2BOBA

Potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobA02
2QKIB 2Q76A 2X42A 1K8IB 4M43H 4EDWH 1T1YB 3X13B 3P4NA 5JXAH 4LLYB 2VLJE 2DICA 3FHQA 4YIQB 5ALBH 3TH4T 2ICES 1T0MA 1WUNT 4MNHA 3O2DA 3DRQB 3TCLA 1KOAA 3ARFD 1NC2B 4YBQC 4ZUVA 4OGYH 3MOAH 3C5ZC 3ARSA 2FIRT 3F12A 3PQYB 3CSBA 4KJQD 1MRCL 1TITA 1KGCE 2CRYA 1KFAH 1W0WA 3BKCH 2NYYD 2JB5L 4HPYL 4KUZH 2H9GB 2DDQH 2D7NA 3CH8A 3RKDD 3GSOB 4YNYA 2NLJB 2P46B 2QSQA 4PGBA 1DVFC 1M05A 4U6VH 5EOQH 5T3XL 4NQXB 4CBPA 5I30H 4DWHA 1IBGH 1KB5A 1IAOB 3QH3A 1JFQH 1KCSH 1Q38A 2HT3D 3QJFA 2JB6A 3CU1A 5D7JC 1JGDA 2VR5A 3NIDE 4C57C 1EZVX 2JK5A 5KOVC 4PBWD 2FL5B 1M6OB 4G9FD 3MLPA 1WJ3A 4HHAB 4R0LB 4C55A 4JQIH 2ZUTA 3HB3D 2YZ8A 3ULVE 2DJ4A 5DRWA 5AYUL 3RGHA 3FAWA 2AJ3B 2QQLL 2IAMC 2FZ3B 3RVVD 5BRZB 2KPNA 3BQUC 3C09C 5JOFA 2Z8RA 4NUJB 5MERA 4UUJA 4JPKL 2P42B 4PJFA 2PETA 1H3TA 4HK0B 2G60H 2AKRB 2EIBA 5INCA 4EQ3A 5IW3A 4QHMA 2A83A 2AV1A 2Y6SC 4FQ2L 2ZJSL 2ZPKH 3AFLA 3O2WL 5DURB 1YJDC 4YX2H 5D5ME 5T1MA 3OTTA 4I4WB 2EDNA 1PGRB 2IG2H 5MEPA 4Q9QH 3MC0A 4AMKH 5EC1A 2J8OA 1MVUB 1S7XB 4H25B 2J7LA 4XP1L 4NRXB 4N1EA 3CFCL 3VFNA 4GBXD 3RUGA 4H5SB 4QRPD 1FG9C 1LO5B 1UKSA 3VA2C 1N8ZA 1EGJH 3IU4L 3BSZH 4P5KB 3D6GA 3NCMA 4PBXA 4RAVA 1UWGL 4G7VH 1T21B 4AIXA 1WIUA 3RDTD 1MCOH 4RZCB 4WW2A 3D2UA 3B8YA 2X4OB 5HY9B 4YDKH 3GK8L 2F5AH 4HT1H 2HVKB 4YQXH 1FC2D 2AEWA 1J0ZA 3G5VB 1VKXA 1PKQE 1OSZA 3B3IA 5E4EC 2B5IB 3IVKA 2E7LA 4KTEL 1E6JL 3HG1A 4NQCA 1P1ZB 4FQ1L 3CFDA 3IXAB 1MCHA 4JO3L 2EEBA 2VZTA 2I5YL 2AV7A 2BHYA 1VB9A 2W0LA 2CLZB 5CJXA 5D9SA 2XYCA 1R5WA 3LPWA 3WS3B 3STLB 3V6OA 1ZKAA 5IFJA 5GISH 4EI5B 1A0QL 5E1AB 1MI5D 1QFWL 4XBGB 2B8OT 3X11B 4QTIH 1HHGB 3MBXL 5L8LB 3HUJE 3W82A 2ADFH 2GJJA 1I8KB 1QFWM 4HPOL 4ACPA 2WSKA 1MFCL 4WY7L 2BOBA 4K9EL 1T5XB 4XVTH 5IQ9A 4L8SC 2C3VA 4Q0XL 4LRNL 1RJZA 4Y2DC 4KHXH 5EBMB 5TQ2H 5L0QB 1Q94B 3WDIA 1A1MB 4MWFB 1XF5A 2FYYA 3UTTE 4RA0C 5T5NF 3G9AB 4RCAA 3ULUC 1DR9A 3DV4B 3QUYA 1J86A 2EYRB 4MQ7B 3RZCB 1MRFL 3B5HA 3INUH 4GRLD 4DVBB 5FECA 4XT1C 1FIEA 1S7QB 1TCMA 5HD8C 2OXHA 2ID5A 3CPLA 3HMXA 3UO1H 1EEUA 1MCLA 4XX1G 4Y0GA 3N9GH 1KLGB 3NPSB 1FGNL 3TYGL 4P49A 3CFEA 4JRXA 4P4KA 1NCNA 3BUYB 1LD9A 4J3VA 2DYPD 3QIUA 1G9MH 2DBLL 3C08L 2ZUUA 2W60B 5IVXE 1CQYA 5SV4A 5FYJL 3V0WL 5HHPA 2N4IA 2P5WB 4MB4A 5HDLA 3OQ3B 3MBEB 4PJCF 4LRIA 4FTVA 4KVNH 3BZDA 4PRNA 4B7LA 4WHDA 2XICA 1REIA 1M71B 3K2UH 1BF2A 3EO0B 3MUZ1 3VWKD 5TGBB 4XAKE 3DI3B 2PW1A 1YYML 4KQ3H 5I1AB 4PJAB 2I26N 1QG3A 1X44A 5KS9B 1Q9OB 1MJ8L 4D9RD 2J88H 2EO1A 4ELKB 1BVZA 4QYOB 2V17H 3M8OL 2FB4L 3P0GB 4W6WB 3JVGC 2MFNA 4R90H 4OZGB 3OL2A 4HD9A 4X6DB 3FZUC 3TBWA 1MY7A 5DDHB 3VXSA 1QSZA 1N2RA 4XPTL 4PLJD 2EH7H 3MNWA 5IMKB 5DUPH 3S9DB 4C56A 4H26A 2H26B 4IMKC 1BQUA 5CEXA 25C8H 1AGBB 3C60B 4NP4L 1BFOA 2WBJD 1RURH 4L3CB 2RFXA 5ETUB 3TJEL 2PYFB 1V3KA 1HINH 2B0SL 2HFTA 2V7HB 5HYJE 1NBQA 2BHZA 5KVEL 3ARUA 1AE6L 1OARL 3G5ZB 5L8KB 2IQ9L 4F7CB 4LCCC 3TBVA 4AT6B 4JLRB 4YBQD 4ENEC 4LCIH 5SX5H 3UYPA 1ZHNA 4BQCA 1AR1C 1D6VL 2CGRH 4Z77B 3C5ZD 1NDMA 4PGDA 4U1KB 4LKCB 4X6FB 3JV0A 3ALXA 2KL6A 3TP4A 3N1GC 4OLXH 1J1OL 5KN5B 4TSCH 3EAKA 4LSSL 3KVQA 2VLRD 5I1HL 2BVOA 2RCSH 2R23B 1UJ3A 1UYWL 1IAIH 5KTEL 3MV8B 3T0VA 2F15A 4PJFE 4I5BA 1DVFD 5TFSH 4JDVA 1B0RA 1FNSH 3FO2B 3L95B 2VDOH 5I1DA 1NANI 1ZTXH 4YE4H 5D7JD 2FEDC 4IIQA 1H3VA 43CAB 1W72H 2FJHA 4P23B 4L8DB 1EZVY 5E2WL 5DJYB 5IR1B 4K7FB 1XR9A 4YFEA 3MTRA 3QDJB 5IJVB 4XXDB 4L3EB 4KRPC 3CVIL 3MRLB 4OM0L 5D4QA 3CVHL 3UBXB 1PW3A 4JDZA 3DVGB 1YN7B 5ESQB 4P5MA 1NCUA 4WJ5A 4MS8C 2IAMD 3BP5A 3BQUD 1HOCA 3REVB 4H88H 4OIBA 5LGHH 1EERB 2BNRD 3QRFM 4TSAL 2DS4A 1NGXA 4OD1H 4KPHL 4MAUL 5DRXA 4UAOC 4XPBL 2IMMA 5GXBB 1IGYA 3HG1E 4NN7B 1C1EH 5C7XL 3G6JE 4YH6A 4NQCE 5EZJA 5KJRH 5HGDA 5D7IE 1HQRA 2EECA 1OL0A 4CW1A 5DT1L 4BQ6A 1YECL 1AKJA 1D5ZB 2EDBA 2JJWA 4MB3A 1OSPH 4NBXB 3CLEH 5CIPH 5EN2B 5CUSH 5D2NE 5T1LB 3WHXA 4JFED 3LDBC 4JGUA 1H5BB 3HZMA 1BVLA 3V6OE 2DQCH 5SWSB 2ARJA 1E4KC 3N1FC 1D5BA 1QHOA 2IPKA 1ZMYA 4UB0L 3CDFA 3TT1H 1NUFA 3KYNB 4ZFOA 5DJ2B 1KCRL 2JCCB 3ZKXC 1M7DA 4KU1A 5BOPA 5MEND 3O8XA 5DMJB 5DS8A 1ODAA 3SO3B 4HC1H 4MSWB 1DLHA 5IBUB 1RULL 3EFDH 5HGAA 4G8EB 3AB0B 4TNVF 1N5YH 4LGRB 1CLOL 3AMKA 5IHUH 2XWBB 4Y2OA 5LGJB 1O5DT 3VFSA 3P0YL 2PKDA 3S98A 1UKQA 5HI4C 1SJEA 5IROC 4ZYKA 3MJ9H 1BLNB 2F19H 3MOBH 5K9KA 1KPRA 2HJKB 3VXUA 2CR6A 3K3QA 3TBTB 3TF7C 1II4E 5J57B 4RMUA 3IJSA 1OWRM 4HUVB 1NLDL 2FX7H 2A0LC 2ITCB 5IHBA 1IGJB 2UY6A 4FTVE 5B38G 3U7WL 4GAYB 2EDQA 3PWPA 3SBWC 4MGXA 5ESAA 1F4XL 4MCZB 2R2HA 3RI5F 4OIIH 4Q6IC 2GTZA 2EDFA 3O3UN 4MYWB 4FFWC 1XIWC 2AEPL 2D7TH 1EHLH 4X6BB 3ULUD 1BBDH 3FRUA 1HH9B 1MCCA 3IFPB 4OZIA 4RGOL 1XCTB 4FABL 5HD8D 5J12B 1K3ZA 4MNQA 2X4TA 2J8UA 5EUKA 1BJMA 2G5RA 3MX0A 3LKOA 4G6MH 4TOYL 5CGYD 2LABA 3LS4H 1IILE 2GSIA 4WI4A 1A7BA 3AS3A 5IMLB 2BRRL 2FJFB 3VXSE 2E8ZA 1LO0H 5KVDL 1RJLB 2YWYA 5E9DB 4F9PC 1QRNA 5K33A 4J12A 1LQSR 3LS5H 4BK4A 5CINL 5DD1H 4N9GB 1WBZA 4CADB 4ZAKD 3A0OA 4FG6C 3LMJH 4DKFH 3E6FB 1Y6NR 2WM0A 5JW4Q 1I8MA 5TQ0L 4ERSH 3QEGH 3TYFA 5I8KH 3K4ZA 5IGXL 3P73A 4G8IB 3IFLH 3SE4A 2EDXA 2EDJA 3RWGA 2UV3A 3BDXA 4LU5H 2WUCH 2B7DT 3ES6B 3MV9D 1EXUB 1T4KB 2AGJL 1A3RH 3GJEA 4L4TA 4TUJA 1GSMA 1VGKB 2A6JA 3B6SA 3EYFB 1AGEB 3KPSB 4M7ZB 5DLMH 3FZUD 4TVPE 5CEZL 4HCRH 4L9DA 1PZ5B 2PTVA 3S7GA 3S88H 3GBLA 3DX8B 5I9QB 1NCTA 2VQ1A 4FXKB 1JHLL 3G6AB 5H8DA 1H8OA 3DXAD 5FA3B 2A73A 5FO8B 2VAJA 2DL9A 4PJEA 1HXMA 5F7EH 3QIWA 2MJWA 5HGHA 4GW5B 3TIEB 4UU9A 5C0JB 3WJJA 3JWDC 1UEMA 3EOBB 1U3YA 3DETC 4N0UA 4QHUA 2BNUA 1AIFA 2XKNB 5D1QB 1U8MB 5JNYA 1RZKL 4J1UA 3S34L 3SY0A 1QVOB 3CXHK 1U3HC 4ENED 5E99L 4WV1C 1AR1D 4MD5B 2EDEA 4NBZB 3T0BA 4F9LC 4QGTA 5I2IA 2H3NB 1BZ9B 1QZ1A 1D9KD 4F7MA 1FPTL 5FV1L 4LNRB 2FD6L 1MIMH 4ODUB 1VPOL 5C0CA 3O4OC 4W4OA 4R4FH 5FIEA 3MCLH 4R26L 1JJUA 3U4BH 4L8CB 2F9BT 3VRIA 1LK3L 1P4IH 2ADJA 3L5JA 2AW2A 3LV3B 5IVOA 3LEYL 4BFIB 1CLYH 5KW9H 2WNGA 1EO8H 2Z8SA 5FB8B 4X4XA 4LEOA 1EHXA 4FQPA 1F4WH 3TJEH 2JIXD 1ZVYA 4Z6AT 1PQZA 3QUXC 1HH6B 6CGTA 1JIBA 2FEDD 3BKML 4ZS7L 3D18B 1UCTA 3GKWH 4PREA 5FYKH 1T2QH 3MRNB 4XNQA 3O45A 5IIEB 3SDAC 3VGHA 3U48A 4WU5A 4DGYL 1IJ9A 2NY6C 4KRPD 3H9SB 4NO0B 4I2XA 3LKRA 5CJQL 5KSAC 4MS8D 5C0RH 5E7FA 3SE9L 2R15A 2VR9A 4L1DA 3IDUA 2Q3ZA 4FQIH 2X1WL 1DQLL 1YPZA 4YPGB 5FM4A 3RVXC 3KS0J 4M5YH 3UBXI 2PTTB 3NCJH 5BO1H 1MJJB 2J4WH 4JFYB 1QQDA 4I1NB 2X6MA 2MCG1 1QSFD 3CSGA 5DMIH 5K9QI 3BPCA 4HEME 3WN5B 3HC4L 1QLEL 3RP1A 3LEXB 1J0KA 1OPGL 1YMMB 2O61A 4QCIB 2X1XR 3UTZB 5FKPB 2F53A 1VA9A 4J23A 4MXWH 3UTSD 5HVWA 3GSRA 3OG4B 4PJIA 4WFED 1CF8H 1FLTX 4ISVB 1XGYH 5IV2B 3TO4C 2CRZA 3UCRA 4LBEA 3JWNC 1QNZL 3WO4C 1ZV5A 4DAGL 3ZL4H 4PP2A 5C0GB 2CSPA 1K8DA 3TA3C 4IDLA 3WEXB 5DJXB 5A16A 5E8PB 2EDRA 5BQ7A 3MACL 4NN6C 5CSZA 5F88B 3FO9A 3O3AB 4OF3A 4KK9C 4Z0BH 5BVPH 4O2EA 3GM0A 1FJ1B 2LAGB 3D39A 1JZ2A 2JJSC 4Q9RH 1FBIH 1AXSA 1NCWL 4HS8L 4OTXL 4OZIE 3EYQC 1SM3L 2YUWA 4LIQL 1AQKL 4R8WL 1ZHBA 2XN9D 5C3LD 4YHIB 2MHAA 2D0GA 1CDYA 2FGWL 1CD0A 4PB0L 1CK0H 3L3DA 1XGQA 1S9VB 3WUWB 4HIEB 5BJTA 2CDGB 1KGCD 1B3JA 3FQXA 4LDEB 3I9GL 3Q6GH 5DFVD 2W9DL 5J3HC 1CXKA 4WI6A 5TE4H 2A0LD 4M6ML 2OQJB 3KAAA 4Y5YB 4U1NA 3LHPH 2NY7L 4YPJA 4MJ6A 4FFWD 3U6RA 1TZIA 5DYOB 1XIWD 5FM5O 3IETA 3SDYL 1CIUA 3NABL 4HIIA 5ABDE 4NZJA 3SCMB 5D7LB 3X13A 4LLYA 2FRGP 4JAMA 4YIQA 2B2XL 4L4TE 4WWKC 5LAXB 4HKZA 5C2UB 5T3XD 1X5FA 2PYEB 3DRQA 4FQXB 1I4FB 3RPIB 3P4OA 2OS7A 1JYNA 4JPVH 3GMMA 3HE7A 3OKNB 3ILPA 4NO5B 5H37H 2B20A 2PW2B 3DMMA 3PQYA 4PJGF 3AU1B 4KKBC 2VE6B 3QXAB 4Z7NE 3HRPA 5I1GL 4PJDB 4Y5XA 1T22A 2L7JA 4JY4A 1G0DA 4J4PC 3DECA 4FG6D 3NGBC 5C0BB 1JHTB 5GS1C 3VXNB 3K46A 2V5MA 1U8LA 1RUAH 1RZ8B 1KT2A 3FB6A 4N0UE 1LEKA 1JN6B 5F7HA 3ZHKA 3PIQB 4Z7QF 1YA5A 2XPGA 4OQTH 4YR6B 3AGVA 4LLAA 2YMXH 4HIJB 3VXQA 4MLSA 4I77L 4MQXD 4X5LA 5DMYA 4QNPF 1XF2A 1IVLA 5D2NC 5ECJE 1J1XH 2FL5A 1M6OA 1UH2A 1NGYB 2Z31C 1IEAB 4HLZH 2K9UA 4PJ8D 5HHNA 5KVDH 4G42B 5K93A 4D0CA 4PV8A 1ZVSA 1WBYB 3Q48A 1SVZA 4LCWB 5SWZB 3H0TA 3T2NH 2VABB 2FZ3A 1RJCA 5BRZA 5C71A 5E95B 2XFXB 1HWHB 5TPWL 3ULUF 3FO0H 5DMKB 3QA3A 3DETD 2E9JA 3PGFH 5EIIB 3OXSA 2OR7A 3SKNB 5DK0B 2IJ0C 3OAUL 1U3HD 4I4WA 1KJVA 3BN3B 2AXFA 2A9NL 1ZA3A 4AQOA 4R4BB 1FL3A 1MVUA 1RJYB 4TTDC 1S7XA 5C0DA 4H25A 4EOWL 1HYRC 4UIKL 3MA7B 4Y16C 4K3EH 4Z7WA 4NFBA 3AREA 4XCFL 1JTTA 4OLZL 3ZE0E 1NKOA 3GSUA 3SJVB 1K2DB 2R8SH 2OMBA 2E7MA 4P5KA 4I9WE 3QFJD 1XCQB 2DD8H 4N0FA 1B6UA 1MJ7L 2WK2A 5GZOC 4RZCA 3U1SL 2O5ZH 3QXDB 5F1NA 1J10A 4PUBH 5F1KC 2HVKA 3QUXD 4YAQA 1JGLH 2R4RL 3T3ME 5HYQA 3OPZH 5J06A 1GC1H 5IT2L 1S7TB 2P44B 1GYAA 5HHOA 5EUOF 5IF0B 1H3XA 4XAWH 1CE1L 4NQEA 3IXAA 3WFCH 2YZ1A 1CDIA 3SDAD 1FVEB 4HWEH 4PJIE 1UENA 4AEIH 2B1AL 3T2OA 4TPRL 1R5IA 1S9YB 4U6HB 4OJFH 3NOIA 5ADOH 2D3VA 5T3ZH 2DQHH 4L9LC 5BXFB 3CXHJ 2BFVL 5KSAD 3HI6L 4EI5A 4UT9L 5JXEC 1C5DB 2HFGL 1Z5LB 4RMRA 4XBGA 3BMWA 4XP5L 1RFDH 2VZ1A 4GSDH 1JWSB 3RVXD 1HHGA 1Q9LA 1R3KB 1FN4A 4XCYA 3FO1A 1CDHA 3HLAB 4YUEH 2OR9L 4PJCB 3PGCA 3TIDA 4G3YH 3H9HA 1A1NA 3O4LE 3C9NB 5DVKA 4QLRA 3BZ4B 3QG6B 12E8H 4G6JH 4OZHF 4JM4H 2VAAA 4U7MA 5EBMA 1OD9A 1IQDB 2XG5A 1Q94A 5FYJD 4V1DB 5CD5C 4MWFA 1TETL 2X4NB 3BGMB 2YK1L 3TEUA 1ED3B 1I1FB 4Y7MA 1CL7L 2AABL 1Z9SA 2NXZC 2G9HB 3SQOH 1NAKL 4NQTA 1T04B 2OSLA 3OZ9H 3QQNA 4YDLC 1S7QA 3TO4D 2B4CL 1UQSA 2Z35B 4PJHA 4NKMB 3W39A 4LDOB 1QYGL 1NCBH 3KXFA 3QQ3B 4F7TB 1KLGA 4U1JB 2N7AA 1UJTA 3FN0H 3TA3D 4XP4L 1NBZA 4LQFH 3BUYA 4A6YH 1NFDB 1S9KC 1P6FA 4GMTH 1EK3A 4U2YA 4KDTA 4LVOB 1HN1A 4XNZB 3D1MC 4KK9D 3OKKB 2DQUL 1A9EB 5LGKA 1JZ5A 3HC4H 3QUML 1IC5H 5JW3L 5J4MA 1IAMA 2HLAA 3D9AL 4HWZA 1M71A 3BRGC 3WFBL 3EO0A 4P2RE 3PABB 3PWNA 5HYJD 2YXFA 4WI9A 4PJAA 1QFHA 3HI5L 5A2JH 5IMOB 4DTGL 3MNZB 2W38A 1IGFL 1B0GB 1MEXL 3RIFF 5HVGB 5E8DH 5KS9A 1Q9OA 5EZLA 1X7QA 2Q8BL 4Z7UE 3VXRD 5H94A 3FB8B 1Q72H 4JFZH 1RU9H 2G5BB 1LE5B 2E3VA 3FFCD 4JFOA 1H3UA 1NFIA 5EWIH 3ZYOA 4JFHE 1RZKC 3I6KB 1S9WB 1SJHB 2E7BA 3TESA 2NX5A 3QDGB 5J3HD 3Q1SL 3RWCB 1UM6L 1UC6A 4OCYH 3HE6A 2JELL 3MZTA 3RWIB 1MNUH 4PY8J 4LSUL 5IMKA 4QTHB 5DK2A 3HZVA 1YEHL 1PLGH 5FO7B 3WLWC 2Q3AA 3WFHB 4YXLH 4M62L 1GGUA 1UB5A 4TUOB 3K81A 5ETUA 3MXWL 4HS3A 3OF6A 5ALCL 2PYFA 4JM2C 4A2MA 3RQ3A 4P2YA 2V7HA 4GG6A 3WNLA 3AAZB 3QDMD 2WWMC 2X40A 1TJIL 3S5LB 3L3IA 2NW3B 4KQ4H 2R0ZH 2NY4C 3THMH 4IRJA 1SMOA 2HRPL 3ARGA 3CVHB 4K7PX 3ARDC 4LKCA 2QADC 3QXTA 2ED9A 2EXWC 4KKBD 3MRCA 5KN5A 4JQVA 5DO2C 1FZJB 4IMLA 3T65A 2H6PB 1X5GA 5AAWA 3BHBB 3ARYA 2HH0L 3I3BA 3MV8A 3S36H 3GBNL 1OGTB 3VFMB 4U6XB 3VXOB 4MQSB 5IB3B 1UCBL 4KK8C 1JZ8A 4BSJA 3V6ZB 2Y07L 4DFHA 3TZVC 4F33B 4NQCD 1UB6A 3NN8B 1YNLL 1N7MH 2ICEB 2AJXL 3L3HB 3STBA 5IR1A 1CICB 5DJYA 2R1XB 3MR9B 2HVJB 4K7FA 4Z7WE 2IANB 4NWTH 1T1XB 2VWEE 3MRFA 2VZOA 2Z31D 4OF7A 3SKOA 4XXDA 3L3JA 3GM8A 1XF1A 1JBJA 4RFNB 3UBXA 4F15C 2K7PA 5ESQA 5IFAH 2FX8L 1C7SA 1I8LC 2DM4A 3REVA 4PJ9C 4GXUM 3TT3H 2DQGL 3V2AR 3CSYB 1RMFH 2DAVA 1X5LA 3TPUB 5A2IH 3HA0A 2WINB 1I9RL 2D4DA 5HHOE 3NIDF 3AM8C 4JG1H 1JV5B 1S7SA 4JREC 1H9VA 3EYOB 4HWBH 5FUOH 2VDKH 4G9FB 1DBML 1ADQL 3QWOA 4KV5F 1DL7L 1D5ZA 2HFEB 4CN1A 4TTDD 5CD3A 5SWQB 1PYWA 2XZQL 4Y16D 3DUSB 3ULVL 4JRWA 4UINH 3RHWK 3TV3L 1RQ5A 1CXFA 2DRUA 2H1PL 5GHWL 5DR5H 4QHLB 4O4YL 1MWAH 3Q2CA 4ZUTA 1NGZB 2ZSWB 4P57A 1RK1B 1D6EA 4HXBL 1GVIA 2Y7QA 2X4SA 1BP3B 2IQAA 5DD3H 3ULUH 2JCCA 5ITFA 3T4AA 4EN3C 4WGVB 4PG9A 4S1QH 1J0YA 2I27N 1DDHA 1K3IA 5I76A 2BK8A 2I60L 3OBAA 3L7FA 4GBXB 4NFDA 4D3CL 1FH5L 4QRPB 3RL1A 1ACYL 3DUUB 1S7UA 4PJHE 1YQVL 3SDDB 4ODWA 4ZUSB 2VDML 3KXFE 3BESR 5GGQH 3VFWA 4NQDA 5F3BB 4F58H 3QDHA 5JXED 4ODXB 3VMNA 4UNTA 4K7PH 4Y1AA 1P9MA 2UWEA 2BNQB 2Z0BA 4PJBF 1NAML 4RISH 5I19L 2RBLA 4M7JH 1FYTB 3HMWL 4Z5RB 3RGVC 2HAZA 2ITCA 2DQJL 3MV7A 3W5MA 2C7UA 4JZNA 1TTUA 5FXCH 2FECL 2GJ6B 5DJ6B 1GGBL 3WNNA 3QEQD 4PTTA 1F6AB 2VISB 3TBYB 5CD5D 4NJ9L 2W92A 4F37F 4X6EA 4X7SL 4DZBB 3BKJL 2BJML 1HH9A 2MWCA 1E4WL 2VH5L 2JJUA 1R3LB 3MLSL 2MQ0A 3HC0A 4PJ5E 1XCTA 5DEGB 4E41B 2QSCL 1J8HD 5FHBH 5HHVL 1JGEA 5ISZD 5CP3H 1SY6H 4X7DC 3K8LA 3L3KA 5EC2B 4XP5H 3MJ8A 4JDTH 3V52H 2NX5E 2I9TA 4TVPD 1UACH 1MCPH 5HYIA 3E2HB 3OV6A 2GK0B 3EYUH 1YUHB 4Z7VF 2BX5A 3ECBB 1RJLA 2VDPH 5E9DA 1K85A 1QBLL 1ORSA 2XTJC 4U7KA 4UQ2B 2AJUL 4JO2L 4M7KH 4N9GA 3QCUH 1WK0A 2E7CA 5EU7E 3WIIH 4X5WB 4YZFE 5DUBA 5HDOA 1OAQH 1CFQB 5J56B 4PGEA 1AGFB 4M1GL 2E8YA 4UV7H 4XZUA 3DX6A 3KDMB 3IDJA 4GG6E 3KYOA 4P46B 3OKMB 4MA7H 5AZEL 4QXGH 4V2BA 2W91A 1VACA 1TPXC 1F3DJ 3QHFH 1WZ1H 2PXYA 3V0VB 2DYPB 3KLDA 3B9KC 1VGKA 2GUOA 5IVXF 2VSCA 5INDA 1L9NA 1AGEA 4PB9H 4LVHC 5CMAB 3BRFA 5I73B 4ZOCA 3NIFE 2WBWB 1MH5B 1P53A 1YEKL 4FXKA 2VR4A 4IJ3B 5F7DB 1G7LB 4C58B 4J3SA 3E3QE 3UBXG 4MNGA 1KELL 1AJ7L 3C6SA 5EU6E 3CFJA 1Q9KB 3WLWD 3IKKA 3MRDB 1N0LA 4TVSa 4AG4L 4QRUB 4Z0XB 3VWJC 5K9QG 4HKXB 1CDGA 1IKFL 1FNEA 1D5MB 1ZVHA 4JM2D 1KIPB 5C08D 2XKNA 2ESVB 5JQ6L 2FSEA 4I18B 4LHUD 2Y23A 4CU8A 4MJ5B 2WWMD 3PL6A 3MNVB 2HT4C 1X3DA 4ZO9A 2FGZA 3N85H 4U6YA 4BZ2L 1VADB 4LLMA 5E56A 2NY4D 3I50L 1LO2H 4K8RL 2VLLA 4K7PY 3ARDD 2AJYL 2EXWD 1K5NB 5TH2A 1JYXA 4RBPK 1QBMH 4NCC1 5DO2D 4OD2A 1RUML 2P8MB 4L8CA 1RVFH 3BFOA 4ZPVB 4A6YB 1GPOH 3EO9L 3T3PE 5GGVL 5I16A 3LV3A 2OL3H 2P5EA 4NKDB 5FB8A 4KK8D 5C0EA 3GKZA 1MFBL 3J8F7 5T1DL 5CHNA 2IPUG 2QQKL 3MCKA 3V4VL 3AXLB 5F1IB 1MELA 1QO3A 2E6PA 3ZYJA 5I66B 3EFFA 3C5ZB 3U9UA 2V2TB 3CMOH 2HTLC 1TZGL 4BFBD 1JPTH 3IF1A 4LEXL 3MRNA 3QNZB 3ZYZA 5IBUG 3SDXF 2VLRB 4I0PC 4M7LT 3KS0H 4UDTA 3H9SA 1KF9B 5DJDB 3EGSA 4ONHB 1Y6MR 2ZCHH 1Q1JH 4XXCA 4PJ9D 3SKJL 3IAPA 4R7NB 1MHCB 2B4CC 2A9MH 3BT2L 1W2KT 3QG7L 3EDJA 2CIKA 4P3DB 3CU7A 3IDMA 5GRXG 4HJGB 1PEWA 5TE7L 3QPXH 2NZ9C 4JFDD 5J7CC 4BSWB 3MOQA 3GHEH 5GS2D 2X70A 3H42H 5D8JH 1L7IH 4QRQB 1G7IA 1T83A 1MRDL 3UTZA 3BH9A 2J6EA 2C3HA 4XPHH 3WCYA 3MMEA 3D3VE 5GRUL 3C5JA 4GW1A 3ZDXF 2CDEA 2R0WH 1BOYA 1HHJA 2IAMB 1BM3H 3H3PH 3O6FB 1YYLL 2BNRB 1TJHL 3P4MA 3GDBA 2OM5A 4Y1AE 5CJ8A 2UWEE 1M1SA 3TWCH 5C0GA 1JZ4A 5KANI 5E8PA 4CVXA 4TNWK 4PJ7F 4XNMA 1DN2A 5EOCH 1FV1A 3IXTA 3K80A 1JVKA 3G6JF 5FGCB 4M61A 4N5ED 4OLVL 2J5LB 5D7IF 1I9IL 3IFNH 2ZOKB 1H8NA 3GSXA 1FJ1A 1I1CA 3FOLB 3FB5A 1JPFB 4E5XB 2AK1L 2AAVA 5F7MC 3I85A 4LASL 4RX4A 2WLYA 4Q7DA 1O7VA 4PP1C 1AGDB 1QHPA 4NRYB 3RWDA 1W72A 4X7TA 5E1HB 3NZHL 3BPOC 4PRAB 1E4XL 2KQMA 5TF0A 1RUPL 3OAYK 4NZUL 4Y4FB 4NZRL 1UZ6E 5F7LB 5L2KB 5IM7A 4ZTOL 5MENB 5IWLA 3GMQB 1FRGH 1JNHA 4Y4KA 3MLWL 5T1KB 4WI3A 3PP4H 3RGVD 4MAYC 4NO2A 3PWVB 3OGOE 4LAQH 3EYSL 4ELMB 2BSTA 4O5LH 2HTKC 2M8XA 1UVQA 2C9AA 3QUZC 4XC1H 4UNUA 3DSNA 1UT9A 4S1RH 1FO0H 4RSVA 4HFWA 1MF2L 1S3KL 4O2CA 3DURA 5FGBC 4JHAL 2FBJL 4OUUB 4BUGA 1T0PB 4QRTB 3U79A 3TVMA 1V7NH 5CIPA 5ENWA 3MRRA 1A7NH 4HH8A 4PTUB 2DM7A 2NW2B 2FH8A 2YWZA 1W8OA 4LF3B 5E7BA 4RGNB 3HS0A 1XF3B 2PW2A 1R3HB 2FX9L 3MLZL 2VE6A 3QXAA 4L8SB 2YN5A 3RTQC 3QHZL 3U46B 2EYTB 1T5WB 4XVJL 1MWAB 1HCFX 2XTJD 1LP9F 2EC8A 4MNGE 1FDLL 5DJCA 2AJSL 2DMCA 1HSBB 2ICWI 1DQDL 1JHTA 4FQJL 2V9RA 1MCKA 3G9VA 3QFDB 1JN6A 1T66C 3DGGB 1U8HA 3I3EA 3TN0A 3HNTH 1LGVA 5GSRA 4NPYB 1F58L 4LSRL 1JMXA 4IOIB 1UG9A 4HC1A 3UTQB 2PCPA 5E2JA 4JO4H 3MLUL 3PG2A 3IKCB 1Q9WA 4L4VD 3B9KD 5CLWA 4NWUL 2YSSA 1E6OH 2ZKHL 1IEAA 1D7FA 5EO0B 2I25N 2A1WH 5E2VH 1FIGL 4KKNA 4ZAKB 2ADGA 3MLYL 2O5XH 5TE6H 4XNXL 1FLRH 1KPUB 4ZODA 1A7QH 1WBYA 4IDJL 2P5EE 4LCWA 1S8DA 3KPMB 4PJXB 4GW4B 4XCCL 1PFCA 3W0WA 2Z91B 3VWJD 2FEEI 2JLLA 2Y72A 3K4DA 5DMKA 3FB7A 3TPKA 1KJMA 5BS0B 5B39B 2R0LH 4NOBA 2D7PA 3SKNA 2BZDA 3QI9C 1VCAA 2AXGA 4KZEL 1WT5C 3F5WB 4G6FD 4C4KT 4QOKD 1RK0A 1TMCB 3BIKB 5ID0B 1NCCH 3UJIH 4MHHI 1WWWX 3U7AA 4HBCH 1C5BL 5D96C 3RWEB 4DOHE 3F7VB 3RA7H 3IU3B 5IB5A 4YXKL 2OTWB 1IGCL 5HHMB 4M93B 2HKFH 5J1AA 3LKQA 5LG1A 3LY6A 4PG2C 4MDJB 3WV0A 4J8RA 5C07B 2NY5L 1KEMH 3O4LD 4U1HB 3O2DH 2A74B 4MXVF 3V4UL 5GS0C 4OZHB 5E2TH 3QEHA 3PP3K 3I3DA 3HNVL 1T7WA 4RGMB 1UM4L 3TNMB 5DVNA 4ETYA 3HFML 1D9KB 1IGIH 1I85C 2HTLD 2X89A 4JVUA 3GI8L 1PY4A 1OAZH 1G7QA 5C09B 1QA9A 1JZ7A 1N64L 4I0PD 2M1KA 2UZIH 3O0RL 4APQC 3LIZH 1S9YA 4U6HA 5E6IB 5E4IA 1X5KA 3BXNB 4P5TA 1G0YR 3SOBH 4RA3A 3CFBA 2I24N 3R06B 5DGQA 1INQB 2JE8A 1DBJH 1NGPH 1Z5LA 1D5IL 1WIPA 3FFDA 1KB5H 1JWSA 2EE3A 2ZCLH 1R3KA 2UUDK 2QQNH 3IDNA 4JM2F 5GJTH 2YPVH 5D6CA 5T1DH 3NTCH 4PJCA 4AENA 3QUMB 2NZ9D 3C9NA 4OKVB 1RZFL 2F5BH 4ONGH 1QLRB 2X4PB 4P2RD 1Q0XL 5A1AA 4V1DA 4WI2A 2EE6A 1FFQA 3BGMA 5FYLL 4D0BB 1MCRA 4F7PB 2XZAL 1K6QH 3A6CL 1NGQL 5ADPH 1U2HA 2A6KA 4DN3H 1CLZL 2ZCKH 5EZOH 4ZDHB 1T2JA 2YPLB 4JFQB 1EAPB 2FO4B 1YEEH 4U1GB 1QBBA 5EO1B 4BQBA 4HLJA 4BSVB 2WUBH 2BC4B 2VITA 2PO6A 5D1ZB 5CBEA 4FFYL 4EXKA 4OGAC 4POUB 3WE6B 5FK9A 4ZSOA 3L5HA 2CXGA 5HYSA 3QNXA 3RU8H 3OKKA 1IFHH 2A6DB 4NNPL 1K9TA 3D85A 4MCYB 4L5FH 1XT5A 4WEMB 3VXTA 1L6XA 3IDIB 4RFOH 3VG9C 2CK0H 5D72H 3I02B 4LLVB 4NRZB 3MNZA 5D6DC 5J13B 4PRHD 3DX9B 2Y06H 1GL4B 2DQDH 3C2AL 4JRYB 5FCUL 5MEOB 1ZLVK 4GKZB 5BV7H 4HJ0C 1G9NL 5ANMB 2QHRL 1WV7T 4XHJC 3CCHB 3SDCA 3NA9L 1PVHA 2ZSVA 2IADB 2XTLA 4E0RB 5D1XB 1ZXQA 1MUJA 2F54E 2DWDB 3ET9F 3VH8B 2OK0H 3QUKB 1AO7E 5AYQA 3RWIA 1WSST 5B8CB 5FUZH 2BDNH 4MAYD 3L3GB 4K8RC 4QTHA 4W4NA 3U30B 5DJ8A 4IRSC 3MODL 3VA6A 3MREB 3T0EE 2HTKD 5MI0C 1FGVL 1EIBA 2VLJB 3O11B 3RL2A 3QUZD 1I1AC 2XXMB 5C6TH 1U8PB 1MFEL 3FQTA 4JFFA 4U4BA 1MCSA 5TDNB 4GO6B 3DSFH 2R56H 1IC7H 3TFKC 4DN4H 5ITBH 1NFKA 5E6YA 4AM0B 3IJHA 5JUEH 2CLRB 4LSTH 3CH1B 5HPMB 3P77B 3RAJH 1JHKL 3U0WH 3ARED 3QJHB 1U8KB 1OCWL 4YWGL 3VD9A 3VD4A 1AP2A 1EBAA 4WTZA 2X7LB 3RTQD 5C9JB 4KAQL 1U95B 4RRPG 1IC4L 2OI9C 3N1QC 4J6RH 2A6IA 3DV6A 4YDJA 2Q6WB 3B9DA 3DI2B 1F8TL 8FABB 4X6CE 3NCFB 3MJ7B 1T66D 4J7RA 1DP0A 3QQ4A 4EUPH 3MA9H 5AUMB 5HHOD 1Y0LA 2J12B 3HMXH 4YXHL 1J0IA 3ARFA 1TXKA 2Y5TA 1SVCP 2MCPH 3PF2A 3MLRH 4HJJL 5BOZG 3QCTH 2B39A 3KR3L 3VFOA 3WFZA 2QLVB 3GHBH 1CD1A 1GGCH 1U8IA 3MR9A 3DRTB 3VGAB 3ZE1E 4FQQB 5KG9B 3KPNB 1WC7B 3ARBB 4QT5A 4WFGE 3RY5A 5C8JA 2OJZH 4KFZC 4NKOB 2WWKO 2V6HA 1KCVL 3WNKA 2B1HL 2UVFA 4ZD3L 4AK1A 3HN3A 3VG0L 4NN5C 2WW8A 1YEJL 1EFXB 1BFTA 4LVNB 3OR6B 5TF1H 1PSKL 5I74B 4JKWA 5D5MB 3CSYA 2RR3A 5F7FA 3EDFA 5IEKB 3OJDA 2XWJB 3K74B 4OLYH 3ZSTA 3ARQA 4G8FA 1JV5A 3QI9D 5DZNA 1FO0B 1FAIH 3EYOA 1S5IH 2AEQL 3PJSB 4OCXH 4QY8B 1U42A 3MRIA 4G9FA 5BW7A 1U93B 2V5RA 3EOTL 1YNTA 4PJ8B 2CDFA 1UM5H 4U31A 1MLBB 5J8OA 1KENH 5SWQA 5AEAA 3DUSA 1WFUA 2AK4D 1PEZA 1MCFA 3I6GA 5C0IA 4U1SA 4LP4A 4OZ4B 4TRPL 1NAMB 1FNGA 3KJ6L 4XCCH 3P30L 4M1DH 1PKQB 1RK1A 2DTSA 4YDIL 2Z8VC 1TCRB 4OV5B 3QXWA 1JNNL 3UYOD 2NMSA 1U3HB 1DBAL 3V6FB 5GS0D 4YHOH 4P48A 3VRLF 3R0NA 1CYGA 4HMEA 1J05A 3BE1L 3MXVL 4GG8B 4XNUH 4OQTA 2BXZA 4NYLA 3FQNB 4GBXA 4TVPH 4U1LA 1RIUL 5DJ0A 1BEYH 4QRPA 4PJ5D 2QBWA 4MZ2A 3C6LB 4APQD 3QUYC 5AD0A 2GFBA 2V5YA 3HUJB 4ZUSA 5LQBL 5F3HB 4WFFE 3EDEA 3MFFA 4O58H 4X80H 3RDTA 5BMFL 4H8WH 1VFBB 3MO1A 1DN0B 5DHVA 3RWHA 4PRIB 2ARJQ 2C5DC 4U3HA 1XGUA 1YEIL 3GFUA 4P4KC 4I3SL 1WWCA 4ZSOE 3W2DL 7FABH 1WICA 1I1YB 5F9DC 1BF8A 4O02L 2FIKA 2R2BB 4UI2A 1S7VA 2I07A 3SE8H 1NSNH 3EOAB 3IB4A 3QYCA 3U83A 3UTTB 3JV4A 4ZOEA 3QO0B 3V5DA 4KKAC 3ARTA 4XTRC 4TULH 2P24A 3S37X 1KCUL 5I1EH 1U3JA 4KH2A 4XCNA 1IGMH 4HUUA 3VFUB 3AS0A 1R3LA 5LCVH 1MI5A 1CE6B 3VXME 3UYRH 5LXGL 3VFPB 3L5XH 1WIOA 2XA8L 4Y19D 4JKLA 4MA3B 5J89A 2ICWA 5I1CL 3TLRA 1B2WL 4OGAD 3OAZH 3RJDA 1LEIA 2ADIA 4KKLD 1FL6A 2DB8A 2Q76B 3G6DH 3F7RA 3P4NB 4Y5VA 1NC4D 5EU6D 3RJQB 4QKXB 1L4IA 4GMSL 1F3DH 3WYRA 4YHNA 1T0MB 4JFFE 4MNHB 3TCLB 1UXSA 4GRLA 4ZUVB 3A6CH 2E9WA 2X5PA 5ICXA 3F12B 4KMLB 1CFVL 3TA3B 3U9PL 1ZGLB 5HI5D 2DYPA 1DSFL 4HJ0D 5FDWA 1WFNA 1W0WB 2IGFL 4XHJD 3MGAA 4YHLH 5IG7A 4YNYB 2EDDA 4PGBB 1DUZA 4YGVA 1M05B 5KSVA 3ZHLA 3ZO0A 1OF2A 3MJ6A 4ONFH 1MH5A 5F7DA 3HI1B 3WSQH 1G7LA 4AIZB 1KB5B 3QH3B 3C8KA 4IRSD 3ZTNH 2D7OA 2EKJA 3VWKA 4OFPA 5HYJB 1Q9KA 1I1AD 3QJFB 1P7QD 1BMGA 1MIEL 3U82B 3MRJA 4PD4K 2E7HA 1JGDB 4RWYH 4CRPA 4K3JL 5DC0A 3TFKD 4DQOL 2VTFA 3QPQC 1WTLA 3N50A 4WHYH 4Z7UF 4MQTB 1ZEAH 3BMVA 4ODTL 2C3GA 1EO5A 1MHPH 3CLFL 1F4HA 5DRWB 1T0NB 3WNPA 1BJ8A 1A21A 4M7LL 2VUOA 4WVRA 3BX7C 1F4YH 2DQTH 4PJFB 2HJLA 5KANG 1NBVL 5INCB 1ZLSL 2P8MA 2WBJA 4QHMB 4PLOB 2A83B 1FAKT 1TDQA 3O6LL 4JKKA 5H37G 4A6YA 4XNYL 4C59B 3KLHC 3OG6B 1U58A 1BZ7A 5T1MB 1TZHA 4RDQG 4ZMAT 4DJMA 4Z8FH 5MEPB 3M17B 5EC1B 4JR9L 5HVHB 1EV2E 1DFBH 1G9EA 4FXGA 1NL0H 4IOFD 4DEPB 5I66A 3VFNB 4O2FB 3C5ZA 3RUGB 3S37H 1BQLL 2V2TA 4QXTA 1KN2L 1ZAGA 4P2QE 1N8ZB 4KJYB 4GJTB 4WFHE 1OCWH 2VLKD 3D3VD 2NY0B 5HGBB 1BX2A 4RAVB 2VLRA 5C2BH 5GGTL 5BV7B 5ID1A 4WW2B 4BKLA 4Y1AD 1KLUA 5E08H 1DVFA 3R1GH 1KJ2A 1RZJL 5ILTH 2AVGA 2JJTC 2Y36L 1XGRB 1VKXB 3B3IB 3IVKB 4HLZG 3P2TA 3HG1B 1NMCB 3G6JB 2GI7A 4NQCB 5D7IB 4P3DA 3CFDB 5D7JA 1I8IA 1KTLA 4MJIA 2AV7B 5D2NB 4NHUB 1ZWIA 4FRWA 5D9SB 3ROLA 2LTQC 1R5WB 1NJ9A 4CJ1A 1YEGL 4DGVL 5IFJB 4K3DL 1QRKA 2VDNL 1FFNA 3NCCB 4Z78A 4ODVH 3WXVH 4KMTH 2IAMA 4Y4HC 4B7IA 3BQUA 2BNRA 3LQAC 1XFPA 5DUML 1QLFA 3DVNA 1WFOA 2M26A 3D48R 4OF8A 3T8XA 2XG4A 1YEJH 1OAUL 5IQ9B 3FJTA 2C3VB 3MGTA 5CJ5A 1RJZB 5I1JH 2CMRL 4OAWA 4YHML 3CMGA 4GQ9H 4FFZL 1G9NC 1XF5B 2ZUQC 3FCTB 5JOPD 4OI7A 3V5KA 3T0EC 5A2LH 1N4XL 1FFRA 3FOLA 3KYKH 5FECB 2P43B 2AI0H 1T80A 4JFEA 2FHBA 3UAJC 5F44A 4BZ1L 1DBKH 1Y6KR 1RV6X 3LH2L 4JRXB 1CGSH 3L3OB 1MI5E 1GAFL 3QIUB 3UJJH 4PRAA 2NY2B 2CKNA 2XQBL 1HE7A 2ZUVA 3GBMH 4H20H 4P2OC 3EW3B 4PJGA 1CS6A 4FTVB 1RUQL 4PRNB 3QNYA 3GMQA 3S35X 1G7HA 4KY1H 1CZ8L 1DLFL 4F57H 1BFVH 5EIQA 1A7PL 5FHAL 4ZPTA 2BCKA 4KKAD 4XTRD 1A14L 3BE1H 1MFNA 2YHGA 4AIOA 1NLBL 3G5XA 3BH8B 4YK4C 4QF1A 4HIHA 4HWBA 1FZMA 2NZIA 1KEGH 4C83A 4PR5A 4OUUA 1LHZA 3OHXB 3RBGA 3TBWB 4PBVC 3VXSB 2NQCA 4K23H 1N2RB 4ODSH 4N1CA 4OKDA 3MNWB 3CK0H 3JBG7 3A67L 4OZFA 4H26B 15C8H 5CEXB 4KJWC 3O9WD 3QQ9C 4L29A 4NZDA 1A3LH 2VC2H 4L8SA 4UILH 3GGWA 2I9LA 4Y2DA 3OKOA 2FHCA 3LCYA 2QR0A 1HSBA 4LSQH 5JOEA 1WZKA 3BD3A 1E27A 1S9XB 3UPRB 3BD5A 2BVTA 3BEVB 3LN4A 3TBVB 1RSFA 3GNML 5HDQL 3QFDA 1TNNA 3F58L 1ZHNB 4D9RE 1NMBH 2XZZA 3IS0X 4NPYA 1NDMB 1NCAH 4PGDB 4OLUL 3UTQA 2E27H 4GT7A 2DQFA 4OD3H 2W9EL 2VUYA 3C5SA 5HYEA 1JYVA 3S6CA 3LB6C 3VD7A 3BWUC 4XP9L 2BVOB 4KXZH 1G0XA 3KPOA 5JR1L 4ONOA 4NGHL 4WW1A 2DKSA 4LARH 4NDMB 4JDVB 5DTFA 5GIRA 5IHZB 5IW6A 4DUWA 4TQEH 5BVJA 5CCKL 1RAMA 4R3SA 2EYSA 3GB7A 3AMLA 2VDLH 4IIQB 2Z91A 1BBJA 3MRQA 1YZZA 1MY5A 4ZOBA 1QKZH 2XRAH 3QPQD 3ZTJG 1WGOA 1R3JA 3MV9A 4X7CC 1XR9B 4M48H 3AUVA 3T1FB 4FS0A 5EUOA 4WIQA 4LOUC 4R6UA 1GIGL 2YC1A 3JVGA 3X3FH 1J9CT 5MP6L 2IGFH 1WWBX 3LRHA 4P5MB 1QSEE 2J2ZA 3BP5B 5F9WC 1HOCB 4LLQA 1XZ0B 3DXAA 1MHHA 5K59E 2VXUH 1FCCA 5CP3A 1SY6A 2V9QA 5I8OL 2CQVA 5DRXB 1AY1L 4OCSH 1V3LA 4P9HL 5DWUH 4E9LA 3KLHD 2OTWA 5I1KL 5FV2A 5EZJB 3S35H 5DSCA 1HQRB 4LHUB 5FKAA 5CKGA 1AKJB 3VW3L 4ZXBC 4LCCA 2KZ1B 4MJIE 3DPBA 3OKEB 3WHXB 3VD3A 4OZHA 5I1IH 43C9B 1CU4L 3GMPB 5DJAA 1JGUL 4LSVL 4JPWH 1YEFL 2NY4B 3HZMB 1BVLB 3TNMA 4M4PA 4ALAH 4CDGC 1F6LL 4HIXL 2VERN 1D9KA 3L7EA 5KZCD 3WKML 4PD4J 5E6ZA 2ARJB 4GUPB 2FBOJ 5DA4A 3BN9C 4XPAL 1D5BB 4WO4C 4OFYD 2IPKB 2Z92A 1WCQA 3ARWA 1WCBA 1KC5L 1F90L 4RBPH 3K4AA 1OTUC 4ZFOB 3QDJE 4LMQE 3Q5YA 1NANH 4L3EE 1U0QA 4FNLL 1A6VH 3OR7B 1M7DB 2IPTL 4S1DC 2JIXA 1A9BA 3O8XB 1VFMA 2DOCA 5DS8B 1DLHB 1IT9L 1A6WL 1FSKB 5HGAB 4M43L 5DHYA 4EDWL 4OKVA 1AHWC 1MFDH 1A8JH 4XBEH 5JXAL 2GITB 2APFA 3UPAA 5I71B 2Q20A 4LLDA 5ALBL 3W9EA 3WXWH 3VFSB 2X4PA 4YHPA 5HHQB 4JZOB 1EJOH 4F7PA 2CUMA 1SJEB 4M02A 5H2BA 4OGYL 4ZYKB 3ABZA 3MOAL 2RB8A 1T1WA 5K9KB 3EZJB 1KPRB 4Y4HD 3BDYH 3IJSB 3H3BC 4JFQA 1GOHA 2FO4A 4PJGE 1KFAL 2OYPA 3BKCL 3SO5A 3ARPA 5IK3A 4KUZL 2DDQL 4JHWH 5SWSE 5ESAB 3FQRA 4BSVA 2R2HB 3SKUD 4YHYC 2BC4A 4M5ZH 2F54D 2GTZB 1WZMA 1QSFA 4MD4A 4U6VL 1CDCA 1AO7D 5EOQL 1V7MH 5I30L 2OL3A 1IBGL 3T0ED 2A6DA 1JFQL 3V7AE 4TTGA 1KCSL 2YPKA 4OZIB 4MCYA 3UTSA 2HG5A 1MJUH 4Z7QE 4NOFA 4MNQB 3UAJD 7CGTA 2X4TB 3CD4A 2J8UB 2EDTA 5EUKB 3V79C 1LDPH 1NQBA 4LLVA 4NRZA 1E4KA 2GSIB 5DK3A 4QNPE 2ORBH 4YLQT 2Y9RT 1WWAX 4PIRF 5MEOA 2D0FA 4JQIL 4LFHD 2YOCA 3FONB 3GIZH 5ANMA 5IBLC 4AY0A 4P2OD 1SEQH 1GHFH 3CCHA 3U36A 2MNUA 2IADA 4E0RA 4TN9A 1F11B 1HIMH 2FR4A 1DQJA 2EDYA 2D7QA 3VH8A 4RFEB 2G60L 3QAZB 1I8MB 2GW5A 4HMDA 2WV3A 5D70H 5SV3A 1QTYT 5IJKC 3CUPA 3O3DA 1GGIH 3KLSA 3MREA 3CZFA 2ZPKL 2LVCA 1F2QA 4YX2L 3UXFA 3LKPB 1FVCB 9CGTA 4L4TB 4TUJB 3S4SA 2IG2L 5FYKU 5TDNA 4Q9QL 1XAUA 2FDBP 3IGAA 4AMKL 2XN9A 3B6SB 1BWMA 4AM0A 5IROA 2E6QA 3IDXH 4PV9B 5HPMA 2ATPB 1OAYH 2VQ1B 1JPGA 2EZ0C 2AERT 3BPLB 3OAYH 1EGJL 2NXYD 3BSZL 2XXCB 4PJEB 1HXMB 4BK5A 4KJWD 3QQ9D 4G7VL 4AH2A 5HGHB 2XIDA 4UU9B 1MCOL 2X7LA 3SBWA 1KTKE 1MCDA 1A6UH 4R4NC 4Q6IA 1U95A 2X9XA 4YDKL 4R0LC 2F5AL 4HT1L 4N0UB 2X1OA 4QHUB 5IFHH 2BNUB 4YQXL 4MA8H 1XIWA 1EUUA 4MVBC 1AIFB 2GT9A 1GZPA 5AZ2H 5JNYB 1HKLH 4J1UB 2Q6WA 3MUJA 1IAKA 3MGOA 3SY0B 1JNJA 5JLZB 8FABA 3MV9E 4FN0A 5LBSH 5EUOE 4JY5H 3NACH 5I2IB 1P4LA 2UYLA 4HX1B 4OM1H 1F13A 2W0PA 4F7MB 2ENSA 2X89D 4QRRD 2DIBA 2YBRB 1AI1H 5GISL 4F9PA 3VRIB 3DXAE 2AQ2A 4UDUA 3BWAA 5K9JH 4QTIL 4JO1H 2HRLA 4LEOB 4X4XB 4NKOA 2ADFL 5GS0H 1LK2B 4UOW0 1PQZB 2EDHA 3WD5H 3E0GA 4XI5C 3CDGA 4F7EA 4XVTL 1OWWA 3SKMA 2JF1A 4P3WA 1RIHH 4FQLH 4NQVA 4KHXL 3JUZA 5TQ2L 3S3PA 1A4KA 5IEKA 3O45B 4OLWH 1XGPA 4WU5B 4LOUD 1U36A 3INUL 4N0YH 3MRHB 2B5IC 1U93A 3UO1L 2ATKA 3N9GL 1U8JA 3QHTC 3VFGH 3VE0A 2VNCA 2VZVA 5IBTH 1YPZB 2VXSH 1W0YT 1G9ML 4WFFD 1H15A 2A77H 3GRWH 3VWJB 5JIKA 1QQDB 2N56A 2V2WA 4WUUE 2X10A 4PJBA 4CL7A 3SEPA 4KVNL 4BYHA 1M7XA 3K2UL 4ZXBD 2O61B 3JSSA 3MLXH 1U3HA 2F53B 5F7NC 1EDQA 4KQ3L 4Z7OF 1MCWM 2FH6A 4WV1A 3TM6A 3GSRB 4F9LA 2ZZUT 4PJIB 3QWQB 1LMKA 4LBEB 2VXVH 2J88L 2CK2A 5L0QC 4WO4D 2V17L 4PP2B 4MMZC 1EMTH 5A16B 4R90L 3T4YB 3VXMD 3RZCC 1OTUD 3HR5A 3HUJA 3QFJA 5F3HA 3WIFA 4A2LA 3FO9B 1P84K 2EH7L 1VFBA 1DN0A 1QUNA 4S1DD 5DUPL 5ESVB 3O4LB 4O2EB 2ZG3A 3OJMB 1QSFE 3QUXA 3NPSC 4UTAH 3F6IA 25C8L 2K7QA 3D39B 4YDVA 1RURL 2HKHH 4PRPD 1AXSB 1OP3K 2R2BA 1I9JH 1T3FA 4KDTC 3I2CH 3ZDZF 3VH8G 5EG6C 1HINL 5DQDH 3PP3H 5C0AE 4JFFD 3UTSE 3MBEC 3SDAA 3U0TA 4WFEE 1ZHBB 5IB2A 2VL5A 5I8EA 1CFNA 2MHAB 4LCIL 3L5IA 1YMME 3L3DB 2CGRL 1XGQB 1JRHH 1UXWA 3VFUA 5KSAA 1L0YA 5BJTB 4X98A 3FQXB 4OLXL 3HCVB 4TSCL 5IVXA 1TTFA 3M07A 5L6YL 1JUFA 2RCSL 2BMKA 4U1NB 1IAIL 2HJFB 5B4MC 4MJ6B 2UUDH 5D71H 4HUKB 5TFSL 4FA8A 5KSBE 1TZIB 1KXQE 3IETB 4HIIB 5ACZA 4LVEA 5ACMA 1IAIM 4K94H 2DJUA 1UWEH 4G5ZH 4P2RB 5DRZB 4M6OH 1FNSL 3V8CA 4QWWC 4JAMB 3I75A 3R0MA 4OFIA 2VDOL 4N0RA 4HKZB 1ZTXL 1J7VR 4NNXA 4YE4L 3GSQA 5A40E 3P4OB 1W72L 1FE8H 2P48B 2XN9E 3C60C 3PDGA 3GMMB 3HE7B 3FTGA 3ILPB 3PHOA 3QRGH 3TO4A 4XRCB 4BUHA 4WNQA 3BP4A 4Z95H 3DMMB 2VJXA 1Q0YH 3TA3A 1ZGLA 4H0GA 5IESH 3VI3F 5IBLD 1UA6H 4Y5XB 1T22B 1ITBB 1HHIA 2G2RB 3P11H 1NC2D 1PKOA 4JY4B 4LAJH 4PFEA 2YUVA 1TQBB 1BGXH 4H88L 3ZSSA 1U8LB 2X4RA 5LGHL 1KT2B 3KLAA 3FB6B 4LLUB 1LEKB 3HI1A 2BSRB 4JQVC 4OD1L 4XMLH 3QCVH 4AIZA 2XPGB 2JJSA 5DD6A 1A6TA 3DX7A 2EIEA 5HYJA 3VXQB 1C1EL 1FNFA 3EHBC 1A6AB 4OGXH 5KJRL 2GTWA 5T3XE 4P9MH 1CXIA 3O6KH 3Q3GA 1XF2B 1OSPL 4ZFFB 3CLEL 5CUSL 3VXRA 3CDYA 4KV5E 5I1LA 1U92B 5A3ID 2YXMA 1V05A 3FFCA 5HHNB 4GAFB 4P2QD 2VDQH 1ZLVH 3BPNB 4D0CB 4WFHD 2DQCL 3SDXA 1DANT 2EZ0D 4PV8B 3DYMA 4P23C 1ZVSB 1T0NA 3H0TB 5FA4B 2J1KA 1QFPA 2H2SC 3MROA 4LPVA 4R4ND 3TT1L 3EDDA 3BEWA 1OP9A 3QA3B 3ZT6A 2AP2A 3QEUA 3WNMA 1SBSH 2IH3B 4HKJA 3OXSB 4QXUH 1OW0C 3IRZA 1KJVB 4HC1L 1FZOA 5H35B 2AXFB 3QDMA 4HG4K 1ZA3B 2O5YH 1MOEA 3CC5A 3EFDL 3M17A 1FL3B 5C0DB 3M1BA 1CXHA 4Z7WB 2Q86A 3AREB 1N5YL 3KJ4B 2QV2A 5IHUL 1CBVH 1GZQA 2YKLH 4R2GB 5DZOA 4XVSH 4NUGH 4O2FA 3AC0A 4NN7C 4HZLA 4F3FA 3GSUB 1T1ZA 4KJYA 3P9LA 3MJ9L 5HGBA 4X9IA 3PWUA 4N0FB 1BJ1J 2F19L 3MOBL 1H5BC 5F1NB 5GS1A 1K4CA 2ICWJ 5GPRA 4PJBE 2FX7L 1WFTA 4YAQB 4XI5D 1BAFH 5HYQB 1XGRA 2V5TA 4X6CF 4PJ7A 1YNKH 4P3CH 2R29H 5HHOB 4LQ1A 4LSPH 4OIIL 5SWZE 5JIPA 4CUCA 1BVKB 3KHQA 3G6JA 3T77A 4NQEB 5D7IA 2D7TL 3DNKA 4UNVA 3MRMA 1EHLL 1C12A 4CVZA 5EBLA 1BBDL 5T5FH 5JDSA 5D2NA 3MCG1 4NHUA 3LKSA 4YBLB 1R5IB 3ZE1F 5FO9B 2Z31A 4PS4H 3SO3C 3WS6C 1DQMH 5KSUA 1JGVH 1HSAA 4G6ML 4FP8H 3LS4L 3SPVB 2GY7B 1Q9LB 3AB0C 3B2VH 3QFJE 1FN4B 1A7OH 4XCYB 1LO0L 3FO1B 4N8CH 4WGWB 3PGCB 3TIDB 3H9HB 1A1NB 4PY7A 3LS5L 4Z7VE 5DD1L 2CD0A 3LMJL 4DKFL 2VAAB 1MHEA 1P9MC 2F58H 2J8HA 5GSVA 2QSTA 4M9PA 2P8PA 3FCTA 5J11B 3BKYH 4ERSL 3QEGL 1NEZA 5I8KL 3S96B 1MSPA 3IFLL 3FMGH 4LU5L 2OSLB 1HHKA 2WUCL 4NCC2 4Y16A 1UQSB 1JP5A 4PJHB 4EUPA 3W39B 1A3RL 4GAGH 2Z4QB 3KXFB 5EBWA 2R69H 5D96B 1NBZB 3L3OA 4MB5A 5DHXB 4WCYH 3QR2A 3RZCD 5DLML 3CDCA 4HCRL 3S88L 2NTFB 1OT2A 5J12C 1IL1A 2HMID 1U91A 3QZWA 2WP3O 5F7EL 5F97E 4W6YB 5F9OH 2HLAB 1ZS8A 1LP9A 32C2B 4HWZB 4DUVA 4KXZI 1L6ZA 2XZCH 2DLFH 5FYJE 3PWNB 3E1F1 4JCMA 2P5WD 3DJ9A 3MBED 2WBKA 3IRPX 3RIFK 5EZLB 1X7QB 1N3NA 4PJ5B 2EIDA 4HWUA 5E5MA 5H94B 4APQB 3BH8A 5CILH 3GSWA 3VDAA 4X7FC 3VGEA 3U2SB 4G6KH 3IDYB 4L9LA 4BM7A 4JFOB 3OX8A 4IM8A 1NFIB 1IQWH 3OHXA 5JXEA 2BSSA 3VRJA 2NX5B 5HI3C 1MIML 1DANU 2CRMA 3HE6B 4R4FL 1BIIA 1ZGLP 4R97B 3MCLL 3U4BL 5DK2B 3HZVB 5MEQA 5JW4M 1P4IL 5B4MD 1CLYL 4I48A 5KW9L 1EO8L 2NY3C 1UB5B 5IKCA 3U7YH 4M7ZC 1F4WL 3QEQA 4HS3B 4KHTH 1P84J 4QXWA 4QWWD 1C7TA 5I8CA 4GG6B 2J6EH 1S9XA 3UPRA 3GI9H 3BEVA 3L3IB 2VZSA 3DO3A 3C60D 3GKWL 1FL5A 4DKDC 3VXRE 5FYKL 1T2QL 4YEFA 4IRJB 1KACB 1J8HA 3ARGB 3IAQA 4WTXA 3FFCE 4OIAA 2R4SL 5ISZA 5D1QC 3MRCB 4HGMA 3SDXE 1L7TL 4IMLB 1I3RA 1QSED 3T65B 5L6YH 5C0RL 4TUKH 1DQQA 4FQIL 4NDMA 1FG2A 5EU6B 4M5YL 3NCJL 2KQNA 5BO1L 5TDOA 5JORB 2J4WL 4GXVH 5IHZA 2R9HC 3WFEH 4K3GA 1GGTA 1ZLWH 5ICYA 5C0NC 5JPNB 1RUKH 1UB6B 5DMIL 3EHBD 1G9MC 3W11C 3QDME 2OX5A 2Y4SA 4LSDA 3LZFH 4MJID 2XNAA 1JCKA 3CX5K 3MRFB 3T1FA 3ILQC 4MXWL 1HI6B 3NAAH 5KVFH 3SKOB 3L3JB 4X8XA 1CF8L 3WL9A 3IJYB 1XGYL 2YA1A 2IMNA 1T20B 3ZDXE 1TNMA 1F00I 3ZL4L 3DROA 1XZ0A 3HNSH 3N1MC 2DQIH 2H2SD 3MSPA 3QDJD 1C16A 3MFGB 4L3ED 4WEBH 4AQ1B 3KHOA 2PF6A 2EDWA 4PJ7E 1I7UA 4B50A 1OTTC 2Y6SD 3BUTA 4Z0BL 5BVPL 1S7SB 3VFRA 4JM2A 3KGRA 4FQCH 4JEGB 5C08A 4DVRH 2APWA 3RX5A 3QWOB 4LHUA 2E9BA 2VN7A 3MRKB 4NZTH 1JPSH 4Q9RL 1FBIL 3OKEA 2EEDA 5CD3B 1PYWB 43C9A 3GMPA 4NT6A 4UT7H 1E28A 3EJZC 3KPPA 3LQAH 1FFOB 1R3IH 1XH3A 3ARDA 3WN5C 4GUPA 1MQKH 4EUPG 1U8OB 2CJUH 4ZUTB 1CK0L 5C3TA 5T1LD 4P57B 1D6EB 2Y7QB 2X4SB 2IQAB 3Q6GL 1CD8A 3MYJA 4EBQH 5ITFB 1AD0A 5TE4L 3T4AB 3OR7A 4PG9B 4N68A 5SWSD 2YEZA 3VXPA 4XCEA 1DDHB 3LHPL 5I76B 3TZVA 4OSUH 1BOGA 1QEWB 5CP7A 2HWZH 3L7FB 1BREA 3RL1B 3ZHDA 2GITA 3KPLA 5IB1A 3WUZA 5L88H 3ELAT 4G8GE 2LU3A 1S7UB 1WBXA 1F5WA 3D3VB 4ODWB 3VFWB 1AGCB 2ZUXA 2FHFA 4NQDB 5HHQA 4JZOA 4L8BB 1XGTA 4XP6H 4JPVL 3S8WA 4HG4J 4RQQA 4Y1AB 3DYPA 4UV4H 2UWEB 4TSBH 4UIMB 3W5NA 4UBDC 1I8LA 4PJ9A 4G43A 4PPTA 1MFAH 2XQYK 3P4LA 4XPFH 5GRVL 4PLNC 5AAMA 1KXTB 1N5AA 3MV7B 2C7UB 4JZNB 4KDWA 2GCYB 4RAUA 5JHDE 1LP9E 4PTTB 3D69B 1JTOA 4Y2DD 3AM8A 4JFDA 1RUAL 1PG7W 4F37K 5EBGA 4X6EB 2OZ4H 4NJAH 5KAQF 5CKAA 4OQTL 1FORH 3EIFA 4HXAH 2YMXL 4Q9BA 3HC0B 4FZ8H 4Y5YC 4AEHH 1JGEB 3T0DA 1TTGA 3VI4F 3L3KB 1J1XL 3MJ8B 3SCMC 2I9TB 3FT4A 1I75A 3RY4A 4TYUA 1FHGA 4CN6A 3FONA 1ORSB 4FQXC 2IBBA 3T2NL 3H9ZA 1JL8A 5DUBB 1F11A 4ODHH 3L1OH 3QEQE 4PGEB 1QACA 4DW2H 4GQPH 4XZUB 3DX6B 4RFEA 3FO0L 3IDJB 3GIVA 3KYOB 5I18H 3PGFL 3L5WA 4LPCA 1VACB 1RY7B 3BISA 3LKPA 2FATH 1FVCA 5LJYH 1LVEA 2PXYB 4HF5H 1TJGH 5HVFB 1J8HE 2GUOB 4I0CC 2DL2A 5ISZE 5INDB 1NBYB 4K3EL 4MA1B 3RBSA 4U1IA 5HI3D 4PV9A 5EOTA 2ATPA 3UJTH 2R8SL 1KCLA 3HZKA 4HUNB 4MNGB 4BH8A 3RGVA 3C6SB 3WLBA 4AYFA 3CFJB 2DD8L 2NY3D 4G7YH 5CEZE 3KPSD 3EYVB 2O5ZL 3HAEH 1FNEB 1J87A 4PUBL 4YBHA 1B4JH 4X0KB 1JGLL 3TBSB 1ZT4A 3OPZL 3OSKA 1GC1L 2FSEB 4OF0A 3UTPE 1VGEH 4C54A 2L7UA 3PL6B 5D7SH 4MXVE 4RMQA 3UPCA 1KIQB 4U6YB 5JLZA 4XAWL 4LLMB 4POZC 4Q74A 3WHE0 5L7XH 5F7YC 4XPGH 4LHUG 3WFCL 4X4YA 2D4FA 4HWEL 2VLLB 4LCUA 4HX1A 4AEIL 3KPRE 2LU7A 5TH2B 1CVRA 3K0WA 5D2LE 4MDIA 4OJFL 4XB8A 4OD2B 5ADOL 3O9WB 5T3ZL 5F70A 2DQHL 4G9DA 2YBRA 3CFKA 1S5HA 2AS5M 1LNUA 2IBGA 4ZFGH 4H0IA 2FEEL 5I16B 2WMPA 2P5EB 1RFDL 4GSDL 8CGTA 1DEEB 3O2VH 5C0EB 4PRBA 1LK2A 4YUEL 3NFNA 2R9HD 5CHNB 4R96B 4WUUD 4G3YL 1VFOA 3MCKB 1C5CH 5C0ND 3DTXB 5C08E 4G80B 1J5OH 4CMHB 1QO3B 12E8L 3W11D 4G6JL 3EFFB 3FN3A 4JM4L 3U9UB 3L6FB 3IF1B 4H1LA 1NGWA 1OT1A 2GAZB 4K9EC 4PJAF 3ILQD 3R8QA 4L4VA 3B9KA 2WZPD 2R4SH 3SQOL 4UDTB 3OZ9L 3MRHA 5KS9F 4IHOA 3EGSB 5E5UB 1L7TH 1GJIA 1KNOA 1SJVA 2YD8A 1NCBL 4WHYG 4DOHB 3FN0L 5DD0H 4LQFL 4OZGF 5BZDB 4X6DF 4A6YL 3JTSA 3EKCA 4GMTL 1UFUA 2CIKB 2DN7A 3LRGA 4NO0D 1JRHI 3IDMB 1J1PH 3VWJA 5IQ7H 4DUXA 2FJGA 3FRPA 3UDWC 3NFPB 5EA0H 3L9RB 4KTDH 1IC5L 2X70B 3F7PC 4KROB 1G7IB 4EIZC 3MV01 3BH9B 4F8TA 5C0AD 3MMEB 3BP7B 3EJZD 3C5JB 4GW1B 5GGSA 4QOKA 2CDEB 3SGKC 2VLME 4E42B 1HHJB 1AD9A 4IBLT 5E8DL 1KB9K 3T1WA 3P4MB 1Q72L 1YMMD 4JFZL 5K59F 1RU9L 2DLIA 3CX5J 5EWIL 3T4YA 4CVXB 2ZG1A 1TVDA 1S78C 4XBPB 4NO3B 4XNMB 3G08A 1FV1B 4YHKH 3IXTB 4OCYL 3O6MH 4KGLA 1MNUL 5CEYB 4M61B 2OP4H 5ESVA 3O4LA 1I7ZA 4PLKC 1O7SA 4JFDE 3GSXB 1PLGL 4RMVA 3NZ8A 3FB5B 4YXLL 3PWJA 3DO7A 1CN4A 3ZKNC 5EOCJ 4KI5E 1U9KA 4LVOC 1N6QH 4XNZC 1SJXA 3RWDB 4JG0H 1W72B 4X7TB 3SGEH 3HC3H 5AG8A 4I0PA 5F96H 5HI4D 4KQ4L 2R0ZL 3THML 3UC0L 3T0WA 4I3RH 5ERWB 3JWOH 2CKBH 5IM7B 1U8NB 4LIQE 4UBDD 1JNHB 4Y4KB 3HCVA 3R8BB 4R7DB 3KNBA 2ED7A 4NO2B 2V7NA 2BSTB 2HJFA 3S36L 5EU4A 3P9WB 1UVQB 1A4JA 4HFWB 1BIHA 5C6WH 4O2CB 1A6PA 1BWWA 3DURB 4ORZC 2VXTH 3ZDYE 4P2RA 5DRZA 2GKIA 1CCZA 3VJ6A 3GO1H 4XC3H 1MPAH 2EH8H 1ZANH 3TVMB 1MLCA 3U4EA 3LSOA 5CIPB 3CFIC 5ENWB 1N7ML 4Z7UA 1INDH 3MRRB 1A3QA 4XRCA 5F21B 1UH3A 4YFLF 4NWTL 1PG7H 4GKSA 3SCMD 3HS0B 5D7LD 3O41A 2WIMA 4O9HH 3B83A 3CIQA 5DVOA 5EO9A 2F54B 4DGIH 5DJCB 2VDRH 1AO7B 2G2RA 5IFAL 4X5XA 2ZUQB 4NSKB 5GJSH 5JHLH 5L8JB 3T0EB 3LQMA 3TT3L 5I6XB 4LLUA 2LU4A 1RMFL 4LDLB 2BSRA 4Z76A 2ERJB 1U8HB 3TN0B 4EI6A 2X4UB 3HPJA 5GSRB 1IM9D 1Q8MA 4JG1L 2PCPB 2SEBB 2YA0A 4HWBL 5FUOL 1A6AA 1HNFA 2VDKL 3B5TA 5C0BD 1RPQA 3KYMB 4ELME 1Q9WB 1JF1A 2BERA 4PRHA 4ZFFA 1JWMA 2Y1VA 2YSSB 3D25A 1U92A 2IH1A 5DHVH 3PWLA 2JKXA 3GJFK 3VGDA 4HW6A 3ALPA 1CLCA 2ADGB 4UINL 5E8EA 5T33H 2XTJE 1CICC 3FHAA 5DR5L 3QBTB 1MWAL 4OCWH 3GZKA 1S8DB 5FA4A 2NCMA 4MAYA 1LO3H 3W0WB 4QHNB 1ZSDA 2NYYC 1KBGH 1TVHB 5DD3L 3ULUL 4X6CB 3QUZA 3FB7B 1A7RH 1OGAA 5C86A 4RFNC 1KJMB 2IH3A 4M6NH 2CLVA 5FGBA 5C0FA 5SWZD 1NCDH 3K8MA 4S1QL 2EDKA 3FRPG 2AXGB 2DLTA 4M03A 3VRLE 5H35A 4S0SD 4POZD 3BZEB 4HUXA 4L4VE 2HT3C 1RK0B 4JKMA 3V7MA 3E8UH 2YD4A 1G7PA 1BJ1H 1RZ7H 1SEBB 2NXYB 2AQ3A 1CGYA 1OM3H 1OHQA 1NPUA 5GGQL 2P47B 1LO4H 4CMMA 4F58L 3RTQA 3V5HA 1CVSC 4JKPH 3ISWA 4R9HA 5IB5B 2H8PB 4K7PL 3PHQB 5JW4N 4NHCH 5J1AB 3BGFB 4RISL 1G7JA 3LKQB 1Z0MA 1YY8A 4J8RB 3W81A 4M7JL 1NH6A 4JB9H 3FOMA 3QEHB 2YD7A 3T2PA 3D0VA 1BVKA 4PJXE 4GAJH 1QPXA 3EO1A 1G7QB 1UGNA 2LVEA 4QOKE 1QA9B 1YEDB 2NY6D 2RJMA 3KWWA 4JGJA 4DK6A 5FO9A 4P5TB 4HK3N 5FOBA 3LEVH 5FHBL 1T03H 3CFBB 1HQ4B 1SY6L 2GJZB 3FFDB 3V8OA 2HA1A 4JDTL 3SPVA 3S36X 4WU7A 3V52L 1UACL 1MCPL 2Q8AH 5ACLA 3EYUL 4DKEH 3OAZK 3IDNB 5D6CB 3SDDC 4AENB 2VDPL 2ILLA 2EIZB 4M7KL 4HAGA 3QCUL 4RWHA 4MJ4A 3WFDH 3WIIL 4YHZH 2PR4H 1OAQL 3HAEB 4XB7A 4P2CG 1M4KA 3QI9A 2BSED 4OV6F 4UV7L 5CSBA 1WT5A 3LD8B 3B43A 3STZB 5C07E 4FHBD 3S96A 4OFKA 4MA7L 2A6KB 4QXGL 5DD5H 2HN7A 3QHFL 1WZ1L 2Z4QA 5F7KC 1HZHH 2AK4A 1RIVH 5AG9A 3IFOA 3M45A 3ULSA 2VITB 4KK6C 2PO6B 4PB9L 5CBEB 2NTFA 4WEUD 5FK9B 2FO1A 4ZSOB 2OTUB 2EDOA 5HYSB 4PG2A 2EO9A 3QNXB 2EDLA 4ODBD 2DWEA 1R0AH 3D87B 4S11A 1UH4A 3D85B 3ESUF 32C2A 4NM8H 3VXTB 3MRGB 3VGBA 3E2HC 3ZKND 4FZEH 5EDXA 3EYQD 2BVYA 3B4NA 3V4PH 4PJ5A 3N85L 5KVGH 1CT8A 1TFHA 4APQA 4LCYA 3VXMB 3U2SA 1YN6A 1FNAA 1GC1C 1LO2L 3SDCB 1KJ2H 5CAYB 1KN4H 2ZSVB 5ICZA 4M8VA 4P46C 1MUJB 1QBML 2R1YA 1CFTA 3ZTJH 4KVCH 3MLVH 1KB9J 4OB5H 2N1KA 1RVFL 5DJ8B 5E8OA 1GPOL 1A6ZA 3NCYP 2OL3L 3RL2B 1MREH 5DZLA 2QEJA 3GRWA 4JFFB 3FQTB 3NH7H 5FAAA 5I73C 1OP3H 3HHRB 2ZNXA 1S7WA 4IJ3C 5DFWH 3IJHB 1CFSA 3P0VH 4HMCA 4WWKD 4D9LH 4PRHE 3QXVA 1KPVA 3CMOL 4HV8B 1JPTL 1HHHA 1WTGT 3UC0H 2YUZA 5L9DH 2AJZA 5L2JA 1ZT7B 1AP2B 4Y19A 4I18C 1WAAF 3QWRA 1EEYA 2ZCHL 1YJDH 3X12A 1Q1JL 4JRYE 5KSBF 4J4PD 5FGSA 2A6IB 3DV6B 4YDJB 4CJ0A 1OAKH 1NC4A 5EU6A 2A9ML 6FABH 1AXTH 5GZNC 1OGAE 3DBXA 5JORA 3QQ4B 1A5FH 1Y0LB 1FC1A 3QPXL 3ARFB 4LP5A 5JPNA 1M7IB 2Y5TB 2YN3A 3PDOA 1P4BH 5F6IC 4KUCD 5TDPA 2DQEH 3GHEL 4OCRL 5D6DA 3H42L 4NC1E 5D8JL 1L7IL 3RY6C 3VFOB 2H32A 3VGFA 4JZJB 3BZFB 1CD1B 1U8IB 4J3XA 1T89C 1R6VA 4XPHL 4UTBH 1F4AA 1HI6A 4QT5B 5C8JB 2R0WL 3A6BH 3LN9A 1BM3L 3IJYA 4HUMB 1LEGB 4M3JA 5HTSA 3H3PL 1DE4A 1T20A 1U6AH 1CICD 3CXDH 4ZTPH 1WZLA 2CKBB 5D7KE 3TWCL 3Q6FA 2IAND 4IRSA 2IFFH 3ALWA 4P99A 4UT6H 5EOCL 5JPMA 1I1AA 3TGXA 1P7QA 3SE3C 3OJDB 5DVLA 3PXJA 1N0XH 4G8FB 4BFGA 3IFNL 3MRIB 2DTMH 4KI5C 3MRKA 1YNTB 3EZ8A 2CDFB 4P2QB 4G8GD 2VIRB 4KKCC 2R1WA 3I84A 4WI8A 5F1OB 4OZFH 1FFOA 4JN2A 5E2UL 3F62A 3IS1X 3OXRA 4D0DA 3W9DA 3I6GB 5C0IB 4U1SB 4NIKB 5I75B 1JK8A 4OI8A 1CGUA 5DEFA 1FNGB 1U8OA 4XMKH 4WWID 5GZOD 1OD7A 4F8QA 3BAEH 1FRGL 4WI7A 4HUWA 2VXQH 4PJDF 1OVZA 1NUNB 3PP4L 5DJZA 3O6FC 5JHDD 35C8H 3OKYA 4LAQL 4O5LL 1IEHA 2A38A 1J05B 1KJ3H 4BH7A 4XC1L 1FZKA 4S1RL 1QEWA 1FO0L 4NYLB 3GMOA 1INEH 4KZDH 4U1LB 5DJ0B 4OF5A 1HEZB 4YFDB 2J5LC 2VLKA 3CSPA 3D3VA 2GFBB 5AD0B 1YC7A 1V7NL 1AGCA 2AK4E 3MFFB 4S1SH 4L8BA 3RDTB 1KG0A 3MO1B 1A7NL 5DHVB 3RWHB 2MQCA 1QFUH 1TQCB 4CGTA 5IP4A 1KCKA 1XGUB 3JWDL 4UIMA 3DGCR 5EPMA 4D8PA 4XH2A 5J0BA 4LKXB 1BD2E 3SDDD 2FIKB 4NM4H 1S7VB 2I07B 2GCYA 3JV4B 4GKNA 3V5DB 3D69A 3DYOA 4Y4FC 2BNQD 2P24B 2BVUA 3VFTB 2UVEA 3GSNH 4HQQH 4RMTA 4U2ZA 4XCNB 3HNTL 5EU5A 1CGTA 1I7TB 1BZQK 1FYTD 2NXZD 4HUUB 3HR6A 5C6PB 1OTSC 4I13B 1MI5B 2GJ6D 3LN5A 4JO4L 1I3VA 3UROR 4JANA 2LQRA 1L0QA 2W0KA 4PGJA 3WDHA 1E6OL 2ICWB 3MV11 4KK6D 5IUSA 2A1WL 5E2VL 4RIRB 4X8JA 1LEIB 2E9IA 2ADIB 1FL6B 2O5XL 4LLWA 1JMZA 4J3OC 4E41D 5TE6L 1FLRL 4DCQB 4Y5VB 1A7QL 4HFUH 3REWA 1F42A 1RZGA 1JZ3A 5CEZD 2MPAL 4YHNB 4PRIE 4RGNC 3EDKA 1UXSB 4GRLB 3ZKSD 5GRJH 2IWGA 2BOCA 1DBBH 1H3PH 1IKNC 3UTPD 5ICXB 4RMSA 2R0LL 5CZVH 3ME0A 5EORH 3VCLA 1FCGA 3SGDH 1V3JA 4HS6A 4JQXC 3F8UB 1YC8A 1Z9MA 5FDWB 5CZXC 3KPRD 5JO5A 4P59H 5IG7B 4Y19E 1NBYA 4YO0A 4JCLA 1NCCL 3PUCA 3UJIL 1DUZB 1H0DA 4P46D 4YGVB 2LAAA 1RHHA 3WIHH 5KSVB 1OF2B 2R2CA 4HBCL 5AWNH 1X5YA 1JNLH 5CGYC 4U3XA 5JQHC 3C8KB 3RA7L 3VWKB 2ZWLT 4GH7B 1FFPA 3MRJB 2HKFL 3FQWB 4W81A 5T3ZD 3EYVA 2P8LA 1KEML 3O2DL 3F65A 4ZAKC 5CBAB 5DC4B 4X0KA 1ZT1B 3TBSA 3NFSH 4BFEA 5F7UA 1MAMH 5E2TL 2AJVH 2MQ3A 1G6RH 4N9OB 4F2MA 1WEJH 1KIQA 3JV5A 1IGIL 4XX1E 1OAZL 5D93B 5EZIH 1XF4B 3FN9A 2HYMA 2D31A 4XMPH 2QADD 2GK2A 3BO8A 2EXYC 3V9FA 2DLEA 2ESVD 2UZIL 4K71B 1ZGLM 3LIZL 4PRDA 4EVNA 2HJLB 2EE9A 5DEZA 3O9WA 5I15H 1FVDB 5FUCC 4WUKH 3SOBL 2WBJB 1ORQA 5B3JF 1DBJL 1NGPL 1J0HA 1GGYA 1NFDF 1U58B 1BZ7B 1KB5L 5B38A 1DEEA 2ZCLL 4B0MM 1TZHB 4XWGH 1CR9H 4HDIA 5GZND 2QQNL 5GJTL 2YPVL 1A2YB 3CAFA 3NTCL 4NKIH 4R96A 4JFPA 3ARRA 1JWUA 3DTXA 3TZVD 4FXGB 1YMHA 4G80A 2QL1A 2FCBA 2F5BL 2ZUSA 1UKTA 4AL8H 4ONGL 3L6FA 3GUTA 1UZ8A 4M93C 4QXTB 4AZ8A 1N6UA 2GAZA 5F8QC 1K6QL 3SGJC 4KTYA 5LWYH 1BX2B 5FF6A 2VLMD 1QSEB 5CJOH 3BW9B 4HKBA 5ADPL 4IRZH 3V95A 4DK3A 4DN3L 3B2UC 3QO1A 5ID1B 2ZCKL 2QTEA 5EZOL 2HFFA 4BKLB 1AFVH 2UZYB 2D03H 2W0FA 4RGMC 1KLUB 1DVFB 4M1CC 1KJ2B 1D9KC 1YEEL 3SGEI 2APXA 3X3GH 4OT1H 4P4RA 1IEBA 1KLFA 4J3WA 5BZDA 1OAXH 2WUBL 1IM3A 4OGZA 3X14A 1CGVA 5DQJA 5D7JB 5E6IC 1I8IB 3OB8A 1KTLB 3RU8L 4MJIB 1IFHL 2AXHA 3MUGA 3NFPA 4X9HA 5CWSA 2KDGA 3L9RA 1ZWIB 4OCRH 3RIAF 2DBJA 4L5FL 3ROLB 1U8QA 4KI5D 1NJ9B 3LKNB 4RFOL 1IZJA 2CK0L 4KKCD 5D72L 1FFNB 3BP7A 2VLKE 2H41A 4Z78B 4E42A 2FWOA 3DOSA 2Y06L 3BQUB 3C09B 2DQDL 1S7RA 4CKVX 5BV7L 4DKAA 1MRCH 1QLFB 3DVNB 3RUGE 3T8XB 4U7SA 1HDMB 3MGTB 4D2NA 3KPQA 1AH1A 4XBPA 4NO3A 2JB5H 4OAWB 3QB7C 4HPYH 5FDYA 3GMRB 4Q2ZB 1LDSA 2OK0L 4S2SB 4EN3D 3O6FD 5CEYA 3UZVB 3B9EA 4KUCF 2BDNL 5FUZL 3V5KB 5T3XH 2ARWA 4U1GC 2DMKA 3LPFA 4JFEB 1PBYA 4W68A 1BPVA 2IFGA 5C6TL 5D1ZC 4FMFA 2BY2A 3DSFL 2R56L 1IC7L 5J9PA 4DN4L 2YD9A 5ITBL 1SHMA 4QRSA 5JUEL 4LSTL 4OFYA 4LGPB 5E2UH 2X05A 2WIIA 3RAJL 1F3JB 2CUIA 3U0WL 4PJGB 2A2QT 2F8VA 4MD0B 5GGUA 2JJTA 5ERWA 4CVWA 3QNYB 1U8NA 5E4EB 5AYUH 1G7HB 5J13C 2QQLH 2C1PB 4R7DA 5JOPE 4JPKH 2PNDA 4J6RL 2BCKB 4ZPTB 4Y4FD 1ZHKA 5L2KD 4FQ2H 1BQHA 3G5XB 2ZJSH 3O2WH 5D1XC 4QF1B 4HIHB 3MA9L 5T1KD 3PDDA 5DQ9A 3HMXL 1FZMB 4C83B 4PR5B 4KJPC 1OTSD 3U30C 5B8CC 1EX0A 2MCPL 3MLRL 3QCTL 4NC1C 5I17A 2BVPB 2XV6B 3N0PB 4XP1H 3K1KC 4O51B 4Y4HA 3GHBL 1GGCL 3CFCH 4OZFB 3JWDH 4ZUUA 2EKSB 4L29B 3IU4H 4JRXE 2OJZL 1BQSA 4NKQB 2F54A 2I9LB 3GGWB 1UWGH 4Y2DB 3OKOB 4D9QE 3H2WA 5JIIA 1IMHC 1AO7A 2QR0B 4RDQF 3LQZA 4M8QA 3QISA 4NSKA 5DFVC 3GK8H 1E27B 5FM5M 5TF1L 1YDPA 4RGND 3T0EA 1W8NA 3LN4B 2GY5A