2BOBA

Potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobA02
2UVEA 1YQVH 1MWAL 4KRPC 4FTVB 1I9RL 1NGZB 2VLJD 2X4PB 1MAJA 4ZD3H 3PWUA 2P46B 1NAMA 5GISH 4Z7UA 4Q9RL 1KENL 5JDJA 5IHUH 4GW1B 4YK4B 3SQOL 4G9FB 3H3KA 3P30L 4QTHB 5HBBA 4HIJB 5FDWA 2QHLA 5KG9A 3V79C 2HTLD 1NGPL 4J8RA 5DD5H 2DBLL 1HKLL 1UKTA 2I5YL 1BVKA 1XF4A 4OLVH 4JFEB 2NY7L 2Q8AH 5EZJB 4A2LA 2AERT 5HGBA 4HGKC 2ATPB 2IALA 3G5XA 1NAMH 4NOFA 5AYUL 4U1MB 3H3PL 4HK3N 1GPOH 2QQNH 2VSCA 1WCQA 5IB4A 1U8HA 4X4ZA 4FHBD 5GS2D 3MR9B 1OM3L 3IDJB 1ZLUK 2OR7A 1I7TA 5D7KE 1QSFA 1GGCL 1VKXA 3JV0A 2MOVA 4JM4L 4PRIA 3SDCC 4YO0A 2DQIL 4QRPB 3MSPA 1AGDA 3N1GC 3RVVC 3VG9C 4LSVL 2R2HA 5LAXB 2P4AB 5E9DE 5D7LB 2O5XL 1QSZA 5ISZD 2Z93B 1MFCH 4MX7A 3V6ZB 2W9LA 4EDWH 2F19H 4RX4A 4WFFD 3KJ6H 5D2LE 1BREA 5HHNA 4ZODA 4OLWL 4TNVF 1MPAL 1MI5E 1F4YH 2Q86A 3BGFB 5C07A 5C0BA 1U8QA 1N6QL 3GB7B 5DK3A 4LPVA 1B2WL 4HPOL 2BCKA 3RL1B 1E4JA 2CDEB 4JRYB 1FP5A 1UM4H 3ILPB 5DVKA 5IHZA 4RZCA 4HFUH 4KI5C 3B9KC 1AD9B 3ARFA 4J3OC 3D0LA 5EZLA 1U3HD 5EA0H 1WFUA 2DQEL 3FB8A 2UV3A 2DQTH 4JE4B 3L3KA 5GGSY 1HN1A 1RURH 3X3GH 2WQRA 2MCPH 2AGJL 2OR9H 2YKLL 5DURD 1D7FA 1HWHB 3CVHA 3I75A 5L88L 3QZWB 4QEGA 1DANU 1LO4H 5MENA 4KGLA 4U1IB 3WNOA 1J88A 1A9EA 2DBLH 3BGAA 5EOTA 5JHDB 4M62L 2OYPA 1MFNA 3DHJA 3C5SA 1UEMA 4PR5A 5D2NA 3WFDL 1HQRA 4DVBB 1IGJA 3OB8A 3UTSB 4S1QH 2ATKA 2W38A 1LEKA 1UKQA 2ZSVB 4CADA 1LMKA 4IS6B 3MRHA 3KHOA 1QFOA 4UINH 4P2QB 1Z9LA 4J6RL 2WINA 2GSIA 2ZP0T 4JQIL 1HNFA 1FO0B 3BE1H 5D1QD 1V3KA 3VH8B 3BRDA 5MEPA 2FIKB 4LKXB 1EGJA 3GIVA 4HKXB 5EO9A 3K0WA 2PETA 3VFUB 4BZ2L 3I6LD 1CGSL 4JPVH 4RAVB 1NCDH 1DBAH 1MCJA 3QDMB 1EV2E 3SO5A 5HSFA 3QO0B 3UBXI 1BVKB 1XF4B 3HMWH 4UB0H 5FXCH 1QR1B 4PRDA 3ZDXF 4X7CC 2FHCA 2IH3A 3IKCB 3HPJB 1CXFA 5E6IC 2EECA 3NIFF 4ZUUA 3MZTA 4O2EB 1NUGA 2FSEA 5HDQH 3INUH 1YY9C 4Z7UB 1X5JA 2DI8A 1GZQB 5D6CB 5DR5H 3D39A 3VXMA 4WTXA 1F6FB 3BPNB 4GKZB 3KWWA 5C09B 3VXRD 5TE6L 3TV3H 1A1OB 3TCLA 2VDML 3MCKB 3DUHA 4P5KB 2V5SA 3CFCL 1HH6B 2J1KA 4Z0XB 4PRPA 3EJYD 1QR4A 2PTTB 2N7BA 5C09E 4QLRA 3K74B 4RZCB 3NIFE 3QP3A 2X4UB 4DEPB 4PJ7A 3PV7A 1EAPB 1JTOA 3PL6C 2I07B 3HCVA 4EUPB 2X40A 3VWJA 1BQHG 4GXVH 5EN2A 1IAOB 3VFNA 3UJJL 1CG9A 4I3RL 3T08A 3X3FH 5ITFA 3TP4A 5JO5B 1MHHA 5DJ8B 3S88H 4P9ML 4OFVA 3MMEA 4JDTL 2IAMB 4HJJL 3WFBH 4PJAB 4D3CL 1ZHKB 2YC1B 1BZ7A 3Q48A 5GS0D 4OJFL 5JR1H 3U4EB 1CK0H 4JANA 2ZUQB 3CK0H 3HR6A 3PNWA 3OHXA 4JFZL 3AC0A 1ZSDB 1KYOJ 1MOEA 3G9VA 5ACMA 5JOPE 1URLA 1P5VA 3P4OA 1C7TA 2XA8H 2QR0A 5LQBL 4ZUWA 4L3EA 4K3EH 1A7QH 1K8IB 4WW2B 5H37H 4ZFZA 1I1AC 1O5DT 1JJUA 2A6IB 2LVEA 3I02B 3SHSA 4N8PA 4R4BA 4ORGB 2H8PB 4X7DC 3CXHK 2O5ZH 5HYSB 3C5SB 4NN7C 3RI5K 1A3RH 2DLFL 1JRHH 4DKFL 2YK1H 4X8JB 5ICYA 3EYOB 3I85A 3R06A 3DTXA 3RWIB 1MFBH 2NXYB 3ARDC 1SHMA 5KSUA 5IMLB 1WFNA 3C2AL 2R1XA 4OZGA 5H94B 3LN5B 3H9SE 4LCUB 2XZAH 4EVNB 2VXUH 2NCMA 3W5MA 1WTLA 4IRSD 4JKMA 1OAZL 4HT1H 2EYSA 2EDNA 4L8CA 4I3RH 4K3GA 3GO1H 3BSZL 2YZ8A 1GGIL 3ARGA 4AEIL 4RMUA 5HHVL 3TFKD 3EFDL 4QRPE 5D6DC 2BERA 3O0RH 1G1YA 1KB9K 5HHXL 3N0PB 5FHAL 2YPVH 5FUZH 3PV6A 1RUMH 2LV4A 2W92A 3S9DB 2AJYL 5JW4N 3FZUC 3WJLA 4LP4A 5BO1H 2K7PA 2HH0L 2WP3O 2EDKA 5J6GB 5F7DB 2C4FU 5I2IB 5T1DL 3U9UA 3KLAA 1YYML 2AJUH 4QHMA 4P49A 1XF2B 2BVOB 1AGBA 2M2DA 2PW1A 4R3SB 5DJAB 4DGYH 5D71H 2A9MH 4N5UA 3P11H 2HT4C 2NY6B 4D94A 2BSTA 2CKNA 5IMOB 4X5LA 2YN3A 1RMFH 5BV7H 1LE9B 4C57C 2D9CA 1FDLH 3H9SD 1KBGL 3MV9B 4ZAKB 2P8PB 1OLLA 1R5VA 1T1YB 5F1IB 2JJVA 5E1AA 3TH2T 2YBRB 5DD0L 1UM6L 2OXGA 1DFBL 1WZKA 2H2PC 1WIPA 5TDPA 2NXYC 3TJHD 3B83A 2Q1EA 4QF1A 4G6FB 4OQTL 3DGCR 4H8WH 2LABA 4JR9L 3P77A 3LKPA 3GKZA 5DQJB 5I8CB 5E08H 4N0UE 5IM7B 5JXEA 1UVQA 1UQSB 2VWEC 4FFYH 1VFUA 2CUHA 1FCCA 3MPCA 5FFLA 1T1ZA 1L9MA 5GJSL 5I18H 3FFCE 1JV5A 4TYUA 4G43B 5GGVL 2QSCL 2FSEB 4M7KL 1NAKL 5EO9B 3RWFB 4XMLH 5HXMA 1MPAH 3QUZD 3D0VB 4QHLB 5C0GA 5JOFA 2X70B 4KHXL 1V7ML 3MRRA 5DMJB 2X7LA 5T1MA 3V6ZA 4TUKH 1KFAH 1GSMA 4O51A 2ZCLH 4NJAH 3SQBA 3JBG7 3WHE0 3QQ3A 4OIIL 4L3CB 5BS0D 2BNQE 2OJZL 4DW2L 2JTDA 4YX2H 2YN5A 4XCFH 4F58L 3ALWA 2FIKA 4LIQE 3W11D 3IJSB 5GGRB 4G9FE 3OTTA 4LCIL 3T0EB 4PLKC 4Z8FL 1OGAE 4WO4B 1YMHB 5IMMB 3QUYB 3DROA 4YZFF 1MCWM 3H9ZA 2Z92B 1MCIA 4OB5L 3L3GB 4K3HA 2NY0D 3C6SB 3P2TA 1HH6A 2AQ3A 4N8VB 5EU4A 3MRIA 1UA6H 3PABB 4P9HL 1XR8B 3MTRA 4G6JL 2PKDA 3FO2B 1JWMA 5EORH 4HFWB 3FRPG 1CD1A 4ZOAA 4Z7VE 4XVJL 5DUBB 5DLML 3UBXA 5CEXA 1UADC 1W72A 1NCBL 4J3UA 4PRHE 4HPYH 4OZIF 4JHAH 1QFPA 3QQ4B 3ARED 4UILL 4QYOB 8FABB 4XNYH 5DS8B 3TM6A 5HYSA 3G04B 4HKJB 1HXMB 2ZJSL 5KTEL 1MJ8L 3VWKC 5E00B 5ID0A 1FG2B 1ZSDA 1EK3A 2HVKB 4FFVD 4K71B 4GJTB 5DD3H 4JO3L 1CIUA 4QRUB 2X9WA 5L9DL 4LEOB 2A2QT 2VN7A 5IEHA 1E6JL 1K3ZA 2XZQL 1EEYB 2FNBA 3HZKB 1FCGA 1DZBA 1OPGL 5HHOD 4DOHE 3HE6C 5CCKL 3O0RL 3ILQD 4F7EB 5GGQH 3CFDB 3MRMA 2Q76A 3OL2A 2X10A 4KQ3H 4YC2C 5EZIH 3BX7C 1XZ0A 4PJ8B 4XP5H 1A9BA 3STLB 1T04A 5D2NE 3TO4C 3ARFD 3BH8A 4OF0A 3T0XA 2X09A 4P23C 3RTQB 1J87A 1OP5K 1BP3B 4JHWL 4U1SA 1FN4A 4JREB 4PYGA 5E56A 1I9IH 3X13A 1KIUA 2ZG1A 4QRTA 5DRZA 1YN6B 4MAUL 2P8LB 2EH7H 1N59B 5EU7E 3UC0H 1OL0A 3BWAA 1HH9B 2OBGA 2EYSB 2MTPA 2P5EE 4N0FA 1G0XA 4F8QA 5I1KH 3OF6D 3GMLA 3V7AG 1CICD 2F53E 1J5OH 3EHBC 3N1PC 5HHMD 1DBMH 1X5LA 4GW5B 1B0WA 1Z0MA 1FSKC 4WU7B 3T4AB 3QPQD 3VXUD 1IQWH 4RFNC 2VLKB 4KDWA 1IGIL 1OQXA 4I4WA 1NMAL 5KAQG 1P69B 3QT2A 5DI8B 1WF5A 1X44A 3MGOA 3KLAB 4XI5C 1BFVH 2ADGB 1QNZL 4R4FL 3GBMH 1R3IH 4MAUH 2X1WL 3L1OL 4FQHB 1ZTXL 5IIEA 2OTWB 5K33A 4U6YA 5IF0A 5B38B 4JZNA 5AZEL 3BYYA 1P7KA 3D85D 3VCLA 5GGTL 3VG9B 1ZT7B 4OAWB 5IVZA 4ODTL 5DJAA 5K93A 4LPYA 5FYKD 1S9XB 2BVTA 3IT8D 4L9LA 3IETA 4RBPH 2ADJB 4YGVA 5ENWA 1I3GL 3GGWA 4ODUA 2X4QB 1TQBC 3IDUA 4NWUH 5GPRA 3VXSB 3LS5L 3GI8H 3DSFL 3M45A 3X12A 4DTGL 3CH8A 4YDJB 5EPMB 1EEZA 2WZPD 4P2CG 3UAJD 1S7RA 2C4XA 2NY7H 2ZNWA 3FOLA 5BOPA 1FZOB 3T4YA 1JN6A 4NKIL 3EZJB 1H3PL 4N0UB 4TN9A 4JFYB 4QYOA 8FABA 5TE6H 4M1CD 4LIQL 1GPOL 3QJHA 5JW5B 1T1WB 3CNKA 3QEGH 1RIHL 5KOVC 1KJ2H 4JFXB 2MPAL 4PJBF 3ARZA 5IOPB 4JFED 5E00A 1J86A 3UDWA 4FQPA 5F88A 3BPCB 1IZKA 1HSBA 3QNZA 4ODXB 1TJGH 4LVEA 1J10A 3PWLA 4RISL 1ADQL 2HFEA 1QACA 3HS0A 1KCUH 1BGXH 1JGUH 3NZ8A 1QFUH 2HTLC 4NQEE 5DJXB 4X5WB 4YXHL 3PXJA 4KKLD 1EPFA 3DMMD 4X6CF 3NCJH 5D7IB 4PJ7E 4KJQC 1P5UA 4YPJA 4KRLB 2PW2A 4JPIB 4HH8A 2R0KH 4FZEH 2EIZB 4WHYG 5HYJB 4BSWB 3WE6B 2B4CC 1Z2KA 3OR7A 5KSAC 1FGVH 4R9HA 5DZLA 3HN3A 4R7DA 3VFWB 1A6VL 4XCCL 3SCMA 4C83A 1RJZB 1DBKL 3PWNA 3BHBA 3T0VA 4OI9A 4XP6L 5CSGA 3FOMB 4X6FA 3LKRA 3S3PA 2VLRD 4DFHA 1CT8B 1QUNA 1ZVSA 3HG1B 5F70A 2ZUYA 1KTLA 5F3HA 3BQUD 1RJYB 4Z5RA 2DLTA 2IALB 4QXUL 2DYPA 3MNWA 1CDHA 1VEMA 3DO7B 5CLWA 4Q97A 5D1XD 2DAVA 7FABL 3VA2C 4UIKH 2ED8A 4ONOA 4PV9A 3VXUE 1RURL 4IOIA 3RNQB 4AG4H 2FL5B 2ZCHL 3ULUE 3MBEC 1H8SA 1BOYA 1RUQH 1J9CT 2PO6B 1M7XA 1A6TA 4PLJD 1ZHNB 4Y16A 2FO1A 1AH1A 1IAIM 3KPOA 3UZVB 4JY6B 5EC1A 4GW5A 4U3XA 2ZUXA 3DUSA 1OTTC 5C0CD 1YUHB 3P9LB 4OIIH 3GMPA 3V0WH 4NC1C 3Q3GB 4I2XA 3GJEA 1MCEA 3VG0H 3VWJC 5IB3A 2Q8AL 1QZ1A 2F19L 4YHYB 1J5OL 1N59A 1AHWA 4P2QD 2ZZUT 5EPMA 2JB5H 4JRYA 5I1KL 4HXAL 4OCXH 1U8MA 3QDAA 1EO8L 3RX8A 3QYCA 2YA1A 2JCCE 3LKSA 2AEPH 3A6BH 4S1DD 3IVKB 4OAWA 2A9ML 1T2QL 4IS6A 4HEPG 1EVTC 3P0VH 3QSKB 4RA0C 1E0OB 4YEFA 3ZE0F 1JK8A 1AE6H 1Q72L 5FCUH 4GAJL 1A1NA 4JPIA 3BN9D 3WO4B 2HTKD 3C2SA 4QOKE 2Z4QB 4UTAH 1TDQA 5I1IL 5CEZL 3NFPB 3QUKB 3WKMH 3O6ML 4ZQKA 4J1UB 4NC2B 1RUML 4HF5H 1TZHA 4WU7A 3T4AA 2BHUA 2EC8A 4ZO6A 3U7WH 2AXGA 3AAZA 4LHUB 4YBLC 2XZCH 1PBYA 4DCQA 4Y1AA 1UWEH 5I1JH 3NPSB 3QQ4A 4U1GB 5IG7A 1J0ZA 2CMRL 3V4UH 3RUGF 5KSAB 4XVTH 5GZND 3Q5YA 5EOCH 3ILPA 5BV7B 4P2QE 1BM3L 1V7NH 1NDMB 4Q58C 2NY5L 5KVEL 1UG9A 2VAJA 1JNLL 4HXBH 4LRIA 1YEHH 2H41A 4XC3H 3DXAA 4OV5B 3OAZK 4N0UA 4W6WB 1CXIA 2E9IA 3TBWB 1KEGL 1CL7L 4KJYB 3CFBA 3EOTH 1EHXA 4BH8B 5C0FA 2FX7L 5SX4H 1AQKH 1CFNB 1VGKA 3WNPA 2J8HA 2XTLA 4ZUUB 2DN7A 5FYKL 4PTTB 3KPSB 1QG3A 1VACB 2XN9A 4PRIB 1NEUA 3WKML 1H3WM 2YSSB 5D1QA 1G7MA 3X17A 3OZ9L 5D7JC 2E6PA 5GS1B 5C0AD 2P45B 4OD2B 3TC9A 3BYTA 4N5ED 1JGDB 3L5IA 3T4YB 4NHCH 4P48A 4BH7B 1KB9J 4XMPH 5CKAA 2C7UB 2JELH 2VL5A 3PDDA 4IIQA 1G1CA 2VZSA 5E9DD 5E8DL 1YNTB 5F96L 3UYPA 1NAKH 1C5DA 4P2RE 1H3TA 2OJEB 1EGJL 4TNWF 2XV6B 1GOHA 3TIDA 4PJ9C 4M7LL 5E03A 4JM2A 1A7PH 4MS8D 5D7KD 4R8WH 2JIXB 4LCYA 4Y5XC 1VERA 3FFCB 4CMHB 1YEJL 2NY2C 2J3SA 1H3XA 3VFNB 5CINL 3VFOB 4LVNC 3QIWA 4YBQD 3VG0L 3L3KB 3MLRL 1QEWB 4YXLH 5FM4A 1IJ9A 4H20L 4KROB 2XKUA 1IGCH 1IARB 5FF6B 3D2UB 4P4RB 1JNNH 1GC1H 4JFDE 1H5BC 5JHLL 1UB5A 2CK0H 5LXGL 4NZUL 3QHFH 3B8YA 1QLRB 1BF2A 1S78C 1KNOB 3C9NB 3QR2A 4JFZH 1S7QA 4A6YA 4KK9C 2NZ9D 2G75B 3SGKA 4UZGA 4HUVB 1YEHL 3EO0A 1ZANL 4R90H 5FYJL 5IV2A 3NBNA 1K8IA 2AABL 3LAFA 1DQMH 1VEPA 3T8XB 4XGZA 3REVA 4DZ8A 1FNFA 1FC1A 3DPBA 3HC4L 1MFEH 5KSVB 4U0RB 3FTGB 4JFXA 3KYAA 3GSOB 5EZIL 2NR6C 3TO4A 2VUYA 4JANB 4GG6A 2P5EA 2YD7A 3CZFA 3N50A 5TQ0H 1V5JA 2YXFA 1C16A 4MXVF 4FXKA 3T2NH 1MJUH 1H3GA 1R24B 4LCWB 2X4NA 3RKDD 1KJMA 4J3XA 1FFPA 5TPWL 4DGYL 3UTPE 3MV01 2GT9B 4PGCB 3OQ3B 3O2DL 1YMMB 3BO8A 3STZB 5J1AB 1ZEAL 4HWNA 5JUEH 4G8FA 4UTAL 3H9SB 4EIZC 5F9OL 2IQAB 1GCFA 1MIEH 1U0QA 4HG4J 1IM9D 3LPWA 4XRCA 3QCTL 5D7IA 5E5MB 5AWNH 3KXFA 2F5AL 2VABB 1QKZL 3GMOA 4LL9A 2XTJD 1QO3A 4JFOB 4N90E 3Q3GA 4I2XB 1XAUA 1K8DA 3LMJL 4PGBB 3OKKB 5GSRA 1HHKA 4F7MA 4P0DA 4L8SA 3B9KB 4G6ML 2CO7B 5HHOA 5F9DC 3UEZA 5D8JH 3OKNB 4AEIH 1LO3H 4EBQH 2VDLH 4H0IA 3V5KA 2ZG3A 4R96A 2PO6A 2X05A 2EDWA 5C0DB 3ARBD 1G7JA 3IDMB 3RWEA 2ZPKL 1RZJH 1BQUA 1A7QL 1EFXA 4KRNA 1TJHH 3NMEA 5F8RC 1UWGH 4XTRC 3BIBX 3BD4A 5A1AA 1MJ7H 4NO2A 4XNZB 3GJFH 1XF5A 4R2GB 5A2IH 4RCAA 4Z77B 2F54A 4WUUB 4JGUA 5F7DA 5FO9B 5J7CC 4IJ3C 4IDJL 4TUJA 5KSBE 1AXIB 2GJ6A 4GQPH 4LAJH 4OGXH 1AJ7L 1WWBX 3CIQA 4NQXB 1OSPH 4MA1C 4EI5C 1T2XA 1NSNL 4WO4D 1OAUL 2LAGB 1AGEB 2J6EL 3CXDH 3MOAH 3U2SB 1MCRA 4C56A 1FBIH 1CGTA 4AIOA 4G3YL 3QEUA 4U31A 3C09B 2PYED 3MUGA 3VDCA 1QRKA 4F2MA 4KI1A 2JK5A 4WY7H 5SX5K 1X4YA 4YIQA 3PHSA 3EO0B 1R6VA 1CDUA 3RZWA 5AD0B 1JYNA 3OB0K 2D31A 3VJ6B 2G60H 3HB3C 5I1HH 4ODWB 5K9QI 3FO0L 2WLYA 4LSQL 4ODSH 1P7HL 4X6CA 5BZWB 3RZCC 2GAZB 3QO1B 4YGAB 2Z91B 2I24N 4FN0A 2R56H 3BGFC 5K9OA 1HXMA 3ARBC 1CD1B 4GQ9H 2AK4D 3FFDB 2P5WE 4K94H 1LE5A 3CPLB 1JGVL 2EDHA 3DXAD 2G75A 1WTGT 1T5WB 3UC0L 1RY7B 1JF5A 1U8LB 3AS3A 1PFCA 2Z92A 4PYHA 5AG9A 3WMSA 3RU8L 1AKJA 3W0WE 1TQCC 4F15C 2DWEB 1I9RH 3GSNB 2XWBB 3QUXC 1D6EA 2UZIL 3VXUA 5IG7B 1FIGH 1XGUB 1EA9C 1B4RA 1BWMA 1F4HA 4HGWA 2V2TA 3OXSA 5TH2B 4DQOH 1BFSA 2Y72A 4HWEL 3B6SB 4OLUH 2DWDA 5HVHB 1UWEL 3KPLA 5I1JL 3EFFB 1DLHA 1Y6KR 2EIBA 3HMXA 4NGHH 3WUZA 3AM8C 1UM5H 2AJYH 1X7QB 5IBLD 1YMHA 4GRWB 3RTQD 5DA0B 5IMMA 2R2EA 1IAII 4WFHD 5DGQA 2IANE 5IT2L 4P4KA 2VXSH 3MACH 1IGFL 4OD1H 4RIRB 1IQDA 5HI3C 1N4XH 1NFIB 4Z7VF 3CXHJ 3O3BA 1F45A 2OL3H 4WW1B 2Q6WB 2XWTB 2W60A 3KYNB 3QB7C 4WHTA 3VFPA 4ZUVB 1JHKL 5DEGA 4R4ND 4WI4A 3KLDA 1Q0XH 4HT1L 1BD2A 3SGEI 5D1ZC 3BISA 4Z78B 5D96C 4NO0A 1I8IA 2AEWA 3WNNA 3IRPX 4HC1L 3GBLA 2D0HA 4PTUB 3U79A 1FHGA 4MD0B 1SEBB 3P4MB 4AQOA 3LDBB 1HYSC 1OAXH 2WIMA 4K07A 4Y4KB 3MOBH 1H5BB 4XMPL 4I48B 1HOCA 3N1FC 1NMAH 5HPMA 4OUOA 2VDRH 3ZDXE 4LP5A 1T2JA 2Y36L 4G8EA 4PY8J 4OLWH 1KN4H 1TQCB 1FYTA 1FVEB 2PNDA 1T20A 4JZJA 3WYRA 3MRPB 2OZ4A 3IS1X 2B1AH 4QTIL 4MA8L 5DZNA 1I7UB 1KLFA 2I60H 4OLZH 2XG5A 3UBXB 3WJJC 4TNWK 2GAZA 3QO1A 1MQ8A 4LF3A 4HUMB 3ZSSA 5CP3A 3EOTL 2UY7A 2VDPL 2X6MA 3PHOA 3QFJB 4GH7B 3S5LB 1BJMA 1YDPA 3NTCL 4TRPH 4UU9A 1INQB 4FQQA 5JR1L 3OKEA 3IFOB 1MUJA 4GBXA 1AGDB 4GRWH 3TT1L 5HI5D 3WCYA 4AMKH 4QXTB 5INDA 2OZ4H 1KYOK 1KPRA 3SBWC 4JHWH 2APXA 1EDQA 2MHAA 5BRZA 4PJFF 2NX5E 4Z7OE 2MNUA 2JIXA 3IU3B 4HZLB 1FPTL 3OAUH 2DJUA 3GHEL 1JPSL 4P99A 4EN3C 1R0AL 2B0SH 2RFXA 5D7IF 2VC2L 4KGJA 2X4QA 2DMCA 2H9GB 1MLBA 1V7MH 1RJLB 2WINB 2LU4A 1CZ8L 4TVPE 3NZHH 4NRZB 5EH1A 1D5IL 4GW4A 1NCAL 5IFAH 2IPKB 4LKCA 2HJLB 3VFMA 3MLWH 1ZGLP 3QI9A 2EH7L 3MFGB 1BBDH 2VH5L 1FNSL 2YA0A 3TZVB 4R4NC 2JCCF 4JQXC 4X4XB 4PJBB 3E1F1 1YQVL 2XPGB 3OGOE 4RFEB 2ZOLA 5MENB 3JV4A 5BV7C 3HPJA 5GRVK 5I19L 2EYRA 4UT9L 5GRUH 1RI8A 4NUJA 5I76B 4KUZL 5J11C 1A7NL 2EEAA 4OD3H 4FQJH 4QGTA 2EYTB 4LLYB 3TBYB 2V2XA 3BIKA 5IB1A 1FZMA 2HLAA 4QNPF 2Q8BH 1D6VL 1JBJA 2R23A 3TN0D 4P3DA 5D7LA 3FT2B 5IBTL 4Y16C 1B6DA 5GSRB 1YA5A 3RGVD 43CAA 1IM9A 3LQAC 2IQAA 1A6ZA 3HG1D 1P1ZB 2G60L 5DO2D 1G6VK 1JPFA 1EBPA 4AIZB 2ZJSH 1JPST 1L6XA 2RJMA 4RAVA 2OI9C 4APQC 3LKNB 2CDGB 5CZXD 4APQA 2M26A 3EYVA 2WWMD 1F4YL 1KJMB 2EZ0D 3LKRB 3NGBC 1HHJB 1MWAB 4HX1A 4TSBL 3SDCA 2R4RH 1LK2B 4U33A 1RK1B 1OAKL 4EOWL 4U6TA 3BD3A 2QQQA 1EMTH 5JW3H 1DLHB 2GY7B 3GRWA 1C8PA 4PJXB 1T5WA 3F7YB 2XT1B 3IDGB 3PQYD 5C6TH 3QUML 5DFVD 4UT9H 5C0CB 5D9SB 1AO7A 2UZXB 1E4XL 5LWYL 4PRIE 2OR9L 2MCPL 2AABH 35C8H 2J4WL 3AB0B 5HHME 5DT1H 3RL2B 3PG2A 3KPNA 1QQDA 5EIIA 2YRLA 3HI5L 5C0BB 1ADQA 1T20B 3K8MA 3QIUD 2I9TB 4OLZL 1CFBA 4KKCD 5I73B 2R1XB 1CLZH 4MCZB 5FKPB 5EZLB 1JFQL 3RAJH 1OW0A 3HUJA 5EG6C 5DJ0A 2XPGA 2QQKL 5KOMC 4RWHA 3GIZH 5JW5A 2DKSA 4K23L 1A64A 2IH3B 2R4RL 3DX8A 4PRDB 4XB7A 4EUPH 1L7TH 1LD9B 1UC6A 1QKZH 5DEGB 1MCKA 3KPLB 5CJBA 1A6VH 5CJ8A 1GYAA 1H9VA 5JXAH 3B2VL 2AJUL 3UTSA 4XHJC 4E41A 5MEOA 4PJDE 3QXAA 1MCNA 2Y4SA 4FS0A 4X6FB 5KSAD 2XWBA 1WT5C 4HMEA 4PJAF 5DDHB 1KT2A 3TLRA 3E6FA 2GJ6E 5H35B 3D85A 2B2XL 3OJMB 4YHLH 4L8SC 3S37L 4NWTL 2EDEA 3B6SA 3I6GA 5EUKB 3LDBC 1KIQA 4BKLB 1YJDL 3BIAX 2JCCB 3QHTC 3GI8L 3PGFH 4OZGB 4RQQB 5C0FB 4P2OC 4OLUL 4HWEH 1MLCA 4FZ8H 5DUPL 2WANA 1YEFL 4M93C 1KJ2A 3P11L 3CU1A 1MJ8H 4ODTH 4Y4KA 1JL8A 5BZWA 1FIGL 4EEEA 4HUXA 3RVXC 2D7OA 5KW9H 3G6DL 2DQGL 1T83C 3H3BC 2NY3C 3N1MC 4PB0H 5SWQA 3WFCL 2R69L 1AO7B 3SGDI 1OT2A 1LE5B 2NTFA 1BD2B 4LHUA 5DJDB 2LE9A 1ORSA 5JW4Q 1JF1B 3ZDYF 1T89C 5DD1L 3LN4A 1FFQA 1GGUA 1SQ2N 4GBXD 5IFAL 5E9DB 1LK2A 4PD4J 4OLEA 1U8NB 3O6FD 2H9GA 4JPKL 1PYWB 3CMOL 1QSEE 4G8IA 1QR1A 4JDZA 2W9EL 4PJGE 4BA8A 2ITCA 1PY9A 4XHJD 4QWWC 1MFEL 2X70A 4EN3D 1T4KA 4XVUD 1KJ3H 2QJDA 2BNUB 1A7PL 1KPRB 4Z7QE 3RZCD 4LPWA 4UINL 3PHQA 2N1KA 2NZ9C 4MJ4A 1N2RA 1NC4B 2X4TB 4ZS7H 4AMKL 1S7XB 1FFRA 4HIHA 5ALBL 1NFDE 4PP2A 3ELAT 3QRGH 2AV1A 5IW6B 4YHKL 4JY4A 4KY1H 3O3DA 3TNMA 1B9ZA 4D0BA 1G7MB 4TUKL 4AM0A 1S7QB 4YBQC 2DQDL 2AAVA 5IMKA 4DVRH 1TETH 3VD9A 3WNMA 5GGSB 3E2HC 5GJTL 5L2KB 1RUAH 4BH8A 4HDIA 1SYSB 4JHZA 5CGYC 4IBLT 1CDBA 4JFPB 3GKWL 1EEQA 2NX5A 4GUPA 4EVNA 4D9RD 4GMSH 3KPMA 2FL5A 3PWPA 1DEEB 1U8IA 4MD4B 1HIMH 4KUCF 4X4ME 2D0FA 1ZWIB 4TVSa 1K85A 4QHNA 2ESVA 3BD5A 2Y07H 5A2KH 4X7TB 2ICES 2QLVB 3VFMB 1UACH 1IEBB 4HJJH 3WFBL 1MSPA 4NM8L 1DCLA 3IAGC 2ZPKH 1MF2H 3F7QA 3AU1A 4RFNB 4TQEL 1DBJL 2CDFA 1MELA 3SEPA 3EYQD 1EJ6A 4FQ2L 1JZ6A 1G9NC 1NCBH 3EOBB 2V2WB 4JPKH 2IBZX 4XNUH 1J1OH 4KV5E 1E28B 1CD8A 3VXNA 2DQHH 3MACL 3NFPA 3T0EA 3NCYS 5HI4C 4OCYH 2VISA 5JOFB 2XTJB 4GT7A 2B4CH 4M61B 5IEKA 4HJ0D 2F5AH 1DANT 4PJXF 1NBYA 1UH3A 3BP5B 1Z3GL 4TVPL 3MO1B 5IBLC 4UT6H 5BS0A 2COQA 3LEVL 4TPRL 3ORJA 4G8FB 2YD5A 3GM8A 4XMKL 2IMNA 1OP3K 3BT2H 1M4KA 1QBML 4F9LC 4X6CE 2CD0A 2ITCB 2GYSA 5I0DA 3ARBB 4WV1B 4DGIH 5GS2H 3A67L 3D0VA 2VLRB 1PLGL 4ZS6D 1G0DA 1W72B 3CCHA 4H0GA 2OTPA 1EVUA 1G7IA 3PGFL 1F90H 2AW2A 1QD0A 4L5FL 3U7WL 1KUMA 4R2GD 1S9VA 2IBZY 2KL6A 4Y1AB 3BWAB 3BN9C 5GISL 3V52L 5F9WB 3OGCA 5FGSA 5MEQB 4RBPK 4HH9B 3WN5A 5I73C 4DZBA 4NNYB 2XIDA 3OG6B 3BP7B 2FLRT 4F57L 3U7AA 4R90L 5C9JA 1RIHH 3S36H 2D7NA 4Y4HB 3RUGE 4UDUA 1I8LC 3P0VL 3FL7A 1S7XA 1S7SA 4HQQH 3JUZA 5CD5C 1NMBH 4E5XB 1XR8A 1A21A 2E8YA 5CUSH 1I9JH 4KRMB 2ENYA 2CUIA 5LWYH 1A7OL 4NPYA 4KZEH 4XPBH 1AHWC 1ITCA 3SE4A 3JUYA 4PJIF 3R8BB 3QFDB 5B3JE 7FABH 2XWJB 2FR4A 2QQKH 5A43C 1WLHA 3ESUF 3DYMA 3GSXB 4KKCC 3SDYL 3OPZH 3REWA 5FKAA 4LDEB 3MUJA 1JE6A 4LSVH 5C7XH 4NQCE 2VTFA 4GAGL 2NY2D 4B5EA 5HI5C 1Q9LB 2IC2A 3I50H 4Z77A 4XXDA 5IGXH 3TT1H 4WDIB 2BX5A 1DJSA 4WFGE 1M1SA 3C60D 3RBSA 1J11A 1XGRA 2AK4B 4G9DA 5HY9B 2IPUG 3Q1SH 1CXKA 4YHMH 2E9BA 3PGDB 2ZCKH 5TGBA 4K9EL 1U8LA 4MB4A 3OKOB 2P5EB 3CZFB 1O7VA 4U0RC 4F57H 3QNXB 3W9EB 2F53A 4X7EC 2NW3B 2VIRB 4I18B 1SMAA 2W1NA 2P8MB 3EOAB 4QXWA 1QBLL 1TFHA 3CVHB 1NGWB 1S9WB 3T8XA 3TZVC 3V6OE 4ISVB 2WWMC 2OMBA 4PJCF 4F7TA 3T65B 4EIGB 4H26B 4CVXA 1FDLL 1G6RL 1G9NL 4Q0XH 4LASL 1KENH 1BJ1H 2IBGA 2FWOA 4QGYA 4BSVB 4YDKH 4YAQA 5I8KL 2DMBA 1RIUH 2Z31A 1ORQB 1CDYA 3HC3H 3VGAC 4PJ9A 3QDJE 2QADB 5TF1L 4ZUTA 5JW4R 2FJFA 1WAAA 4MGXA 5B8CC 4V1DB 3FT4B 1S3KH 1EO5A 2YK1L 3GM0A 2P7TA 5EOQH 2X1XR 4OCYL 1S9YA 4X4YA 3BP5A 4TSAH 3ARVA 4PY7B 5FHAH 4HS3A 3MYZA 4ZSOE 3G08B 1CVRA 5I8EB 3FAXA 4QRUA 1Q9WA 3V4VL 4D0DA 4AL8H 1XFPA 1KELL 1KIRB 4W4NA 2CLRA 5E6IB 2R2BA 3G6DH 3K4DA 4WEUD 3FQRA 3TA3C 3OR7B 2ICWB 4WGVB 2CLZB 4QHNB 2DI7A 2O61A 3DHMA 2SEBA 4YBLB 1QSEA 3K4AA 5TDOB 1AXSB 1EZVX 2CMRH 3HC0A 1KLUA 3V4UL 3CLEH 2BVQA 1H0DB 3JWDL 4KUCD 3QFJD 5AEAA 3FFCD 5GS1C 3SPVB 4Z6AT 5F1SA 2R29H 4XC1H 3W9DA 1UJTA 5IQ7H 1BMGA 1D9KB 2UYLA 4WNQB 1JHTB 4KVCL 3IYLW 3U0PA 5CKGA 5C0EB 1ZK9A 1OF2A 3BZEA 1G7IB 2XICA 4LOUC 4Z0BH 4NUGH 2X41A 5C0AA 43C9A 4AQ1B 3W2DL 2WAHA 4O5LH 1D5BA 1INDL 1FL6A 3CU7A 4P9HC 1MIML 1MQKH 2ZUWA 5FHBL 5DSCB 5KS9F 3IXAA 4X6BB 1JYWA 4CNIB 2Y1VA 3CDCA 3G6JA 15C8L 5GS0C 4ZUVA 3GNMH 2EKSA 4OKDA 2R1WB 3K2UL 3D3VB 4OCXL 3SDAB 3SO3C 3ZKXB 2W65B 3BH9A 3OPZL 3D25B 4LHJB 2EICA 4XX1G 2I9LA 3NH7H 3RA7H 1PKQE 2UUDK 4EKXA 1RJZA 4KU1A 1I75A 1OSZA 1QSFD 1AKJB 1AHWB 4X5WA 2EH8L 2DBJA 2XZQH 2VLKA 3WLBA 2PTTA 4PS4H 1KPVA 2C3XA 1PKQB 4CVUA 1ZLVK 5MP6H 4BYHA 4LEXH 4CVXB 3QUXA 4HH9A 5ILTH 2V2TB 4HIXL 2DIAA 3DUSB 2D7TL 3SJVD 2EIZA 3HCVB 4EUPA 5IMLA 5D1ZD 3DYPA 4EJ1C 3P4LA 3ULSA 2RGSA 1F4AA 3ULVE 4TTDD 1NBQA 5IGXL 4R97C 2VR9A 3DO3A 4L8BB 4YWGH 2HKFH 3RWGB 5DQDL 5KSAA 3RNQA 1LEIB 2AJXL 2H8PA 3ILQC 3QG6B 5IWLA 1XGPB 1OAQL 5L8LB 1CBVH 2KDGA 4G8EB 4Y7MA 5DK2A 4KQ3L 4EOWH 3RGVC 2VKWA 3FFDA 3WDJA 1JGLH 3VFPB 1U58B 5DQ9B 3F5WA 5E99L 4MZ3A 5DJYB 5C2UB 4ZS6C 1D3CA 4Y16D 2W0FA 3P4OB 3Q6FB 1Z6JT 4TSAL 2ED7A 3QULB 4AY0A 2Z8RA 1WBZA 4EXKA 4HX1B 2FJGA 3ARGC 1KG0B 1A1NB 5TF1H 1WICA 3BT2L 2DIJA 2FECL 5EA0L 1UJ3B 4PLOB 4DUVA 2VDQL 5GZOD 2FDBP 3ME0A 5L2KE 1RJYA 2HRPL 3RY6C 1CE6B 1ZOXA 3ZYJA 2XQBL 4MXWL 3QI9C 2P48B 3MJ7B 5DSCA 5IEKB 1NDGA 1HHHA 3UP1A 1XIWB 3TESA 3RNKA 1KTKE 3MROA 4M7ZB 5D72L 4PJ5E 3QEQE 5BRZD 1HK6A 2FJFB 4Z0XA 5C0BD 3K81A 4MAYD 5K59F 3EDFA 3MYJA 2DTMH 4QY8A 1U91A 3E2HB 1IBGH 5AZEH 3LH2L 4UOJA 2MPAH 5CEYA 5EO1B 5GGVH 1JVKA 4AJ0A 4OZIE 2P5WD 2OP4H 4JKPH 3W5NA 4WFED 1XEDA 5LGJA 4PLJC 5KZCB 4M7JL 4KH2A 3GSNH 1A3RL 2DLFH 5CGYD 5K9JL 1N6QH 4Z76B 2VXTH 5ADOH 1SJVA 1T21B 1IEAB 4WEBH 1LO0L 4R0LA 1JPTL 3ULSB 4PJEE 4NJAL 1H8NA 1TJIL 2VLJA 4LLWA 4L3ED 5FA4A 4XZUB 4ZFOB 5DJCB 1LO3L 4EBQL 5CBAA 4Y88A 3QIWB 3VW3H 2D3VA 3W9EA 3QWRD 2AXGB 3AAZB 5I15H 5EU4B 2W0LA 3LY6A 4H88H 3HR5A 4QOKA 2A9NL 1GH7A 2W59A 3RGHA 3SY0A 3F12A 4Q9RH 1BF8A 1UJ3C 2IAMA 4QHKI 3SDCD 2BY2A 4I0PD 3TN0A 1XGRB 4V2CB 3TPUB 1I9IL 1QYGH 5GJSH 1I4FB 1FL5A 2YC1A 3V5HA 2EIDA 2YUZA 3MV8D 5F1OB 2QQNL 2V7HB 1E4XI 2BHZA 5AUMB 3V2AR 3C5ZA 4IMKA 3D9AH 2VLME 3L95A 5T1KA 3VRLF 5JORA 4JG0H 3QRFM 4S1RH 2DQFB 4HUWA 4M6OH 4ZFGL 2H45A 5I74C 4YHZL 1H3VA 4X6DE 3FQUA 3WDHA 3QUMA 4JG1H 2Y36H 3HZMB 3SE8L 3RWFA 4GRLA 4F7TB 3HE6D 5E8NA 1UM5L 4OZHB 3QEHA 4UNUA 1OF2B 4RGNB 4WUUE 4H8WC 5I76A 1VFAA 5C0EA 4NHUA 1W8NA 1MHCB 1ED3B 4PG9B 1AR1C 1ONQB 3H6JA 5GRUL 1DN0B 3I2CH 1IC4L 4P57A 5DEFA 4ZS7L 1OT1A 1HXYB 4UV4H 1MI5A 1RZFL 4O2CA 1W0VB 5TQ2H 3CFIC 3DX7A 4RMSA 2UUDH 4OIBA 5GS3A 1YYMH 4UILH 4ZXBD 4X0KA 4ZOEA 3BZDA 3NCEB 3MBXH 3PWUB 2AXJA 4FNLL 5DRXB 1PVHA 5J6HA 3SDXE 4IRJB 4KFZC 2I9LB 4NKIH 2J8OA 4JDVA 2FGWH 4LLUA 1G0YR 2W65A 2QSTA 5MP6L 1Y18A 4NO3B 2NY4D 2F5BH 5IUSA 1I85A 4ENED 5F7LB 1YN6A 5FYLL 4JG0L 4OZFG 5BS0E 4RFOL 1MCHA 2FJHA 4K3EL 3HI6L 2IJ0C 4LK4A 4ZO9A 4CMHC 4NQVA 1FRGL 1NL0H 4MQSB 4GAJH 4YPGA 3MLPA 4KPHH 5GRJH 4PB0L 3E0GA 4JFFD 2VXUL 3MJ9L 3C8HA 3MRLB 2BVPB 2XZZA 5HGDB 1DUZB 2YD4A 3L5WB 3X11B 5FKPA 3A6BL 3MRQA 3I50L 3TH3T 1SJXA 4I5BB 2A1WL 3HA0A 5DI8A 4Z95L 4YHPA 1U3JA 4NZUH 3VFSA 3W11C 2DQJH 2BFVL 1GC1L 4JDZB 5DYOA 2E5EA 1ZWIA 2KQMA 3S37H 3QIWC 4LSTL 3GSOA 2ITDB 4E41D 1A6UH 1TTGA 2D2OA 2C5DC 5CBAB 2FB4L 3QPQC 1NCNA 4ACPA 5GQBA 3OAZH 1CL7I 2ZSWA 2ADFH 1A5FH 4I9WD 4MD5A 2VWEE 1NBVL 1F6AB 3RIAK 5SWZE 4MNQD 1IGTB 1F4XL 1KEGH 4I9WE 2DM7A 4JHBA 4LCIH 4XPHL 5DT1L 3IDNB 5KS9E 1JRHI 4OF6A 1DLFH 4M3JA 1J1PL 5MEND 4F9PA 1XF3A 2B8OT 3LB6C 1AQDA 4LGRB 5DFVC 5CIPH 5C0IB 2ZCLL 3ARTA 3D69B 2CXGA 2FX8H 1A6UL 3VW3L 2W9EH 5J9PA 1YY8A 2IQ9H 3VXSA 5IJVB 1AFVH 1J8HE 5F7HA 4OLYH 5B8CB 1M6OA 1CLZL 3QZWG 1LO0H 5JDSB 4WTWA 1E28A 2GQHA 4ONFH 1TLKA 3GIVB 3LQAH 3DX8B 1DUYB 4XRCB 5JA9A 4YO0B 2XN9E 1P7KB 5BQ7B 3AS2A 4P4KB 5CZVL 1U42A 1RJCA 4RDQF 5I66A 2Y23A 5C0AE 1LDPL 5J11B 1WVZA 1A3LL 5GZNC 5F7NC 4U1LA 1RQ5A 1XGQA 1NPUA 2R15A 1RU9H 2BNRE 3UXFA 2P44B 5IVXB 2ADGA 1FIEA 3QG6A 2DKUA 3QFJE 5DUPH 1A4JA 1YECL 4PJHE 3FZUD 4JHAL 2H32B 1SY6L 1ZLWH 3RFZC 2BOBB 1L7IH 5IBUB 4HUNB 4MA7L 2KZWA 3EJJX 3MRFB 2J88H 3TCLB 1HXYA 4RQQA 3ZE1E 2A0LD 3KXFE 3Q6GH 1HWGB 1HZHL 1K4CB 3OWEA 2HRPH 3MBEA 5I1GH 4ZSOB 1OY3B 3IDYB 1DQML 4RGNC 2XOTA 5IKCA 5EU6D 3D9AL 3BZFB 5T3ZE 2BNRD 4OZHA 1T66C 5IQ9A 1RK0B 4CW1B 2F8XC 5GRVL 5D96B 4PTUA 3BDBA 3QUZA 4JO4L 5JHLH 4ODVL 3TF7C 3CVHH 1NEZG 4U0QB 4UI2A 1CE6A 2VXVH 3DETC 2A6DA 3MCG1 1A8JH 2DQHL 4GAGH 5B3JF 5TE7L 4XAKE 3LHPL 4PBXA 4NKMA 5EBLA 3ZO0A 3IFPA 4JFQB 4BSWA 2YD1A 4F7EA 2RIKA 2OXHA 4KDVA 2FLBT 3QXUA 3RWDB 3U0WH 4M61A 5JHDE 3H0TA 4YDVB 4P46C 3TVMD 4LSUH 3MRGB 1Y6MR 1ZXQA 1MHHB 4PBWD 5D5MF 3RPIA 4ZFOL 3GK8L 3L5XL 3L1OH 5CFHA 1AGFB 3F58H 5MEQA 2YRZA 1MFBL 2UVFA 5IWLC 5DK0B 3U1SL 3EKCA 1VHPA 1HHGB 3UJJH 2XQYK 4MXVE 2GIYA 2MQ0A 3RWIA 2C4FT 1KN2H 5C0ND 4NSKB 4FFWC 5IVNA 2O93L 1JPTH 4RMTA 4CU8A 3GJFA 2GFBA 2OX5A 4KQ4L 5DZOA 1A1OA 1JPSH 1ZVHA 2G2RA 3HKFA 1S9VB 3QDME 5HYEA 2FEDD 2W60B 1TPXC 2FD6H 3SCMC 4MVBC 4K7FB 5TE4H 5JMRA 1F3JA 4O2EA 2HT4D 4GRLB 1PQZA 3LQZB 3PE9A 3EGSB 4I8DA 5M94B 2VLRA 1YNLH 4WI6A 4J2XA 4DK6A 1AGCB 4O58L 5BRZE 5J06A 1QLEH 4CKVX 2R0ZH 5ECJE 3QCUH 5IVZB 2BXYA 3MMEB 4Z0BL 4EXPX 4M9PA 1KIRA 4KKLC 3MRHB 5DA4A 4NPYB 1P4LB 5EFIB 1F2XK 5E6ID 1MUJB 4GBXB 3QJFA 4TULL 2AKRB 2JLLA 4DKDC 2IADA 3VRJB 2B2XH 4XP1L 4WENB 1DE4A 3U7YH 5A3ID 2J2ZA 2QQLH 1QFUL 4PY7A 3GSXA 4GAFB 4AK1A 1A0QL 3NACH 1DVFA 2EDLA 4XPTL 3VFRA 5IHUL 1VFBB 2CR6A 3TFKC 4KXZI 4EN3B 5A2FA 3T77A 1K5NA 1M7IA 2AQ1A 4OM1H 1FSKB 2XKSA 2ZKHH 3DSNA 4N1HB 2WQ8A 3DV4A 2XZAL 3M07A 4LBEA 5FM5M 4S1SL 2BSSA 3BPCA 5IW3A 2H3NA 4TNVK 1KLUB 5E8PA 4QNPE 3HMWL 3ALXA 2NY5C 4NCC2 3IGAA 4F33A 1HHIA 4OGYH 4AH2A 5GIRA 1WEJH 4FP8L 4A2MA 1F6AA 4LSRH 4GRLC 4D9QD 1KXTB 4Q9BA 4QRSB 1S3KL 1KULA 4PIRF 2Q7YA 2XNAA 1HOCB 4LCYB 4MLIA 2DQDH 1R0AH 5ACLA 3VWJD 1G7QB 5E8OA 4QHKJ 3OAUL 4UDTA 2AP2A 4DKEH 1KV3A 3REWB 4IMKC 5FYLE 4HHAA 5DTFB 4R26H 4AG4L 4OGZA 5ITFB 1G7PA 3KYKH 2GUOB 3MBED 2FYYA 5ID1A 5HTSA 3A6CH 3R1GH 1TZIB 4YXKH 1X5FA 3FB7B 5KN5B 5D4QA 4F37K 2VZ1A 1U8MB 5KVGL 1CTOA 2EC9U 3T1FA 3O4LE 3WEXB 3LEYH 2AV7A 3ZDYE 5HVFB 5KS9A 1TVDA 4XP4L 3C6LB 5I1DA 5FB8B 1AO7E 1W72H 3MXVH 3CX5K 3FT2A 1BQLL 4D8PA 3X3GL 2A6KA 3PWVB 4JZOA 2K1MA 3BQUC 2XQBH 2JB6A 2IFGA 5J9PB 5LVEA 4JO4H 3WS6C 3RY5A 4BQCA 1R3HA 4XCNA 4MJ2A 2DDQL 4L4TD 1Q8MA 1WIUA 4M6AA 4JCLA 2P47B 5ISZB 1UM4L 1LWRA 4Y16B 4AZ8A 3T2QA 3ZE2F 3QNYA 4K71C 4X8JA 5KW9L 3TJHC 3AS1A 1L0QA 3LKPB 3QNXA 5CP3H 4K7PL 2VLJE 3CDYA 1RULH 4WU5B 1X4ZA 5DJ2B 4QRQA 3ULUL 5A3IC 1DDHB 1BGXL 4LLDB 4POUB 4V1DE 4OM0L 5D72H 3VA6A 3DMMC 5BW7C 4PRHA 1BIIB 4Y1AD 1Y0LA 2YEZB 1BFOA 3EO1A 5EU5B 1PLGH 2ICWA 1DBKH 5TDNA 3UMTA 1K8DB 5DURB 4ALAH 3ROLA 1PAMA 5D93C 1CGWA 2OSLA 2QL1A 4NQSB 1TZHB 2FRGP 3FRPA 4YFEA 3MROB 4PB9H 1P7QB 5B39A 5I8EA 3UTSE 3OBAA 5I9QB 3U9PL 1PYWA 2HAZA 4S11A 2CIIB 1MCPH 3N85H 1EHLH 4GS7B 1IKNA 2IGFH 3UTSD 1G7QA 1KC5L 1SJEB 2CGRL 3S36X 4LAQL 3UJIL 3F62A 1JUFB 2JJUA 4JN2B 1Z9OA 2NMSA 1S9KC 2HLFD 1KACB 5DD5L 5SWZB 1R5IB 2QHRL 1R5WB 4FQXA 3JTTB 4Y5YA 1ZA3B 4UQ2B 4WWKD 2HRLA 4OD3L 3SO3B 3SN6N 3I3EA 4NYLA 3VRLE 3ZKND 1CBVL 1GC1C 5KZCD 3M8OL 1RULL 3KPNB 5FGBA 1TTUA 5EZOL 3PQYA 4ODSL 4FQ1L 1I1RA 5H2BB 4XMKH 3WIHL 3QDMD 3SGEH 5C0CA 4G42B 5GGVY 3TIEA 1NCCL 4GKNB 1K5NB 2P5ED 5ILTL 4M4PA 2BJMH 3NIGE 3L3GA 1FNAA 3OKLB 1JRHL 4DKFH 3DJ9A 4M00A 3KPRE 3RWGA 4HUXB 5JPNA 1V3MA 1J0JA 5IW6A 3WFEH 4KK8D 3KNBA 3VXPB 3SDCB 1J05B 2G9HA 4QOKD 5FA3A 4H5SA 2X1PA 5CSZB 5F1IA 1L6ZA 4EDWL 4WHCA 5IQ7L 2IADB 5F7YC 5T33L 3QWOB 4R6UA 4PJGA 3L5JA 1YZZA 2OLDA 3D3VA 4Q6IA 3SDAA 4MQ7B 3KPPA 4Z7QF 4F7CA 3DETD 1QPXA 2HWZH 5LCVH 5IHBA 1IZJA 2C3WA 1AJ7H 3UYRL 3GNML 2Z0BA 3C8DA 4CMMA 1A7OH 5FYJU 4OUUA 2PYEE 3BP6B 1WJ3A 4PJ8C 4LHUG 5CBEB 5AZ2L 5EWIH 4OFIA 1MIMH 1I8MB 2AKRA 4DKEL 1VFMA 4K7FA 3G5XB 3U0WL 2UWEA 2CO6B 2EKSB 3PHQB 5HGBB 1U58A 2OL3L 4PJEB 3SOBL 3U2SA 5HDBE 4LMQI 1UXSA 5B39B 1FV1B 4NBXB 3T0AA 4UAOC 1IC7H 1HZHH 3QDGE 1XF1A 1DQQA 3CDFA 4LGPB 4EDXB 4OZFH 2VL4A 5I1LA 2CIKB 3D2UA 1J8HB 5IFJB 4M8QA 4PRHD 5IBUG 4S0SD 4Z9KB 5ESQB 1A47A 1KCVH 1U91B 5HJ3B 3WIHH 4ZUSB 2NTFB 1J0YA 4FMKA 4PV8B 4GSDH 3MV8A 3IKKA 4JVWA 4QHUA 3LV3B 1UWXH 2R39A 4ONGH 1TMCB 2Z35B 2C3VB 3X13B 1VFBA 2L4OA 3U83A 4O2FB 5FV1L 1IE5A 1IM3B 2AV1B 3PJSA 4LASH 5C3LD 5C2BH 1PX3A 3TPKA 1HSAA 1RZ7L 4Y5VB 1WZ1L 4FQLH 5FOBA 5FYKH 5GRXG 3O11B 1BBJA 2APFA 4XH2A 3MO1A 4JFFA 4DGVH 4S1RL 1NFDA 2ADJA 4YGVB 5ENWB 1H8OA 3VFRB 1ZHBB 4IRSC 1P4IH 1FFNB 5INCA 3NPZB 3OMZA 3ULVF 4MB3A 1NCTA 1UCTA 1TZGH 3PUCA 4O02L 1UACL 5E2UL 1PGRB 2BNRA 4YH6A 4FTVD 3MC0A 3VFVA 2ARWA 2VLJB 3K4ZA 4PJHA 3AB0C 4XBPA 3D3VD 4P9MH 3SDAD 4HKZA 4G3YH 3BOVA 4YUEL 5HPMB 1WQVT 4BFBD 4H5SB 4QTHA 3E3QE 4Q9CA 1I1AA 2OK0H 3GBNL 1Z0NA 3RKPA 5J13B 1CIDA 4ZFFB 4FQXD 1K4DB 4HWBA 2A6JA 1MF2L 3BMWA 4XNZC 3KJ4C 3CSGA 4KK5D 4WWID 1DQLL 3KPSE 2VDRL 4QY8B 1FYTD 4M7JH 2QSCH 2DQEH 2R8SL 1NCWL 4GKZA 2ZCKL 3MV9D 4WW2A 3QDMA 3SJVB 5JXAL 2CSPA 5AYQA 1RD6A 2A1WH 4HDIB 4I48A 1E4KA 1FNGA 2Z91A 5KSBF 1I3RB 3WHXA 1O0VA 3E8UL 5JZ7D 3HG1A 4LLQA 1KPUA 3LD8B 2ITDA 3E3QC 3MUZ1 3O4LD 4P3WA 4G6FD 3S3JA 1I7ZB 3FQUB 5ETUB 1GGBH 4NFBA 4I18C 5GSVA 1IVLA 4GRWF 1TZIA 5I75B 3IAPA 3Q5OA 4MSWA 1WWCA 3FONB 2VZTA 3FN9A 4ENEC 5F1KC 1JN6B 3VFWA 2H2PD 3GSWA 4NDMB 1SY6H 3L7FB 3WLWD 1CR9H 3ZHKA 3DRTA 3ARDA 1FLTX 3QQ9D 2HG5A 1GZPA 1WITA 1CT8A 1X5XA 3CFJB 3GSNL 5K9JH 2FGWL 3CDGA 3MLSH 4DGIL 3U4EA 4K3DH 4HSQA 4NNPH 1X5KA 2GSIB 4JRYD 3DIFB 4X4YB 5ADPL 2Q20A 3CFKB 3DURA 1HQ4B 4WCYL 3IU3A 1FNEA 1Y0LB 2YEZA 3GDBA 1YY9D 5D70H 1U8JA 5D1ZA 3IRZA 1S5IL 4J3SA 1TJHL 2NY5H 5KVEH 4M8VA 3UTOA 3DUUB 2DM2A 1S7UB 4OFPA 2NY3B 1LGVA 5IR1A 3P0YL 4CW1A 1OGTA 1A6TB 4ERSL 5IOPA 3BKYH 1WC7B 3UTZB 2HLAB 2KQNA 1A7NH 1Q1JL 3FRUA 3MRPA 4MAYB 4LVHB 5BVPL 1T5XB 2F58H 4QO1A 5FGCB 1ZT4B 3GMRA 1ZLWK 4KK6D 1M7DA 2LAAA 3WJJA 4IOSD 4Y2DB 3UROR 1CQYA 5LGKA 2VE6B 2VKXA 5HPOA 4XXDB 1JP5A 3L5HA 2CIKA 1MNUL 5DMGD 4P5MB 1R3LA 2BY0A 4F9LA 4F15B 4TPRH 4JPWH 5DFWH 3VH8A 4BQ9A 3RUGB 3RY4A 2X1OA 2ESVE 1OB1B 4ZDHA 2CDGA 3BESR 2AEPL 2O5ZL 4JRXB 3AMLA 4R7DB 2C3HA 1J1XL 4L3EB 1U6AL 2VLMD 3TVMA 1RK1A 2D9QB 3BAEH 3DVGB 1AY1H 2XFXB 4ZAKC 3RVTD 1RJLA 4RIRA 4MJ6A 3MJ9A 1VACA 1J7VR 4CJ0A 2FX8L 4PGEB 3RWDA 3M1BA 1J05A 2G9HB 5FA3B 3KLHC 5E4EC 1P84J 1E27B 1GHFH 1ODAA 1PDKA 4OGXL 1DQJB 1N0LA 3O3EA 2R23B 4CL7A 1WBXB 4P5TC 3LV3A 4F9PC 3CZJA 4U1HB 3DXAE 3MV8B 1UVQB 1K4CA 5MENE 2Z31B 3QHFL 5A16B 4NN5C 5C09D 3VXRB 4CU6A 2AK4E 4M48H 1LP9F 4JGJA 4KC3B 1I7ZA 4WI9A 4ZNEA 4MAYC 3HRZB 2GTWA 1IBGL 1OWWA 3CSPA 4U05A 2I60L 5F7KC 2CKBL 3MV9E 3VXRE 4BQ8A 1RZJL 2LVCA 4GRLD 1TJIH 1T03H 3KPRD 4D9LH 1JNJA 4PP1C 5I75C 3SKUD 1QLFA 1LO5A 3T2PA 3SJVA 3QWRA 1JI1A 1MHEA 2HLFC 1ZGLB 4CVWA 3U6RB 1Q9OA 3ULUC 4MD5B 1FORL 1KIPB 1L9NA 1OHQA 1KCKA 3U46B 4LQ1A 1M71B 5MERB 1JWMB 3F58L 1FGNH 2LU3A 2ZOLB 1K4DA 3G6JF 1GGYA 1GGCH 3HLAA 3CFKA 2OCFD 4YHNB 3BGMA 4KKNA 3PQYE 1T7ZA 4P23D 3GBML 5C07E 2ERJC 5EIVA 5HHQB 4U6XA 2BY3A 3TO4D 1R24A 4LCWA 4KZDH 3HMXL 4KJPC 1TXKA 3AXLA 3NPSC 4NQEB 3QI9B 1AGBB 1Q0YH 4PJGF 1F02I 4NZRL 4Z18A 1B0RA 1UXWA 3QHZL 1RZGB 4MWFB 5IVXE 1ES0B 3RIFK 5HDOA 4P2YA 2IEPA 4LSRL 3QAZC 5GSVB 1DBBH 3BXNB 4LAQH 1TVHB 2VXVL 3TO2B 3M17B 1NMCB 4JO3H 2LU7A 3ARGB 5IQ9B 5C2BL 4X5XA 5T3ZD 3KHQA 4WI2A 1VEOA 1SYVA 1ZE3C 3SQOH 4YFLF 2A77L 2Q7NA 4J7RA 2APBA 3VXSD 2XY2A 1M7DB 4JFFB 1XCTB 5EC2A 2G2RB 4X98A 2XQYG 3N1QC 3LN5A 3G5ZB 5FF6A 3MRNB 3MXWH 5FYJH 3VXOA 2R0LH 3SKMB 1WC7A 1I3VA 3GSRA 2HT2D 4YQXH 1D9KA 2LQRA 2UYLB 4WNQA 5GRZA 3MRCB 5DRWA 3VMOA 25C8L 4DAGH 3R0NA 4MAYA 4XAWL 3C9NA 1KNOA 1Q94A 2X4RA 4NC0B 3MLVH 2A73A 4R7NB 4JG1L 4GO6B 4X6EB 3SE9H 3WDIA 1N6UA 4WO4A 1PKOA 2FEEL 1NCDL 1H3UA 3HC0B 3S98A 3FKUS 2W0PA 4BZ2H 4UV7H 2PXYA 1KXQE 5DD6B 1N8ZA 4K7PY 2Z9TA 3FO2A 4MNGE 1Q9WB 2VC2H 1UA6L 4U6HA 3ES6B 5IHZB 2ZUUA 4JQIH 4G8GB 2CLRB 3I6GB 5EUKA 3L3DB 5C08E 4O58H 5D7IE 4LSSL 1A6AB 2FIRT 2YD6A 5CZVH 4JRXA 1PG7X 4HWBL 4FQIL 3G6AB 3TYFB 4KKAC 1U3HC 3H0TB 4OI7A 3RU8H 3OV6A 3W0WA 1AIFB 3O45B 3ZYIA 1U8HB 1UEYA 3GFUA 4DEPC 4PS4L 2AJSL 3FB6B 1VB9A 4MJ6B 3CSYB 2O5YL 4YHNA 1C7SA 4ZAKD 2WM0A 3NH7L 4PJ5A 5D2NB 1MHPL 1CLCA 3LEXA 4QCIA 2ZUTA 1IEBA 2A74A 1S7VA 3ZTJH 3EO9L 3LHPH 1C16B 4X9GA 4NZDA 1F4WH 5FYLD 2FJGB 4UOW1 4PG2C 5JPMB 2DS4A 1WBZB 1U8NA 1ZMYA 4G80A 4H25B 4HWBH 4L8BA 3TNNB 2HFFB 1SBBA 3HRZA 5DMGC 4PFEA 4Z7WE 4OZ4A 4R0LB 1JNHA 3MV7E 4OTXL 5AAWA 1YQ2A 1A5FL 4ZFFA 1G9MH 3WS3B 4BFGA 3MA9L 2WIIA 5E70A 3JV6A 3D39E 3VXME 4IRZL 4NO0D 1WEJL 4LSTH 5J0BA 2J6EH 5T5FL 2NX5B 3UPRB 1CFTA 4XB8A 1B90A 2RB8A 1IL1A 1JGLL 5ICZB 2E7MA 1II4E 4OF5A 2VXSL 1EUTA 4RISH 3MODH 4HG4K 4Y8DC 1F58H 3ULVC 2QSQA 4J23A 4JB9L 4XCCH 2VZOA 4BZ1H 1DQJA 1FNEB 5F3BA 3RDTD 2B1HH 1S9XA 1P7QA 2ESVD 3BE1L 1FFOA 2H32H 4EI5A 2EE9A 3BUYB 3RX7A 3HLAB 3H9SA 4YDIL 5ID1B 2AI0L 3MLSL 4Z7NE 1NGXA 1HNGA 5LBSH 5EU6E 2GUOA 1W8OA 3EYFA 2Q7YB 1TNNA 5GGRY 3O9WA 4Y19B 4XNUL 1NC2A 3GRWL 1AFVL 3TYFA 1DVFD 1MHEB 4FFWD 1PY4A 4K94L 5HYIA 5J8OA 4C54A 2R0ZL 3SDDC 4M6MH 3AREB 4GAYA 5CS7A 1NGYA 3SGDH 2ZNXA 3ES6A 3SKMA 2D7MA 4UNTA 4KXZH 4PRNB 5AWNL 5T1KD 4XPGH 5IW1B 3GUTA 1PD6A 1YNKH 1BFVL 3JTSA 2HH0H 1YEIL 2A73B 1ZEAH 2L0DA 2DM3A 4HIXH 3UO1H 1PW3A 1RUQL 2Y06L 2W9DL 4OZIB 3I6LE 5K9KB 3SDDB 5F8QC 5F21B 1UENA 1AI1H 2DJSA 5AG8A 4N0CC 2WUCH 4YHZH 4FG6C 4YNYA 1I1AD 1T1WA 5DUMH 3IKCA 4M43H 1J0KA 5HHOB 4HLZG 3BW9A 4LRIC 1OGAD 1FLRL 1HINL 4HBCH 3HUJF 3MRMB 4HWZB 4RX4D 1LEGB 2QBWA 4QRPA 4R8WL 3H7BB 1KGCE 4ZUWB 1DUZA 2DYPD 3L6FA 4OGAD 3W0WB 3AXLB 5HVWA 5D2LB 1IGYB 3L3IA 4LPUA 5D6DA 5EU3A 3TGXA 1YDPB 3C8KB 1I7RA 4MB5A 4HQQL 5E8DH 2OTUA 2GSGB 4YFDB 4YFLI 3IDJA 4WUUA 2M8XA 5E08L 3O6LH 2MQCA 3ZE0E 1S8DA 3MOAL 4PRHB 5DRXA 5J6HB 1IGCL 5GXBB 3PL6D 5E5UB 2R0KL 1IFHL 2VITA 5DWUL 4HUUA 4CAGA 2NY4C 4JDVB 4ELME 3HZYB 2RBLA 5E94B 4F3FB 5ANMB 2Y06H 2Q3ZA 3QEQA 1A4JB 2OP4L 4JKPL 5C0RL 3O8XB 3T3PE 3TBYA 1TJGL 3CPLA 3EUUA 4NCC1 3DVFA 4UV4L 1WSST 4G6AC 5EBGA 5T3XH 1KCSL 2MMXA 4KROD 2DTML 1GZQA 1AR1D 5D5ME 4FTVE 4N68A 2X4OA 4XVTL 4RFEA 5JXED 1ZA3A 2J88L 3D18B 4MA7H 2Z4QA 2YBRA 3DVNA 5JNYB 5EUOA 4G6MH 5DYOB 2VN4A 4PJAA 4XXCA 4LU5L 1S7VB 5IFHH 4NT6A 4PJEA 3HNVH 1U8KB 3TBTA 2BOCB 2CUMA 3KPPB 3MRLA 2PYFA 2ZG2A 4HK0A 3VWJB 5D1QC 2GY5A 2HFGL 3MREA 5I8KH 5CZKA 5F9OH 3BP6A 5DFTA 4O9HL 1OVZA 4B53A 5IB5B 5C6PB 2VOTA 2FJHB 3I2CL 4NP4H 5I9QC 4Z7WB 2DD8L 4JQVC 2XI9A 4PRAA 2V2XB 3BIKB 4LVHC 5IB1B 4QXTA 1HIML 1FYTB 1YMMD 5C0RH 5DQJA 1OW0C 3IFLL 5D6CA 1HEZA 3SE8H 4RRPA 1OAUH 3ULUH 4H20H 1CFTB 4LLQB 3EDEA 1RSFA 4NM8H 2WLZA 4XMLL 4WI3A 4H26A 3VD3A 4LLYA 1XR9B 4MA3A 1ZHLA 4JKWA 3B9KD 5EOCJ 2WNGA 3VFOA 5M95B 3H7LA 1JIBA 1VADA 1MREH 2VZUA 3B8SA 4UIMA 3WUWA 1L0XA 2AJVL 2YMXH 4DW2H 1CR9L 4HMCA 2HN7A 3U9UB 1RZ8B 4L4VE 1T0NA 3ZHDA 4AIXA 5C7XL 4WI8A 3M8OH 4HV8A 4J3VA 1N64L 3MNVB 3BQUB 3ROOA 4HUUB 5T3ZH 1IKNC 3DLQR 3O6FC 3K1DA 4NQCD 2EDBA 1EEUA 3LEXB 3RVVD 4WW2F 2G5BA 3UTTB 4OCLC 4MQ7A 4UT7H 3LOWA 3IU4H 3G08A 3VXQB 2OTUB 3RBGA 5EO0B 4JLRA 5EUOB 3CDGB 1IILE 3PHOB 3QFJA 2NY3D 1OM3H 3KPQA 2ADIA 4PGZA 2FATH 1P7QD 2JELL 4HIEB 4JREC 4HEME 4BM7A 5CGMA 5IB2B 3IDNA 4KPHL 1FE8H 3H7BA 3EIFA 4QHLA 3ZYZA 3OX8A 3O2VL 4MCZA 4LSPL 1JNLH 1VDGA 3DNKA 1BBJB 3O2DH 4P2OD 5CP7B 5DJ0B 4XNYL 5C0IA 3T0DA 3SDXB 4Y2DA 4OZFA 3GMQB 3MRDB 1UGNA 2WP3T 4FQXC 4Y5YC 4G8GE 3EOAA 3UPRA 2HFFA 4OZHE 4HCRL 1A1MA 1T0MB 2HKHL 4XAWH 4JO2H 2R2CA 1KBGH 4N0CD 5IKCB 1JZ3A 3N06B 1RMFL 1WV7T 4U3HA 5E8PB 4S1SH 1BEYH 1NC2B 1D9KC 4HIIA 4UBDD 3FN0H 1KCSH 4HAFA 2CKBB 5DHXB 5EU6A 5HDLA 5ITBL 3RPIB 2Z31C 1S5IH 4DKAA 2XTJE 3MRGA 4OCSL 4ZO8A 3SGJA 3BVNB 5IB5A 3CFDA 4MLSA 1U36A 1WK0A 1UT9A 3E6FB 4Z7WA 5B22A 1OP3H 3DGGB 4XVSL 5KVMC 5IVXA 1T2QH 3WIIH 3HNVL 4B7IA 2F74B 4FXKB 4OZGF 3QUKA 3T3ME 2R1WA 4ONFL 4LSDA 3O9WB 4QHMB 2Z93A 1NDGB 2IBBA 4ETYA 3B5HA 3C6LC 5MEOB 4CUCA 2IPTH 1I3UA 2C7UA 4KUZH 4M5YH 5JNYA 3G04A 4HKJA 3NCBB 3TH4T 43CAB 4YNYB 4YHOH 1JHLH 1CXLA 3ZKMD 1J1PH 4CJ1A 4G6AD 1J12A 3KYOB 1FAIH 3C5JB 4JFHD 5F44A 1OCWL 1K2DB 3C2AH 3QULA 5CJXA 3PP4H 3JTSB 5DUBA 3B5TA 4GW1A 1TVBB 5EBWB 3UYRH 2X4OB 3GSUA 3NVQA 2AK1L 4P59H 4DOHB 5LGHH 1NKOA 4XGZB 3REVB 4LEXL 1MRCL 2VDNH 4XCNB 4JFEA 1T21A 5ANMA 2EDFA 5TJWK 1XGPA 5DUML 3KPSD 4XNQB 3FQXA 1DBML 1S5HA 1EFXB 3F6IA 1H15B 2X89A 4WEBL 1UB5B 3ULVH 4U1JA 3QI9D 1VCAA 4JY5H 2VITB 4PJDA 5I1AA 2VLLA 1CL7H 1LP9E 1JMXA 4X4MA 3TJEL 1BVLA 1WWWX 2EDRA 5CIPB 5BV7L 3C5ZD 4MNQA 5AZ2H 4MQXC 4ELMF 2WBJB 2CJUH 3LKQA 3UTQB 3EBAA 1VFOA 4O51B 3TA3D 1BX2B 2PXYD 2AXFB 1D5XB 4X7FC 1T22B 1JHLL 4GG8B 2VISB 3S88L 1PZ5B 4WUKL 3U4BL 1SYVB 1YEDA 3ARGD 4Y2DC 2E6QA 2JIXD 3RUGA 5HYSG 1ZT7A 1T04B 5C08D 3MRKB 2H26B 4N8CL 1FYHB 3D25A 3TN0C 1QFWL 3BKJL 1P9MC 4LLVB 3VXQA 3P9MB 4NNXB 1CXHA 5F1NB 4KMLB 2F54B 3U7YL 4KI5F 1OP9A 5IBTH 1XF5B 5KVFL 5DVLA 1GOGA 1JWSA 4Y4FC 4I3SL 3BQUA 3ROOB 5JQHC 5L2JA 4XCYB 4YQXL 1LO5B 4I3GA 4XPFH 2HVKA 3B2VH 3EGSA 4TTDC 4HC1H 3FQTB 3TT3H 5E2TL 4NQDE 5I16B 3IJYA 4MNHB 1M71A 5MERA 1MLCB 4MQTB 4DZ8B 1Z5LB 3RRQA 1R3HB 2FEDC 2PTVA 4XWGL 5EB9A 4PD4K 1F6LL 3RWHB 3VRIA 4OQTA 1H3PH 4G8GD 2VNCA 3ZKNC 3RIFF 4WWKC 3RL1A 3OX8B 4JVPA 2YD2A 4AM0B 1KT2B 3TZVD 1I8IB 4E42B 4FQJL 4G42A 2Q3AA 3DMMA 4YIQB 3KXFB 7CGTA 4HF5L 4FQXB 3EDDA 4Y5YB 3FAWA 5BCAA 5J1SC 4LCWD 3O6MH 1HE7A 3G9AB 5EO1A 1KN2L 1ZVYA 1DQDH 2GJ6D 3ARXA 4JLRB 3MRNA 2EXYD 5A16A 3IF1B 3O2VH 2YWZA 4JRYE 4YDJA 2CPCA 4ELKB 3VE0A 3VGEA 5C3TA 3EYUL 3TN0B 1UJ3A 4C58B 5ADPH 2UZIH 4ELMB 3JWNC 3MLWL 3VFUA 4DN4H 1QA9B 3VH8G 4P46D 3TVMC 1R5IA 1ZTXH 2X89D 4LOUD 5DHYA 1BQLH 4PUBH 2ILLA 3O6KL 3PWPD 1A14H 5FECB 1G6RH 1G9NH 1CZ8H 1TTFA 3QCVL 4HCRA 4JQVA 5LCVL 3OKMB 1G9EA 4HK0B 5I71C 4OM0H 2CDFB 4L4VD 2FCBA 1XGUA 2R0WH 1GJIA 3QDJA 1EEYA 3HZKA 1OD7A 5I17A 1OAKH 4BFIA 3OXSB 5TH2A 4PJAE 4Z76A 3KGRA 2YMXL 4EUPG 4Z7UF 4PR5B 2OSLB 4PJFB 4S2SB 5J3HD 1X5AA 5CJQL 5FIEA 3CFCH 4UQ3B 4POZC 2DDQH 5C0CE 1DN0A 2ICEB 4PRPB 4GMSL 2UZYB 2EDJA 3VXOB 4Q7DA 2OM5A 1KIPA 3OSKA 3S8WA 5F7FA 4MZ2A 3PQYB 3OGCB 5BMFH 3LSOB 2YPLD 4JY6A 5H2BA 1GHFL 2A0LC 3C5JA 1HSBB 4N0FB 2QEJA 1HCFX 4LLMA 3CXDL 2VIRA 3IJYB 1R5WA 1FH5L 3QNYB 1S7TA 5JTWA 4X4XA 3BPLC 1G7HB 1KXVC 5GGQL 4UAOB 4IOIB 4NYLB 1U6AH 3EDKA 1VESA 5SV3A 2ICWJ 3S3SA 4EZMA 4WTZA 4PUBL 2PYEB 4IDJH 3QEUB 1ES0A 4XCEA 3FT4A 4ESKA 2Y7QB 1UWXK 3HI1A 5KAQF 1ZLSL 1LQSR 5CGTA 3DO7A 4Y19D 1BQHA 3GMNB 3SKNB 1I1FB 1O7SA 3EYUH 4XH2B 5IB2A 6FABL 1FO0L 2F74A 4K3JH 4P5TD 4XPFL 1KELH 3H3PH 4ETQA 1N26A 4WI5A 4EI6A 3MFFA 3WIFA 4FZEL 1WAAE 2EEBA 4FABL 2CRZA 3RVWC 3FN0L 2WBJA 1X5IA 1IM3A 1JZ4A 3DOSA 3B9EA 4Z7VB 4DGVL 5KVFH 1BZ9B 1N5YH 1D5XA 4RMRA 4RDQG 2H1PL 2GKIA 4LLDA 1CLOH 1AD0A 4JAMB 3BWUC 1UH2A 4U1JB 3DXAB 4HS8L 5HJ3A 5HYJA 3EYQC 5IVOA 4ODXA 2WBJC 4GG6E 1Q0YL 2R0LL 5T3XD 2NYYC 5EBMA 3U48A 4Y4HA 1F00I 3LB6D 2VR4A 3GMMA 4KZDL 4RWYH 5DGRA 1WIOA 1JZ7A 3P4MA 4NKDB 1I1AB 5I1LB 5ITBH 1E4WH 1QBMH 3GMQA 1A3LH 1NQBA 4P5KA 5B4MD 1FNHA 2X4SA 1R3IL 2Z31D 2HJLA 1MJJB 1XGYL 1JNHB 4KDTA 3S34L 4KK6C 3JVGC 2DYPB 2UWEB 3MNWB 1LK3L 2AEQL 5D2NC 4LRNH 5I16A 1I8LA 1D5IH 1NLDL 3OKMA 2F53B 1BZQK 4ONHB 3KPRB 1MWAA 1HHJA 2XN9D 3HHRB 3MLRH 3CLFL 4Q6YA 2EXWD 2OJEA 3LS5H 5EU7C 3BKCH 1AO7D 5J6GA 3IFPB 2Y25A 1OQOA 5HGHA 3RDTA 3VGAB 2Y5EA 1M6OB 1RUPH 3F7YA 1FE8L 4CBPA 4OBRA 4GW4B 4WHYH 4PJ5B 4QT5B 5DVNA 3S35H 3VFVB 1ZAGA 2N56A 3ZT7A 1EZVY 5IROA 2PUQT 5C92A 1SBSL 4R3SA 3QWOA 3MRRB 1QYGL 4KTEL 5FYKE 1N0XH 1KGCD 1KCLA 2DL9A 2H26A 5F96H 1GIGL 1I7RB 3IU4L 4L29A 4KMTL 4A6YH 1I85C 4MA1B 4EI5B 3WXVL 4XVUC 5KSVA 1VGKB 4J12A 4Y4KD 5T1LA 5EBLB 5FYJE 3VE0B 3P4NB 3UDWC 1YEEL 4PJ9B 2FZ3B 3U4AA 1FZJA 3OKEB 2BNQB 3ZTNH 3O11A 1I9EA 5CCKH 4HUVA 1HDMB 4PJXE 4OLVL 3I9GL 3BPOC 1EAPA 4PRBB 2VJXA 1HCVA 4C56D 1F2QA 1V3JA 5C0JA 4GMTH 3FQNA 1X5YA 2VYRE 5IM7A 2BVQB 2NW3A 1YEGH 1NGYB 5JIHA 5F9JA 5JPMA 5J4MA 5GHWL 1IGTA 3WFCH 4MDJB 5DJ6A 2PF6A 4ISVA 3LH2H 3RVXD 3HNSH 4BKLA 5B21A 3DX6B 4RGOH 4RNRB 5C0BE 3U36B 4GXUN 2IPKA 1BM3H 1V7NL 1U8JB 5EZOH 1WFOA 5IFJA 4ODBD 5AAMA 5KANG 3HE7D 1MRDL 4UQ3A 3LCYA 5BVPH 3BN3B 1P4IL 1S7WA 1WZLA 4NBYB 5HI4D 4F3FA 2C9AA 3LD8C 3MREB 3OZ9H 3CMOH 1K6QH 1UZ8A 1R3KA 2NNAB 1DQQB 4RAUB 1EAJA 4P46A 5DDHA 4U6VH 1NEZB 4GLRI 1AD0B 4JAMA 2ENSA 3OKYA 5ANME 4BFIB 5B8CA 1AQKL 1BQHB 3GMNA 5I17B 1CGSH 4JPVL 3IJSA 3RHWF 4TULH 1BX2A 2GCYA 1XGTA 3SDAC 3CVHL 4WVRA 3STBA 4P9HH 3MOQA 5F9AC 5ACZB 1KCRH 4OF3A 1QRNE 1DL7L 3VU2A 4XC3L 3MGTA 3MRKA 4BH7A 3C8KA 4E9LA 2FO4A 5GS0H 4JCMA 3UJTH 3TBSA 1OTUD 5ESAB 2YPKB 3VD4A 1NANH 4NQXA 1KB5H 2D03H 1BJ1J 3B43A 3MODL 2BY1A 1KEML 4QRPD 4R0LC 2I25N 4WRLA 4ZTOH 4ZOCA 4UDTB 1PQZB 1JHTA 3GJFK 3LQZA 3RWHA 3VRIB 2RQ8A 2JJTC 4H88L 1F11B 2KBGA 4PGDA 4XNXH 4U1MA 4HS8H 4F7PA 1NJ9A 1MCCA 1HSAB 3QIBC 2EDXA 2X9YA 2J8UE 1WISA 5CMAA 2YD3A 3VGGA 4OZGE 1DBJH 2VQTA 2FECI 3SDDA 5I19H 4N8VA 2HKFL 3OR6B 2YWYA 1KB5A 4X6DA 2VZVA 1NH6A 3I3BA 2Y07L 1G7JB 1NUFA 1PSKH 4D9RE 1EUUA 1Y6NR 3V9FA 2VH5H 2R2BB 4U3CA 2AV7B 3WD5L 4LVNB 4HFUL 2CK0L 3MJ7A 1MJ7L 3DARA 5L2KA 1N7MH 1CD0A 3GHBH 1W0WA 1BD2E 3QIBA 5D9SA 1SJHB 4YX2L 5KSBA 1YMMA 3BO8B 3ARUA 3LQAL 4TOYH 1FFPB 4PJHF 3NFNB 4L4JA 5F7WC 5EU3B 4PJ7F 5BZDA 5E8EB 1YC7A 1T1XB 5BJTB 2NX5D 2E27L 2YUWA 1E27A 1YEEH 2RR3A 1BLNB 2R0WL 1OAYH 4G6KL 5DMIH 5JHDD 4U6XB 1CU4L 5BOZG 3T1FB 3MJ8A 4GG6B 1AXTL 3V4PL 4X80L 4NT6B 3T0EC 2ZSVA 3VFTB 4TSBH 3NA9L 1NC4A 4P2OA 5CZXC 3LN4B 2DOCA 2CRIA 5D7SH 5TFSL 3QH3A 5CILL 3U46A 3OXRA 5JZ7C 5E2UH 1DDHA 4K8RL 3RDTB 5HGHB 4WJ5A 5GS0L 2YUXA 1A9EB 1QVOA 3BMVA 1T0NB 1YN7B 4K9EC 3DVNB 1NL0L 3MRBA 1N6VA 4JZNB 3QIUB 5M7QA 5JUEL 2HFEB 4MJIE 1FG2A 3VI3F 1E4XH 4KK5C 5HDQL 1NC2D 2AJZA 3FQNB 3HPLA 3C60B 3ZT5A 2CK2A 5FUZL 4NO2B 4XP9H 5DRNB 2FX9L 3O41A 4X99B 5IV2B 1ZT4A 4L5FH 4I4WB 1YYLL 4QKXB 3GI9H 2EDOA 2V5RA 1MCBA 1M7IB 3QUMB 1W2KT 5FDWB 5HHVH 5LGJB 3LMJH 2XKNB 5F7UA 3QEQB 3K8KA 3L7EB 2KUTA 3O3DB 3TNMB 2M1KA 1F42A 3ZL4L 4DUWA 5E5MA 2NLJA 1BFTA 4KJWC 4PRBA 1D5ZB 1A9BB 1XT5A 3AVEA 3N85L 4OM1L 1CXEA 3O8XC 4V2BA 3MV11 5GGSA 1DL7H 2PTUA 4M6ML 4WGWB 1CYGA 2YA2A 32C2B 2MSPA 3KAAA 4J3WA 3WIFB 5DRZB 3C6SA 3CX5J 1U8QB 3KR3L 4UV7L 5GRWA 3SDDD 4NFCA 2IANA 4MJ5A 4HV8B 2EDDA 5BW7A 1IGFH 3SKOA 5A2JH 5H37G 4XPAH 1A6AA 5HHQA 1N5YL 3M1BB 5IT2H 1FVDA 1BQSA 4M6OL 4ZFGH 4IRJC 4OFKA 1Q9KB 4P5TA 5CEZH 5CINH 2IQ9L 4O00A 3CFEB 2FH6A 4UOW0 3Q6FA 5IROC 2BOCA 1FJ1B 1UXWB 3S5LA 5L88H 4J4PD 3ABZA 2DKMA 4V1DD 3W0WD 4C55A 3KVQA 2VB5A 5IEHB 4BZ1L 3SGKC 3R0MA 3MR9A 5BMFL 3V7AE 1VENA 3MLTA 1ZANH 4MD4A 4D3CH 2YPLE 5EOTB 4M1GH 1MCDA 2HFTA 4OSUH 5ID0B 1W0WB 3IDXL 1BD2D 2H3NB 1ONQA 3ULVD 2J8UF 4XZUA 2X44D 5CJQH 5CIPA 4CDHA 3W2DH 1RUPL 4OZFB 4MMXC 2MKLC 1H5BA 4F37F 3G5ZA 3I02A 4XP9L 3U6RA 1ZT1A 4F7MB 3ARPA 5FCSH 5FAAA 3FJTA 4QRQB 4D9LL 4ZPVB 4NJ9L 3TA3B 3BKJH 1KN4L 3LEYL 5DVOA 3UYOD 4WV1A 4TVPD 1CLYH 4I0KA 1MH5A 1CD9B 3HE7A 2BFVH 4GXUM 5SWZA 4E41E 2CXKA 1U8OA 5C08B 4FOMA 3D5OF 1LHZA 4U2ZA 4WY7L 4JM4H 4RA3A 1GIGH 1Q9LA 2JJWA 1JK8B 1NC4D 3QO0A 3CSYA 2F54D 3HAEH 2FHBA 3MJ9H 5F7EH 1WCBA 2RCSL 5FDYA 4X9BA 2FHFA 1ZV5A 2V5TA 3DGGA 1RZ8A 5E5RB 5JW3L 3CJJA 5B38A 4LPCA 4OF7A 4AEHH 5CEZE 5T5NF 5DJCA 5L2KD 2VDNL 2VXTL 4LHQB 5ADOL 4ZMAT 2BSRA 1LO2H 4LCWE 4CVZB 5SWSE 1CQKA 2BMKA 5BJTA 4ODVH 4U7SA 5HYJE 4NUJB 4Y0GA 5I1EH 2EDQA 4E0RA 4KKBC 4XWGH 1H15A 3KPOB 3BEVA 4PJ7B 1AQDB 1U8IB 4GRMB 5CD3A 4PBVC 3KXFD 1AKJD 5BXFA 4K8RC 5E24E 4MDIA 4KMQA 3TWCL 3AFLA 3ARRA 4JB9H 4RRPG 5DRNA 3TZVA 1IC4H 4YHOL 1OP5H 5EULV 3MA7B 2DLGA 4JM2C 3TIEB 2VDLL 4S1QL 1Z9SA 3MNZA 2A6IA 3K2MC 3KWWB 1MY5A 1NGPH 4X6CB 1ZLVH 4Y4HC 3BAEL 5E6IA 2DQUL 1B88A 1J8HA 2VR5A 4ZQKB 3MLYH 2FX9H 5F88B 4XPAL 1U3ZA 1KTLB 1QSVA 1QSEB 5TDOA 5H8DA 5L9DH 5CWSB 3OHXB 5J1TC 3I6KB 4NFDA 1SM3L 3HB3D 4WFHE 5ACZA 12E8H 4LSPH 2VAAA 4F80A