4HGMA

Shark ignar variable domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TRVDQSPSSLSASVGDRVTITCVLTDTSYPLYSTYWYQQKPGSSNKEQISISGRYSESVNKGTKSFTLTISSLQPEDFATYYCRAMGTNIWTGDGAGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shark V-NAR
publication title Atypical Antigen Recognition Mode of a Shark Immunoglobulin New Antigen Receptor (IgNAR) Variable Domain Characterized by Humanization and Structural Analysis.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Immune system
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgmA00
1FNEB 3L7EB 1VFMA 3VFTA 2P5EB 5H37G 5A2FA 5EBGA 25C8H 2MCG1 1M7IB 1FZMA 1K85A 1CLZH 1CL7L 5DMKA 4HFWA 1LE5B 3IFOA 2F53E 2Z93A 4MNQE 1MCOL 2ZUWA 1SBBA 3M17A 1EV2E 3MV7A 3B3IB 1U3ZA 2BC4B 3JV0A 4PGJA 4EVNB 4KRLB 1IGFH 1A6UH 4Z7QF 5EU4B 1FLTX 1ZXQA 5IMKB 2Y7QB 4G6KL 2XNAB 5IHLB 5TPWH 3ZKSD 1LO4L 5EB9A 5HI3C 4O2CB 1I7RB 2MNUA 1HIMH 3SE9H 5HHQB 3PV6B 3TWCH 5ECJE 4JQIL 1BBJA 3UDWC 3RJQB 3ESUF 3G6AB 3PWLA 3B2VH 2A38A 4YQXL 4NUGH 4M7ZC 3CAFA 4OGAD 2LU3A 3R8QA 1QSED 1P4BL 5DFVC 4U7SA 1OCWL 2BOBA 5F7LB 3LN5B 5GS1B 1P7QD 4ORZC 4XWOC 3WXWL 3IKCA 5LBSL 5DUML 1UENA 4YNYA 1EIBA 2EIDA 4R97C 2EDHA 4K2UH 1TIUA 2C7UA 4UTBL 5HHOA 3WFHB 4M1CC 3LPGA 3EO1B 5CEXB 4LMQI 3E1F1 4BQ9A 5J11C 3FO2A 3KLHD 5BV7H 4X7TB 4ZAKB 3GDBA 3MV9D 3F58L 5J13C 3QEQB 1VGEL 4JCMA 4JY6B 5JOPE 2X42A 2OBGA 3QUXA 2P43B 2F19H 4MJIE 2HMID 3VD3A 5GGSA 4IRZL 2A6JA 1EEUA 3HNVH 1UXSB 2B1AH 5K33A 4GW4B 1MREH 5D2LB 5C6TH 5SWZB 4XBPB 2LV4A 2XQYG 4UIMA 3SOBH 3T08A 3TO2A 4EDWH 5BMFL 1SJHB 3C9NB 5GGUB 4ZOBA 4L1HA 2V2XA 2O5XH 5ALBL 4LIQH 2HWZL 1T5WA 5L88L 1CWVA 1UYWL 3MBXH 1HZHL 2VLRE 4PS4H 4MWFB 4RRPA 4FABH 5EFIB 4MA7L 3BP4A 1XF3A 3IU4L 3EOAA 1BVZA 1MCNA 1JIBA 1OTSC 3SY0A 5T5FH 4HS3B 3RBSA 3UROR 2PO6D 2JIXB 2N7BA 1XF2A 4KKCD 2H8PB 4Z7UB 5E4EB 3PF2A 4JGMA 2P5WD 4Z7VB 3AAZB 2D31B 3MUHL 4LNVA 4X8JA 5MP6L 2K9UA 2NY7H 4MDIB 5EULV 1AGEA 5GSRB 2FCBA 2J8OA 1C5BH 2XA3A 4Z7OE 4NZRH 4XVUC 3BP5B 2PW2B 4XXCC 3EFDH 3KPMB 3EYOA 4EXKA 1EHXA 5SWSE 3MFFB 1AO7D 1BQLL 1YEJL 3G5YA 3TYFB 4PJEB 3OR7A 1C12A 3KDMB 5IFJA 2D7TH 4HBCL 5ETUA 4Z9KB 3LPWA 4K3DH 4OZFH 1Q0XL 1WWCA 2X4TA 1AFVH 3P9LB 4IMLB 5F9JB 4UT6L 5JMOC 4X80L 2N1KA 1X5ZA 4NHUB 4DZBB 2VR4A 2NXYC 3RVVC 1ORSA 4J4PC 3ARFA 4H26A 5T1LA 3W39A 4PGDA 1CXEA 3O3BB 3MO1A 5HGGS 1DQLL 2AJSL 3VA2C 1NBZB 2YWZA 5I71C 4WWID 3O3DB 1MPAH 1V5JA 4PJ7B 1HH9B 3CCHA 1I3RB 3TN0D 5DJXB 5FA4B 4CW1A 2OQJA 1E4KA 4MCYB 3PP4L 1UADC 1NGQH 5GIRA 5C0CE 4OF5A 1U41A 3MXVH 3LSOB 4UQ3A 2NTFB 1U93A 4JANB 1F13A 3FFDA 4EBQH 2JJWA 3TIEB 4ZD3L 5A43C 1W2KT 4QTIL 3VFRB 2FR4A 3BFOA 2E5EA 4WI4A 4EI5A 4QXGH 2YXMA 1W0WA 4O58L 3DO3A 4JZJA 4Y5YA 1VFAA 4KDWA 1FFRA 1FNSL 2XWJA 5BZDA 2Z35A 1H3VA 3QO1A 4CN6A 1CFNB 4M7JL 3EO9H 4MAYA 2YMXH 1W0YT 1QKZL 2NX5E 3ROLB 1SYVA 1B0RA 2ERJC 3VRLE 5ITFA 3O2WH 3UZQA 4Y4KD 5EUOA 1J05A 1PSKH 3K8MA 4WFHE 5B8CC 2FNBA 1H8SA 4JJ5A 4IEFB 3JWDL 1R5VA 1DUZA 2Y36L 4FG6D 4DN3H 4ZNEE 1T66C 4WW2B 2NY0D 4GRLA 4FQCL 2DIAA 4I18A 3O8XA 4G3YH 1G7LB 4ZS6C 2VITB 1JPTL 2V5MA 1QLEH 3GSWA 4F7PA 2DDQH 4XGZA 1BJ8A 3NVQA 5MEND 2FJHB 3ULUF 2YSSB 1AC0A 2G9HA 2N56A 4TTGA 3RTQC 1J0JA 4P4KA 1LDPH 1TTGA 4JM2B 1DCLA 43CAA 3QDGE 3EDDA 4LLDB 5FGCB 4LOUD 1CBVH 1ONQB 4DJMA 4O2EB 4C56D 5GZNC 3SDDC 5JXEC 3PWNA 3T2NH 3CJJA 5EU6A 4LARH 1I9JL 1LD9A 3FB8A 3MV8D 4B7IA 4NN6C 2XFXA 1OLZA 5IM7A 4DGVH 1YA5A 5H35A 3ES6A 3FCTB 1A7RH 2FLRT 1RAMA 1EJ6A 3SDCB 2PR4L 3DRQB 4OSUL 4PYGA 4RGNC 1LO0L 1OW0A 2NPLX 1A3RL 5E2WL 1QSFD 5BRZE 5DRZA 3HI1B 3D25A 2DQFA 2VDMH 1ZLWK 3U4BH 3CFBB 5HI4C 4Z7UF 1ZWIA 4MA3A 3GSUA 3HMXH 5E7BA 2W9DH 3GHEH 4Z7VF 1F4HA 1KPVA 4DW2L 2QHRH 4P2OD 5MERB 3X3FL 2AK1L 4YWGL 5HGDB 2HKFH 2DIJA 3OKYA 1N6UA 3GJFK 3OKOB 4V1DD 4UBDC 3HN3A 2NY5L 1G6RA 4U3XA 3EYUL 1XGYH 3VH8B 2ADIA 1B0GB 2VC2L 3MA7B 2LE9A 3P4OB 2MMXA 1KN2L 2VLRA 3EUUA 4AIZA 1HK6A 3SCMD 1A7NH 2WP3O 3LDBC 1ZLWH 4UDTB 4KI5D 2NY6C 4HWZB 5BXFB 5F7UA 5IR1B 1NEZG 2P7TB 4LCYA 4NQVB 2YZ1A 1YECH 4CVZA 1MH5B 2XTJC 4NBXB 3S4SB 2A6IB 1CIUA 1H9VA 4LCCA 4ZPVA 5IFAL 3VXUB 5FYJL 1KC5L 3TYGL 5IQ7L 1X3DA 4X0KA 1A7PL 5A3ID 1HNGA 1P4LA 1LE9A 2N7AA 2XN9A 4IRSA 4ZUWB 4IMKC 2Q76B 5FECA 3P4MA 2UZXB 1UT9A 3QDMD 4F57H 1P1ZB 5DMJB 2OI9B 2VDNH 3KLAB 1PKOA 2X1QA 1WAAE 1T7WA 2PXYB 3MOBL 3C6SA 2GW5A 3IJSB 1U92A 4C83A 2WBJA 1WSST 4L4TE 1OGAE 1W0VB 1NLDL 1QEWB 2Z8VC 3OAUH 1UEYA 4LLVA 1RJZA 1FFNA 3B5GA 4QOKB 4LVHB 3ZYOA 1WEJH 1TZHB 3MRPB 1CLYL 4JFFA 3PIQA 4QRUA 3LCYA 4WI6A 2XKSA 1CLOH 1CR9L 4X99A 5L2JB 2ARJA 3GSVB 1UKSA 4KJWC 1JP5A 1IEHA 2PTVA 3QFJE 5JIIA 4LHJB 2R2EB 1QRNE 3I9GL 1H0DB 3P77B 4I77H 4M9OA 1LEGA 3RVWD 2OJZL 2FL5B 5T1KB 5E8NA 3K7UA 3LRSA 5ALCH 2H2PD 4PRAB 1EHLH 3HCVA 2R1WA 4Y88A 1JZ6A 4OZHB 1E4WL 4JZNB 4PGBA 1A6TB 4WW2F 4OZIE 3GBNH 1HSAA 1G7PB 4Y16C 3T0EE 3WSQH 3D3VE 5CZVH 3JTSA 4LPVA 1P5VA 4I3RL 2Y5EA 3SDXE 3HLAB 5J89A 2FJFB 3EZJB 1XGRB 3S35L 5J1SC 2WNGA 1BD2D 4HUKB 4F15C 4B7LA 2LQRA 4JG0L 4M3KB 1DBKH 2I5YL 2AEPH 4HWEH 1ZT4B 3P11H 2OXGA 3QISA 1KLUB 3TO4A 5DVKA 1JF1B 1CGXA 4GMTH 1JYXA 2ITCB 2GTWB 4NKIH 2HFEB 3IDYB 1R3KA 1KFAH 3D0VB 4NJAH 3RRQA 1KIRB 4CJ1A 4U1HB 1Q8MA 3LQMA 1QLRA 2YUXA 3QUMA 3TZVC 4OD3L 4J3UA 3PHOA 3PWPD 2R8SH 4ZNEA 2AJ3B 3X14A 1NAMA 4OD1L 2WZPD 1IT9H 2AGJL 2ESVD 1YN6B 1YMMD 4HIIB 4KZEH 4NKMA 4XMKL 2ICWB 3QUYA 3UTZA 1N3NA 1X5GA 4ODWB 5BW7C 3PWVB 5DT1H 3GJEA 3PDOB 1QVOA 5FB8B 4OIIH 4P2QA 1T0MA 3RWGA 3TNMA 1EEZA 5DJ6B 4Y19A 1TZIB 3QAZC 2PCPB 5J6HB 1LNUA 4OTXL 2RR3A 5HHME 3BW9B 3O6FC 3BP7A 1CDBA 1ZLVK 3WFDL 3S6CA 4XPBL 4AK1A 5JNYA 3IJYA 4YDVB 4PJ9B 2A73A 2BSTB 1KLGB 3LS5L 5K59F 3CFEB 5DO2C 1R5WA 4FFVD 1HCVA 2LAAA 2NCMA 5TE4H 2DWDA 2VE6B 4XP5H 3CMOH 1ZGLA 1F2QA 4PP1C 4H20L 1FL5B 1ZTXL 2V7HB 5MEOB 5D9SB 5KSUA 3TIDA 3MFGB 1AXSA 2X4QB 3QWRD 3NPSB 5CAYB 5BRZA 4JHBA 4GSDH 2E7CA 5JO5A 3GMLB 1IZKA 5HHNA 3ZDZE 1G0XA 2PYED 3CDGB 1YNKH 3OJDA 3GRWH 4L9LB 4H1LB 2BVOA 1NGXA 4JFXA 4XXDA 5KVDL 2WUBH 1NBYB 4G7YL 3MJ8B 5FCUH 4HIEA 4JDVB 4UAOC 1G9NH 5GRWA 4LIQE 4DAGL 4ZYKA 4N8VG 3L3OB 2BNQE 4CAGA 1K2DB 5D2NA 3IJHA 5F7KC 2ZCLH 5I2IA 2QSTA 1JWSA 1CXLA 3E0GA 5DFWH 1WFUA 5DSCB 3GMQA 4J3OC 4Y2OA 5EO0B 1T21A 3FFCD 3HKFA 3H42L 4ODXA 5E2TL 1NFIB 4YHML 2BNUA 1NUGA 2HFGL 5T3XE 4QHLB 3FQRB 5EZOL 5DQDH 1FNGA 4L4VA 2D7MA 3P4NB 2VDPL 3BIAX 1T22B 3DYMA 2FH8A 3HR6A 3MLUH 1QP1A 1HI6A 2OTUA 2CKBL 2B2XH 4QHUB 3S34L 5JW5B 4OGYH 5AWNH 5F93C 5K9KA 1NSNH 2A83B 5T1DH 2Q86A 1FVCA 3TBWA 5BVPH 3PJSB 3M07A 2IBGA 4DKEL 1DQDL 1CF8H 1FAKT 1LK2B 1YEFH 1ZE3C 1I9IH 4P5TB 4AMKH 1I1YB 1FN4A 4OZHF 6FABH 2AXGA 3IDXL 2Y06L 5CIPH 3W11D 2NXYD 3R4DA 3RVVD 2VL5A 2CK0H 1TENA 3JXAA 2DLFL 4L4TA 4WO4D 3NCYP 4B53A 2VAAA 3QIWD 4OKVA 3OF6D 3SPVA 1CXKA 2BHYA 1RK0A 2HYMA 5JW4R 2BFVL 3KPLA 4GG6B 1JNLH 4HT1H 1J0YA 5FO8A 2DI7A 3UYPA 1WF5A 3IETB 3GB7A 3ULVE 4QRRD 2P8MB 1MI5D 4XHJC 1FH5L 3DUHA 1WFTA 2VO5A 2HA1A 3MUY1 3P30H 2V5TA 2Z31B 3HZYA 3PABB 5BQ7B 4G6ML 3VXTA 1YEDA 4JDZB 1L0QA 4RMQA 4I48A 1J7VR 3WEXB 4FQ1H 3HG1D 1NEZA 1HQRB 3GMPB 1WC7A 4JHAL 4UOW0 4O2FB 4JPKL 4U7MA 3MLTB 2AI0H 4WWKD 1KTRL 1WIUA 4CGTA 3BEWB 4LLMB 8CGTA 3IDMA 3GSNB 1JMXA 3SGJC 4TVPL 4P2RB 3MRQB 3GUTA 4K9EC 4JHZA 4XP6H 5LQBL 3WS3B 4RAVB 1T66D 3FN9A 1IRAY 4YHKL 2XWTB 5DJAB 3KS0H 3GI9H 4PG9B 4APQA 2JCCE 4FTVE 5ISZD 3W2DH 1WCBA 3TA3A 1MHCA 3EYQD 1NMAH 1YN7B 5EZJA 3AREC 4UILL 4A2LA 4G9FD 4AM0B 2DQCH 3RTQD 5DMIH 3KPRE 5HYJA 3HZVA 2ZKHL 1EBAA 1EA9C 5DF0A 2QSQA 1E6OL 3KYKH 3EDJA 3FRUA 2VLJE 4N90E 3BN9C 5IF0A 1D9KB 3TBVB 2WINA 2IMMA 5DC9B 1UJTA 4LNRA 1VDGA 3HC0B 2Y5TB 4U6VL 3V52H 1TDQA 4ZFGL 1N6QL 1BIIB 3RPIA 2XT1B 3VFPB 3DVNA 2RFXB 5CJ5A 5KSVA 3UZVB 1DBJH 3WLBB 4Z0XA 4JFPA 1X5YA 4GAYB 3DETC 1NGWA 4WHTB 4WUUB 1DVFC 1INDH 3F7VA 2Q8AH 2XV6B 4LLWA 5HVFB 2Y07H 1T1XA 5IB2B 2R1XB 3D2UD 3WS6A 3SKJL 1UEMA 1IE5A 3TPUA 4XB7A 4LPWA 5I1IL 3WLWD 4UBDD 5ICZA 1AIFB 3V5DB 4JAMB 3V7AG 5FYJD 1CL7H 1WZ1L 4N0UE 1MCOH 3ILPA 1MLBA 4NRZA 3K8LA 5FDYA 3TCXA 3RDTD 5B3JE 4P48A 4JFDE 2ATPA 5C86A 1HHJB 4EUPG 4G6KH 5JA8B 3MSPA 2FHFA 2NY6D 4PV9A 2V5YA 3VGDA 1LO4H 4JPIB 4OCSL 1XCTA 2F8VA 3HR5A 5MEQA 1OAYL 3ARSA 3U79A 4JRXE 2BNQA 3EJJX 4W6WB 3O9WB 4JQIH 3VGFA 4GRMA 4TTDD 4YQXH 1NFDB 1UCBL 2RIKA 4LHQB 5IW3A 1EFXB 2X4NA 1P4BH 4AL8L 2KH2B 2W0PA 3MRBB 1BMGA 1OCWH 5EWIL 3LVEA 4K23L 1OGTB 3WXWH 4N9GB 3H9SA 5DUMH 5LBSH 5JHDB 2QEJA 4F7MA 4J8RB 1MCBA 2ZUXA 1HSBA 3KHQA 3UJJL 4UTBH 1AD0B 1OF2B 3ARGB 1CYGA 4WI7A 3T04D 2ICEB 3VA6A 5DGQA 2R2BA 5KSAC 3B5HA 3F58H 1VGEH 4X5WB 1KBGL 4L8DA 1ERNA 4KJWD 3C60A 4ODBD 1JV5A 2Y9RT 1R24A 4RA0C 3IB4A 2YA2A 4JLRA 3D39B 2X5PA 4LLYB 1FZJA 1A1NA 4FQQA 4X5XA 2H45A 1NC4D 4NFDA 5FO7A 5BMFH 3L3IB 4Q2ZA 4GS7B 4QWWC 3W9DB 3PWJA 5FYKL 3VJ6B 5IJKC 3DHJA 4OD2A 4N8VA 5ALBH 2HWZH 3T2PA 5L88H 1IKFL 1UYWH 1IC1A 1MQKL 4QRPD 2PYFB 1HZHH 3BGMB 5T5NG 2HJFB 4PTTA 1WBYB 3NAAL 5GGVH 3BVNA 5GGRB 1ZT7B 4MA7H 3IU4H 4S0TD 3VXRE 2YBRB 2NYYC 3S3PA 3RNQA 1U8KA 5IHZA 3RI5K 1GAFL 3NA4A 3QHZL 4IIQC 4EIGB 5CEYB 3ARBD 3CH1B 3MV9E 4NO5B 5CWSB 3VGGA 4W4OA 4PY8I 5A16A 5MP6H 1KACB 3MOQA 3T4YB 3IS0X 4KC3B 4G8GB 4P23C 5JPMB 5C3TA 5CUSL 3HNTL 3QG7L 4KDTA 1BQLH 1YEJH 3FQUB 4UINL 3ZTNL 4HKXB 1F3DH 5D7JB 1F3JB 5FOBB 4OV5B 1AGDA 4HPOL 4UB0L 3MUJA 5DD1L 1RK1B 1OSZA 3MRIB 2ILLA 1Q0XH 2QQNL 4UT6H 3GMNB 5B38G 4X80H 2B5IC 4KUCD 2CDGB 3MODL 2H2SC 3KPRA 1UH3A 1WK0A 4P4RB 1DQLH 2AJSH 2CDEA 4X7CC 3O6FD 2BY3A 5DMKB 3C8KB 1Q9OA 3ZYZA 2GYSA 5BS0B 2P5WE 4ESKA 5J0BA 2GJ6D 3D6GA 5HDLA 1EVTC 3PP4H 3EYSL 4KQ3L 4M9PA 4YC2B 1IILE 2FEEL 1T20A 1T1YB 3MLSL 5E1HB 1S8DA 5F9DC 1WBXA 1UJ3B 4ZD3H 5FDWA 3SDAD 1AO7E 5FKAA 2XPGB 4OGXL 4QTIH 3UPRB 5T3ZL 4OFKA 1ZAGA 4TVSa 4OUOA 4NCDA 2UUDK 1AGCB 3HRPA 1S7RA 4HJGB 1OD7A 1TQCC 4O58H 4YX2L 4PJAE 1T80A 2HLAA 4R6UA 2YRZA 1FNSH 3LHPL 5TDOB 3ARPA 4XC3L 3BKML 4M7JH 5H94A 3U0TA 1QKZH 3SHSA 3EFFA 4LLUB 5CCKL 2DM2A 3B9KA 4KRPB 3UTTA 4EJ1C 4PJXB 4JDTL 5HHOB 3OZ9H 2BX5A 4N0UA 2JB6A 1JGVL 1HOCB 1CDIA 3JWDH 5LXGL 3C6LD 4MB3A 2AQ3A 2Y36H 1UZ8A 3QBTB 4LPUA 4ZXBC 4FQCH 3L5IA 3FTGB 2RJMA 3MNVB 1U8HB 4JKPL 3RX5A 3DGCR 4I3GA 2X1OA 1CICB 4HZAA 4NN5C 2IPTL 3OBAA 5KS9B 1I1CA 1X5XA 3SJVB 5JDJA 4HKBB 3WUZA 4Z18A 2X9YA 4XX1E 4K3HA 2LU4A 4UIMB 2IH1A 5IB1A 1X4YA 1CCZA 4LSRL 2V2XB 5E2UL 1P7KA 4TUOA 4CL7A 3CVHB 4KKBC 3TVMD 3GIVB 4IBLT 3GJFA 1T03L 3QIBC 2YPVL 3EDEA 1I9JH 3DX7A 3BIKB 5D5MB 4POYA 5HVHC 3BP4B 3RWCA 3VG9B 2W0KA 5DZNA 4M48L 1QR1A 3BXNA 5I8KL 3OSKA 5B4MC 1RZJL 3PV7A 1VADA 4ODSL 1ZVSB 1OWWA 2VLKA 1NFKA 5ABDE 1TCRA 3N1QC 2PR4H 4OSUH 3WL9A 4RGOL 1LO0H 5KG9B 1A3RH 4D2NA 5E2WH 1SY6L 4URTB 1T3FA 4C59B 3ZKNC 4DUXA 2AJZA 3VFWA 4X8JB 4Y4HA 5DD0L 4LU5L 5MENE 5F7WC 1AGEB 4X98B 4ZUSB 4DW2H 1ODAA 2MWCA 3U30B 4TVPD 4JRYD 3BYYA 2GUOA 4GXUN 3X3FH 2AK1H 3STLA 4YWGH 2ADJA 5DJCB 4EUPA 5L8JB 5I30L 5JA9A 3OKNA 4P2YA 4F33A 3E6HB 2NY5H 1EGJA 4R7DA 3EYUH 3ARQA 3C08L 3OR7B 1C12B 1GZPB 2VC2H 2XKNB 1L9MA 2WANA 3IF1B 4HIJB 1KN2H 4OBSA 2YZ8A 5D71L 2BRRL 2P42B 2PXYD 2X4TB 4IHOB 1I3GL 3VXRA 3MV8E 4R4FL 4K7PY 2H26B 4Q0XL 1LP9A 5J9PA 3P73B 3IGAA 4QCIB 4KWUA 4PGDB 3T2QA 4CNIA 5HYIA 4K94C 2C3HA 1S7UA 4ELKB 3QWOB 2UZIL 3MV9A 3MBED 5TFSL 1H15A 3W5MA 4U1SA 5IFAH 1IAKA 4U1LB 1QSFE 3V0WL 5FYJH 4CW1B 1KC5H 4NRXB 3TYGH 5IQ7H 4G5ZL 1A7PH 2FO1A 3VFSA 5IEHB 4HQQL 1IGJA 2VUOA 3SKOA 1JNHB 1U93B 5AAMA 2XWBA 1AQDA 3AXLA 4WV1B 3QIUC 2OJEA 1LGVA 2OSLA 4NOFA 2MQ3A 3LY6A 3MOBH 5DRNA 1GRWA 4L8SC 2R1YA 1HILA 4K94L 1M71A 4KQ4L 1NLDH 4NBZB 4JZJB 3U2SA 3BN9D 5E5UB 1WBZA 1AI1L 4JO4L 3VXMA 2WBWB 1CLYH 4JKLA 3RA7L 4HK0B 4KI5E 1E27B 5DJZA 3DJ9A 4Z76A 1CR9H 3U7YL 1LP9F 2H9GB 2MKLC 2CR3A 1OM3H 3U4EA 4ONHB 43C9B 3GO1L 5D6DC 2X1PA 3I9GH 1MCPL 2NR6C 1J05B 2F53B 4MNQB 1D5ZB 3IXAA 2OJZH 4MJ4A 5IV2B 5IVXA 4CUCA 2BVQA 1HHGA 2D9CA 1J0HA 3WJLC 1DUZB 2IQAA 1PLGL 5GRXG 4F2MA 2Q7YB 4QF1A 5I6XB 1E4WH 1V3KA 2GK0A 4O9HL 1YY8B 3QDME 5E6IB 4Y2DA 4LDOB 4FQLL 1DBAL 4MMZC 3CDFA 3HE6C 4NQDA 2GSGA 1LEIB 4I3RH 5E00A 3MGTA 3BH8A 1OTTD 4PJAA 1K8IB 3S35H 3N1MC 4I13B 4JG0H 1EO8L 1EUTA 1GGIL 5HHPA 43CAB 3RWHA 2BNRA 5EUKA 4UNUA 1DE4A 4RX4A 3CD4A 4OQTA 2VRAA 1OARL 2IADA 5F89B 3UBXI 3HA0A 1MFDL 4D3CL 5D6CA 1UKQA 3HE7D 1A9BA 2F58L 3FOLA 1BWMA 1N2RA 4PJFA 1PX3A 1MWAB 1I9RL 3LKPA 1AKJA 4LSTH 1XFPA 2C26A 3TN0A 4ELME 4OD3H 1R5IB 3ES6B 4RGMC 5IVXF 1FRGL 5B38A 4JO2L 4PTUB 4OD1H 5C0GB 3FT2A 4GUPA 1J10A 5CSZA 3QI9B 2AGJH 4WFED 2QADB 3KS0J 4XMKH 1MJ8L 3D25B 5I1KL 3NIDF 1QYGL 3PNWB 4MJIB 2XZQL 4JVUA 4MA3B 1Z9LA 5EIIB 1LK3L 1KPVB 4FMKA 2DYPB 3MR9A 1HYSC 4LF3B 2CK2A 4Y5VA 3BSZL 4OTXH 1BD2E 4A6YA 1C7TA 3U1SL 5FYKD 4CMHC 3HS0A 4XCFL 1ZHKA 3ZHKA 3WFDH 2VISA 4DEPC 3U6RB 3NBNA 2ADIB 4S0SD 4XPBH 4BKLB 1CG9A 3LS5H 3IDGB 4HIHA 1A7QL 2X6MA 1TPXC 2EXWC 1U8PA 4PJFF 4YXKL 4BFIA 2WW8A 4IJ3C 4DK3A 1T0NA 2FZ3A 4H20H 5EOTB 3I84A 3PWPE 1H3XA 3OJVC 3F62A 3L3GA 4ORGA 1XR9A 2WMPA 1SEQL 2VLMD 4JFQB 1I4FA 3QUXC 2ESVE 1G7HA 4OUUA 1MHEA 5LCVL 1YMME 4GW1B 4RMSA 4NQED 3PGCA 3HAEB 5MENA 5L2KA 4PGZA 1JWMB 2Z91B 1GPOL 3N1GC 1K4CB 4NKQB 5GRJL 4HG4K 3ARVA 4LQ1A 4PPTA 4HMDA 5KVDH 5SWSB 1AXTL 4JKMA 3Q3GA 5I1DA 2JB5L 3V5HA 4DAGH 4FHBD 2R0WL 5F8QC 3HRZA 4UMGA 3BD5A 5CMAA 4JQXA 4C58B 1RJZB 4PG2C 1A14L 3EO0A 3H42H 5D1QB 4WEBL 2HFFB 5E2TH 3PIQB 3G6JA 4YHMH 2CLRA 2HFGH 1RSFA 4P23D 1YYLL 4PLNC 2NMSA 3PQYA 5EZOH 5KVMC 1TJIL 2NLJB 5FYLL 1KYOK 1LEGB 2CIIA 3RZCD 2VDPH 2ZSWA 5TDNA 1L7TL 1QSFA 1CDHA 1BQHB 3ILQD 1EJOL 2R0ZL 3I2CL 3S88L 2CKBH 1S7XA 3S34H 3BDYL 3ECBA 4FNLL 4MNHA 4Q74A 3LRSB 1FL3A 3RP1A 2PYEE 1WICA 5C0CB 2R1WB 1OOAA 4DKEH 1DQDH 1IVLA 1MJUL 2QR0A 1I1AA 3IDXH 1Q1JL 2WWMD 2AV7A 3OR6A 2A1WL 4LKXA 2Y06H 2BSSB 5T3ZD 5IKCB 4KMTL 2GY5A 4FXGA 2H2SD 3QUZA 2DQDL 3RL2A 3NACL 2XQBL 2DLFH 4OLWL 1CL7I 5HGHA 3DIFA 1EK3A 5DJ8B 3FFCE 2BFVH 1Q94A 4P0DA 4H5SB 2QQLH 5GS1C 3U9UA 3ARFC 4D0BA 3G6JF 3LN9A 2NX5B 4U0QB 3B6SB 2KKQA 3HPLB 3QSKB 2AQ1A 1R3KB 2G5BA 1TVDA 1FH5H 5ICYA 1FPTL 4GKSB 2VLLB 1MCEA 1X4XA 2YD5A 5DJYA 4G6MH 1FORL 3PHOB 2X1WL 2UWEE 4U33A 1MEXH 3BHBB 5ADOL 4ZAKC 1NAMB 4QNPE 4M8QB 4IOFC 3KVQA 5IMOA 3D5OF 4JHAH 4M6OL 4NQXA 2B1HL 3QUYB 3ULUC 3UTZB 4JPKH 4P46C 1N3NB 3C5ZA 4KK9D 4S2SA 2BY1A 2HP4A 3BEVA 1UVQA 4FQXB 4PJHE 3ARTA 3TNMB 3MRLA 5C2UB 4TVPH 3QDGB 1I3UA 4X7EC 4ZO6A 1J1XL 5LQBH 1OVZA 4ENED 2ZZUT 4YHKH 5CGYD 3ARDD 4QRRE 4NKOA 2K1MA 4U1NA 4NCC2 5J3HC 1MI5E 3DXAA 5CD3A 1V8HA 1UZ6E 5DURD 4RFNC 2DWDB 3V5KB 2AXFB 3ULUL 4WJ5A 1HXYA 3VCLB 1MF2L 3FT3A 4UILH 1JTPA 4PRNA 2DJUA 3NCMA 3GNML 3ZSSA 4M61B 2RBLA 3HG1E 1F3DJ 2ZKHH 4Y4FD 1E0OB 4JPVL 1G0YR 2ZPKL 4MNGA 4ONOA 5BRZB 1FIEA 1E6OH 1ND0A 1N5AB 5JPNA 2C1PB 3H9HA 4BJLA 3HUJA 4KKBD 2WQRA 4XMLL 4MJ5B 4NNPL 5JORA 1W72A 5GGTA 3UYOD 1N6QH 3QIBD 2IBZY 1IKNC 2HT4C 4JFXB 3FB5B 4LSQL 1KN4L 4Z7OF 5B4MD 3BD4A 3FAXA 1MCJA 1A1OA 3VDBA 4U2ZA 2YPLD 4ZYKB 3C5JA 2GCYB 2HN7A 1AQKL 1TZGH 2E8YA 3IJHB 5FGRA 3P9MA 5ISZE 3MOAL 3PP3K 4N0YL 4I0PD 3PGFL 4ZFOB 4PRHD 1HHKB 4UNVA 2D0HA 5E1AB 3SKJH 1QBAA 3UDWA 4G9FE 5ESVA 1T0PB 5CHNA 3VWKC 5I1IH 3B5TA 4GAGL 3QXAB 1MAJA 4GBXD 4HIXL 3QUKA 3P3YA 4NO0D 3UTSD 1ETZB 2CPCA 2X7LA 1WZ1H 1KPRA 1I7TB 4PRBB 3HUJF 2B39A 3PL6B 4JFEA 3MV11 1JK8B 5DVLA 1WUNT 3PP3H 2NY3B 1LVEA 2PW1B 1N5YL 2FB4L 2IAND 1I3VA 4G6JL 4OCSH 4TNVK 1JGUL 4LGPB 1DJSA 1XF1A 1LO5A 2EKJA 4NDMB 1JYVA 1U58B 4L4TB 1OGAB 5KAQF 1IAOA 1MVFA 1A1MA 2E7HA 2NZ9D 4QXTA 5JOFA 3ZKXB 2H6PA 1OP9A 5I17A 1UCBH 4FA8A 1J1PL 3V79C 5C08A 4KK6C 4E5XB 3LKNB 4AL8H 5ANME 1U3HD 5ACZA 4X6CA 1ZT1A 3BQUB 4PJGA 3VI3E 1RZIB 3GB7B 3QFJB 4HD9A 4K23H 1SJXA 1Q0YL 1QRNB 4NP4L 4HW6A 3F6IA 1F45A 3UJJH 1G6RL 3HZYB 5FYJE 5EH1A 4DTGL 3VXTB 1YEDB 4NNYB 4WW2C 2CQVA 1T5XB 4KKLC 5MI0B 1NEZB 1OTUC 1IAIL 3LAFA 1ZEAL 4BK4A 3LKRA 3B2UD 4OZIB 3RIFK 4YGVA 4LLQA 1MHHA 4JFOA 1LWRA 1SVZA 1KBGH 3T0EB 3G9AB 3D3VB 5DQJB 5B39B 2OLDA 5DVOA 5IB5B 4QHMA 3DSFL 3SDXB 4EXPX 3NTCL 3MPCA 2V7NA 2QKIB 2NR6D 3IDMB 1GC1H 7FABL 3FAWA 3OXRA 4JM2C 5D1XA 2KZ1B 5FUOL 3GSRB 2AEWA 4I2XA 3OKDA 4AEHL 3GUTB 5ILTL 1C5CL 3PWUA 5KVEL 5FYKH 4NC1C 4WHYH 4X6CF 4PJGF 3FO0L 4XXCA 3I6KB 5JW3L 1MQKH 3WIHA 1YEEL 3F8UB 4O4YL 3SO3B 3NAAH 4JJHA 5IVZB 1AR2A 4UT7L 3ABZA 3LRHA 5CJ8A 5ENWA 4YHLL 1GVIA 2UWEA 1B4JL 3SDCC 3QQ3B 1GAFH 4KROB 2RQ8A 3QHZH 1XIWB 1NPUA 2X4PB 4BH7B 4NN7C 4N0RA 1GGBL 3V6OC 1P2CA 4YHIB 4J4PA 4PP2A 4CDHA 5J4MA 3TBSA 4PJHA 1PG7L 5CJBA 1S7QA 1PZ5B 3MV7D 5HHMB 1YYML 2V5RA 5FGBC 3K1DA 5CUSH 3HNTH 4XPGL 5KSVB 1DLHA 1HHIA 3QG7H 1BZ9A 2MQ0A 4F80A 2OTWA 4UINH 3ZTNH 4RQQA 3Q1SL 4LSUL 3T4AA 5DEGA 2HAZA 4U0RC 5EBLB 4ZOCA 1FVDA 1CTNA 5TGBA 4HPOH 4M6NL 4UB0H 4QRPE 1J9CT 5DD1H 2FH6A 1EO5A 4X6BB 1DFBL 2QQNH 4I5BB 1A6ZB 5BV7B 1HYSD 2Q3AA 3MODH 3VFNA 2NY2D 1JGEB 1JFQL 4HUWA 3KHOA 2R4SH 3VWJB 1J1OL 4RWYL 3CX2A 3THML 5HHOD 3EYSH 1DANT 2EC9T 3BD3A 4KQ3H 5DUPL 5C1MB 5HXMA 3O4LA 1DBBL 2ATPB 4MQXC 3UJIL 1T04A 2YUZA 3MLSH 4Z5RA 4ZSOE 3QUML 3P2TA 3VMOA 1KB5A 2OI9C 2VNCA 5F7EL 5DZOA 1L9NA 3O6ML 4Z7WE 3IS1X 5CZXD 5HBBA 3CVIL 4OGXH 1NAML 3DX8A 2BNQB 4KJPD 5T3ZH 2EEBA 3LEYL 3VRIB 1WAAF 3QUXD 1EDQA 3IDIB 4MD5B 4OLYL 1N0XL 1WFOA 4YX2H 1A6WL 1MSPA 3WFCL 2YKLL 3LHPH 3RGVC 5I1CL 3WNOA 4XC3H 4HXAL 3BKMH 2XZCL 3D18B 4DQOL 4G9FA 4X6EA 4K3EL 3GSNH 3HZMA 5FYLD 1I9EA 2GHWB 1TLKA 1OP5K 4IRJC 5DEZA 2VKWA 3NFPA 5CCKH 3F7QA 4RAHA 4UUJA 1MELA 3T0VA 2BMKB 2D0FA 4Q9BA 4ZS7L 3SDDA 5JXEA 2UY6A 1JGVH 2GJ6E 5LXGH 4JZOB 3MC0A 4HXBL 4PJDF 4LEXL 3JTTA 1X9QA 3MRKA 2R2BB 3H9ZA 2X4OA 5C3LD 4OZIF 4IOIA 4JKPH 5C0BA 1PQZB 4DGIL 2W9EL 1RHHA 3KPSD 1ZHBB 5IMMA 5JR1L 5T33L 2NXZB 1SM3L 3QHTC 1ITCA 1MCDA 1BHGA 3EAKA 4YK4B 2IPTH 5DD6B 3SDXF 4JLRB 1OP5H 3UAJC 2V17L 2WIIB 1A1NB 3K3QA 4FQQB 1A4KA 5BOZG 5IB3B 3MJ7B 5AZEL 3T65A 4LSRH 4GXUM 5E2UH 1YQVL 5I73B 1NGZA 3BUYB 3I75A 5DD3L 3WO4B 1T03H 1H3TA 3UEZA 2YPVH 4MQSB 4MZ2A 4G6AC 4DZ8B 4F37K 5I8KH 1RZJH 4DFIA 4MSWA 4ODSH 3H3BC 4JQVA 4W4NA 1KCSL 4YZFE 1G1YA 2FSEA 5E56A 3GBML 1OP3H 1XCQB 4RGOH 1ZA6A 1OB1B 2A74B 3ARFD 1YJDC 3BRFA 3JUYA 5T1LD 1SY6H 4OCWL 5HJ3B 4X4XB 4DWHA 5DD0H 5BJTA 4LU5H 3TGXA 12E8L 4BUHA 1T89C 4NCC1 3CIQA 1CDUA 3KYMB 4CKVX 3RWEA 4OZGE 3V6FB 1JYWA 1BZ7A 4FFWC 3X12B 2Y1VA 1JRHL 5I30H 4UU9A 2W65B 4QT5A 2WBKA 1S7WB 1MOEA 4UIKL 4PJ9C 2BJML 3C08H 4YE4L 3GK8L 4QGYA 5F97E 3RWFB 4IMKA 1XZ0A 2JCCB 3HI6L 5HY9B 3FQNA 4FTVB 1EHNA 2X89D 3CU7A 1CU4L 2LVEA 3ULUD 4KZDL 4P46D 5D71H 2BRRH 3NIFF 1CVRA 4EI5D 3DPBA 3IU3B 1I3GH 3X11B 1U95B 3DBXA 4R4FH 5DHVH 5BZWB 4EN3A 3B4NA 3CSYA 4Q0XH 3QO0A 2W1NA 4NBYB 4KHTL 3KPRB 4AQOA 2CKNA 2Q6WB 1UWEL 3NCJL 4MAYD 3L5JA 2BSED 1GH7A 2UZIH 4WU7B 1SVCP 5TFSH 2BDNL 1HWGB 5C71A 3CZFA 2VLJB 3C2AL 1BLNA 3V0WH 4CADA 4F9PC 4XTRC 3GMOA 3CSGA 4MXWL 4G5ZH 1MNUL 2R39A 2R4RL 5EG6C 5J3HD 4HQQH 3LN4A 4TVPE 4JRYE 4G42B 1L0XA 1WBXB 3ORJA 5INDB 2EE3A 2G5RA 3K74B 4S1SL 1NLBL 5HD8D 3GZKA 2WLYA 5FDWB 5AYQA 4GRLD 1H5BA 1NC4A 5I1HL 3O8XD 5F7HA 1JZ7A 5DHXB 2H32A 3SE8L 2F54A 1UM4L 3TA3C 1NC2A 4FZEL 4K94H 4KK8D 4KQ4H 4QRPA 2E9BA 3B83A 1IQDA 4Y16A 2OL3A 4PRPA 3IDJB 2QHLA 5I15L 1AI1H 3VFVA 4JO4H 3RA7H 5I8EA 3U0TB 3U7YH 4P4KD 5D96B 2ADFL 1I8IB 4DFHA 4Y5XB 1CD9B 4K55A 4LKCB 1AGBA 1CD8A 2X4SB 1X7QB 3GO1H 1VKXB 2EXYC 4JFZL 4RIRA 4AH2B 1MCPH 1IEAA 3S96A 5FKPA 4N0UB 1QSVA 1VFUA 3SGKC 5EU6D 1F2XK 1KYOJ 3GMRB 5GZOC 5FO9B 1TJGL 4OFVA 4JFDB 1PLGH 1RZ8A 4MD4A 3TZVA 4O9HH 1U8QA 5D1ZB 1MLCA 4JN2A 4HUMB 5DI8B 1U8MB 4FQLH 1YPZA 3OX8B 4JRXB 3S9DB 3QXDA 2P8PA 3VI4E 3TFKD 5C6PB 4LGRB 1P84J 3T8XA 3WNLA 5BW7A 1EO8H 3QZWB 3R0MA 5L8LB 1OARH 4FN0A 4D3CH 1MFDH 3TBTB 3ZTJG 2J5LC 4K7FA 4HKJB 5E03A 4HBQA 2F58H 3L3DA 2Z31C 3B8YA 3VGAB 2K7PA 3L9RA 4YBLB 1Y6NR 2XKUA 4G8FA 1I9RH 4XRCA 3I02A 2VLRD 1BFSA 1TVBB 4R2GC 1IZJA 1FRGH 3KWWA 3OGCB 3MUZ1 3KLDA 1SHMA 5C0RL 3CLEL 4JO2H 4RWHA 2P24A 5JLZB 1JGDB 1TCRB 4PJIE 3WL9B 1NDGB 1WTLA 1RJYA 1HINL 3QEUA 1MJ8H 4RAUB 5I1KH 2ZCHL 3DYPA 1QYGH 4V2BA 2XZQH 3ZT5A 1DQQB 2Q3ZA 5TH2B 1GOHA 5ESAA 1LK3H 5EU3A 2EYRB 1YPZF 1EXUA 3OG6B 5GSVB 5FEBA 4X7SL 2GUOB 4E42A 3G08B 3STLB 2ZOKB 3BSZH 3G5ZB 3U1SH 1F90L 2XN9D 3W0WA 4IRSD 3I6GA 4NHCL 4XCFH 4RA3A 5HI5D 3EGSA 3O2VL 1T6WA 4D8PA 1BFOB 4UDUA 5FF6B 1P7QB 2X9XA 1N59A 5EU7E 2HG5B 1X5FA 4BZ2L 1A7QH 2JCCF 1VACA 4NUJB 4DVBA 5EBMA 3WXVL 1S5HB 4KRNA 5JIHA 2WBJD 3EBAA 1MCQA 5F1IA 3VXRB 3QJHB 4HKZB 3UTQA 4KRMB 1OAUL 2EDDA 3QJFA 4JFFD 4CNIB 5EDXA 5K9JL 3MV9B 2EDBA 4WFEE 3EZ8A 2FEDC 1FZOA 5LCVH 1IAKB 4F7CB 1UB5B 3K8KA 3BPOC 4JREB 1R3LA 1F42A 2VSDA 3NFNB 3SDYL 1KCRL 3VFSB 1KEML 1GPOH 1KGCD 5GRJH 1IEBA 3W9EB 2LAGB 2XWBB 1AXTH 3NH7L 5CBAA 5FYKE 2HLFC 3JWOC 2JB5H 5EOQL 2R0WH 3UMTA 3RKDD 5DRNB 4LPYA 1RQ5A 1O7SA 3FQXA 4ZOEA 2JELL 4Z7NF 1QFPA 5L7XL 1IGTB 1A14H 4WEBH 5JW4M 1KUMA 3MROB 3REWB 4EI6A 3U46B 4KPHL 1G7IA 1YYLH 1P69B 3U4EB 5H2BB 5TE6L 1TJIH 2PO6B 3IFPA 4R4BA 3QCVL 5FYLH 3TO4D 2VLME 4YDIL 1L7TH 3S88H 1EJOH 2P5WB 2R0ZH 3I2CH 4U1JB 3ULVL 3BDYH 1HHGB 4FNLH 4NQEE 1IL1A 2IQAB 4X9GA 3VD9A 5FV2A 1T83C 4F2MB 2A9ML 4QF1B 5B3JF 3RNKA 1MJUH 1MFCL 1Q1JH 4PR5B 5C0FB 2A1WH 1AO7B 4KMTH 3E6FB 3O9WC 3ZE0F 4NT6A 3MZTA 3T0BA 2DQDH 4PIRF 4JO1L 1F11B 3NACH 1G7MB 2XQBH 4OLWH 3OXSB 4PJAB 1MCIA 3D0LA 1KTLB 1VERA 2C3GA 3BH9A 4QY8B 5EUKB 3FO1B 1WZKA 4P2QD 1DE4B 3UTOA 4Y19D 5GGQL 2AJYL 4OCMC 1ES0B 3LKSA 5D6CB 3VDCA 4M93C 3KXFA 3SGJA 5D70L 2F74A 3S37H 3ARGC 3OG4B 1F02I 5FXCH 4QRSB 1FPTH 4WI9A 3TN0B 3LKQA 1IMHC 1FORH 1F3RB 3DYOA 2XOTA 5ADOH 4PJ5A 4GUPB 4FQPA 4RCAA 1IBGL 3S35X 2VDKL 1GZQB 4M6OH 3AREA 1AR1C 1N7ML 2B1HH 4ETQA 3FO9A 1GSMA 5IOPB 3QDJA 5T3ZE 4L8CA 1G9ML 4Q6IB 1HH6B 5BRZD 5GS3A 3AU1A 3L3JA 2SEBB 4ZODA 2XZZA 3EYFB 2E7MA 1HDMB 3BAEL 4M4RA 1VGKA 4A6YB 2I9TA 1PKQE 4GS7C 5SWQA 2IEPA 1J1XH 2Z92B 3RVTC 2HT3C 2UVFA 4RZCB 2FX9H 4R96B 5DTFB 1RJLA 1EH9A 5TQ2L 5E8PA 4Y4KB 2CRMA 4BYHA 3ULUH 5JXAL 3ZL4L 2ZJSL 1MF2H 4ZFFA 3BKJL 1DVFA 1T0NB 3MRJB 4OCRL 2VOTA 4MA8L 3GNMH 3UAJD 4LSDA 2AKRA 1YC8A 2C3VA 1CDGA 3UBXB 2NY0B 1S9XB 1HKLL 4E41D 4JPVH 1UXWB 2YD1A 2ZPKH 1OAXL 3ARRA 4Z77A 3WDJA 2KUTA 3BI9X 2DB8A 1UB6B 3PGCB 4L4VD 5MENB 1IARB 3FONB 4XMLH 4LCUB 4NNPH 4KVNL 4XVTL 3EYVB 5DRWA 3TNNB 3VD7A 5I76A 1UC6A 4LSQH 2XRAL 1KN4H 3G5XA 2G2RB 3B9EA 4AT6A 5I1DB 5FHAL 3QNXA 3PHQB 2W60A 1KV3A 3HRZB 1WTGT 1FFOB 1S3KH 2IH3B 3HB3C 1AQKH 3K1KC 3LQZA 1PYWB 4OBRA 1OSPL 3BJ91 3ULSB 3FHQA 4ZQKA 3VRJB 2Q8BL 3MOAH 3LQAC 5K9OB 3EO0B 3MV8B 5C0DA 3NIGF 4I1NB 1FFPA 1IGIL 3DUSB 3MRGB 5DEFA 3WFZA 3WNKA 4ODUB 4H25A 1Y18A 3QB7C 3CPLA 4GAGH 1ADQA 2J12B 1R3JA 4HIXH 2BHZA 5TDNB 2VN4A 1QSFB 1ACYL 4MNHB 2CLVA 1JPFA 1IC7L 2AVGA 4YC2C 1FL3B 4KV5F 4X6DE 1S7TA 5LAXB 4P2OB 4ZDHA 2K7QA 1FV1A 5GPRA 1U9KA 2FIRT 3I3DA 3U0PA 3IYLW 2AV7B 3LQAL 1N5YH 2FB4H 5C0AA 4G6JH 4XT1C 5JW4Q 1X5AA 1JGUH 4GKNB 2YPLE 4LCWA 1JUFA 5H37H 4I9WD 4S1RL 2FJGB 5KSAA 3M45A 3TF7C 1WWWX 1XF4A 1UGNA 1RUPL 3OHXB 4ZPTA 5HYSB 3SCMB 1J1PH 3ARUA 4PRHE 4NZUL 2D03L 2AABL 2FEEI 2M8XA 3U9UB 4DCQA 1L0YA 4L5FL 5F21B 1A7OL 4LLAA 4XPAL 5ESQB 3TCLB 5I8CB 2C4FU 4KRPC 4XZUA 2QBWA 1P4IL 4NP4H 1Q0YH 5F9WB 1CD1B 4QYOA 3HPJA 3Q6FB 1EGJL 3UTSE 1G6RH 4APQD 5IJKA 4DTGH 4GRWF 1G0DA 3O6LL 3TA3D 1DZBA 1KNOA 3QHFL 1C08A 1KG0A 1ZEAH 3MA9L 5GJTL 5IMOB 2J8UE 4MZ3A 3V6ZA 4NQXB 4IDJH 1KIUA 5A1AA 1CICC 3QDMB 5LVEA 1U6AL 5HYJD 5EO1B 2IANE 1HQ4B 4XB8A 4BZYA 3EIFA 3DSFH 4IIQA 4LHUA 3NTCH 3O3EB 5EC2A 7FABH 5TE7L 4WNQA 1C5DA 4NRYA 5FUOH 1FZKA 4AEHH 4OFIA 1C5CH 1ULVA 4JO3L 4P23A 5ICXB 5KVGL 3CDCA 3FO0H 4HLZG 4NO3B 4NKOB 5JW3H 1YEIL 4X4YB 2FATL 1YEEH 2YHGA 3VG9C 4O4YH 3K2MC 3V7MA 5ID1A 4WJ5B 1EBPA 3EDKA 4ELMB 1YEHL 1RZFL 3ZE2F 4OLXH 4UT7H 1BF8A 4M43L 2Y4SA 4YHLH 1B4JH 4MJ6A 1JJUA 4FXKA 4P5MA 4LFHG 2CO7B 2GTZB 4Y2DC 4K3JL 3M8OL 1ND0B 3DMMA 2PKDA 5KSBE 3J8F7 4QLRA 3VE0B 1GGBH 2AXHA 3MJ9A 3KPOA 4UOW1 3U30C 1M7DA 2YXFA 4MA1C 4PJ8A 1PG7H 2GY7B 3I6LD 4R0LB 5IW6A 1BJMA 2VQUA 5B3NA 1BD2B 5CFHA 3Q6GL 1YYMH 4JGJA 4Z7QE 4XPGH 4R2GD 1GGUA 2CGRL 2NY4D 32C2B 4KKNA 3C5JB 3MRMB 3Q1SH 4LSUH 4FQIL 3VD5A 1AP2B 4QHNB 3MRNA 3KG5A 1MJJB 4OI7A 3IT8D 2BNQD 5LGJB 4EQ3A 5IBLD 1DFBH 1U2HA 2M1KA 1W8NA 3FOMA 3PWPB 2HVKA 5ESVB 1OAZL 1JCKA 1JFQH 4P49A 1CFTB 5F7FA 4X9IA 3TJHC 2ESVB 4PJCA 5E9DE 1YMMB 1KTDA 4OQTL 1J1OH 1A47A 3H9SD 3THMH 1NCBL 4KK5D 4C55A 1CE6A 4P9HC 2EDOA 5DUPH 4R97B 1DBBH 3UJIH 2GJZA 3QUMH 1RVFL 3VXNB 1QO3A 4MQ7A 3DSNA 4KJQC 2XIDA 1SYSA 5F7EH 4JHWL 5IHUL 3O6MH 4WV1C 1QQDA 3CVIH 3GFUA 1NAMH 3D87B 3DRTB 4ZXBA 3LEYH 4K8RC 3C60D 1A1MB 1U8IA 2FECL 4U6XA 3ET9F 4J1UA 1N0XH 4OLYH 4D0DA 2H6PB 1A6WH 3WN5B 5I17B 4LAJH 5DQ9A 2YKLH 4R3SA 3WFCH 2ZWLT 4Z0BL 3FQTB 5I1CH 5IESL 4HXAH 1ZT1B 2XZCH 4DQOH 3GGWA 4EDXA 4K3EH 4MVBD 4ISVA 4ZO8A 4NZDA 2FX8L 1RV6X 1D6VL 5TDPA 3ULVD 2HLFD 1K8DB 3BIBX 2EE6A 4ZS7H 2PYEB 4J12A 2HJLA 3JVGC 4HXBH 5I6XC 3QT2A 4LEXH 5AD0B 1TVHB 2YD6A 4FFZL 2VXUL 4QTHA 5E6IC 2RCSL 4DGIH 2YRLA 5IROC 1GYAA 5ELIA 5T33H 2A2QT 5JR1H 3DO7A 1SM3H 2YPLA 4QHMB 4YIQA 2V9TA 4QGTA 2EIZB 1FO0A 2ZG1A 5CP7A 3BE1L 4L8BB 1FNFA 4HC1A 1QOKA 1A4JA 3O4OB 2V17H 5DC4B 4Y8AA 1CFSA 3FFCB 4KJYA 4BZ1L 4HJJL 3T3PF 5F72S 3PWUB 5AZEH 4RFOL 2QTEA 1YQVH 4GW5B 4X83A 3S5LB 3JV6B 5FYLE 4XVSL 4H8WC 5J1TC 5DD3H 4DUVA 4NO0A 4X8XA 3RX8A 2B4CL 1YY9C 3MRCB 2NY1D 1JF6A 3FQWA 3VFOB 5ENWB 2UWEB 3U4AA 1VHPA 1WZLA 3HZKB 3QI9C 5LJYH 1KCSH 2J8UA 4PB0L 1XGPA 3GBMH 1XR8B 3DVGA 2W0FB 2O5YL 4GMSL 3KPRD 4F37F 5MEPB 3KPSE 4OCWH 2NXYB 4H0IA 4M6ML 4PP2B 2PTTA 4WTXA 2VWEE 12E8H 4PJHB 1MVUA 3RVUC 5E08L 4WO4B 1JN6A 1Q9WA 2X4UB 3QIWB 1EAPA 5IEKA 4LMQE 2EYTA 1AD9A 1BZ9B 1JRHH 3DUUA 1DSFL 4UIKH 3ZSTA 2BJMH 5DEGB 4YE4H 2HT2C 3GK8H 4QRRB 1DN0A 3D69B 3HI6H 1MI5B 4GKZA 1CU4H 5TGBB 4KZDH 1I85C 2IFGA 2IC2A 4XMPL 2VXSL 3QIUA 3WHXB 4NO2A 1UKTA 2EDLA 3WUWB 1YMHB 1ZA3A 2YC1B 4WI2A 4YHNA 1D5MB 1JHTB 4KHTH 4PGEA 3HG1B 2E6JA 1UACL 5FK9A 4BSWA 5GS0L 2L7UA 4F7TB 3NCJH 3K2UL 3VXOA 4D0CA 2VQTA 4K07A 4CMMB 2BDNH 1EUUA 4LAQL 4P57A 3C2AH 5F1NA 3D1MC 3B9KD 4PJBA 3UTTD 4WWKB 1MJ7L 4X6FB 4MXWH 1IGYA 1MNUH 2R4RH 5D6DA 5EORL 1I1FA 5H8DA 1QLFA 1LO3L 1T04B 5EO9B 5B8CB 1KB5B 4G8IB 4N5EC 3LPFA 4S1SH 1HEZB 1NLBH 4YHPA 1U0QA 4XBGA 5D7IA 1MCSA 3WJLA 5I1HH 1DUYA 3DX8B 2YD4A 3T77A 5ERWB 3DTXA 1LHZA 3DX9B 2AV1A 3SE8H 3FZUC 1UM4H 5C0IB 4FZEH 5ISZB 3DROB 3SQBA 4NYLB 5KVFL 1VCAA 5D1QC 2NW2B 3ULUE 2EYSA 3NCBB 2A6DB 5E94A 3QP3A 1HYRC 5J1AB 3HE6A 5I15H 1BVKB 4L3AA 4YFLF 3U7AA 4G9FB 1PW3A 1Q72L 1QBML 5F88B 3RTQB 1P5UA 2ADFH 3RUGF 4YEFA 5B21A 3GKZA 5E9DA 4JFZH 4WRLA 5E0QA 2O61B 3RL1B 4LPTA 4HHAB 3GSQA 5IQ9A 4PJBF 1YUHB 5EUOE 1TJGH 1KT2B 5BVJA 4TPRL 4TSAL 4XCNB 4YAQA 1XF5A 3BZFA 4Z8FH 3FMGL 4NN6B 3KPNB 3I50L 3I3BA 1WIOA 4MD0B 2VLKD 3CGTA 4ZUUB 1I7ZA 1Z5LA 5D7IF 1UM6L 3L95A 4MS8C 2ZUTA 2UYLB 4NNXB 4M5ZL 4X4ZA 2ITDA 4NQUA 4Q58C 4Y4HD 3TLRA 1KENL 1PVHA 1RIVL 1VFBA 2LABA 5ANMB 4HS8L 4RFEA 5I66A 1W72L 5GGTL 2YN5A 3T65B 4R7NA 3D2UB 3KPQA 1RUQL 2IFFL 3EJYD 3MGOB 4OGZA 1JZ4A 3VGHA 1I8LA 3GMMB 1V3LA 3LKOB 5EN2B 5DWUL 3RWIA 1VFOA 4ZUVA 3IXTA 3V4PL 5EU6E 4RMTA 3EOBB 5DDHA 3RDTB 5C0RH 3CLEH 3VXRD 3FT4B 3LDBB 4L3CB 3U7WL 3IVKB 2NY6B 1UH2A 4Q97A 1HINH 2VZOA 5A2LH 1E4XI 5EU5B 2ZCHH 4I0CC 4ZNCD 2GAZA 5C0JA 4BUGA 4FQXC 5CINL 3NZHL 2E9JA 1A2YA 4LEOA 1IAMA 4X7SH 1CT8B 1BX2A 1OQOA 1JZ8A 2E6QA 4Q9RL 2HTKD 4PRDB 4L3EA 3KNBB 5HHVL 3DV4B 1NJ9B 3VXSA 1BZ7B 1MIEL 1F90H 2FRGP 4NHCH 2YD9A 2D7OA 5DS8A 1BP3B 4U1MA 5INCA 2BVPB 4EQ2A 4HJ0C 3UTPD 1Y6KR 1BVLA 1N8ZB 3FQNB 3T0AA 3BWUC 4BZ2H 3QNZB 3WXVH 5I18L 2V9QA 2VXTL 4NQCA 3CFJB 1TQBB 1OAUH 1U8OA 3CSYB 3DOSA 3QO0B 4HGMA 4MLIA 3VXMD 4PG2A 4L1DA 4PREB 1FNEA 3L7EA 4TOYL 3O11A 5K9JH 4MDJB 4UTAH 2P5EA 5HGBB 3CZFB 2VZSA 3KPSA 4CADB 3ALPA 3PHSA 3GMOB 3EHBC 1EPFA 1A6PA 1P9MC 5T3XH 5CJXA 1M7IA 3SDYH 3NN8B 1KCRH 3AMLA 1E28A 1KEMH 1LE5A 5D1XC 3WIFB 5ITBL 3F7YB 3G5VB 3B3IA 5D7SL 2BC4A 4CN4A 4EVNA 3PXHA 1NC4B 3NH7H 4S1DD 5EU4A 4JY5H 2XN9E 5DMGC 5IMKA 1FL6B 2Y7QA 5EOQH 2H32B 2XNAA 1NH6A 3QPQC 4AEFA 1ZHNB 4Y2DD 5DJ0B 3V4VL 3VH8G 4I8DA 2YN3A 4QRPB 1FFQA 2JELH 4O2CA 4NQDD 5L7XH 5HHQA 3PV6A 3MCKB 2FO4B 4R4ND 3VFVB 4HH9B 4CBPA 4V2CB 1J11A 5IJVB 5I8EB 1BBDL 3G6AA 4HEPG 5EC1B 3RY4A 4IS6A 2BNRD 3TC9A 2V6HA 4KPHH 4MHHG 4NKDB 4RX4D 4JFFE 5TE6H 1S9YB 4HCRL 4RIRB 1IFHL 3QCVH 4FQ2L 1F4XH 1S7SB 1LILA 3ARBB 4U3CA 3LN5A 4YDIH 5GS1A 3TT3L 2FIKA 5IW1B 4ALAH 3ULVH 1QFHA 3PL6C 3WFHA 3WIHL 1AKJD 3MLXL 4ZSOB 2A9MH 3EO1A 2NY3C 1DQML 1KGCE 1OLLA 3QRGL 5CEXA 1MLCB 3QH3A 1MFCH 3LS4L 2C1OB 4Z7WB 1TXKA 5F7NC 4ZAKA 1BEYL 4JO1H 3TJHD 2AERT 1CGWA 2EDRA 3QEQA 4JY6A 1PGRB 2CDFB 4N9OB 3ZKXC 1CFQB 3VGBA 4I4WB 2X89A 3BMVA 3QRFM 5E24E 4P46A 2R9HD 2EEAA 4X7FC 2EDWA 4HDIB 4XNMA 1UXSA 3BQUC 1A7BA 4GW4A 5D2LA 5E5MB 5GGQH 1RD6A 2AJYH 3MRDB 1ACZA 1FLRL 4K7FB 5J8OA 4XBPA 4J7RA 1SJHA 3C9NA 3K80A 3QPXL 5D70H 5GGUA 3O6FB 1J87A 3MX0A 1I8KB 3MLRL 5K59E 2EO9A 1KOAA 4LASL 1NGYB 3VGEA 2GJ6B 4Q9CA 4WI5A 5IK3B 2P49B 5EFIA 2P24B 4NM4L 1IBGH 2YEZB 2VDKH 4HWNA 3T0EC 5C9JB 4DKFL 1C16B 1N7MH 1WWAX 2C4XA 3MXWL 3SDAB 4CU8A 2GT9A 1X5JA 3CXDL 1G84A 1RUML 2VIRA 1G9MH 4HS3A 2JIXA 4HS6B 1WV7T 2P4AB 3T09A 1K6QL 1NMBL 2H8PA 4Z7UA 5DK2B 3RIAF 1GIGL 3AAZA 3DARA 4Z7VA 3BAEH 1Z3GL 5L2KD 1MHPL 4MDIA 2YPKB 5GSRA 3TM6A 1SMAA 4WDIB 4WIQA 2V2WB 1SJVA 4P2QE 1IAII 1GCFA 4Y19E 3OKKB 3SE3C 5D2LF 3BP5A 2PW2A 1IKNA 3KPMA 3F12B 1KB5L 3MFFA 3TYFA 5TQ2H 3QFDB 3L5WB 5E2VL 4ZFZA 5F1SA 2CKBB 4DVBB 4NZJA 4PJEA 2P46B 3KDMA 5F1IB 3H8NA 3UTQB 5JXAH 1PEWA 2OMBA 3ZE1F 3ZL4H 2ZJSH 3BKJH 3C6LB 1VB9A 4OCRH 4C4KT 4MA8H 4KROC 4IMLA 2DQEL 3VXPA 1XIWC 1IGML 4ZMAT 5JUEH 1HKLH 4HV8B 3K4ZA 4NHUA 4DZBA 5E8DL 3GM8A 3H7LA 2W07A 1OAXH 3O3BA 3PQYD 2BSRB 3UC0L 4M7KL 1R3LB 1NBZA 2UV3A 3VWKA 2FYYB 3O3DA 4PJ7A 4KGLA 4KVNH 4UV7L 4XVTH 1ZHLA 1HH9A 3X13B 1IEBB 5DJXA 4G8EB 5FA4A 4MCZB 4OZGB 2X70B 4MCYA 2XRAH 5KTEL 2JKXA 5DJDB 3EJZC 5FHAH 3HTLX 1I1AD 3LSOA 2NTFA 4JANA 5GRZA 3TIEA 1FNAA 1A6VL 3TVMB 3FQXB 1OSPH 3F5WB 3QUZD 1FGVL 3CFDB 3VFRA 3OPZH 4U49A 2Q8BH 3MJ6A 1DP0A 4PJEF 5D2NE 3BO8A 3QEHB 2IPKB 3CK0L 4ACPA 4JQVC 3ZYIA 3E2HB 4NUGL 1IGIH 5GS0D 4R90L 3CFKB 2DBJA 1CFNA 4MXVF 4KAQL 2VN7A 4GJTB 4NIKB 4E41E 3VWJC 1H3WM 1QRKA 3MRFB 1FAIL 3ROLA 5DJ2A 1ACYH 1FVEB 1GGCL 3DVIA 2HT2D 4AENB 1SEBA 1IC7H 4L4VE 1F58H 3GJFH 1CD0A 2WIMA 4PJ7F 4JRYB 4YXLL 2R29L 2GITB 4W68A 4H1LG 3LQAH 4WW2A 3L7FA 4YXHL 4P5KA 3TBYB 4DK6A 4Z7WF 4YDLB 5CJOL 1S9VB 2VITA 5I75C 4S1RH 1FJ1A 1AGFA 2FBOJ 3C5ZD 1N4XL 1BPVA 3F7PC 1RUPH 4YJZL 3ELAT 1T7YA 3KYOB 3HNVL 4EN3C 3BGFB 2B1AL 2NQCA 4NZUH 2D03H 2AABH 3X3GL 1Z6JT 1YDPB 3QCTL 4L5FH 1A7OH 4XPAH 4JM2A 1FC2D 4LLDA 1NMCC 1P4IH 2F74B 4EUPH 3QQ4B 1ONQA 3MBEB 4NPYB 1NKOA 4O2EA 1EGJH 4O00A 3S98A 2VABB 3DXAD 3O6LH 3STBA 3LV3B 2AJXL 4NWUL 3IRZA 4XCYA 3L6FB 3QHFH 2YA1A 3MA9H 1ROWA 1QTYT 5GJTH 5HPMB 3TESA 1H5BC 3FCTA 2A6KB 1U6AH 4YK4C 1V7NL 4KKAC 3SDCA 3DRQA 4DUWA 5IUSA 3ROOB 1CQYA 4I9WE 2BXZA 3HI1A 1KSRA 1U3YA 2BVTA 2CLZB 5J7CC 3ZDYF 5SX5K 4MAUL 3S37X 3MLZL 3V6OA 2G60L 3EW3B 4ONGL 1REIA 4TN9A 1C5BL 2EKSB 5I73C 2AK4D 4JO3H 5HGDA 2V2TA 1XH3B 3AS1A 5KW9H 4OB5L 3WO4C 3NGBB 1A3LL 3OKOA 5KVGH 1RJLB 4XP1L 2B0SL 4JM2F 5FGBA 1YEIH 5E8PB 2FATH 2DWEB 3VH8A 4Y8DC 2D7TL 5HDBF 3MA7A 1YEHH 3P4OA 1RZFH 4LRIC 4B0MM 1DVFB 4M43H 2DRUA 5HI3D 1YEKL 3GSXA 2C3VB 4C57C 1JBJA 2OL3L 4PJIB 3RHWF 3MNWB 4HWZA 3N0PB 5BXFA 5IR1A 4LPXA 2ZNXA 2P7TA 2A0LC 4K3JH 4NQVA 3M8OH 1MH5A 5HYJE 2A6IA 5DFVD 4NQSB 4ZUTB 3C87A 3KYNB 5DRWB 5D8JL 3H7BB 3T3MF 3VXUA 4XWOD 3O0RL 3Q6GH 3CH8A 2BHUA 1U2CA 1KJMB 4BFEA 4JFED 5IB4B 2CGRH 4ZUWA 4ZTOL 3QULB 2DTML 4M1CD 4Y7MA 2Q76A 4FQIH 1P1ZA 5IMLB 4ZQKB 5I1JL 3MACL 3HE7B 3KLAA 3P4LA 4YO0B 5DUBA 3F6LA 2QQQA 3CXHJ 5C0NC 3W81A 5C0DB 3BZ4B 1W0VA 1QEWA 5DEFB 4QOKA 3DURB 5C08D 1TZHA 1OAZH 3MRPA 3CPLB 1R3JB 1JRHI 3ALXA 4YBQC 3RGVA 5L2JA 3GSVA 4OQTH 4HJ0D 2CLVB 1JPFB 2B8OT 2R2EA 3CC5B 4J3VA 1JHKL 5EPMB 4C54A 1NCBH 3P77A 4IRJA 3SE4C 3CX5K 4G80B 1T2JA 2R2HB 1JHLL 5I0ZA 2FL5A 1ZLVH 1QACA 4BH8B 1DEDA 3I6LE 3SKMB 4ODTL 5K9QG 4RMWA 5T1KA 1RVFH 5C8JB 4PRAA 1N26A 4JHWH 5IHUH 4OZHA 5J12B 4PY7B 4JZNA 1A6TA 2XYCA 1JUFB 1MIML 4FXLA 4XAWL 2DIBA 1PX4A 2EDTA 3BP6B 1QHPA 1OTSD 2EH8L 1D6EB 1OY3B 5A2JH 4OLEA 3MMEB 3HLAA 3P0YL 4Z0BH 5IESH 4JKKA 2VZUA 5D96C 1XGRA 4F9LC 4CVXB 4DCQB 4Y5XC 4X4ME 5D1XD 3CSPA 1U8NB 2EO1A 4AQ1B 5CKGA 4A6YH 1ZT4A 4E41A 4OFPA 2FX8H 3KGRA 3HPJB 4BQ8A 1KLUA 3SQOL 1JF1A 1I7UB 2ITCA 2DQHL 2GTWA 1KJVA 4TSCL 2HFEA 4XVUD 3OTTA 4NQEB 3D0VA 3H9SE 3QPQD 5JDSB 1KNOB 1KIRA 3G04B 4HPYL 3O3AB 4U1HA 4JKWA 4D9RD 5I16B 3BPCB 4FFZH 5D1ZC 3WNMA 2VXUH 2RCSH 1KIPB 2AJ3A 3CLFH 3OMZA 4WENB 1AHWB 1R0AL 4XCEB 1YN6A 2L4OA 2HJKB 2ICWA 2VDML 3BE1H 4TNWF 4J4PD 2I60L 2EIBA 3PWVA 3K46A 1XGQB 1DTUA 1FZKB 1C1EL 4HJJH 5FUZL 2DLIA 1T89A 5FB8A 1B4RA 1DDHB 3LIZL 5DJ6A 3UX9B 1TZIA 3SGEH 2PCPA 5J6HA 4HLJA 4RFOH 4J6RL 5FM8A 4N8CL 4P23B 3BW9A 1EEYB 3VGAC 3MRHB 2D4DA 4XVSH 4YBLC 1YNTB 4RBPK 3O2DA 3U83A 2IAMC 3RZCB 4XH2B 2B4CH 1LEKB 4PJ9A 2BSTA 1A6AB 1BOGB 1KLGA 1M05A 2J4WL 2VE6A 4MJ2A 2JK5A 3QYCA 4PB0H 5D7KE 4LBEB 5L9DL 1FL5A 2O5YH 4GMSH 1QZ1A 2B5IB 2JF1A 2V7HA 5D9SA 5MEOA 4E9LA 3QEGL 2X4QA 4M6MH 1M7DB 4JPWL 2MFNA 2Z8WC 5AUMB 5E08H 3N9GH 1TNMA 4OGAC 5IW6B 1S7VB 3CDGA 1PKQB 4F9PA 1TMCB 1ZMYA 3O4LD 4P3WA 5IBTL 2G75B 2X9WA 4L9LA 5GGVY 4H1LA 5C9KA 1DSFH 1A8JH 2JJSC 2O5ZL 1XGUB 4GG8B 3L3HA 1Q9KB 2E9WA 1NBYA 3MJ8A 2VYRE 4JDVA 3RVXC 4FQJL 4P3DB 4HFUL 3OKLB 4ZS6D 4XMPH 2VXSH 1K2DA 3TEUA 3D48R 1MFAL 2VDOL 3FOMB 2ED9A 5EO0A 4FQHB 1P53A 1UACH 3G6DL 3CUPB 5FA3B 5GS0H 2APXA 2FGWL 1MRCL 1NFIA 3K2UH 4AY0A 4LAQH 3VXQB 2HMIC 1J5OL 4QHLA 3MCLL 2O26U 1T1ZB 4OI8A 5DLMH 5T1MA 5DMYA 1FG2B 1MJ7H 3P4NA 1CE6B 1T22A 2FD6L 5EORH 4K9EL 5J6GB 4QHUA 1LO3H 2CO6B 5GZND 2LVCA 3SDDD 4YLQT 5JXED 4YUEH 5ALCL 4W6XB 4MQ7B 2NW3B 3SGKA 2F9BT 1X5HA 2A83A 2I9LA 1Q38A 3DLQR 3PJSA 1B6UA 1RUAL 5AEAA 1LK2A 4MMXC 5C0BD 3P0GB 1KJ2A 2VUYA 1T1WB 3ARDB 4D0DB 5KVFH 5M95B 5DURB 4RGND 5F9OL 4NN5B 3OB0K 1L4IA 4I0KA 4OZ4A 4YHZL 1J88A 4OV6F 4UZGA 5HI4D 1Q72H 1QBMH 4RNRA 1DBKL 4Y4FB 4U05A 1CFVL 3V8CA 3WD5L 1XT5A 3EJZD 3IETA 4NQTA 3MUGB 2P8MA 1F6AA 2HJLB 4U6YB 3C5SB 4LSPL 3FRPG 3UTTE 2VDRL 4X6DB 2E9IA 2YD3A 4HUXB 4HZLB 4MYWB 3R8BB 2P44B 2Z31A 3QIBB 4TPRH 4TSAH 5BQ7A 4JDZA 5HVHB 4XC1L 3ETBF 8FABB 3I50H 3WEXA 3BWAA 3OB0H 1U8LB 5DK0A 3DO7B 4WHCA 1UG9A 1HQRA 2YPLB 4U1IA 3GMPA 1UM6H 1GXEA 4M5ZH 5DHYB 4M5YL 5F3HB 1Z0MA 5DRXB 2ORBL 2GEEA 2XTJD 1OAKL 1KENH 1RIVH 4I0PB 5DHVB 1QNZL 4PRHB 5KJRL 5F96L 2YWYA 3BEWA 4LLMA 4HS8H 2Z4QB 1W72H 5GGTH 2BY0A 4X4MA 2QLVB 5EBWB 5GHWL 1EMTL 4P2RA 1RUQH 2IFFH 5F71A 4JY4B 3KJ4C 4GBXB 4RAVA 1NCWL 4NO0B 5C70A 4YHYB 3UTSB 4GG6F 2XWTA 3O45B 4PG9A 2ICCA 4XNQB 5DWUH 3OKMB 1F4YL 3V4PH 4F8TA 3GSOB 4D9QD 4DGYL 1YN7A 2J8UB 2VQ1B 4EN3D 3DVGB 2CIKB 4L29B 3U7WH 2IANB 1DQJB 5I1LB 2VLKE 1CXHA 1FBIL 1MAML 2ZUUA 4PGCB 1MRFL 5CINH 3NZHH 4PY8J 1ADQL 1SJEA 3C8HA 1JN6B 3V7AE 4Q9RH 1D9KA 3DI2B 3TBVA 3AFLA 4HGWB 4M02A 2AQ2A 5IEKB 4IRZH 3HC0A 1MCKA 2Y5TA 4U31A 1MIEH 1ZLSL 1BIIA 3M1BA 1U3HB 3VFPA 3UCRA 4DN4L 1Y0LB 5EOCL 2RFXA 2BVEA 4Y4KC 3KPPA 3IFNL 4GKZB 4IM8A 1I8MB 3WLBA 1RFDL 3SBWA 4DKDC 4GAYA 5I18H 4G9DB 4WHTA 4WUUA 2F54D 2VXTH 4CN1A 1NC2D 1OL0A 4Y16D 4L8SB 1ZA3B 4BELD 2NY0C 4PRPD 5F7DB 1KCKA 5C7XL 1YC7A 2AEIT 4OF3A 1HCFX 5IB2A 4TOYH 4OLVL 2R1XA 4D0CB 2Y25A 1LP9E 5LGHL 1ZGLP 2HTLC 5KSBB 2CXKA 4JB9L 4HMCA 3B8SA 5TF1L 3HFML 2F8OA 1AIFA 3V5DA 4JAMA 3RWDB 3BZEB 3S36L 5ITBH 3A6CL 5D7SH 4XVJL 4BQCA 5BVPL 4LOUC 5I19L 4LVOB 3QA3B 1DUYB 1HHJA 1MCLA 2J6EA 3LZFL 1CQKA 1T83A 3TZVD 4OCYL 3T77B 2R15A 2BCKA 2DM4A 3UTPE 3NFSL 3V4VH 4BSVB 5SX4I 5E94B 3O9WA 4HBCH 5CSGA 1MY7A 4WEUD 1BBDH 2ADGA 4FS0A 1NFDA 1MAKA 4UQ2B 2ZUQB 5IIEB 3OQ3B 4KHXL 1EFXA 3VXME 3VFTB 1OT1A 2RHEA 3DMMC 4LRNL 3MREA 4HT1L 5E9DB 4HCRH 1IFHH 4FQ2H 3TT3H 1JZ2A 1OGTA 1C7SA 1BFTA 5JHDA 4PJ8C 1FZMB 3ARXA 4J8RA 4P2OC 4HFWB 3IFOB 3WIHH 1AD0A 1OF2A 2Z93B 3ARGA 3MLXH 1QFWL 3M17B 5C0ND 3MV7B 5IVXE 1QFUL 1DQMH 3QRGH 5DO2D 4RGMB 3LS4H 3RKPA 5HVGB 4PP1D 3V0AC 4X5WA 4BSJA 1F6LL 3T0WA 5MHSD 3SCMC 4NQDE 3MJ9L 1BBJB 1FQ9C 2EDFA 3PWLB 1KULA 3H6JA 4YDJA 1FLRH 3D39A 1NFDF 2DI8A 2NY2B 5F9WC 3W0WD 2BNRE 2DKUA 4XP6L 3QPXH 3W9DA 2BOBB 3VJ6A 1P6FA 3IKCB 3MLRH 5A3IC 4POZC 3RWIB 4LASH 4YNYB 4QO1A 3BGMA 2HJFA 2C7UB 4PJFE 1WBYA 3PGDA 3L3KA 2CUHA 5GGRA 1ZT7A 4NM4H 2RAMA 2Y23A 4F7EA 2YBRA 2KPNA 3FO2B 4DKFH 2UUDH 3MXWH 2ED7A 2DKMA 3GIZL 3CXDH 5CEYA 5J57B 1RUMH 3E3QE 4FRWA 1JPTH 1N6VA 1A2YB 3CH1A 4NO5A 1K6QH 3QUXB 1GIGH 4O02L 1UWGL 1Z3GH 5GGSB 1MHPH 3QQ9C 2A6JB 3T4YA 1JE6A 2MHAA 4G8GA 4U1MB 4WW1A 4WI8A 5JTWA 3ZZ1A 1Z9SA 5DFTA 3TO2B 1KB5H 4M6AA 4HKXA 1FCCA 5E2VH 1CGYA 1T5WB 4LL9A 3GI8L 2H2PC 1EERB 1F4AA 1F3JA 5FOBA 4CRPA 1K4DA 1CN4A 3MRIA 1RHFA 2A77L 2DQEH 1XF3B 1IGMH 3EOAB 1J8HE 3GMNA 3O11B 2YA0A 1JI1A 4OFYA 2CDGA 5E8DH 1A5FL 3SY0B 3KPSB 4WGWB 5KSBF 4P4RA 3KR3L 2AXJA 1LDSA 1UH4A 3UC0H 4M7KH 5F7MC 1XF2B 1ITBB 4R0LC 3PDDA 3C8KA 3UPAA 1E28B 3FRPA 3K0WA 4UV7H 5BS0A 2IAMD 4HF5L 5HTSA 2ZUVA 2DQUL 1A21A 5L2KE 1F97A 3FJTA 1NBVL 4XHJD 5KTEH 2OR8A 4N68A 1T1YA 4RMVA 2MJWA 3RQ3A 4WUKL 3NABL 1UJ3A 3EYOB 4FFYL 2R0KL 1O0VA 3G5YB 1A6VH 1AH1A 2XPGA 1FGVH 3UPRA 5GJSL 5IFJB 4NFCA 3CNKA 5ETUB 3OJ2C 1AGCA 2E6PA 5C2BL 4XI5C 4HJGA 4HSQA 3CK0H 1FO0L 4UNTA 1RIUL 4IS6B 4HC1L 4R90H 4XNZC 3H2WA 5TDOA 3PXJA 1QR4A 3G6JE 4KAQH 5A2IH 3QXTA 1ORSB 1FAIH 3ARFB 4H26B 4QRTA 4PBXA 2FIKB 5DR5L 5T1LB 3W39B 3KXFD 3MO1B 1GGCH 4LLUA 4HMEA 3PQYE 5EA0L 4JVWA 4PJXA 3RVXD 3CCHB 3WBDA 3HAEG 1RULL 4YXLH 2R29H 4ONFL 2OQJB 1HOCA 4UT9L 3CX5J 3QH3B 2VDQL 1J12A 4PJ5D 5GIRB 3F65A 4YXHH 1BQSA 4UQ3B 2WAHA 4PFEA 5CJOH 3FFDB 3ARED 3FTGA 3MNVA 1U8HA 1MQ8A 1T2QL 4FFVC 3QDJD 3UJTL 2J3SA 3WN5C 1CICA 4LSSL 2FR4B 1N4XH 4PV8A 4DOHE 4P46B 4EI5B 3GEWB 4XNMB 3VFGL 5KS9A 2IGFL 1W0WB 3SJVA 4Y5YB 4HKBA 1VFAB 3X3GH 4TSBL 5IFHL 2FBJL 2XWJB 3QCTH 5BZDB 2Z35B 1FGNL 3WFBL 3QO1B 1CXFA 4MAYB 1SYVB 9CGTA 1B0RB 3CVHA 3GIVA 5ITFB 4H0GA 5EUOB 1LO2L 1BQHG 2FECI 2AJXH 2ATKA 2YOCA 5GGVL 4NWUH 3BIKA 4JJ5B 4LVNB 5D5MA 1NANI 4PJXF 4RFNB 3DETD 3C2SA 3SKNA 1DVFD 3H3PL 1B88A 1R5VB 5C07E 1ZVSA 2P1YA 4GRLB 5KOMC 2GT9B 3O8XB 4I18B 1V7NH 4XNYL 2VIRB 1FIGL 5FGSA 3RFZC 3WYRA 5KG9A 2X4RA 3GSWB 3AS0A 5CP3A 4F7PB 4OJFL 4XGZB 3O4OC 5KAQG 2GQHA 4OIBA 4MAUH 3MLZH 2G60H 4ONGH 4NWTL 4X98A 3CFIC 4ZUSA 3EKCA 2G9HB 2C9AA 3A0OA 5KS9F 4Z95L 5DJCA 4P4KB 4OB5H 1A3LH 2I5YH 4XP1H 2B0SH 3E6HA 4ZFZB 3PWNB 4UI2A 1GZPA 1NCDL 2XKNA 3WHE0 3V0VA 2H32H 3IF1A 4HIJA 5EU6B 2A9NL 1EFQA 1BECA 4NC2B 4FMFA 3DXAE 4Y1AD 1LD9B 1YEKH 1Z9MA 3DI3B 5E99L 3VXPB 3FB8B 4IHOA 4UV4L 2OL3H 2XFXB 5IM7B 5D5MF 5H35B 2H26A 2H3NA 4KY1L 3W11C 4TUJA 3P73A 3SGEI 4QCIA 3FN0L 1ORQA 1IAIM 4ELKA 3QWOA 5GRUL 4WO4C 4MNGE 3VWKB 1WFNA 3QDAA 5DRZB 3QIWC 2DQFB 1ZHLB 5D8JH 4U1LA 1ZWIB 3GSUB 4GAFB 3P0VL 2Q7NA 4NRXA 3HUJE 2OZ4L 3O0RH 1MFBL 2APTA 5IEHA 1AC6A 5DD5L 2LTQB 3ZLQC 4ZTOH 2DTMH 1JNHA 2AK4E 2DQJL 5C0AD 1I8LC 4KXZH 3NCFB 5D7LE 4JM4L 1G6RB 5I1JH 3MACH 3QNYA 3JWDC 2AJVL 4JE4B 4LCWD 4WV1A 2Q87A 2X40A 5KSAD 4GH7B 3BO8B 2VLRB 3X17A 4AIZB 5IG7A 2Q1EA 2B20A 3WFEL 1J8HA 1VEMA 4HK0A 1E27A 4LCYB 5C0EA 4K71B 1ZTXH 4CVZB 5DJ2B 5GRVL 2H9GA 4WWKC 1SEBB 4ONHA 1CGUA 1NCTA 43C9A 4LCCB 1JHKH 3BKYL 4NZTL 1VENA 4X9FA 4ZPVB 1KXQE 4QWWD 2F53A 2UVEA 3OZ9L 2OYPA 4MNQA 1JHLH 1D5ZA 5IV2A 4YGAB 5CBEA 4X0KB 4ODTH 4MX7A 4CDGC 1ZSDA 1HHHA 1LE9B 1P4LB 35C8L 2XN9B 3L7FB 1JI2A 2IPUG 2ARWA 4IRSB 4P5KB 3JVGA 2Q7YA 4JFEE 5FECB 3P4MB 4WHDA 1MIMH 4XAWH 1FJ1B 2NYYD 1YY8A 5E6IA 1AGFB 4G7YH 5CSBA 2HTLD 5IROA 3EYQC 1TTFA 2EH8H 2DLGA 4LHUD 4BK5A 3C6SB 1LEIA 1U92B 4C83B 2WBJB 2DF3A 3JWNC 3P0YH 2DM7A 5SV3A 2AW2A 4LLVB 1FFNB 1K8IA 5DGRA 4W70A 2IALA 4JFFB 4QRUB 5C08E 4X99B 2ARJB 4X6CE 4PJGE 2QSCL 3SQOH 5F89A 3BMWA 2DQHH 1TETL 4TSCH 5CJXC 4XCYB 5EUOF 4HPYH 1MWAA 3RAJL 5LKNA 2VB5A 2NY5C 5E8NB 1R5IA 3HCVB 1Z0NA 4PTUA 3EOYG 5C0GA 4PGBB 1R0AH 3QI9A 1HSAB 2HRLA 4WFFD 3DMMD 2ZSVA 2VMFA 2VERN 2M2DA 3PNWA 4MJIA 3JTSB 4NN7B 2I60H 1CDJA 3O6KL 5EIIA 1PBYA 1A9EA 4PJ8D 2DYPA 1C1EH 5FUZH 4LF3A 3LIZH 1VESA 1BJ1H 3DGGA 1R6VA 2V2TB 4JN1L 4J6RH 3WLWC 3DVFA 4DVRL 4N8CH 1WITA 1F6FB 4I2XE 5IGXL 4GOSA 3TO4B 1E4XL 3U6RA 1KTKE 1IM9A 4BKLA 1T4KA 1S78C 3IDGA 4U0RB 3RDTC 3GSXB 1QLRB 3QUMB 2J4WH 1I85A 2OX5A 1DANU 2EC9U 4D9RE 3BYTA 5C07A 5EOTA 3REVA 3X14B 2J7LA 5L9DH 3S3JA 3QEGH 4JFQA 2EDKA 4OAWA 4NKMB 4JPWH 3O41A 3P40A 2APFA 3QXVA 4TTDC 1ZGLM 4GW1A 5B39G 4PRIE 3HAEA 3GJEB 4POZD 1QVOB 3PDGA 4NOBA 1JWMA 2IMNA 2H1PL 2Z91A 3J7HA 4P2QB 5IBTH 1T0MB 3RWGB 1EEZB 4Y19B 4HUUA 1K4CA 3WO3B 4F8QA 1LNUB 1KCVL 2O5ZH 5SWSA 3BP7B 1R3IL 3A6BL 5D93B 5HDQL 4FQJH 3JBG7 4XPTL 5DUBB 4ZXBD 4HFUH 5JNYB 3IJYB 1TQBC 5EZLA 1PEZA 1INQA 2A73B 4PBWD 1MFAH 1R5WB 2VDOH 1BGXL 5I8OL 1H3UA 1ZGLB 5D1QA 1U8JA 3G6DH 2HFFA 3QQ9D 5HYFA 3RGVB 4G6FD 2FGWH 1MRCH 5E7FA 2EE9A 5KSUB 3TIDB 1J5OH 1OM3L 1AXSB 3MCLH 4R26L 2NLJA 5E4EC 4IRJB 2FD6H 5JO5B 1BQHA 3ZDXE 2DQIL 2VZTA 4K9EH 5HHNB 3S7GA 3T2OA 3OJDB 4U6VH 4PJDE 2V5SA 4ZFGH 5C0CA 2BVOB 3O4LE 3NZ8A 1RUAH 1NGXB 1WT5A 4XXDB 2AK4A 2UY7A 4FP8L 3NCCB 5D7LA 2BSSA 5IKCA 4HIEB 2ZCKL 3Q0HA 4HX1A 5D2NB 5F9OH 1RIHL 5TQ0L 1MRDL 4YH6A 5I2IB 1DL7L 1JWSB 2DLTA 3BGAA 4YHZH 1V3MA 3GMQB 3ZKND 5DJ8A 1T21B 4ODXB 1A3QA 4E41B 3ARBC 2BNUB 4H5SA 1CFVH 2NX5A 3WD5H 2ARJQ 3TT1L 4KDVA 1KJVB 3B6SA 3D85D 3HPLA 1FNGB 4L4VB 5C09E 4LSPH 2VDRH 1HI6B 3VW3L 2OTUB 4LSTL 4GKSA 2VLLA 3EOTL 1CS6A 1HXMA