4HGMA

Shark ignar variable domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TRVDQSPSSLSASVGDRVTITCVLTDTSYPLYSTYWYQQKPGSSNKEQISISGRYSESVNKGTKSFTLTISSLQPEDFATYYCRAMGTNIWTGDGAGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical Antigen Recognition Mode of a Shark Immunoglobulin New Antigen Receptor (IgNAR) Variable Domain Characterized by Humanization and Structural Analysis.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Immune system
molecule keywords Shark V-NAR
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgmA00
4FQQB 2X89D 4GKSA 4M1GL 2X10A 1FGNL 3IXTB 2VKWA 3O11B 1G9EA 4JQXC 5F9WB 4PJ9D 5E24E 2BOCB 4HWBL 4X8XA 1HILA 4JN1H 5CJ8A 2EKSB 3QDGD 4XWOC 5DLML 2A74A 5EBLA 5D4QA 1OAXH 4WRLA 1TVBB 3MV7A 3CH8A 2OL3H 3MTRA 1OAXL 5HDLA 1J0ZA 2EDHA 5CKAA 4L8BB 1R3LB 4I0PC 4HWEH 4F9PA 4HH9A 4OFPA 4Y1AA 3PV6A 2CKBL 2ZSWA 2P47B 3VXUE 3BZEB 2GAZA 4KJYA 1WZKA 2ZUQB 4H20H 4JVPA 4PUBH 1XF3B 3KYAA 4LMQI 4RRPG 1NFDE 4JFDB 5FB8B 5HY9B 2AV7B 2ZZUT 1ZHLB 5BRZD 4HIXL 3X13B 1JI1A 4NQVA 5AWNL 5KSUB 1OF2A 4G8IB 4J23A 5CD3B 3GSVB 1P4BH 4LHJB 3TO2B 5ENWB 1U8HA 1OLZA 4LFHG 4ZUUA 1KCKA 3QCTL 4XPTH 2P24A 2YR3A 4ETQB 2Y23A 2C4XA 2VH5H 2DQEH 3GHEL 1JYNA 3ULVF 5F3HB 3FRPA 4GKZB 2A2QT 3ZKSD 1UZ6F 2UV3A 5BOPA 5I1DA 5T1LD 1Q9OB 2FDBP 3FQNA 3M17B 2R0ZH 1D5XA 1XGUB 2DM3A 5EBWB 3W5MA 1QLEH 3JSSA 3UJIL 3RNQA 3O8XB 3JWOL 3AREB 5BV7L 2IANB 5FYKL 2DQDH 5I16B 2EH8H 4M7ZC 3V2AR 3WXVH 2DLFH 1EJ6A 4U3CA 4G6JH 2WAHA 4GBXB 2NTFA 5HHME 2Q76B 2IG2L 3SE8H 4Q0XH 4WEBL 3MRLB 3D3VE 3WFDL 4AM0A 4LNVA 4OBSA 3MRGA 4M1CD 1R0AL 2ZPKH 5D6DC 3VWKB 3GBNL 3FFCA 1HI6A 5BW7A 5DD3L 3VXSD 5IHBA 4HS6A 1CG9A 1ZVHA 3AB0C 1EEUA 3QXDA 4LSVH 3L3GB 2B5IC 1ZLUH 1OGAD 5HVHB 1LO0L 4XNZB 4GFTB 4Y2DD 1OSZB 4WWKB 3GIZL 4H1LA 4OFIA 4LAJH 2JK5A 5I71B 4PTTA 1IGML 1MFAH 1WAAF 2ARJQ 3TV3H 5GS3A 4ELMA 3KR3L 3WJLA 5ISZB 1EEZA 1HKFA 2IBZX 4MQ7B 1BJMA 4IDJL 3FHQA 5C86A 1NKRA 2VN7A 1CD1B 4ZUWB 4F9LC 3RTQB 2W0FA 3VD3A 3L3HA 1FG2A 1NDMB 5CINH 2D03L 2XWJA 2UYLB 1VADA 1UM5L 2GJ6E 2R2EA 1WITA 1QVOA 4L9LB 1A1NB 1FBIH 4ODWA 5L8LB 2QL1A 3GSXA 4WGWB 5GS2H 1YNTB 3VXSB 4GUPA 1KN4L 2D7OA 1G9MH 1EHLH 1OSPH 5JA9A 4OIAA 4PJCA 4P5TD 5HGHA 2G75A 2X42A 4JFQB 5FDWB 2AK1L 2CLRB 4XP9H 4KK5C 4WWKD 1VKXB 3BQUB 4U33A 3HA0A 5A2KH 1LMKA 1S7WA 5CBEB 4L8DA 3KLDA 2NY5C 1AO7D 1RUQH 4HK3J 4RISL 5I0DA 1IAOB 5DQDL 3MCG1 1UVQB 4C56D 4QRRD 3CVHB 3KS0J 4PRHB 2ZP0T 1I1AA 2B1AL 3B9KD 2OLDA 3S36H 4MJ4A 1A6PA 4JRYA 5CGTA 1FPTH 4OCYL 3HHRB 1ZSDA 4NCC1 3EYQD 3QFJA 4YAQA 1AO7E 5IEKB 4P9MH 1ZA6A 2R9HD 3S4SA 3CMGA 3C8KA 3L7FB 1EX0A 4LOUD 2DBLL 1CVSC 1M7XA 2QJDA 4JZNA 4TUKL 5F1SA 4G80B 5C08B 4L8CB 1ZT1B 4Z7UA 3MODH 4R4NC 2FH6A 3ULVE 3QEHA 1JYVA 4H1LH 3RZCB 3O4LE 2G5BB 3HPJA 4Z0BH 3RWEB 2Y7QB 4KV5E 4K71B 2NTSP 3DNKA 3VXOB 3ULVD 2RFXA 1AD0B 2F15A 1LO0H 2UWEF 1CT8A 3T0AA 1P7KA 2NY5H 1K5NA 3V5HB 5BV7B 2DKSA 5L7XH 5F9OL 3SKOB 4PRDA 4JM2D 1B0GA 2PW1B 2CUHA 1IILE 3KLAA 4E41A 4B0MM 1G6RL 4H26A 5HYEA 5LGJA 4PY7A 3ARBA 4FQJL 1A7NL 3VFUB 2X4SA 1JZ7A 4X7SH 2P5EA 3H9SA 1JHLH 1YEEL 1RMFH 3BE1L 4OLXH 4F7MA 2CJUL 1ADQH 1KBGH 5HDQH 4NIKB 2YXFA 4Y4HC 3LCYA 2AXHA 5HYJE 1U3HA 1LVEA 1FZJA 5FYKH 2X9WA 3ELAT 2GY5A 3TN0C 1U3HB 4OI8A 5CILL 5MERB 3IAPA 4F3FB 2ADFH 1G9NC 1N26A 1TIUA 3B2VH 4PTUB 4QTIH 5T1KB 3DMMA 1AGEB 3MLYH 4F8QA 1AH1A 1EGJA 1IM3A 3E2HB 1OP3H 1P9MC 2EO1A 3REVB 3D39E 4M1DL 3R06B 1D5BA 2VLLB 3LRGA 2XA3A 4I9WD 2BNUB 3C5JA 4DWHA 3BDXA 5KSBA 3N85L 4X9GA 4AENB 1F4AA 4POUB 4I18C 1EEYB 4NQDB 4XBGB 3IXAA 4YO0B 5C3TA 3UTPE 4MLSA 3FQXA 3OAZH 4FP8H 4JN2B 5DJZB 3PNWA 4J7RA 4EI6B 2XWTB 4HLZH 4G6FB 3LKSB 1DQJA 4PIRF 1UZ8B 1C1EH 2Z8SA 1G7QB 1J5OH 2PYEE 4NRYB 4QCIA 5I19H 2AXFA 2DDQL 1MOEA 3O3DB 5DUBA 2FEDC 4UAOC 2OK0L 2X9YA 4YXKL 3RVXC 1JUFA 4BUGA 2WUBH 3TBVA 3X3GL 5H94A 3I6GB 1UJ3B 3SJVD 4N9GA 5K9OB 4X6EA 2KPNA 5TH2A 3FQTB 3BH8B 3ARYA 4P46B 1KLFA 3TBTB 4MD5B 3RWFA 5T1KD 1ZA6B 3TM6A 1P4IL 2G60L 2H9GA 2I07B 1RURH 5DA0B 2F58H 1I1AC 2D0HA 4O2CA 5HJ3A 1KPVA 4XP4H 1HHKA 1YN6A 2Y6SC 1P2CA 4XNUH 3D18B 1BMGA 5FGCB 3CXHK 5C3LD 2KBGA 3UYRH 4BFIB 2V9QA 4S1QH 5FO7B 4GKNB 5IW6A 4M6OH 4BQ8A 2RHEA 1NMBH 4M7ZB 1H3PH 5GHWL 4ONHB 4EI5B 1SM3L 3WDHA 1D7FA 1WFOA 4HKJB 1JPST 1L7IL 3GMMA 4P2RD 2NR6C 4NQED 3BGFB 5M95B 5GJSL 2BK8A 5ITBL 1LO3L 1GCFA 1M71B 1A14H 4FXGB 1KCRL 5LVEA 1YEHL 1BQHG 2W38A 3VD7A 1IAIM 4TYUA 2DWDA 2D7TH 3L5IA 3IVKB 3DYOA 1UB6A 4MB4A 4OFYA 1G6VK 3DX7A 2WUBL 4MJ5B 3MACL 2ARJA 1N6QL 2NLJB 3HI5L 3QUMB 1DQLL 3TPKA 5C7XL 4EUPB 2FZ3A 5I1GL 2E6PA 2X4NB 1CGVA 3VXNA 4GMTL 4KI5F 2X41A 1A3LL 1UB5B 3DO7A 2H2PC 4MD4B 1AQKH 3PQYB 1J10A 1PVHA 1JJUA 2OBGA 3VXQA 1BGXH 1T5XB 4R7DA 4QOKA 3HMWH 3MUHL 2DYPA 3WNMA 4XMLH 1RUML 3IDMB 3MA9L 1BBJB 4N0UB 2AJ3B 5EPMB 5GSRB 2VXUL 1KXTB 1U8OA 1QRNA 1T5XA 4MA7H 4LP5A 2Z92B 5DD0L 3RPIB 2EIEA 3Q1SH 1VACA 3GM8A 2ATKA 4PB9H 3S98A 5GPRA 3DO7B 1SHMA 4AZ8A 4HUUB 3D9AH 1X4ZA 2VWEC 4ODHH 1MWAB 2EDDA 2YD7A 4GLRI 2W9DL 5C1MB 2WQ8A 4HDIA 4HUMB 1U3ZA 1HQ4A 1U9KA 3G6AA 1W0YT 4I1NB 3ZMRA 4DOHE 4G9FE 4X6DB 5DK3A 2L0DA 2BSTA 4MDIB 4OCSH 1VFAA 1IKFH 1LEKA 2X4UA 3K8MA 3H42H 5IQ7L 4JZJA 2YUXA 1C16B 1FG9C 4HT1L 3D25A 5IVXA 1QLFB 5B39G 4G9FD 2DWDB 3MRQA 5C0IA 2H1PL 4IRJB 3SE4A 1N3NB 3VFNA 3GI9L 4Z76B 2VITB 3V9FA 1ZVSB 1AGFA 4NRZA 3WIFB 4NKIH 4ORGB 2OI9B 2FX9L 1A3RL 2DRUA 1IKNC 5JW4M 3K8LA 2X4OB 3QUYC 3PWNA 5IMOA 5IMLB 5JPMA 3B5GA 4KMLB 1MQKL 3TFKC 4D0CA 3K2MC 3MV8D 5D5MB 2RQ8A 3LOWA 4X80L 3ABZA 2J8HA 3JTSA 1SQ2N 5AD0B 3HUJF 2X4OA 5DZOA 1DVFC 2AW2A 4K9EH 2ID5A 1HH6B 3CPLA 4HWZA 3O4LD 2X4NA 1V3JA 4TUOA 4EUPA 1XF4A 3RVUC 3TC9A 3F5WA 1M7DA 1GGIL 5T1LB 3VRJA 3ZT7A 2OL3L 3VXTA 2AK4D 3HZMB 5EZIH 1NMCB 1FNSH 1RZGB 1JTTA 2P4AB 1PGRB 5GGVY 1DLFH 3O8XD 4PP1D 5DURB 1FO0L 3V6FB 5IT2H 4P2QD 2V2WB 1LP9B 4ZO9A 4EDXB 5JIIA 3C6LB 3L3DA 4H25B 4NO2A 1IM9B 2GK2A 2NY3D 3ARFA 4CUCA 4RGMC 3EJZC 2QADD 2OJZH 1GIGL 4G8GD 4PJXB 4XVJL 3BO8B 4XMLL 1G9NH 1WZ1L 4NC1C 3FQXB 3IXAB 3RA7L 1OPGH 1BWMA 4I8DA 2P44B 3PWLA 3U36B 1A1MB 2NR6D 3IGAB 3OAYK 5B8CB 1KGCD 5JO5B 4N0UA 2M8XA 1KOAA 3VH8B 2BHUA 4GRMB 5IESH 3BVNB 4G6AD 5ICZA 1IEBB 1AR1D 4CADB 2XRAH 2ATPB 5GGSB 5DYOA 3CX5K 4O58H 3WIHL 1U8NB 2EECA 3WO3B 3P77B 2VZVA 1AXTL 1R3KA 1CE6B 1HHGB 1AE6H 1EBAA 3BRGC 3ULVH 3SDCD 4HZLB 3MYZA 3U4EB 2ZCKH 5E56A 1IAKA 1WC7A 3PWVA 5I1HH 2FZ3B 5DEGB 2Q7NA 4HK0B 2FEEL 4WHCA 4LCYB 1EFXD 5E6IC 3HS0B 3MLZH 3SDAD 2NXYC 4EEEA 3PWPE 2HMIC 1CDJA 4BZYA 1V7NH 1GJIA 3LY6A 5HGAA 1YYML 2VYRE 4HUXB 3AM8C 5DVMA 3EYOA 1QSFA 1OD9A 1NLBL 3NCFB 1M71A 4FXGA 2EICA 2OMBA 2EXYC 4X5WB 4HXAH 4LSVL 4P5TB 3BEVA 3HAEH 3PUCA 1VERA 1CZ8H 5EO9B 3WIIH 4C59B 1AY1L 1CGTA 4XNUL 4F8TA 2MJWA 5DD3H 2YRPA 1NANI 4HKJA 2YZ8A 3HC3H 3GBNH 4NQCD 5I1EL 3WHXA 3QCVH 4I4WB 1ZEAH 3LQZA 3LQAC 5GRJL 4HKZB 1BGXL 5FF6A 7FABH 5D1ZD 4Q9BA 5I74B 1YMHA 3E6HA 1IT9H 1FSKC 5MERA 4XPBL 3SGJA 3GDBA 3ILPB 3DUSB 4PRPD 2BNQE 3NBNA 1DQMH 1R5WB 5IEHB 2I07A 1EFXB 2IEPA 5DRWB 1P7HL 1I8LA 2D03H 5JMOC 4OI7A 4NHCH 2FH8A 1IGJA 3DHMA 1AXIB 5KSBF 4JPKL 4HEPG 4PRNB 1YEIH 1KIPA 3QDGB 4DEPB 2J8UB 2A6KB 1RVFL 4Y2DA 4HIJB 5F89A 4AT6B 2A9MH 3CLEL 5JNYA 1L0XA 1YJDL 4R0LA 5KVMC 3OWEA 3OHXA 3VH8G 3LD8C 2EEBA 1EO5A 3OKNB 4JHWH 4KKAC 4MNGE 4ONFH 2ICES 4JPIB 3WIIL 1MIEL 5AWNH 5JDSB 2FB4H 2WBJD 5ICYB 3OHXB 3NCEB 3BRDA 4JFOA 4I48B 2VC2L 43CAB 2P8PA 1JV5B 1GGBH 4NNYB 4K7PY 4UTBH 4UTAH 4YH6A 4TOYL 1PEWA 5GSVA 3OF6A 1MHCB 1NL0H 1QVOB 5FCSH 4G3YH 3MCKB 4PRPB 1OWRM 4URTB 5ILTH 4MA1B 3S4SB 4UIMB 3ARGA 3DX9A 5A3ID 4N68A 5DHXB 1RHFA 1QEWA 2ZCKL 1JHLL 1JPFA 1YEEH 3D85D 4U1GB 4NZTH 1H3GA 1FFNB 2HTLC 2DIAA 3T0VA 4NCC2 4YHPB 5DA4A 4QHUB 1DJSA 4DGYH 2VDNL 4DVBB 4ODVL 3LPGA 3LQZB 1TZIA 3LEVH 2IFFH 1LEGA 3SDDB 1F2XK 3VFUA 3B8YA 5FDWA 4MNGA 3ES6A 4X0KA 3L3GA 1MCNA 2YWZA 4LLWA 2V2TA 2FATL 4UDTB 1LNUB 5IMMB 5I1JH 1KJVB 1U8LB 4M00A 1DN2A 1X5AA 3M8OH 1Q72H 4MX7B 3P4NA 3NA9H 4WHYH 4WWKC 5IV2B 1CGSH 1WZLA 2X1WL 3EIFA 4NC1E 5I8OH 4BKLB 5IQ7H 3T3PF 5CEZD 4NHUB 3O6FC 4ODVH 1MIMH 5DS8A 4FQCH 2Q1EA 2J8UE 1NC4D 1DBKH 4HWUA 1G0YR 1OGAB 1AHWC 4GSDL 4ZUWA 4Z7WF 4KK6D 4HWEL 2SEBB 1DFBL 2YC1B 4RMVA 1S9VB 3S97C 4AEHH 1XGUA 5ETUB 5CIPH 3C8KB 3SBWC 4PB9L 5DYOB 4N8VG 2ADGB 3QG7H 4AK1A 4DK6A 1U36A 3F5WB 1YN7A 1T80A 3Q6FA 4JY6B 3BVNA 2GCYA 4V1DE 4KGJA 3V5KA 1LP9F 1UXSA 1CE1L 4NQDD 2CRIA 2VQ1B 1S7WB 5CBEA 1VENA 4ELKB 4G8IA 2WIIA 3LQAH 1MCPL 4RNRB 3V4PL 3PABB 4JO3H 4GRLA 2OCFD 3O3AB 4PJCB 3MNWB 1HXMA 4R0LB 2MSPA 3ECBB 4DQOL 2VLKB 3U1SL 3HG1B 4NO3B 5E5MA 5KS9E 2VZ3A 1A7QH 4P2OB 3C60B 2HT2D 3RWIA 1JTOA 5LAXA 5EH1A 1T20B 2F5BL 4YZFE 4XP6H 4Y5VB 4YHNB 3M17A 1CICC 1U58B 1ZV5A 4NZRH 2OR7A 1T7WA 4UMGA 5F1IA 3W39B 3B9KB 1M7DB 4BUHA 4L1DA 3QHTC 1DQML 5IFHH 2ZCLL 3UEZA 2BSRA 3V8OA 2XY1A 3BIBX 4MQ7A 3EYSL 2BSSA 5M94B 5EU4A 1OP9A 3UC0L 1HHGA 5F8QC 4NN6C 1I85A 5B38G 5C0FB 2Q3ZA 5I18L 1HN1A 1A8JH 5DTFB 1NLDH 3P9MA 2HFEB 4P99A 3RWDA 3WDIA 1L0QA 4QRQB 5HYIA 5CD3A 5E08H 3GSWA 2CH8A 2E7MA 4WEMB 3GBLA 3WFZA 1AGFB 4NRZB 1AI1L 3FONB 3HCVB 5F9WC 4CL7A 4P4RA 1CZ8L 4NQEB 4HUWA 3I75B 3B9AA 3HI1B 1WTGT 3CLFL 3NFNB 2BVQB 3KXFE 1ZLWK 1RJLB 5BMFH 2PTTB 5DD5H 5GGRA 2X6MA 2APWA 5IK3A 3JV4A 3VXNB 4TVSa 2HTKC 3E8UL 2BNRA 5D6CA 5TF1H 3U9PL 3HLAA 4PJHB 2CIKA 3QH3B 4ODXB 1JYXA 3P73B 1KSRA 1HSAA 3I6KB 5JXAL 4JREC 2VB5A 2EDYA 3QI9B 1DBKL 4S1DD 1XF5B 4F37K 2E7LA 4PFEA 4F57L 3W9EB 1DEEB 5T1MB 2EKJA 3SKNA 5IWLA 3QH3A 1RK1B 1Q0XL 5L2KE 1FN4A 4JFEB 4RAVB 2Z0BA 6CGTA 5DWUH 1UWEH 1JNLH 4F7TA 1U91B 1FYTA 3FQUA 4JFYA 5GIRA 1XGPB 5SX4I 4X4ME 5F7KC 4LCCB 4ZPTA 3RAJH 3FFDA 1IGYA 1QFPA 1Q9KA 2D4DA 1CDHA 5E00A 5DI8B 3IFNH 3E1F1 3DTXB 1BIIA 1U8QA 4Q2ZA 4Z7QF 4LRNH 4NBZB 4G5ZL 4EN3B 1CE1H 4PGDB 4X6FB 2B4CC 4PRBA 3SGKA 1RIVL 4CJ0A 1FZOA 1YJDC 4OLVL 5LGHH 4AIZA 4WHTB 3O4LB 1FVCA 4JCLA 1QNZH 1JNNH 3WIFA 4JM4L 2WINA 2NW3B 4YPJA 4Z76A 5ADPL 5CLTA 2NLJA 5IQ9B 4HZAA 3R0NA 2R23A 2R15A 3TBTA 4G6FD 2VR9A 4G9FA 2NY0D 4OT1L 2EC9T 3IVKA 2AJXH 4Z7VF 1S9KC 4LSTL 4I3SH 1LHZA 4HAFA 5B39A 4G9FB 4V2BA 3LB6C 5E99H 3W9EA 5GS1A 4IRJD 3MV7B 4I0CC 1FNSL 1U2HA 4TVPE 5EOCL 3CFJA 3FRUB 5DJAB 4XPHL 2NW3A 3K4ZA 5E94A 4R4FL 1KCSL 4CAGA 2A74B 4KU1A 4WFEE 2ED8A 1KYOJ 1KIRA 2R0LL 3TJHC 2ENSA 1HH6A 4DGIH 5FEBA 4JHWL 4KKBD 8FABB 1KUMA 2B8OT 4XX1G 4X80H 3V7AE 3VFMB 5DSCA 4WHYG 4YXLL 1CD9B 4WFED 5JPMB 5J1TC 4NN7C 4S2SB 2ZUVA 1PX4A 1FE8H 1J1OH 4LEXH 5D7KD 3K74B 4OTXL 3D0VA 5IJVB 1NBYB 2PXYA 1ZVSA 4JRXA 1FSKB 3SQBA 3DVFA 3TLRA 1ORQB 5B3JF 1ZTXL 4ZS7L 4CVZB 2VZOA 1MVUA 3I85A 4JM2F 4JFYB 3AC0A 1CBVH 3C8HA 4HS8L 2R2HA 4HCRL 3N1GC 1PFCA 5MEQA 1KC5H 4KK9C 5D2NE 1I7UB 5KSAD 4NYLB 2F5AH 4N0CD 3RTQD 4XB7A 1O7SA 4HJ0C 4BSWB 3JXAA 3R8BB 3H42L 5SWSE 3L3OA 3ZE0E 3GJFA 4B7LA 1IM9D 1KELH 5DQJA 3TH2T 4YGVB 3QQ3A 5HHVL 3LIZL 1RMFL 5IVOA 4DZ8B 3TBSA 1RZ7H 1CK0H 1J88A 3RWIB 1NMAH 3FB6B 1F4YL 3MJ8B 1ADQA 3HC3L 1GGBL 3PNWB 4GO6B 4UTBL 4NPYA 1G9MC 2IH3A 2I9LA 5F9DC 1VACB 3WD5L 2EE9A 3KLSA 3GHBL 4EUPH 4OV6F 1BQHA 3RWHB 3HAEB 2NXZB 4LRNL 3LS5H 3GMMB 1K5NB 3V5HA 1T0MA 4PGZA 4UT7H 3VGHA 4RGND 4Z7QE 1D5BB 4NOBA 2FBJH 3FL7A 3U79A 2OL3A 1D9KC 2ILLA 4UNVA 1EGJH 4JGUA 4M61A 1MREH 1JHKL 1BIHA 3RWEA 4U49A 3T65A 2VJXA 2EDWA 3ZE1F 1IZJA 2WANA 4PRHD 1X44A 1NGYA 4X9HA 1D9KB 1PSKH 1RZ8A 4YDLC 1JNHB 5I1HL 2O61B 4WI4A 1KF9B 3KYNA 4KKLD 1KACB 4KTYA 5F1IB 1BLNB 4P2CG 3W39A 1FL5B 1KT2B 4QRRE 3OKKA 3C5ZA 3FT3B 5CMAA 2O5XH 1IC5H 4YDLB 3MBEA 1EJOL 3QULA 2FEEI 2R1YA 1DQDL 3LPWA 3MLUL 3EOAA 5FGRA 5DFVD 1XCTB 3V5DB 4KZEL 4GRLC 3I50H 4PJAA 1IQWL 2ZJSL 3RZCD 3S9DB 3PGFL 1YY9C 1IAOA 2G9HB 5F21B 3V52L 3B3IB 4IBLT 1IGFL 2X1QA 3DVGB 4LIQL 2M2DA 2HT3C 4RNRA 5I1EH 4I3RL 4X5LA 1I8IA 2C26A 1D6EA 3OXRA 4D2NA 2ZPKL 4WTZG 3DVGA 3TNMB 1N5AB 3WNKA 4ALAL 1R3IH 1T22B 2R4RH 4JFDD 1UGNA 1J0IA 3SE8L 4JM2B 3MCLH 3Q5YA 2VERN 4M7JL 5BXFB 1R5IB 3EO1A 4OBRA 1QSFD 3KYOA 4YHKH 3IDXL 5BXFA 4PJ7B 4YEFA 5FUCC 4ZXBA 1DLFL 3BZ4B 4NZDA 3L7FA 1K3ZA 4DUVA 1EFXA 3L3HB 2NY1C 5GGVL 4XNMA 5H94B 5IVXF 1CIUA 1FL3B 3LKPB 3QNYB 4QXWA 5FGBC 1U3HD 3N0PB 3LS4L 5JR1H 1YDPA 1TLKA 3DGCR 1B2WL 1FL6A 1FCCA 1SEBB 1MFBH 4TQEL 2Y06H 4KHXH 5ADOL 1N7MH 3TJEL 4XCYB 2XQBH 1K9TA 5I19L 1ZHKB 1T1XA 2UZIH 3CK0L 3QDGE 4DOHB 1U3JA 2EE3A 4YXHL 3U7YL 5D7SL 4EUPG 4CVWA 4E0RB 1KTRL 1DR9A 4PG2A 5GRZA 5E8NB 2DLEA 2EXYD 4M43H 2P8PB 3KGRA 4PRDB 4MNGB 1TETL 3BGFC 1OOAA 1QSFB 1A1NA 4GOSA 5J3HD 5E2WL 1CFQB 1F3DH 3L5XH 1HHIA 2W9EH 4LIQE 1IBGL 2YUVA 4Y2DC 4YGVA 1Q94B 3O2DL 3CCHB 4NKDA 4LCYA 2B2XH 1WAAA 1ZHNA 2VDRL 2R4SH 3QISA 2ESVA 5F7YC 4DFHA 5GS0C 4U0RC 2M1KA 4JN1L 1RIUH 4JZNB 1X6LA 1YECL 2FYYB 2I5YH 3DWTA 4P46D 1WBZB 4XRCA 1EAPA 4Z7WE 3QQNA 4N0FA 3W11D 4OCXL 4TUJA 1OT1A 4CVZA 1RK0B 1KCVH 4QO1A 1FC1A 2DJ4A 1NBYA 1YMMA 3O0RH 5GSVB 2YUWA 4NNPH 5I75C 2W9LA 2JJVA 5C8JB 2PO6A 1E6JH 1IJ9A 3EO1B 1I8MA 3CU1A 1T5WA 2HJKB 1TJGL 3SKMA 4NT6A 1UVQA 3U36A 1MQKH 3QWRA 1HKLL 1L6XA 5ICYA 3MNZB 2X4PB 4KFZC 5F9OH 5F72S 4ZTPH 5D93B 1H3WM 2FX9H 2VTFA 2R0KH 3A6BL 4HIXH 3NFPB 4U6YB 4LGPB 4ZOAA 5FO8A 1ZMYA 2A9NL 4FZ8L 5FYKD 3G5YB 4JGMA 3TPUB 1NCDL 3VMNA 2D7MA 2BJMH 4MQXC 3LV3A 3FO1A 1UWXK 1VESA 2MQCA 2HKHL 3CSYA 1WAAE 5C07A 3VA6A 3V5DA 3QEQB 2YK1H 1QA9A 4QWWD 5HYFA 3VDAA 1FVEA 5I66B 1SBSL 5GGVH 1YEDA 1H3VA 3KPRA 4HH8A 5H2BB 1RZGA 3EDJA 1UJTA 4PJGF 3GK8H 4D9QE 2ZG2A 3DETD 5CGYD 5DEGA 3LEYL 5DJ8A 5I6XB 2BMKB 4XAKD 1T7ZA 4TSBL 3EYVB 2YA1A 4OCWH 4FTVA 5C0DA 5FHAH 4XP1L 2J4WH 3ZYZA 3JTSB 1KIUA 2APFA 3MRNA 3F12A 1K2DB 1OY3B 5FYJL 3VG0L 4GKSB 4ELMB 4ODUA 4NFDA 4Z5RA 2I60L 2R4RL 5DFWH 3ARGC 1IEBA 2PYEB 4RWYL 1CLZH 3TH3T 5J4MA 3V7MA 4OLWH 3X13A 4U1SA 3WS6C 4XCCH 4U6HA 1Q9KB 2XI9A 1PLGH 5JXED 5DRXA 2F53E 1YEJL 1PZ5B 2XNAB 3BUTA 1FNLA 4WUKH 4FZEH 4O9HH 2CGRH 4HKXB 4F7TB 4TNWF 3VRLE 4PLJD 3ZDYF 4P2OD 2YHGA 4M02A 5L2KB 1YEJH 4P9HH 5FFLA 3BPOB 4APQA 3GJFB 5C6WH 5I9QB 1ACYH 3MACH 4LPUA 2OK0H 3DVIA 2EDRA 2OSLA 1WICA 3EAKA 5CWSA 3FN9A 5D70L 1ZLSL 4JFED 1JGVL 5MEOA 2YZ1A 4K7PH 1MFDL 3BN9D 1GC1L 2APVA 3JUZA 1X7QB 3IFLL 2P5WE 4UT6H 1IL1B 4CADA 4DCQB 5MHSE 4P2RA 4TPRH 3QEUB 1IGMH 4F7PA 1KEML 1O5DT 3GMNB 4TUOB 3NOIA 5SWZD 5F97E 1S7XA 3VWJC 3BP4B 1A1MA 4UT7L 1A2YB 4BZ1H 4KTDL 1FFRA 5JA8B 3GIVA 3RWDB 4W4NA 1NEZG 2GITA 3MRMA 1OAUH 3PDDA 4J4PC 1I1YA 3TBYB 4PV8B 1SBBA 1FDLL 4XP4L 1NLBH 4J6RL 4NQCA 4Z7WB 1WIPA 4ZAKA 1JZ3A 3FT2A 4F7CB 1RJLA 2PETA 1PD6A 1F4XL 5HXMA 3LH2H 2AEWA 3LIZH 5F7MC 5EBMA 1ZT7A 4LVNC 2A1WH 4H8WH 5CJOH 1NGWA 4XBPB 2DI7A 3GMOB 5T3ZL 2NY0B 2VDKL 1UT9A 4OZHB 1QLFA 3X3GH 1NBZB 4U1HB 3F7QA 4LHUD 4LASL 4YXKH 2XFXB 5JW3H 5D7IF 3IFPA 3IDYC 3HR5A 3C6LD 1CFSB 2ICEB 1NH6A 4UZGA 4ZUVB 4E42A 2BSSB 3VRJB 3UTQB 2LAAA 2NY3B 1F3RB 2N1KA 3CFEB 4P48A 1RU9H 4AEFA 5ESVA 3LRSB 2NY5L 4OD2A 4YHLH 3O4LA 3PABA 4F2MA 3EFDH 3WUZA 5IP4A 1I1AD 1ZGLA 4LEXL 1CFTA 1MF2L 4ELKA 1T89A 3WUWG 1NC4A 4MZ2A 4LLDB 5A2IH 3LRHA 3OSKA 4APQC 4EN3D 5HHXH 4UILH 2VLRA 2HAZA 3MUZ1 5CZXC 4NRXA 1YEKL 5EO0B 4CMMB 3IYLW 3T4AA 1FVEB 1WCQA 5DDHA 3FO0L 3FO9A 5DUPH 5JOFB 2YRLA 5IHZA 4HGWB 3GMOA 1DLHB 2BFVL 5IFJA 9CGTA 2FX8H 2AJUL 4K8RL 4NQUA 4ODTL 4ZS6C 3VI3E 5EU7E 3TCLA 1A6TB 1BD2D 4DN3H 2RCSH 4U3HA 4XXDA 3KJ4B 3MOAL 4CVUA 1KGCE 4P9ML 1S9VA 2GAZB 3QJFA 1RUKL 5EU3B 2PTVA 5KS9F 1VFBA 2N56A 4JZJB 1P1ZB 1Y0LB 5F7EH 1W72A 4P57A 1DBAH 4OT1H 4UOW1 2K3TA 4JFPB 2D0GA 1QZ1A 2DJSA 2V17L 4UUJA 5IKCA 3UTTD 5I1LA 2ARWA 1INQB 2BVEA 1E27A 2P5ED 3H9SD 1K4CB 1DL7L 3N9GL 3ARGD 1X7QA 3AREC 4J3OC 1OD7A 3F62A 2HMID 2VDPH 4XGZA 3DSFH 3QEQE 2GJ6A 2QR0B 3MBXH 5CUSH 4OGXH 4P4RB 2OQJA 1AHWA 4RA3A 1NPUA 5D93C 4ZNEA 1MCLA 1NAMA 4H5SA 1U8MB 5DMIL 3TBWA 2FR4A 4NZUL 1OGAA 1U8KA 4K2UL 2VXSL 2GSIB 3LN5A 1OARL 4OFKA 5D1ZB 3ZYJA 4L3EB 1Q38A 2Q20A 2Y9RT 4N9OB 3RVWD 5F1NB 2HP4A 4HUVB 1YNLL 3WFBH 1JGLH 5GGRY 4G7YH 4ZTOH 4A6YL 2AQ1A 5DWUL 2CK2A 3A6CH 5SWZA 2E9BA 4TUKH 1WSST 5A3IC 1CF8L 3ZSSA 3MO1A 3BZFB 2X5PA 3U4AA 4L3CA 4M62H 3JVGA 4N1EA 2HTLD 4K3GA 4U0RB 3T0DA 1UM4L 4XMKH 4POZC 4ZYKB 3DX7B 1L9NA 4JB9H 1UB6B 3SE9H 1T20A 1FJ1B 5IJKC 1YUHA 4M9PA 2P5EB 3H9SB 4ZAKC 5K9OA 1CR9L 1U3YA 1ZHKA 3IU3A 2X4SB 4DVBA 4TULH 4NO3A 3QPXL 1BQLH 3QSKB 3MRNB 4JZOB 4X5XA 1BQLL 1F3JB 3O3DA 4R4BB 4MSWB 3AS1A 5CEXA 4GG8A 1U6AH 1P7KB 1FC2D 4WI9A 5J12B 4OF7A 3VMPA 1DDHB 1NC2B 4X4MA 4GG6F 3DX9B 4YR6B 1HWGB 3PWUA 3QUYD 5FO7A 3ALXA 5D1XD 2IAMD 2H41A 3G5VB 1U8JA 3L7EB 1A3LH 4M5YH 3MRBA 3D6GA 3QO1B 2E6JA 3SDYH 4QHKI 1YNLH 2GK0B 4ZFZB 3SCMB 3X17A 2DM2A 4O2CB 3L7EA 3CXDL 1MREL 1QFWI 3O6KH 2B1HH 2BVPB 5C7XH 4TUJB 4OZGF 12E8H 1NGQH 4FQLL 1K6QL 5T1KA 1C5BL 4Q74A 5E2UH 1WT5A 2FBJL 4OLYL 4QNPF 4XRCB 2WBKA 1JHTA 1MCWW 3OKNA 4KH2A 5FUOH 4XCNA 3ZTNH 2HJFB 2F5BH 1EERB 4GG8B 4YC2B 3BDYL 4JFZH 2MCPH 4K7FA 3NACH 4NP4L 3AGVA 5D7KE 3L9RA 2AEQL 1LO3H 4FXKA 4NHUA 5DS8B 4Q6YA 3MUGA 3RVVD 1I8KA 1KENH 5I2IA 1GZPB 2DMCA 1UM6H 3MRPA 5C08E 1L7IH 3PQYE 4I4WA 1BJ1H 2NNAB 2QADC 3PHQA 2DMBA 5GHWH 1NCWL 3X11A 4XBGA 3D2UA 3WFHA 4RMSA 4LLWB 3S5LG 4NFBA 3W2DL 1EO8L 2GSGB 3T0BA 5CBAA 3VXSA 1SEQL 2JJTA 1A5FH 4N8VA 5EOQH 4HFUL 4FQ1H 3MLSL 3MV7E 4M7KL 4AG4H 1NGYB 1I9JL 2RFXB 4P59H 1WCBB 3TNNB 4M61B 5MHSD 1OAKH 3B9VA 4PTUA 3K0WA 2VXQL 3Q3GB 1E4JA 1JYWA 4QRSB 4JVUA 4FRWA 2R1WB 4JPVH 5C0RH 1V3KA 4N8VB 5EDXA 3UJIH 1FRGH 4WY7L 3K81A 2C3GA 5ACMA 2VDOL 1LGVA 4XAWL 2Q86B 4XVUC 5B22A 5E9DA 5KVFH 1GPOL 4CNIA 4JDTH 1WV7T 4P2QA 3EFDL 3ARED 4PRPA 4X7TB 3SDXE 3D69A 1E27B 2R56H 3VD4A 3QB7C 1ZKAA 1HK6A 3UTTA 3BPNB 1BEYL 5DMJB 4D94A 2E5EA 2DQGL 4R26L 2DD8H 3L3OB 2DLTA 3WUWB 5C9JB 1KLUB 4LASH 2AJVL 3LHPH 4O2FB 1QG3A 5LJYH 1MHPH 4V1DD 3OXRB 1U95A 4LSPH 2AJZA 2VISA 4DKEH 3GMQB 2A1WL 2IC2A 1MCQA 4JFQA 1QFUH 1A4KA 1PX3A 4JM4H 1P6FA 2DQUL 2NXZD 4RMRA 4GBXA 1RSFA 4GUPB 5IJVA 4GRMA 1JRHL 2GK0A 5IFJB 4Y2DB 3G08B 4RIRA 4Z7VA 2J8UA 3T4YA 1T66C 5GRVL 1WJ3A 2WWKO 1IC4L 5K33A 4S1RL 4CMMA 2ORBH 3G6DL 3ZKMD 1WTLA 4R9HA 1MNUH 3DV6B 1K4CA 5HPOA 5F7HA 3MJ9H 3BE1H 4OLXL 1I8IB 1INQA 3KPSD 1ZE3C 5J11C 4GH7B 5E2VL 4FQXC 4HWNA 1KB9J 3CFJB 1DSFH 1CFSA 2AEQH 4GW5A 4APQD 3GM0A 4LSDA 1RUAH 4PB0H 3CX5J 2PYED 4G42A 4JGJA 1RD6A 4HW6A 1JN6A 1HNFA 4RSVA 1S7TA 3TA3B 4L4JA 4ORGA 1AQDA 4XBPA 3EZ8A 1BAFL 3U9UB 3DRTB 1VHPA 2EDXA 4MD0A 5SV4A 4OLZL 4Z7OE 4Z7NE 3O6KL 2PXYD 3GSXB 5CD5C 3JUYA 4IRSA 3VW3L 3ROLB 2YPVH 1ODAA 4LVHC 1J1PH 3DURA 5IVXB 3GB7B 3KPTA 2WBJB 3QA3A 2VLRB 2P8MB 4EI5C 4C54A 5B8CC 3SQOL 5TGBA 3TEUA 2I9TB 1U8QB 3RGVD 4AG4L 3WLWD 1N0XL 2HTKD 1YPZB 1KPUB 3U4EA 4HDIB 4KTEL 5AYUL 1I3UA 3K80A 4LPTA 3VD5A 1SVZA 2GJ6B 4LK4A 1YNKL 3KS0H 5AZEL 2GYSA 4G7VL 4X4XB 3WJLC 3F6IA 1AJ7L 4KKBC 4OFYD 1QSED 1AXSA 1QBLH 5ID0A 2VUYA 3CVIL 5IOPA 3F58H 5F7LB 1JZ2A 3A67H 2X4UB 3TO4A 3IGAA 1RFDL 1U2CA 1J86A 4KZDH 3U7AA 2P24B 1NUFA 3JVGC 5DUML 5BO1H 3PQYA 2EC8A 4HXAL 4YDIL 3MLRH 1KYOK 1QD0A 1WFUA 3S88H 4I77L 3JV4B 3FB5A 5FOJA 4YUEH 1DN0A 3TBYA 3WFBL 3THMH 4CW1A 2BJML 3KYMB 1KIQB 2BHYA 4FZ8H 3TCLB 4ZNCD 1QBMH 3QHFH 4AQ1B 1FIGL 1J8HE 1LO2H 1K3IA 3KWWA 4YHYB 3ROOA 4JG1H 1JI2A 3PL6B 1BM3L 3QEUA 1NGPH 3CU7A 3QI9C 2GJ6D 5CUSL 5D2LA 4CMHB 2H32A 3CGTA 2CIIB 3LEXA 4I13B 3RDTD 1E6JL 4H0GA 3L1OL 2BXZA 3N9GH 1QHPA 2HLFC 3B2UD 1INDH 2XZCL 4RQQA 1BZQK 2DQJH 1KCVL 1DANU 3DYMA 4ETQA 4XH2A 1U58A 1S3KL 4S11A 4D0CB 1BHGA 4N0YL 3QZWB 5A16B 4PGDA 5MENE 3QA3B 4ZUTB 1YZZA 4RFEA 5EWIL 1Z9OA 3BFOA 4K3HA 2NXZC 1TJHL 1T03L 3CSYB 1J0HA 4LLYA 1BD2B 1EZVX 4XNYL 4QRPB 1Q1JH 4M03A 5J1AA 3V0VB 1H8OA 5I8EB 2X4RB 5E2WH 1NKOA 4G7YL 4PLJC 4QYOA 4RFEB 1JFQH 3PXJA 3IKCA 4LOUC 1ZGLP 4PRBB 2VE6B 4WO4D 3QNXB 3QWRD 2VDML 1QTYT 2C3WA 2YD1A 1A9EB 1G7PB 2DTML 1NAKL 1Z0MA 3IETB 2VAJA 4NRYA 4QCIB 3RZCC 4ODXA 4Q7DA 1I3GL 3KPOA 5GJTH 3BD3A 3KNBB 2Y6SD 4DCQA 1DQJB 1IARB 2ADGA 4LLMB 2KQNA 1KULA 43C9A 1B2WH 3Q5OA 3EO9H 3U0TA 3BIKA 4QXUH 3T1WA 3WCYA 2N7AA 3OX8B 4RAVA 1C7SA 4LGRB 5D7LE 4DTGH 5LXGH 1KPUA 1A6UH 2J12B 3QEQA 4RRPA 5GGQL 1QSZA 5ALBH 3EYUH 2HWZL 3LV3B 1CTNA 2DN7A 1GVIA 3QI9A 4FFVD 2I9TA 1YMME 4PJIB 1HSAB 4HEME 1IM3B 4LSQH 2ICWA 3FQRA 4MNQB 4NQXB 3AXLB 5F88B 1EVTC 1MCOH 1UB5A 1T1WA 4QHKJ 1RUKH 1GXEA 4EI5D 3LKOA 2WM0A 1F11A 4UTAL 5BRZA 2EZ0C 1FDLH 4OM0L 3MNZA 1F13A 4JANA 5IBTH 3HI1A 1WGOA 4NQDA 4YO0A 3ARFD 5E8DL 2ESVE 4JREB 5I1CL 4YEEA 1I8MB 3ES6B 4X0KB 2OTWA 5HHOD 3RL2B 4FG6C 5IOPB 4NNXA 4YHIB 3UTTB 4I3RH 5E8EA 2H3NA 2IGFL 1CICA 2OJEB 5DD1L 5T33H 2A77L 3G04B 3QXAB 3WKML 4X4XA 4DKDC 3C5ZD 1WBZA 4I9WE 3BQUC 1BWWA 4ZO6A 4K7FB 3O3AA 3U0WH 1LO4H 3UO1H 2XZCH 3S8WA 3MSPA 4YZFF 5GS2D 1KV3A 4HPYH 3UTPD 3MA9H 3QQ9C 5GS0H 1UC6A 1YY9D 1RJZA 1MRFH 5FK9B 4FQIL 3G6JB 4ONGH 1R5VB 2HLAA 5I66A 1IGCL 1M7IB 2J8UF 2NY7H 1FIGH 2UWEE 3S5LA 4FZEL 1ITBB 1U8JB 4K07A 2KZWA 4K3JL 4PJBB 3MLWH 1JGEB 4IOSD 5FA4B 3MNWA 3IFOA 1A0QH 5J89A 1N5AA 2ZG1A 4JDVB 5JDSA 5ETUA 4I18B 2NNAA 5KJRL 3SOBL 1RQ5A 4NKMA 4I5BA 3D87B 4AEEA 1EO7A 4Z8FL 2P48B 2O5YH 2NY0C 2AKRA 4L4VB 4GW5B 2J88H 1KLUA 1MCKA 1KCRH 4FQ2L 1YDPB 3NPSC 3O2DA 4HBQA 4NQCE 1DSFL 1UFUA 2W60B 4LHUA 2C1OA 5EUKA 4K3DL 2QSTA 5DZLA 4CRPA 5KSAA 5L0QB 1CLCA 1NC2D 3LKSA 2GTWA 2CLRA 2ZOLB 1W0WA 1KB5L 5HGHB 3TFKD 3LZFL 4BJLA 3MJ9A 2FYYA 5D1XB 2VSCA 4M7LH 1MUJA 3A6CL 3T4YB 1TJIL 1W72H 4YFLI 4HMCA 1LP9E 4L9LA 1S7QB 4X6CA 3ORJA 5B3JE 3E6HB 3GJFH 4JFFA 3SQOH 2EXWD 4G6ML 2QHLA 1HNGA 5HHPB 2FIRT 1HH9A 1WWAX 2G60H 3TNNA 4K3JH 4YR6A 1QO3B 4F3FA 4QT5A 2VIRB 5CP3A 3O8XC 2LABA 3BW9A 4MA8L 3TBWB 1ZOXA 1F45A 2D7QA 1MFEH 4PG9B 3BEVB 5KW9L 4YE4L 4DUXA 3HAEA 5E2TH 2ZCHL 3AB0B 2ED9A 3WFHB 4JO2L 3VXRE 1HHHA 4Q9RL 1NAMH 1HYSD 3X11B 4XBEH 4XPAH 2ZOLA 4KDVA 2HRPH 4XC3H 1M05A 3QHZL 4OJFH 5DURD 4NNPL 4NN5C 5AZ2L 4P2QB 2R56L 1GZPA 4NZJA 3VFGH 3NCJL 3IDNB 3UO1L 2J8OA 2D2OA 3MLTA 3FT3A 4QXGL 4TSCH 3IAGC 4RGOH 4NNYA 4JFPA 3TWCH 5DXWA 2B0SL 1MWAL 3RTQA 4R3SA 1FFNA 1WC7B 3PWVB 4I2XE 5CJXA 2O61A 4BQ9A 4XCNB 1JHTB 3MFFA 1TCMA 4P5TC 2LAGB 2FJGA 2HVJB 3ARGB 5EA0H 5SWSB 3FMGL 5IVXE 3DI2B 1EIBA 2ORBL 3BPCA 5IM7B 1JNNL 1QNZL 2DL9A 3MCKA 1FHGA 1TJHH 3FMGH 4IOIA 1UA6L 4GQ9H 3S3PA 4K9EL 4HGWA 1DBBL 3I84A 2EYRA 3ZKQD 2O26U 5I16A 1TVDA 4CBPA 4S10A 4ZSOE 4GW4A 2RJMA 5DEFB 5HBBA 3DVNB 2VR5A 1MWAH 1IGJB 4XNXL 1OTUD 5E6ID 3EFFB 3TIDA 4PBVC 1OGAE 2EEAA 1JWSA 4MCZB 1OAZH 1HI6B 4LLDA 4AL8L 4QWWC 1QLRA 4D9LL 2HLFD 4JEGB 4OZFH 4NKIL 3OR7B 4RAUB 3MRPB 5TQ2H 1SJHA 1RAMA 3QHZH 5DQJB 5KSBE 4R4BA 3IB4A 4NO5A 4E42B 5AG9A 3VGAC 3UBXG 4AT6A 4D9QD 5ACZA 1ETZB 3QQ9D 5I8KL 4NYLA 4DK3A 1YUHB 3WS3A 25C8L 2H3NB 3TGXA 1CWVA 1ZA3A 2ICWJ 1MAML 1A6AB 2X4QB 4D9RD 3S37X 5EC1B 1BVLA 5SWSD 3FQNB 1NGWB 4U1NA 5C92A 4M4PA 4LHUG 5CHNB 4N5ED 2PXYB 1B0RB 2OZ4A 1JF1A 1DLHA 5L9DL 3MUJA 2EDNA 5BMFL 3FO9B 3S88L 2VABB 4L5FH 3J8F7 5EULV 2R2EB 4LPXA 4CU7A 2YXMA 4NKQB 4AQOA 5AG8A 4P9HC 4EN3A 8FABA 2EYTA 2WUCH 3HS0A 1NGXA 2AI0H 3MRFA 3MZTA 5CCKH 2E8ZA 4XX1E 2IMMA 3V0WL 3BWAB 4Y4HD 1NMCC 2MHAB 4KRPC 5D7IB 5I30H 1AFVL 4ZPTB 1BX2B 4PJCF 3NVQA 5I18H 5KZCB 4G7VH 1BVZA 1MCEA 3MLVL 3O11A 4NPYB 5KOMC 3IFPB 3RQ3A 1JGVH 4NFCA 1DE4A 2Q8BH 4KZEH 2KDGA 1OP5H 2WLZA 1KENL 4DUWA 4NQSB 4C55A 4ZYKA 3MXWH 3TJEH 5MP6H 2OTWB 1EXUA 4A6YA 1H3UA 2GI7A 2AK1H 4QRUB 2VKXA 3RU8H 2WINB 4DKFH 3N06B 3GJFK 1OSPL 3FN0L 2XICA 2QQQA 2YPVL 4MS8D 1A7QL 4RDQF 1EZVY 4J3SA 3VW3H 5IK3B 3T2OA 1R3JB 4RA0C 2FBOJ 5K9JL 2X4RA 4OZFA 5DO2D 3BGAA 4O5LL 5EOTA 4X7DC 4OLZH 2LQRA 4G6MH 3CX2A 3AXLA 5F88A 3DGGB 2NPLX 3CXDH 4KMQA 1OAQH 3MGTA 4U7KA 3CJJA 3F7PC 4NZUH 1U8IB 3VFSA 3PL6D 4F7PB 4LNRA 2AXGA 2BY3A 3JBG7 4PJ9C 3EKCA 4Y1AD 4FABH 3RVXD 1BFTA 1F42A 3VI3F 4IDJH 3VXQB 2EH7H 4HPOH 1NFIB 1WFNA 4KKCD 4LQFL 1XGPA 4XP1H 1K2DA 3BISA 1LDSA 5DHYB 1WUNT 3WKMH 4X8JB 5E8PA 4ZO7A 3CVIH 5I1LB 3LRSA 2LE9A 5IKCB 3V52H 2P5WA 2V9RA 2Q8BL 1IM9A 3KJ6L 2AERT 3C6LA 3L3DB 4H25A 1H5BB 1NDGB 1S9WA 5FUCE 4F15C 4XWGL 4PJEB 1DBAL 2CIKB 5B39B 5E7FA 2BNRB 5D6CB 5F3BB 5EU3A 3SDDD 1KLGA 4LLQA 4OZHA 4XHQA 3L3JB 4LCWB 3VG9C 2NY2B 1Q0YH 4KHTL 5EU7C 4PGJA 2GJZA 3LKNB 5HY9A 4M62L 5FB8A 5JPNB 1ZT7B 2ADIB 2Y1VA 1KIQA 2WW8A 1QFUL 3ULSA 1I75A 3FONA 4ZFFA 5DVNA 2FECI 1SY6A 3RWCB 4V1DB 1QBAA 3ULUD 4L5FL 5FGSA 1ZA3B 1FZOB 3SPVA 4CU8A 3IS1X 3WS3B 1G0XA 1F58L 5CEZH 1C16A 2GITB 3MRMB 1TJGH 2EEDA 5L6YH 4M6NL 1F4HA 5SX5H 4NO5B 3DX8A 3TN0A 2BSRB 3O0RL 5E00B 1KPVB 3QEQD 3SCMC 2AXJA 2CRZA 5HJ3B 5GJTL 1YN7B 4JY6A 3T2NH 2B39A 3RDTA 1E6OH 1SY6L 2WP3O 5DGRA 4XPTL 1REIA 2EDKA 3WMSA 3DVNA 1N5YH 4RMQA 5TE4H 4Y8DC 3KPRD 4HJGB 4UDUB 5C0BB 3ZE2E 1CL7H 3DARA 3D3VB 3L3IA 3P0YL 4NZTL 5TH2B 5IB1B 3SJVE 3KPSB 5IIEB 2QTEA 1A47A 1YPZA 4Z7VB 5E5MB 1S8DB 4Z18A 1G1CA 5C07B 5CZVH 4LCWD 3R4DA 1IAII 3O2DH 5HYQA 1H5BC 1T6VN 3S96A 5BVPH 4L3ED 4CW1B 2VXVH 4ERSH 1CU4H 4FXLA 1NL0L 3GB7A 3F7YB 4M7KH 5J7CC 2AJZB 2E6QA 1X4XA 3O6FA 2XNAA 3NFNA 1MJUL 2J5LB 2XOTA 4LCIH 5B21A 1EEYA 5GXBB 1JNJA 3BKJL 2P8LB 4C57C 1QRNB 1JF5A 4NT6B 1FZKA 3QUMA 2FB4L 3HCVA 4Y2OA 4G8FB 5HHOB 2VLLA 4NQSA 2DIJA 2ZKHL 4ONFL 4PJ5E 2JIXA 1JN6B 3Q6FB 2VWEE 2F53B 4LSUL 5KANG 2BNQD 5TE4L 1T0PB 1RK0A 4NQEE 1T7YA 3T1FB 1HDMB 1F97A 1S9YA 1YJDH 5F71A 1PJ9A 2B0SH 4ZG1A 1FL6B 5FV1L 3RGVB 3T2NL 3H7LA 3UBXB 4QXGH 4TSCL 1NCAL 4WV1C 2XQYK 2LU4A 5HPMA 1MFDH 3BHBB 4WI8A 4Y88A 3BWAA 2QLVB 3AY4A 5FCUH 5JDJA 3QUZA 4KAQL 1QO3A 12E8L 1DBML 2VDMH 4HS3A 2CUIA 2AVGA 4Q9RH 3OKMB 3QUYB 5L88L 4GKNA 5IW6B 3VXUA 1YEDB 5F6IB 1WCBA 5IV2A 1MI5A 2W59A 2RGSA 4Q58C 3ULUF 5C9KA 3ZDYE 2DLHA 2H32H 1OP5K 3BKYH 4WDIA 4E41B 3I3EA 4MD0B 4OF6A 5E1HB 3MGAA 1OTUC 1ZEAL 5HGBA 2QEJA 3PHQB 2EE6A 1H8SA 4AH2A 4I0PD 4UBDD 1F6LL 3FQTA 1TZIB 1LWRA 1VSCA 4AIOA 4HHAB 3WXWL 1NUNB 1ETZA 1QR1A 2ZJSH 1KN4H 4EDWL 1ONQB 1T4KA 2BVTA 2FNBA 3D0LA 4TULL 5FHAL 5HYJB 1A7RL 5I30L 4GJTB 1BZ9B 3O41B 4KTEH 3FOLA 1QSEA 3L1OH 5GZOC 4PJDE 2HVKB 4MCZA 1ZWIA 3TYFB 3CD4A 1CFNA 1XF1A 3C09B 1MCJA 3TCXA 4UB0L 4GRWE 5B4MC 3T3PE 3VWJA 2HFTA 4X6EB 4ZS6D 5KSBB 3MRRA 4JFEE 4Y89A 1UJ3A 1PSKL 3BKCL 4ZFZA 3SCMA 1AE6L 1I1AB 4PLKC 4E5XB 1S5HB 3A0OA 4OLYH 3V6BR 1YMHB 3REVA 1RZJL 4EKXA 4ORZC 2AXFB 4JM2A 5DUBB 3G6JA 4OZFG 3G5YA 3TPUA 5K9JH 1AR1C 5JUEH 4YUEL 5DMIH 3B43A 4MX7A 1N2RA 2V2XA 4H0HB 3SDYL 2NX5E 4PPTA 5DFTA 3G9VA 5CJBA 5I8KH 4UB0H 2AK4B 3T8XA 5C6PB 5KG9A 4PRAA 4YX2L 1FORL 1ZXQA 4IMKC 4UQ3A 4N8CH 1XGRA 4UOJA 1NMAL 4IOFD 3UAJC 3QDMA 1XCTA 3GGWA 4XVJH 4LKXB 3D69B 2HKFH 1A3QA 1KELL 1M05B 4PJ7F 1ZHBB 1XGRB 5FM8A 4HBCH 5HI3D 1AC0A 3NCYS 3CNKA 2XZQL 2AK4A 3T8XB 4JKLA 4BSWA 3P3YA 4Y19A 3QIBD 4ENEC 1NFDA 5TDOB 1FZJB 4P2QE 4HF5L 5HGDB 2D9CA 1SYSA 1NCCH 3L6FB 2R0ZL 3RVWC 3WSQL 3ZZ1A 1EMTH 1Q94A 5I76B 2JB6B 2G5BA 3HPJB 4WI2A 3UP1A 2OL3B 1N6UA 5F1KC 2BFVH 3CDYA 1OSZA 4WWKA 2X1XR 1H3XA 4NN5B 1DQQB 4A6YH 5KSAC 1HXYB 5LGJB 1JZ6A 1PKQA 1YQ2A 2GSGA 4S2SA 3I2CL 3PWLB 2VN4A 1CG9B 1EHXA 4JFOB 1HINH 4F58H 3QIUA 2XT1B 4D3CH 5INCB 1A3RH 1XIWC 1CLYL 4HXBH 2HT2C 3UX9B 1KJMB 1N0LA 4XHJC 5KSAB 4BA8A 5AZ2H 4DZ8A 3LEVL 4KDTC 4BFGA 5E4IA 2F19L 2IMNA 1WVZA 2BP3A 3IETA 3DSFL 1G6RA 2VDPL 4N0UE 4XPAL 1I9IL 3QNXA 3LSOB 2UY6A 3SE3A 2AJXL 2DAVA 3DI3B 4ZFGH 5KW9H 1X5XA 4LSUH 3MPCA 5HVHC 5C08A 3AREA 2KH2B 3QG7L 1VKXA 3J7HA 1R3KB 5D1XC 1D5XB 3GSRB 3BYYA 4QTHA 4D0BA 3O6MH 4JFXA 3EUUA 4GMSH 4Y0GA 2DJUA 3KDMA 3MRKB 5IEKA 1KT2A 4DVRH 4K55A 5C0ND 3TF7C 3GMPB 4OLVH 5LGHL 2HG5A 5HSFA 4HWZB 1I9JH 5JO5A 3OGOE 2IPKA 4JPWL 1FGNH 4M1GH 3T77A 1CXIA 5DD0H 4L8DB 1Q1JL 1CGSL 4U1JB 4JRXE 5HTSA 1T7XA 4X4YB 4YWGL 3NIFF 2X44D 1CD1A 3SCMD 3WFEL 4Y4HB 1NAMB 3FT4A 4H5SB 1T0MB 4HG4K 5CEXB 1AHWB 3GBMH 1AD9A 4NO2B 5KZCD 4LCCA 4U7MA 3W9DA 3O3BB 2QKIA 4R26H 3HE7B 2I9LB 2H32B 4PJAB 4ZPVA 2Y4SA 2Z31A 1MF2H 3U7YH 4JFZL 2F53A 1ZLSH 2OJEA 1X5FA 4JFEA 5FYKE 4PJ7E 1VPOL 5HGAB 5HHQB 1P5VA 1VADB 4L4VD 3SGEH 3MQIA 3KWWB 1GPOH 1F02I 1VFAB 3BH9B 4X6DF 5CP3H 5JR1L 2GIYA 5EBMB 1NGQL 1FVDB 2IPTL 1W72B 4P57B 4PJDA 1F8TL 1QSEE 3P73A 4XP5H 1GOHA 1FVCB 5MEQB 3FKUS 3FT2B 3CZFA 2AGJH 1DN0B 5IVNA 4ISVA 4YDJB 1NEZA 3OKOA 5F1NA 2MNUA 2BVQA 2A6DA 4V2CB 3TZVD 4X6FA 3VA2C 3QG6B 4EBQL 1AI1H 4PJIA 1IQDB 3SN6N 4LPCA 3JZ7A 2D31B 3RTQC 5DJ0A 2W91A 3BDBA 4U6XA 2BY0A 3ZKXC 1NGZA 4O51B 4KMTH 4NUGL 4TSAL 5DDHB 2IANA 3IDGB 1KJ2B 2DS4A 4J3WA 4IOFC 1XR8A 1EAJA 3K1KC 5LGKA 4HJGA 4UDUA 4QRQA 2PW2A 5IR1A 1UH4A 4GRWF 2IH3B 2HA1A 3EDEA 5D8JH 3RDTB 1RV6X 3MRQB 3WN5C 1BFSA 3QPXH 4JHBA 4MAYA 1RFDH 4FQPA 5J6HB 4PJXA 4K3DH 1JMZA 3JTTB 2IWGA 5DD1H 2OZ4H 5IB5A 3B9EA 3OAYH 4IRSC 2CDEB 3HZVA 1QBLL 4N1CA 3GK8L 4H0IA 3PHOA 1GHFL 4FQ2H 1OGTB 1H15B 2HN7B 1OM3H 2FGZA 3AS2A 5JIKA 5IBLD 1YEGL 3HLAB 4PJHA 3NABL 3V6FA 5L2KA 4BZ2H 4QYOB 3DURB 4LKCB 4Y4KA 4KQ3H 1MFNA 2Q8AH 5IGXH 1K8DB 5A2FA 1CGYA 3BIAX 1MCOL 4QHNA 2FEDD 4QRPD 3U9UA 1XF4B 3SGDH 3D0VB 1MRCH 4KKLC 4KUZH 2BRQA 2Q87A 1MFCH 4LRIA 1AQDB 2XXCB 1ZAGA 5C09A 5D96C 4F7CA 3P0VH 4DEPC 4M6MH 4Z7WA 2GEEA 1TNNA 4WUKL 4Y1AB 5LXGL 4NRXB 4OD3L 1JGUH 5DT1H 3H9HA 5C70A 3BZDA 1AGBB 1R3HA 1NC4B 4S1SL 4Q2ZB 4H88L 5DFVC 5ISZE 3TO4D 4HV8A 2OR9L 3RI5K 5C0BE 5ESVB 2QQLL 4P5KB 4M1DH 1VPOH 3FRPG 5MI0C 3W82A 3OZ9L 2K7QA 3FFDB 4NBXB 2I60H 1IL1A 3U0PB 3VG0H 1V05A 3MR9A 3DYPA 3MJ6A 2UZXB 3P4OB 1FYTB 3H7BA 2Y72A 2J4WL 1O7VA 5C0IB 1AFVH 5C0BD 5C0AD 5JMRA 4A2MA 2CRYA 4NQTA 2H6PB 4ZSOB 5E2VH 5CJ5A 4N9GB 5ID1B 1ZT4B 4LAQL 5T1MA 5F6IC 3PP4H 5IQ9A 3MLZL 1BECA 4NJAH 3T0EA 1WBXB 1TVBA 1E4XL 3UZEA 1HXMB 1CF8H 3DGGA 4CJ1A 3WV0A 2FO4A 2Z31C 1KC5L 4E9LA 3M8OL 2DQHL 1D5IH 3SKJL 2AJUH 1L0YA 2VISB 1JGLL 3QUXA 1TETH 1JL8A 4MJIE 3FB5B 1DBJL 2BERA 1CBVL 4EI6A 2X4PA 1JGDA 3RGVC 4GBXC 1A6ZA 5D5MF 3RPIA 3LMJL 5ELIA 3PP3K 1BIIB 4NKOA 3D18A 4PGEB 1P6AB 3JWNC 4C56E 4OZIB 1HHKB 1HHJA 2GCYB 3PL6C 1TZHA 4YK4C 3OQ3B 4IRZL 4OGXL 2PYEA 5ERWB 4R7DB 4ZD3H 1DE4B 2VLRD 5KVGH 1N7ML 4Y8AA 3UDWC 4KKCC 4OQ1A 5C0FA 4POYA 3IT8D 2DQGH 5DJ6A 3UYOD 3CC5B 1FIEA 4GS7B 2X7LA 3OJVC 3TBVB 2ZUQC 5J0BA 3MC0A 4KRNA 4PJ9A 5D7JC 5KBNC 1QKZL 5T5FH 5FYLH 3FB8A 4F15B 1FCGA 3D39A 4ZOBA 5H2BA 5DHVA 1XGYL 4Y5VA 4LU5L 5SWQA 4YHKL 1G7QA 5TQ0L 3LH2L 2HT3D 3P4NB 5LAXB 3Q6GH 3SDDC 3MREB 4P2OA 5GGRB 3E8UH 5E8OB 1DBBH 5IW3A 2FHFA 4GQ9L 5C0EB 1FAKT 4JY4A 2IH1B 2VXQH 4HUWB 1VFMA 3Q1SL 1AGDB 1OAKL 4MCYA 2MQ3A 3GO1L 4JKKA 3VU2A 3BWUC 4U6HB 5DGQA 3UPAA 4I0PB 3NFPA 3B9DA 4U6YA 3SO3C 2G5RA 3LN4A 4FMKA 4XP9L 4EI5A 5I6XC 4ODSL 4IMLA 4XHJD 5KSVB 3OG6B 5CSGA 3QI9D 5JNYB 5C0DB 5J13C 1HQRB 3LKRA 4XCEA 4YHPA 5F89B 5F7UA 3LKPA 1GC1C 3OKDB 5D7SH 3VRLF 1W8OA 3VWJD 1Y6KR 2O5ZL 2XQBL 5EZOH 5DVLA 4Y7MA 4U1KA 5DC4B 4MJIB 4FTVE 1IAMA 5CJQL 3TT3L 2BVPA 1HCFX 5DEFA 4HC1H 1BVKA 1P5UA 3NABH 1ZANL 3P9WB 2NCMA 3BPNC 3DUUB 1VEMA 2ESVB 3ARBB 3HC0A 1LE5A 3ARQA 1IKFL 5KOVC 2FD6H 2JB5L 2BVOA 3ARRA 3KPPB 2DM7A 2A6JA 3TH4T 2FWOA 3UCRA 3TYGL 3DX6B 4JLRB 3ARBC 3QCVL 1S7VA 2WBWB 3MV9B 1HHIB 3FFCD 5FKAB 8CGTA 1D6EB 1RIHL 2PR4H 4MB3A 4G8EA 4KJWC 4OKVA 3Q48A 4JN2A 1MI5E 3DETC 4UDTA 5IMMA 3IU4L 2V2TB 4J12A 2HJKA 3UYRL 4QHMA 5CEYB 1KCUL 3HPLB 2BNUA 3QWOA 5EIVA 3DUHA 4F80A 1UWGL 5JHDA 4HK3N 4TSBH 1RHHB 2JCCB 3R06A 3GSUB 2IPUK 5GS1C 1X9QA 4NO0A 5J13B 1VGEH 3EZJB 4JFHD 4DKAA 4N0FB 4EN3C 3PP3H 3EYFB 4OAWB 4M48L 2AGJL 4PJAF 1QOKA 2CDGA 4PJCE 4PG9A 4PR5A 4AEIH 1FL3A 3QNYA 4NM8L 5F9JA 1G84A 2XKUA 1JPFB 4TNVF 2H45A 1DQLH 1KPRB 4OZIE 3CCHA 2J3SA 3QUMH 4YDVA 5FV2A 1IFHL 4L4TB 5BZDB 5HHPA 4PJ8C 1KJ2L 1VDGA 4FQCL 1BOYA 3MLWL 2BNQA 4R90H 4HIIB 5FYJU 3D3VD 4R2GB 3MV9D 2IBBA 3HUJB 4MVBD 3BKYL 3FCTB 3K4AA 5C07D 2YN5A 1OWWA 1IGCH 3GRWH 4DZBB 5ITBH 2ITCB 3LHPL 4Z7NF 5DMGD 3K1DA 5E6IB 43CAA 4HS6B 4P3DB 1GZQA 1T22A 1UQSA 1VGKA 4XCCL 2LU3A 3PDOA 4KRPB 3U2SB 3O6FD 4JAMB 4MZ3A 3LQAL 4NGHH 3WFCH 1I1FB 4WENB 4Z7UF 1JK8A 3PDOB 4MXVE 3QXVA 4R4FH 3WHE0 5I73B 3B3IA 4XCYA 1ZS8B 1D5MB 3DMMD 3GHBH 5HI4D 4DGYL 2AV1A 4ZXBC 5E99L 4QTIL 3C87A 2ADFL 5CGYC 1P1ZA 2AAVA 2C7UA 3UROR 2VDOH 1FNAA 1I7UA 1V3MA 2OTUA 5C0JA 5T33L 3QDGA 3EJJX 2HT4D 2F53D 4PRNA 2F58L 1RURL 2A6IB 4G9DB 3QJFB 5IHUH 5KVDH 1CE6A 3BPLC 3FN3A 5IF0B 4LGSB 2JKXA 1MVUB 3KHQA 3QXWA 2VNCA 4NN6B 5DK0A 2J6EL 5EB9A 4PTTB 2CJUH 3BD5A 5F7EL 4PJ7A 1IBGH 3GSOB 2A83A 2IBZY 3C5SB 1MHCA 2UZYB 2E7HA 1JRHH 1D9KA 1RZ8B 1A7NH 3GKZA 1FYTE 4FQ1L 3WHE1 5AD0A 1FFOB 4I48A 5DSCB 5C0AE 4GG6E 2CSPA 4C4KO 3TNMA 1U8HB 1JRHI 4KDWA 3GSVA 2ZOKA 3CFCL 1T21A 1TXKA 4XZUA 3HPLA 2DI9A 4OD2B 1FE8L 3U48A 1B3JA 4JJ5B 3RAJL 3PJSB 5FKPB 5JOPE 3OJDB 4QY8B 4YXLH 3FRUA 1BQHB 5DJAA 3RWHA 2BC4B 2X70A 1AIFA 1SY6H 2X40A 2X2YA 1P84J 1CDGA 2MOVA 4WTWA 4Y4FD 1S7VB 2R1YB 4WW2F 4HH9B 4MA3A 3VGFA 5CZXD 4AMKH 1EMTL 4D0DB 4P3CH 4PJGA 3OKKB 1CFVH 1D3CA 1LEKB 1S78D 4XTRC 5D72H 4W68A 2CR6A 4ZMAT 4GAYA 3G6AB 2W9DH 3ILPA 4NM8H 1JNHA 2CLVB 2OI9C 4UINL 2RBLA 2XZQH 3LKOB 2WLYA 3DJ9A 3IRZA 4FNLH 1TVHA 1HCVA 1WISA 3TZVB 1KBGL 1ADQL 2FLRT 1U8NA 1TQCB 1IGIH 5DQDH 4MNQA 5ENWA 2VXUH 7FABL 3OKEA 3DV4B 5IMLA 4HGMA 4X7SL 4JQXA 4H1LB 4L8SC 5D5ME 4YNYA 3STZB 4MQTB 5DI8A 2D3VA 1S7UA 5E4EB 1QP1A 1U8MA 2EIZA 4HUNB 2AV7A 5MEPB 4P5TA 4JKPH 4EOWH 1GGTA 1U92B 3MRIB 4XWOD 4MD4A 1XF3A 2VZUA 1A1OB 3PE9A 1K4DB 2PR4L 3L5HA 4LLVA 3QUXC 5JUEL 4PJEE 5FXCH 1EFQA 3JV5A 3MRGB 3MRDA 4YHMH 4XCFL 5KTEH 2HFFA 1EJOH 2IF7A 4NJ9H 4Y5XC 1UM5H 2MWCA 3RY4A 5D7JD 1XF5A 5E94B 4NP4H 1MAJA 3I6KA 2ADJA 5CINL 1GC1H 4NUJB 1OLLA 2V2WA 2Z8WC 3MREA 5SX4H 1YEIL 3H0TB 4W81A 1JPGA 4Y19E 4W6XB 3AU1A 1MWAA 1YEHH 3QZWG 2PTTA 3TT3H 5FAAA 4NN7B 2QQKL 2MCG1 3STLB 1H0DB 5C2UB 5CZKA 3QDAA 5GISH 3UXFA 1PZ5A 2BHZA 3G6JF 3ISWA 5GGUB 3MJGX 2EDFA 1G7IB 4XPBH 1LE9A 1WQVT 4MXWH 2R69L 2CGRL 2DLGA 2C4FT 2AJSH 4HJJH 4M3KB 3VDCA 2MPAL 3VFMA 1F6AA 2Z35B 5DHVH 3BJLA 2BZDA 4WFHD 4JRWA 3N1FC 1QACA 4OF8A 2BY2A 1U93A 1HOCB 1KIRB 5DMYA 1R0AH 3CDGA 3JV6A 5I17A 1IGYB 4MMZC 1AJ7H 3I6LE 4S0SD 2H9GB 4KJPD 1FZMA 3MLVH 2QSVA 3O6LH 4OV5B 1U91A 4NOFA 3KPRB 3EYSH 1R24A 2CR3A 1ND0A 3MJ7A 1NFDF 3I6GA 3ARDD 5ACLA 4RMTA 4PD4J 4HIEB 5J9PA 5E95B 3MRCA 2QQKH 2BSTB 4MDIA 3VXTB 1C12A 5T1LA 1T83A 2J1KA 3OR6B 4PJBE 4QXTB 5DJCA 4HD9A 3WNOA 1TQBB 5D7LB 5IVZA 3GSQB 2JJSC 4UU9A 2MFNA 4JFHE 1B4RA 2WIIB 1LD9B 35C8H 5L9DH 4S0TD 3RFZC 4PV8A 4TTDD 2YBRA 1VB9A 3JWDL 4I3GA 3U0PA 3E6FB 1RZFL 5IB2B 4I2XB 2XA8H 4K3EL 3I75A 4RZCB 1QRND 4J3TA 4L4VE 1MJJA 1A2YA 5I1AB 5IW1A 3B6SB 1KFAL 2A9NH 3TO4B 1KNOA 1BBJA 3JWDC 5DR5L 5KAQG 3ET9F 4P3WA 4WW2B 3EHBD 4U05A 4XVSH 25C8H 3FOMA 3CFBA 3QXTA 4R7NA 1KB9K 1RU9L 4QOKB 3GSWB 4RCAA 3LMJH 1QQDA 5JIPA 2DL2A 4LBEA 2YWYA 2DKMA 4QF1A 4PJEF 4XT1C 5C09B 2PO6C 2ERJB 3RBGA 1FN4B 5T5NF 2OJZL 4ZUSB 1RK1A 4O02L 2OSLB 5SV3A 3HE7D 4FNLL 4YHZL 3FZUD 4ZO8A 3PIQA 4NO0D 4JHAH 3VWKC 3C2AH 4PP2B 4N1HB 1CFQA 4MVBC 3TA3D 3NH7L 4MJ2A 1BZ7B 1IRAY 1RJYB 4BYHA 1RIVH 1JP5A 3VFOB 4ZS7H 5FYJE 2IPUG 2VLKA 4YFEA 5DRXB 4NQEA 4YHOH 1T89C 4AENA 3WO4C 3OKLA 5BZWB 1I9EA 2OS7A 3RJDA 2HH0L 4U1SB 3P4MB 4K94C 2DYPB 5C0GB 4HIHB 4OIIL 3R1GH 3RNKA 1K4DA 3EOBB 4NGHL 4LL9A 3UAJD 5TFSH 1IC7H 3B9KC 3NTCH 3VXOA 3OAUH 4OCRL 4X99A 1XIWB 4UV7L 1P7QA 1C8PA 3F12B 3IFLH 1QFWL 5IWLC 2X1OA 3BD4A 1SJXA 2IQAB 1BJ8A 4RGNE 4X6BA 5TDPA 5H37H 4GW1B 4WNQA 3HNVL 1YMMD 5DJ8B 1ZT1A 2ZG3A 4Z7UB 5ICXB 2KKQA 4G80A 2DBLH 3P4LA 2YKLL 3S7GA 4R90L 1T3FA 1CDBA 5GQBA 4UIMA 4Y5XB 2VDNH 3RP1A 4UQ2B 1T1ZA 4MJID 2Y06L 3B8SA 1MFBL 2E9IA 4KHXL 4TQEH 5ADOH 3ZDZF 1N6QH 2OP4L 4P46A 1YPZE 2YC1A 3D5OF 1ZSDB 1XGTA 3SJVA 1HYRC 4JRYB 4R8WH 2Y5TA 2FLBT 4KQ4L 1IT9L 2P45B 1R5IA 1RULH 3GNMH 2F8VA 1GHFH 1EK3A 3ECBA 3WE6A 4J4PA 3UDWA 1J87A 2VMFA 3QPQD 4JQIH 4GRLB 3OXSB 1J8KA 3IJSB 2BNRD 1ND0B 5ILTL 3PWPA 5KS9A 2UWEA 1T04B 4ONHA 3D9AL 3HRZB 1YC7A 4M4RA 3QDHA 3CFDB 3ARPA 1TDQA 1XIWD 2BC4A 2VZTA 3VMOA 3HE6D 2Y7QA 2HJLB 5C9JA 4H8WC 3TVMB 3JV6B 1PY9A 5I17B 4PJFA 3GUTA 2IQ9L 5T1DL 3WNNA 1P2CB 1Y18A 4MXWL 4HUKB 3FAWA 1RUMH 1YMMB 5A40E 1TTUA 2W1NA 4GT7A 3WN5A 3OPZL 1BPVA 3SKUD 4RMWA 2OXGA 5GISL 2IADA 1J05A 1HIMH 3PGFH 4OZGB 3AMLA 2IPKB 1J18A 3KPNA 4L29B 3I50L 1P9MA 4KY1H 1FFPB 1GSMA 1ZANH 2R2BA 4PRID 3QEGL 3MBEC 1ZHNB 4K8RD 1EEZB 1AP2A 1X3DA 5GRYA 4QTHB 4D0BB 4JHZA 3MMEB 2VDLL 5DVOA 2XRAL 4LVHB 2EO9A 2DDQH 2CO6B 3ARWA 3S4SG 1CQYA 5C0AB 4R2GD 2NX5A 3BQUA 1LO5A 1D6VH 3BT2L 3U30C 2ZNXA 1U8LA 3A6BH 2R0KL 4WWID 2AV1B 4H26B 3WLWC 3CDFA 1HKLH 5DJXB 3TVMD 3F7VA 2QQNH 3BXNB 1UXWA 5EBGA 4ODWB 1SM3H 5EC2B 1CT8B 4PJXF 3HG1E 3QUXD 3CDCA 3N1PC 1GIGH 4JAMA 5T1DH 2YD3A 4WEBH 3BXNA 1T1XB 4WO4B 3MA7A 3F7VB 4WUUA 1AKJB 3RZCA 1JZ4A 2EIZB 3M07A 4AEHL 1I7TB 3O9WC 4HIJA 3RIAF 2QHRL 1IAKB 3JWOH 5BV7H 3LEYH 1T6WA 3I02A 4Q9QH 3KPQA 3LAFA 3IDJA 3O8XA 3C08L 1LEIB 2R2HB 5I73C 1CFVL 1RULL 3GNML 4YHZH 4AMKL 3RHWK 4I0KA 4J3UA 4RWHA 3QDJA 2EDEA 3CZJA 3BP7B 3UTTE 5TPWL 3TIEA 5I8OL 1R5WA 1Z9LA 3CUPA 3KAAA 4M93B 3KYOB 3T0EC 1MCHA 1A7OL 3VXRD 1EA9C 2E8YA 4PRHA 3QCTH 3KLAB 4K7PX 1LILA 3PHSA 5C0CA 4P5MB 4WO4A 5FM5M 4JO3L 1K85A 5JLZB 4K94H 4QGYA 3VXMA 3SDXB 3VFPA 1C1EL 4CMHC 5F7DA 4AL8H 4OTXH 4KVCL 2NY1B 1MY5A 2LVCA 1MHEB 2GT9B 4Y5YA 1FV1A 5FUZL 5TE6H 3ARFB 3H6JA 1EV2E 5IG7A 3C5ZC 2XN9A 1F3JA 4KJPC 1NCBL 4M5ZL 1UYWH 1YNTA 3JWDH 1RUPL 2CK0H 2I25N 1A7OH 2A6KA 4WV1B 1DL7H 1NUGA 3EOAB 3BZEA 4NCDA 2ZSWB 5LQBH 3VXUD 3RUGB 3MRHA 5E5RB 3EO0B 4OCXH 5EU6A 4NSKB 3VGGA 5GZOD 3WSQH 1DUZA 3CSBA 4PS4H 1Q9OA 1FG2B 3QUZC 3BZFA 4QOKE 3RL1B 1JBJA 4HSQA 4PJ5A 2Z8VC 1X5GA 3QFDB 3QPQC 3S36L 1D5ZB 3KLHC 1MCBA 2Q7YA 3IXTA 4MA7L 5ADPH 3HMXA 1RUQL 1I3VA 2W9EL 4MDJB 1R3IL 2IAMB 4DN3L 2JK5B 1X5IA 1YY8B 1GAFH 2C3HA 5ICZB 1E4WL 3FQWA 1I7TA 4FQJH 5IMKB 3O3UN 5C2BH 1NAML 2LTQC 4KPHL 3CH1B 3MZGB 1IGFH 2WNGA 1P7QB 4IIQC 3P9LB 4UAOB 2QBWA 1JWUB 3MA7B 4PGCB 3NZ8B 1IQWH 3FQUB 5DF0A 2FGWL 3FB6A 5ANMB 3BGMB 3D25B 1FO0B 1Z9SA 4KUZL 3V6ZA 3OKLB 5BZWA 4JPKH 1JWMB 1PYWB 2FX7H 3MV9E 3SKNB 4OUUA 4XXCA 4BSJA 1AR2A 2ICCA 3MUY1 3DMMC 3GI9H 2WMPA 2NTFB 3QWQB 1CD0A 2EDBA 3VFVB 1W72L 1F5WA 1BZ7A 1UG9A 3B2UC 3S34L 5GRVK 1EHNA 4JG0L 1D5IL 1FLRL 3ARDA 4GAJL 3IRPX 3O81A 3SKJH 2EKSA 4KY1L 5LWYL 4OZ4A 3RNQB 3TA3C 2K1MA 2CLZA 2CDFB 2ATKB 1OB1A 3KR3H 5I8CB 1BF8A 1N64H 4G3YL 3KHOA 5GSRA 1V3LA 4HQQL 5DJ2A 5HPMB 3GIZH 2NY4C 4BH7A 5K9KA 3DIFB 4I77H 3V95A 3QT2A 4U7SA 4LDLB 2XTJB 4L4TD 4J1UA 5FGCE 1FNEB 3QAZC 4WJ5B 1MSPA 1C5CH 3P9MB 4PREA 4UV4H 2W65B 4Y5VC 3PG2A 5SWZE 1RHHA 2H8PB 2OR9H 3F8UB 4WTXA 1ES0B 4G43B 5KSUA 4AY0A 2ERJC 2E3VA 1KEMH 1FQ9C 5IW1B 1UACH 5T3ZE 4U0QB 4XB8A 5D7JB 5CEZE 5FO9B 3PV7A 1AQKL 4EDXA 1N3NA 2FD6L 4HG4J 4OKVB 4X6CE 1LP9A 1RJYA 1RVFH 3MNVA 4R8WL 2DLFL 1IGTA 3DROB 2OX5A 3BT2H 4WUUE 4HC1L 5IFHL 1GH7A 1MY7A 4L8BA 3S34H 5I1GH 3HG1A 2GJJA 5EZOL 1WBXA 1N8ZA 2R8SH 5F6HJ 5CJXC 4IIQA 2BXYA 4HIEA 4OGZA 5D72L 4ACPA 2QSCH 3KPSA 2EIBA 1YEGH 5DQ9B 4WU7B 4OV5A 5K59F 2PXYC 5HHNA 1QFWH 1XH3A 2XTJD 2VQ1A 3KPLB 2YPLA 4DQOH 4HC1A 2YRZA 2VLME 1MEXL 3NN8B 3TO2A 3CFKA 3GIVB 1I3RA 2CQVA 4WFGD 4PRIE 3V6OC 4LDOB 3INUH 3F6LA 3GJEB 5D8JL 3PWJA 2XTJE 1KB5B 1XFPA 4JFDA 3MGOA 1XIWA 2EDLA 15C8H 1A7BA 1J0JA 3V4UL 2H26B 2DKUA 1IEHA 3O3EA 3BH8A 1YYMH 1WZMA 5HI5D 2VXVL 1UH3A 2CKBH 1C08A 3ULSB 1SJEA 2VLRE 3BP6B 1FGVH 5IBUB 4IHOB 4OF0A 5MI0B 4N0RA 5E9DE 2W07A 4APQB 4CDHA 3BSZL 1P4LB 2Z91A 5TE7H 5BS0E 1SBSH 2BY1A 1XCQA 5FM5O 2DQTH 4LCUB 4XP5L 1JMXA 4PJEA 1P4LA 2Z91B 4HS8H 1I9IH 4PV9A 3IDIA 5DJZA 1WIOA 3O2WH 4O58L 1LNUA 1XZ0B 4GAGL 4P3CL 2BCKA 2H2SD 4EIZC 1F6FB 4JFDE 3IJHA 2PCPA 2AJ3A 5EPMA 4FQHB 5DR5H 3GZKA 5LBSL 1EUTA 4A2LA 1VFOA 4R6UA 2DQEL 2H8PA 1ITCA 3O3EB 5HYSG 3L5WB 1T2JA 2XA8L 4Z5RB 4U1MB 2DWEB 2YPLE 3UPRB 1I8LC 1F58H 3AVEA 1KJ2A 4JZJC 1RZIA 5EU4B 4R96B 1EPFA 2JCCF 3R1GL 3FQWB 4FQHA 2R0LH 2OMNA 2BMKA 4POZD 1YY8A 3VGAB 4UIKH 2IFFL 2K7PA 5EOCH 4EVNA 3HZKA 4F57H 3MLYL 4WI7A 3ESVF 1V8HA 3IDIB 4Z78A 4PJGE 4YHNA 4Z7OF 1OQOA 3AU1B 1EEQA 1YECH 2VDQH 1B90A 1XR9B 5D7LA 5IVZB 2R1XB 3C2AL 4TRPH 2DQTL 4XWGH 3O6LL 4WFHE 1JUFB 4J8RB 4ODHL 3NCBB 1TQCC 2XYCA 1HEZB 2NZ9D 3FO2B 3SGKC 1ZT4A 4RBPK 4FOMA 1DVFD 4ZSOA 5EN2B 4ZFGL 1UKSA 5D1QC 4MAYD 4ZFOB 1L7TL 2V5YA 2Z31B 5FM4A 5A2JH 1WBYB 5GRUH 1RZJC 2DM4A 3W2DH 4LLUA 2MHAA 5D7IA 2LVEA 2DQIH 3QQ4B 2NY6D 1UXSB 3Q2CA 3QNZB 5BW7C 1TTGA 3P0VL 3QEHB 5DK2B 3H9YA 3EHBC 4ELME 3QP3A 3DECA 1F6AB 1MEXH 1S7SB 2B4CL 3BI9X 4J1UB 2H1PH 5I74C 1AGEA 3RWFB 1WK0A 1JNLL 3UJTL 4RX4A 3LS4H 3EDKA 3QFJB 4YAQB 35C8L 3QUZD 1JF1B 2NZIA 3TP4A 1I4FA 4NC2B 2D7TL 1C5DB 4ZFOL 4N5EC 1ULVA 2O93L 4NKDB 4RFOL 3E0GA 3S3SA 4KROC 3GSRA 2VL5B 4C83A 5HHMD 2B4CH 3RUGA 1MQ8A 1LEIA 5CGMA 4LKCA 5TF1L 3U9PH 3UTZA 1J0KA 1H8NA 5H35B 1WF5A 2UVFA 1A7RH 2Z31D 2XZZA 3ZL4H 4N90E 3AY4C 2EIDA 1MCDA 3NIFE 5HVGB 4PJ8D 4JKPL 1KEGL 2NY6B 4JJ5A 1NANH 3O4OB 4KRPD 3OR7A 4RAUA 1KJMA 3ZDXF 1T21B 1I1FA 5C07E 4U1LB 1T1YA 3K4DA 4ZNEE 3KPMB 1JWUA 2PW2B 3DMMB 4OSUL 5BQ7B 2EYSA 5DD6A 1FNGB 4LVEA 1EHLL 4D9RE 4B41A 5IMKA 2WWMD 4HK0A 3VGEA 3H3PL 3RGHA 2D31A 5JORB 3LPFA 5D2NB 4ZODA 4XNMB 2ZNWA 3DV4A 3HC4H 5IM7A 5INDB 1V7NL 1KTLA 1RZJH 5HI4C 5BZDA 3RIAK 3EJYD 2ZWLT 2JB5H 1X4YA 3AS3A 2XQYG 4KI1A 5FYLL 4YDJA 1MAMH 1MIML 3BZ4A 1KTLB 2LU7A 2ATPA 2YKLH 5EU6E 5GGSA 1J5OL 4YHYC 2R2BB 4IMKA 5J3HC 2PYFB 4LVOC 1Q72L 5J56B 1TITA 3KPNB 1A14L 4L29A 4PJ8B 3U7WH 1JV5A 4OZGA 1B0GB 2PW1A 4OUOA 5EU6D 1M4KA 1OARH 1T2QL 1P4BL 4GRWH 4Y1AE 5EZLB 4BH8B 4F7EB 3OAUL 4OCRH 1MFAL 3BGMA 1MH5B 3K8KA 3QIWD 2GQHA 4JPIA 4U1GC 5GS0D 1MNUL 4BSVA 1OQXA 1G7JA 1Q9LA 1OAZL 2HH0H 2FGWH 2BX5A 4EDWH 1PY4A 3G6DH 1QFWM 2HJLA 5EIQA 5BS0A 3OJDA 4QY8A 2Q76A 1F3DJ 2F9BT 4LVNB 3WD5H 4F37F 1MHEA 2Y07L 4PRHE 4G8EB 3FCTA 1PG7H 3IF1A 5C6TH 1T04A 3AM8A 2VIRA 1LO5B 2JJSA 2UWEB 3HAEG 3M1BA