIA 3BD4A 1JNLL 5HDOA 2R0KH 4PLOB 3AS1A 4P4KB 4LVOB 1DVFC 2XQBH 1LO3L 1FAIL 3DROB 3VRJA 3QI9B 2LE9A 2ZUTA 5FDYA 2CK0H 3TT3L 1FPTL 4ZMAT 2Z4QA 3BJLA 4KKAD 3W5MA 4OD1H 1EFXA 4D0DA 3L6FA 4PB0H 1NCWL 3L5WA 4YFLI 5LKNA 4OKVB 3U36B 3BDXA 2ICWB 5DURB 5TH2A 5E56A 4K3GA 1NGZA 3O6FA 5HYSG 4FMFA 4Y4KA 3TYGL 1WSST 2FX7H 1CR9L 4HW6A 2HFTA 3JWDH 1CL7L 2R2BA 5KANG 1ROWA 4DK3A 4E42B 4HWEL 1QBLL 1BWMA 3P0YL 4U1JA 1A7BA 3GSNA 1LO4H 4XNMB 4JPWH 1DQQA 4XNQB 3WXWL 1E4XL 1D5IL 3SO3C 3U2SA 4TOYL 3NCEB 4RAVA 4JZJB 2CLZB 3QUXB 5C0CD 4H88L 4ODUB 1OB1B 4OSUL 1RUQH 1FYTE 3S3SA 4CMMA 4UTAH 5IM7B 1KCUL 4NRZB 5GGVH 3MSPA 2JJTC 5F1NA 1WCQA 4QRTA 3U4BL 1OGTB 1AD0B 1HSAA 1NGQL 1F2QA 1RFDH 4QXTB 2Q8AH 1KT2B 1U8HB 3KYAA 3MRLB 4W4OA 1NMAH 2NX5B 4KWUA 4M7ZC 5EUOE 4FFYL 1OHQA 4IHOB 5E4EB 3MGOB 5ICZA 4X7FC 5I1IL 1FC2D 1JF1B 1YY8B 4AIOA 3TZVB 4PLJC 4H0HB 2B0SH 2A0LD 2WUBH 4IOIB 5IT2L 3QUML 4HXBL 3D0LA 1CGSL 1OTUD 2C1OB 4Z78A 5KZCD 4L4VE 2Q3AA 3O4OB 4CVZA 3JTTA 5E7BA 1P4IH 4UIKH 3D2UB 4NGHH 4XBEH 1YZZA 5IMKA 5EO9A 4JY6A 4M6AA 2P49B 4Y16C 3O3EB 5DJZB 3V4VH 6FABH 4AL8L 4FQ1H 2G9HB 1A6ZB 2DBJA 4E41E 4C56D 5M94B 4XC3H 1MCCA 5DEFB 4ZXBB 4BUGA 3DTXB 3QHZL 2BOCB 4XCYB 4TRPL 2F8VA 1I85C 4CN6A 1YNKL 5ESVB 2MJWA 3RWGA 3T2NL 4DZBA 1MJ7L 1ZV5A 2EDKA 5F44A 1YEIH 2EO1A 1J1XH 4HV8A 4F9LA 5JMOC 3O41B 3VXPB 5DDHB 1JGLL 4X98B 3MV7D 3W2DH 1P9MC 4QRPE 4U7SA 2A73A 2EXWD 1NJ9B 2MCPH 4YE4H 5L0QC 4J3WA 3SJVD 2EZ0C 2EDEA 4I3RL 4I77H 1U3HD 4Z7VA 4M4PA 5TFSH 4NKOB 1I1RA 3CZJA 3KYKL 5DO2C 3P11H 3PDGA 3SGJA 3NMEA 5DEGA 1BVLA 1VFOA 2MKLC 3QHFH 5FV2A 4MCYB 2NTFA 4JDTL 4CN1A 5CGMA 3DETD 3BGFC 2IH3B 5HHPA 1HWGB 1FGNL 1YQVL 3V6ZA 1BVZA 1K4DA 3LMJL 4S2SB 3ARBB 1NLBH 4DTGL 1JPFA 1LO2L 3CCHA 3CFDB 3N85L 2XZAH 3PGCB 3DGCR 5D2LA 1UFUA 2AXGA 3QFJD 3F7RA 2WBKA 1DANU 4LCCA 5EBWA 4X5XB 1EIBA 1IT9H 4PD4K 1IFHL 2QQKL 4BK5A 2YRPA 1CFQA 4P9HL 5E5RB 3EW3B 3BRDA 3WIIH 3QDGD 4OCLC 5DYOB 3LN4B 4WO4A 3OAYH 2DI8A 2RFXB 5D2NA 4MXWH 2BDNL 4I0PA 4PGCB 3ROLB 3VI3E 5C0BA 2AKRB 5ICYB 3BVNA 1X5FA 1FFRA 1QLEL 4J3UA 1GIGL 2IADB 4KJPD 3QQNA 1CXLA 3FN3A 1OP3H 4ZOEA 1DR9A 1PW3A 1TZIB 3L3OA 4F7EA 1TJIL 3UPCA 2XTJB 3VXRB 5A3ID 4I1NB 1I8MB 1L9MA 3VH8B 3HLAA 1CDIA 4DEPB 4G80A 3BDYH 4JO2L 1BZ7B 2X4NB 3DO3A 1NL0H 2IPKA 4GUPA 35C8L 1DEEA 4LCWD 4WHDA 2ZUWA 3LKNA 2AJZB 3CDGB 4U1KB 3SPVA 4YHOH 1NEUA 2NXZD 3BKMH 1MHCB 1U8QA 2DBLL 4QOKD 2G60L 1JWSB 4JJ5A 3UZVB 5DQ9B 1DBJL 2YK1H 3W9DA 3FCTA 3LRSB 4K7FB 1YEFL 1PKOA 4F37K 4HG4J 4L3ED 4JLRB 2VXSH 4HWNA 5GSVA 2ICEB 4JAMB 5GS0C 5BVJA 1GAFL 5K9JL 4R4ND 1FO0L 5IROC 1HYSD 1LEKA 5JW3L 5KG9B 3ZDYE 2V2WA 3RAJH 3MACL 3QFDB 4ODSH 1VGKB 3AXLB 5I76B 4KK6D 4U0RC 4JB9L 3GSQA 4G3YH 2Y06L 1VA9A 1EVUA 2VKXA 4WI8A 4M1GL 1G9NH 3V95A 5HBBA 2B39A 4U1LB 3OB0H 2HLAA 2OZ4H 2DJUA 1I9IH 3BSZH 2WBJD 3CC5B 2N56A 2QV2A 5F89B 4F9PA 1B2WL 4B41A 5JPNA 5IESL 1BD2D 4Q6IC 1MIEH 3LKQA 5J1TC 5I1GH 1A6UH 2R9HD 3DV6A 3MRJA 4KZEL 2XQYG 4DK6A 2NY3C 5JZ7C 1A9BB 3S36L 2J8UB 4P5TA 4QCIB 2YEZA 1CN4A 1ZE3C 5FF6B 2BNUB 4EEEA 2FYYB 1QR1A 3ARVA 1TCMA 2Y5TB 2D03H 5D7SH 4MNGB 3PWUB 4PJ5D 1PQZB 5C0FB 3RUGB 3MJ9L 5E2WL 1RSFA 3VWKD 1A3RL 4WJ5A 3U4EA 1F8TL 4F7MA 5JIKA 1S5HA 1GGTA 3G9AB 3OSKA 1EHLL 1BX2B 2EEAA 4GBXA 4Y0GA 4JKPL 3O6FC 2OJEA 1LE5B 2X1XR 4J12A 3DUSB 4HWBH 3QRGH 2OXHA 1NUNB 4OZHB 4RWYH 5C0BE 2VB5A 5TDPA 1BIHA 1H0DB 3BESR 2V5YA 3F7YB 5T5NG 5FKPB 4DUWA 4J1UB 3VXOA 5EC1A 1UM4L 4EKXA 5F88A 5JQ6H 3CVHA 3EYVB 1MWAL 3IDXL 4GG6F 4UU9B 3FONB 3K2UL 4O2FB 2DRUA 3TGXA 3WN5B 3GMNB 4YK4B 3BPLB 5C0DA 1KC5L 1ZSDB 3BZ4B 1AP2B 1KXTB 2BXYA 1UADC 4NYLB 2IBZX 3B83A 3L3IA 4HPYH 1LK2B 3DIFA 5F8QC 4MD4B 5FCSH 1V8HA 3BT2L 3R06B 4W4OC 3CLEH 3Q6GL 3B5TA 4HS6A 3NCMA 4FABH 3FTGA 5ESQA 4J3OC 3TO2A 3W11C 1WJ3A 3HC3H 3QDJA 5GRVK 3FO2B 4YHNA 1PLGL 2AXHA 3QIUA 5ISZA 1I1YA 2F58L 3GBMH 5DT1H 3ARGD 4P48A 2QKIB 2PW2B 2E7HA 4YLQT 5D70L 1LP9F 1QPXA 3VGGA 3D85B 1S9YA 4MS8C 1ZEAL 5ADOL 3INUH 1RURH 3LKPA 5CEYA 1FFQA 2BNRA 4MA7H 1EBPA 3K4ZA 5DD6B 3SO3B 4P99A 1FVEB 3FO1B 2H26B 4MAYB 5B38B 3FZUD 4M8VA 1NCUA 4IJ3B 5HHOD 1ES0B 3GRWL 3OJ2C 4DW2L 2OI9C 2YPKB 5I75C 3HNSL 3QUMA 1T2XA 4KK9C 4ZUTA 5TJWK 4OLZL 3C09C 4IRZH 3ARDD 3L5XH 5DRXA 5BRZA 1LQSR 3ULVH 4NT6A 1AHWB 4TULL 1IEAA 2GJ6B 5D7LA 3QG6B 3OKOB 4X5LA 2N1KA 1VDGA 4FQJH 4RX4A 2Z35B 4F9LC 4R2GD 4LHQB 3EDFA 4OM1L 5EU6A 5J13B 3MUHL 2D4FA 1CVSC 4MX7B 4XCNA 4X6EB 3WS3A 2NY6B 5EU4A 4RMWA 4NN5C 3GMLA 2A9ML 1HOCA 4KROC 4L3CB 5BQ7A 4RA0C 4KH2A 5EPMB 4YHZL 1FBIH 4D2NA 4UOW1 3CFCH 4NKDA 1IGCH 2I07A 5J12C 1TMCB 4PGJA 3M17A 4F33A 1OGAE 2A74A 3SGJC 2JIXD 3WO4C 1EJOL 1K4CB 4TNWK 3FHAA 3HZVA 1MFDH 3BKYH 3MOQA 1X6NA 4Y16B 4H26B 1C7TA 3RNKA 4G9FA 4JFXB 1QSED 1T0NA 5GRUL 3UZEA 4HKXB 4LLDA 4D8PB 1BVKA 4FTVB 4HCRH 4UT7L 2Z91A 2JE8A 1S7RA 3MREB 4I48A 1SJEB 1A9EB 1U8PB 3FN9A 2VDQL 4LCCC 2I9LB 2ZSVA 4MCZA 1NC4D 2B1AH 4M7JH 1G7PB 1NDMA 5I30L 3QXWA 1EPFA 1LO0H 4OLWH 3RZCB 4XPAL 2E8YA 1TDQA 2Z93B 2EYSB 1DQDL 3GJFH 4NJ9L 4WEMB 2P5WD 4WO4C 3WDHA 5C7XL 3HC0B 4JHAL 3P4OB 3EDJA 4NQDB 4JO1H 5D2NC 5JO5A 1T7ZA 4Z7UF 4I0PC 4NDMB 2IBBA 5E8NB 2J3SA 4MJIB 1DLHB 1IAOA 5FYLL 3UJJL 3PHQB 4N8CH 1ZAGA 4HULB 4FQHB 1MRDH 4Q2ZB 3C6LB 4APQA 4L9LB 2DM2A 5HYSB 1IC5L 1G6RH 1A2YB 5SV3A 3ULSA 5I9QC 1B6UA 2C5DC 3AY4A 3MLSL 5DUPL 1S78C 3H7BB 3MV11 5HXMA 3PE9A 1C5DB 1SEQL 1T1WA 4WW1A 4JHWL 3GGWB 4WI6A 5FUZL 4LAJH 2V5RA 4A6YB 1AD9A 3NIDE 3UMTA 4BSJA 3FT2B 1I9RH 2GYSA 2NXYD 5D6DA 1VKXB 1DVFD 3VFMB 4JRXD 2B4CC 5MI0B 5BCAA 5FHBL 2YMXL 1LP9A 1JGEB 4ZS7L 2HVJB 1TVDA 5CP3A 4G6FB 4AH2B 3QXAB 3D18B 1OP9A 4N5ED 4X80H 2A83A 1VADB 1CK0L 1IKFL 5GSRA 1G9EA 2ICCA 3BN9D 5ILTH 1KN2L 5BRZE 1U8JB 4FP8H 5D7LE 3C60B 1X5IA 5I74B 4X6CF 4YDKH 4LHUD 1UVQB 2CRZA 1I8KB 1IGTB 2YD9A 1FLRL 5TPWL 3QDMD 4TUJA 4BKLB 1E6OL 5AZ2L 4U2YA 1IAIM 3BP7B 2GK2A 3MFFA 4NOBA 5EU6E 2A77L 1FDLH 4HFWB 1UT9A 1CZ8L 1NGWB 5IW6B 4JZNA 3H9SD 4JPKH 5GGVY 5L9DH 4H25A 1MJJA 1SEBB 4U6YA 1A7RH 4R97C 5IMLA 2IAND 4U3CA 1F3JB 1ND0A 2V6HA 4BZ2L 4N0YL 4V2BA 4GXUN 4LU5L 1FO0A 3F6IA 4HUMB 4Q58C 4YHKL 1RV6X 2ZKHH 2BJML 4HD9A 3DX7B 4NIKB 1CLYH 2HAZA 3RX7A 3O8XA 2VMFA 5JORA 4F9PC 5C6WH 2VXTH 2VDOH 2EEDA 3ZL4L 4EBQL 3LVEA 3IDGB 3ZYZA 4G9FE 2VJXA 1U2CA 2OQJB 1MREL 15C8H 3F65A 4P2YA 4LCYB 1FYHB 1ZVHA 2A6JB 5JXAL 1WWWX 4XPFH 5CILH 1RZJH 1I3GL 4GRLB 4HZLB 3U9UA 4LGSB 4P5TC 4M5YH 1VPOL 3NAAH 3MRFB 4HS8H 3BZEB 1EXUA 5CBAA 4MMZC 4OTXH 1JZ6A 4NQVB 3PWLA 3SKMB 2FWOB 2VLJA 5I17B 2FX9H 1KB9K 1PZ5B 1QFWM 3NABL 3OZ9L 4V1DB 3HE7B 1G6RB 3A0OA 4NOFA 5I8CA 2P8MA 5F7DB 1QZ1A 4GBXC 2Q6WA 1KN4L 3O3DB 1MUJB 1V3MA 3NCCB 3QR2A 3IRZA 1G7QB 3WSQL 4GG6E 3BP5A 3G6AA 4EI6A 1F90L 4OQTH 2GI7A 2VDKH 2X4UA 3MJ9A 2FGWH 3VFSA 3OGOE 4XC1L 1MH5B 2FJHB 5MEOA 4ZD3L 3DVNA 4H20H 1DUZA 4OI8A 4N1CA 3UTSB 3ZE0F 4Z7UA 3A67L 4R7DA 4MSWA 2VDRH 3P73A 5DLMH 5FDWA 1MELA 5EU3B 2C3VA 3B2VH 5FGSA 4XVJL 4OLEA 4HG4K 5F97E 4ONOA 4YHLH 4PBVC 3AUVA 5FA4B 1A6TA 2PTTA 4K8RL 5F96H 3V5KA 4Z0XA 1A22B 1MI5A 2VR4A 4RMUA 1XR9B 3I3DA 5CJQL 2Z8RA 4YAQA 3LS5L 4POZD 2HFFA 1UXSB 5LCVH 4P3CH 4KJWD 1RMFL 1M1SA 1LP9E 5ECJE 3DX9B 1MWAA 5DO2D 3OF6D 5T1DL 1EFXB 2A1WL 4UDTA 3L5WB 4G42A 2VXUH 4XBPB 1JNHB 2G2RA 2W0FA 3QIUC 2APXA 5TH2B 2OTWA 3IGAA 4P59L 1NGZB 3LEYH 4JFDA 1MJUL 4Z95H 1Y18A 1TIUA 4Y4KB 3VFNA 4LSTH 5ICXA 1S7VB 3RBSA 4BZYA 3UAJC 1IAKB 4N0FB 1F13A 4W81A 1X6LA 4IS6A 3LKOA 4WRLA 3TH4T 5JIIA 1EX0A 1NGPH 1PSKL 2EIEA 4U1JB 4HAGA 1ZLUK 1HNGA 1DQQB 2IQAA 3T09A 4LQFL 2AXJA 2ZP0T 3U2SB 5CJXA 4X6CA 2EIDA 3TT1L 5GQBA 4P3DB 5I19H 5F3BA 1TLKA 3MLUL 5IGXH 5HHNA 3N1GC 1CT8A 5F7MC 5AD0A 3NZ8B 4NC1E 5E00B 1A21A 5FGBA 4GW1A 1D7FA 3B2UC 4MGXA 5ITBL 2XWBB 3W0WD 2FR4B 4NP4L 3TBWA 2G75A 3SQOH 3GRWA 4YUEL 3BPNB 5JHDD 3VFRA 5FYJH 4RGMC 1QFUL 4U7KA 1J05A 4YC2B 2A9NH 3ESUF 4PRBA 4ODVH 3NACL 2FBJH 4X9FA 2E3VA 1FYTD 4OLXH 2VXQL 4R26L 1UM5L 4Z78B 3KG5A 3D39A 3JTTB 3CU7A 1LDPL 1NAMA 5GRVL 5BS0B 2C7UA 1WC7B 2HFEA 3GKWL 3FT4A 4FRWA 4YWGL 1KJVA 4L1HA 2Y4SA 2OI9B 1S8DA 3Q5OA 3NCBB 1YEJL 3QB7C 43C9A 1IM9A 1U58A 1NBZA 5BXFA 1N6VA 2EC9T 2MMXA 1BQLL 32C2B 4PGDA 2YD4A 4OM0H 2AW2A 4ODXA 4RNRA 3V5DA 4LPCA 4I3GA 5AYUL 1VEOA 3RWGB 5JW4Q 4XVUD 4X7SH 4Z7UE 5CP7B 3VE0B 5TGBB 4H8WL 1DSFL 1M4KA 3Q3GA 5E8EA 2X1QA 1ZHNA 1AH1A 4L4VD 2XY2A 3PUCA 3ZDXF 1AXIB 4FFVC 4LEOA 3MBED 1CCZA 1U92B 3HNVL 4NN5B 5E99L 3WJJC 4ORGB 4KROB 5F7WC 4ZUUA 3GO1H 1IAMA 4XXDA 2HH0L 4DOHB 2Y36L 4Z76A 1DBML 1HIMH 1LHZA 4E41D 4Z7VB 5E94A 1U42A 2BNQA 1OQXA 3PWJB 1YMMA 4APQC 2FCBA 2LU4A 1ODAA 3SDDB 1PGRB 1A4JA 4UOW0 1N2RA 4HSQA 4PJFF 1QRKA 1RVFL 3O4LE 3AY4C 1D5ZB 3IFPB 3SDCA 1JRHI 5CEXA 4TUOA 3VJ6B 2DM7A 4JFDE 4K7PH 1BWWA 3F58H 3CCHB 3UPRA 5D2LB 1KLUA 3QXVA 2AXGB 3MFGB 4QRPD 4DJMA 5D6DC 4YFLF 5GGTL 1VGEL 5I1DA 1MIMH 4X8XA 2X6MA 4ZG1A 2Q1EA 4OFYD 4NHUB 2YOCA 4XCCL 4X6CE 1HWHB 3GIZL 1INDH 1D6VH 1MY5A 4AEHH 1CFQB 4WV1A 1CD0A 5C0AA 5ENWB 2DS4A 5HI4C 4HK3J 2BSRB 4FQIL 1NAKL 3CMOH 3VXUA 2CDFA 2D9QB 4L8DB 3IT8D 4NHCL 1TNMA 5D2NB 4W6YB 4DKFH 1N6QL 3O6FD 5GGRA 4U1NA 4NQEA 3KPTA 5IMOA 3SGDH 1DE4A 4TQEH 3SY0B 5DRWA 1RZ8B 5JQHC 3AREB 4WUKH 3RY6A 4U33A 5C0CB 4MNQD 4ZFOA 3KVQA 5B3JF 1KLGA 4U3XA 3PWVB 3ALWA 3L3OB 4GMTL 1NBYB 1KACB 1H3VA 2NMSA 3ZYOA 2R69H 1GCFA 1DN0A 4PLNC 5HPMB 1INEH 3TT3H 1CGYA 2EKSA 4ONFL 3D39E 4JFZL 1NCWH 4N68A 3C08L 1YEGL 2IPKB 3O8XC 4M02A 1JHTA 4Y1AA 1CDUA 3BP6A 5IB1A 1X7QA 2Y5EA 2HRPH 1S9VB 5HVWA 4UUJA 5SX4I 5CD5D 5I18H 5LWYL 4L8BA 2FD6L 2Q8BL 3TYGH 4DCQA 5JW4M 3W11D 5FGCE 5MENE 1XF4B 2ICWI 4U1GC 1CR9H 2KUTA 5FUOL 1CL7H 3RRQA 5KZCB 3P0YH 3HTLX 5DJXB 3NTCL 1P6AB 4LSSL 5JIHA 3WXWH 1E4XH 1RUML 1J86A 3C5ZD 5GSVB 1IAII 4TOYH 5KBNC 5EOQL 5BVJB 3N1PC 4Q9RL 4H88H 3IU3B 1J0HA 3VA6A 3NN8A 1KCUH 2DICA 3LN5B 3ZE0E 2Q7YA 2YD5A 4D9LL 5DJ0B 4U6XB 1HI6B 2EXYC 3H0TA 5I1HL 3U4BH 2BY3A 3R0MA 5EBLA 4XB8A 1GXEA 3K4AA 2X41A 3HAEA 1EO8H 3S37L 2BNQE 3V7AE 2MQ0A 2HLAB 2NW3B 1UJ3B 2ZPKL 4XHJC 2FBOJ 3MV7B 4FFYH 3S88L 1AIFA 1XEDA 5JPNB 5E7FA 2GAZA 3SJVB 5IT2H 5C0RL 4HXBH 5F70A 4EQ2A 5IP4A 5TQ0L 4YGVA 4X0KB 1SY6L 4ZUWA 3BGMB 1T20B 5FA3A 2BVPA 1HHJB 2Z9TA 1QFWI 2XI9A 3AROA 1RD6A 1AE6H 1VERA 4XVSH 3IYLW 5J11C 5J6GB 4XI5D 4R0LB 5EB9A 3F7VA 3ZKXC 2VAAB 3WEXA 4AL8H 1ZA6A 3U4EB 4F7MB 4KUCF 3I75B 3CX5J 1MRCL 2G5RA 4LGRB 4YO0B 3VXUE 4JR9L 3B9KA 4ZPVA 2VZ3A 3QFJB 2DQTH 3GSUA 3QHZH 4OCNC 5DUML 4NQEE 4HLZG 5D1ZD 5LQBH 5I8KL 1MJ7H 1WTGT 1NGYB 2EH8L 2XG5A 5EN2A 1KNOB 5FK9A 4G5ZL 4MYWB 5D1QD 4LDEB 3QH3A 2ARJB 5F3HB 1ZLSL 1O5DT 4QY8A 3OG4B 1JGLH 1CDCA 25C8H 1XGPA 3DNKA 5CJXC 5EC1B 4U0QB 3SE4A 3KYOA 4TNWF 4M1DH 5JA9A 4QRRA 5H2BA 2XNAA 5C0DB 1MHHA 3HZMB 5I1EL 4MB3A 5FGBC 3G04A 1Z9LA 1I1FA 1VFUA 1JPSL 2C3XA 4K3JL 4B7IA 3T4AB 1YEHL 4I2XB 4EUPG 3L3IB 1RZFH 4I0PD 1WBZA 1N5YL 4JDTH 2R0LL 2MQ3A 1J8HB 3V6OA 3VXTB 1JMXA 1KIPB 4AIZB 1FGNH 1YQVH 4H0IA 2WWMD 4LP4A 4QRSA 4DTGH 2X9WA 3QDJB 1LO2H 2FJFA 3N85H 4HGMA 5ISZB 2YC1A 1B0RA 3HUJA 4X6DB 1X5LA 1FZKA 3RDTD 1JF5A 1YEKL 2VLMD 3K1KC 1DBAL 1SYSA 3K0WA 5CGYD 4YIQB 3SBWA 5EORL 5ID1B 4QXGH 4Y5YA 2YKLL 4MJ6A 4ONGH 1IFHH 2ADGB 2NY5L 4M7KL 3WHXA 4KVCL 1KENL 4P9HH 1PAMA 3VXSA 1H3UA 4PJAA 2BNRB 4O2CA 3OKDB 2NXZB 2NYYC 4NJAL 4WHTB 3MZTA 5LGJB 4QOKB 4QHMA 3CUPB 3RWHB 1MAML 4HUXA 3BPOC 4QT5A 4WWKB 3S34H 3CFKB 5J89A 3WXVH 3QUMB 3P2TA 3P4MA 5E4IA 1FSKB 5K33A 3IDMA 4L3EB 4S1SL 5T1KA 5EZOH 4XMPL 5E2VL 3ZDXE 4WFHE 5INDB 5E9DD 3NFSH 3L9RB 4Q9CA 1QLEH 2ZCHL 4WW2A 3AC0A 4XP5L 4YR6A 2FX8L 3T0EB 2VQ1B 3DO7A 1P1ZA 1ZKAA 2AQ1A 5BVPL 3QEQE 5TQ2L 3VDCA 5TF1H 4FQ2L 4JFEE 1F6AB 5JR1L 2O5ZH 4WI7A 1QEWA 1HOCB 2AJ3A 4TTDD 3TBTB 3MLRL 1KJ2L 4X4ZA 4JO2H 5CS7A 2WBJB 5ALBL 2FGZA 2DI7A 3ECBA 4ZAKD 2J6EH 1AJ7L 2I07B 5FYKL 5ESAB 3X12A 3O3BA 2XA3A 4F33B 2A74B 3DX8A 5DD0L 4HH9A 3OKYA 5HHQB 4NSKB 3H6JA 3SDCC 4Z18A 3REWA 1DBJH 1MCKA 1YEFH 3RNKB 5EOTB 1WWBX 3HG1A 1KCRL 2B1HL 2LFGA 1UZ6E 3PQYE 1UB6A 4M7LL 1S7RB 2H8PA 3C5JB 1N8ZB 2VL5B 4S0SD 4FXKA 1TVHB 1CDYA 4OZGB 1GAFH 1TPXC 2H3NB 3AB0B 3VWKB 5JW3H 1NMCB 2AERT 4NPYB 4ZSOA 2K3TA 1NDMB 5TDNB 2ZOLB 4GW5A 2ZJSH 4KRNA 2H41A 1OM3H 4WV1C 5MHSE 2L0DA 1OGAD 1HEZA 2Y06H 4QRRE 5F7LB 4HWZA 2R56L 5C6TH 4ODWA 2Y25A 1RZKL 5B3JE 3D5OF 4K2UL 1QBAA 2ARWA 3TNMB 4KKNA 4FQLL 4PRHA 3VFOB 3P4NA 3X3GH 3G5YA 1FZMA 5IR1A 1IAOB 1FZOB 4BK4A 1MFBH 1AGEB 1RJZB 3HRZB 3RY6C 3V6OE 2R1WA 4F8TA 1FL6B 2CKNA 4MWFA 3ULSB 4IDLA 2ERJC 4JREB 4KZEH 1F97A 4I9WD 3HUJE 3S36H 1T1WB 4E5XA 4EIZC 3SDXB 1DDHA 1QLFA 1MJ8L 5DD1L 3BDBA 4M6ML 2B5IB 2EC8A 5E2WH 2ATPA 4XT1C 5DJ2B 3VXSE 1M6OB 4PJAE 4JG0L 1A3RH 3QNXB 2BSSB 3O3AA 1F8TH 5J06A 1FORL 3DMMA 3OX8B 1NFKA 3QEGH 3ARGB 5EULV 4JKPH 1N64H 3VI4F 2W60A 3OKKB 1V3KA 2NZ9C 1MHEA 3IFNH 4HBQA 1F5WA 4P2OA 3QIUD 4KRMB 1I7UA 2Q7NA 4H1LA 1HCVA 3BWAB 3WBDA 2DQGL 2J88H 4UINL 3D3VA 5DJYA 2YA1A 3K4DA 2Y07L 4WFFE 3TJHC 4MQ7B 2R4RL 2IGFH 2Y1VA 3T2PA 1GZPA 4Y4HD 4PBWD 4JZNB 3EYQC 1RJCA 1HH9A 2LABA 4OCYH 4U6HB 1TNNA 1JGUH 1CDGA 5C8JB 4LLYB 1CGTA 2X40A 1ND0B 3K80A 5DD5L 4HUWB 1EAPA 1HKFA 2EDYA 1RZIA 1FO0B 1A6AB 4IIQB 4DVRL 3Q6GH 5BRZD 1FIGL 5DGRA 1NEZG 4RRPG 4ALAL 5D7LD 1NUGA 2VYRE 1P7QA 2R1YA 4QTIL 4RX4D 2A2QT 1A6VL 2RCSL 1JP5A 4AM0A 2Z31A 4OD3L 3V6FA 3K1DA 3LQZA 2V17L 3KPRD 3SKJL 2D7TH 1ZEAH 4KPHL 4LCUA 3U9UB 3T65B 4KGJA 5T3ZE 2R0WH 4GS7C 3EJZD 4Z7OF 3DI2B 1JJUA 4ZSOE 1H9VA 1QTYT 1WT5A 1EJ6A 2AJVH 2HT3C 2VLJB 3E3QE 4ONHB 5GIRB 2O5XL 5CMAA 3QULB 3GSXA 4QTHB 5DUBB 5IOPB 3IKCA 5DC9B 4JFFA 1QSEB 4G8FA 1HQRA 3HNSH 5L2KB 4K8RC 1HKLH 2P8MB 3TO4A 2AI0L 2LQRA 4OB5L 1SY6A 3B9KC 4YQXL 4K3EL 1EVTC 4ZFZB 1LE9A 4Y4FD 4PRHE 5A2FA 4PRDB 2I26N 1RAMA 4KRPB 5JOFA 1B4JL 5MEOB 3DVNB 5EA0L 4OM1H 2LU7A 1QLRB 3P73B 3GHBL 1MLBA 4WGVB 4PJHA 1EGJH 1J11A 5GS1A 3SE4C 3ELAT 1I3RA 3ZE1F 2A9MH 4LSRL 4YHZH 5I1LB 5L2JA 2GTZB 4X9BA 2X1OA 3MJ7B 4FFVD 1DFBL 4EVNB 4BELD 3G5ZA 1EAJA 4RWHA 2E6JA 3BUYA 4KTDL 4K23L 1F45A 1SBBA 2E27L 2KQNA 3GI9L 1EH9A 3MOBL 1EJOH 1RI8A 2MKWA 4RQQA 3HB3C 4Z9KB 2CDEB 2YBRA 1MWAB 1KPRB 3V6OC 2Q87A 1FZJA 1XH3B 1U8KA 2X7LA 3E2HB 5IW1B 3S3PA 3SGKA 4NO3A 4S1QL 1MFAL 1OL0A 1F4YH 4RCAA 3BZDA 2G2RB 2C9AA 4KJYB 3WLWC 2NXYB 3QBTB 4UQ3B 3IGAB 3WCYA 2CR6A 2VDQH 3MPCA 4JRXB 3ALXA 2IPTL 5ICXB 3SBWC 4TYUA 4YXLH 4NWTL 4QHUB 2EEBA 2ZUVA 4Y5YC 2W9DL 3D3VE 2F54A 4XPAH 1XFPA 4N0CC 3VFUA 1T22A 1WK0A 3PNWA 1HSBA 3B43A 4OBRA 5HJ3B 1DQDH 4HLZH 5ANMA 2YD2A 2PO6A 4JHAH 4MA1C 3HCVB 3MCG1 1LEIB 1R3LA 2JLLA 5HI4D 3FQXB 4OF3A 1PKQE 1NC2A 3X11A 5FYLH 3UJJH 3OAUH 3KPOA 3DWTA 5HHMB 4LKXA 4GW1B 4PG2A 1UKTA 4XNUL 1QVOA 4WW2C 2J1KA 1CIDA 3VD9A 2MOVA 4LP5A 1Q8MA 4OLUH 5CIPA 5DUPH 4BUHA 4Y5XA 4PG9A 4M6OL 5AZEL 3I50L 5F1IA 1I1AB 2AJUH 4FQPA 4HT1L 5DD3H 3RWIB 2IANB 5FUZH 1X4YA 3RQ3A 4JQIL 3S4SB 4EUPH 4AQ1B 3IDYC 1T03H 1F6FB 2J4WL 1CD1B 1UWXH 1IGML 4KUZL 2XXCB 2W59A 3V52L 1HYRC 5AWNL 1U36A 1WBYA 1KELH 1KBGL 4R4BB 2CIKB 3EO1A 4ZS7H 2XV6B 1BJ1J 3O11B 5C0GA 3OGCA 5GZNC 3NH7L 3RL2A 1CK0H 3W39B 1X5HA 1IKFH 4XVTH 1XIWC 3BPOB 1KN2H 3MRMA 1KJ2A 5C09D 3WKML 1R3HB 4M8QB 2GITA 1IM9B 2H6PB 3MZGB 3TIDB 1NBZB 3PWPA 1FLRH 3ISWA 5JA8B 3VGAB 1KJ3H 1E6OH 4RNRB 3TNNB 3UTQA 1SMAA 5IG7A 4TSAH 4RAUA 5IJKA 2A77H 2NY0C 3E3QC 5DVMA 3OAYK 5DMKB 4OLYL 3PXHA 4N0RA 2PXYC 4GG8A 1CG9A 5E8EB 5GISL 1ZGLB 4PRPA 3HE6A 4FQXD 4LEOB 4BZ2H 5C9JA 1I4FA 3PABB 5JDSA 1A6WH 2X2YA 3D0VA 3KGRA 3PV6A 4OV6F 4YHKH 1BZ9B 2ITCA 4QYOA 4KJQD 2EXYD 4OGXH 4PB9L 5T5FL 1SVCP 1OP3K 4RDQG 1WV7T 5DMJB 1W0WA 4LIQE 3AGVA 1U0QA 5JOEA 3B5HA 1OWWA 4EBQH 1YMMB 1X5ZA 1AR1C 1S5IL 4G8GA 2F19H 3KDMB 3U0TB 1A4JB 1N2RB 3QCVH 1IQWH 2JB6B 1AKJA 1T3FA 1I3GH 5E08H 5CEXB 1IC4L 4TUOB 3S9DB 1VPOH 2GY7B 3IU4L 1OCWH 3TA3B 4JANA 3RZWA 5EIIA 3UO1L 1OAZH 1NCBL 3VI4E 3UPRB 4ZO7A 3VGDA 3CNKA 1BZQK 3NABH 3U9PL 2F54E 2A6IB 3OZ9H 1MHPL 1MEXH 1NMBH 2W1NA 4NCDA 3RPKA 2CUIA 3Q5YA 1ZT7B 1MCEA 4C4KT 3DMMC 5ANME 1P6FA 4CJ0A 4AEIH 1KN4H 5C0AB 3RL1B 1G6VK 1CLOL 1JNNL 2YA0A 4Y2DA 2BRQA 2DWEA 2P8PA 1CGXA 4EUPB 3WSQH 4JGUA 2QSCH 1F90H 1MCIA 3O4LD 4P2OC 1XR8A 1JBJA 4XC1H 3KPNA 1H8SA 3JV6A 4U1NB 5GGRB 4ZD3H 1WIPA 3HHRB 4D0CA 1DE4B 1CDJA 1FNHA 4R9HA 4HLJA 3BE1L 2DTML 1Q9WA 3KXFA 4JDZA 4I3SL 1NBVL 3RWDB 3IS1X 4M43H 3A6BH 1M7XA 3OB0K 3SE8L 2NW2A 1KB5H 3QIWD 5CJQH 1DN0B 2R15A 8FABA 3W0WB 2Y72A 3CFBA 3FB8A 4BA8A 3FO9B 4RMSA 4U1IB 4ETQA 5JHDB 2EKSB 2VDNL 4M93B 1CFSA 1JGVL 2VL4A 5D5MB 1U91A 1JHTB 4Z7OE 4Y1AB 3BP6B 1Q1JL 2PYFB 1TQCC 1ZANH 4P59H 1MJUH 2AAVA 2VH5H 3ZE2F 3S35X 3QQ9C 2Z31C 2GFBB 1D9KA 2PR4L 2RR3A 4N0UA 1DL7L 2JELH 3I6LE 1G1YA 2OXGA 2EICA 3BW9A 2D31B 2QJDA 1EZVX 4CKVX 4EJ1C 2WNGA 1NCAH 1PG7L 4LQFH 1WT5C 2MPAL 3EUUA 1KIRA 2APFA 3VD4A 1FJ1B 1MVUA 2EDJA 2X70B 3TT1H 1NKRA 1U41A 4P2RA 3B6SB 3TCLA 4QHLA 1UQSA 2XRAH 3TO4C 1U3YA 2DQDL 4CU7A 1MCWW 5SX5H 2LVCA 3GMMB 2W65B 3MBXL 5JHLL 5IEHB 1T2QL 2WWKT 5FO7A 3WIHL 5D1XD 2MQCA 3ZE1E 2W0KA 4JM4L 3DLQR 5ITBH 1G0XA 5EBLB 3LKRB 4KZDH 3VCLB 3MXVL 5MEND 3NVQA 3EYOA 3VGHA 3BKCL 4PLKC 1LK3L 5HVFB 5DRNB 2EH7L 4BQ9A 4DKDC 3KPPB 4G8GE 4L4VB 2R4SL 1WISA 4IBLT 3PG2A 1U6AL 4EI5A 2RBLA 3G6JF 3MBEB 4QWWC 1QFUH 4DN3H 5GS1C 4XCFH 3CVIL 1SM3L 5F72S 4F2MB 1ADQA 4WUUA 3NACH 5HY9A 2ZUQB 4XBGA 3GMPA 4YGVB 3RVWD 4R26H 4MQXC 5T33L 4G9DA 3QUZA 1UM5H 2PYEA 4GLRH 4YH6A 5CSBA 1EEYA 1FG2B 4PBXA 5IVZA 1HH6A 4LLUB 3CZFB 2P43B 3GKWH 1R3IL 5CAYB 4YWGH 1A3LH 1UACL 3SGKC 1QBBA 3WEXB 3TFKC 4FG6C 5L88L 5K9OA 2I5YH 5DJAB 2D2OA 4X4XA 4DVBB 3B9KB 4M6NH 4WI5A 1XGUA 1BQLH 4QRPB 1A5FH 3GSUB 4QHKI 3SDCD 4OD1L 3KNBA 1BQUA 3DX6A 3MNVA 3QPXH 1M05A 5EZLB 5EBMB 4H8WH 4PJBF 2QQNH 3QH3B 3FQUB 3PDDA 3KXFE 1XGQA 2R2HA 4WI3A 2FX7L 2C3GA 2GEEA 4JKWA 2PO6C 3UTTA 1TQBC 3HNVH 3MUGB 5DRZB 3CFEB 1JHLL 4WTZA 4JPWL 2ZUUA 1WWAX 2Y36H 3RKPA 1DBMH 3IDJA 3VXUD 2GHWB 2NY5C 3PP4H 3G04B 4BFGA 1I1FB 4MNQB 1FHGA 3GMQA 4LARL 4PG2C 2IPUG 4F7CA 1RUQL 4S1DC 1S3KL 4NQED 2VRAA 3IKKA 3RP1A 3DV4B 1M7IB 2GCYB 2VIRA 4Y5XC 3PL6D 1J0ZA 1LEGA 1QRNA 1CXFA 2DAVA 4PYHA 3MV8A 3I2CL 5DK3A 3FHQA 3LPFA 1TJGL 3Q5TA 3OKMA 1RZGA 4ZFFB 5H94A 3F12A 4N0UE 2YC1B 3JV4A 2XTLA 5CHNB 5L7XL 5GGTH 3RVUC 3C2SA 4IRJC 2D7OA 5C0IA 4YDJA 2OLDA 5A2JH 4XCCH 4C57C 4P2RE 2FJGA 3BJ91 2WUBL 4IOFD 3QEUA 4FQIH 1NAKH 5IB3A 1WEJH 1OAYL 2CR3A 4BQCA 4NZRL 4LCIL 4QT5B 1PVHA 3CH8A 5DI8B 5IQ7H 1NEZB 1P4IL 1N6QH 1GPOL 4NGHL 3S3JA 1INQA 1JWMB 5T1KB 3V0VB 5GS3A 4WHYH 5F9WB 4PP2A 3V4VL 4JGMA 1UZ8A 2GW5A 4RBPH 1JMZA 5IJKC 2Q20A 2AK1L 3GJFK 4XP1L 2COQA 2EYRB 4XC3L 4L8CA 1JNJA 3RGVB 4GMTH 1XZ0A 3JBG7 3GSOB 4FZ8L 4WUUE 1BBJB 1FIEA 3HE6C 4PY8I 4MD0A 1YEIL 2E7BA 4B50A 4H0GA 1ACYL 2AJ3B 1BIIB 3DARA 5JLZB 1GHFH 1KEMH 3G5XA 5DQJA 1WUNT 3KYNB 4HJGA 2OL3A 5DHVH 3VDAA 2MCPL 3U6RB 5DMGC 2XFXA 4HH9B 5LWYH 2XWTA 4JQXA 2FD6H 2Q8BH 1RZKC 3JWOC 5TFSL 1ORQA 3REWB 1LVEA 3ZHDA 5FUOH 3HG1B 3TIEB 3C6SA 1LMKA 3NTCH 4EDWL 3QEQD 1UB6B 3BUTA 4LSSH 2P5EA 3TBVA 3ULUF 4OCMC 2PUQT 3MA7A 1RUMH 4PV9B 4JFED 4HQQH 2OCFD 4Q9RH 1Q94B 1B9ZA 3L3JA 1V5JA 3T4YA 1KTRL 4X7TA 3PHOA 3L5HA 3H9YA 3EGSA 1ZT1B 2HT3D 4LSVH 3OJMB 5A2IH 3UTTE 3B4NA 3U46B 1W72H 4PJBA 4D9LH 5EU7E 5ABDE 4F80A 1N0XL 1IT9L 5I0ZA 4HWZB 4Y2DC 2R29L 4QF1B 2H32A 2ADIB 2W9LA 5FXCH 3GIVA 1HHIA 2VERN 3J7HA 1R24B 3P4NB 2QR0A 3PGFH 3PQYD 4K9EL 4X7CC 3M07A 3LEXA 4MXWL 1FFNA 3ZKSD 2YPLE 1QRNE 3QWOB 2R1WB 3MLYH 3QIBD 5B21A 3MV8E 4HJ0C 5HYJA 4XCEA 4EDXA 3L3GA 3C8HA 4JKLA 3F5WA 2QEJA 3RA7H 1JYWA 3JTSA 5TQ0H 5KSUB 4GKNA 4DGIH 1DDHB 5MHSD 3IAGC 3RHWF 3IFOB 4GRMB 5LBSH 3D25B 5KAQG 3VWJD 3ZE2E 1FH5H 4P4KA 2PNDA 4OT1L 1KCKA 4WDIA 2F53E 1PX3A 4L4TE 4WTZG 4X4ME 3SGDI 3DROA 2WIMA 1RUAL 4OI9A 3QI9A 4QO1A 3O3AB 4PV8A 1I9JH 3NGBB 1MRCH 4JR9H 4XNZC 1T5XA 3HB3D 4YX2H 1T89A 1EA9C 4LNVA 3BDYL 3RDTB 3UEZA 4KKCD 2W60B 1YNLL 5DUMH 4OKVA 1NL0L 1QSFE 1D9KC 3QO1B 1MCBA 5I8KH 2VXVH 3TPUB 4OZ4A 1MNUH 4RGND 4YHOL 3BRFA 1DLFL 3CXHJ 5DS8A 4PGBB 1H3XA 2APBA 2LAAA 5DHVB 3L7FB 3BWUC 3U48A 2DKUA 4E42A 3D87B 2NY2D 4CJ1A 5HD8C 5C08A 4CU8A 2VDPH 4N0CD 1MRFL 4Y19B 3DYOA 3VXSD 4XNMA 2WLYA 3D69B 1NFDA 2B20A 1HH9B 4JZJA 3G6JE 5E9DB 5IHZB 4OUUB 3QUXA 4ODUA 1OB1A 4HIEA 3RAJL 4K3JH 2CO6B 3RIFF 4ODSL 5IM7A 1CL7I 2R0LH 4NQSA 1T1ZB 2XKSA 3D1MC 3RIAK 3BAEH 4G3YL 3H3BC 1BJMA 4MB5A 1OGTA 1E4XI 4EI5C 2WUCL 3FFCE 4GMSH 1YN6A 3ARWA 4N1HB 4UNTA 4MJ4A 4QXTA 1KT2A 1MPAH 1W72B 3VMPA 3MRLA 4LLAA 2OZ4L 1I9IL 3BSZL 4PJIF 4WFFD 5E5UB 2P44B 1YEKH 2XPGB 3V6FB 4IHOA 2HT2D 3MGOA 2XQYK 2YKLH 3DSFL 4LGPB 1YY8A 1JF1A 1MIEL 1AI1H 5DFWH 3QUZC 4FOMA 3WNNA 3TZVA 2WSKA 4IOIA 2ZNWA 3CSYB 1RU9H 3GSXB 5AUMA 1MAMH 2C1OA 5IFAH 2JJWA 2AP2A 4KHTH 4JFFB 2HMID 5A40E 4PJBE 3I3BA 2D03L 4K94H 5GZND 1JZ8A 5D7SL 3UTZA 4ZFGL 1MCWM 5IV2B 3HMXL 4HGKC 4R6UA 2E7LA 3ZKNC 4XAKE 1JWUB 1K5NB 1Y6MR 2E9JA 5E2VH 1XIWD 3O3EA 2W92A 2AQ3A 2O5YL 2YRLA 1A6ZA 4XP5H 3W82A 2FX8H 4ZXBA 3NFPB 2WMPA 5T3XL 1A6PA 4XCYA 5IIEB 5T3ZD 2X1PA 4LPVA 3QRGL 4MAUH 5ESVA 5HYJE 1B0GB 4LLWB 1YMHA 5DEZA 5TQ2H 4FQ2H 2V5TA 1MLBB 4PJHB 2CH8A 5GS1B 3O41A 3VXPA 2VN4A 2PXYD 1ZHBA 5DDHA 3UJIH 5IBTH 2V7HA 5ALBH 4FS0A 3MLTA 3P40A 4WNQA 3Q0HA 3BUYB 3K81A 1NJ9A 1CICA 5DD0H 2EO9A 4NNYA 1KEGL 2JJVA 2DYPB 4LMQI 1AXSB 4NKOA 5HSFA 4TVPE 4O00A 4R4FH 1FZJB 5HDLA 2B1HH 2F8OA 4MCYA 4HPYL 3LOWA 3IAQA 4JGJA 5JW4N 2AV1B 3I9GH 2O93L 1ZLVH 3ARBA 3QPQC 3CFDA 3NPSB 1KTDA 3PGCA 2VO5A 2ED8A 4HH8A 2GJZB 2JKXA 4CMHB 3GBML 5DT1L 3PWNA 4ELMA 4MVBC 4X5XA 1R3KB 3OJVC 4HKBA 2R56H 3FQNA 1KPVA 2CRMA 3MV01 5FV1L 4PGZA 3QRFM 4FQLH 4MA7L 4OZHF 5IHUL 3SE3A 3WUWG 3LN4A 4F58H 2RFXA 4P2OD 4X9HA 5E0QA 2DLTA 5C0NC 4PGCA 3ROLA 4IRZL 2AKRA 4Y4HB 5ICYA 3S35L 3ULVL 5GGSY 4PRIB 5F1IB 4KK5D 2IADA 4UDUB 2JK5B 2NX5E 5DD1H 1TZIA 1V7NH 2EIZB 3QDAA 4HBCH 1T6WA 5T1LD 3VXRA 2FZ3B 3SQBA 4JG0H 4Y5VB 1BOGA 3A6CH 5CEZD 3CH1B 3GJEB 3ULUE 2EECA 3H7LA 4UV7H 3H2WA 1FBIL 1BZ7A 5C0GB 4HK0B 3CFCL 1A8JH 4JQXC 5J3HC 2X4NA 1JK8B 1IGCL 2H2PD 2NLJA 3HC4H 2UUDH 1ZHKA 3KPRB 4PP1D 2AK4B 4Y2OA 1VEMA 2W9EH 4LOUD 4DAGH 2HLFD 2AJZA 3CDGA 2BY0A 5D4QA 3MRMB 4G7YH 4U1KA 4P46A 3VGBA 3ZKMC 4HIIA 2GITB 2BX5A 1MHCA 1JWSA 2Z31D 3PWPB 2DQGH 4G6MH 4UINH 5DQ9A 4JFYB 3LRSA 4K7FA 1T1XB 2XOTA 2X4SA 2UY6A 1G84A 1GOHA 5IG7B 2R4RH 3GKZA 4K3DH 2APVA 2HT4D 4JLRA 4JRYA 4JAMA 2IAMB 3ARQA 3LHPL 4GG8B 5KG9A 4YBQC 3K8KA 2CLRB 4M7JL 4PRPB 5FO8A 5D71L 3RKDC 1UXWA 1GGBL 3QFDA 1Z5LB 4I0KA 1H5BB 5DD5H 5C9JB 4OLWL 3FQTA 1VGKA 3AXLA 4JDVA 5I76A 5DFVC 4CU6A 4DVRH 1K3IA 1FIGH 5ID0B 1QSVA 4Z5RB 5AG8A 4ALAH 3EFDL 1O7SA 4ODHL 2DIJA 3L3DA 4QTIH 2XZCH 4U1LA 4RMQA 2RCSH 2DLFL 2F8XC 2YHGA 1WIUA 5IFHL 4J2XA 3CC5A 4ESKA 4LK4A 3P4LA 4OD3H 5F89A 4E0RB 2CD0A 1K8IB 4HIHB 3SKJH 3KAAA 4LSPH 3BEVB 4QWWD 4KPHH 3H3KA 4LF3B 1QACA 4BQ6A 3RVVC 5EIIB 5I8OH 5JTWA 2ESVB 3VG9C 3PXJA 1RK0B 4IRSD 3U7WL 2O5XH 4OJFL 4P4KC 1NUDA 5IMMB 1FRGL 2J8UA 4LVOC 3KPSD 5FF6A 2BNUA 2FYYA 4TUKH 3QI9C 2Y5TA 1RULL 4MNGA 1KG0A 3U30C 5C0FA 3RUGA 3STZB 1W0VB 4YQXH 4ZDHA 1T89C 4K3EH 5IHBA 3U7YH 4R96B 3KJ6L 3GMRB 4Y2DB 2NY1D 1YJDL 3ARFA 3T77B 1BX2A 3MRHA 2HJKB 3PGDB 1LE5A 4X80L 2VABA 3DUSA 5EA0H 2X89D 1IBGH 1NDGB 3HKFA 3GHBH 1OLLA 1C08B 4B7LA 4S11A 5DQDH 4S10A 3F7YA 4YDKL 3R4DA 4UI2A 5FKPA 4MJ5B 4OD2B 2HA1A 1DFBH 5GGUB 2MHAB 5TE4H 1OY3B 5AAWA 5D93B 4NBZB 5IVXB 4JZJC 1NCCH 2PO6D 2XTJE 4KTDH 3EYVA 3QUXC 4K23H 4DZ8B 3RWJB 3GI9H 5C92A 4UU9A 5KSAB 1FDLL 3MOBH 4O2FA 5C07E 3WN5A 4JPKL 3GMNA 5L9DL 1CDHA 2X4PB 2ENSA 4FFWC 4ETQB 1ZSDA 3BZ4A 4LPUA 1A7RL 3QNYB 1AP2A 5IBUB 1U91B 1MFAH 2ORBH 4S1DD 1LK2A 4X5WB 3EHBC 3LPWA 1ZWIB 2D0GA 3MRDA 4LAQL 1NANH 4JY4B 2IPTH 1A3QA 4X7EC 3M8OL 4HHAA 4M48L 3FO2A 3L7EA 4N1EA 2VXTL 2VDOL 1CGWA 4YDIH 4E9LA 4TTGA 5J56B 2QKIA 2PW2A 3QJFB 3TZVC 4K55A 1DCLA 4O58H 1SBSH 4IRJD 4XPFL 1RJLB 3D85A 3DURA 2IBZY 2P24B 2OZ4A 4HS8L 4ZOAA 5L6YL 3LPGA 5C09B 2IWGA 4LLMB 3O4OC 2OP4H 4MXQD 3DGGA 5DD6A 2DKMA 1ETZB 3FO1A 1J7VR 2H26A 4MAYA 2E7LC 2UZIH 1ES0A 5FO7B 2VUOA 1QFOA 2YPKA 3WLBB 3BKJL 4GXVH 4XNUH 4CNIA 4M00A 3JUZA 1T83A 4KI5F 4ZXBC 3F8UB 4Y8DC 4M6OH 43CAA 3HI1B 1AHWA 5AZEH 3TM6A 3WUZA 4G8EA 2GJ6A 2D7MA 3QG6A 3OKOA 4HT1H 3OXSA 5JW5A 4MD5B 4IM8A 4JQIH 3HPJB 3IXTB 2Z35A 5I71B 1J5OH 2J4WH 4KUZH 5IB4B 3CXHK 5AWNH 4JO3L 3TYFB 1P7KB 4X6EA 1ITCA 2VDRL 3HE6D 5DLML 1KJMB 3GMPB 1KBGH 3B2VL 4LLQA 2J8UE 3DVGB 4L3CA 2PYEB 5JW4R 2V2TB 4HWBA 4YHLL 1EEYB 2CIIB 3PIQA 4ENEC 5IVZB 3NH7H 2GT9A 5E2JA 5F96L 3JWDC 4MNGE 4J6RL 3RUGE 2D4DA 2EDWA 5EUOF 4Q6YA 3WKMH 4HGWB 4KQ4H 4G8GD 5K9OB 4X4XB 2ZWLT 3ILPB 1OAXL 3HNTH 4H26A 4JFXA 4HKXA 4D8PA 3DX6B 3ARBC 2P48B 5I6XC 3FT3B 4X6BB 4HMDA 4OZHE 1IC1A 1SJEA 1A9EA 4QKXB 4OLYH 1U8PA 2XG4A 4Z95L 2I9LA 5J1AB 2PTUA 4FZEH 1XGQB 2R2HB 1T21A 1G7PA 2VSCA 4Q0XL 4RFEA 3VXMD 3O4LB 3RZCA 1NGPL 2E5EA 4K3HA 3ARSA 2EYSA 1BREA 2XA8L 3BQUD 3SE3C 5T5FH 1F3RB 3QUYD 2XN9D 2M2DA 5J8OA 4HX1A 4DUVA 3H9HB 2O61B 1S5IH 5IGXL 3WHE1 5C9KA 4U31A 3N0PB 3B9VA 4MJIA 1N3NB 4FQHA 4Q2ZA 3C6LA 4L9LA 5HYSA 3IU4H 1A2YA 3KXFD 3SQOL 1NCBH 4O51B 2B8OT 3JV4B 3U9PH 3O3UN 2XTJC 2WQRA 3NBNA 2P8LB 1L6XA 1MHPH 2HJFB 4PJXA 4L29B 4YDJB 2CMRL 1K9TA 5F93C 3FT2A 2F5BL 3VA2C 2FJGB 4DEPC 3VFMA 4ODVL 4OI7A 1TZGL 5IB3B 1LNUA 5GS2D 1JGEA 4WU7A 3NCYS 4P46C 4AH2A 3QXAA 5GRZA 1BJ8A 3D18A 4BQ8A 3KHQA 1VADA 3EOYG 1KYOJ 3MQIA 1U95A 5E6IA 1U8JA 5EIVA 3BE1H 2A6KB 2GJ6E 3C60A 2DTMH 2ZUXA 1UVQA 1E4KA 1I8KA 3QQ3A 1IGTA 3V79C 4I3SH 3EOTL 3SO5A 1BAFH 3SE8H 3O6KH 4P2RD 1J10A 3BP7A 5D1XB 2D7PA 4HFWA 2OMNA 4PTUA 1ZVYA 5F7YC 5IW6A 1D5MA 4LNRB 1JPGB 2GKIA 3VRLF 3QNZA 1Y6NR 1P5UA 4HCRA 1Z0NA 4LRIA 1JGVH 1F4HA 4NRYA 4JQVA 1F3JA 1UEYA 3HI6H 2Q76B 4OFVA 2FO1A 3BPCB 2I24N 3SGEI 1CLZH 3T3PF 2PCPB 2VR5A 3DX7A 4NC0B 2BERA 3KPMA 3KR3H 2PR4H 4EI5D 4WFGE 1DL7H 1ORQB 2AQ2A 3U7AA 1C7SA 3IDGA 3P9MA 2Y6SC 2OQJA 3O0RL 2LV4A 2X42A 3GJFA 4FTVE 2A6JA 4LCYA 5CKAA 3MOAH 2P5EB 1PG7H 4WUUD 4XXCA 1A1NA 4JN1L 2APTA 4MMXC 5K93A 4GRLA 1HZHH 4HZLA 3TVMA 5IB5B 3MRFA 3BZEA 4P2QA 1W8NA 1AY1H 3L3JB 4JCLA 3F58L 4NQVA 5DMIL 5HI5D 3SKMA 4X4YA 2FWOA 1PZ5A 3E8UL 5JHLH 2RAMA 1T2QH 4V1DA 3HE7A 1G6RA 3WIHH 1IZKA 1R5IB 2QHRH 4JM4H 2H32B 3MYJA 3ARFC 5F7DA 3OKNB 1INDL 3MXVH 3ZKND 3O3DA 4NQDE 1MCFA 3LZFH 1MUJA 4HPOH 1P4BH 5FM8A 2R4SH 3CMOL 1G7QA 3MR9B 4LBEB 1T1YB 1T0PB 4WCYH 1CXKA 1OPGH 4MJIE 3MNWA 2C1PA 4PJ9D 4PRAB 5D72L 4GRWF 1MH5A 1FFNB 3S5LG 1SM3H 2FJHA 1FGVH 4XCEB 3QT2A 3UTSA 2HTKD 3U0WL 5EU3A 4XB7A 2IQ9L 2WLZA 4BH8B 5IFJA 4HMEA 4Z7VF 4HF5L 5FA4A 3VG9B 5LG1A 5IQ9B 3WN5C 3ULVE 3MLWH 1P4LB 3BPLC 4WDIB 4YK4C 1R3IH 4TNVK 3PL6B 5MP6L 3BXNB 2R69L 1XR9A 1UACH 1XGYH 4PV8B 5L88H 1VHPA 3WUWB 5GXBB 5KVEL 1UXSA 3U30B 4KDTA 1INEL 3BO8B 5CLTA 1T5XB 3DX9A 5T5NF 3NA9H 2VDLL 3OTTA 2YPLD 1QRND 3C2AL 5D2LF 2MNUA 4XBPA 1JNHA 4P23D 2WK2A 2R0ZH 4HIXH 1RPQA 1RUPL 2DJSA 2HRPL 4OZ4B 4XP9H 4EOWH 5I18L 2OJZH 2GK0B 1S7VA 5HVHB 1G9NC 5DS8B 1IAKA 4N0FA 3MRQA 1CQYA 4TSCL 4DGVL 4KI5E 2F53D 3TN0A 5C08B 1JHLH 3C8KA 2DM4A 4L4TD 5BZWB 4YDVA 2ZG3A 1O0VA 1NFDB 3SN6N 4MAYC 5EWIL 4P3DA 1IM3B 4IJ3C 5IHLB 1CLCA 4HIEB 3BH8B 5ERWB 1Z3GL 4LARH 4NO2B 3QWQB 1T83C 3VDBA 1S3KH 5SV4A 3NZ8A 1QSFD 4GOSA 3UCRA 3O2DH 5E00A 5IW3A 1L9NA 4NQSB 4OCXL 1AHWC 3OPZL 2ZCKL 5DJDB 3SDAD 3I2CH 5KSBA 4LL9A 3UYRL 1TJGH 2XWBA 3VFVA 1R3JB 2FR4A 4Z77A 1YN6B 2ZZUT 4J3SA 1EO8L 1MFCL 2UWEB 2PF6A 5KTEL 3LV3B 4IMKA 5F9JB 5L7XH 3DXAA 5J13C 5CKGA 2L7JA 3JWNC 5K9QG 3WNOA 2NY6C 2C4XA 4NNXB 2EDTA 1XT5A 2ZG2A 4PJ8A 1Q9OA 3RTQD 4AZ8A 4OF5A 4OQTA 2CKBL 1ONQB 1AQKH 1OAYH 5AUMB 4OV5B 4NZRH 1NFIB 4LCIH 3TWCH 3T2OA 1DUYA 4V1DE 3CGTA 2HYMA 2EDXA 4P9MH 1IGFL 4D9RE 1GPOH 3THML 1AE6L 1ZTXL 1BMGA 3UTZB 5BS0A 4XVSL 1WC7A 3FFCD 4X9IA 4ZNEE 3IJYB 5C71A 4PJFB 1IC7H 3ZKMD 1G7JB 4YXHH 2H2SD 2AK1H 4XP1H 2E7MA 32C2A 3V8CA 2DQTL 4UAOC 3QCTL 2M1KA 1CE6B 4N90E 2FH8A 4FZ8H 5LQBL 1YMHB 3LB6D 2X9YA 4AK1A 3UTSE 5CP7A 3VE0A 2QLVB 5TGBA 1U93A 1C16B 5B4MC 3RZCC 1ACYH 1JUFB 1ZHBB 1OD7A 2V7HB 2AS5M 1CFTB 25C8L 3QP3A 1EFQA 5LXGL 3MLTB 3BEWB 1U92A 1N4XL 4OKDA 4WNQB 3BOVA 1G7IA 5KSVA 1BFOA 4M1DL 4ORGA 3IB4A 1T80A 1U8NB 3W9EB 5DFVD 5ACZB 1CICB 3QIBB 4ZODA 4NNYB 1EMTL 4NO0D 2DL9A 4C58B 3KPQB 3IJHB 3QCUL 1UWXK 3PWJA 4XZUB 2UZYB 3C6LC 4L9LC 4XTRC 1E27B 3SDDA 1OOAA 5ITFB 5H35A 3KS0J 1RZFL 4EDWH 5C0JB 5HYJD 4RMTA 4DFIA 1D5ZA 3IFPA 3VJ6A 3AS2A 2R8SH 5T3ZH 3SEPA 3RVVD 5I6XB 1R5VB 1KTDB 2X9XA 3ULVC 3DUUB 3PWNB 4P4KD 4ELMB 3V5HB 5EUKA 5DZLA 3MJ6A 5MI0C 1N0XH 3HZKB 4QXGL 5CJ8A 4GQ9H 4HKBB 4NHUA 1V7MH 2C4FU 2R29H 3FQNB 4AEFA 1KPVB 1BF8A 2NTSP 4ONGL 1XGTA 2YD3A 4TVPD 4RGNB 5ENWA 1JPST 4JM2B 2BSRA 2ZUYA 4L8DA 1AGDB 4ZOBA 1WCBB 4K9EH 1YECH 4U49A 3VFTB 4JFPA 4NM8L 3S34L 2NY2B 1MQ8A 5E6IC 4QGTA 3WXVL 3VRLE 2BXZA 3C60C 1GOGA 5I74C 3T0XA 4Z7NF 1E4KC 5EZOL 3HPLA 4JY5H 3WFDH 3SY0A 4HKJA 1RZ8A 3KLSA 3NFSL 3GSVA 3AREA 1ZT4A 4KI5C 5C0CA 3T1FB 3LQAH 5E8OB 1TCRA 1G9ML 1CD9B 3WHE0 2R23B 3T3PE 3PWVA 3DBXB 4J4PD 1NBYA 4OT1H 5CBEB 4G8IB 1KFAL 5F6HJ 2YUZA 3QUXD 3CDYA 4LRIC 1RUAH 4JQVC 1BOGB 5TF1L 5HPMA 1ZA3B 2OX5A 2O5ZL 1PG7W 5INCB 2FEDD 4FFWD 1RIVH 1C1EH 3T2QA 3TV3H 1YNLH 4BZ1L 4OBSA 2NLJB 2J6EL 5BS0E 1ZHKB 4PREB 2BMKA 3NCYP 1S9VA 4P46B 4PJEB 3NIDF 2BK8A 4HIIB 1DLFH 5HHVL 2NX5D 2APWA 2HVKA 4XXCC 1XF4A 4GRLC 3SCMD 2X4SB 3TVMC 1MRFH 5DJXA 3TZVD 3V8OA 4JRYB 1X4ZA 2X4OB 1FFOB 5HGHB 1LD9B 3ULUD 3HE7C 1Q0YL 4GRWE 2DTSA 2AGJL 5FO8B 3IU3A 1UXWB 5E8PB 4C56A 3D2UD 3ARYA 1S7TA 2ZJSL 3FQTB 4JDVB 1RY7B 4DN4H 5CEZH 1OM3L 1UYWH 3LN5A 5DJ0A 4U6XA 1HI6A 3P3YA 3QUKB 4DOHE 1KPUB 2BCKA 5C6TL 4NO5A 2WUCH 4YPJA 3L3DB 4Z7VE 2QSQA 4ZXBD 3HS0B 1U8OB 3QZWA 2NW3A 3FQRB 1PD6A 3WMSA 1UJ3A 4TPRH 3X3GL 2YZ1A 3GBNH 3MV7A 4M7LT 4ZOCA 1MFBL 4CGTA 3DSFH 5HYEA 5HPOA 1GC1L 3FB6B 2OR7A 1S9KC 5IBLD 3SJVA 1QBML 1REIA 2ZNXA 2A6DB 3MRRA 1U3HA 5D2LE 1A0QL 4X0KA 3PP3H 3BGMA 1T20A 1HHJA 3OR6A 3BISA 4OIAA 4ZFGH 4MA3A 1KG0B 3HMXH 1BEYH 4KDTC 5J6GA 4R0LA 3NZHL 1AC0A 2CSPA 2DLGA 2DN7A 4ZDHB 2VAAA 4I18A 2O5YH 4KMTH 5FYJE 3REVB 4Z7QE 3ARFB 3I75A 4YO0A 2H45A 3RVTC 3MRHB 2SEBA 5T3XH 3QEGL 1QSZA 3QFJA 3BD3A 5D2NE 5GRYA 1N64L 4WI4A 4UZGA 2VABB 3I6GB 4Y4KC 3U79A 3B9AA 3VFGH 1OP5H 3IFNL 5SX5K 1NGYA 3RWCA 2QHLA 1KNOA 4GAGL 4AENB 1L0XA 4UTBH 5C0CE 2VWEC 3TN0C 2ARJA 5F3HA 4KU1A 2IH1A 3C5SB 3QDGA 4WHCA 3D48R 4JE4B 2J88L 1FC1A 5GGQL 4UILL 4JHBA 5C86A 1OTSC 2IGFL 4HXAH 2NY4D 1KEGH 1RZJC 3DRQB 2R2CA 4OCYL 5D7JD 3N9GH 4J3TA 3HZMA 3QJHB 4ZO6A 1JGUL 2EDOA 4XHQA 4JG1H 3T4AA 4I2XA 4KY1L 3GUTB 2VN7A 3SDXF 3K2MC 2IJ0C 1MQKH 3BPNC 1J8HA 3MRDB 3VXTA 3UYOD 1KIPA 4AIZA 4IMKC 3TF7C 1KSRA 3QO0B 5IVNA 4ELKB 4HHAB 3L7EB 1PKQB 4LSUH 2FIKA 4X6DA 1L4IA 3C9NB 2XTJD 4YC2C 5KVMC 4YIQA 4PJ8C 3X3FH 1IMHC 2PN5A 5ID1A 5C07D 3DURB 1B4RA 2D7TL 5HGDB 2VLRD 2ADGA 2R0WL 4ZPTB 1DP0A 3TPKA 3OKDA 3DGGB 5IHUH 4WHTA 2AJVL 5LGJA 4QOKA 3RWHA 3CUPA 2IF7A 3FJTA 1GL4B 1RJYA 1S7SB 1FL5B 3RU8H 4WWKA 3CFKA 2BVUA 3EOBB 3WNLA 4CNIB 1HKLL 5GRJL 2FSEB 4L3EA 3V0WH 3S35H 5INDA 4LFHD 3MRBB 43CAB 3L9RA 3R1GH 4G8EB 4R7NB 4Y7MA 1Q9LB 5CIPH 2NR6D 3OXSB 5JW5B 4NQCD 2RHEA 4NUGL 5EOCJ 1AO7D 3T0EA 2VQ1A 4MLIA 4HDIB 4WTWA 2YD8A 5SWSB 4OFPA 1IQDA 3SJVE 5AAMA 4YEEA 1QG3A 4G6KL 1F6AA 1EGJL 1EHAA 4LLQB 3KLAB 3BIAX 1KTLA 3TBTA 1F58L 2WBJA 3PIQB 3G5VB 1KTKE 2GT9B 4G6AD 5ESAA 4G7VH 2OK0L 2P45B 2Y7QB 5SWZB 1BD2A 5J57B 4ZUVB 1TITA 3SDDC 1FAKT 5FIEA 4IRSB 5HHQA 4NSKA 5M95B 3QFJE 1DQJA 3KPSB 3S5LB 3QZWG 5EOTA 4EXKA 2AXFA 4U1HB 1F4YL 2J5LB 4GXUM 1ZLWH 3C5JA 1N8ZA 5K59F 1F4XL 2VL5A 4KGLA 1I8IB 4JHZA 3K8MA 5ADPH 1TVHA 4LKCB 4OZGA 4UAOB 4BJLA 2H3NA 4W68A 1NH6A 3LHPH 4KKAC 3VWKA 1TVBB 4ODTH 4CVUA 4NPYA 1T21B 4YXLL 5D71H 4RFEB 1GGBH 5TDNA 2ZOLA 4Z7NE 5DMYA 1U8LB 4KFZC 5JPMB 3V6BR 4RBPK 2QADD 4OCWL 4PJCA 4NN7B 3EFDH 2Y23A 4ODHH 2JJSA 4X83A 1QUNA 1J18A 3OKEB 4HX1B 4BQBA 3TNMA 2DLFH 5FOJA 5IFHH 4O4YH 4L8SB 3VFOA 2DQHH 4I2XE 3MCLL 4KC3B 1KUMA 4UV4L 1FZOA 1FNAA 3OAUL 4LASL 4PYGA 4BFEA 3AREC 1AGEA 1RJZA 3HRZA 1J8HE 3JWOH 5JXEA 4HUNB 3FO0L 5I1JH 5I2IB 1FL6A 1KCLA 2GSIB 3QDJE 4OLUL 4OCSH 3U7WH 3OAZH 5ISZE 3MO1A 4OJFH 3O9WD 1FRGH 2AJUL 4KKBD 4EN3B 3OXRB 5DD3L 5HGBB 3SDXA 2YS4A 4PJXB 1DBKH 1FNSH 2HKHH 4UT6H 3UTPE 3RWFB 1FL3A 4WWID 1RULH 1T03L 2YSSA 5B39G 1N0LA 4X6FB 5DJ2A 1M6OA 2BNRE 3K46A 3QNXA 2BSSA 3KJ6H 1YJDH 4QOKE 4TSBH 1KELL 3VG0H 1LNUB 1GGCL 3AAZB 4NFDA 1B0WA 4WU7B 1PJ9A 3OX8A 1M7DA 3ARGA 3FFDA 1GVIA 1YUHB 3OKKA 5KS9B 1NQBA 1P2CA 4X8JB 5DTFB 4XVTL 4L3EE 1U95B 3IXAA 3NCFB 4KHXH 4O5LH 5E6IB 1OTUC 1TTFA 1JZ2A 2CK2A 3SDYL 3WFCL 2N7BA 1WFOA 3BWAA 3X17A 2J6EA 3QQ3B 4TNVF 4NWUL 4NZUL 3T0EE 3S96A 2HKFL 3D85D 1IL1A 1KJ3L 1CFNA 3GNML 4X9GA 3OR7B 4MQ7A 1BJ1H 2HG5B 4TSAL 4GKOA 3VD7A 1Q9KB 4PTUB 5CINH 5JUEH 3TBSA 1D5MB 1A7QL 3LH2H 3QNZB 4MAYD 4U6HA 2IFFH 1RIUL 5D7IA 5C8JA 3MLVH 4LPYA 4NRYB 3HRPA 4LLYA 2DIAA 4LMQE 4CADB 4HUWA 4XRCB 1A6WL 1U3ZA 5C2BH 1A6AA 4IIQA 5GS2H 4LAQH 3TCXA 1JVKA 1S7WA 2GJ6D 4OGXL 1UJ3C 3BI9X 3KPMB 3M8OH 2AJXH 4M48H 5EG6C 4PGEB 3MRKB 2F19L 3P9MB 3FN0L 2YD7A 3GSRA 3GJFB 1MOEA 3QCVL 1IQWL 4WI9A 5HGAB 5IWLA 1QKZL 2YXFA 3ESVF 1A1NB 1U3HC 4XPTL 5E08L 2D7NA 3T65A 2VLKB 4OZGE 2NY6D 4UIMB 2BOBB 3TVMB 1OCWL 4JZOB 4P2QB 1FVCB 5L6YH 2FHFA 1G7LB 1OAZL 4PLJD 5GIRA 4ONHA 3P77B 4X4YB 2V9QA 5ACMA 3QULA 4PUBH 4Q74A 4QTHA 5DUBA 4R0LC 5IOPA 1MEXL 1NMBL 2DOCA 1QSEA 4I18C 3MGTA 5GS0L 3BKJH 5L2KA 2VZSA 1FNFA 2V7NB 3MYJB 3MROA 1SHMA 3OHXA 1BM3H 4AEIL 3MV9D 4Y16D 4ZFZA 2ZSWB 5DGQA 1NC4A 5I16B 4M4RA 1IGYB 1H8NA 2QSCL 4FTVD 4PRDA 3VXMB 3KYMA 1HXMB 3MNWB 1SYVA 2C1PB 4RFNC 5F7HA 3QEHA 3BQUB 5FOBB 4JO3H 3QUYB 2XN9B 2P5WA 1QLRA 4N9GB 5I73B 4YHYB 3RZCD 3SDXE 5IFJB 5I1LA 2GTZA 5CWSB 3K7UA 3MJ7A 4I5BB 1VENA 4M43L 4EVNA 3A6BL 5DK0B 3GB7B 2PW1B 1FNEB 1LO5B 2NNAB 4U6TA 4J6RH 2ITDA 5FCUL 3E6HA 1KB5L 4NQDD 5TDOA 4KJPC 4WTXA 3EOAB 2EZ0D 2BSED 2CDEA 1D5XB 1OAXH 1KPRA 1XH3A 5IW1A 4D0BA 3C6LD 3FB7A 4XX1G 5A3IC 4B5EA 3DYPA 1XF5B 4KJYA 3SKNA 4KXZI 5DJ6A 1ZANL 3LCYA 4UQ3A 5EIQA 1A1MB 5DF0A 3DSNA 2LTQB 4MA8L 3VFWB 4JRXA 1J1OL 2VH5L 5I66A 4QHUA 4XAWH 2JELL 4Q0XH 3MRQB 2J8OA 1ZGLP 2XKNB 1MFNA 3TN0B 4HZAA 3C87A 1NCAL 3C8KB 3CPLB 2NXZC 4BSWB 2XA8H 4YDVB 2YWZA 5HJ3A 3GSNL 4M03A 4G6JL 4LEXL 4KMLB 3HCVA 3SKOB 1Z9SA 4WWKC 1LEIA 1A7OH 1AFVL 2FO4A 4YNYB 4G6FD 3FQXA 3MA9H 2YUVA 2XRAL 2P42B 1FSKC 1XCTB 2DQJL 4URTB 4R4NC 3GDBA 1BFTA 1HYSC 3RJDA 5KSBB 3C60D 3VFVB 2BVTA 4KZDL 4Z77B 3P0VL 3T0EC 4P5MB 1WZKA 4YPGB 2QQLL 5L8LB 4W6XB 4KK6C 1I1AA 3O81A 2AEQL 3UZQA 3DXAB 1JGDB 3RWIA 2IANA 4R8WL 4HIJB 3K3QA 2CMRH 3S4SA 4DN3L 4XCFL 2F5BH 1CD1A 1LGVA 4LVEA 4PJ8B 1JN6B 1SJXA 1Q9OB 4N8PA 5KJRL 2WBJC