1IFHH

A detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Detailed analysis of the free and bound conformations of an antibody. X-ray structures of Fab 17/9 and three different Fab-peptide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ifhH01
1NC2A 4X5WB 4N0UE 2IH1B 1MHPH 4TULL 4HWZB 4JKKA 3VFWA 3VFRA 1JNNH 4S1RL 3NH7L 5B4MC 4MA7H 4C56D 2DMBA 4R0LB 1UKSA 1MPAH 3MLRL 4JVWA 1DANU 4LNVA 4YX2H 3WS3B 1HHKB 1YNKH 1TJIH 4XC1H 3DMMA 1UVQB 4K2UL 1KLFA 2LU4A 2APXA 4GKOA 2OTPA 1T89A 1U8JA 1FFQA 5D5ME 3LKQA 4JQXC 2N7AA 1X5IA 3S34L 2JJTA 4QRPB 4AT6B 1YN6A 2HG5B 3RL1A 2PETA 5DJYA 4JFEE 4XBEL 4AEIL 4XVJL 3L3IA 2NR6C 3IDMA 1I3GH 4HJ0C 1T0NB 3UAJD 1X5LA 4DGIH 3KYKH 3LIZH 4OLVH 4ZUWB 2NY2C 4L8SC 3QI9C 1FVDA 3P9LB 3MRNB 3WUWB 4WGVB 1CTNA 3ARBD 3T0EE 4JFED 4CRPA 3O6FA 1TCMA 2GUOA 5F7MC 1KBGL 2FBOJ 5I8KL 3P3YA 1AE6L 4LSQL 3QIBC 3BQUA 2BZDA 4J7RA 1NH6A 2EH8L 3C6LA 3GRWA 3T0ED 1MCFA 2BSTB 4PP1D 1RVFH 2K9UA 3V4UL 4XBGA 1P7KB 1E4JA 4XWGH 5IKCA 2X10A 4LARH 1FGVH 2NY0D 1FBIL 5L2JB 2A6JA 3UDWA 4WEMB 2A73A 3D69A 4PY7A 5C0BA 1HINH 4LQFH 1QG3A 2IPKA 3R0NA 4GBXA 4XP1H 5KZCB 4WI7A 3BOVA 3TBVA 4PRNA 2EIZA 2AXHA 4IRJA 4XAKE 2EXYD 2XA8H 1LEGA 1CTOA 2OLDA 1BFSA 4NRZB 3BD4A 4JZJB 2XPGB 2WWMC 3O8XD 1LK2B 3RWFB 3UBXG 4TRPL 4UNVA 2CJUL 2H9GA 2Z8RA 3MCLH 3C60B 3TFKD 4RIRA 4Y19A 4G42A 5T1LA 4XAKD 2C26A 1N59A 2OBGA 3TT3L 4KDVA 3DIFA 2OJEB 4PFEA 3R06B 3RWGB 4WTXA 1EUUA 5DDHB 5F89A 3MGTB 1MIML 2NY3C 4ZO7A 5INCA 1EPFA 3ZYOA 3VD4A 4OCXH 3KS0H 5HJ3B 5B39A 4DOHE 1OP3K 2KZWA 3WD5L 1MY5A 1KEMH 5E94A 2W65A 3MRMA 5E24E 4M6OH 2NNAA 2HTLD 1YY9C 4HW6A 5E08L 4TSAH 1YMMA 3HRZA 5FHBL 4EVNA 5EU5A 1JF5A 1L7IL 2LAGB 2WBJB 1I9EA 3E6HA 1AIFA 1A3RH 1EZVY 2Y25A 1QEWA 4K07A 1BFTA 8FABA 4F7CB 3AMKA 4FFVC 1UYWH 4IS6A 1CLZL 3T0AA 3QQ3B 3W5NA 3MZTA 1UJ3A 2VXVH 3CFIC 1JGEA 1UFUA 5HHOD 4ZFGH 4DAGH 4M6NL 5T5NF 3MFGB 4HMEA 3IVKB 2OR8A 1OVZA 4U1LA 3ZKNC 3DXAE 5D71L 5D9SA 3QRGL 2WQRA 3BEWB 3QUXD 1RZ8A 3ARUA 3UTTA 1GZPA 4KRPB 3VFNB 5FV2A 2K3TA 2JIXA 5GRJL 1MCRA 3S35X 1AY1H 4FG6D 2X4TB 1WICA 4XH2B 1OF2B 3CCHA 2EE3A 3HC4H 4MVBD 4ZOAA 1S7TB 4B50A 2R69L 5HDBE 4P46B 2XOTA 3UJTH 43CAA 2IGFL 4OM1H 3MNZA 4UT7L 4TUJA 3CFCH 3HI6H 4JM2A 4KXZI 2A6KB 5EU4B 5C0JA 3O2DL 4OCMC 4MMXC 2ITCA 3CLEH 4FXLA 5K9JL 2H2SC 3QDJB 2HVKB 3MJ7A 4PRAA 1GZQA 4G7VH 5IK3B 1IE5A 3AY4C 5GSVA 1PKQB 5JORA 1O0VA 4GRWB 3C5JA 4ZSOB 1WBXB 3ULSA 3GMLA 1R5VB 3RZCA 3I85A 3MRQB 3ZTJG 3PWUA 2FEDC 3C5ZB 4ZTOL 3DVGB 3C6SB 4HS6A 3B3IB 4F15C 4QRPE 1IQWL 3L3GB 2R0KL 1ACYL 1SY6H 1B0GB 4CN1A 1J1PL 3QIWA 4L1DA 1WT5C 4XCCL 2Z91B 4CAGA 1XZ0A 4HUWB 1Z0MA 3JV6B 3OKMA 4MDJB 4L9LA 4YHNA 4ODHL 4QRPD 4ODTH 5K59E 4XWOD 1KB5A 1YUHB 1EEZB 3DRTA 1NFDF 4P5MA 2DQGH 1CWVA 4NZJA 5BS0E 3GSNA 4WHCA 2VDKH 1SJHB 1Y18B 3AB0B 4M6ML 5AYUL 3IETA 5TGBB 5GZNC 5EOCH 1AHWB 3VXTB 4DZBB 2W07A 1J5OH 1N0XL 1CBVL 1GGUA 4H5SA 2JB6B 5MI0B 4HUMB 5ESAB 1XF3A 5D1XD 3GDBA 2GT9A 5DVNA 1D5ZB 4JFXA 4G6MH 1YQVL 1F4XL 1FCCA 4BKLA 5I71B 3MREB 3WXWL 1OB1A 4WHTA 4C56A 4JKPL 5FUCE 1A1NA 4YEFA 3MBXL 3UTPD 4N0UA 3MX0A 1QBBA 3D0LB 4PLOB 3JV4B 2G75B 5DFVC 2B5IB 9CGTA 3NABH 1Q9OB 4O02H 4WV1A 1P6AB 2P1YA 3JUZA 1MJJB 2OP4H 2Y6SD 2CRYA 4MQSB 4O4YH 2P8MB 4XP5H 5D2NC 1J86A 2CK2A 3FQRA 2H6PA 4OT1H 5KZCD 1T3FA 1WBYA 4QHLA 5D5MA 4YJZL 2EIDA 3WNMA 1QPXA 2DD8L 5IESH 5K9KB 3GIZH 1I9IL 5IHUH 3CSPA 2HVJB 2FJHA 5E2WL 3ARBA 2JELL 4JFEA 1P84J 4UTAL 3P73B 3G5VB 1DTUA 3D18A 3JZ7A 3QWOB 2CR3A 4MJIB 3C60D 1F58L 1BQHG 4MLSA 3T0EA 1UM6H 2VDLL 5DMIH 1V7NL 1G9MH 5IJVB 1CXKA 4JO2L 3WFDL 3N50A 4PJEB 5E2UL 3V6ZB 4F7TB 2BOBA 3OR7B 4HUUA 2EEDA 5HI3C 1FHGA 4F80A 3F5WB 2W59A 3CXHJ 4P3WA 3VH8G 3DMMC 3WIFA 5DD6B 4HGMA 4XC3H 1I1AB 3SCMC 1WV7T 5JA9A 4JVPA 1NCBL 4M5YL 4XP9L 4JFPA 2AABL 1HEZA 3KR3H 1T89C 2HJLB 3JWOC 1BM3H 3U46B 1KN4H 5KS9A 5JOFA 2WBJD 1X5YA 4AIZB 5F9AC 5D7IB 1IAOB 4FQ2L 1HZHL 5TF0A 2EC9T 2Q76A 2AJXL 4M03A 1KLUB 4PRPB 3O8XA 4OFKA 2X5PA 4HFWA 2EDEA 3O6FC 1G1CA 4FQ1L 4X98A 5HVGB 3MOBH 2YN5A 3VI3F 3MA7A 5E6YA 2AJZB 4RWYL 5CILL 4R2GC 3L1OH 4GG8A 3BPCB 4KRPD 4YFLI 3C6LC 2NMSA 3U30C 4TSBL 4XNMB 5I1AA 4FABH 2KKQA 5CKAA 2ZCLH 3BDBA 1JK8A 3F7RA 5AWNL 3TP4A 5MEQB 4HDIB 4P46D 2H32H 3UCRA 1P84K 2VRAA 3VD5A 3QULA 5JQHC 3ZKMC 1UWEL 4NN7C 2NTSP 1TZHB 4TQEH 4EUPB 3AXLA 1RUPL 2XQYK 1UCBH 5I17B 3PQYB 1JYWA 2YD6A 3CVIL 4WWKB 4ZTPH 1LK3L 4ZUTB 4GRWE 1C16A 5IEKB 2PNDA 1U58B 4N9OB 3PDOB 5D2LF 4LRIC 2EZ0C 1MAML 3QDJD 1WAAE 4GH7B 1DFBL 4GBXC 5HHXL 2X1QA 4AMKL 32C2B 4AY0A 3CFKB 4ELKB 4MXVE 4QHNB 3T3MF 1UKQA 5E8PB 3CXHK 5ITFA 1LE9B 3C5ZD 4HLZG 5TPWH 4TVPE 1M71B 4OZHE 4X4XA 1VFMA 3BYYA 3H6JA 3ILQC 3ET9F 1NMBL 2ADFH 4G5ZL 1HDMB 4N0FB 3EUUA 4XMPL 2Q7YB 3VJ6B 2CMRH 4X6CB 4GT7A 3QUXA 4ZFOB 3G04A 4H1LH 4YHMH 2VR9A 3S7GA 2VUYA 2FYYB 5F7WC 4TVPD 4OF8A 5DSCA 4YHIB 1YEFH 1ONQB 2JLLA 4ODVL 1N5YL 4YUEL 4Z7NF 3NN8A 4P4RB 1IKNA 3BKML 4I5BB 4UBDD 1D9KB 3VRIB 4ZNCD 3OKEB 1H8SA 1MH5B 1WFNA 4YHOH 3V8OA 5CJ8A 7CGTA 1IGIL 2I60L 2R23A 1HYSD 2W0FB 1DSFL 3QNXB 3CIQA 2DLFL 1CLCA 2F53E 3BGMB 3R1GH 4X5WA 2F15A 2IH1A 4FFYH 4HLJA 4XRCB 1RJZB 3DECA 4DKFH 4HWZA 4RMTA 1IC5L 3MLVL 5IUSA 4NZTL 4UDTB 1I3RB 4R0LA 2HH0H 1UJ3C 3MLXL 3UJJL 4IIQB 1HHKA 3WS3A 2KZ1B 3WJLA 4X99B 5JW3H 1UVQA 1T0MA 1DN0B 1W0WB 4NBZB 4ZDHB 2F58L 3QPXL 1BQUA 4UV7L 4D9RE 4FNLH 1A7RL 3KVQA 3BRDA 5BJTB 4QRPA 3TH4T 3LQAL 3NPZB 1CICB 2HG5A 5EIIB 2PXYB 4WUKH 3LS4H 3PXJA 4D9RD 4ZUWA 3NPSC 5HGAB 2EDQA 3VGAC 4MJIE 3P9LA 5GZOD 3MRNA 3WUWA 4R3SB 5CCKH 4XNUH 2HLFD 3KJ6L 1DANT 2UVEA 3WN5B 3D87B 4UTBL 4BSVB 3W39B 2QHRL 1H8OA 4K94C 1RAMA 5EO1B 4PJEE 4MJID 1NAMH 5D1XA 1AGBB 3WFZA 2DOCA 4D0BB 4HG4J 2AK4B 2BSTA 4X4ME 1HWHB 1A7NH 3VGFA 3QCUH 3RZCC 4RMSA 1P7KA 1NFIB 3I2CH 4LLUB 3SGJA 4XP4L 4HPYH 4MYWB 5F3HB 5F7EH 2GI7A 5L2JA 2A9NL 3IFNH 3VFGL 1JWSB 4OCNC 3QRFM 1LO3H 4QRSB 3HZVB 1JYNA 4AEHH 1QFUH 1I1AD 5D7IE 4W68A 4XMKH 4Z6AT 1U8IB 3QIWC 2GFBA 2RQ8A 4HPOL 3OAYK 5BZWB 4XPGL 4PRPE 3RGVB 4KZDL 3FKUS 1RSFA 4HWNA 2D0FA 4LL9A 4I3SL 4ZXBB 5AZ2H 1JBJA 3TVMB 1LMKA 5IQ7H 4NHCL 3FRPA 2N56A 4CU6A 4YBQD 4NRZA 3GI9H 4PRPD 1FLTX 4JZJA 1S78D 2XPGA 1LK2A 4JRYB 4OZFG 3RWFA 4I77L 4X8XA 3C60A 3RKDC 1Q9KB 5FV1L 5KW9L 3RX5A 2NYYC 3V5KB 3RWGA 5FYLL 4NJAL 2ZKHL 4R4ND 5DDHA 1UWGL 1G6RL 3MGTA 2E9JA 4OF0A 3MACH 3SN6N 4L8BB 4Y16B 4ZAKC 2VZSA 4O2EB 1OM3L 1QYGH 2IBZY 3TO2B 4PY8I 3H9YA 5HJ3A 3SDYL 2X4SB 1RU9L 1GGBH 4DK3A 4DTGL 3DYPA 3PQYD 1CFSB 4WWKD 1PY9A 4C83B 4GS7B 4UI2A 1OAZH 4MSWB 4X7SH 3VXQA 1MHHA 2WBJA 4UOW1 4XXCA 1JTOA 1QACA 4EEEA 4F7CA 4O2CB 2X4QB 3UAJC 2QSTA 3QQ3A 4X6CE 4UV4L 3PDGA 1J18A 1JI1A 1WIUA 4K9EC 5E00A 5A40E 1ADQL 5DURB 1JGVL 1JL8A 3B9AA 4RAUB 2D31B 5D2LB 3IVKA 1TQBC 2G2RB 3BEWA 5JQ6H 4OGZA 1T1ZB 1E4XL 3FAXA 2CGRH 3VFNA 2X4TA 3BVNB 4XH2A 3FTGB 1OF2A 3GSWB 4NO0B 3EYUH 1S7TA 2EH7L 1H15B 4P46A 4PTTB 5F71A 5D1QB 3BDXA 2ARJQ 3SDDB 1D9KD 4MJ6B 3X3GH 2OS7A 5C6TL 3MLSH 1KEGH 3O3EB 2A6KA 3TYGL 3LKOB 3LCYA 2FECL 4P0DA 4WEUD 3P0YL 4S2SB 3QDJA 2HVKA 3P9WB 2DQJH 5IK3A 3BHBB 2XN9B 4Z0BL 2J4WH 3OBAA 1RULL 1SM3L 4ZSOA 1R5VA 3MRQA 3DV4A 2Z9TA 3VGBA 3WSQH 5EOQL 3C5ZA 1WAAA 3EO0B 2AAVA 3DVGA 3C6SA 5M95B 3O8XC 3B3IA 1UM5L 4Z7UF 2B1AL 2DM4A 3FB7B 3L3GA 3QCVL 4K7PX 3BPLB 4JHBA 1B0GA 3CH8A 1X5FA 5FYKE 1Z9LA 5DD3H 4OZHA 2Z91A 5J89A 4LSPL 4HUWA 3JV6A 1H3WM 4MDJA 4OF5A 3LY6A 1JNLL 5T3XE 1RZIB 1Q8MA 1CICD 4HQQL 1KJ2H 2EO9A 3HCVB 4F8QA 2PXYD 1IFHH 1P7QB 5HYJE 1DEEB 1YUHA 1EEZA 1CFQB 2XYCA 4N0CD 4TULH 2Y06L 1H3XA 2A83B 5E95B 1R6VA 1RUQL 5DHVH 4S1RH 2X05A 3NH7H 2OMBA 5T3XD 1NUFA 4AM0B 1JE6A 1Y18A 4Y4FC 5TGBA 3NFPB 1UENA 3MLRH 3VXTA 2D9QB 4KVCL 2AK4E 3NFNB 2A1WL 4GKNB 5B38B 1ACZA 1BREA 3DARA 2JB6A 5ESAA 4JKLA 5I2IB 2ICWB 5KSAB 5GJTH 1TTUA 1URLA 2WIMA 3MREA 1OGAB 2AK4D 1OAKH 1MCIA 1HOCA 3S34H 4NM8L 2ZUUA 4AEIH 3D0LA 1MCLA 3JV4A 4XVJH 5DWUL 2Q87A 1JVKA 2G75A 4X7EC 4Y2DB 1L0YA 4OLYL 4V2BA 1Q9OA 3ZSSA 1WFUA 4NPYB 2H3NB 1MJJA 1TZGL 2EE2A 1XGTB 3S5LG 2P8MA 3JUYA 4NQUA 1KBGH 5ICXB 5I8KH 4S1DD 2E7LA 1AE6H 5CGTA 5C0ND 4ERSH 3RGVD 3CJJA 2EH8H 4JRYE 2XV6B 1E0OB 3RI5K 1IKNC 4J8RB 4ZXBD 5K9KA 4W6YB 2HVJA 3TVMD 3V4UH 4U1GC 2PYFB 5I6XB 2W92A 3P73A 4NP4H 4NO2B 4DN4L 3HNVL 3G5VA 4JRYD 4NQCB 2O26U 3MRLB 1FBIH 3QWOA 4MJIA 1WSST 1E4KC 3VWKC 4ONHB 4OI9A 1JZ7A 4K3HA 2NXYB 3FL7A 3MXVH 4FQPA 5IJVA 4QKXB 2FHFA 4PJEA 5E4EB 2A77L 4Y16D 5I1EH 3OR7A 2EDXA 5C92A 4HJJH 4K8RC 4R0LC 3BN3B 3DBXB 1PLGL 4X4MA 4LCIL 3F5WA 1DJSA 5J6HB 5EBWB 5DD6A 5AG9A 4YPGB 1I1AA 4KVNL 1AXSB 3VFMA 2OI9B 2HJLA 4TRPH 3VGDA 3U46A 1ITCA 1VERA 3VWJC 3K0WA 1CFTB 3TT3H 1ZHKB 4M62L 4AIZA 5D7IA 1IAOA 2DKUA 3ZT6A 4Z7WF 2X4RA 4JGUA 3MRRB 5ALBL 1KLUA 3O3DA 2UY6A 3NIFF 4PRPA 3GSXB 4JY4B 1ZLSL 2YA1A 4Z7VF 5DURD 2VXUL 4PBWD 1XGYL 5GGTA 4ENED 5KSBF 1B6UA 3ULVE 1LILA 2CDEB 1RZGB 3OHXB 2AJZA 3WD5H 2BVTA 2WNGA 1YZZA 5D1XC 3DVIA 3BPCA 5E08H 4KTYA 5FHBH 5LBSH 4W81A 2RB8A 4XNMA 4Q0XL 2GTWB 3ULVD 1LQSR 4PG2C 1DQLL 1YC8A 4NO0D 1Z5LB 4U6TA 3H7BB 2E7MA 5MEQA 4HDIA 5D1QD 1NCUA 4M5ZL 5IW6B 3SDDD 1TZHA 1CLZH 4EUPA 2IC2A 4WW2F 5I17A 3PQYA 2XN9E 4WWKA 3IDXH 5DD5L 1O5DT 4M6NH 2D03H 4ZUTA 5IEKA 3N1PC 3BKYL 3PDOA 4LHJB 2FATL 2ED7A 1KIRB 5D71H 3QRGH 3O41B 1RPQA 1C7TA 1I7ZA 2XN9D 5GGVY 2QJDA 3U9PH 2ICEB 1IT9L 3WXVH 5GRJH 32C2A 4HIEB 3CFKA 4ELKA 4QHNA 4YEEA 2FNBA 5E8PA 1I7RA 3DTXB 1NCAL 3IU4H 1LE9A 2B0SL 1A5FL 1M71A 2R69H 2FX8H 1MIEL 5CKGA 2MKLC 5F7HA 4N0FA 2D7QA 1HDMA 2Q7YA 3L3KB 3VJ6A 4X6CA 2QR0B 1IZJA 1MFCH 5DMJB 1J0IA 5AYQA 2DQFB 3ES6B 3IAGC 2Z4QB 2FYYA 4LP4A 2OK0L 3O2DH 1ONQA 4LSVL 4HC1A 4R8WL 4ELMF 1T7YA 5K9JH 3O81A 3HNTL 1FO0H 1G9NL 1P7QD 4I5BA 4HK3J 5ITBL 1D9KA 4M48L 4ODUB 3VRIA 3OKEA 1OARL 2Y7QB 2EKSB 1MH5A 3AU1A 2R0ZL 2YWZA 4ZTOH 2V5MA 1U2HA 4JPKH 1KCUH 2W0FA 2YWYA 4HT1L 1A9BB 3QNXA 4APQB 1KJMB 1IQWH 1R5IB 3BGMA 5IVNA 1ACYH 1J1PH 4XRCA 2WBJC 1RJZA 5KSAD 4WIQA 4YQXL 4BQ6A 1U41A 2MSPA 1OGAD 4DVBB 4UDTA 3VD9A 1KACB 4ODHH 1I3RA 4CN6A 3LV3B 3NVQA 2HWZL 3OAZK 4IIQA 3TBWB 4LFHG 1IL1A 4X99A 4XGZB 3O2WL 4Z7QF 4Y2DD 3LD8C 1DN0A 3ZYZA 3PJSB 1TETL 4ZDHA 2BHZA 1MCQA 2NCMA 4M6MH 1X5ZA 1UJTA 5BJTA 1KCLA 3RU8L 5T5FH 1DL7L 1CICA 1YPZF 1CBVH 4F37F 5EIIA 1Z2KA 3CUPB 5HDQL 5L8LB 3VFOB 5CHNB 4DN3L 1CXHA 5B8CB 1X4ZA 1KCRL 3RWDB 1J12A 4NQCE 1F4XH 3QCTL 5HGAA 3IF1B 4XX1G 3WXWH 3QUYB 4JKPH 1K6QL 3MBXH 3WN5A 5BW7A 4BSVA 4NQCD 4C4KT 5EO1A 1D6EB 4KHXL 1M05B 4NWTL 1AGBA 2WUBL 1PEWA 2OSLB 4L8DB 1W8NA 1ZWIA 4D0BA 1I8IB 4NQEE 2NXYD 3O9WC 1V05A 2AK4A 5EO9A 2D7NA 5EPMB 4NCC1 5JA8B 5F1NB 2J1KA 2BRRL 4AG4L 3VG0H 1NFIA 4LLUA 3C5ZC 4KGJA 5F3HA 1F6FB 1ND0B 4GW1B 2R1WB 2DD8H 15C8L 4OGXL 1JWSA 3NOIA 1I9IH 4QRSA 3HZVA 1ZLVH 2WZPD 5E2WH 2VQ1B 4MS8D 4UTAH 5E6IC 1U8IA 1CD1B 1BAFL 3H3BC 5BZWA 3ZE0E 2GW5A 5IJKC 1CGYA 1OTTD 3RGVA 2E8YA 4PB9L 3B2UD 4XI5D 2VN4A 1FFPB 2VDLH 4ZXBA 1V7NH 2P5EB 3TVMA 1N8ZB 4KRMB 4JO2H 3WFDH 3BSZL 5JHLL 3BZEB 3BAEL 4JRYA 4MQTB 3AB0C 3HAEB 5LGJB 2ZUQC 4B5EA 3RDTB 1VKXB 1Q9KA 3W82A 2JE8A 3V5KA 5MI0C 3X14B 3MRDB 1NCBH 1S7UA 4XP9H 4U31A 5GS3A 2AABH 1OQOA 4Z7VB 4G9FB 4Y16A 2ADJB 4O2EA 1Q38A 3TO2A 5I19L 1KSRA 3AROA 4LLWB 3LQMA 4M4RA 3CC5B 1U8PB 4FQ2H 1F97A 2X4SA 4P2OB 3MROB 2YC1B 4M7JL 1Y6NR 4YXKL 2AJXH 1CFSA 3C2AL 4KJQC 4BELD 4C83A 3MV7B 1IKFL 2I9LB 2OL3H 4MSWA 4QHKJ 4RWYH 3RX8A 3S35L 3T0BA 4Y88A 5CILH 4YHPB 2LFGA 2Y9RT 1DQML 2X4QA 4WW2B 5IR1B 1RK0B 3MV8B 2CR6A 3P4OA 4KKBD 5J3HC 4RAUA 2CKBL 2D31A 4IHOB 3BJ91 4GRLC 5AWNH 4Q6IC 4YDVB 1FNHA 3D2UB 1AR2A 2DWEB 1UWEH 2BFVL 2G2RA 2VXQL 1F3DH 4LPXA 3WO3B 1RUPH 1XEDA 1WVZA 1T1ZA 3CVIH 1LK3H 2X4NB 3K4DA 1I9RL 3BVNA 4Z78B 5EA0L 3FTGA 3GMNB 2EDTA 2EXWC 5I1DB 3QPQC 1N64L 1WQVT 3GSWA 4NO0A 1HXYB 4HUXB 5IB3B 3AUVA 1MAMH 1TCRB 1H15A 4PTTA 4LAJH 5D1QA 5JW4Q 4X6DF 1DFBH 5HHXH 4DVRL 2J6EA 3EJYC 1RIHH 4GLRH 2B1HH 1IQDB 5T3ZE 3O3EA 3LKOA 2B4CC 2HT3D 1J05B 1BP3B 1XF4B 4S2SA 1NMBH 4G5ZH 4APQD 3IJSB 3BHBA 1GH7A 1T1XB 1CU4L 2XN9A 4O5LL 1INQB 1TQCC 3DUHA 4PLJC 1A6ZB 3CFJB 2VDQL 4ODVH 2Y07L 3EO0A 4YUEH 4HS8L 2A9ML 2NY1B 1S78C 1A02N 3DPBA 3SQBA 3SKOB 3BKMH 3ARDB 4HHAB 3FB7A 4KK8D 3GKZA 1QPPA 5DMGC 1T1WB 4PGJA 3OKLB 3RBGA 5C1MB 1IGIH 2I60H 4BZ1L 3E3QE 1FC1A 1PSKH 3VFVB 1F4WH 1RZIA 3HCVA 2DLFH 5ELIA 5M7QA 1P7QA 1DEEA 1CFQA 2XTLA 3VXRB 4KI5F 1U8HB 1IC5H 2A83A 3MLVH 3QO1A 4NQVB 3ALWA 1CVSC 3LSOB 4NZTH 4F57L 5HHMB 4AM0A 5IWLC 2BSED 3QUYD 4HF5L 1HQRB 1WWBX 4F7MB 3RVXD 1NGPH 3MLXH 3UJJH 4MAYC 4KQ3L 4GKNA 4LLAA 1FFOB 5K33A 5KJRL 5HTSA 5F7UA 2Q3AA 4YR6B 5JR1L 2YD7A 5I2IA 2F58H 2ICWA 4D94A 1IM9B 3QPXH 5GS0C 5KSAA 3RFZC 1WZ1L 3CSYB 4AYFA 1OGAA 1A7RH 2Y5TB 1T04A 3LQAH 3TA3A 3UP1A 1PW3A 4OKDA 1KCVL 3N85L 4Y2DA 1A6WH 5EZJB 4LSTL 2P4AB 4NPYA 4XT1C 3OAUL 5SWSB 2GTZB 3KJ6H 4KV5F 1XGTA 2AK1L 2P5EE 5ICXA 5EO0B 5F88B 2GY7B 5C0FB 1OP3H 3VW3L 1CGXA 1OP5K 5CJQL 3T1WA 1G0YR 3FB8B 3GBML 3GJFB 4J8RA 4XNZB 2P5ED 4OF6A 4YHLL 4ZUUB 2BCKB 2PYFA 3UJIL 4NO2A 1T83C 2IPTL 3Q3GA 4BFBD 3SDXF 3ZHLA 4XP4H 1VA9A 1EX0A 4NQCA 1RMFL 3MRLA 3SQOL 4P9HL 4G9FE 4MNGB 3RDTD 2A9NH 3VFGH 4ONHA 3T08A 1AGEB 3KDMB 2YD5A 5LGKA 4Q9QL 1GIGL 2C4FT 5DQ9A 3VXSB 2CRZA 2A6DB 2OX5A 4HPOH 2DQIL 4G9FD 4QO1A 1H0DB 1PEZA 4XPGH 4KZDH 3BPOC 1UQSB 3DBXA 3MV7E 4UAOC 4I3SH 4P2OD 5J6HA 4JRXB 5EBWA 4Z5RB 4ZNEE 1U3HB 3JSSA 4YPGA 1AXSA 4Q6YA 4JY5L 3ZT5A 1CXFA 4IDLA 3MV7D 2G9HB 1CFTA 2VLRE 3LKRB 5IB2B 1IAIH 1ZHKA 3QT2A 4XCFL 1F6LL 3PWVB 3T2NH 3U83A 1WZLA 2ZKHH 2ZPKL 1G6RH 3BYTA 4OKVB 4N0CC 3VA2C 2HT4D 3MV8D 2XTJC 4LMQI 2XFXA 3DHMA 3ARZA 3GSXA 3CZFB 4JY4A 2VR4A 1U42A 3WS6C 2QL1A 1OM3H 2D9CA 4X9FA 4WHYH 3GSRA 4CMHC 3UMTA 2E8ZA 2RFXA 2EYSB 2CDEA 1RZGA 1RU9H 3OHXA 3D2UD 4LCCB 2D7OA 2EDOA 3KPOB 4K71B 2GSGB 4DTGH 3TN0B 5EC2B 4NKDB 1JIBA 2GTWA 5DVMA 4DKAA 5F97E 1Z5LA 4LIQH 3NCBB 5L6YL 3GHEL 1ZT7B 4TTDD 3H7BA 3MLUH 1VGKB 3VD7A 4O9HH 4LLQB 2K7QA 5IW6A 1XMWA 3ARGB 4NBYB 4JFZL 5F8RC 3G5YB 1PY4A 4Y5XB 4RDQF 4AJ0A 4KZEL 3KGRA 3B5HA 1JGVH 5FIEA 4F33B 3OGOE 4V1DB 1FG2B 3BGFB 5IIEB 1MF2L 3JWOL 4X6DB 1KIRA 4S1DC 1KN2L 4YDJA 3O41A 2Q8BL 3PWNB 2BNRB 3ALXA 4HWUA 1E4XH 2ICEA 4WW1B 5F3BB 5DVOA 1FL6B 4HIEA 3EYVB 5CIPH 2NXZB 4WHDA 3F8UB 1GXEA 2J8UF 3T0XA 3DTXA 4Y4KC 5DC4B 3VRLE 1FIGL 2P8PB 3OXSB 2XQBH 2NY1D 4NZRL 3W11C 2EDLA 3L3KA 1T6WA 3ARDD 2QR0A 4LCWB 5HHQA 5C6TH 2DQFA 3ES6A 3HA0A 4JHWL 2Z4QA 3TYGH 1XIWB 4HGKC 2APBA 3VXRE 4ZUVB 2BHYA 4LPVA 1JPGB 1JPFB 3GRWL 2CXKA 4HBCL 3RPIA 2G60L 4K3DH 4P4KB 5C86A 5J11B 3P0YH 5HHME 4FMKA 1IGYB 5I1JL 4Z0BH 1Z6JT 3GMPB 5H37H 3V0AC 1IC7L 4ODUA 3VXRD 1SM3H 2Y7QA 3GSVB 2EKSA 4MXQD 1MJ7L 3EYQD 3WDIA 1NLBL 2I26N 5EOQH 5HHMD 3H2WA 5C70A 1NUGA 1NBVH 5B3JF 1A9BA 4APQA 1EHAA 1U8LB 1UM5H 2B1AH 1RHHB 1KJMA 1R5IA 3CFBB 3QCVH 1FVEB 2F9BT 1IM9D 1UZ8B 4EUPG 2VDML 3NACL 4LSPH 3SDCC 5DEZA 4DVBA 4GG6F 2X1WL 1G7LB 1JNLH 4MJ2A 4HQQH 5SWSE 3GFUA 3LV3A 2WP3O 1P53A 3TBWA 2X70B 1IEHA 4HEPG 2VLMD 2ZWLT 4XGZA 1AQDB 3PJSA 3FQWB 1BVLB 1UZ6F 2J2ZA 1T80A 5KVMC 5SWSD 1IGCL 4G43B 4RMUA 3LN9A 4UB0H 4E0RB 2A1WH 1ZGLB 3MYJB 2JJUA 3ZE1E 4RZCB 5HPOA 5JIIA 3ULVC 3WUZA 3PHQB 3CUPA 5GSRB 5ILTL 1VFAB 3VFOA 5CHNA 2P7TB 5B8CA 3RWDA 4IRSC 1VDGA 3IF1A 2RIKA 4MNGE 1BJ8A 2MHAB 3QUYA 1ZLWK 4J4PD 5DWUH 3VMOA 4R7DB 2BVQA 2ZSWB 3VXSE 1D6EA 5E6ZA 1NJ9B 4OLYH 1M7DB 5I1GL 5JXED 1M05A 4JFYB 4JG1L 1Z0NA 4X83A 4L8DA 2OSLA 3K8MA 1I8IA 2F5AL 1TZGH 2AEQL 4HAGA 5EPMA 3VXSD 4JRXE 5F1NA 1AC6A 3SDXB 2XZCL 1BEYL 4L3CB 3Q1SL 4IRZH 2BSSA 4H1LG 2QQLL 1ND0A 1HKLL 4GW1A 2R1WA 4RFNB 3V79C 5IVXB 5KOVC 4JRXD 1FRGL 4YHKL 3MRJB 1U3HD 2VQ1A 4ALAL 2COQA 4DN4H 3HNVH 4RGNB 4PLKD 2C3WA 1VPOL 4ZS7L 5D96C 4YH6A 1H3VA 1IGJB 1C5CL 1FFPA 1D6VH 5ERWB 3S36H 2P5EA 1K4DB 2D7MA 1N8ZA 4RMRA 1EZVX 3VA6A 2JJSA 1OT2A 4X4YB 3BZEA 2YKLL 1HK6A 1YJDC 4YE4H 5BMFH 4XPTL 3QAZC 3VE0B 1U92B 3HAEA 1GJIA 5LGJA 4H26B 4YBLC 1FP5A 1PLGH 5FM4A 3RDTA 4LCIH 3ZL4H 1VKXA 3NBNA 2WIIB 3X14A 3TN0D 2OYPA 3MRDA 4KVNH 1K9TA 3DX7B 4FQXB 4LVOB 2QTEA 4URTB 4DGVH 4G9FA 4Y5YC 3RIAK 1F00I 5IBLC 1U8MB 2ADJA 4U1MB 1M6OB 3NZHL 3TA3C 2IPUG 4M62H 4DKEH 4LLWA 5DRZB 3CC5A 1U8PA 4OZIE 4M1DL 3MROA 4P2OA 4QT5B 2DM3A 3ARGD 4Y2DC 4RFOL 5ALBH 5INDB 2BNRE 4ZS6D 4L4JA 3VU2A 2O5XL 1XGYH 3MV7A 1U8QB 2ZP0T 2I9LA 4UZGA 4V1DD 1DQTA 4M93B 4LIQE 1G6VK 1WZKA 3RTQC 5HI4D 1NAMB 3VDBA 4ZFZB 4ZD3L 2YUXA 2BNRD 4YHPA 1G84A 3P4NB 4WW2A 5IR1A 1RK0A 3MV8A 4QGYA 2NXZD 4G6JH 3SE4A 3ZKXB 4Q0XH 4HCRA 1DQLH 2BERA 4LCWE 1IAII 4IHOA 5ICZB 5I6XC 4LP5A 5D7SH 3D2UA 3MCG1 4U2YA 3GMOB 3ULUF 3AREB 3DI3B 1CDCA 4LCWD 1G0DA 2J8UB 5DD5H 2X4NA 1M7IB 3SDAB 1XIWD 3SY0B 4Z78A 3GMNA 1ZANH 5I1DA 3S4SB 3BKYH 1HXYA 1QBLL 2HFEB 4HUXA 4P4KD 5IB3A 1TCRA 5E4EC 2LVCA 5J12C 3QIUB 3EFDL 3MUZ1 2Y36L 4OLUL 3QG7L 1UH3A 3T1FB 5F96L 1N4XL 1FH5H 1UWXH 1IQDA 1NCAH 1DBJH 2B0SH 1A5FH 2I5YL 2P43B 2P44B 1J05A 2HTKD 5C07B 1G7PB 1XF4A 2E9BA 4OCRL 4RNRB 5GGRB 2KQMA 3IJSA 4U0RB 1T1XA 1BOGB 1INQA 1NKOA 4KI5D 3E8UL 3CFJA 2OK0H 12E8H 4AQOA 4R8WH 4R97C 2ED9A 3KLDA 3WFBH 3TEUA 2UWEF 3HNTH 1A4KB 1G9NH 3SKOA 5ITBH 5FO9B 5DQJB 4HHAA 4M48H 1OARH 1CGVA 3MUJA 1T1WA 1MFBL 6FABL 3OKLA 4LLVB 4GG6B 2DF3A 5C0IB 4HT1H 3S96B 1JZ2A 3VFVA 2FD6H 5DK2B 2FO4B 1PDKA 1SEQL 1S3KH 3ZHDA 4TPRH 3VXRA 4D3CH 2FECI 4YQXH 2WANA 4NQVA 1IC4L 3GZKA 3LSOA 3OAYH 1HQRA 3MGOB 4F7MA 3A67L 2HWZH 4JN1L 5LQBL 5FGBC 1FFOA 3O2WH 2ZUYA 5ADPL 3MYZA 4YR6A 3R8QA 3FO1B 1TETH 3BE1L 1YNLL 1IM9A 1KELL 2C1OB 4WY7L 3H3PL 3ARSA 3CSYA 3HG1E 3OKNB 4PV9B 2Y5TA 5IVXE 2X7LB 3RU8H 1UGNA 2AJYL 1DL7H 3UO1H 2VC2L 2CD0A 5HDQH 3LB6C 5LAXB 4QNPE 3BP5B 3O45B 4DN3H 5DVKA 2DN7A 3QCTH 5EZJA 5BXFB 2X1PA 5SWSA 3T2PA 5GGSB 2GTZA 4C4KO 1K6QH 4CUCA 5EO0A 5F88A 4RGND 4XMLL 1UC6A 4ZO9A 4NWTH 5T1DL 1OT1A 3OB0K 1MHCB 2WUBH 3RGHA 3FB8A 3GJFA 1YY8B 5EU7E 3VD3A 1VACB 4ZUUA 3K4ZA 2BCKA 5GJSH 5CEZH 1OOAA 2ITDB 4J12A 4J4PA 4XTRC 1JGLL 1HI6B 2E27L 1QRKA 1I8MB 5FO7B 5JXEA 5F6HJ 4MNGA 1U8NA 5H2BB 15C8H 4OGXH 1QLRB 1AGEA 3KDMA 4N9GB 3ARRA 4FQCL 1AP2B 2FHBA 4FQXD 3VXSA 2A6DA 1BAFH 4HSQA 4K7FA 3GGWB 2Q20A 2JTDA 4XVUD 5JZ7D 4XPBL 1P1ZB 2V6HA 4UU9B 2VH5L 3V4VL 3GMRB 5FHAL 1T7XA 2ARWA 2XWBB 2OJZL 4JRXA 1MRFL 4JREB 4Z5RA 1U3HA 2XT1B 2DQCL 1FE8H 3BSZH 3SE8L 1K5NB 3U36B 3CVHL 4L3EB 3BAEH 4PJDF 3NCYS 1ZVHA 4PRBB 1L7TL 1YYML 1JZ3A 4EI5B 2G9HA 2AV7B 4KPHL 5IB2A 1BLNB 3LKRA 4PREB 5J57B 5TE7H 3KLAB 2KQNA 3PWVA 1JZ8A 3MLPA 4YLQT 4EXPX 5IFHH 3LKSB 4MHHI 4OKVA 4KU1A 4JKMA 3OL2A 1INEL 1H3PH 5C8JB 3CZFA 1HH9B 3DV6B 4XHQA 2J8UE 5I19H 5FEBA 1B0RB 1Z9SA 2C3VB 2EYSA 3BPNC 1CQKA 4LCCA 4M7JH 3KPOA 3ARED 2DLEA 2GSGA 1IRAY 4YXKH 5EC2A 3C2AH 3QUZB 3ZTNL 4NKDA 4YZFF 2Z0BA 2W9DL 5ICYB 2XWJB 3SDAD 4D8PA 3WO4B 4FXKB 5GS2H 4NQSB 3MLYH 3S35H 1VGKA 2MOVA 4FS0A 3QIUD 5C07E 1J8KA 1DQMH 3ARGA 3G5YA 1II4E 4JCLA 3N0PB 1OLLA 1I8KB 4Y5XA 5DJ0B 5GS1C 5KVDH 1KOAA 4KWUA 2HT2D 2CKBH 4F33A 1FG2A 3PUCA 5CFHA 1WFOA 2R2CA 5C07D 5IIEA 3RY6C 4NWUL 2BFVH 2VXQH 3PWNA 5DUBB 2BNRA 1KCSL 1G9EA 3GMQA 5ACLA 4RBPH 4WW1A 5F3BA 1FL6A 3EYVA 5D72L 4WDIB 5EA0H 4L8CB 1IJ9A 1MEXH 3QBTB 3GMMB 2P8PA 3OXSA 1MPAL 4GG6E 3QHFL 4DVRH 3NTCL 4NZUL 5I1LB 1YNKL 4PJGB 3EZJB 4XC1L 2XKSA 4P2CG 1FG9C 4LCWA 1PG7X 2P45B 3RDTC 1S7RB 1WWAX 3B9KB 3U4EB 2QSCL 3WFEH 1A14H 4ZUVA 3EO9L 1JPGA 1JPFA 1K8DB 2ZOLB 5FAAA 3EAKA 4P4KA 5DT1L 1EJOL 1IGYA 3IT8D 1WITA 1JHLH 4O5LH 1MAKA 1MCNA 5E4IA 3HE7C 2C3GA 2UZIL 5FYJH 2E7CA 2JKXA 3BN9D 3GSVA 2EDJA 4CJ1A 2VDQH 3SKMB 3FOLB 1HHHB 3STZA 2X2YA 1U8LA 1MSPA 2AXFB 1CXLA 1RHHA 3ZLQC 1FLRH 5IFAH 3NA9L 1FVEA 3IDYB 3ZHKA 2O93L 1UZ8A 4EI6B 2DBJA 2VE6B 3K74B 4ZFFB 3WLWC 4BZ1H 3PGDB 1G7LA 5JTWA 3C08L 1MVFA 1J8HE 1OTUC 1X5JA 2X70A 4JPIB 1OAQH 4WWID 1AQDA 5CWSB 1J1XH 3HB3D 3FQWA 2ID5A 5LXGL 1BVLA 2AQ3A 2R1YB 4UT9L 4WU7B 4YGVB 1YEIL 4F57H 2DIBA 4G43A 2JCCB 1MJ8L 2P49B 1P4LB 4E0RA 4KQ3H 3MYJA 1ZGLA 4RZCA 5KJRH 3PHQA 4JGJA 5JR1H 1FZOB 5GSRA 1VFAA 2P7TA 2CKNA 1HCVA 1WZ1H 2FL5B 4PTUB 4S0TD 4HULB 2MHAA 1JN6B 1IAKB 1WZMA 3VXNB 2C3HA 1MCWM 1UXSB 3RUGF 4R7DA 2E9WA 2ZSWA 1KCVH 1YQ2A 3N85H 4FQQB 4O51B 1NJ9A 5J56B 1M7DA 4JFYA 4LSTH 1ORQB 1GCFA 3OAUH 4MQXC 3BI9X 2EDRA 2AK1H 5CMAB 2EIEA 4GXVH 1C5DB 3WNKA 5CEZE 1AI1H 2APWA 1DLHB 3VW3H 4L3CA 3DYOA 5TE6H 4Z95L 1VSCA 5CJQH 4I2XB 5JLZB 3GBMH 2DL9A 1AXIB 5IVXA 4F8TA 3EZ8A 4KGLA 1MUJB 4M00A 3MRJA 5EDXA 5AEAA 5A2KH 3UJIH 3LRSB 2BVUA 4L3ED 3BO8B 1X3DA 1MFEL 1DUYA 1CF8L 1RMFH 3RHWF 4NFDA 4P9HH 4EI5D 4D2NA 3HNSL 1IGJA 4I0PC 3EO1B 3L5IA 4G6FB 4I1NB 1A3RL 1XF1A 3I3BA 4PJXF 4A6YA 5ERWA 5L7XH 1ROWA 1GIGH 4Q9QH 2D0GA 2PR4L 1FZKB 4PG9B 5FXCH 4Y8DC 2DQIH 4X4YA 4L9DA 4Q9CA 4PJDB 4UT6L 4CU8A 4DAGL 1U92A 1TXKA 5AZEL 4H26A 4ACPA 3MTRA 1Z9OA 3MJ9A 2R9HD 3FONB 3H7LA 2X42A 2WIIA 1MHEB 4KROC 3W2DL 4LGRB 3QUZD 3ULUE 3DX7A 2YD2A 4FQXA 4JY5H 4OGAD 1CLYL 2F8OA 2I9TB 1U8MA 1AD9B 4U1MA 1M6OA 4P2RE 4WFGD 2EDWA 4XCFH 5DRZA 3ULUD 2ZPKH 5DFTA 4QT5A 1F02I 3GUTB 5INDA 5DHYA 3QWRD 1U8QA 2DQEL 4HUNB 4TVPL 4G8GB 1CXEA 1NAMA 3CLEL 4ZFZA 4W4OA 3FAWA 3GNMH 4Y8AA 4D9QE 3P4NA 4N1CA 3F7VB 4RRPG 3BH9B 4PJGE 4NUGH 5F7LB 4JFDB 1GSMA 3O4LB 3C5SB 4LOUD 3LQAC 5MHSD 4J3WA 2DQHL 4PUBH 3GHEH 5HD8C 3HMXA 5ICZA 4WI4A 3S97C 4RSVA 2GQHA 3PV6B 3GMOA 1GGCL 4JFZH 2YZ8A 3AREA 5EWIL 1LO0H 3TZVB 2D4FA 2J8UA 3B9KD 4Z7OE 4KZEH 1M7IA 3SDAA 1IGML 5JDJA 3OAZH 5DJCB 1P5VA 2ATPB 2HFEA 3HAEG 5E2JA 1MF2H 2YRZA 2ZUSA 3EHBD 3N06B 3QIUA 3GJEB 4N5EC 2Q8BH 1BBDL 4OLZL 3KXFB 2CO7B 3T65B 2BVEA 2DQGL 3T1FA 3P40A 1QSZA 1ZT1B 4F58H 4BH7B 4L4TB 2BRQA 2R29L 1XF5B 5SWZB 3HC0B 5DUML 4BQ9A 2ZUWA 2YPKB 1FIGH 3LDBC 3KPRB 4YIQB 5C07A 1G7PA 4RAHA 3W0WB 4NZRH 4RNRA 5GGRA 2ZSVB 5CZVL 5FECB 1BOGA 5C7XL 1PFCA 3IFLH 5FYJE 4PD4K 2YS4A 4FQHB 4JHWH 1LGVA 1LP9F 2F54B 3UROR 3KYAA 5EUKA 1U2CA 3GRWH 2FLBT 2G60H 4LLDA 1HN1A 2DJ4A 2JCCE 5I1JH 1A4KA 3DROB 4KTDL 3MRFB 3U6RB 5FO9A 5DQJA 1IC7H 4CMMA 4R26L 1MJ7H 2DBLH 1FFRA 5IQ9B 1NLBH 4K71C 4LLVA 3CH1A 1MCDA 4GG6A 2YR3A 5C0IA 4FN0A 1GGTA 4JKWA 5DK2A 1P6FA 2FO4A 4UINH 4KJPD 2F5BL 3CSGA 2V2TB 4M1GL 1TJGL 3GBNH 2VDMH 3NACH 2P5WE 5A1AA 3K1KC 2CUMA 1BZ7B 3RWJB 4YC2C 3GIZL 5E99L 1QVOB 3MGOA 2B4CL 3ESVF 5MERB 2XKUA 5HI4C 2C1OA 1S9KC 4JCMA 5FCUH 1IGCH 3OKNA 4I2XE 1ZGLM 3U7YH 5ESVB 4PV9A 5CAYB 1EBAA 5J06A 2X7LA 4LDEB 4M9PA 4KK6D 3FHQA 1NBZB 5LAXA 5MENE 5ILTH 3BP5A 3O45A 3UYOD 3V2AR 4KAQL 1KPVB 2VDRL 1H5BB 3E0GA 5BXFA 4XBPB 4QXTB 2EDFA 3RNQB 5DC9B 1E28B 1PJ9A 4GKSB 2P48B 4B0MM 4U1IB 1EIBA 2Z8WC 1MRCL 2A6IB 2VAJA 3KR3L 2DI7A 3WKML 1BM3L 5I1GH 3V0WL 4PJDE 1MHCA 3WFHB 5J11C 2WQ8A 4G6FD 2IQ9L 1YY8A 2AJVH 5DFWH 2AEQH 2FX9L 3T3PF 1VACA 3MR9B 2ITDA 2XZCH 2E5EA 4HIHB 1BEYH 5E7BA 2DMKA 1HI6A 3Q1SH 5GRUL 5TDOB 4LU5L 1I8MA 1OGTA 5FO7A 2QQLH 4MA1B 1W2KT 5DRXB 1CS6A 5D1ZC 5H2BA 1QLRA 4PJXB 3KLHC 5I1KL 4EKXA 5GS0L 4N9GA 1R5WB 3LOWA 1AP2A 2LABA 4LKXB 1A7QL 3GGWA 4W4NA 4KK9D 1NMCC 4M6AA 2AXGB 1P1ZA 4ZS7H 4C58B 5A16B 4UU9A 5EG6C 2LAAA 1FSKC 1C5CH 3GMRA 4JAMB 5DJ2B 4G8GE 1CFVL 2XWBA 4X80H 1F8TL 4BQBA 3BIBX 3RA7L 2PO6B 3P4MB 1UCBL 1K5NA 3U36A 4L3EA 1PKOA 1INDL 3D9AL 4XPTH 4B41A 4PRBA 4JFDE 4G8GD 2AV7A 1BLNA 4PREA 4HC1L 3KLAA 5DZNA 3VFPB 4OQ1A 3LKSA 5GGQL 4PJ8B 1A6UL 4JFDD 1F90L 5C8JA 3O4LD 1X7QA 1HH9A 1LDPL 1LDSA 3DV6A 4FTVB 1FL5A 3QXTA 3B5GA 3ZE2F 3O0RL 1BOYA 3NZHH 4OCYL 4E5XA 1B0RA 3HRPA 4M02A 2UUDK 5J4MA 3RWCB 2CMRL 1U3JA 3KPNB 2OTUB 4RFOH 3PIQB 1JCKA 3D1MC 3QUZA 1G1YA 3TZVD 3L5WB 4YHML 3KXFE 5ICYA 2XWJA 4FXKA 4NQSA 5IW3A 4MWFB 1BBJB 1KC5L 5SWZE 4ZD3H 2D3VA 1MCWW 4PJFF 3KPRE 1OY3B 4QRUB 3W0WE 3KXFD 1DBML 1KB5H 3F62A 3V7AE 1I8KA 5DJ0A 4L4TD 3DYMA 2AP2A 5SWZD 1KTLB 1ZXQA 3QWRA 2F54E 2E3VA 5I73C 4YHOL 1CFBA 1P4BL 3ELAT 2VKXA 3MLZH 3IRPX 3KPRD 4WNQB 5KVFL 2R2HB 3W0WD 3O11B 1X4XA 2PW1B 2ZNWA 5DUBA 3EFFB 4BFIA 1DQJB 1C7SA 5FYKL 3TESA 2F54D 3STBA 2AEPL 4WDIA 1QLEH 5FGSA 4L8CA 2C1PB 4IOSD 1PZ5B 3OKOB 3GMMA 2VL4A 1XGUB 1X6NA 2HH0L 5T3XL 1WK0A 3EFDH 2MMXA 4IOFD 5I1LA 4PJGA 2VITB 2Y36H 3G6JB 4OLUH 3QG7H 3ARFB 5EU7C 2BSRB 4JZNB 4KKAC 5F96H 5F6IB 5HYSB 1S7RA 1Q0XH 3B9KA 4OFDA 3U4EA 5HDLA 3LRGA 2I5YH 5B3NA 4IJ3B 1K8DA 5GRZA 4JO4L 2ZOLA 3FOMB 1B88A 4G3YL 5JZ7C 4GW4B 3E8UH 3LS4L 4P49A 4KH2A 4HUVB 4NUJB 3SKMA 4RGOL 3BGAA 3FOLA 5BO1L 1I85A 1HHHA 1OP5H 5CUSL 3BXNB 2AXFA 5C0BE 4PGZA 4M93C 1GOGA 4I8DA 3D6GA 2ENYA 1MFBH 2VE6A 1F13A 2APFA 4ZFFA 5HYFA 4WHYG 3FFCB 1Y0LB 3PGDA 1L0QA 2YUVA 2FSEB 4KTEL 5CD5D 5JPNB 1SEQH 2K1MA 4JPIA 3UEZA 3J8F7 5CWSA 4MJ4A 1S5HB 4BA8A 2R1YA 4WU7A 4YGVA 1IC4H 3IFNL 2IALB 5DUPL 2JCCA 1QFUL 5D70L 1P4LA 5CEYB 4AK1A 2O5ZL 4WTWA 1BFVL 3K4AA 3SGKC 5ADPH 1FZOA 3BE1H 1YNLH 4R96A 1KELH 3LEVL 3H3PH 5EC1B 3T0VA 2FL5A 3RVVD 3C2SA 4NCC2 5K9QI 4NN5C 1JN6A 2AJYH 2EC9U 5IQ7L 5I8OH 1IAKA 3VXNA 3GI9L 3I6GB 3MRPB 1UXSA 1YEHH 4FQQA 4O51A 1MCBA 4YDLB 1UM4H 1ORQA 2BP3A 3L3OB 2YBRB 2OTWB 2UY7A 4HUKB 1C5DA 3HZMB 2PTVA 3MACL 4JDZB 4XMLH 4MA8L 3OTTA 3S36X 5T1DH 4FQJH 5FB8B 5E5RB 3KNBB 5HGHB 5C0AB 1SHMA 3EOAB 4I2XA 5IOPB 5JLZA 2BY3A 5I15L 1CE1L 1GGBL 4MZ3A 2PO6D 2X6MA 3LRSA 1CQYA 5E2VH 3THML 1JGLH 3UTTE 3BO8A 2E27H 5H37G 4M43L 2L0DA 5JW4R 1OAZL 2GYSA 4X7SL 3ULVL 3FO9B 5FF6B 3EO1A 1EFQA 4FQCH 4PJ8D 1FZKA 3HMWL 4PG9A 2IQAB 2GSIB 2WLZA 5D6DA 2J6EL 4EN3C 2ZNXA 4PJDA 2A38A 4FTVD 4XPBH 3DUUB 4KXZH 4M7ZC 2A2QT 2QQNL 3R0MA 3V0VB 1G9NC 2VH5H 3V4VH 4IDJL 5FHAH 4HIJB 4QRRE 2OJZH 3FONA 1MRFH 1B0WA 4JZOB 1MHEA 2DQCH 2K7PA 3SE8H 1WEJL 3CVHH 1LO2L 2XZAL 3CDCA 1L7TH 1YYMH 1AD9A 2QQKL 1SJEB 3VFUB 1JPTL 3KS0J 2E6JA 3LEYL 5IP4A 4Z18A 2J5LB 4KJWD 3WHE0 4XPAH 3GUTA 1INEH 1J0HA 3X3GL 2EYTB 3ZDXF 2GJ6B 1YMHB 1DUZB 1NGWB 2DRUA 4G8GA 2HYMA 3AS1A 4H25B 4R4BB 4ONFL 5E7FA 3C8KB 3NGBB 5ESQA 2IEPA 3F7VA 1OHQA 3BH9A 3G6JE 4JFDA 3O4LA 1MRDL 3C5SA 4CVZB 2XZQH 5ALCL 4GKZB 1YJDL 3SPVB 3PV6A 4PJ9B 3O6KL 2MQ3A 3ARFD 1S9VB 4U7MA 4P23C 4JDVB 3TZVA 5FYLE 3KPSB 3U7AA 5F7DB 1D5BB 2J3SA 5DJCA 5JOPE 4U1NA 4WO4C 3VFSB 2ATPA 2V2XB 4U2ZA 4NWUH 4C56E 3GJEA 1KJ2L 1MVUB 1KCSH 1IFHL 3MRGB 5FYLD 3KXFA 1KPRB 3T65A 3TPUA 4MHHG 5D72H 2DQTL 1ZT1A 4BH7A 5JOPD 3UZEA 4L4TA 1XF5A 5SWZA 3HC0A 2XI9A 3I75B 1UACL 1NGZB 2YPKA 4BM7A 1QR4A 2IAMB 2XQYG 4QHKI 3KPRA 4YIQA 3W0WA 3FFCE 4BFGA 3QHFH 3NTCH 4NZUH 2ZSVA 5FECA 2WAHA 3C09C 3TBYB 3WFCL 4KHTH 1ZLWH 1GGIL 4FQHA 2F54A 5GJTL 5L8JB 2QSCH 4FOMA 2EIBA 5EZIL 3EO9H 1JWUB 3PL6B 4YNYB 3FFCD 1J0KA 4QTHB 1EK3A 1IGFH 1OAKL 4KMQA 5DT1H 1EJOH 2DB8A 5I66B 3DROA 3MRFA 3U6RA 2UZIH 2KDGA 4M4PA 2FEEL 3RPKA 1U9KA 1SYSB 2VLLB 5D7JC 3LHPL 5IQ9A 4KUZL 4TOYL 2V17H 4Q58C 3E6FB 4RA0C 5JW5B 3D48R 1JUFB 3NA9H 1TPXC 2V2TA 4ERSL 1NUDA 1T1YB 4MNHB 1BZ7A 3RWJA 3BJLA 2V5SA 3C08H 5DEGB 3E2HB 5EOCJ 4NP4L 5DJZB 3RJQB 5MERA 1QP1A 2Q8AL 5CBEB 1QQDB 5LXGH 4UT9H 1YEIH 3WMSA 5KS9E 1PX3A 4O2FB 5C0AE 1MJ8H 1VENA 2I07B 3KJ4B 5ESVA 3RNKB 5ANMB 3MXVL 3IS1X 4LBEB 1DQDL 1NBZA 4CNIB 4P2YA 5FA4B 2ARJB 2V5RA 4HJJL 3UBXB 1KPVA 3C9NB 4TSCL 3HR5B 1H5BA 5FGCB 5C0AD 5ISZB 1OAXH 2GK0B 1A6TB 3BKJL 5DJ6B 4QXTA 3VXMB 4PJHF 4L1HA 5F7KC 1NDGB 1GGYA 1A7BA 1E28A 5KBNC 4GKSA 4U1IA 2A6IA 3GJFK 1Q1JL 3REVB 2GEEA 2HMID 4Q9BA 3FQNB 4CW1B 4YK4C 3WFHA 1JGUL 1NC4B 4XCEB 3VXUB 1CI5A 1RZJL 2KUTA 3MR9A 3U0TB 1NBQA 3H9ZA 4OV5A 1FORL 4HIHA 5TDOA 4Z95H 4ODBD 2F19L 1NMAH 4LLYB 1QSEB 3O4OB 1QBML 5F7FA 1B6DA 4PJXA 1KULA 2PN5A 4PY8J 4MA3B 1R5WA 1RZKL 2ATKB 4LKXA 4N0YL 1EEYB 3WCYA 5LBSL 1MFEH 1CF8H 3W5MA 4N8VG 2HJFB 2AXGA 3CU1A 3GSUB 4R7NB 5A16A 5HHOE 1XF2A 3HNSH 4C59B 1FPTL 3FJTA 4JAMA 5DJ2A 1W0YT 2PR4H 2YN3A 4X7DC 3SO3C 2PO6A 4KKCC 3P4MA 2DJSA 5K93A 1X5HA 5C2BL 4PJCF 1QFWI 4UT6H 4YAQB 5L0QC 2AJSL 4BQCA 3IDXL 4NKMB 2GJ6D 2D03L 2DI8A 4RMVA 5AZEH 1KFAL 3H9SB 4WCYL 5CGYD 5E1HB 25C8L 3FN9A 1CIUA 2OZ4A 4NCDA 3VFPA 5EN2B 2NY5H 3W2DH 1X5AA 4PJ8A 3U9PL 3WXVL 3SKJH 5J1SC 3TCXA 1EAJA 4GRWH 1CLYH 1I9JL 4FTVA 4I3RL 4NQDB 3IU4L 3KPSE 3MGAA 2LTQB 2FX8L 1M7XA 3G9VA 5HHNB 4G6AD 1PVHA 2BNUB 4RA3A 4PJ9D 1T22B 3RWCA 1N0LA 3EBAA 3KPNA 2OTUA 3T4YB 3PIQA 4HK0B 1MFCL 2VB5A 5CJXC 3L5WA 1LO5B 4KDWA 3KPSD 5T3ZL 5DO2C 2DQEH 4TVPH 4MWFA 4POZD 4QRRA 1BBJA 3HE6C 5FCSH 4NDMB 3EYOB 5K9OB 1FO0L 1S7SB 4QRUA 1CD9B 4J3SA 1EEUA 3GB7B 3O3AB 1KTLA 4KMLB 2DQHH 1CN4A 4UIMB 2IAMD 3NIGE 4JPKL 5CJ5A 1KCUL 1PG7L 4OQTA 4WNQA 2R2HA 1QD0A 3O11A 2PW1A 1GGCH 2BVYA 1BJMA 3EFFA 4LVHC 5EWIH 2WWKT 1JPSL 5CJBA 4I3GA 4O58L 4I4WB 4H0HB 1WWCA 1IGMH 3VFTB 3U0WL 1CGSL 3PL6D 5C0GB 3QWQB 2C1PA 5D6DC 1PZ5A 2J8OA 3EGSA 3OKOA 1XGUA 5DJ8B 3N1MC 4Q74A 2YMXL 2UZXB 1N6UA 1UG9A 1BBDH 3VI4F 5BV7B 4OLZH 2ORBH 2VITA 3G6JA 2NY2B 1XT5A 3ARFA 2BSRA 3QI9B 4JZNA 5HYSA 2Y4SA 2R29H 5DUMH 1KF9B 5MP6L 3FOMA 5HI5C 4P9HC 5CZVH 5T5FL 3QIBB 3QHZH 1KT2B 5C7XH 2XA3A 2FB4L 4GW4A 3UTPE 3BP7B 2R2EB 1VADB 5DEFA 3SJVB 1RZ7L 3Q48A 4HIXL 4HUVA 4NUJA 3G9AB 3OB0H 4JQVA 4KTDH 3BXNA 5E9DB 4R26H 4GMSH 3OV6A 3WL9B 2DLTA 4W6WB 3QZWG 1VB9A 2LVEA 5FGCE 3HZKB 3FFCA 5ISZE 4N90D 1Y0LA 2VZOA 4OIIL 4YXHH 4OV6F 2FSEA 3VXME 3BISA 3JVGA 4F9LA 3QEQB 5JPNA 1FGNL 2F5BH 3VG0L 2W9EL 4M1GH 1TJGH 1UA6L 4KI1A 3RVTD 5ISZD 1MFDL 1S5HA 1GC1L 3DETD 3PGFL 5TF1L 3VXMD 1ADQA 2IALA 1FJ1A 4IMKA 5E99H 5CEYA 3U7WL 3I6KB 4QRTB 2B4CH 1JZ6A 4MD5B 3ARVA 3BWUC 1LEIB 5F7NC 2ILLA 5FM5O 2H41A 1A4JB 1NC4D 3MSPA 3VXUD 5EC1A 1QSEE 4FFWC 2NY3B 3LKNB 1TFHA 4Q2ZB 2P46B 3RWIB 3GSQA 4F7EB 3I6GA 5EZOH 3MRPA 3ILPB 4KAQH 3LN4A 2VDRH 3QUMB 1QSED 4XHJC 3L3OA 2FGWL 1FNEB 5GGTH 5DMKB 5KTEL 2YBRA 5I1EL 3ZDZE 4F3FB 2OTWA 3T2QA 3VG9C 4F9PA 3VXOB 3L5JA 3OKYA 3QNZB 3HZMA 1F42A 4J1UB 1MRCH 3C87A 4JDZA 3PP3K 3WKMH 3V0WH 5FB8A 4HCRL 1D5XB 3KNBA 5HVHC 1OTSD 2JJTC 5C0AA 3EOAA 2VNCA 3CX2A 3H9SE 2IQ9H 2YOCA 3BMVA 2FX9H 4J3VA 1G7JB 3CFEB 1EV2E 4P9ML 1CYGA 1J88A 4EUPH 4O00A 1P69B 5GRUH 2AKRB 4LU5H 1DEDA 3WJJA 3H9SD 5JO5B 4TNVF 2OL3L 5I0ZA 3I3DA 1TZIB 1AQKL 5HYIA 3PHOB 3FO9A 5FF6A 1FNLA 4NQDE 5I1KH 1N6QL 4CBPA 5GS0H 3IAPA 3BQUC 4P3CL 1A7QH 2IQAA 2GSIA 4PJCB 2OR7A 4NN6C 1AO7B 2BY2A 3T0WA 5IHZB 1NCDL 2VZ3A 2D2OA 2OQJB 4WTZA 4NQDD 3V0VA 5DZOA 5C09B 1B4RA 3P4LA 4HIJA 1CFVH 4KKLD 1F8TH 4JZOA 5J13C 3RA7H 3QDJE 1HNFA 2VABB 1ZHLB 1PKQE 1INDH 3D9AH 1MLBB 3UDWC 2H2PC 1RUML 4LCYB 4ZSOE 3SE9H 3O6LL 1SJEA 1MWAL 3VFUA 4HC1H 5CD5C 4G6KL 2XXCB 1C5BH 1P7HL 2A0LC 2DICA 2GJJA 1FYHB 2NY6B 5GGQH 1ZS8B 3FQXB 1RIHL 1A6UH 1I1YB 1F90H 2B1HL 1LDPH 5HHOA 5B4MD 4IRJC 3O0RH 1YMHA 1C12B 2Q86B 1DUZA 4OCYH 1NGWA 2HFFB 3FZUC 3KHOA 1UB6B 4A2LA 5GRXG 3U9UB 2N7BA 4CDHA 4H25A 4R4BA 3C8KA 1LEKB 1JHTB 2PYEB 5FKAB 2NQCA 4ZPVB 5J7CC 4K3EH 1TDQA 5TH2B 5ID0B 3IGAA 2P42B 1OW0A 1UEMA 2F8VA 2W9LA 2YXMA 4CVZA 5JPMB 2XIDA 4OFYD 3FMGL 1KC5H 3PE9A 4GKZA 3D85B 4BQ8A 3T0DA 3SPVA 3QO0A 3DJ9A 5I1HL 2NR6D 3WLBB 4PJ9A 1DBMH 3L3JB 4MA1C 1I1FB 2NY2D 3QI9D 1F3RB 2Z93B 4JDVA 3REWB 2RHEA 3KPSA 5F7DA 1D5BA 1P4BH 3VFSA 5KVFH 2V2XA 3SJVE 2BY1A 5T1MB 1PSKL 5SX4I 4OLEA 3G6DL 1F4WL 1MVUA 3QIBD 2BXYA 4R90L 3MRGA 4BSWB 1NFDB 1KTRL 5ACZB 2DM7A 1KPRA 5IBUG 5FYKH 5E9DE 1FIEA 2AEPH 1R0AL 2DLGA 3CK0H 1EO5A 3SJVD 2JK5B 3WNNA 5IROA 3I75A 1NGZA 1HXMB 1U36A 2IAMA 5IBTL 1SYVB 3IDGB 5T3XH 1NGPL 2GITB 1N7ML 3OKKB 4X8JB 1T5WB 4MMZC 1YEJH 1P4IL 1TNNA 3NCJL 4D0DB 5E9DD 5ABDE 1VFOA 3TBYA 3QEQE 5IF0B 5HVWA 5D93C 3FN0L 3AGVA 5L8KB 1JWUA 3PL6A 4YNYA 2J88L 4JO4H 4PJ8C 4QTHA 4JM2F 4R4FL 3ZO0A 4P57B 2WUCL 4AT6A 5EULV 2QSVA 5CGMA 5C0RL 4G3YH 3QEQD 5I66A 4WI8A 3NMEA 2VQTA 7FABH 5I16B 1HHIB 2GJZB 1T0NA 2HRPH 4YHYC 2PKDA 1A6WL 3ESUF 1YEEL 1SYSA 1TNMA 4RGOH 4HJGB 1R3KB 4M1CD 5BO1H 4E41B 3MRKB 1IZKA 4LDOB 2WWMD 1G7IB 4JM2C 3BZFB 2MKWA 1BQLH 3E6FA 5CUSH 5EFIB 2HA1A 2BX5A 5JW5A 2MQ0A 1JUFA 2AEWA 2J8HA 4LVNC 3BZ4B 3EJJX 2XXMB 4QRQB 4JM4H 3SOBL 1T1YA 4KRNA 1UKTA 4MNHA 1NLDH 2G5RA 5E56A 4LASL 2NY3D 4KTEH 5DEGA 5DJZA 3ARTA 2NZ9C 1QR1B 5CBEA 3SEPA 1QQDA 2QEJA 3TGXA 5FDYA 3AC0A 3WV0A 1YY9D 4O2FA 5DUPH 2WK2A 3SCMB 2I07A 4G8IB 3RNKA 5D70H 5GQBA 3TIDB 4HH9B 5ANMA 2O5ZH 1BFVH 1UEYA 4LBEA 2VAAB 3PHSA 4KK5D 2XG5A 4CNIA 5F9JB 3IKCB 5FA4A 2ARJA 4L9LC 4OZFB 3STLB 3LEVH 3UBXA 3C9NA 3HR5A 5ISZA 2GK0A 1A6TA 4FFVD 5DJ6A 2Z8VC 5L88L 3VXMA 4X5LA 1T03L 2D7TL 4NNYB 3ZDYF 1NDGA 1EUTA 3ARFC 5F6IC 2NY4C 3RVUC 2W0LA 3REVA 5CEXB 1AO7E 3QFJB 3M8OL 3ZKND 1GOHA 4R2GB 1NC4A 1IEAB 1IAIL 1XGRB 2OJEA 4XCEA 3T2NL 3VXUA 4U33A 4NKOB 3R06A 5C09E 3C6LB 4JFFB 3U30B 3U0TA 1A47A 4DZ8B 1X5XA 1AO7D 4MA8H 3G08B 3PQYE 1MJUL 5CLWA 5C0EB 3EYSH 5A2FA 4LLYA 5L2KB 5C09D 1QSEA 2VDNL 5I15H 1CE1H 4NN7B 4QOKB 4U05A 4PJAF 4MA3A 5E5MB 1CK0H 3HPJB 2ATKA 4WV1C 3B2VL 3THMH 1LVEA 3ARQA 1EEYA 2A73B 5J1AB 1A7PL 4PY7B 3B83A 4M43H 4HG4K 1FZMB 3GSUA 4R7NA 4LIQL 3ULVH 2H2SD 1GL4B 3JVGC 2VIRB 1RIVL 5IMMB 3MLUL 5GGVL 5D6CB 4O9HL 3UZQA 1QFWM 3MV9B 2NY6D 2WSKA 3HMWH 5K9QG 3DGGB 1MQKL 2J6EH 3BESR 3SKNB 2ZJSL 1REIA 2PYEE 4YAQA 2V5TA 3KPTA 2FEDD 4NKMA 4OIBA 2QQNH 2FHCA 3H9SA 3ARBC 4YWGL 4IDJH 2IFFL 4JQIL 2PYED 5EN2A 2VO5A 3TBTB 1WEJH 1LO2H 2RCSH 4UILH 3SGEH 2XZAH 5A43C 5FK9B 3T0EC 4D9LL 4PP1C 2QQKH 3B9VA 4NQDA 5I1CL 4HXAH 3C8DA 3D85D 4X6BB 5DGQA 4GRMB 1ZK9A 1PAMA 1QZ1A 1JPTH 2XQBL 5F6HI 3LEYH 4DW2L 1XCTB 3LAFA 4HKXB 5HHNA 1MREL 2BNUA 2ZOKB 4A2MA 1T22A 2NY0C 1ZT4B 4Z8FH 4OB5H 1FNAA 3T4YA 2KPNA 4HK0A 5D7LB 2H1PL 2HFTA 4PGBB 5F1OB 1NFDE 1LO5A 5EU4A 5GZND 3DURB 4F9PC 1QTYT 1S7WB 4YDIL 4K3DL 4ONFH 4NDMA 4PJ7F 3EYOA 5B39G 1KUMA 5K9OA 2CH8A 2ZG2A 4UOW0 5J1TC 1S7SA 4DWHA 35C8L 2FH8A 1PKQA 3CZJA 1QEWB 3GB7A 1WBXA 1IILE 1MRDH 3O3AA 5ALCH 3HKFA 2EXYC 4LPUA 1A1OB 5KVEL 4UIMA 1YJDH 5TDNB 1LHZA 1T2XA 4Z76B 2IMNA 1NBVL 3U48A 5DFVD 3O6KH 3H0TB 3V5DB 3BRGC 1KTKE 2YD3A 3IJHB 3TFKC 2Q1EA 4I4WA 5L9DL 1L0XA 2B2XL 1DCLA 1JTPA 3VFTA 3Q0HA 5C0GA 2HKHL 4OFYA 1ZA3B 5DJ8A 1GYAA 4PPTA 2X4OB 1S9XB 4QTIL 2DQTH 3VGAB 3QI9A 4UDUB 1L6ZA 5LWYL 1SJHA 1UACH 2HTLC 5CD3B 3BT2L 1AHWA 4E41D 4DZBA 4HKJB 4UB0L 3O6MH 3K8LA 3QIBA 5GHWL 1HYRC 1KT2A 3WFCH 2E7HA 1GGIH 2KBGA 1CDIA 3WDJA 3BP7A 1D5ZA 2R2EA 1VADA 3HN3A 1BJ1H 1XGPB 5EZIH 4MAUL 3SJVA 1ZV5A 4OZ4B 1RFDH 3OJVC 2VDPL 4X0KB 5DLML 1BHGA 1DBKH 3S5LB 5TQ2H 4OFPA 5E9DA 3BUYB 5D7KE 2YXFA 4RWHA 1QSFB 1AH1A 4LPYA 5DJDB 4FZEL 3WL9A 1FNSL 2YEZB 3LHPH 4LKCB 4KUZH 5DQDL 1NDMB 3SCMD 3HZKA 3QUXC 3QNYB 2P8LB 1DBBL 1V8HA 4TOYH 4A6YL 2C4FU 1XZ0B 5HDBF 5D7KD 4FG6C 3QEQA 1CGWA 4MVBC 4OSUL 3FT4B 4IRZL 5JMOC 3QUKB 3QFJE 1V3JA 4PJ9C 2XY1A 1OAUL 3MLWH 5AD0B 3I6KA 4QRTA 4MD5A 3DX9B 4MB3A 2Q8AH 1LEIA 4J3XA 4LK4A 3QDMB 1H3GA 3OB8A 1KPUB 2V7HB 3QFJD 5FYJU 4UNTA 4E42B 4R2GD 1A4JA 3QJFB 1QRNB 4J6RL 1CLOH 5L2KE 3VI3E 1D6VL 2GT9B 4JDTL 3C6LD 4JFXB 1J11A 3S36L 4FQLL 4JFFD 3UTOA 3LKNA 3PP4L 4M8QB 4KC3B 4AEFA 4PR5B 1DQDH 4IM8A 3RWIA 3V6ZA 4F7EA 4ZAKB 3OPZL 4F7TA 2UYLB 5LJYH 2YK1L 4IMLB 4YE4L 5BMFL 3ILPA 2IAMC 4NC0B 5L2KD 3QUMA 4TSCH 4LAQL 4OLXH 3Q6FB 2JF1A 1OWRM 2BNQB 4LSRL 3BKJH 3X17A 1FNEA 3ZKMD 2QBWA 5DMKA 1FDLL 1VESA 3WJLC 4RISL 3ZL4L 4QOKD 2KL6A 4F3FA 1R3HB 4PJBF 3NIDF 3MV9E 3QNZA 4DGVL 5K59F 4J1UA 1MNUL 1EMTH 1Q1JH 1JHKL 3CXDL 2CO6B 2UUDH 2F8XC 2EZ0D 3JXAA 1JGUH 3JWDH 3L95B 1FC2D 4XWOC 4DKEL 3HMXL 4CADB 5D2LE 1RZJH 4PJAB 3MV9D 3E1F1 1G7JA 3CFEA 1RK1B 5JMRA 4NKIH 1G0XA 1FORH 3FCTB 3DO3A 2AKRA 4NO5B 2F19H 5JO5A 2W60B 1BX2B 3T3ME 3ILQD 1QBMH 1UXWB 1TZIA 3PHOA 1TQBB 2R4RL 1JF1B 2DTML 5GRVK 3VCLB 1RZKH 4N0YH 4PJCA 1A64A 4G6JL 1LE5B 1AO7A 3LRHA 5D7LE 1RI8A 5A2IH 5IHZA 4MDIB 2OQJA 1EH9A 2RR3A 2Q6WB 2FDBP 4U0QB 2SEBB 5C09A 1FPTH 1VHPA 2I25N 5D7SL 3SGJC 1K3ZA 3MRCB 4Z7NE 1WISA 3ZKQD 5D7LD 2VUOA 5C2BH 2VABA 3IAQA 2AJSH 3UTQB 1ZHLA 1HSAB 5FUCC 1MLBA 1U8OB 4LCYA 4ZQKB 2Y6SC 1KFAH 3PV7A 4WCYH 1ZANL 4CKVX 5AG8A 1U58A 3CFDB 25C8H 2XNAB 1NL0H 3AY4A 4ODWB 4BSJA 3HTLX 3CNKA 5KVGL 1ZS8A 3AFLA 3FQXA 1I1YA 5CSBA 3LVEA 4Y1AB 1I9JH 1FH5L 3KHQA 4I3RH 2Q86A 1C12A 1DBJL 1F4HA 1BMGA 2HFFA 1DLFL 3ORJA 1UB6A 2NY7L 4JZJC 4PJ7B 3RWEB 3U9UA 1HILB 4XPFL 1ZAGA 3GK8L 4X98B 1LEKA 2PYEA 5CSGA 5FKAA 2BY0A 3K8KA 4OZGF 4ZFOA 3C60C 3IS0X 2VERN 3RIAF 1WT5A 4ZPVA 5BRZB 5BVPL 5T3ZH 2MCG1 3ABZA 4HWBA 3J7HA 12E8L 4YHIA 4YFLF 5JPMA 4CVXB 3ZKSD 3WFBL 3D85A 5IVZB 4I13B 4P4RA 3S37X 3T04D 5CSZB 4Z7UB 5IGXH 1UADC 3SGEI 3L3JA 4ZO6A 1F3DJ 1SBSL 3HPLB 1I1FA 2Z93A 1ETZB 1KG0B 3REWA 4OM0L 3QJHB 3OKDB 4U7SA 5DS8B 4Y4FB 2WWKO 1CZ8L 1PG7H 5T1MA 1ZEAL 4ZOCA 1OGAE 2ERJB 2H45A 2FD6L 3CPLB 1QFOA 1JPSH 1NFDA 3QR2A 4HK3N 1S3KL 4O58H 4BSWA 5ACZA 3ROOB 4TPRL 4D3CL 4XNXL 4XXCC 4YBHA 3U0WH 1CGSH 2JK5A 1QSFE 3S3SA 1D3CA 1HXMA 1EGJA 1SYVA 3IDGA 2GITA 3OKKA 5A2LH 2YMXH 2FBJL 4X8JA 2VZTA 1T5WA 1RHFA 1OSPL 4LGSB 4D0DA 3N9GL 1W0WA 4HGWB 5E5UB 4U4BA 1J0JA 5IF0A 1QSFD 4DJMA 3CVHB 5C0DB 2YRLA 4QWWD 4NJ9L 5MP6H 3LH2L 4KRPC 4JHAH 2R8SL 4HV8B 4P57A 1TJHL 2OXHA 3UO1L 2DAVA 4U6YB 2FIRT 2PXYA 3DXAB 2FB4H 5I16A 1HHIA 3TT1L 2ICWI 2GJZA 3VDCA 2LTQC 4P46C 5IT2H 3QDME 1RZ7H 3LZFL 2HFGL 4HIXH 5I74B 1P5UA 4GRWF 1UT9A 4R3SA 2CUIA 4HJGA 1QRNE 4PGCB 1D5MB 4H8WC 4E41A 3MRKA 5B22A 1G7IA 3BZFA 4XPHL 5EFIA 4AL8L 3W39A 3N1GC 1Y6KR 3QDMD 1KB9J 2VLJB 3BZ4A 3VWKB 2NYYD 4QRQA 2NY5C 1QRND 4MXVF 3D25B 2BNQE 4OIIH 4UQ3B 5GJSL 4OZHF 5CEZL 4ZAKD 1FGNH 1RJYB 2W9EH 5C9KA 1QR1A 5ID1B 1UA6H 1AFVL 2O61B 4QGTA 1MFDH 2BNQD 3HAEH 1GC1H 3PGFH 1T0MB 5TF1H 3HC3H 5LG1A 3ZZ1A 3SCMA 4G8IA 4RQQB 3TIDA 3U7WH 4HH9A 4PJAE 1KYOJ 3S98A 2VAAA 2FEEI 4HZLB 4KRLB 3NFSH 3VWJB 4BUGA 5F9JA 1N3NB 3IKCA 4UMGA 4OZFA 3STLA 4G7YL 3UC0L 3CAFA 5BV7C 1AGDB 5GPRA 4UBDC 4PJBB 4NNYA 1OD9A 2Q7NA 1FE8L 5FOBB 1AGFB 3MJ6A 5CEXA 1HYSC 1AHWC 1EVTC 3QFJA 1KENL 4YXLL 2FGWH 5F93C 1IEAA 5KTEH 1TLKA 2BC4B 5TE7L 1XGRA 3UPCA 1QHOA 3ALPA 4RFEB 5BS0B 4NKOA 5D1XB 4Z7WB 1QA9B 3OG6B 3WUWG 5IFHL 4JFFA 3RHWK 4JRWA 3ULUL 3UTSB 1H3PL 4DZ8A 3CMOL 5I71C 4QEGA 4L8BA 3G08A 3OGCB 1G7MB 5C0EA 4HCRH 3EYFB 5L2KA 5KSBB 4DK6A 1NGXB 2CK0L 1HQ4B 4QOKA 5E5MA 2B5IC 3HPJA 4P9MH 1KB9K 2DQUL 1SVCP 2AXJA 5J1AA 5FGRA 3FQTB 2HRLA 1NGYB 4RX4D 3NAAL 4Y1AE 1SQ2N 4ZOBA 2GFBB 1A6VH 4LRIA 1FZMA 4JPVL 3MLYL 1AQKH 3IXTB 2VIRA 2EDYA 5IMMA 5D6CA 1N6QH 2E7LC 1GVIA 3CMGA 4HMCA 2DIAA 3X11B 3MV9A 3BMWA 4O2CA 4P3CH 4PJ7E 3KYMB 3DGGA 1T2QL 5BQ7B 3VRJB 4Y89A 3SKNA 4Y1AD 3IFOB 3EDJA 5KVDL 5GZOC 1NCDH 5BRZE 4QXGL 2HLFC 4M1CC 4XB7A 4PJEF 5D2LA 3P9MB 2WINB 3LKPB 5IB5B 3SKUD 3X12B 3MXWH 4OJFL 3T2OA 2VMFA 1KYOK 2IADB 2D7PA 1FN4B 3TBTA 4Z7UE 3W9DB 5BRZD 3FRPG 4MLIA 5FK9A 1RUMH 1W8OA 2KH2B 3FN3A 3O6LH 1MWAH 1MEXL 4X6BA 4G6KH 4GRMA 4JO3L 2Y5EA 1XCTA 3B8YA 4HKXA 3BEVB 2ZOKA 3SDDA 1ZT4A 4OZGB 5D7LA 5D7IF 4MJ6A 3KG5A 4PGBA 5GGRY 5DRWB 3TPKA 3AM8A 3WFEL 1A14L 1V3KA 2IH3B 4Y4FD 1I1AC 2DDQH 3DURA 3QXWA 4ZPTB 4ELMB 1S7WA 3M07A 4LRNL 3A6OA 4MCZB 4KK5C 1CL7L 3S88L 3VXQB 2FWOB 1MHHB 1JHLL 1VEPA 1QNZL 4HMDA 4LFHD 4NGHL 5FYJL 1J10A 5J6GB 3FMGH 5IB4B 1A1OA 4YBQC 5E00B 5TDNA 4Z76A 1R3JB 5I1HH 4XX1E 4KY1L 5H94B 1HIML 3LD8B 3H0TA 1A1MB 3V5DA 5IFAL 1FLRL 5DD0L 3IJHA 2MTPA 4JFHE 3EDKA 4OUUB 5D4QA 5SWQB 4R4NC 3IKKA 1ZA3A 2BVOB 4NRYB 3G6DH 2X4OA 4R90H 1S9XA 3DXAD 4JFHD 1OAQL 1NGQH 1XGQB 1J1XL 4UDUA 1R0AH 1KIPB 2VLJE 4E9LA 3OR6B 1AD0B 5IBTH 5CD3A 1MCJA 8CGTA 3NFPA 1N7MH 4HKJA 4WWKC 1YPZB 3NFNA 1P4IH 3MA9L 5B38A 3NCJH 3AVEA 3T09A 1MLCB 1JYXA 2VLJD 3VWKD 1DDHB 4U1SB 3PWLB 1XGPA 3FN0H 3O9WB 4X6CF 1EDQA 5ECJE 2NY6C 2J88H 4OUOA 4OZ4A 4N0RA 3GJFH 4NQXB 2Y1VA 4R4FH 1A0QL 2WUCH 3DV4B 4X0KA 2IBGA 3O3BB 5C0RH 3S5LA 4LSSH 1A21A 4K8RD 3BUYA 5GGSY 2HJKB 3EDDA 1CCZA 3K2UH 3OXRB 3BWAB 4QHMB 1QSFA 1YEEH 5CP3A 5DJDA 5DMYA 2YEZA 2H3NA 4LKCA 1TVHB 1NDMA 3MMEB 3QNYA 5E6IB 2P8LA 4U6VL 2W38A 4GXVL 4OZHB 1AI1L 4PJBE 3NIDE 3VWJD 4XCNB 3FT4A 5GRVL 5TE6L 4GSDL 3F12B 4DGYL 2GKIA 3SOBH 3QUKA 1TENA 2CPCA 4LASH 1D9KC 5TJWK 1KNOB 5AD0A 4Z7WE 3DX9A 4V2CB 1TVDA 1W72L 3V6BR 3NIFE 3QDMA 2ZUQB 3UTSE 2IF7A 4Z7VE 1KPUA 1T20B 2V7HA 3FQUB 4E42A 3QJFA 1QRNA 5BS0D 5KSBE 3G5XB 3LS5L 5L7XL 2GY5A 5JW4M 3QEUB 4GAGL 4M8QA 5HGDB 4PR5A 5ACMA 3UTSD 4ZAKA 3HR6A 2UYLA 1HOCB 4IMLA 1JRHL 2F53B 4P5TB 3F7PC 3Q6FA 2BNQA 4IIQC 5JHDB 2ZUXA 5L88H 1VEOA 1T03H 2D7TH 1DZBA 1R3HA 3TIEB 2G5BB 4F7PB 4PB0L 2R0WH 3F65A 1OSZB 3MV8E 1CD0A 1C08B 3LPFA 3M8OH 3D3VB 3L95A 5ETUB 1CICC 3CDFA 1A22B 2PXYC 4CADA 5E2TH 4PJAA 2X41A 4PBXA 1X5GA 3WHXB 4L29B 1DP0A 5IMLB 1RK1A 2BK8A 2WW8A 3MRRA 3BFOA 4M9OA 1L4IA 3WIHA 3FCTA 1XFPA 1MJUH 2VQUA 4GRLB 4NO5A 2W60A 4Q6IB 1BX2A 3WN5C 4ZUSB 1UXWA 2VDNH 5BW7C 1JF1A 3GNML 4ORZC 4X7TB 4TNWK 3VCLA 5BZDB 1FNGB 3B2VH 1A7PH 4NUGL 1LE5A 4OZGE 3B8SA 5C6PB 2A74B 4MDIA 1WTGT 4PUBL 2Q6WA 1RIVH 2SEBA 5GGVH 4BJLA 4DFIA 2I24N 4ELME 3SBWA 1PQZB 3TNMB 3MRCA 3ZYIA 3F58L 1LO0L 1MQKH 2ZJSH 4D0CB 1WTLA 1F11B 3UTQA 1HSAA 5EORL 1U8OA 4U3HA 3HHRB 4ZQKA 4RX4A 4WFFE 4YWGH 3CFDA 3VFMB 2XNAA 2IFFH 4JQIH 4OD1L 4ODWA 3TH2T 2X1XR 3MFFB 5CLTA 1TQCB 5C0NC 3RGVC 4WFFD 4Y1AA 4F58L 4D9LH 2X4RB 4ZXBC 3UYRL 5I76B 1HNGA 3TVMC 5CBAB 3QDGB 1IGTB 5I1CH 3O3DB 4DW2H 2B20A 5EUOF 2WBWB 4PJ7A 3RWEA 5TFSL 1HILA 2QSQA 1MREH 3IDJB 3U79A 3A6CH 1ZTXH 3GO1L 1F45A 3LQZB 3IFLL 2H1PH 1XR8B 5BRZA 4M7LH 4Z7QE 1SJVA 3RX7A 4CVXA 5E8OB 4YDIH 3H9HB 2R0LL 5DA4A 1JNJA 3SHSA 5IVZA 1BF2A 4ODXB 4Y16C 4Z7UA 5CSZA 3V4PH 35C8H 3RY5A 2R56L 1YPZE 1GPOL 3HPLA 3FO0H 5F72S 4GXUM 1ETZA 1KG0A 3F7YB 3P0VL 1VGEL 2DBLL 4CN4A 3QJHA 2R1XB 3OKDA 5DS8A 4Y4FA 5KVEH 4OCLC 1ZGLP 5T5NG 2CRIA 3JTSB 4OD3H <