2BOBA

Potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bobA02
1CICA 3MRHA 3V0WL 3S88H 3OZ9H 1CR9L 2YXMA 4Q9BA 1Y6KR 4O2CB 5KW9H 1EFQA 1V7NH 1T5XA 3N85H 1EFXB 4ALAH 2HT4C 3DOSA 4ZPTA 1XCQB 1JPGA 8FABA 2NY5L 3GSWB 1J86A 4QOKA 5BS0A 1I3UA 5IHBA 1VKXB 1RUKL 4KI1A 1ZHNA 3C5SA 3D2UB 5HVGB 2X10A 1JYNA 2YPVH 1QFPA 2FJHB 3BW9A 1UFUA 1A1OB 5IR1B 1EEQA 3CCHA 3BIAX 4L9LC 4HC1L 2A73A 1JRHH 5DQ9A 5DYOB 2Z8SA 4D0BB 1U91B 1MFCH 2Z91B 3C8KB 3OAUH 4WO4B 5FA3A 1LMKA 1MCOL 5EU7C 4G6KL 3UC0L 4WCYL 1QNZL 2PO6A 2BHUA 5DRWB 1K5NB 4PY7B 1TJIH 2G75B 4YX2L 5FGSA 2B0SH 4PB9L 3AC0A 3E6HA 5HHPA 1YQVH 3V6OC 2E9JA 1KCSL 4LLAA 5ERWA 4HFUL 1RHFA 4OBSA 1JPTH 4C83A 3HMXH 5DMYA 3F7PC 2ZCLH 2FX8H 4X5LA 4YFLI 4U1JB 1L9MA 4ONGH 5KOVC 2HLFC 1T2JA 5GZNC 1HOCB 3MRLA 4XB7A 4QXUH 4X7EC 3V6FB 4ZOEA 4M3KB 1EHLH 4KRNA 4GRWB 1LP9A 5F1IA 2X4TB 5JIKA 1RZIB 4FZ8H 1KJ2H 1IC5L 3ZYIA 2VQ1B 2DLTA 1F2QA 4U3HA 4PY8J 3M45A 5AZ2H 1K85A 2WUCL 4IDJL 4MWFA 5H8DA 2EECA 1I9RL 2VTFA 4WW2C 4LCUA 4DW2L 5ITBL 2BNRD 4PREA 1MUJA 1PG7H 3MBED 3OKOA 1H9VA 1AIFA 3SE4C 1KB5B 4OLZH 3D69A 2GIYA 4XTRD 1OTSC 1HKLH 3GHBH 1NFDF 1A6VH 4LSQL 4RDQG 5CEXB 3EJYC 4N1HB 1CDYA 1L7IL 4YDVB 3BQUA 5C86A 4EUPB 4UT7L 1QSFB 4G5ZL 4FP8L 3OKDA 5DJYA 3AAZB 3BN9D 2D7OA 3CLEL 4D0DB 5FFLA 1N5YH 1MJ8L 5FF6A 2IQAA 5E00A 1OQXA 1U8HB 5IVZB 5I76A 5IV2B 5ID1A 1XZ0B 3LEXB 2CIIA 2GAZA 4XCEA 1WC7B 4NQSA 1CD0A 3QNYA 1JNLH 2LU4A 5EA0H 1MIEL 5IM7B 2BVPA 5MEPA 1DDHA 1MWAA 2ESVA 4KVCL 5D8JH 4HIJB 4WWKC 1W0WA 2DBLL 3I6LE 1SY6H 3UAJC 3TPKA 2AJUL 3VRJA 1PDKA 2IBZX 1UEMA 5A2FA 3NABH 2CUMA 3QIUB 1U6AH 5I30L 1OW0A 1S9VB 4Q7DA 4HAFA 2M8XA 4AIOA 2UVFA 4LF3A 2HFGH 1DANU 3IDUA 1UCTA 5CP3H 2I25N 4YHOL 1MREH 4KDWA 3S5LA 4HJJL 4HZAA 3U9UA 3KPRD 2A83B 2N56A 3V4PH 3MLUL 5GS0C 1Q9KA 5GRZA 4D9LH 4RWYH 4QXGL 3WE6A 3BAEH 5JW4M 2AAVA 4G9DB 3QUYC 4FMKA 5I18H 5LCVH 4DVRH 4NM4H 2GQHA 4QF1A 1HZHH 2D4FA 2AJSH 4UDUA 3VXRD 4QHUA 1YNTA 3NIFF 4AYFA 3S37X 2DYPD 4LCWD 1NCAH 3TLRA 5L88L 1J9CT 3PWNB 2NY6B 3C5ZC 1B4JH 4LVNC 4D3CL 2HH0H 3HG1A 2X1WL 1HQRB 1JPSH 5MERB 2DQFA 4GQPH 2WM0A 1SBSH 2WBJA 4JPVH 3GI9H 5EZOH 4C59B 4N0RA 4Z78A 1N5AB 2EO9A 4R2GC 4PRBA 4X7TB 2VWEC 3SOBL 3E8UH 4LSVL 1W8NA 1MAML 4JJHA 4LVOB 1MJUH 4HULB 1XH3A 2A0LC 2NY3D 5IVXB 4F2MB 1CLOH 4QWWC 2YPLE 1CXIA 4OCYL 2B7DT 4NQDB 2BSTB 5EFIA 4D9RE 5HYQB 4HPYL 2R29H 2YD4A 3MPCA 4JY4B 3DO3A 1DVFC 4HS8H 2P5EB 3KS0J 3OKKB 4KK9C 5EBLA 5C0FB 5KVDL 2NZIA 4R4BA 3VRLE 3TF7C 3U0WH 2DL9A 1Q0XL 3GO1H 3V5KB 4MAYD 3IF1A 1QHOA 1NC4D 3QUZD 4LHUA 1J18A 4JM2A 2YWZA 4X4XB 1SYVB 4P46D 4QTHA 4OD2A 1F3RB 1G7HB 1Z3GH 2YKLL 1NUGA 1Q0YH 2IPKA 4NNXA 2NNAA 3L3GA 5ACZB 4JZNB 1JCKA 4Q9RH 1BJ1J 2CRYA 4K7PL 2IADB 3GSQB 2QSCH 5C0CD 3WHE1 4WI4A 4YHMH 1CG9B 2ITDB 3ULSA 1J12A 1HSBA 2VAAA 2K9UA 3CU7A 4EI5A 1N3NA 4UZGA 3ULUH 3I02A 3ZHKA 1PJ9A 3CVIL 3S4SA 2AI0L 5KS9B 4CL7A 1U3HB 2N7AA 3UO1L 2ZPKL 1G9MH 2DQGL 2R1YB 4X98B 3TBVA 3FO0H 3SGJA 1AJ7H 3ZE1F 1MLBA 3KPNA 3VWKC 3QIBA 5GSRA 3O4LD 3H3PL 4K3HA 4PJXA 4NQVB 3W2DL 1MI5A 3GBNL 4JZOA 4IS6B 3KYOB 2A6DB 4QRUB 3VXUD 3WL9A 1AGCA 3DURB 5IMKA 3I6GA 3DUSA 5KOMC 4HWBH 1S7RB 2PYEA 3ECBB 1U8IB 4PV9B 3CDGA 1CDUA 3IDGB 1N0XH 3W81A 3SDDB 1V3MA 1KIRB 2F74A 4GH7B 4EI5C 1ED3A 1JGUH 1HWHB 2FYYB 3JZ7A 3RUGF 5T1LD 1FBIH 5ACLA 5CEYB 5FV1L 4HWEL 2BXYA 43CAB 5MENB 3EO9L 1H15A 2DQEL 4AEFA 3NPSC 4PJBB 3RZCC 5D6CA 2ZG2A 1L0XA 3SGJC 2O26U 3X14B 4DUVA 3QIBC 3WIFB 4HJGA 4RAUB 2VDOL 2X89D 3DXAD 4DQOL 3KGRA 1M4KA 2JKXA 4HWNA 1JWMB 5EU5B 5I1EH 3BD4A 3BMWA 4N0YH 2AJ3B 3MV7B 2ZNXA 2F8XC 3EDFA 4H25A 2FL5A 4OJFH 3VXMD 1IC7H 3C60D 3DV4A 4GRMB 1OP3H 1QRND 1Q94A 4PJFA 4XPAL 2HT3D 3A6BL 4GKNB 1TCRA 4FABL 4TTDD 3FRPA 3P0VL 4JQIL 3T2PA 2EYSA 4NO3B 5FCSH 3CXHJ 4RSVA 4X9GA 4MQ7A 1FGNH 4R7DB 1FDLL 3QI9C 1FO0L 4F7EB 5C07B 2JF1A 3D25A 3QUZC 2ZUSA 1RIVH 5HHVH 1G7MB 3EFDL 4HLZG 5ELIA 3GMOB 4NUGL 2HAZA 1JRHI 4K3JL 1S5HA 3F7RA 4EUPG 3MRIB 3LZFH 3QHZL 5K93A 2CIKB 1Q1JL 1YJDL 2BNUB 2MTPA 3HUJA 5DMJB 4YDIH 3O0RL 5EO1A 1OD7A 3LCYA 2QSVA 4YHPA 3IDJA 4J3SA 2BSSB 4R97C 5JXED 3R0NA 25C8H 3F7YA 4ZFOB 1N6UA 1FHGA 1K4DB 4P2QB 4TSBH 5J13C 5FYKE 5T5NF 1IGJB 1QFWH 4PJGB 1MFDL 5D7JA 5I15L 4LCCB 1NAKL 1J5OL 1YPZB 3GBML 5HDQL 3LQMA 1CVSC 4GS7C 4NKIH 2GYSA 3RX7A 3ALXA 3ZKMC 1D9KB 3MFFA 3O3UN 4OCRH 4ZUVA 1ES0B 3NACL 4KKBD 5B39B 1MHPH 1R5IA 2AEWA 3W0WE 2A6IB 1D6VH 2AK4B 4HMDA 2ZUTA 1VFMA 4G3YH 1R3LB 1A6AA 4CW1A 4PP2A 4GXVL 4XP4H 1IAKB 1S5IH 4U6XA 7FABH 3VG0L 5I8CB 4F57L 4RQQA 5DC9B 5D1ZA 3WN5C 1YEHL 4RISH 5DHYB 4HCRL 1S78D 1KLGB 3T0EA 5HY9A 2PETA 4XNQA 3MJ9L 1LWRA 1OAXH 5CMAA 1RZ8A 4YO0A 4ZO7A 4V2BA 1CXEA 4MA7H 1SEQL 1HYSC 1TQCC 2OZ4H 3F5WA 3BZEB 3FOLB 4LLUA 1NDMA 4TQEH 4Z7VA 5I1LB 5JOFA 1P69B 5ADOH 1NDGA 4HT1H 2YD8A 4Z7QF 5D7JC 4B7LA 4EIZC 2YR3A 1Y0LB 2BNQB 1ZSDB 2DF3A 3QPXH 4RBPH 4MXQC 5IMLA 5C0JA 2DLGA 1EO5A 4PGZA 1T66D 3FB5A 2MQ0A 2R1XB 5DZOA 2Q86B 5FGBA 3N1QC 5IF0B 5JDJA 4PBVC 5T3ZE 2VN4A 5DRXA 1XEDA 2NY4B 3QO1B 1U8KB 1AFVH 3T2NH 1L7TL 1PZ5A 5FA4A 5D1ZC 1WLHA 1T2QH 5D5ME 3GDBA 2WZPD 4MD5B 2CK0L 1EEUA 1KT2B 1GAFH 3MRDA 3T0EC 5EU4A 3WFZA 4M6MH 4G8FA 4P23B 1HXYA 5EU6B 3A67L 4G43B 4UU9B 4EOWL 3MRJB 4JPWH 3B6SB 2Q76B 5TQ0L 5E9DD 3MZTA 3LD8C 1MF2L 4RMQA 3SCMA 2EIBA 4XHQA 5D72L 3TV3H 5CZKA 1RMFL 2FWOA 5DHVA 1I1AB 4IIQA 4MJ4A 5E4IA 5E2TL 1I3RA 5KZCD 3S35L 3P4OB 4QHLB 5LGJB 1PLGL 4LCIL 4JFFE 2XG4A 4FMFA 1OWRM 4OT1H 1BQLH 5I1JH 3DYMA 2Y5TB 2NY1D 4YHYB 2J6EA 2DWDA 2WK2A 3EYVB 1VPOH 4G8GE 4PJIB 1KJVA 3UYPA 4UOW1 1DQJA 4JO1L 3IVKB 4Y4HD 3O4OC 3BYTA 4XVTL 1T03L 1LO0L 3S96A 4HIIA 3TH4T 4Q6IC 3ILQD 3P11L 4CNIA 5I73B 5C70A 1BLNB 4MA3A 1NCWL 3LV3B 1P7HL 5J1SC 2P5WA 1WK0A 5D2NE 4ZS6D 1O5DT 2XKNA 5F89A 4PRHB 1TZIB 5LVEA 1W2KT 5L0QB 4KV5E 4LNRA 3VW3H 4XPFH 1OGAD 3OPZL 4KJQD 3QDHA 1C08B 2NXZC 4HXBL 2APXA 4JRXA 5DD1L 4BH7B 1D3CA 4TVPD 5D1XB 1K3IA 1KG0B 4BSVA 5IWLA 3PL6A 1S7TA 4DCQA 3VGHA 3EHBD 3CU1A 1GGIH 3GKZA 4U1MB 1CFVL 2P44B 1QSEA 4ODHH 3L7FA 3AS1A 3D87B 3OTTA 4RRPA 4NZJA 4S11A 2AS5M 1JYVA 4W4OC 5DVLA 3OB0H 5DK3A 4W6YB 5C0BB 3CIQA 4JDVA 3UTTA 2FATH 2WWMD 3KYMA 4LAJH 4JHAH 4MLSA 1T66C 1WVZA 3FFCA 5J57B 4OIIL 1BX2B 4GW4B 4JG1H 2CKBH 5GGTH 1MJ7H 4IJ3B 2ADGA 3Q2CA 2F58L 5GS0H 2EDFA 3WLBB 3O6FC 3RVWD 3WDJA 3UPAA 2Z31A 3RHWF 4WEMB 3LEYH 5I1GL 4OFVA 1CD1B 4JFZH 3PNWA 4KHXL 1ETZA 1NCDL 3TZVD 4KY1L 3GFUA 3W39B 1DLFL 4JANA 3VFTB 2MHAB 5GSVA 3Q3GA 4HKJA 4P5MB 4MJ6B 4ZXBA 4CBPA 1IGFL 3BP4B 3KLHC 4JKMA 2YSSA 1WCBB 2OSLA 5DS8A 1JWSA 4M43H 5EG6C 1RZFL 3BO8B 1YDPA 1NL0L 2F19H 1TVBB 2R0LL 2Z8RA 1T7VA 5F9WB 1R5VA 3HFMH 4ETQA 3SKJL 3G5VB 4ZSOE 3ARGB 3DPBA 5GGRB 4L3EE 4MD4B 2HJFA 4O5LH 2FB4H 4KJPD 1RU9L 1W72L 1U8NB 4OF3A 5EDXA 4DKEH 1A6UL 4GG6A 3MNWA 4TRPL 4M02A 4ONHA 4NDMA 4X99B 4PD4K 1R24B 3FRUB 4I2XA 4PTUB 4QRPD 3H7BB 5DUBA 5EORL 4ODXA 1QR1A 1F11A 2YOCA 3QUKB 4XP6H 1Z9OA 1RJZA 2XZQH 5F44A 4CVXB 1NCNA 4Y5YC 2NZ9D 2HA1A 3BZ4B 4YFDB 5A16B 1NPUA 4MB4A 3V6ZA 5CJ8A 2VLRB 1VACB 3GJFA 1AY1H 1SBBA 4OV5B 4QRRE 4TNWF 5DXWA 4X9IA 4ERSH 3A6CL 2HMIC 2HLAB 4TNVF 3VMPA 4EZMA 4AL8L 3P9MB 43C9A 5HGBB 2DB8A 4MDIB 2APFA 2C3XA 3MACL 4M93B 3JWOC 3EGSA 3NZ8A 5E94B 2IJ0C 2YRPA 5B39G 1E28B 5F9DC 3FZUC 3EJJX 4Z95L 1FLRL 5HPMB 4NQEA 4JM4H 4ODWA 1ZGLP 1JNHB 3RTQA 1IAOB 3PWPE 4UINH 5BVJA 2JB5H 3GGWB 1C16A 4MXVF 3WO4C 1WIPA 5L7XL 5JNYA 4KKNA 1TZGL 2ENSA 3B9AA 2G60L 1N2RA 4K3EH 2R2EA 3B8YA 4QHKJ 2P8LA 5ICXB 4UNTA 3L5WA 3K2UH 4IOIA 2HVJA 4MNHA 3EBAA 2OYPA 5EC2B 2R56H 3GRWH 4L9LB 2FD6L 1UM5H 1FNGA 3KXFE 4JLRB 4V1DA 5BZWA 3TBWB 5AWNH 2W0FB 2CXGA 1A1MA 1XF3B 2D9CA 1IARB 1QKZL 1RK0B 2VDRH 3L3IB 4F7TB 2G2RB 5DUML 4A2MA 5GISH 3G6JB 2VXVL 2IPUG 3KYNB 5F3HA 1BZ7B 3QCUL 2XWBB 1DUYB 4IHOB 1QFWI 3CFCH 2MSPA 1AQDA 3VGAC 4N0UE 5I1CH 1DBAL 4F37F 2VLJB 5T33H 4IOSD 3F12B 2PN5A 3CPLB 5BZDA 4OKVB 3O6ML 1CE6A 4KJPC 3KVQA 3MGOB 3D0LA 1NFDB 2APBA 5D1QD 3TIEA 4CUCA 4P9HC 4JO2L 3K1KC 4PR5B 4UQ3A 2IPTL 3HE6D 3DVNA 3V5HA 4N8CL 3C6LA 2D7PA 3RPKA 1UACH 1H3XA 2R9HD 5IB4B 5A3IC 3QDJE 4WW2B 4LDOB 1P53A 1AXIB 3MCLL 4DKAA 4JFHD 2HTKC 1KEML 2FGZA 4ZDHA 5GXBB 3QRGL 3IFPA 2WUBH 4NT6A 3I75A 3C6SB 4OB5L 3QFDA 1CS6A 3LS5L 1MQKL 4PS4L 4M7KH 1EJ6A 2VJXA 4OGYH 4ACPA 4AH2A 4UIMA 1U8MB 1SEBA 4TYUA 5H35A 5HHMB 2MMXA 1FV1B 3AY4A 3GJEA 3ESVF 3GMRB 1JV5B 2DMBA 3HZKB 5HVWA 4XCNB 4W68A 3N1FC 4NO0A 5SWQA 2VLKB 2XPGB 2E7BA 1KLUB 1P7KB 2XA3A 2YPLA 3OR7A 4M62L 2OTWA 3FTGB 4YE4H 4FFVC 5TE4H 4G6MH 4Z7WE 1N8ZA 2O5ZL 5F7LB 3SDCD 5JR1L 3PQYD 2GK0B 3VXSD 5DFTA 3D3VD 4HX1A 5EZLB 1A7RL 5LQBL 1ZA3B 4MCYA 4WWKB 4JE4B 1Q9LB 3MV9B 4NJAH 3LKNA 1RSFA 4EXKA 1E6JH 4HUWB 1A4KA 1F8TL 3WLWC 3HI6L 1HSAB 1KN4H 4XBGA 5HDBF 3L3HA 4N0CD 1IGML 4HUXB 1D5XB 2KH2B 3ZDYE 3O2VL 1HI6A 4DGIH 3BUYB 3WXWH 4P3DB 3EYUH 2P7TA 1PAMA 2W38A 1D5ZB 2CKBB 4MB5A 1GGYA 1E0OB 3SKMA 4FQJL 1KB5L 2DQHL 4PJEF 4MB3A 4GBXA 4HKXA 4ODUB 4PRIB 1A3QA 5CBAB 2A77H 5AYUL 3P2TA 3QUYB 4F15C 2BOBA 4BUGA 1J0YA 3KPSA 2OI9C 5IMOB 4X5XB 3O9WC 4OM1L 1ZT4B 2NX5B 2BY1A 2L7UA 4U1LA 3UYRH 4DGVL 1S7WB 5EWIH 1BD2E 1NBYB 2BXZA 4PJ5D 5JHLL 5CJXC 3P73A 4DN4H 4LMQI 5J9PB 5HYSB 4LVNB 1I4FA 4PJDF 4HHAA 5DWUH 4J7RA 1DQDL 1RUPL 4M7JH 2PXYC 3O3BA 5EZIH 3ORJA 1IM9A 5I1IH 3SBWC 2J8UF 1JBJA 4P4KD 3TO4A 4MSWA 1UWEH 1X44A 3MYJA 4IRJA 2XY1A 4GBXC 2XOTA 2DLHA 2DIAA 5DJXA 5AZEH 5IHUL 3D85A 2ORBL 3VCLA 5SWSE 4DZ8B 5KVGH 3OJMB 4F9PC 1XGTB 1EAPB 5ESAB 1JTOA 4ZS7H 1MFAH 5EC1A 1ORQA 3AMLA 3FN9A 3MOAH 1DVFB 1CICD 4TUKH 1Q9WA 5DFWH 1RZJL 4ZAKC 3MV01 4KROC 4ORGA 4WFHD 5D7KD 4JRWA 4HIEB 1WEJH 1ZLWK 5MEOA 1I8MA 4WUUE 1IM3A 2CDFB 3PGDB 1SJHA 4U1KB 5BJTB 5HHOE 5IGXL 2OQJA 2DOCA 5JXAH 4AM0B 4QOKD 5BS0D 2KQNA 4F9LC 3WNLA 4MS8D 3RI5F 4NWTL 4KU1A 4MQSB 3DX6B 3O2WH 3V95A 1QLFA 5T3XL 3QJFA 2UZIL 4NRXA 4NQTA 4PP1C 1EEZA 2PR4L 3CZFA 4L1HA 1AXTH 4HZLB 4NQXB 5J6GA 2XWTB 1ACYH 2DDQH 4LLWA 4P57B 4F3FB 4WUKH 2E7HA 8CGTA 3TH3T 3U30C 4NZRL 3TT3L 3RIAK 1A6ZB 3FT2A 5DMKB 2PO6D 4QRQA 5ILTL 4JO4L 3UTPD 1U8LA 4CMMA 4N0CC 1GH7A 3IJSA 4QY8A 3VWKB 1QSVA 2NXYD 5K33A 1U3JA 3BFOA 3CFJB 3LVEA 3UTSB 4YH6A 3G6DL 3VFVB 1S3KL 1MLCB 4TUJB 1WT5A 3H9ZA 4K8RD 3I6KA 4OZIE 3MLRL 2VE6B 1ZS8A 2A6KB 4I4WB 1X5FA 5HPOA 5E2UH 4ZFFA 1VCAA 2P8PB 1ZV5A 4GW5B 5DA0B 3MBXL 4UIKL 3D5OF 4PB0H 2ZSWA 4MNQE 2V7HA 1JGLH 1KIQA 1RURL 3OL2A 4NC1E 3MOQA 3N9GL 4DN3L 2BVOB 1MNUL 3U7WL 4F58H 4PJ9D 3EFFB 4J8RA 3ARUA 5DK2B 2I60H 3NPSB 3O2DH 1V05A 3RZCB 4YGVA 1IGCL 4KXZI 5DVNA 5CSBA 5GHWL 4YXKL 2YRLA 3S36X 5L8JB 3U0TA 4H5SB 5C0DB 4P4KC 3TFKC 1NCBH 3S88L 3OZ9L 2YA1A 2WANA 1MEXH 5KW9L 2IALB 1C5DA 1V7NL 4HFWA 3N85L 1MCWW 3Q5TA 4ALAL 3QUMH 4MJ5A 1OB1B 4K3DH 3BQUD 3PWUA 1B9ZA 1G7PB 1FP5A 4CVWA 3VI3F 2VZUA 5IB2B 3MV8E 1IT9H 1S7UA 2WP3O 3C5JB 5I6XC 4LU5H 4CN6A 2YPVL 5C7XH 1ADQA 1I9JH 1B0RB 1Q9OA 1YN6B 2NLJA 4M6OH 4NN6C 1EV2E 4N8VB 4RFOH 1AHWA 1JRHL 3WSQH 1IKFH 1IZJA 4HDIA 2C3WA 1DEDA 4FFWD 4AK1A 1MFCL 1WITA 2HTLD 3QI9B 1BVKB 3OAUL 4XBPA 1NC4B 3QUZB 1B3JA 1AR2A 4JO3H 1OSZB 5IOPA 1TJIL 1C5CH 3RNQB 2B0SL 4P4RA 2LU7A 1GGBH 1YQVL 2XNAB 35C8H 5DFVD 1JPTL 1NCCH 3HMXL 5E1AA 4N5UA 2ZCLL 4OZFA 5DJDA 2FX8L 5KJRH 3TJHD 4YXHH 4ONGL 1B0WA 1TJHH 5D5MA 2E7CA 4R97B 3HMWH 1BOGB 3IKCB 5E70A 5DDHB 4HC1A 5HXMA 5LGKA 4KRMB 4QXUL 1EHLL 1FORH 3VXQB 2ADJA 4E5XB 5JO5A 4FZ8L 1KJ2L 2RBLA 1FL5A 3MZGB 4LLDA 3BPCA 4U1IB 4BSWA 4XH2B 4Q9QH 4O02H 4FQXA 4RGNC 5TDNA 1URLA 3O4LB 4J2XA 5JUEH 4R26H 1PKQA 3WD5H 1T1XA 4GS7B 5AZ2L 3GBLA 5E4EB 3PXJA 4FQQB 3VXUB 1XR9B 1IQWH 2UWEB 1SYSB 3EYSH 2ENYA 3FOMA 1PG7L 1FQ9C 5EBWA 1XIWA 1U9KA 1Q72H 1RULH 4XPHH 3HG1D 4JGMA 4OLZL 4G8GA 1FZKB 3NFNB 2CSPA 2UZXB 2YD6A 3WJJC 4G42A 2WBJD 1HKLL 3GHBL 3WN5B 1A6VL 3IJYA 1WBXB 1LILA 2P24A 4IM8A 5A2IH 1ZVSA 2P8MB 4Y5XA 5D2NA 4RCAA 2C1PA 5D96B 1NMBH 3X13A 4PJ9C 4AIZA 4OM0H 1TQCB 2DJUA 1QG3A 4Z8FH 4NO2A 1N5YL 4HWZA 1I8IB 1JN6A 2N1KA 3HZYB 1LP9F 4HH9B 1LO5B 1MAKA 4PGCB 1T1YA 5HYSG 1D6EB 2D0HA 1JNLL 3B9DA 4ZFOL 5EA0L 4J3OC 2DMCA 4WNQA 3ZYZA 2RJMA 1F00I 2QADD 5D8JL 3LSOB 1K8DB 1SY6L 1F42A 3BPNC 3GSXB 3TBTA 1PQZA 4LDLB 2VC2H 3PHQB 4LHUD 4JM2D 4RMVA 2EXYC 3NABL 5K9OA 1CGWA 1U6AL 4G9FE 5FB8B 3BEWA 5ID0A 4G7YH 4WHYG 1IBGH 2EDEA 2HFGL 2HKFH 3T8XA 4FFZH 3BRGC 2OJZH 4EVNA 4LP5A 5I2IA 5FDWB 2FZ3B 3H0TA 1P2CA 3RUGE 1H3PH 1MREL 3QQ3B 3LD8B 3S37H 3V4PL 2MKLC 2JLLA 4D9LL 4WU5B 4RWYL 4G8EA 3BAEL 5I18L 5LCVL 4DVRL 4NM4L 4RMSA 3GSUB 1HZHL 5ISZD 2OXGA 4P9HH 2AJSL 2I5YH 2VLLA 5B8CB 4JPIB 5J8OA 3MRNA 4NO5B 5M94B 1NCAL 4RMRA 2ERJC 2X7LB 4MD0B 5BMFH 5KG9B 4GRLA 1B4JL 4NRYB 1S8DA 5F88A 3O4OB 1S9KC 2HH0L 4RGMC 1KCLA 1OP5K 1JPSL 2ITCB 1NJ9B 3ES6A 4GMTH 4Q6IB 2E27H 3RWHA 1SBSL 1VGKA 3UP1A 4JPVL 3GI9L 5EZOL 2VRAA 2PYED 1GZQA 2CGRH 5B4MD 4JJ5B 1S9WA 5EH1A 3PP4H 3E8UL 4ZSOA 4HKBB 3MNVB 1MJUL 2PYFA 4B0MM 4S10A 1CLOL 4FQHA 1X6NA 3KPOB 4I0PA 1QLRB 2NXZB 1AKJA 5EN2B 4WI7A 1YUHA 3VFUB 4HV8A 3MGAA 2MCPH 2XG5A 2F5BH 2Y72A 4Z5RB 3F58H 1VDGA 1XGQB 2R29L 2V2XA 3SO3C 3X11A 2PF6A 1Y18B 5EO0B 1GOGA 4HS8L 2B5IC 2JIXA 1CFBA 2EXWC 4UNVA 2G5RA 3U0WL 1XGYH 3GO1L 4K94C 3V0VB 5BXFA 3VXPB 4MX7B 5DEFB 4I8DA 5A1AA 3N06B 5IJVB 1U58B 3CK0H 2VR9A 3FKUS 1BIIA 1CGTA 4QRRA 1QR4A 1Z3GL 1ERNA 1BJ8A 1Q0YL 4ZO9A 4X5WB 2FSEB 4OFDA 4X6FB 1GOFA 2DWEA 3KAAA 3SDAA 5CEZH 5CKGA 4Q9RL 3MRMB 1ZHBA 2XTJC 1K3ZA 1G7JB 2QSCL 1X4ZA 4YHML 1OAUH 1DN2A 5HYJA 4I0PC 2EDNA 2CMRH 1MH5B 3C8HA 4PYHA 4LPXA 5IBLC 4Y4FA 3O6FB 3ULUL 1GHFH 3DRTA 4M8QB 1IGIH 3GMPA 3PWPA 4GW1B 2ZNWA 3VI4E 4J6RH 5SX5H 1G9ML 2MFNA 3BZFB 3FO0L 3CVHB 1ZT1A 1AJ7L 3HS0A 3OR6A 1KSRA 3REVB 3QXUA 5IW6A 4PUBH 3UTQA 4ZFGH 3O6LH 3LKSB 3PGCA 2FO1A 2Y23A 1UC6A 4D9QE 3EOYG 5CGYC 3DBXB 4N8VG 2DM3A 4CN4A 4JFEB 5HI5C 4HWBL 4RWHA 3T3MF 4JM2F 1KXVC 2J4WH 5TDOA 3GSNB 1WFNA 1WWAX 1N0XL 4XNUH 1CFNA 3WKMH 1NBVH 1FJ1B 2DQTH 2ID5A 4NC2B 3RVXC 1EO8H 5I1DB 3AB0C 1JGUL 1AQKH 3O8XA 1PKOA 4AENB 1E4WH 4WRLA 1FBIL 3B5GA 2DLIA 3RGHA 3MCKA 1KF9B 5CBEA 1XF2B 1P7QB 4PJ7B 3G04A 1AO7B 1PEWA 3SE3C 4JFOB 4Y5YB 3HNSH 5JOPD 4XI5D 3UZQA 1G6RH 5I1EL 1PSKH 3UX9B 3TA3A 4N0YL 5IB3B 3MJ8B 4PJXF 2EE2A 2XWJA 3ILPA 4OJFL 1CYGA 3BRFA 4KZEH 3VXME 4H0GA 4N90D 4GKZA 3DVGA 2C3VA 3TIDA 4PJHB 1W0VA 4KMTH 1VFBB 5FEBA 5FKPB 3HAEH 4YUEH 3BDBA 1YEKH 3TT1H 3DJ9A 1FGNL 2XQYG 1GOHA 2ICWA 1AD0A 3IAGC 1E27B 1UH4A 2CH8A 2I9LB 2IPUK 3TYFB 1HQ4A 3SGKC 1RIVL 5E99H 5HHVL 3WO4B 4CAGA 3G5YA 1DFBH 5C0ND 1RPQA 4HEPG 4YHIB 5EULV 5KSBF 2IANB 4OCNC 1G9NC 1T22A 3LZFL 5T3XE 5JQ6H 3RVTC 1B2WH 4QHNA 4YDIL 2VIRA 3WIHH 2H32A 5F9OH 25C8L 1WWCA 5CD5D 3B43A 1B4RA 3ULVC 1UB5B 4Z7WA 3KYAA 2GK2A 3QJHA 4TSBL 5JLZA 3SCMD 4PJFF 4UOJA 1IQDA 2HFFB 1AGEA 5DSCA 3T65A 3QQ4A 4D0CA 5IVXE 1QFWL 1G0YR 3EYFA 3WMSA 3W9DA 2NR6D 4NQDE 3DWTA 3REWA 3QULA 3FQTA 4K23H 4NKIL 1A8JH 5I16B 1T1ZB 1B6DA 4OCRL 2NW3A 3VGAB 1MHPL 2VDLH 2P5EE 3IJHB 1BBDH 1D6VL 2ZUYA 1VFOA 4XVUD 4G3YL 4RNRA 4XP4L 3PWLB 1S5IL 3DSFH 7FABL 5HHNA 2QKIB 2X4PA 5TF0A 1RIUH 4RISL 1QHPA 2A6JB 2P5WD 3MLTA 5EUOB 1FFRA 2X70B 4APQD 3HUJF 5JHDA 4S1DD 3DX8B 3MODH 1OAXL 1AD9A 2WLZA 2M2DA 1OP9A 4U6HB 4MA7L 4YK4C 1RZ7H 3BDXA 4QRSB 2OZ4L 4OF7A 2JJSA 4TQEL 3HI5H 4Y4KC 4IOFC 4X0KB 2E9IA 1H3TA 5D7IA 1DUZA 1WBYB 1FFPA 2JCCA 5ADOL 4HT1L 5HDLA 4JRXD 1Q8MA 5F6IC 3ZHDA 3QPXL 4L8BB 1BD2A 4O51B 5EUKA 4JGUA 3TNNA 1YJDC 1XGPA 4N9GB 3PL6D 1HEZB 1JUFB 1MHEB 3EJZC 4ZFZB 4J3WA 5DRZB 4CADA 2FEEL 3TVMA 5BQ7B 3RDTC 1TCMA 2F54B 3DHMA 1QSED 4OQTH 3H3KA 3RNKB 3X12A 4WFEE 4IRSA 5ESVA 1X5KA 1AFVL 3QUXD 3T2NL 3B3IB 4ZUUB 1TETH 4KK6D 1T2QL 4EI6A 3H9SB 1I7TB 1GAFL 1G7IA 2DIBA 3MA9H 4ELMB 4M6ML 2V2WB 3WDHA 4I18A 5DJ2B 5SWSA 3WFEH 5DTFB 2HN7B 4JPWL 4P5TD 4OI7A 1XGRB 4FQIH 3V79C 1OP3K 3TV3L 3RWEA 3R8BB 4LARH 4Z7VF 5IW1B 4ZNEE 4NUJB 1N64H 1PBYA 4PJEB 5JZ7C 2GT9A 2Z31D 3QEUB 4J4PC 5ADPH 2P43B 3SKNA 2EH8H 1AE6H 1RUQH 2YZ8A 4X6CB 4MZ3A 5MENE 4R3SA 1M71B 2R8SH 4PJBE 2OP4H 3RWIA 3SHSA 4OT1L 1BQLL 4ZXBD 5DJ6B 5I1JL 5EIIB 5IVOA 3L95B 1VPOL 3JV5A 3QFJA 3U1SH 4H0HB 1LNUB 5K59E 3BD5A 3ARXA 4M8VA 4ZTOH 2D03H 4JFDE 1VHPA 4PG9B 3IGAA 4JKWA 4M48H 4F15B 2ZOKA 1JHLH 5F21B 4L8SC 3GB7A 3VW3L 4JQVC 4XPFL 2OI9B 2J8UB 4GT7A 3O9WB 4OF0A 5EU3B 2FCBA 2H3NA 1BWMA 1OGAE 3ZT6A 5CCKH 4CGTA 3LB6D 5IK3B 2X44D 1U8JA 2HJKB 3DV6A 3K46A 1TZHB 3MNZB 3O11A 5C07E 1A7NH 3GNMH 4OZGB 4P99A 2B1AH 1FNFA 4G7VH 4J1UB 2VL5A 4UV7H 2PXYB 1HIMH 4OZIA 1GGIL 5D1QB 1K9TA 5CINH 4WHTB 3EYQD 2I26N 3K4ZA 4ODHL 3MJ6A 2QR0A 2W9EH 3ZDZE 1DSFH 1F45A 2X4OA 5FO8B 3HA0A 1FE8H 2DTMH 2ZOLA 4MNQA 1D5BA 1ZGLB 4P3CH 4WFFE 5J0BA 1WIUA 2FATL 4Y2DA 3CDFA 3G5XA 3CH1A 5EBGA 3MR9A 4LPCA 2HJLB 5HDOA 2ZUXA 3LKRA 4A6YH 4XRCA 1OOAA 1WF5A 5I1AB 1FFNB 4JG1L 5LJYH 2CKBL 1MWAH 4LLVA 5GGTL 4ZAKB 1MJ7L 2OL3H 4NQED 4KROB 1G6RB 3WDIA 4XNMB 3RTQD 5GS0L 3OB8A 4M1CC 4X4YA 3D0VA 3LEYL 5I0ZA 2VSCA 2DLFH 3OJ2C 4JFZL 1ZE3C 4RBPK 3OXRB 3RRQA 3AREC 2AK4E 3PWVB 2WNGA 3SDCB 3T77B 4F7MB 1D5MA 4M43L 3MV8A 4M7LT 3I3BA 3D3VB 4UT6H 1IAIM 3QR2A 2F19L 3BXNB 5KN5B 1UXWA 4YPGB 1X7QB 1BVLB 1YY8B 2VERN 3HFML 3GM0A 5FIEA 2YHGA 3AROA 2AV7B 1DBMH 3V7AG 4CVZB 3U30B 3ET9F 1KV3A 2FB4L 4O5LL 3L5JA 3VFPA 4TSCH 5FOBB 1WICA 2XN9B 4MGXA 1HDMB 1KXQE 5E8NB 4DKEL 1EO7A 3I6LD 3KJ6H 5GGSA 4DTGH 2XYCA 2GTWA 4CN1A 5D7LB 4JFYB 1RJYB 5MEQA 1INDH 1PFCA 3IDMA 2BVEA 4HKZA 2Q87A 3TWCH 5I71C 2UZYB 1KCVH 4XP6L 4G8IB 4GAJH 3QEHB 4Z0BH 4P2OA 2XZQL 5FO9B 5J89A 4ZUWB 2PW1B 3Q6FA 3H42H 2OS7A 4LKCA 3FQXA 4MA8H 3HLAA 2EDDA 1NGZA 4FQ1H 1AY1L 4XC3H 5C2UB 1RZGB 4G6AC 4K94H 4U7KA 2BMKB 4J23A 4ERSL 5HVFB 1W72A 1FZMA 2FO4B 5E6IA 4I5BB 3V5DA 1FFOB 1AP2A 2GTZA 1T89A 2BOCB 4R0LA 2Q1EA 5J11C 3C6LD 5EU6E 4YDJB 4MCZB 2C7UA 3RJQB 4JFPB 4KMLB 4JZJA 4KRLB 4LCYB 3QEQE 1K4CB 2GCYB 3VWJC 4LL9A 3NCMA 2FGWH 4OCWH 1YEDB 4JM4L 4P4KB 4BQCA 3CZJA 2O61B 4QHKI 4PRDB 3H8NA 2AKRA 4UINL 5HDBE 2JB5L 3OXSA 1NEUA 3RWGB 3RGVA 5ABDE 4GG6F 4JAMB 1G7QA 2FJGA 4GUPA 4K3EL 3MRPA 5MHSE 3WS6A 5C0EB 4NO0D 3RY6C 3K2UL 1AGFB 3BHBB 1K2DA 4NN6B 5E6IC 1YMMB 2X9WA 2R56L 3CFKB 2YPLD 3GRWL 1J8HB 3IETB 1UM5L 4D9RD 3I85A 1U8QB 2EYRA 4JR9H 1VEOA 4U1NA 4XX1G 3N1GC 3QDMA 5AWNL 5GRJH 5HSFA 1H3UA 1JPGB 4XWOC 3VRIA 1KCUH 1HYRC 3TNMB 4OGAD 2QQNH 3OB0K 5C08E 1NUDA 1HK6A 3E2HC 2VDRL 1CGVA 5DEZA 4HS6B 3QDGA 3X3GH 3GIVA 1MVUB 5GISL 2IH3B 1FG2A 3KHQA 5IB1A 4PJAA 4JG0H 1UJ3C 2PCPB 1FZJA 4KK8C 3P3YA 3CFCL 2WWKO 5I1CL 4ZOBA 3HNTH 4G9FA 4JY5H 1ROWA 1P1ZB 1MY5A 2AJZB 4OZHB 3STZB 5T33L 4JFQB 4JDZA 2EDQA 3WEXA 5I8OH 3RWCA 2PW2B 1I1YB 1DBJH 3L3JB 1ZXQA 1NH6A 2NTFB 3BEVB 4RGNB 1BQHG 1ZEAH 4MQXD 5L2JB 5E8OA 4U2ZA 2ARJB 1XAUA 1YEIH 2F8VA 4PGJA 3ARFC 1WZ1H 1UACL 2VZ1A 2I9TB 1P6AB 2HVKB 2XA8H 3PV6A 4QTIH 2GJ6E 2D4DA 2C1OA 1ZA6A 4HIHA 3SKUD 3V9FA 3P9WB 4LSTH 3WUZA 4GAYB 3WV0A 2V7NB 2XZAH 1UCBH 1ZOXA 2FEDD 1CIUA 2WUBL 4I0KA 1CT8B 2OJEB 1U8OB 4E0RB 1QZ1A 5KSAC 1BFVH 4O2CA 3BE1H 4M7KL 2HT2D 1EFXA 3DYPA 4OGYL 4UOW0 1J0JA 4HUVB 1IM9D 1XCQA 2DQUL 3GSWA 3TO4D 3G9VA 2XKSA 3KPLB 4I1NB 4PJ9B 4IRJD 1J1PH 1G9NH 4M6NH 3FFDB 3HR5B 1VKXA 3D2UA 4LP4A 3D85D 1IGYB 2EDBA 2FJHA 2W60B 1A1OA 4B41A 5IR1A 5E1HB 3EDKA 4G80B 3EOAB 4YE4L 4XPTH 5TE4L 1KUMA 4G6ML 5F8QC 5DYOA 1KYOK 4D0BA 5T1DH 1U91A 3ULVH 2Z91A 3C8KA 4MJIE 4WO4A 4WEUD 3VXSE 3JV6B 3C8DA 2G5BB 5FAAA 4QNPE 2XFXB 3BPNB 4NJAL 5GIRB 5DRWA 4GKOA 1K5NA 2F5AH 4PY7A 1E6JL 2G75A 3P0GB 3LKPB 2JK5B 2J1KA 1OGTB 1HHGB 5H2BB 1KN4L 1F4WH 1E6OH 1YNLH 5BW7C 1KFAH 4U1JA 1DCLA 3QWOB 4DGIL 1C12B 4A6YB 4BH8B 1HOCA 3WXWL 4X4MA 3EYUL 2E6PA 5KTEH 1BZ9B 5DEGB 2OL3B 3V6FA 1LDSA 32C2B 2X4TA 5F9JB 2J88H 5JDSB 2W0LA 4NBXB 1RZIA 4MYWB 3BH9B 2A77L 2WV3A 1M7DB 4Q0XH 2VQ1A 4XBEH 1LK2B 4ODVH 4XCYB 4JREC 4LFHG 5F7EH 4KJYB 3UYRL 3QXVA 4NYLB 5EWIL 1W0YT 1ULVA 2UVEA 2ERJB 1F13A 4DN4L 4KC3B 1VADB 4LRIC 3H7LA 2D7QA 5DWUL 5JMRA 1HN1A 1KB5A 3FB6B 4M7JL 3VRLF 5EZIL 4Q6YA 4MQXC 5CEXA 5I1IL 1A2YB 4DAGH 2O93L 4YDVA 4EUPA 3QIWD 1UWEL 4PRPB 1QSFA 4Y89A 4XT1C 3MRQB 3LKOB 3BX7C 5FYKD 3AAZA 5AZEL 4D0DA 5J3HD 5DK0B 3T09A 5KVGL 2YC1B 5DI8B 1REIA 1U8HA 5IVZA 4ZS7L 5J12C 5D71H 1MFAL 5IV2A 1KEGH 3EDEA 1XZ0A 3SO3B 3LEXA 3MOAL 5EU7E 1WC7A 4LQ1A 2B5IB 5E5MB 4TUKL 4R7NB 5IM7A 2ADIB 1WEJL 3H9YA 4WY7H 4HIJA 1R5WB 1S9XB 3G6JE 5D7KE 4CDHA 1A6PA 4NQCB 2KL6A 2DKSA 3V6OE 5GZOC 5JXAL 4CJ1A 5DZLA 1JPFB 1OAYH 1OTUD 3QIUA 5K9KB 2IBBA 3ZDXE 1S9VA 3QG6A 2A2QT 1BAFH 2P48B 1UWXK 3O2WL 4X6EB 2XTJB 5KSUB 1CU4H 3JTSB 4JB9H 2EC9T 4KK5C 2LE9A 2DN7A 5DQJB 2EIEA 2AXFB 4I3RH 5E2WH 1X5IA 5HI4C 1AXTL 4LASH 4P2RB 4HBQA 1ACYL 2A83A 2DDQL 3UDWC 5BOPA 4WUKL 1R3HB 2FR4B 4G9DA 3U6RB 2LU3A 4PTTB 1MPAH 4QLRA 3UTPE 3QHTC 4YIQB 5T3ZD 2CK2A 1BJMA 3PWNA 3CSBA 3QP3A 3PUCA 1A7QH 3BIKB 1RY7B 1HQRA 2XZCH 3QWRA 5MERA 2H26B 5E2UL 1UADC 1TTUA 4XP5H 4XPBH 4LMQE 1N5AA 5ISZB 2CLVB 4OQ1A 1LP9E 4X7TA 4H88H 2X41A 4PB0L 1FIGH 1JGLL 2YA0A 4FQXD 2O5XH 4S2SB 3WKNA 3S36H 3AB0B 3GEWB 5F97E 5DUPH 5IVXA 3ROLB 4F2MA 3BGFC 2XQYK 4I3GA 4NQDA 5FYJE 2BSTA 4HMEA 4F58L 3VD9A 5DJAB 1ZMYA 5HYQA 2I60L 5ANMB 3O2DL 2EDRA 3ZKNC 5SX4H 5GRUH 1EUTA 4ZOCA 1YY9C 1XIWD 4JY4A 1LHZA 4KWUA 2P5EA 3OKKA 1I9IH 2K7PA 1NCBL 4G8GD 1HILB 5C0FA 3QIWC 1MEXL 1F3JB 1S7VB 1FNSH 3CSYB 4XPGH 3QUML 4K3DL 5C2BH 3V5KA 5JOEA 1GIGH 3BP6B 3DROB 4TULH 1KPVB 5D6DA 4DKFH 4YC2B 2FDBP 4X4XA 1SYVA 3GSVB 3RU8H 2ARWA 3MROA 3WBDA 1G7HA 5KSBB 2Y36H 1PD6A 1NUFA 1ZLVH 1IT9L 4LU5L 1GZPB 5C7XL 4U6YB 2ZUWA 5ACZA 1I9JL 4JZNA 4XVJH 2IADA 3GSQA 4M6OL 4ODSH 5DURB 3F8UB 4RFOL 3WSQL 1CG9A 1IKFL 3PDOB 2ITDA 4WDIB 4PRIE 1CDJA 5GRWA 1PX3A 4C57C 2NY2D 2NX5E 4YNYA 5KS9A 2X4UB 2ESVE 1U3HA 3B9EA 4JO3L 4X9FA 1C5CL 2R1YA 4X98A 3UTOA 1W8OA 2EEAA 5KSVB 3SO5A 1GGBL 2YK1H 5CJ5A 35C8L 1NCCL 3V8OA 5IFJB 5KJRL 4YXHL 4NQVA 2XKUA 5GJTH 4FHBD 1NGQH 1TJHL 3HMWL 3K2MC 1R3JB 4NOFA 3OSKA 4FTVB 3KYOA 4IS6A 2A6DA 4QRUA 3DURA 3GMNB 2SEBB 3VFRB 1I7ZB 4L29B 1FORL 2VWEE 1S7RA 3ECBA 4ENEC 1U8IA 4PV9A 5CJBA 3IDGA 3CC5B 3W5NA 3L3KB 3SDDA 4Q9QL 1KJ3H 1QQDB 4O02L 1KIRA 5M7QA 4ZNEA 1TQBB 4UAOC 2FYYA 4XXCA 5JUEL 4R26L 3WD5L 1I1RA 1HCFX 5CEYA 3FB8B 3HMXA 3QPQC 5HHQB 5JA8B 1N6QH 2FNBA 3TN0C 1IQWL 43CAA 5MENA 3EYSL 3MXVH 4PJBA 4XXDB 3X14A 1U92B 4GRLD 1NKRA 3T1WA 1Q72L 4GQ9H 3WIFA 1RULL 2NYYD 4XPHL 4RAUA 2GJJA 3VMNA 1QRKA 3GJFH 4PV8B 1JWMA 2R69H 5GGVY 2AJ3A 5IT2H 5H37H 3MV7A 1Y6MR 1NMBL 4YK4B 1FO0B 4GRMA 5D5MF 4OM0L 4L3ED 4Y4KB 4Z8FL 3FO1A 4GKNA 1XR8B 1YMHB 4OAWB 5HTSA 5F6IB 2YA2A 4NO3A 1J1OH 1NC2B 1QP1A 2RCSH 3BWUC 3FO9B 1FC1A 4GJTB 1UGNA 1IAIH 1A64A 4GLRH 2ED7A 2LAGB 3NH7H 5L8LB 5BRZB 5IROA 4OI9A 4KI5C 5DR5H 4R7DA 4F7EA 1FL6B 5C07A 2Y5EA 4UB0H 3RDTB 3TBSB 5IUSA 5C0AB 1G7MA 4WV1C 4DUWA 3GMOA 3ARDC 4F7CB 2VC2L 2CO6B 3MRIA 5JOFB 3OAZK 1NDGB 4QRRD 3UTSE 5T1KB 3T3ME 2CIKA 4UI2A 2BNUA 1BFOB 2AQ3A 4LLYB 4NJ9H 4BQ8A 3SDAD 5JW5B 2Y7QB 3IKKA 4G7YL 1IBGL 4Q74A 3D39B 2HKFL 2BSSA 4FFZL 1NGYB 2OJZL 1LEIB 3C87A 3INUH 4XVSH 2EDXA 4ZFOA 1H3PL 2X4NB 4N8PA 3HB3C 1K4DA 4P2QA 3DRQB 5KVMC 4KV5F 4Y4FD 1IGJA 4MXWH 4PJGA 4LGPB 1FNLA 2AXJA 3MJGX 3PWPD 3B2VH 4LCCA 3L1OH 4WGWB 2GHWB 1MCCA 4P9HL 3RWFB 1YPZA 4RFEB 3RL1B 2I5YL 1OCWH 3V0AC 3EDJA 2EEDA 4JFXB 1D9KA 1UZ8B 1I7UB 1OLLA 1WISA 1ES0A 1INEH 1B0GB 5B39A 5BMFL 2A6IA 5CP3A 2AK4A 1R3LA 1MI5E 4NWUH 4F33B 4MDJB 1IAKA 4GMTL 2A74B 1XF4B 2E27L 4OKDA 5I8CA 5D7SH 2F9BT 2DRUA 2NTSP 5D2LB 2ATPB 2CGRL 4OLUH 3KXFD 5DHYA 2XY2A 4WI6A 3MRKB 3DMMC 1KLGA 1PGRB 1WFTA 3K1DA 3PP4L 4L8SB 4TNVK 4Q2ZB 4X7CC 4S1SH 3O8XD 3MLXH 4C58B 3BZEA 3FOLA 4PBXA 2LAAA 4XWGH 2FLBT 1WZLA 5ALBH 5I1LA 1G7LB 2NYYC 2Z9TA 1MQ8A 1X5AA 2MCPL 1Y0LA 2BNQA 1ZSDA 2F5BL 3ARTA 3RY4A 3F58L 1FYTB 4DOHB 5TDPB 4FFYH 1A3LH 5AG9A 4HMCA 4BQBA 3OKNB 2R1XA 4U6VH 4X6BB 4APQB 3DETC 4OFKA 1R6VA 3RA7H 2Q86A 2H2SD 5C9JB 1XGYL 1X5XA 5IF0A 1L0QA 3TA3D 5BCAA 1S7SB 2WAHA 5TE7H 3CK0L 1U8KA 3QO1A 3CMGA 1VB9A 1WV7T 1GC1C 3CUPB 4MD5A 1KT2A 4P48A 5TPWH 4X6DB 1N0LA 5CEZL 3W11C 4P23A 4FN0A 5EU6A 2VOTA 3ARQA 4G43A 4UU9A 5C3TA 1YEGH 1OAUL 3MRJA 4L4TB 3B6SA 2Q76A 1YN7B 2C3HA 2CMRL 2E7LA 3QEQA 3RKDC 2IQ9H 1MIMH 2W0PA 2HWZH 1GHFL 3QUXB 3WFCH 3K4AA 5AG8A 1I1AA 1IGIL 1U2HA 3QNZB 4J6RL 5I66B 5FGCE 4QHLA 5LGJA 2UWEE 4MJ2A 4LPWA 2UYLB 5GGSY 5E24E 3EYOB 3AREB 4PUBL 4ZFGL 5BVPH 2Y5TA 4RAHA 3O6LL 4F37K 5DD5H 3EYVA 4BFGA 4P5TB 3T0WA 4K3GA 2P4AB 3VJ6B 3IVKA 2YN3A 1GJIA 2PTTB 5FUCC 5MP6H 4GXUN 1BLNA 1ZT7B 3LV3A 1RFDH 2J4WL 3DX7B 4PRHA 2WIIB 1TZIA 3LPGA 4XNUL 1IC1A 3WKML 1NBVL 1I1CA 3FQUB 1IL1B 2DQTL 4QHMB 3MLZH 1EO8L 1AQKL 1SJVA 1E4WL 3RWDB 3DTXB 4KHTH 2GITB 2BX5A 4BH7A 1DN0B 3M1BB 5D1XA 5I71B 3RBGA 3RVUD 2UUDK 1MRCH 1KG0A 1GRWA 5HYEA 3HNSL 5FYLE 1P9MC 3O3EB 1XGUB 4U1MA 1XF5B 1G6RL 4LLQB 4Z77B 1HHIB 3H3BC 1PSKL 3QWQB 4NZUH 3T4YA 1YECH 5JHDD 1QEWB 3VFGH 2F53B 5I73C 3T0EE 2QTEA 3MUY1 5CAYB 4KZEL 4LSSH 3ULUC 3S3SA 2BVQB 3TPUB 5J4MA 1HH9B 5J11B 3NOIA 1ZLSH 3KPQB 1U41A 1T4KB 5C0BA 4Z7VE 1G9MC 5D4QA 4KMTL 1QFOA 4YUEL 2GSIB 5FO7B 1YEKL 3B9KC 3VWJB 1BD2D 1BX2A 4GW4A 3TT1L 3B2UD 3WLBA 5C8JA 1BOYA 3TVMD 3L3OB 3Q0HA 5L8KB 5E99L 1TXKA 1B88A 4OCXH 1ITBB 1DFBL 4PRAB 3UTZB 1CD1A 4IRSD 1JJUA 3QQ9C 3W39A 1RIHH 4CU7A 3VFTA 2MHAA 5JQ6L 1B2WL 3IXTB 4P5MA 4MJ6A 4S0TD 3HE7A 3HPLB 3BP4A 4OLEA 3WIHL 2VZTA 4LOUD 1WCBA 5F9OL 1I75A 2BY0A 5IBTH 5SWSD 3RTQB 3BO8A 4Z0XB 1TVBA 5HYFA 4OCSH 3G5VA 3ARGA 3IDIB 3E2HB 2ED8A 3C09C 4MD4A 4MJIA 3NCBB 1U8NA 2BERA 5ESQB 4K23L 3MRFB 2GW5A 1UJ3B 4NFBA 4X99A 1R24A 3FRUA 3QHFH 3TYGH 1CDCA 4PTUA 3H7BA 2VDLL 3CFDB 3STBA 2OM5A 4CMHC 1BBDL 3QUKA 3JVGA 4P2CG 4CVXA 5HGHB 3WNPA 3DSFL 3BZ4A 5A16A 3IDXH 5SX5K 1CL7H 1KACB 1RIUL 1VACA 2VLRA 2WIMA 3U4EB 2FHCA 1QA9B 1EX0A 2Q6WA 5FYKH 4OV5A 2EE9A 1EJOH 3MODL 5BO1H 3S8WA 3VFOB 2HLAA 3HC4H 1RZ7L 3ARFB 2JB6B 1IZKA 1EGJH 3BP5B 1FG9C 1NSNH 2L4OA 3HI5L 5DO2D 3RPIB 3P9MA 4DEPC 5HGBA 1UEYA 4MDIA 1BQUA 1JL8A 5E94A 5E0QA 4Z7WF 2C4XA 1BMGA 1KLFA 4JRXE 1UKQA 1E28A 2R2CA 5HPMA 5KSAB 1X5JA 1JNHA 1IAOA 5JIHA 1HHHB 3NAAH 1LE5B 3GGWA 5FUOH 1IAII 3BISA 4OQTL 4GLRI 2DI9A 4FXKB 1QSEE 3E3QE 5DJZB 4HS3A 4BFEA 2ZSVB 3MMEB 1TETL 5ICXA 2F15A 4MNQD 3BP7B 2VZVA 5EO9B 3WIIH 4YHZH 3ZDYF 3MA9L 1KCRH 4Y2DD 3BI9X 5EC2A 3UTTE 4PIRF 4MVBD 2CQVA 4JFEE 3WFEL 1DQQB 4L9LA 5EZJB 5EOQH 4JLRA 3TBWA 3FFCE 5CD3A 2W0FA 4Z7NE 1XF3A 5I8KH 1SEBB 4FQIL 4ISVB 5CJOH 4LARL 5F96H 4HG4J 4AY0A 3V4UH 1N64L 4XAWH 1CXLA 1RK0A 2R0KH 2Y6SD 3L3IA 5ADPL 5D7IF 4RGOH 4F7TA 1MCBA 3ARBC 2Y4SA 2G2RA 1VGEH 2JCCF 4KKLC 5T3ZH 2EH8L 1AE6L 3WFBH 1RUQL 3G6JA 1DBKH 1KYOJ 4GO6B 3KYNA 4HAGA 1BZ7A 2R8SL 4OZFH 3V6OA 1A4JB 4PJ7E 2OP4L 2YPLB 1AO7E 1M7XA 2XWBA 1DUYA 1UVQB 3DGGB 4IHOA 1CFTB 3UZEA 4HC1H 4EN3D 5A2LH 3O6KH 2VLJA 3U1SL 2MNUA 3MV8D 1V8HA 4BZ2H 3F12A 3CPLA 5JW3H 4PRNB 1JPST 4OKVA 4M4PA 4ZTOL 1EEYB 1RUMH 2D03L 5GGQH 5GS1B 1KBGH 1JTTA 2ICES 3MGOA 4M48L 4LGSB 1JHLL 1NFDA 3MA7B 4PJ8C 1KCSH 4W4NA 4PJHE 4JREB 4KRPD 4PR5A 2Y06H 5CCKL 2Y9RT 4P0DA 5IB4A 4WW2A 4GG6E 4Y16C 4RX4A 4I2XE 4NHCH 2Z92B 3V7AE 1A7NL 2EDTA 3GNML 2B1AL 4G7VL 3SE4A 1AI1H 4QCIB 4UV7L 5FYKU 1G9EA 1MJJB 1KULA 3C6SA 1AGBB 1HIML 4KJWD 2GEEA 5DMGC 4M00A 2DS4A 5CINL 4LKXB 3PJSB 4DK3A 1OARH 1FC2D 4EXPX 2IANE 4XGZB 3KPPB 5BV7C 1U8MA 2W9EL 4GOSA 1DSFL 4CVUA 3FCTB 2XXCB 2Z8WC 1FCCA 2YD7A 1FV1A 1FE8L 4EIGB 3GMRA 1JV5A 3HZKA 3P9LB 4P3CL 4XCNA 4JKKA 2VLKA 3QXAA 1U36A 4HH8A 2XPGA 4OUUB 1CGYA 1KLUA 1P7KA 3UJJH 2YPKB 4M9OA 3S97C 1GPOH 2CRIA 5FHAH 5J12B 3FTGA 4A6YL 1H8NA 3MRGB 3OV6A 5HGDB 3EZJB 3VH8B 4JVPA 1VENA 1MWAL 1EDQA 2GK0A 2OL3L 3S98A 4F8TA 3LMJH 5EZLA 1FGVH 1ZA3A 3UJIH 4H20H 4NQEE 3UZVB 4WWKA 4ZNCD 4IRJB 3JWDH 3RVVC 3MV9A 4AT6B 5ENWA 1S9YB 5DJ8B 2DLFL 1E4XH 2KKQA 4HUWA 3L5HA 4JN2B 1SVZA 5F1OB 3ZTJH 2GUOB 2CUIA 5E8EA 3OGCB 1HSAA 1NGWB 1WBZB 2AABH 3KG5A 1JWUB 4OZIF 5HHXH 2AQ1A 4HUXA 1D5XA 4U3CA 2CRMA 3BUYA 4UT6L 4P3DA 4LLMB 1D5ZA 2X1OA 5DQDH 2CKBA 1RHHB 5GGTA 5EUOE 1NAMH 1DR9A 4R4NC 2Y6SC 1FPTH 3VXOB 1F4YH 3QDMD 4V1DE 5IKCB 1FNEB 4ODUA 1QFUH 3P4MB 1DBML 2IFGA 4PRIA 5A40E 5FM5O 5CBAA 3QUYA 3TCLB 5H37G 3QDGD 4TSCL 5IMOA 4X5XA 1ZT4A 2NX5A 4WHCA 4DVBB 4JEGB 1MCRA 3KJ6L 4DTGL 1S7WA 3PIQB 1JGVH 2E8ZA 1NBYA 1INDL 4XX1E 1CXHA 2R0ZH 3TWCL 3C5ZA 4J3UA 4G9FD 5J9PA 1KCVL 3VGEA 4GAGH 1OHQA 4GAJL 5HYSA 4WJ5B 4Z0BL 4JN1H 4HPOH 3EOTH 4MMZC 1UH3A 3PGFH 4C4KO 2V9RA 3H42L 5KANI 1G6VK 3MLVH 4MA8L 4FQ1L 5CZXD 5IBUB 4JRYB 4XC3L 4K94L 4M3JA 5JPMB 2H9GB 1CFQB 2CPCA 3MO1B 1U95B 1BFTA 5L9DH 3RWJB 1GC1H 3BGFB 3LN5B 2MPAH 4DZ8A 1JZ8A 4RDQF 1XGTA 1EAPA 5ESAA 4POUB 4QGYA 3GHEH 1DVFA 4UV4H 2FGWL 4L4VB 3FQNB 3UBXB 2W9LA 3QIWB 4HIEA 2V7HB 1CN4A 4N5ED 1EFXD 1T20B 2B20A 2IMMA 2CDFA 3PGDA 4U1KA 5BJTA 4JGJA 1A9BB 3OKMB 4AM0A 5CEZE 5CS7A 4NKQB 3OKEB 2NW2B 1I3GH 4U6TA 1BBJB 5I1KH 5IQ7H 3SEPA 3G6AB 5C09B 1LO3H 3MSPA 3DX6A 4MLIA 3W0WB 4FXLA 4UUJA 4DWHA 2PKDA 3GMLB 1JNNH 1JGDB 3FQWB 3MBEC 4JR9L 3SDYH 5GRJL 4HZLA 4NQXA 2XWTA 2LFGA 1CFSB 1RUAH 2H8PB 4P57A 1KCUL 4XTRC 2H6PB 4F3FA 4WO4D 2QQNL 4PGBB 1A6ZA 5DMKA 4YZFE 2DM4A 3X3GL 1ZHKB 1UM6H 5DJCB 2DAVA 2EDLA 2R2HB 1FFQA 3NFPB 1Q9OB 5E7FA 3VWKA 4JG0L 1WZMA 3BN9C 1CK0H 3CFJA 4OZGE 3UTSA 3VFVA 3HNTL 1MLCA 3JTTB 3GRWA 4TUJA 3LS4H 3MREB 3BGMB 4JY5L 4Y8AA 1UENA 5FCUH 2VE6A 2A6KA 15C8H 4I4WA 3NTCH 5I8OL 2P8PA 2IAMD 4B50A 1DBJL 4GW5A 3DARA 2J5LC 1ZEAL 4UAOB 1YEIL 1CL7I 4LSDA 1WZ1L 3UBXI 3KPSE 4M7LH 3HC3H 2BVOA 2XA8L 3CGTA 3TN0B 3EFFA 4OFIA 1T83C 2ATKB 5ETUB 4QTIL 5DK2A 4KTYA 2HFTA 4LSTL 3RZCA 1YC8A 2XZAL 1OQOA 2I07B 2IFFH 1J7VR 1NKOA 1UCBL 4H5SA 4QEGA 5C0DA 3HNVH 3P30H 1FL5B 1BFVL 3BE1L 2IALA 3ETBF 4JVUA 3T2QA 4D9QD 2OMBA 1OB1A 2EDKA 4PJAF 2EKSB 4WFGE 2D31B 4Y1AB 5IVNA 4LK4A 5KVFH 5JTWA 1J1PL 1G9NL 1G7PA 2FBOJ 4M6NL 2V2TB 1Y6NR 4JFFB 5IB2A 3C5JA 5D70H 2NY0D 5JPNB 1B0RA 1YN6A 2ZCKH 3L5XH 4XPTL 4L8CB 4N8VA 4YFLF 1WTLA 1E4KC 5T1DL 4KKCD 3ULVL 2X4QB 5DHXB 2NQCA 3QI9A 1BVKA 5B21A 1CDGA 3QUZA 4M7ZB 4POYA 5C0RH 1X5LA 4CDGC 1UA6H 4WV1B 3IRPX 4I3SH 4X9BA 4NNYB 1SMOA 1OSZA 2F5AL 3ARDB 2Q20A 1R3IH 2DJSA 5IQ9B 5CWSB 5J6HB 3RNQA 2IBZY 3RL2B 4NRZB 2BHYA 1KJ2B 4HGWB 2XNAA 2X4RB 4B7IA 2NY3C 3QIUD 2H32H 1F4WL 5DMIH 1E6OL 1YNLL 4WGVB 1CGSH 1KTDB 1KFAL 5KANG 5TQ2H 2P1YA 4PYGA 1X5HA 4QXTB 2IWGA 1BOGA 2E9WA 5F7YC 3BPOB 5DDHA 4ZYKB 4E9LA 3SDXB 5KTEL 1XCTB 3NIDE 4LVHC 1A7BA 1WAAE 3VH8G 3OJVC 3VXQA 4I48B 2J88L 2DQCH 3CLFH 4E5XA 4LIQE 4Q0XL 4U1IA 4XH2A 1I3VA 3LQAC 3O4LA 4MAYC 4XBEL 2BHZA 2EC8A 4ODVL 4ETYA 5IP4A 5F7EL 4FOMA 2WINB 4P46C 1KTLB 4FQQA 3VXUA 1XR9A 2UWEA 1SYSA 3SE8H 2BP3A 5T3XD 1S7XB 2NY6D 2JJTC 2IAMC 1NAMB 1PYWB 3QWRD 2GI7A 1UM4H 2P45B 3VGBA 1FZKA 3NFNA 1VEMA 3KLDA 2OTPA 3WN5A 3DIFB 1WBXA 1P84J 3DMMB 3TJEH 4DAGL 3IU4H 2P8MA 5EOCH 4YBLC 4K9EH 3V4VH 1MRFH 5IG7B 5I1HH 1YMME 5DD6B 4HK0B 4HJ0D 4NQDD 1I8IA 3BWAB 3HZYA 3MUHL 1AXSB 2X89A 3B5TA 4GRWF 4HH9A 4XHJD 1LO5A 4PGCA 4KKAD 5D71L 3TEUA 1TPXC 4AEIH 1KEGL 5I9QC 3K7UA 1WWBX 3BJLA 3PWJB 1D6EA 5E4EC 2X1XR 1I9EA 5GGVH 2P5ED 4WY7L 1A6TB 3QG7H 3VI4F 3LSOA 4MMXC 4L3EB 1K8DA 5F93C 5IBUG 3QDAA 1MVFA 3GSXA 3X17A 2YS4A 3PHQA 1OAYL 1RK1B 2W65B 3KNBB 3PF2A 5FB8A 1SJEB 1BAFL 4R6UA 3VXNB 4Z76B 1E4XI 5D96C 3PDGA 1CU4L 5C71A 5DVKA 4JB9L 5F7WC 3VFWB 2FZ3A 1Z9SA 1RJLB 4I3RL 5E2WL 3ROOB 3QQ3A 4LASL 4PGDB 5DF0A 5FM4A 3ZMRA 4RGNE 3UBXG 4WU5A 4NQUA 2IMNA 4OD1H 5E2JA 2Z93B 1BGXH 5B38B 1JHKH 1RV6X 4C56B 3GSUA 4PJCB 3JWNC 1MPAL 2CD0A 1NANH 5F1SA 2EDOA 4JDTH 5B8CA 2EYTB 4JPIA 3SKOB 3C60C 4WFED 4NO5A 3OX8B 2HT3C 3IXAB 2X7LA 1G0XA 1AGDB 1FAKT 4MD0A 5KG9A 4TTDC 2R2BB 4NRYA 1A7QL 2XZCL 2E9BA 2ITCA 1LO2H 1NJ9A 4EKXA 2EZ0D 3HTLX 4X4ZA 4Q6IA 4ZODA 3RZWA 4XP5L 4XPBL 2W0KA 4JJ5A 1N7MH 4URTB 1P5UA 4H88L 5BV7H 1FIGL 3SDDD 2H2PD 2O5XL 3S36L 4HKBA 3MNVA 2AJVH 3JV0A 5DUPL 2NMSA 3KPOA 3B8SA 1QLRA 4PLJD 1PKQE 4GAFB 5EN2A 3ZT7A 5MEND 3VFUA 4Q58C 4Z5RA 3KLAB 2ZZUT 1NGXB 5GRUL 5B8CC 4P5KB 1XGQA 3DUHA 1I8LC 1T21B 3KXFB 5T1MB 1Y18A 5JXEC 4ZQKA 3WFDH 3MUJA 3PE9A 1I9IL 4FG6D 4Y19B 2R15A 5GRVL 1JZ4A 5GPRA 1FNSL 3MRCB 4XPGL 5SWZB 3V0VA 5C2BL 3VXPA 4MX7A 3B4NA 2XXMB 3LPFA 1GIGL 4PLKD 4TULL 5DEFA 3MV7D 5IJVA 4N68A 1U58A 4DKFL 4W4OA 2JTDA 1L6XA 4JFDD 3RU8L 4HLJA 2BY2A 3NCYP 1IRAY 2Y36L 1EBPA 1KCKA 4OLVH 4X5WA 5CJQH 2FSEA 4X6FA 1D5IH 1S7QB 3O2DA 4XVJL 3MRMA 4N0UB 2CLZB 4ODSL 2W91A 4KKBC 1G7JA 3B9KB 2DQJH 1OSPH 5FK9B 1MH5A 2VITB 3BPLB 3ZHLA 3MLYH 5BOZG 3T3PF 1F4HA 2YRZA 5IVXF 3O6FA 5C07D 1J10A 2YD1A 4Z7UB 1CD8A 4M8QA 2ILLA 1OTTD 3VFNB 2GSGB 4GW1A 1S78C 5DZNA 3BZFA 4LBEB 3CVHA 3OHXA 1DLHB 2BSRB 2YK1L 1G1CA 2VDQH 3U4BH 3QISA 3REVA 3QDJB 3LKSA 3Q5OA 5I74B 5GJTL 1NGQL 2IH1B 4WFFD 2I24N 4H8WH 3DBXA 1J05B 2BVUA 4JFEA 3U36B 4YEFA 4PRPE 3VDCA 2VUYA 4P2QD 2UV3A 3GSNA 3C09B 2HFEB 3S3PA 1TVHB 1FJ1A 1KJ3L 2FLRT 2D9QB 1FAIH 5I1DA 5J1AB 4AENA 4KDVA 4UMGA 3OBAA 1N6QL 4H26B 2RFXB 5GGUB 1D9KD 3WNKA 3MXVL 1XF2A 1P7QA 4K7FB 4PJ7A 4CMHB 3AS3A 1AO7A 3EKCA 4OF5A 5H94B 4RIRB 1PEZA 5E95B 4GQ9L 2AK4D 4TPRH 4CJ0A 5KS9F 4JFOA 4Y5YA 1I7RB 1BF2A 3T65B 3U9PH 4NQCE 2VDKH 2R69L 3W9DB 1A9EB 5IB3A 3GMMB 3MJ8A 5IT2L 1A47A 3R4DA 4OLWH 3SPVB 4E41B 2X9YA 2YXFA 1IGTB 4XAKE 3U46B 4RAVB 4X8JB 2W92A 4OUOA 4DEPB 2XTJE 3MTRA 5B22A 4GSDH 4PJHA 5LWYH 2YUWA 4WU7A 1VFBA 5TF1H 4FNLH 1J1OL 1M7IB 2RCSL 5FKPA 4LPYA 1AC6A 2BNQD 2NY1C 4Y0GA 4P2RE 4BKLB 1JI2A 1H5BC 1IAIL 1O0VA 3HC0B 5F7FA 3DVIA 2HRLA 4Y4HC 2W9DH 5DR5L 1E27A 2I9LA 3TYFA 5FECA 5LGHH 4UB0L 4JHWH 1RVFH 2Q8AH 3ILQC 4G6FB 3W82A 4LPUA 4NKOB 2Z4QB 4ZS6C 3ZO0A 4YHIA 1VFAB 3O41B 2NY4D 2X42A 2IANA 4OFPA 4PJBF 5IJKA 3NCYS 5DJ0B 3VXTB 3P4NB 1EXUB 4NJ9L 4KJQC 5HGAA 1OAZH 5K59F 5EU6D 2R23B 3INUL 4OZ4B 4XVSL 1NBZB 4ELKB 3OF6A 4L3AA 5F7UA 2BC4B 1ZWIB 1FL3B 1HHKA 6CGTA 1UB5A 1SVCP 1JFQH 4GKSB 3QEQD 5HYJE 3EHBC 3SJVB 2HFFA 3QNXB 3WS3B 4MXWL 1I1AD 3ARBB 1MCJA 1MCNA 1UXSB 3B2VL 3L1OL 1T04B 3SGEH 1QPPA 1OCWL 3EZ8A 5LBSH 2W1NA 3BYYA 2BDNH 1T1ZA 3NZHH 5I16A 3CJJA 4ZD3H 1INEL 3KWWB 5IJKC 5MHSD 2WWMC 3IJHA 4KQ3H 4NWUL 2A9MH 3PWLA 1OWWA 1N6VA 1OL0A 2MWCA 2QKIA 5D7SL 3TO2B 4OLUL 2A6JA 3ZDZF 5L2KB 5EUOA 1KGCE 5IHZB 2X70A 3R06B 1HCVA 3DX8A 3RVWC 4WUUB 5B38G 1U93B 2EE3A 1EVTC 4PJ8B 4U6HA 5HHOB 3HZVB 4S1SL 4QRSA 4OIBA 5C08D 3MLXL 4XWGL 4X0KA 3TZVC 2KPNA 5ALBL 1WBYA 4Y16B 1WZKA 4DJMA 3QO0B 4UBDD 5INDB 5D1XD 3GK8H 2OR7A 4L8BA 4O51A 4FFYL 1A3LL 1A6WH 4N9GA 1HEZA 1IKNC 1FZOB 1JUFA 1MHEA 4U6VL 4ZFZA 1AR1D 5DRZA 3RA7L 5TJWK 5BQ7A 2AXHA 2CJUH 2F54A 1ITCA 4L9DA 5C3LD 5BV7B 2AJXH 3RNKA 4NZTH 3U7AA 3W9EB 5TE7L 3B3IA 4ZUUA 1OT1A 2OTUB 4BELD 3P4LA 3H9SA 4FTVE 1I7TA 2V5RA 4ELMA 1MCLA 5C0BD 4AJ0A 2V2WA 4PGEB 2AV1B 2WLYA 3ULVE 3PP3H 4NKMB 5DJ2A 1JHTB 1I8KB 4F80A 2AEIT 5DTFA 1YEGL 2HN7A 1I1FA 2GJ6D 3ZYJA 2VISB 1WFOA 2IQ9L 1XGRA 1F58H 1FH5H 1N4XH 2QR0B 4ZUSB 2NZ9C 1MIML 2HWZL 2Z0BA 3WFCL 3LIZH 4NUJA 1BQHA 4PJEA 3QEUA 1ONQB 3T4AB 2FIKB 5F72S 1V3JA 3LQAH 4X6CA 4YQXH 1DEEB 2HP4A 1RZKH 1PG7W 1M71A 4X8XA 5DJ6A 5BVPL 3HE7D 5EIIA 1XFPA 3L95A 5CP7B 9CGTA 5DD5L 1CQKA 2QBWA 1FNAA 3WNOA 1U0QA 2ICEB 3FMGH 1LNUA 2FEEI 1NANI 1TDQA 1SM3H 3EIFA 5MP6L 1BEYH 1QO3B 2B1HH 1F6LL 1RFDL 4KDTC 4O58H 3NGBB 3ARGD 4PG9A 3S9DB 3T1FB 4IMKC 2QEJA 4MJID 4JKPH 2RB8A 2JELH 2J8UA 3MLZL 3O9WA 3VGGA 5EU3A 4JCLA 4EN3B 4F8QA 2D7NA 3HRZB 5IFAH 1IILE 3Q1SH 1G0DA 2AJYH 5IK3A 3L3DB 4KHTL 4ORZC 5CJXA 2HJKA 3FB7B 5BRZE 1TZHA 3MNZA 1LEKB 4IDLA 3LRGA 1MRCL 4YBQD 4OZGA 1OM3H 4J1UA 5CILH 4ZUTB 1SMAA 1U8PB 3FQRB 4JQXC 2QHLA 2PXYA 3BMVA 5D1QA 4LGRB 4WHTA 5E08H 3U2SB 3K3QA 3SBWA 4NZUL 3AM8C 1YECL 3VFGL 3FHQA 5GGSB 1UWGH 5JHDE 5FO8A 4LSSL 4ODTH 4AG4H 1ZGLA 1ZLSL 3D39E 3AXLB 2AEQH 4F9PA 3PABB 5D7IE 2CO7B 2HJLA 1UYWH 2JCCE 4BSJA 5I1AA 1FFNA 5KAQG 5IMMB 3DX9B 4ZAKA 2W59A 4U05A 1G6RA 4XNMA 5AD0B 5KVEH 1A1NB 3FT3B 4OCXL 1X4XA 2HT4D 2R0WH 3QQNA 4Q9CA 1GSMA 2F8OA 1RIHL 5D1QC 4F9LA 3OKLB 3IFOB 5IEHB 3HE6C 3OXRA 5LG1A 4HUUB 3PWVA 2R9HC 3QZWB 3T77A 4XNYH 4F7MA 3KDMB 5IBTL 3D3VA 5D2LE 1Z0MA 4NFDA 1M05B 3BXNA 2BNRB 3DYOA 5KN5A 5IIEB 5J1TC 4YPGA 3MBEB 4DK6A 1X7QA 1BVLA 3EO0B 4OCSL 5AUMB 3FHAA 2AV7A 4HIXH 3WO3B 3S7GA 4YHNB 4CVZA 1ZVHA 2FJGB 4GUPB 5FOBA 4RMWA 2XN9A 1T0NB 4Y5VB 2DLEA 1HDMA 4OTXH 5E8NA 1DE4B 1QFHA 1HXMB 4MAUH 2HG5B 5GS2D 3QHFL 3FO2B 4DOHE 5D7LA 3TYGL 4JFYA 1RJYA 2EDHA 3WIHA 2CLRA 4HQQH 2HLFD 5GZND 2EYRB 1M6OB 4G8IA 2VLJD 4P59H 2DM7A 3QEHA 4XCCH 3QFJE 5FO9A 1YYMH 1JZ5A 4ZUWA 4U33A 2PW1A 2D7TH 3IDXL 3ZTNH 1CL7L 3SDCC 3MRBB 1J11A 3PDDA 1RZGA 5JIIA 1TTGA 1WAAA 2BMKA 4LNVA 4U1SB 5FYKL 1EJOL 4K07A 2J5LB 5BO1L 1TJGH 4LQFH 4DGYH 3HC4L 2FO4A 4I5BA 3L6FB 4AIXA 4X6DE 1FFOA 2BOCA 1EGJL 1NSNL 3CX5K 2FJFB 4QT5B 4QYOB 4YDJA 4MCZA 4OLYH 1HH6B 4LDEB 4CKVX 2OMNA 4JFPA 5FGRA 3HI1B 4FXGB 5IFHH 4RX4D 4LCYA 2V17H 3RWCB 1K4CA 3OG6B 2GCYA 3TC9A 3RUGB 5EIVA 1YEDA 4P4KA 2G9HB 4PG2C 2O61A 3IB4A 1H0DB 2BCKB 3MLSH 4PRDA 1EVUA 4QNPF 1OTSD 3NAAL 5F7KC 3RWGA 4HSQA 3KPRB 2X4SB 5FUOL 3EJYD 4LSRH 1Z2KA 2WP3T 4JAMA 3ZKXC 4U7MA 1UQSB 3C9NB 1ORSB 1F3DH 5HHMD 2VSDA 5EPMB 2VZOA 1NFIA 1T0MB 3G08B 5C0EA 2WSKA 3VXRB 3WIIL 4YHZL 3L9RB 4JPKH 1AGFA 3HRPA 3BHBA 1KCRL 7CGTA 2OX5A 4NIKB 1YEFH 2DYPB 4LCWB 1YMMA 5C6TH 1N26A 3CFKA 1MHHB 4WI9A 1J8HA 5FYJD 5IEKB 3IETA 5EOQL 1DBBH 1V3LA 1U8QA 1IEAB 5I8KL 4AQ1B 1T1WB 3BUTA 5CJOL 5F96L 3TNMA 2FX9H 3LQZB 3V4UL 4XAWL 4OQTA 4WWKD 2R0KL 4RGOL 3BVNB 3MV9D 4HS6A 3UAJD 1VGEL 1LEGB 2ZJSH 5C1MB 3K8KA 5T3ZL 1ZAGA 3NCFB 1MVUA 3WFBL 2IH3A 1DBKL 2WMPA 2GJZB 2FH8A 2IGFH 2NY3B 2PCPA 4YR6B 5C0IB 2VDMH 5LXGH 2FH6A 2DD8H 3O6KL 5C0GB 3NN8B 3SGEI 1P1ZA 1UB6B 2AJZA 4OZHA 3STZA 2AGJH 4JFQA 4BZ2L 2KZWA 4KUZH 4LVHB 3BRDA 1OP5H 2X1QA 5JW3L 2PW2A 1I1YA 2CR6A 3O3DB 5GS0D 1CICC 1RUML 2F53E 3L3JA 4UILH 5GGQL 1KBGL 4J3VA 4PRID 1J1XH 1OAKH 3QUYD 2NTFA 3BEVA 4MAYB 4TUOB 5L2JA 2A9NH 2ARJA 4QGTA 2D3VA 2Y06L 2NX5D 1RJCA 2ESVD 2I9TA 1VEPA 2VNCA 4P46B 2HVKA 4MS8C 1YQ2A 5JIPA 1CIDA 1IEHA 2Z8VC 4NHCL 3C5ZD 1C1EH 4GAYA 2IAMB 2V7NA 4OLXH 3CH8A 3DO7B 1CF8H 1AI1L 1C8PA 5C0CB 3AU1B 1CT8A 2OJEA 3C2SA 1U8OA 4E0RA 3WJJA 3G6JF 12E8H 3OAYH 5IB5B 4M1GH 1OARL 5JMOC 3NBNA 4HUVA 1WWWX 2LV4A 1OF2B 4R2GD 2ZKHH 5I17B 1OD9A 4YBLB 3KPLA 4PJ9A 4Z7OE 3S3JA 2YD5A 4L8DB 2PO6C 2A0LD 3ZDXF 3FFDA 3HR5A 1KIPB 3V6BR 4QWWD 3QT2A 5LAXB 1IGYA 2APTA 2NXYC 3HHRB 3UJJL 2W60A 5CHNB 1H3WM 3D48R 1GPOL 2P47B 5CUSH 4GG8B 5FHAL 1JIBA 4G80A 1T6VN 3EOAA 1KTRL 1TPXB 1DTUA 5I9QB 4TVPH 2FX7H 4K8RC 1DVFD 1FVDB 3QXWA 3LMJL 4KK9D 1CXFA 1FGVL 3PHSA 3UJIL 3JV6A 4H20L 2G5BA 2XFXA 3JWDL 4S1RH 5ICZB 3KLSA 5GIRA 1E4XL 2Q7YB 4WW2F 4FA8A 5ITFB 2NY0B 3LKPA 2IG2H 4AZ8A 1KPRB 4YHLH 2JK5A 1OGTA 1HHGA 5F1NB 5H2BA 2AABL 2YMXH 2E5EA 5T1LB 1CCZA 1GGTA 3RKPA 5HHXL 3QWOA 1C12A 2KBGA 4A6YA 4BH8A 3PHOB 3VU2A 3LRSB 4KVNH 5DQDL 1BZ9A 3FT4A 5DEGA 1NAML 2OL3A 1FPTL 1LO4H 3SE9H 1F4YL 1EZVX 32C2A 3DXAB 5F9JA 5JDSA 3M17B 3DUUB 3F6LA 3BH9A 3QDME 1QFUL 1CVRA 1P4LB 1M7DA 3OWEA 5E6ZA 1L9NA 3GZKA 3CXDH 1LK2A 2PTVA 4XCYA 2KZ1B 3BQUC 2QSTA 3QDGE 3QG6B 4KJYA 1L4IA 3VXMB 3UROR 3C60B 4NYLA 3VWKD 1QRNB 2R4SH 1JGVL 4KPHH 4LEOB 4PJAE 3HCVB 2VB5A 2R0ZL 3UTSD 4BYHA 4GAGL 1VADA 2DI8A 3QZWG 4JN1L 5J7CC 4HPOL 3EOTL 4NKDB 3FB6A 4ZTPH 3ARVA 3PGFL 5FM8A 3MLVL 1NLBH 2CDGB 3I9GH 2GFBB 4FFWC 2CR3A 2XTLA 2HTLC 5TH2B 2L7JA 3E0GA 1A2YA 2D7MA 4PRPA 5TGBB 1P6FA 4YAQB 3MRQA 3LKOA 3QCTH 4EI5D 3LN4B 5L9DL 5DK0A 1GC1L 1GGCH 2MJWA 2VDNH 2MPAL 4KQ4H 5F3BB 2YC1A 5DI8A 5LKNA 5DFVC 3OGOE 1N59B 1OW0C 3RZCD 3TJHC 5CIPH 4JHZA 3UYOD 1BPVA 3GHEL 1EHXA 3QIBD 3RIFK 4UV4L 3QAZC 2VR4A 5E5MA 4R7NA 2ADIA 4FQ2H 4OV6F 5I19H 1MI5D 1R5WA 1S9XA 5GRXG 1AC0A 3IFLH 3D18B 4NQCA 2APWA 4U1HB 1MSPA 4X9HA 2C4FT 1JPFA 3MLWH 3VMOA 2ZCHH 4NNPH 4WW1B 1MCSA 1I3GL 5K9KA 6FABH 1FSKC 5HVHC 4JY6B 5I1KL 5IQ7L 3G5ZB 4XNZC 1LO3L 4NM8H 4X6EA 3R8QA 2YUVA 5KSUA 2DQIH 5EOTB 1MFEH 3JTSA 2J8OA 5DQJA 4PBWD 2AXFA 2OR9H 1JNNL 3SDYL 2I27N 4P2RA 5AYQA 1RUAL 3QI9D 1T3FB 1R3HA 2FR4A 2WBJC 4LRNH 4MZ2A 5D93C 3U6RA 3MROB 4PTTA 1UM6L 3T2OA 2VZ3A 3NFSH 2M26A 4R4FH 3B5HA 4YIQA 3LH2H 1Z9LA 3E6FB 1CK0L 4EDXB 1C7SA 5CSGA 3EOBB 3LS4L 4QRTB 1F6AB 4A2LA 2ADFH 5FCUL 2QQKH 3BIKA 1LD9B 15C8L 3NTCL 1LQSR 1ZTXH 4X4ME 2H26A 3ARPA 1IFHH 4YNYB 3STLB 5ISZA 2CLVA 3BH8B 4GRWE 3MCG1 4XC1H 5A2JH 3FAXA 2QADC 3U83A 4S2SA 1JZ6A 4MNGB 1LK3H 3ROLA 4M7LL 2LTQC 3QUMB 2R4RH 3C2AH 4P9MH 3HC3L 4JM2C 4WEBH 1QVOA 5DJAA 3ZKQD 3ZKMD 5ANMA 1UG9A 3FONA 4UDTB 3SE3A 2IFFL 3GSOB 3HNVL 3P30L 1HILA 5E9DB 3TBYB 3H9HB 3IDYC 4KTEH 1A5FH 1F3JA 1S7VA 3UPRB 3O45B 3CSYA 5CGTA 1MFBH 4RZCB 1KN2H 3BP6A 3DROA 4N0FB 1KPVA 4U31A 5KVFL 5KZCB 3GSVA 1HYSD 1QSFE 2XT1B 2ZG1A 5KSBA 5KBNC 4OD3H 5B3NA 1GZPA 5D70L 4U6YA 1A3RH 1EZVY 5D7JD 2ZCKL 3L5XL 1BWWA 2NY1B 5T5NG 1H5BB 4BFIB 4IMLB 5CSZB 4MXQD 3H6JA 3PDOA 4WDIA 4Y4HB 2V9TA 1R3KB 4NHUB 1UT9A 3SGKA 3LKQB 5C0RL 3GM8A 5D9SB 1YEEH 4JFDB 3L7EB 1UA6L 4I3SL 2X4UA 5FYLD 5B4MC 4OI8A 1R3IL 4OCLC 3AS0A 3FO1B 4L3CB 2Z35B 1FIEA 2H1PH 5KSVA 5SV4A 1OGAB 1JP5A 5D1ZD 1ZANH 1Z0NA 1OPGH 2VDPH 5DMIL 5IFJA 3T0ED 1CGSL 3NIGE 2J12B 5TQ2L 1IC7L 4YC2C 3T0BA 2IF7A 1CGUA 1R3JA 4FTVA 1V7MH