4HGMA

Shark ignar variable domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'TRVDQSPSSLSASVGDRVTITCVLTDTSYPLYSTYWYQQKPGSSNKEQISISGRYSESVNKGTKSFTLTISSLQPEDFATYYCRAMGTNIWTGDGAGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shark V-NAR
publication title Atypical Antigen Recognition Mode of a Shark Immunoglobulin New Antigen Receptor (IgNAR) Variable Domain Characterized by Humanization and Structural Analysis.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Immune system
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgmA00
3HI5H 3NCMA 4TRPL 3P0YH 2HT4D 5GGSY 1NAMA 5JNYA 1OAYL 2YA0A 3NFSL 5DHVA 4Z5RA 4JDVB 5J6GB 4P3CL 4DZ8B 2HFEB 4PREB 1LO4H 1Z3GH 3G08A 3PGFH 4UIKH 4D9RE 4AEIL 1OW0C 5I71C 3WXVL 5C0IB 3D39D 1AD9A 4M9PA 1GSMA 4Y8DC 4P23C 3S88H 1RURH 4GMTH 2OTWB 4Q97A 4P5KB 1OTSD 2PCPA 2RFXB 1YEHH 3T1FB 3G5ZA 2BSRB 1AY1H 3T0WA 4E41B 3VXOB 1MJ8L 5DO2D 3RVXD 5B38B 3UTPD 5FYJU 3VCLB 5L2KB 1MCHA 4WUKL 5LGJB 3MSPA 2FX9L 4FQCH 4PRHE 4HXBH 1LE5B 5I66B 4I77H 4D0CB 3TBVB 3KYKH 2ZUTA 1IC7H 1INQB 1SJHA 4P3DA 3SQOL 3VXRD 2XICA 4OCXH 1AC0A 1YMHB 3QI9C 4YHLL 1IJ9A 1AXTH 3QEUB 4U6TA 2L4OA 4K3JL 4Y4HA 2ESVA 1BZ9A 3QFDB 5JMRA 2HKHL 1P6AB 2HAZA 3P4LA 2DD8L 1ZE3C 3KXFE 4LNRA 2KZ1B 4XPGL 2F54D 5I1GH 5KS9F 5KS9B 1RULH 1IC1A 1UACH 3GMQA 5DVMA 4PBVC 1MRCL 5DJXA 5TF1L 3WHXB 5I0ZA 4K2UH 4N8PA 1KPRB 5D2NB 1N0LA 4XHJD 5EUKA 4QHUA 3QUMH 1UA6H 5F7UA 2P5WE 2CSPA 3X17A 1PQZB 3SN6N 4LCWA 3D3VA 1C08B 3MV01 3UJTL 1MAMH 5IB1A 2PO6D 1GL4B 3VXUE 2B1AL 3V4PH 1X4XA 1SEQL 4DVRL 4NYLA 4MXQC 1LO5B 2IPTH 3P73A 3VRLF 1J12A 1T3FA 2HTKD 3GMRB 2XFXB 3QQ9C 3IDIB 4WGWB 2I9LB 4FQ2H 1TTGA 3ECBA 2YBRB 3F8UB 1NGYB 4ETQB 4M48L 4KKNA 2F53E 1PW3A 5D7LB 2IQ9L 1F4XH 3SDYL 5I74B 4WW2F 4WW2B 4HPOH 2YXMA 4I4WA 3VG9B 4ELKB 4AT6A 4PJIA 4BSWA 1VKXB 4QRSA 4P59H 2VSDA 2QHLA 4M93C 3AU1B 2R8SL 2R4RH 4KHXL 1A7QL 3OXRB 1KJMA 2Y72A 4WV1A 2AJXH 1MWAB 3HZYA 3Q6GH 5IR1A 1OAQH 3LD8C 3TYFA 1YEKL 4FRWA 5IVXF 3ULVD 3W82A 5MHSD 2P42B 2ZCLH 1OLZA 4MJIE 1JGEA 1FZKA 1AD0A 3HR5A 2JJTC 1PX3A 4FXGA 4PJHF 4PJHB 1GGBH 1EIBA 2ADGA 1J05A 4QYOA 5SWQB 3LDBB 3BP7A 3MCLL 1PFCA 2WINA 5C0GA 2VDKL 3RTQD 3SGJA 1W0YT 3PWPB 4IRZH 3MRQB 4NQSA 4LAQL 5HYSA 3RKDC 3HLAB 3O6KH 1BGXH 5C9JB 1CLCA 4JB9L 3KDMB 1I3GH 3QYCA 4JFHD 4NHCH 4JG0H 5AZEH 2B1HL 3MFFA 2Q20A 1DN0A 4AZ8A 3H9SA 1N6VA 1NGZA 4M6MH 3U4EA 3REVB 4LLWA 3QAZB 2FECL 3U82B 4HEPG 5IWLA 4FFVD 1RUAH 5M7QA 4Y4KD 1MCWM 2IBGA 3P4NA 4XGZA 1K4DA 5FO9A 3ROLB 2GK2A 1DBKL 1OARH 2P8PA 1UJTA 5F7WC 1LVEA 3L95B 3EO1B 2ZUXA 4PUBL 1WUNT 1LO2L 3KYOA 4P4KC 3BH9A 1YY9D 4KJQC 3VXPB 4I2XA 4NDMB 2DL2A 3SKMA 4EBQH 1WIUA 5D9SA 4DAGL 3HKFA 2PNDA 4LPCA 1BP3B 2NY3D 1AQDB 3CSGA 1C1EL 4JO3H 4OM0L 5HHXH 3CH1A 4YZFF 3ZT7A 2HLFD 1IL1B 1KFAL 3C5ZB 3X12B 4ZO9A 5JPNA 1D9KC 1T2QH 1N6QL 4PRID 4XP5L 3FQWB 3NVQA 4HQQL 5L7XH 1ZLSH 1AIFA 1E27A 2VDMH 1R5IB 3GO1H 1FL3B 1ZS8A 4IOIB 5DGQA 4CVUA 3AUVA 1QFUH 2V5YA 4M5YH 4JY5L 4NKIH 4YXKL 5TDOA 1YEJL 3MBEB 1L6XA 5DURB 1FFQA 4GKNA 4GW4B 4OZGB 4JM2C 4O4YL 4M6NH 5I8KH 2P8LB 3KPRE 4KI5F 1UJ3B 4NQVB 4ODUB 1PZUB 3HE6D 3P9LB 3AMKA 3MRKB 2AQ3A 3QDMA 5HI4D 4PJ8D 1EHLL 5CD5C 4ZPVA 3GMMB 3ULUC 5J3HD 4LKCB 2B2XL 4M1GH 2JKXA 4KQ3H 4HG4K 1MHPL 3D0LB 4PG2A 4YX2L 1A1NA 1KCRL 2R2CA 4TULL 1D6EB 2ZG2A 5FK9B 1RK1B 5KVDH 2F5AH 4TNWF 4PRPA 1MI5B 2CDEA 4RGNE 1I1AC 4AQ1B 1TPXB 4GAGH 2Q3ZA 1JGVH 2F74A 1CE1H 5GSVB 5GGVL 2P49B 2HT2D 2AEQH 3KLAA 2OXGA 3VRIA 5ADPL 4YHYB 4LSUH 1ZTXH 2FRGP 4AMKL 1MVUA 4ZO7A 2QQKH 2W9DL 3WUWB 2XT1B 3D5OF 5IB3B 3U9PH 2VLKD 2L0DA 3RVWC 1JF1A 1N64L 1Z9LA 2UVFA 3B5GA 3JSSA 5IT2H 5E4EC 2P7TA 3KPMB 1A5FL 4LSRL 1L9MA 5HHPB 5CCKH 7CGTA 1MFAL 2BY3A 1FYTE 2ITDA 3ZE2E 4LSPL 4NC1C 1DBMH 3V5KB 1D6VH 2NY1D 2H8PA 3K2UH 1JNLH 3MLZH 3JVGC 4WI4A 4WO4C 1QBLL 4XH2B 1QLEH 3BKJH 4G80B 4EEEA 1YYMH 1TQCC 1C5CL 3QNZB 3QDGD 2F58H 2Z8RA 2BNRD 5I8EB 4OKVA 2H9GA 2VDOL 3BDYH 5AWNL 1EZVY 2AJZA 5DQ9A 2W0FB 5ID1A 1YEGH 4H1LB 1S8DB 1QACA 3SO3C 4AK1A 2D03L 4X83A 5INCB 2O26U 1EV2E 2B7DT 3O4OC 4PP1C 3KS0H 5C0AA 1Y0LA 4LEOA 2D31B 5SWZE 1HINL 5FCUH 4OLYH 4MQXC 1IC4L 4LLVA 5E2VH 1HH9B 3VXSD 5HDBF 1YJDC 2A1WH 3CFDB 4RNRA 5I18H 2EDRA 4QOKA 1A22B 4JFYA 3HG1E 4GRWF 5GJSH 3UTQB 1IAIL 3DSFL 4QHLB 3N50A 2RQ8A 3M07A 1P7QA 5D70H 5FO7B 5LGHL 4UILL 4P48A 2Y36H 3IDUA 1TZHB 5DHVB 1NBVH 5CEXA 4PRHD 5GISL 1RMFL 4YBLC 3FTGA 3LEVH 4M5ZL 2GT9A 2VZ3A 1TCMA 3DBXA 4OBSA 3WFDH 2P5EA 5JQ6L 2WUCL 4ONGL 1AD9B 1CXKA 1KCSL 2EIEA 1FDLH 4H8WH 4OB5H 1B4JH 4G9FB 3LEXB 5IW6A 2PCPB 2NY0B 2BVUA 3M45A 1LWRA 1CZ8H 2J4WL 2GJ6A 3G5ZB 5E1AA 3X3FL 1DFBH 5E6IB 3KXFD 3QFJA 4EUPH 5FHAH 5CILL 1K8IB 2ERJC 1QBMH 3GHEL 3GM8A 1NL0H 4UUJA 1JBJA 1C16A 3LKOB 1S7QA 3C09B 2J6EL 3FT4A 3HC3L 4IMKA 5ECJE 5CJXC 2IFGA 3ARBB 2PTVA 2FH8A 5BO1L 3FT3A 3MRLB 3LB6D 2GAZB 4LLYA 5AAMA 4KY1H 2VLRA 4R3SB 3FAWA 1BVKB 5T3XL 2BRRH 3K4DA 3VXUD 4TQEH 2D3VA 3VFRB 4LNRB 1CIUA 4G7YH 4MJ6A 1PKQB 2OZ4A 3VXNA 5DJXB 5GRWA 1CK0L 2B5IC 2R1XA 3ZHDA 1KIPB 1BHGA 5ACZB 3RU8H 5EH1A 2J5LB 4N5ED 2F53D 5HYJA 1BQHA 3HS0A 2EKJA 4LCWB 1QPXA 1UCBH 2V5MA 4DFHA 4HXAH 4JO2L 1WV7T 2FBJL 1JIBA 1XGTA 2AABL 4Z7WA 3BUTA 5EORH 1JWUB 1OAYH 4JKWA 3U48A 1TCRA 4FFWD 2PYEE 1D5ZA 2ITCB 1FP5A 5KANI 4Y4FD 3L3KA 3GNMH 1E4XI 1BOGB 5B4MC 3CZJA 3ECBB 4UAOC 2EDDA 2NR6C 1FVEA 2DBJA 1ZA6A 3D48R 2CMRL 4PY8I 3CMOH 2XQYG 5KZCB 1KJVA 4PGEA 3I6GB 4ZUWA 5BJTA 3TZVD 2N4IA 3H3BC 3S34L 3BPNB 1OPGH 2C5DC 4MJID 2QEJA 4TN9A 1FBIH 1ZVSB 5JZ7D 1S5HB 4UDTB 5DC0A 4PJIF 4PJIB 4BSWB 1F6AA 2UWEA 5T5FH 3LIZH 1IGML 1UH3A 5LQBH 1TVDA 2HA1A 3SDDA 2NY4D 2ADJA 4S1RH 5IR1B 2MKWA 3WO3B 4CJ1A 5CIPA 3P40A 2IFFL 4JY4A 4L8BA 4ZOCA 4LCCA 4H88H 1NGQL 5DA0B 2DQGH 2R2HA 1MH5A 3QCVH 4MA3B 3CVHA 3VRJA 5IB4B 1XF5A 2UVEA 3I50L 1EEUA 4LHQB 1I7UA 3QDJE 1YNKL 4KKLC 4MD4B 2VDRL 4PJ7A 5FUCC 1QYGH 5KW9L 4UV4H 2VLJD 1R5WA 3BP7B 5MEOA 5H2BB 4CUCA 1KENL 4HBCH 4EN3A 2WINB 5C0GB 2HWZH 3ZE1F 1W0VB 2DMBA 2DS4A 3MQIA 3S7GA 3U36A 1CVSC 1P5UA 2DB8A 4KK5D 1B9ZA 3L3IA 3UJTH 4K3HA 1TXKA 1E6OH 1MCDA 4GLRI 3WMSA 2FEDD 5IJKC 1JHTA 5T33H 3HPJB 3MFFB 2GJZB 1ZGLP 4OIAA 1H8NA 1X7QB 1NGZB 3U4EB 5DZNA 4X4ZA 5A1AA 4LLWB 3O6FA 4MNGE 4LBEA 3LMJL 1OCWH 1DQJA 3DVNB 1BM3L 1XF2B 2Y06L 3P4NB 2I07B 4U1MA 2IAMA 5FKPA 4NBXB 1A6UL 1HIML 4HWEL 1U58A 5FA3A 4F57L 5DI8B 1AHWA 4PTTB 4DVBB 5HYIA 1T6VN 1J0IA 2G75A 3BH9B 4DGIH 2OR9L 1J18A 4PJCA 4WFGE 5F7FA 3SKMB 3G6DH 5KTEH 3RZWA 4KHXH 4LIQH 4CN1A 1I7TB 4M9OA 5D2NC 4DKFL 3KPRD 4LRIC 1QHOA 1U8PA 3CH1B 2YK1L 4XMKH 2D0GA 3BN9D 3MA9L 4U6YA 3E6HA 1CTOA 2GK0B 4N8VB 3R0NA 1HK6A 2YOCA 2E7LA 3T8XA 1WAAE 2MSPA 3PXJA 2YPVL 3UTTA 4GG6A 2VR9A 1WBZA 1ZS8B 1GVIA 2OYPA 5BRZE 5TDOB 5A2FA 5KG9A 4OD3L 3UTSA 4RGND 1FNEB 1MHEA 3ARSA 5KSBE 1NMBL 4Q6IB 5CJBA 3FO0L 5TPWH 1BIIB 3ELAT 2ED8A 3MCG1 3A6BL 4IRSA 3EYFA 3IDYB 3QEQA 2MHAA 3H7BB 2RGSA 5K9KA 5I74C 4WW2C 4ZPVB 1R3LA 5J9PA 3VG9C 1A1NB 1EBPA 3ARDA 3JV5A 1AGBA 4PRPB 1UWEL 3BVNA 4RMTA 1R5VA 3DARA 3MR9A 3CSYA 3QIWD 4OLXH 1A6WH 1FYTD 4LLDA 4Q74A 3LN4B 4X5LA 2F74B 2Z92A 1WFNA 1KIUA 3IFPB 2VQ1B 2CKBB 1MVUB 3GJFK 2R0LL 3TJEL 3HCVA 2Q7NA 3N06B 4BZYA 5KSVA 4D9LH 5DK2A 4EOWH 4GBXB 2R56L 2PTTB 1J9CT 1F6FB 1CDCA 1QG3A 3TO4A 2BJMH 2ICEA 1T1YB 2ITDB 5EOCH 2BVPA 1MQKH 4U0QB 3DYPA 3IKCB 4KJWC 1K2DA 4U1HA 4Y16B 5CJ8A 1JE6A 1DLFH 1EH9A 5C0BE 3PNWB 5SWZD 2O5YL 3RPKA 3QCTL 3GMPA 4Y8AA 1X9QA 1FL6A 3QAZC 1G7QB 4IOFC 3HFML 4PJGA 4PJFA 3MLSH 3V6OC 2AJZB 3OGOE 1CE6A 5DQ9B 1MFDH 2DBLH 1JL8A 3S36H 4PYHA 4DGYH 5MEPA 5ISZB 3SE3C 4XNUL 5E03A 5E0QA 1CIDA 1QSFA 5IMKA 1CF8L 4OLZH 4NM8L 5F96H 5C0AB 4TULH 5I1LA 4LEOB 2J3SA 5J56B 3MJ7A 2RAMA 3L9RB 3QG6A 4W4OA 1EEQA 4LLVB 2HFGL 1IAII 4NKDA 4GSDL 1I1YB 3GK8L 4F3FA 4PV9A 5F7LB 3C5ZC 1XFPA 2XWJB 4QOKB 3GSOA 1ZEAH 3RY5A 3WFZA 5KS9E 4UTAH 5EN2A 4XZUB 1YEEH 2XWTA 1P7QB 5FB8A 2YA2A 2HFFA 3EYQD 3OKEA 3TFKC 3U46B 3C2AL 5CEXB 2I9TB 4Q6YA 2PUQT 3FTGB 3MBEC 2Z31A 1WITA 4NQXB 4WFHE 1I7ZA 2XA8H 4IDLA 5F97E 4ZFZA 5H37H 1UJ3C 3B9DA 4KI5C 4F9LA 1OP9A 1KLUA 5EUOE 3ETBF 4K7PH 1J7VR 3FRUB 3PWVB 1T7VA 4JFZL 4ZFOA 1TNNA 3IFOA 3NH7L 1BAFL 1UKSA 4X7CC 3HE7A 4QTHA 4X7SH 2GJ6B 2D7OA 2MQ3A 1CGSL 4GFTB 5AG8A 4MZ2A 3ZE0E 3P0VH 4JFDA 3E8UL 1IM9A 2P43B 2DQJL 5D1QA 1OY3B 3FO1A 2ZZUT 4XAKE 1ETZA 5DUPL 5HHQA 1C16B 1S7QB 4X4XB 1TPXC 4S0SD 1ZLUH 1YQVH 4Q9RL 3FT3B 5DA4A 2FSEB 3ULUL 5C0NC 5EOTB 3MV7B 1LK2A 4J3WA 4YHYC 4U3CA 5LG1A 4LIQE 1RUKH 1RUMH 3U2SA 4Y7MA 4CADA 2X4OA 3RVUC 1KB5H 1KTRL 1S7TB 3KPQB 2X70B 2PYED 1KN2L 3LS5L 2YD8A 1ODAA 3MGOA 5E08L 4OCSH 3D18A 5D7JD 2WWMD 3EYOA 1QSEE 5DHYB 4YPJA 3B9KD 3WSQH 1LQSR 5FYKL 2J8UA 1XGTB 3F12B 4UILH 4GMSH 1DL7L 4Z7WB 4Z7WF 3VMNA 2VZUA 4AG4H 1AH1A 1TCRB 3L7EA 3NPSB 1O7VA 1AC6A 2VL5B 1EFQA 2ZUYA 1DVFD 1MCOH 3QUZD 4Z18A 1DCLA 3OKNB 4ONGH 3BEVA 4K3DH 1FVEB 1V05A 4OIBA 4ZO6A 2CDFA 4OZHF 4OZHB 4XC1H 4UB0H 1KJVB 5E5RB 5C0CA 5DVOA 1G9NC 3BESR 3VMOA 5IFHH 4Q2ZA 1U3HA 4JO4H 4L4VA 4QXTB 1T6WA 3QDJD 4O58L 5F1IA 4E0RB 2F19L 2UWEF 2UWEB 3EDKA 4JFEE 4Q9CA 3BSZH 1AJ7H 12E8H 2GY5A 4ZO8A 1IM3A 2XI9A 1UB5B 1I1FA 5HJ3A 1LILA 1EFXD 1A14H 4LCCB 4X7FC 1F97A 4UT6L 3NFNB 5C0FB 1B0RA 3CVHB 3CLFH 3TBSB 1TVBB 4OLUH 1XF5B 2NX5D 1LGVA 5ABDE 5DEFB 1I7UB 4PJ7F 4PJ7B 5B39G 1A7NH 2X89A 2A9MH 4KDTC 3NACL 4LASH 4YZFE 1FJ1A 5T1KB 1CK0H 2A6IA 4PP2B 4XMPL 3UZEA 5MEOB 2YXFA 4N1HB 1P4BL 4EN3B 1YJDL 1WTLA 2P24B 4PLKD 4TSCH 1NC2D 3VGDA 3LH2L 2AJYL 4TPRL 1TJIL 3BO8B 5JR1L 4OZIE 1A9BB 1IGIH 4H26B 4RGOL 5HPMB 3RFZC 1VENA 4EI5B 3BW9B 2NY0C 4KK9C 3G5VA 4HG4J 2VXTL 4Y19D 3O6LH 4OZGE 5E6IC 2IADA 1HZHL 2R4SL 5E4IA 4NHUA 4RMUA 5EU3B 3U7YH 4HEME 1NSNL 3C09C 1DQJB 4ZFGL 1ZT1B 2H2PD 3DGCR 3ARBC 4HSQA 2QSTA 4D8PB 5IM7B 5A3IC 1U58B 4WWKD 1EEZA 2PXYA 4Y5XA 1WC7A 3AREA 3D25B 4MS8D 2G75B 3R1GL 1OF2B 4PJCF 4PJCB 3L5IA 4KKCC 4BK5A 1YY8A 3LS4L 3BPOB 3DETD 5BRZD 5E5MB 3HB3C 3MZGB 3F7QA 3RIAK 3ZDXF 1K6QH 2J5LC 1J88A 4U6YB 3E6HB 4OGAC 1A3QA 5GGTL 3P11L 4OT1H 2WUBH 5CSGA 1E4WL 4PJ5E 2NTSP 5DEGB 1T66D 3MNZB 4CBPA 1U3ZA 2QQQA 2KDGA 4L9LA 5L6YH 4GG6F 4GG6B 1WBZB 5I1CL 5KW9H 1C5BL 1TETL 2JB5L 5LJYH 1MJUL 2VUYA 2Y6SD 3I3DA 5C07A 2X9XA 5I8OL 1RZ8B 1RIUH 3EOAA 1L7IH 4Q9QL 3U6RA 1I3RA 4LCIL 1JK8A 4MAYD 4R2GD 1QFOA 5K9KB 3TCLB 3QQNA 1R3LB 3I84A 3KPSE 1CR9L 2IEPA 3KHOA 3CFKB 1HXYA 5GS1A 1UM6H 3IJSA 4BYHA 1R5VB 5JOPE 4JN1H 2HJKB 4WV1C 3V4UL 5ILTH 2Y06H 4ZAKA 1KT2A 1TZGL 2XN9D 4LLDB 2OR8A 4DOHE 2JJVA 3QRGH 5IROC 4HWEH 2FZ3B 5HDOA 2AXJA 3DUSA 1GGCH 5CJQH 3S97C 2VXQL 3T09A 1RQ5A 4ZXBB 4RDQG 1KELL 5C0BD 3HCVB 3UPRB 5IB5A 2PW2A 5D2LB 5D2LF 3VWJB 4OQTL 5HTSA 4ZMAT 5DK2B 3U1SL 4L1HA 3DMMD 4L8CB 1FL5A 1X5ZA 1HI6A 4I3RH 4POZC 4ZUUB 3MV9D 3SGJC 2XACC 3MA9H 2ICEB 1FVDA 4G8GA 5GRVK 4M43L 3CK0H 4BZ1H 1K2DB 4WHCA 1ZHKA 1AFVH 1CT8B 1CLYL 4XHQA 2JJSA 2ZCKH 4TSBH 3SDXE 3BOVA 4AYFA 4XBGB 3WLBA 5K9QI 1NUGA 2DLGA 3MRJB 25C8H 3WXWH 1C5DB 4O2CA 4G9FE 4ALAL 2V2WB 3C2SA 2YD2A 2PW1A 3FO0H 1CG9A 5IWLC 4PJFF 4PJFB 5C6PB 1FZMA 1CE6B 1MHCB 1G1YA 1H3PL 2Q6WA 4CVXA 1AKJD 1U6AH 5MEPB 1I9IH 2EDNA 1QSFB 2QJDA 2PR4L 1GIGH 4K23L 5DRXB 3VG0H 2R69L 4HS8L 4NQUA 4G8FB 4MQTB 4Z7UA 2OR7A 3HZVB 3Q5OA 3RAJL 4EUPG 1IC5L 1JHKH 3S5LB 2X4PB 4EI6B 2VRAA 5EIVA 1P53A 3T2QA 1A6ZB 4WFHD 4PV9B 1RIVL 2HLAA 3BKYH 4GKOA 4X7TA 2HTLD 4P46A 3K3QA 1UZ6F 4LGPB 1Q9WB 1PG7H 3UP1A 1ZWIA 3F5WA 2XWTB 1XIWA 5FB8B 4ZNCD 3BKML 1DUYA 5B21A 1JZ3A 5D4QA 3MJ9A 3EZ8A 1NFDE 4Q0XL 3VXMB 2FATL 4XAKD 3ARVA 4OFYA 5MENA 4Q6IC 4WTZG 2FO4A 4ZFZB 4ELME 4NO0B 1U8LB 1T89C 5CHNA 4GRMA 1FLRH 1CCZA 3IDYC 3TT1L 3OF6A 3IFOB 2APVA 2WP3O 1ZAGA 4QTHB 4DZBB 3WD5L 5ADOH 1ZV5A 4KHTL 1Q38A 2BOBA 4W6YB 4WY7H 1LK3H 2WP3T 1CGWA 3RUGE 3STBA 4TYUA 5IG7A 4JFDB 4FP8L 1IM9B 5FDWB 3MUGB 1KJ3L 3FOLA 1WBYA 1U8HA 3NABL 4KK6C 1QSED 4QTIL 3TNNA 4RFEA 3PL6D 5BVJB 2VDPL 3U2SB 4HWZB 3KPNA 1ED3B 4CADB 2X4OB 4XPFH 3GSWB 3OPZH 1KBGH 3GSRB 4HWUA 2L7JA 3HMXL 5IMLA 4JG1H 3QH3A 1VSCA 1XGUA 4HKZA 5ITFA 2VXUL 4QNPF 3L7FB 4GBXC 3GK8H 1T22A 5DLMH 3D85D 1OP5H 3SKNA 4TUKH 2EC9U 1XGPB 1CDGA 1EAPB 3D18B 3FQXA 5CKGA 3D0VB 1FH5L 3TN0B 4FQQA 4MNQB 3NZHH 2XQBH 3MLPA 5AZ2L 2DMCA 5I1IL 4Y16C 3AROA 3HNSL 1QBBA 2J8UF 2J8UB 4X99B 1BFVL 4JHWH 4KQ4L 3MRIB 3AS0A 4WI2A 3B3IA 3DX9B 5EZLA 4JFED 1EUUA 4BJLA 3WL9B 4PS4H 1KEML 2NXZD 3EHBC 1FFOA 3QEHA 2X2YA 4D0DA 5SV3A 4NC2B 3NCYS 3T77B 2CDFB 4JFZH 1IQDA 1RUPH 2G60H 3FQUA 3S3PA 3RNKB 2VDNH 3GSNH 4NJAH 3IDGB 1O7SA 2X7LB 3RWHA 5BV7C 4UV7L 5DUPH 4JHZA 3OAYH 1T20B 4ISVA 4U6HA 1NDMA 2VR4A 4HC1L 1IM3B 3HAEG 3QQ3A 4Q9RH 4NWUL 5F7EL 1P2CA 3H3PL 3C6LD 5CMAB 4PY8J 2R0WH 4JZJA 1GHFL 4KVCL 3KVQA 4RFOL 1NUNB 1B0RB 4XNYH 4CW1A 1ZHBA 5EIQA 5GZND 1AGFA 2B4CC 2CO7B 4R7DA 2BFVL 3NA9H 1DQQB 2YD6A 5ALCL 1REIA 4JM4L 4ODTL 3RWCB 5I15L 1A3LH 3O9WB 2E7BA 4NM4H 4QRQA 3OV6A 3M8OH 4QRTA 1AGCA 1CGVA 4MNHB 3SGDH 5KVFH 4ERSL 1G7IA 5DT1H 5FYKH 4Z0XA 2VDQH 3LQMA 5DJ6A 3NCJL 4K7PY 3QO0A 4FQXB 3CC5B 4H20L 4JFQA 3ROOB 3V5HA 3MNWA 1UYWH 2R2EA 1RI8A 4JPVL 5T1LD 3DX6A 3MUHL 5CBAA 3NIDF 4WHDA 4JRYA 4ZFFB 5TDNA 4HS6A 3RDTD 2VQTA 3EYVB 3THMH 4XPBH 4F2MA 5GZOD 3D39A 3TT3H 1NLBL 3BP4A 4IMKC 2VE6A 2NY2D 3OKDA 2GTWA 5GGQL 2MPAL 4PJ5D 1EEZB 4R26L 3CVIH 5CUSL 1KJ2B 3I2CH 1HQRA 2ZCHL 1QRND 1YY8B 5DD1H 1JRHL 1V3LA 3TYGH 4PJEA 4EJ1C 1XGYL 5I8CA 4MLSA 1EGJA 4PV8B 5GGSA 1U3YA 4BQ9A 1KF9B 4ZS7L 4ACPA 4QCIA 2YUVA 4UT6H 1VESA 4XP1L 2IBZY 4AEEA 3BYTA 5D1ZA 5CD3B 1CFNB 5DJ8A 3KPSD 3MRDA 4OCWH 5ID0A 2IALA 4UU9A 2R29L 1V3KA 2F54A 4QWWC 2CK0L 2V17L 3NPSC 4XMPH 3QIBB 1WZMA 2VC2H 5JOPD 3BH8A 4HS3A 5SX4H 3Q1SL 1RZFL 4NC0B 4WCYL 3HHRB 4OZFA 3P4MA 1RZJH 2OP4H 3QZWB 3U6RB 1I3RB 2Z8VC 3MREB 1U8NB 4P99A 2OCFD 1T0PB 5E5UB 1FO0H 1VFUA 5TFSL 1O0VA 3O2DA 3OQ3B 4QT5A 1R3HA 4DCQB 4BZ2L 1JGLL 3LHPL 5CWSA 1HHJA 4P2OA 3TJHD 4E5XB 3IJSB 2AEPL 1IZKA 3IRPX 1BVLA 1EJOL 3G04B 3QQ4B 4IMLA 1XMWA 2VTFA 5DQDL 3SDDC 3MODH 1CN4A 4X9GA 4P2QE 1EERB 1KT2B 4UBDC 3OJDA 3UAJD 4XWOC 1S7VA 1G9NL 3GJEA 4LCCC 4ZSOE 1NBZA 3WFCL 2EDBA 1RZIB 3DUSB 3UJIL 3JWOH 4YHIB 1IAOA 1WFOA 2BOCA 3G9AB 3MYZA 5JW3H 4I18B 3PHQA 4O2FA 1B0GA 2A6JA 4KU1A 2X4RB 3RGHA 2NY6B 4FNLL 3SDCA 5GSRB 2HFTA 4MJ5A 1UVQA 5EU6B 1FL5B 2X1WL 3L3OA 4EN3C 2X4SA 3MJ8A 3MV8B 1MOEA 3TVMD 3BKCL 1CI5A 1EMTL 1NEUA 4G8GB 4CGTA 4IRJB 5D71H 1OVZA 4S10A 1R3KA 2EDQA 4EI5C 1ZHKB 3VH8A 3BRDA 4NZRH 3CFJA 5TE7L 1A6AA 1C5BH 3GJFA 3SHSA 1J8HE 1I8MB 3VGBA 2VJXA 4JR9H 5F3BB 1ADQA 1BEYH 1CG9B 4J8RB 5T5NG 5DRNA 3U0WL 3W11C 4Q9QH 3QO1A 2H1PL 1B3JA 1FZMB 1G0DA 3JV4B 5I1EL 2BZDA 2I24N 3EYUL 3VJ6A 4Q7DA 1BOYA 4YDIH 3S98A 1F58L 4F33A 4YPGA 2DKUA 4U7MA 4TOYL 2VDLH 3W0WE 2EYTA 3BPOC 1FFPB 4IOSD 5D5MA 3OBAA 3BQUA 3GIVA 2VLLA 4PGDB 3MGTA 2H26B 4KRNA 5JXAL 3MV7E 1YMME 4R8WL 4JRXE 4XC3L 4Y4KA 3D2UD 3GIZH 1OAKL 1RAMA 5HI3C 3GMLA 1Z5LA 3IFNH 4X7TB 4XNMB 3FAXA 1OGAA 2CH8A 3MOAL 4V2CB 2C1OB 2CUMA 4WHTA 1N7MH 4X80L 35C8L 5LXGL 2ATPA 3P77B 1ZWIB 3UDWC 2XV6B 4BQCA 5IEKA 1Q72H 4J1UB 3O41A 4XRCA 3H8NA 5I1HH 3B9EA 3LAFA 3F58H 4XI5C 4ORGA 4Z95L 5EPMB 3SJVA 2PN5A 4X5WB 1F90H 4YEFA 4HT1H 4X9FA 4G5ZH 3BE1L 5MENB 4G9DA 2FO4B 4G6KL 2ZJSL 2V7NA 4GS7B 4PRIA 3V0VB 1BWMA 5IMOA 4IRSC 5FGRA 4NQEA 1F11B 5C92A 5HHVL 4P3WA 1JYWA 4J4PC 1A7RL 4AH2B 3OKYA 4FQHA 1NC4A 3LKRA 3RWEA 5DJCB 4F7PA 5TJWK 4OIIL 2NNAA 4FQLH 2FD6L 3ARDC 2BSED 1A3RL 4APQD 1PLGH 1WWCA 4GXUM 2E9IA 4LCUA 1B4RA 3PG2A 2BNQE 4QRRD 2DL9A 2ZUUA 2VN7A 4K3GA 1J5OH 2JCCE 4PJ9A 4JCLA 1CQYA 5FDYA 4PJ8A 3GBNL 3LSOA 2W0KA 1UGNA 1XR8B 4FQ1H 5E9DB 5F89A 4HIXL 2EO9A 2Q8BH 4OAWA 4K23H 4O02H 5HGDB 3ZYJA 1EVTC 4ZXBC 3H42L 2P1YA 1LD9A 4JKKA 5CEYB 5IMLB 1J1PH 3OAUL 4IDJH 3E3QC 1XGUB 5F3HB 3DV6A 1R0AL 1T22B 3FQRA 5FEBA 4YLQT 3SKNB 3TO4C 3KYNA 1PAMA 2BVOB 1XCTA 4JQIL 5I1KL 3TBWA 4GKSA 2BDNH 1OB1B 1PD6A 2O93L 5E2JA 4NGHH 3DUUB 5EO0B 1VACB 3UO1L 3C60B 3HC0B 1N59A 3G6JA 1BZ7A 1KPUA 4GRLB 4K9EC 5H94A 1S7XA 3SO5A 3MRPB 3KPOB 4FMKA 1MEXH 4P23D 3PWUA 4BQ8A 1MCSA 2AW2A 2FATH 4NNXA 5IHBA 2FHFA 5E2UH 4C56B 3R8BB 5I17A 4U1KA 3SDAD 1X6NA 3QEHB 4QLRA 4IBLT 2OJZH 4Y2DB 3DTXB 1ERNA 1IQDB 3SCMA 1GH7A 4HIHB 1YC8A 2X1XR 1E6JH 4FQPA 1G9MC 1TFHA 3TGXA 2DM2A 1I8IA 2ZP0T 1RJYA 2IPKA 1KB9K 5CSBA 1JWMB 3U9UA 2H2SC 1KJ3H 4POYA 1UT9A 2BNRA 4NP4H 2DWDA 4W4OC 3RWHB 2DYPB 3ILQD 1EXUA 4YDKL 1A7PH 2BSTB 3CX5K 1IKFL 4K8RC 4U6HB 1PYWA 1K3ZA 3O11A 3V52H 4MCZA 1BD2A 5K59E 4HZLB 5LBSL 3S37H 1C8PA 4Z7QF 3O4LB 1JPTL 4LU5L 4NN5B 5J0BA 2E7MA 2Z35A 3NN8B 4CW1B 4MXVF 5JA8B 1NQBA 1HKLL 4LLQB 4FFZL 4DN4H 3EOBA 1AGFB 4N5UA 4JLRA 2FNBA 1A6VL 3S9DB 2CDGA 4Y89A 4JFFA 4G7VL 1FAKT 5DJYB 4L5FL 3O0RL 3DURB 2Z31C 3RIFK 1GC1C 4V1DE 4QRQB 5EBMB 5T1MA 4CNIA 4QRTB 5JW5B 3FB6A 1T7YA 5ACMA 3OZ9L 1BFTA 4NQDA 2HMIC 3QUXA 1PEWA 5FO8A 2BSSA 4D94A 3FFDB 4PLJC 4LARL 2W0LA 3QEGH 2VH5L 5GGRY 4R6UA 3QO0B 2XXMB 2PKDA 5C71A 3WKMH 4WUUD 3TM6A 4JFQB 1IGYA 4U6VL 3AXLB 3V5HB 2E6PA 2FJFB 4LP4A 4I0CC 4PRHA 4OGYH 5CBAB 3WNLA 3Q0HA 4GKZB 5TDNB 2R0KH 2V6HA 2OK0L 4MVBC 3D39B 1MCLA 4PJXE 4P5TD 3GUTB 2VE6B 2HP4A 1JPST 4J12A 4HKJA 3BGFB 4KC3B 3UYRL 3BRFA 2QR0A 3IAQA 3KXFA 4QXUL 2VKXA 1WWAX 5D1XA 4KUZL 2LABA 1JP5A 4BH7A 3VA6A 3CDYA 3QXAA 4BKLA 5B8CA 1Q9OA 3HNVH 2P5WA 4N0RA 5GGSB 3VXRB 3ZDYF 3TN0C 2OL3H 4RFOH 1ZHLA 2CKBL 1I7RA 5D7IB 3WNPA 1NGXB 3UMTA 4JHAL 5GS0C 1G84A 3VXUA 1DQML 5DJ8B 5TE4H 5KVMC 3IS1X 5ID0B 2IALB 1IQWH 4UU9B 4BFBD 3KAAA 2F54B 1UWGH 4WU5A 3IF1A 3V0WH 3BH8B 2EIZA 2HRPH 4OTXH 4S1DD 1BFOB 5E00B 1BX2A 1ZK9A 3MLWL 1NCBH 5DFWH 1ZGLA 4P2QD 3FQNB 3P4MB 3ARGD 4I0PD 3DO3A 1HHGA 5DK0A 5B3JE 5E94B 4NUJA 4LSSL 4XP6L 4UT7H 2PO6B 4MCYA 3S6CA 1RU9H 3NTCL 4QT5B 2RHEA 4DW2H 3BGMA 3EOTL 1ORSA 1HHJB 5DUMH 4K55A 4Y4FA 4G8IB 3U0PA 5IK3A 4XXCA 2LVCA 5CGYD 4U1IA 1JTTA 1ZXQA 1SYSA 4YQXH 5IHLB 4O9HL 4OV5A 2M1KA 3GJEB 3QPXH 4ZG1A 5HDQL 1NBZB 4YFDB 2Q3AA 4J3SA 4MJIA 2EH7L 2X05A 5HGAA 1S9WA 4I9WD 1KJ2H 2BOCB 4HUNB 5HVFB 4J6RH 4JPKL 3I02A 5BV7L 1JRHH 1ZVYA 4O2FB 2AJUH 1J8HD 3ZT5A 5CP7A 3UCRA 3O9WC 5EO1A 4MJ5B 1UVQB 3L3OB 3ZDZF 5J1AA 3MJ8B 5DJ2B 3MLUL 1G6RH 4HLZH 4ZS7H 5CJ5A 3KJ4B 1MQ8A 1MFEH 2PYFB 1OOAA 2EYSB 5LAXB 3VXME 2B4CL 3VH8B 1IGTA 1T21A 2C4FT 4QRPE 4GQ9H 5JLZA 4FQXC 1OW0A 1G7PB 2ZKHH 3W0WD 4PJBE 3GJFB 1JZ2A 2XIDA 4KVNH 3B43A 2IQAB 3Q1SH 4HFUH 3BPCB 4XP4L 4M7LT 1MCQA 4QF1A 1YMMD 5HGHA 4U1JA 1FVCA 4JRXD 3RTQB 1PSKL 4LKXA 5DRNB 1F8TL 3UJJL 3MRHA 4RFNB 2XKNB 4RBPH 3LPGA 2NYYD 2PXYC 1RUQL 3AREC 1ZSDA 4CN4A 4FA8A 4YPGB 4WDIB 3DHMA 5I2IB 5D5MF 5D5MB 3BQUB 3GIVB 3EJZC 3DO7B 1FC1A 2JIXA 3GMOB 3MGTB 3T4AB 5F9JA 5FYKD 3W2DH 4P9MH 1M71A 2FDBP 4Y4KB 2ZNXA 4XCNB 2A77L 5EC1B 4NRYA 1QR1A 3GB7A 1LP9E 3EKCA 2ICES 5IP4A 1BQLL 4BSVA 5FECA 4WHTB 4Z7NF 4D0BA 1E4JA 3BN3B 4U1GB 5F8RC 3RWIA 4IM8A 3CH8A 4FFYL 3MC0A 3O41B 5IESH 2EXYD 2EZ0C 1BQSA 2VZSA 3GMNA 2OZ4L 1A2YB 3ARFD 4ORGB 3M1BA 4DUWA 1RHHB 3QIBC 1IGCH 3L3JA 4L8DA 1MIEL 2XXCB 2NY3B 4X6CB 2BNQD 5HDLA 3MRBB 1UH2A 2EE3A 2QSCH 1A6TA 2V7NB 4PRIB 3T2NL 3D87B 4G42A 15C8L 5DS8B 3Q48A 3EJYD 4I5BB 3QCUL 3U7WH 4UIMA 4F7PB 3K8LA 5DWUH 1NAMH 4XPTH 1JZ7A 4GG8A 4PB9L 5F7KC 3RL2A 5I0DA 4LAJH 1T4KA 1MRDL 1UWXH 1INDL 2EDWA 2O61B 4LCUB 5C6WH 2CKNA 4WI5A 1NGPL 3AVEA 3HE6B 2EDLA 2WLZA 3RA7H 3DRTB 2DTML 1QRKA 1S7WA 4PJ8B 4NCC1 1CXLA 4BFIB 3LSOB 4HIIA 5F89B 5DDHA 3BAEL 3EFDL 3O2VL 2AERT 4HGWA 3E1F1 3KJ6L 1P7KB 1MJJB 1UM5L 3QUMA 4I18C 1R3JA 1LD9B 4KUCD 3ZT6A 5FOBB 1DBJL 4KPHL 1VGKB 2IGFH 4QHMA 2NY6C 1JJUA 4FXKA 4LLUA 5BZWB 3T08A 1J87A 1FQ9C 1FNGA 3FQRB 5CP3H 4KK8D 5EA0H 4KROD 1OAKH 3KYNB 1CICD 1XCTB 1OSPL 5D7SL 5E99L 3CVHL 4IRJC 1KNOA 1CBVH 3I3BA 3G6JF 1N59B 2JK5A 5F7YC 2RR3A 5H94B 1S7XB 5IUSA 2JJSC 2MJWA 3IU4H 1JHLH 2EDEA 4XVUD 5A43C 1X4YA 2VLKB 2VZOA 1X3DA 2WWKO 4C54A 4YHNA 1L0XA 4I3GA 1QFWH 4YWGH 2WWKT 5D6DA 4U1KB 1N5AA 5E2WL 3RVVC 4HJJH 4LPYA 1G7LA 3JV0A 2NY1B 1OQXA 4PLOB 4YFLI 3DVGB 2DQCL 2A6KA 3O8XA 4M1CD 3A0OA 3LV3B 1T7WA 5C0DA 1M7IA 3BT2L 5SWZA 1I8IB 4MA7L 4WTWA 4MAUL 4Y1AE 3MXWL 1NBYB 2B0SL 3QDGB 5I30H 2BNRB 1YEFH 4EDWL 1CXIA 1KN4H 1N26A 3C87A 3MXVH 5AYQA 4QY8A 1EXUB 3ZL4H 1WZKA 5MEQA 4V1DD 3WEXB 2A9NL 3T4YB 2VAAA 5E8DH 4LHUD 1PY4A 4P4KA 1AO7A 3NCEB 5I1DB 5IEHA 5KN5B 4OLVL 2DQHH 4S0TD 5MP6L 1Q0YH 4AIZA 3HG1A 1LEKB 5I19L 2N56A 4MWFB 5CINH 1JF5A 2XG4A 1XIWC 1S7UB 1JGUL 3INUH 4JLRB 3QHZL 5IBLD 1UEMA 4YDJA 3GEWB 3L5XL 3MX0A 3IDJB 3VXSB 5I1KH 3REWA 3MTRA 3ZSSA 1Y18B 3FB6B 3CXHK 5TH2B 4YO0A 4GS7C 4LRNH 2DIJA 4PJDA 3OB0H 2BSSB 2H3NA 3NZ8B 2NY5C 4V2BA 4F8TA 4PRDA 1AI1H 2OXHA 4JM2A 4U2ZA 3CFEB 3GSUB 3MACL 4HHAB 1DEEA 3A6CH 4HKBB 4F7TB 3DIFA 1MREH 4PRHB 1TNMA 3GRWA 5C2UB 4WI6A 2NW3B 2VXSL 32C2B 5AYUH 3F65A 4HJ0D 4KV5E 5SWSE 4RIRB 2GSIA 1D5IL 3VD9A 5E8OA 1OD9A 3DGGB 4MXWL 1PKOA 2QR0B 1L9NA 3MLYL 3VE0A 4GAFB 1KSRA 1KPVB 4LPWA 4M03A 3CZFB 3KXFB 1S9VA 3QRFM 1FORL 2F8VA 3STLB 3WLWD 4FG6C 1WISA 4OUOA 4ONOA 4XCYA 5GGUB 4YDKH 1FZJA 1IKFH 3NCBB 4P5MA 1ZA3A 4BKLB 5HHOE 1NEZA 4PGBB 5DC4B 5C0JB 2X41A 4YUEH 2HJFA 5C8JB 3UX9B 3KPTA 1I8LC 5AUMA 1GAFH 4P2RD 1P1ZA 1F3DH 4JGUA 3P9MB 1S9XB 4GRLC 3VXUB 5EU6E 1IAMA 2IG2L 3MV8E 1JGDB 1U0QA 5ICXA 4GXVH 5DSCA 4L5FH 3IF1B 2EIZB 4CKVX 1X5FA 3JUZA 3OKKB 3WIHL 3JVGA 1ZGLB 4WO4A 3KYMB 5DMIH 2F53B 3DYMA 2FYYB 4Y2DC 3QWRA 1HHGB 5CZXD 5DK0B 3RIAF 4Z7OE 4NUJB 5K93A 5FKAB 1ND0B 3AGVA 4K9EL 1FZOB 1RJLA 4LARH 1C7SA 3B6SA 4LHUG 4MCYB 1SJEA 5A16A 4GUPA 5HYQA 2YPLA 4M61A 1ORSB 1HSAA 3UBXG 1JV5A 4PRAB 1G1CA 5JMOC 4Y4FB 3U0PB 2QKIB 5IB2B 1HSBB 2WQRA 3ISWA 5E95B 3J8F7 4O00A 4RRPG 1KCVL 4Y5YB 1RK0B 3TZVB 2JELL 3RY6C 1G9ML 3BHBA 4MJIB 1OAZL 1MCFA 1CD8A 5HGAB 2OSLA 4HUKB 4U3HA 4QRPD 3ZKMC 2BHUA 3QDAA 1WWBX 2QHRL 3IS0X 4EQ2A 1XR9A 4F58H 2O5XH 5CP7B 2XZCH 4K8RL 4TVSa 2DLTA 4FQJH 1E4KC 2NY4B 1OM3L 4G43B 5J1AB 4XX1E 1KIRB 2EH8L 1M6OA 2YD3A 5F6IB 1CDHA 2C26A 4OKDA 1JYNA 2CXKA 3LRHA 3JWDC 4JPWH 1RJCA 3OR7B 3ZKXB 3ZTNL 4NFCA 3WJJA 4LVNB 1N5YL 3UZQA 5CZVL 2X1OA 5JLZB 2BY1A 2H32B 2HT4C 4NPYA 2R1YB 1FAIH 1AGEA 3D3VE 2VLJB 4XVSL 2OJEA 4FABL 1GC1L 4MNGA 3VXTA 2V9QA 3WDHA 1RZGA 4U1JB 1HNGA 3K1KC 4UI2A 5D6CB 5DYOB 3FB7B 3MRHB 4HV8B 2GHWB 4LSSH 2HVJA 4H5SA 2VO5A 4X6BB 1OTSC 1J0ZA 5DD5H 3BGFC 4X5XA 3FHAA 1Q1JH 2FL5A 1SEBA 3EOTH 3FKUS 5DO2C 3QG7L 3PQYA 3AS2A 5CJXA 4L4JA 1RFDL 1ZT4A 4KZEL 4E42A 5FFLA 3RNQA 2J8OA 4FHBD 5E9DE 1DLHA 4EDXB 1D3CA 4R96A 1ORQB 3E0GA 4NRYB 1QR1B 3DROA 1S5IL 4WWKA 1OAUH 5FECB 3FJTA 3ARWA 5DJDA 5ANME 5D1ZC 1WAAA 4D0BB 3RWIB 1NAKL 2FX7L 2YD4A 3VGFA 5IGXL 3WNMA 5JPMB 3GMNB 1F3JB 5IHUL 4RX4D 3EZJB 1HILB 1J1XL 4JY6A 3L3JB 3CFIC 4KZDL 4JFPB 2C3VA 5L9DL 5KSBA 4XHJC 1KTDA 5FA4B 3KPRB 2Z8SA 4RA0C 3FO2A 3ULVH 1M05A 1BBJB 3CDFA 3I3EA 4F7MB 3LRSB 2AGJL 4G42B 1D5BB 5GS0L 1OP5K 5IIEB 1CFVH 1H0DA 2PO6C 4UIMB 1OAXL 4C56E 3N85L 3EO9L 4GG8B 3BXNA 3RL2B 2FBOJ 1SBSL 5DRWA 3MRCA 1KB9J 1N8ZB 4P2OC 3HZMB 4OGZA 3RX5A 1U95B 2HTKC 1ZOXA 3B2VH 4RGNB 5DXWA 9CGTA 5EBWA 2NLJA 5ESVA 1PSKH 1H8OA 4JFXA 2VZVA 3CX5J 1VA9A 4TSAH 3EFFA 1QR4A 3HUJA 2KPNA 4NZUH 1WZ1L 5EC2A 3I6KA 5IMMB 2YRPA 5F71A 5ERWA 1QPPA 1JPSH 1HQ4A 2HJLB 1NCAL 1YEIL 4HGWB 1IGFH 5IKCA 5F6HI 4JAMA 2AK4E 5ALBH 3ZKQD 3D9AL 1IAIM 3LQAC 4TVPL 3K81A 3SDCC 4LSTH 3FB8B 3QIWB 4RAHA 1KGCE 3HPLB 1FYTB 3F7VB 3ZE2F 1GGUA 5GS2H 3RZCD 5IOPB 4PY7B 3KJ4C 4KJPD 2XY1A 5SX4I 1PJ9A 1KNOB 3OAYK 4R90L 4JDVA 4WHYG 4OF7A 1V5JA 2HFEA 4UINL 5DMJB 3CPLA 4X6DE 3MRGB 5F9WB 3MNVB 1YUHB 3IKKA 2OZ4H 1U41A 3HC4L 5C0IA 4LVOB 4Y1AD 4CL7A 5E8NB 1HOCB 4S1SL 5HVHB 1MIEH 2BY2A 2OTWA 3DMMA 4XP9L 2RFXA 3R4DA 3RTQC 3T1FA 2E27L 1U8IA 4YNYA 5IJKA 2BSRA 3T1WA 4E41A 1A0QH 2GCYA 3VXOA 1G7MB 2HVKB 3VCLA 4RFNC 5EWIH 1LE5A 5I66A 5A40E 2FIRT 4G6ML 3TBVA 1L7TH 5C0DB 1M7IB 1VGEL 1INQA 5SWZB 5KSAD 2J88L 4OJFL 1INDH 5T3ZH 1YMHA 3BQUC 3JTSA 2APTA 4XAWH 3VMPA 1R3IH 3QEUA 3MLTB 2CJUH 4ZOAA 5TDPB 1GOGA 1U36A 3QFDA 4Y4KC 1QFPA 5IEHB 2BCKB 1AKJA 3VD5A 1FGVH 5KVGL 1KLFA 1RZKH 5KS9A 1B0WA 2ARJQ 3VFSB 4U1GC 1KPRA 1YY9C 4MD5B 5F9OH 1DBJH 4KPHH 3VXRE 3J7HA 2ORBH 3UC0H 1NBQA 1C08A 5CIPH 4Z77B 2NY3C 3ALPA 3PF2A 4LEXL 5D7IE 3REWB 1OSPH 2X4QB 3L6FA 4AEFA 5EUOA 4BQBA 2HLFC 4YHKL 2W0PA 4YO0B 3L1OL 4RMRA 1I3VA 5SWSD 1LO5A 1KC5L 1F42A 5DF0A 4PRDB 4H0IA 1H8SA 2R0ZH 4B53A 5JW4M 3GMRA 5EOCJ 1XF3A 2YBRA 1FN4B 4ETQA 4GAJH 1ZGLM 1TITA 3DIFB 3WBDA 5D7LA 2DLFH 5DMGD 1B90A 1QNZL 2ADIB 3VWKD 5DVLA 4XWGL 4ZUVB 5HHOD 4M7LH 2RCSH 2X4UB 1A7BA 4ELKA 2AJSH 1VKXA 5B39B 1YN7A 2DQCH 4PJ8C 2GSIB 2NY7L 4M8VA 1FGNL 4PFEA 5J3HC 4F15B 3AU1A 4M3KB 3OXRA 3OKLA 3VE0B 1MWAA 4MX7B 3QNXA 2ZSVB 4OCRL 1S9VB 2EEAA 4U7KA 2B0SH 2OMNA 2NW2A 3MUZ1 5FM8A 1DQLH 2V2TB 3QHFH 2BP3A 4XTRD 2A9NH 4P5MB 4AEHL 1IEAA 1CWVA 5MP6H 4G8EB 1QSEA 2YRLA 3CFCL 2XRAH 4KMTH 2HT2C 1ULVA 5BW7C 1PG7W 4PJHA 5AUMB 3LY6A 1RJZB 1P1ZB 3PL6A 5EZIL 1IEHA 3PWPA 2MCPH 2PYEB 4Z8FH 3HLAA 3ULVE 5EU7E 5F8QC 4HIEB 3KDMA 1DN2A 5K33A 1V7MH 2DQEL 3DX8B 4HLZG 5D7JB 2JJUA 1NCWH 4NZTH 3B9KB 1BREA 1LNUA 2DDQL 3GFUA 5A2LH 3REVA 3WUWG 3MOBH 4GAYB 5LWYH 2Y7QB 4GUPB 4JO1L 1VEPA 4CN6A 4M61B 4B7LA 1HSAB 4HKXB 4XMLL 2QQLH 1MNUH 1JV5B 1DVFB 4PJAB 4PJAF 3SE3A 4CRPA 1VERA 4Y4HD 3GSXB 4HPYL 2ESVD 3L95A 4IHOB 3HMWL 2CO6B 1XZ0A 4ZD3H 4AL8L 4JFHE 4KRPD 2VUOA 3VXPA 4KXZI 1LEGA 3PWNB 1RIHL 4KKAD 3HB3D 1GZPA 3O3UN 2LE9A 4XPHH 3QDJB 5EU5A 4DN3H 4NRXB 6CGTA 2ZUQB 3RL1B 3L3HB 5C08E 3R8QA 3SKOA 3NGBB 3D3VD 3HI6H 3MLRH 3IFLL 1T5WB 1MUJB 4ZTPH 4HULB 1EFXB 1A7OL 1R5IA 4OZIA 1FL3A 4IOIA 2DQFB 3V6BR 2K7PA 5BZDA 1VPOH 4FS0A 3VW3L 3E6FB 2FEEI 2NX5B 1K9TA 4OZGA 4X6CE 1NKOA 1NFIA 2JLLA 2OMBA 2P8LA 5HYJE 4NQVA 1GGIH 3MJ9L 4YHZH 1WIPA 4DKEH 4JJ5A 3JV6B 3P9LA 3RX7A 1UENA 2OJEB 3MROB 1MHHA 4MNGB 5FYLL 3GMMA 1NC2B 4K94H 4M6OH 1IT9L 3D0LA 4KTYA 5EB9A 4QXGH 3GM0A 1D6EA 5TE6L 2HVJB 2NY5L 5FK9A 1JVKA 1RK1A 5E70A 1DQDH 1TJGH 2AVGA 2BVEA 4N0YH 4DGVH 4U1LA 5T3ZE 5A2KH 2Z91A 2FL5B 4DTGL 2CRZA 4Y19B 4M1DL 1P69B 3LZFL 5TQ0L 2E5EA 1NMAL 1VFAA 5D1XC 5GSVA 4E42B 4B50A 4P9HL 4NJ9L 4X7EC 4QHNB 3NCYP 1J0HA 1S3KH 4S1QL 5CJOL 1DE4B 4HK0A 4WW1B 1WEJH 3DROB 3LB6C 4YE4L 4WWKB 4M62H 4PJ5A 4XCCL 3QT2A 5IHZA 3SKUD 5DJDB 1MCEA 3O3EB 1WAAF 3X3GH 3KPMA 1ITBB 4TUJA 4KDWA 3PV7A 1LDPH 3HNTL 5HHPA 2QHRH 5ICZA 3V7AE 5BRZB 1DBBL 1MLBB 3WN5B 3V5KA 2V9TA 4JANB 1WFTA 4JY6B 5IF0B 5EBGA 3KR3H 3I6LE 4WRLA 4FZEL 1P5VA 5JOEA 4R4BB 4WEBH 1HN1A 5JOFB 4H25A 4XH2A 4N5EC 3MBXL 3OJMB 4G80A 3H9SD 2VLKE 3OL2A 4ENED 3QNZA 4EUPB 1KG0B 2EDJA 2FJGA 2H41A 4JN2A 2FX8L 1HYRC 5GRJH 5I8EA 4XX1G 5J13B 1FCGA 2BMKA 3NCCB 5CEZL 2AK4D 4HWNA 1MFNA 1IBGH 4FFWC 3BMWA 3MRCB 1CL7H 3AC0A 4UNVA 2HRLA 4Y4FC 1U8MB 4H1LA 4HCRH 4XXCC 1S8DA 5E24E 5EBWB 3TH2T 1KGCD 5INCA 3UPAA 2JTDA 1CD1A 3DLQR 4TTDD 4HF5L 3EFFB 4RWYH 3QXVA 4JZNB 4J7RA 4Y5YC 3EYSH 1U8QA 5EC2B 1KB5A 2D31A 4MAYB 4R2GB 1JFQH 3TZVC 3WKNA 4OLWL 4DK3A 1W0WA 2HG5B 5CLWA 5JZ7C 1EEYB 1HH9A 5IKCB 2ZWLT 2X4NB 1RFDH 2EDFA 4OD1L 2XZAH 2OTUB 3CFDA 5TQ2H 1JN6B 5FGCE 1CFSA 3UTQA 2MTPA 2NY4C 1WGOA 4QHLA 5FM5M 2XN9B 1CFQB 5FO7A 5F6IC 1P4IL 3GBML 3VFUA 3VGHA 3CXHJ 4NRZB 4A2MA 4ZQKB 2MKLC 4KDTA 4L4TE 1TZHA 3ZKXC 4LVNC 2J1KA 3RRQA 1JMZA 1AR1C 3FQTB 3SDXA 3VXSE 3CPLB 2E3VA 5JORB 5C0BB 4WI8A 4J2XA 5C3LD 3SGKC 3I75A 3QDMD 4PGZA 4G9FA 3BIBX 1F4YH 3DMMB 3LEXA 4OSUH 5I1JL 3MV9B 3BZ4B 3QUKA 3PHOB 3UTTE 1NFKA 1U8IB 4YNYB 3JWDL 5E6IA 4KK5C 2GCYB 2NQCA 2ZG3A 5FHBH 4KTEH 1K8IA 3SOBL 2YEZA 1QEWA 3EO9H 2FEDC 3LKOA 4KK6D 1MPAL 1EJ6A 5GJTL 3ARBA 3MRLA 2GAZA 3JTSB 3CUPB 4LSQL 4R3SA 1S78D 5EU4A 1BVKA 2XTLA 4U0RB 5HYSG 1FPTL 2ILLA 4NT6B 3VFRA 1AKJB 3OR6A 4L9DA 4QKXB 3U7AA 2ZPKH 1EVUA 4DFIA 1PKQA 2APFA 3B8SA 3ARQA 1JUFA 5GRUH 3MJ6A 4RSVA 4N0UE 1KIPA 5ACZA 5KAQG 4LLMA 4NWTH 3MGAA 2WNGA 3GKWH 4TVPH 2XWBA 4G3YH 3PP4L 1EGJL 1ES0A 3GGWB 3M17B 4Y88A 3HRZB 4FTVE 3UYPA 3ZO0A 2MNUA 5K9OB 4ELMA 3L6FB 3T0BA 5EUOF 4M7JL 5EUOB 4JVWA 1Q9LA 2AQ2A 3BN9C 4NKMA 3S4SG 1JWUA 2FB4H 3K8KA 5DD0L 3RI5K 2ITCA 3RBGA 3U4BL 4PB0L 3TIDB 3ILPA 2DQUL 4PTUB 1BOGA 3HAEB 1XF3B 3ZE0F 1QHPA 1U2CA 4L3CB 4UTBH 1WZLA 3P30H 3I6GA 3LOWA 3RPIA 4RGNC 5DGRA 5ACLA 3IDNB 4OZ4A 1OQOA 1ZVSA 1E4XL 1K3IA 1S5HA 2X5PA 4NNPL 1ZHNA 4UDTA 1BWWA 3RIFF 1QZ1A 1CLZH 4JDTH 2MOVA 4MJ4A 1YN7B 3MRMB 2HYMA 1NLDL 3MPCA 3TC9A 3O6MH 3O2DL 5C0RH 3TA3D 5BVPH 5KBNC 1INEL 5LCVL 3OKLB 4PJGE 3QNXB 3V9FA 1NCDL 2EDOA 4O2EA 4APQA 2NW2B 5IROA 2WIMA 4M7KH 4MHHI 5DRZA 2XZZA 4MA3A 3QIWC 3BJLA 1FYHB 5IB4A 1IEAB 4JPIB 2DMKA 1OTTD 3NPZB 3B8YA 2ZUVA 1QSEB 4MD4A 5J8OA 1FFNB 3NCFB 3QULA 4DQOH 1FE8L 3PL6B 4HH9B 5H2BA 4GOSA 4OF0A 1F4WL 2P5ED 5F9WC 1W0VA 4OGXH 3X14B 3FFCE 4LOUC 4LVOC 2QSQA 5HVHC 2V2XB 3D85B 4XNZB 5D6DC 1JTOA 2GJ6D 5GXBB 5DK3A 1ITCA 3WFEH 3QFJD 1FIGH 3HPJA 4J3UA 7FABH 2GJZA 2ZSWB 3BUYB 5IBTH 5JDSB 1X7QA 3O2WL 1LNUB 3WV0A 1LEIB 2WIIB 3LKPB 2VLJE 3O8XC 4ODHH 1F3RB 2Q8AH 1XGQA 5ENWA 1L4IA 5C08D 5C6TH 2AK1L 3DVNA 4U1SA 1XF2A 1IFHH 5GS2D 2I07A 1JYVA 4JFEB 5M94B 2VLRD 2DQDL 3TV3H 1ADQL 1AP2A 2NXZB 1Z0MA 5DI8A 3SDAA 4MZ3A 4PTTA 4DVBA 1XZ0B 3V4VL 2A6DB 4O5LL 4UMGA 1UXSB 1LEGB 4A6YH 2OI9C 2A83B 1CGYA 5FUOL 1LHZA 1T03L 3QXUA 1OGTA 1GZPB 2EC8A 4ONFH 1MFCL 1I7TA 2ADFL 4OCRH 1DBAH 5EU5B 5E6ZA 5HYJD 3SKOB 2FGWL 2GK0A 4N8VA 3BZFB 4N8CL 43CAB 1W72H 1YYLL 1N2RB 4KJYA 2YMXH 1B88A 3B2UC 3ULSA 4HMDA 1GJIA 5C2BL 3C6LB 4OZIF 4OZIB 1A47A 4IJ3B 1ZKAA 1QFWI 3V2AR 5BZDB 2Y07H 3LRGA 5T3ZD 1FNEA 4OZGF 1FHGA 1HHKA 3EYQC 4JE4B 1FRGL 2W1NA 4Q6IA 2CQVA 1NFIB 1D5XB 3IETB 1T89A 1BIIA 4JJ5B 1HNFA 1QQDA 3SPVB 3ARZA 3H7BA 2KUTA 1MHHB 1G7JB 2EE6A 4JRWA 3MRFA 2VXVL 1NCCH 1MRFH 4KTDH 5DQJB 5EG6C 1T5XB 3DI2B 4U1LB 3SDDD 4F15C 2E9JA 2F9BT 3CAFA 2ZOKA 2Z91B 4K7FB 1LO0H 1MJ7H 3PIQB 3WE6B 5ITBL 1T2XA 3LKNB 3LN4A 5T1LB 2HH0L 3R06B 5BMFH 1VFAB 1MCPL 4DEPB 2BVYA 4HPYH 3RDTB 3I6LD 4HK3N 3IFPA 3MZTA 2VQ1A 4HH8A 4HWBH 2CKBA 3ALXA 4XVJH 1UWXK 4P5TA 2I5YH 2NY2B 4BH8A 4HK0B 3NAAH 4PJ5B 2AXFA 5IHZB 4WI9A 2XNAB 4GBXA 3BP5B 2PTTA 3IDXH 4JKPL 4TUJB 5T5NF 1QRNB 1T1YA 5ICZB 5DR5L 5BOZG 3KYAA 2NXYD 3DRQB 3MLVL 5IW1B 3I85A 5E8PB 1JNJA 3IKCA 4JGJA 3ZSTA 4OCYL 4Y16A 4RZCB 4ZYKA 4H25B 1CGXA 3UTOA 3PNWA 4LNVA 3B9KC 3T04D 5F9AC 2NZIA 2FJGB 2QQNH 5GHWL 4S2SB 5GIRA 4JN2B 3O6FD 3SE8L 1IILE 4LDOB 1JPGB 3BZEB 3KPSB 1G7QA 2BMKB 4RISL 1CU4L 1A4KA 2D7TL 2IAMD 5SV4A 3VD4A 4NFBA 2QTEA 1DVFC 5ISZA 3SE9L 2FCBA 4ODVH 4LGSB 3TWCL 3PGCB 1CD1B 1XAUA 1YC7A 4EXPX 4DOHB 1BQHG 3ARGA 4I0PA 2AJVL 4NNYB 1U8QB 2GITA 1KB5B 4ZSOA 1X5HA 3N9GL 4L4TD 3N0PB 3ZHLA 3L9RA 2CGRL 1W0WB 3QNYA 4YHOL 1I1YA 5I75B 5F44A 4MA8H 5I73B 4NO5A 3LPFA 2ZUQC 2W59A 2E7HA 4M7ZB 3LEYH 3NGBC 4LSVL 2HKFH 2XWJA 2VERN 2FHBA 4A2LA 5L88H 1CFSB 2X09A 4P9HH 3DNKA 5HSFA 1EA9C 4XZUA 1AGDB 2Y5TB 3TBTB 3UTTD 2Y1VA 3MRRB 2CLZA 2YUZA 3VFUB 1N0XL 4XI5D 3U46A 4YC2B 1Y6KR 1ZANH 2DJSA 1I3UA 4NIKB 2D4DA 3UTSD 2GIYA 3AB0B 2I9TA 4WNQA 3WJJC 3WUZA 2BVQB 5EOQL 3EDDA 3SDXB 3SDXF 1UQSB 4NQXA 1G0XA 1GPOL 4LFHD 5F6HJ 4YXHL 4IRSD 3QEQD 3I75B 5JW4Q 5INDB 1YZZA 3W5MA 1J8HA 5IFAH 1NH6A 4HX1A 1IEBB 3FRUA 3PWVA 4H0HB 4HJGA 2XPGB 3QUKB 2CD0A 2GYSA 3K7UA 3ARDD 3MBXH 3TVMB 3V7AG 3FL7A 4GW1A 3GSNA 4Q9BA 2Q86B 4WGVB 1PGRB 2YEZB 1QEWB 4X4XA 5F1KC 1XCQA 4D3CH 3OB0K 1BJ1J 3NMEA 1J1OL 4PYGA 1TVHB 2FSEA 5EZOH 4NKOA 5EOTA 3MV7A 1YMMA 4FTVD 4JRXA 5FYJH 5EU4B 1MCKA 4ODSH 3QISA 4W6XB 3WIIL 2NPLX 2H2PC 3X11B 4UT9H 3OR6B 2FR4B 1S7TA 1BBDH 3KPQA 4WWKC 2X70A 3H3KA 2X4TB 1YPZE 3TO4D 3GI8H 1JUFB 5IQ7H 1KCKA 4MS8C 5DZOA 3C8KB 2Y25A 4LLMB 5HHMD 5H35A 4JQXC 1NFDF 1NFDB 4HW6A 5DHYA 2XWBB 4H8WC 1ES0B 3CLEH 4I8DA 3L3DB 4JREC 3OX8A 1U42A 3D2UB 3F12A 4ELMB 4ELMF 4TRPH 2YKLL 1Q9LB 3LCYA 4NKMB 2AXHA 3H0TB 3NFSH 2XZQL 1B2WL 3K0WA 3KHQA 4KGJA 4P3CH 2QV2A 1T83A 2VL5A 1LO3L 1T66C 2C3HA 4N90E 1CFTB 3ILPB 5J13C 2CLVB 4AEIH 3TBYB 1UM4L 4NN6B 3WXVH 3OKNA 3OMZA 3RUGB 3RUGF 2P8MA 4OZHA 5JUEL 3RPIB 3CIQA 2BNQA 4OZ4B 2YA1A 4QXWA 2JCCA 1ZHNB 2DQIL 4QXTA 1MJ8H 4MAYC 3F7YA 2CIKA 4R2GC 2GI7A 4ZUTB 1ZLVK 4E0RA 4WUKH 2DLEA 1HYSD 2FX9H 5D8JL 1XT5A 3QIUD 3P4OB 1SJXA 4J3XA 4PJAE 3SQOH 5IJVB 3QXTA 2AI0L 3FFCD 1UB5A 4O2EB 4APQB 5EBLA 1MFBL 4JFOA 2W91A 4YHLH 3LQZB 5DRZB 3WFBL 4K71B 4WFED 3RKPA 3NFNA 4K3JH 5C0FA 3JUYA 4QRRB 3L3GB 3TBSA 1TVBA 2HKHH 4LFHG 4FQIL 2DD8H 5DEFA 4Z7UE 4XPGH 3EO0A 2DF3A 3F6IA 1Q0XL 5TF1H 5T1KA 1MRCH 2BVTA 4NBYB 3QULB 4PP2A 2Z31D 1WWWX 1T1XB 1DDHA 4ZPTB 2P24A 3K80A 1OP3H 3DXAE 4XPAL 3BO8A 1EGJH 1A9BA 5AD0B 3HE7D 1CYGA 4H26A 1NANH 2YSSB 3DMMC 5C7XL 3S35X 4EIZC 5HPMA 1PBYA 3N1FC 4U05A 4EI5A 3BW9A 1TTUA 3T0EE 2B1AH 2NX5E 1JMXA 4Z78B 1SEQH 4OM1L 4DVRH 2YHGA 1EPFA 3VGGA 5D1QD 3U4BH 1T0MA 1RHFA 2I60L 5H8DA 5EU3A 2YD5A 4YFLF 2D0FA 1XGQB 4QHKI 3HAEH 5ENWB 1NCTA 4M48H 4P23B 4U1SB 1ZT1A 5HHNA 1NJ9A 2IQ9H 3G5YB 4D8PA 2YZ8A 3SDYH 1EO7A 5IM7A 4LQFL 2LAGB 3U4AA 4OZFH 4R4FL 1AP2B 3BEWA 3SDAB 2I27N 5CBEA 1RVFL 2C9AA 4U0RC 3SBWA 3D25A 4Y19E 1OF2A 5GRVL 1CVRA 4HFWB 2R8SH 3QBTB 1P9MC 5E5MA 1A7QH 1OGTB 3S36X 3CU7A 3VU2A 2EDHA 4C55A 1YEKH 1NMCB 3CGTA 4I3SL 4XCFL 1M7DB 3HI5L 4V1DA 5DEGA 3LVEA 4KJYB 3MNZA 3UDWA 2ID5A 3ULSB 2HTLC 3LN5A 3QPQD 3MCLH 1Z3GL 5F88B 3PGFL 2VDKH 3RBSA 1HHKB 3LKQB 1RZ8A 2XTJE 4LAQH 4ZNEE 3S88L 5C0CD 3ZYZA 1RURL 4GMTL 1QQDB 3T65B 3BZDA 4RAUB 4BUGA 1X5JA 2V7HB 4JB9H 1JNNL 1U3HD 4J4PA 1YEHL 4L4VD 3VDAA 5BS0E 3TCLA 4HAFA 3MRFB 4PLNC 5DJ0B 3Q5TA 1AY1L 2B1HH 4PJXA 1B6DA 3CFKA 2YN5A 4POUB 5HD8D 4FQCL 4PD4K 4HXBL 4TVPD 4I77L 2ZOKB 1MAJA 3KYKL 3W9EB 2HJKA 1IC7L 4X7DC 5FYJE 3G9VA 1PEZA 1DBKH 4PPTA 3C5SA 4OCXL 2FZ3A 4F9PC 1AXTL 4CDHA 3ZLQC 4PUBH 1LO2H 4O5LH 2ATKB 1EX0A 4ZXBA 4P5TB 1KTKE 4BH8B 3UPRA 3VWJA 5D2LA 5I1GL 1RULL 4DAGH 1UACL 2AXFB 4K2UL 3T3PE 3LDBC 3PL6C 3UTZA 4NN7B 4L8CA 1C1EH 3QUML 4ZUUA 1UA6L 4OM0H 2PTUA 1KFAH 2FGWH 3WIHA 2XN9E 3OJVC 4GQPH 1N6QH 2DKSA 1CDBA 4XP5H 2CRYA 4HQQH 4YR6A 1BECA 5GGRB 3HRPA 3CU1A 4XNZC 1CT8A 4ZYKB 3LKSB 3V4PL 4N0CD 2GTZA 4QGYA 2DI7A 3TO2B 1AR2A 3MYJB 4XBGA 1K8DA 4JY5H 2IPTL 4YXKH 3MRJA 1KYOK 2W9EL 1YEJH 5GIRB 1C5DA 2N1KA 2V2WA 4FQ2L 4O4YH 3MV9E 1A4KB 3H7LA 1MHCA 1F4XL 5C0EB 1X5LA 2D2OA 5HY9B 2VN4A 1EHLH 2Z93B 3FB5A 2PXYD 4HPOL 2NXZC 1S7RB 2B2XH 3ARED 3BIAX 1MHPH 4YX2H 4P2QB 1KCRH 2A0LD 3ARGB 4RMVA 4I0PB 5DRXA 5CFHA 2H6PB 2GITB 2AV1B 4P59L 4G8FA 4ZSOB 3EJZD 3HZVA 1N4XL 2KH2B 3S5LA 5I6XB 2X4PA 4EI6A 3QNYB 3Q6GL 3O3DA 1A6ZA 5EZJB 1OAQL 2EDKA 4NO5B 4EIGB 5L8KB 5GGVH 3DX7A 3JZ7A 4YDLB 1Q9WA 5ADPH 4AMKH 2W9DH 4ONHB 2X9WA 2CLZB 3G6AA 2K7QA 3EDJA 4IJ3C 1FG2B 1GGBL 5C07D 1CDJA 4PJEE 1N64H 4ODXA 4WNQB 3VXMA 2D9CA 1A5FH 4QRPA 4LSRH 4YDVB 5GZNC 1MFAH 4IRZL 4PJBA 4X4MA 4LSPH 4K3EL 5BCAA 4NO0A 3HTLX 1U8LA 3WJLC 3O6KL 1J8HB 1BGXL 4HX1B 2CLRB 1I3GL 4HJGB 3ZYIA 3WNNA 4NHCL 5F1SA 4DZBA 4BQ6A 4JG0L 1QBLH 5AZEL 2JJWA 4GW1B 3GSNB 3W5NA 1C5CH 1D7FA 5GS3A 4M6ML 5FDWA 3MUGA 2VDOH 3QJHB 3SKJL 5AWNH 4RISH 1RUAL 4ZAKD 2DM3A 3W0WB 1XCQB 4P4RB 1XEDA 4RMQA 5I9QB 1S9YB 1Q8MA 3GRWL 4KMLB 4NKOB 3Q6FB 4DEPC 2D03H 1HWGB 3RDTC 3OHXB 3DJ9A 1YMMB 1UB6A 4JRXB 1I9RL 5BVJA 4HWZA 1XH3A 1ED3A 1U8KB 3QDHA 1HINH 1LP9A 2NY2C 3GSWA 3P9WB 4EBQL 3GSRA 3ARYA 3UEZA 3PXHA 1IC4H 2IANE 4MQ7B 5DJAA 4N90D 3BYYA 3L7FA 4AJ0A 5HHXL 1X44A 1XGPA 1EAPA 1DANU 5H35B 3D0VA 1T2QL 3TN0A 3VGAB 4MNQA 1BVZA 1IAIH 3DSFH 4JCMA 5L7XL 3OX8B 1L0YA 4X99A 5LGHH 2VDML 1NUDA 3GO1L 2JF1A 3MRIA 1QFUL 4M5YL 2W60B 3DX9A 5FAAA 4OUUA 3VFVB 3KNBB 5GISH 1RMFH 5EOQH 1GGTA 4URTB 3WL9A 4M5ZH 5I8KL 3WS6A 1EDQA 1KV3A 5JQ6H 2WUCH 1KCSH 1T1WA 3T77A 3ARFB 3KWWA 2P8MB 1IGJB 1QFHA 2V9RA 2GKIA 2BNQB 4M1GL 4G6AD 4KQ3L 2J4WH 5I76A 3X3FH 2JCCF 2JCCB 4ZS6D 2XQYK 3RNKA 3IDMB 3ORJA 3K1DA 4Z7VB 3F7YB 2CIKB 5FIEA 5KVDL 3IDGA 5CILH 3O3AB 1JZ5A 2X7LA 2YD7A 3GHEH 5J1SC 4X98A 2WAHA 1XGRB 3AM8A 2YZ1A 1JI2A 5I75C 1T20A 1MCRA 5JIHA 2J6EH 3HC3H 4GAGL 5I73C 3DXAD 1JGVL 4P46D 5BO1H 4M7ZC 1CE1L 3TJHC 5EBLB 3IB4A 3G5XB 4JFOB 5CMAA 2EKSB 2AEQL 2OL3A 3O4OB 3AAZA 4LSUL 1ZTXL 4Y0GA 5T3XH 1XIWD 1UXWB 3OGCA 2QQKL 3T0ED 3LN9A 3U9PL 3EDFA 3EO0B 4YK4B 4YC2C 4PBWD 1XF4B 1DQQA 2B8OT 4OF5A 5IT2L 4OFYD 1DDHB 3RWCA 3O9WA 2DTSA 5CCKL 4M8QA 4KUCF 2JB6A 4MNHA 1DBML 4KKBC 4QEGA 1ZLWH 1F02I 4JO2H 3U83A 2FBJH 1VADB 3K2UL 1JNLL 3MLZL 4KROB 1JZ8A 1CICB 1FO0B 2AABH 1Z9OA 2BXZA 5J89A 1QLEL 1QSVA 3TVMC 4FQXA 3BKJL 3CC5A 1CL7I 1YYML 3ROOA 1YEDB 1GYAA 4C83B 3SJVE 3CMGA 2E8ZA 1VFMA 1FNSL 1T0MB 3BDYL 4ZFFA 4P2CG 3EYVA 5DFVD 1UKQA 5EDXA 4B0MM 2CMRH 2Q76A 4J23A 4UNUA 4Y1AA 5HHNB 4NQEE 1NJ9B 5ESAA 1YEGL 4WJ5A 3S34H 1Z9MA 3BEWB 5EIIA 5CBEB 5K59F 1KJ2A 1F5WA 5FCUL 4OLYL 5HYFA 1IGMH 5E2VL 2QL1A 2PETA 5KSAA 2A1WL 4PV8A 4LCYB 2XTJD 2IFFH 5I18L 1NGQH 3Q2CA 2D7MA 4ODBD 5GJSL 5BS0D 4V1DB 5D70L 1UG9A 1CD0A 4LHUB 5CD3A 3I50H 1CFNA 1DJSA 1YNKH 2Y36L 2VDRH 2EC9T 3LN5B 3RVTC 1QRNE 3UBXB 2F15A 1NBVL 1YA5A 2APWA 3QIBA 5E8EB 1BLNB 1KENH 3LEVL 3MA7A 3B83A 5M95B 4NN6C 2Q1EA 1R24A 3WFDL 5FYJD 4OB5L 1FDLL 4H8WL 3WFHA 1B4JL 3QWOB 3QZWA 3MREA 1U8NA 4M02A 2GFBB 5IQ9B 2WBJD 3BPNC 1NCUA 3KLDA 4ZDHA 1CZ8L 3BPLB 4PJXF 4PJXB 2AKRB 4OM1H 4DCQA 4I48A 4TTGA 5SWSA 5FHAL 5BXFA 1QBML 4MYWB 3VGEA 2EXWD 4E5XA 1NL0L 3G04A 3QQ4A 4D2NA 3LMJH 4F80A 1BM3H 3WS3B 2XA3A 4APQC 3MOQA 1I1CA 3C5SB 1K5NB 1A6UH 1HIMH 2YC1B 3VI4E 4KY1L 5IFJB 4F57H 4K71C 1RZIA 2BRRL 4YHIA 4KRLB 3ZKMD 4C58B 4TQEL 4HIJB 2OR9H 5DTFB 3RJQB 4I18A 2EE9A 4G7YL 1FNHA 4X0KA 2X4RA 3QUYD 3U0TA 5GSRA 5EU6A 3RU8L 4YIQA 3UTZB 4MMZC 4YAQB 4DKFH 4F7EB 2GUOA 3MV8A 2YK1H 5AG9A 5FF6B 4AM0B 1UCBL 3W9DB 1YECL 4HXAL 4IRJA 4YR6B 5EO9B 4L3EE 3SE4C 3PWLA 2YPVH 5EORL 2GTZB 4ODWA 5B3JF 1HXMB 4JFFE 3N1PC 1K8DB 5JHDE 1DUZB 2HT3D 4P2RB 4JRYD 3B5HA 4OD3H 1I8MA 5E56A 3GNML 5KOVC 3V8CA 4XT1C 1NMBH 5F3BA 1KLGA 5DUBB 4J8RA 3CMOL 3CX2A 3DSNA 4BELD 3A6BH 4NQDE 5DMKA 3JV4A 1JNNH 4NSKB 1AXSB 3FB5B 1OPGL 4LK4A 1FBIL 2VWEC 3SDAC 4X9IA 5JA9A 3O3BB 3NIFE 5DMYA 5T5FL 1UWEH 3LIZL 1FFPA 1NGWB 5LQBL 4HAGA 3E2HB 4PGDA 3HN3A 2H26A 5IVZA 3O3DB 3OTTA 4S1RL 5CP3A 5T3XE 3OXSB 4WI7A 1TZIB 4H88L 4XNMA 1NMCC 2DQGL 3DX7B 3QCVL 3ILQC 1H15A 2C1OA 5D1ZD 3F7RA 3P77A 1PDKA 2R0LH 3TJEH 1SY6A 4J1UA 4NCC2 3FOMB 3G6AB 1QYGL 4N0FB 3D69B 2GEEA 2Y23A 4UV4L 4ODXB 5EPMA 3GZKA 2R56H 5EULV 4HBCL 4X5WA 4QRPB 5EFIB 2HWZL 5C09E 4PJBF 4PJBB 1FC2D 2BHZA 3BWAB 4RCAA 3V0VA 4BSJA 1F11A 1MSPA 1F3DJ 4AH2A 1E6OL 43C9B 2AP2A 2APXA 4XCEB 5DJCA 5T33L 2N7BA 2M8XA 3QXWA 1U93B 2O5YH 8FABA 4P2OD 2A73A 2W9EH 1YN6A 2IAND 4OFIA 3QCTH 2E9WA 3OJ2C 2VOTA 3HFMH 3RWDB 1OCWL 1SMOA 4LLAA 1VFBA 1MCIA 4GT7A 1CFBA 3NIGE 4UOW1 4XNUH 1TIUA 1CF8H 5E9DA 1XR8A 4NM8H 1UB6B 3T0XA 3QP3A 2G5BB 2R9HD 1XH3B 5HGDA 4DGIL 4P5TC 1LP9F 1LP9B 1U91A 3G6DL 2N7AA 1N4XH 5CEYA 5KTEL 5DJZA 3SDCD 4LIQL 1CXHA 5DJAB 5ANMA 2HFGH 4LVHB 5F3HA 4GSDH 1MWAL 4W70A 5JO5B 4NN7C 1QUNA 2HN7B 2BVOA 4QRRE 4AENB 4XMKL 5IVXB 1OB1A 4MJ2A 3KG5A 4F7CB 3DUUA 5EO0A 1I8LA 1VACA 5HPOA 3C60A 3HC0A 3VFWB 2MFNA 2X1PA 3MUY1 4GRLA 3O45B 1LDSA 3MRPA 3KPOA 4Z0BL 1T0NB 3C2AH 1WJ3A 1TENA 3PV6B 3H9HB 2C1PB 4OUUB 2UZXB 4C56A 5T1DL 3K74B 4K3EH 5TPWL 1QLFA 1YNTB 3VFMA 1T1WB 5F7DB 3KWWB 5IBUB 4B7IA 4Y2DA 3DTXA 1ONQB 3NH7H 1BAFH 4O51A 3KLHD 4S1DC 4HIHA 5I76B 4OF3A 4BFGA 3ARGC 4I0PC 1CGSH 2V5TA 1V3MA 3TEUA 3BQUD 3E8UH 5DD6B 1JWMA 3IXTB 3QB7C 2DQJH 4LHJB 3SKJH 4X98B 3VI3E 5BQ7A 5I6XC 2DYPA 3RI5F 1NDGA 4OLXL 2BSTA 3U79A 2VWEE 2DM7A 1A6WL 2AK4A 4ESKA 1OGAD 2J7LA 3GRWH 3S4SA 3OAZH 2CUIA 1CLOL 4HZLA 1NCNA 4WU7B 1UCTA 3O4LA 4GO6B 4CMHB 4YDLC 3ULUH 2OL3B 1I4FB 5CGYC 3RY6A 3AAZB 5KANG 1I9RH 3VD7A 4OZFG 3NN8A 5GGVY 3OGCB 1WICA 3S35L 4HUXA 4LLQA 3SY0B 2VITB 5GRXG 1CQKA 3ABZA 3FHQA 3SJVD 4D9LL 4MLIA 5E2TL 4EOWL 1KN2H 1J86A 1IAKB 3LS5H 4LF3B 3BISA 4U6XA 1WCBB 2EYRA 2CPCA 5DJYA 1E4KA 4MDJA 4X6DA 2BJML 3DURA 5E08H 5EBMA 5JW5A 4M8QB 5EOCL 5GRZA 2JB6B 3MO1B 1MQKL 4NQED 5TGBA 4M3JA 2DQTL 1NC4D 3BD4A 4YHML 3FFDA 1JNHB 4EKXA 2O5ZL 3GBLA 1DL7H 1DLFL 3RZCB 1A6PA 5JXED 3AXLA 2SEBB 2FJFA 5BOPA 4PD4J 4DUXA 2QADD 3VXQA 1W8OA 4GKZA 1QVOA 3MLSL 3V0AC 3WNKA 4GW5B 4PJ9D 2Q76B 4Y1AB 1MFDL 2DBLL 3S36L 4L8SB 2Z4QA 4DGYL 5I9QC 3GUTA 5ESAB 4WJ5B 1EBAA 3I9GL 4OLZL 5F96L 4JZOB 5EIIB 5LVEA 3K4AA 4O58H 3IVKB 4WUUE 2F19H 3VH8G 1IRAY 4H0GA 2NYYC 2OTPA 5DVKA 4C4KO 5KSAB 2C3GA 3VXRA 4QHKJ 4JHBA 1G6RB 3VGAC 4C4KT 1ZEAL 4UTAL 1H3VA 1YEEL 5D7IA 5HVWA 1NGXA 3PGDB 3C5JA 1A1MB 1SYVB 2VAJA 3NACH 1H3TA 1A64A 4KI1A 4Z76B 1T83C 5CSZB 1KYOJ 4D9QE 3NFPA 1P4BH 1YJDH 4Q58C 1BIHA 3MA7B 2XA8L 1BFOA 5E00A 1MAKA 1H5BB 2EXYC 3LH2H 1R24B 2AJYH 4TPRH 1TJIH 4ZUSB 3FQNA 5JR1H 2VIRA 4K7PL 3WFHB 3ARFC 3ZZ1A 3SCMD 4IIQB 4RGOH 5E94A 4TUOA 4EXKA 1CXFA 4X7SL 2PO6A 1MF2L 5HBBA 4ZDHB 2AQ1A 2VXTH 1BQUA 4EZMA 3TH3T 4I48B 1Y6MR 1HZHH 2BX5A 2R4SH 3RWGB 4KV5F 5SWSB 3P0VL 5BXFB 1FV1B 1FNSH 4DKAA 3EOYG 1BPVA 1WQVT 5I16B 4G8IA 3EJYC 4ZOEA 1NSNH 1BD2D 4ZFGH 4RQQA 3RGVD 4JQVA 1YQVL 4PRBA 1Z2KA 2MCG1 1MCJA 3VWKB 2VZTA 3QXDB 4L3ED 1RUML 1RUKL 5HHOB 2IH1A 4XNXL 1HEZA 1KB5L 3R1GH 4YBQC 3IT8D 3LS4H 4JFFD 4YK4C 3T2PA 5J12B 5JHDD 4GXUN 1VCAA 4JEGB 4X0KB 4X9HA 1DR9A 3TA3A 4D9RD 5KSUB 3U0TB 1P6FA 1DP0A 2A74B 4YIQB 2VQUA 4OCSL 4OI7A 1KXQE 3RQ3A 1AO7E 1U9KA 5DJ2A 2GUOB 4NQDD 4GRWB 1RZJC 3QUXD 5GGTH 3P11H 3BX7C 3WSQL 2PYFA 1E4WH 5ESQB 1N3NA 2EYSA 3CDGA 3BGAA 4KK8C 5LAXA 4KROC 2D7PA 1CICC 3PWLB 4GMSL 4I9WE 1KULA 5JNYB 1NAMB 4AG4L 5I1CH 4Z5RB 4ODWB 1TMCB 1G7PA 1EHXA 1TETH 2JB5H 4Z7OF 3AFLA 2KL6A 2B39A 1MJUH 4KWUA 3G08B 5I8OH 2IQAA 1MCOL 3V6ZA 1E0OB 3BPCA 3FONA 2WLYA 3RTQA 5T3XD 1KLGB 2UUDH 4XVUC 3B9VA 4K3DL 4XC1L 4LCIH 4PJDE 4UB0L 5DMKB 5IFHL 5ELIA 2XKNA 4HUUA