4HGMA

Shark ignar variable domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TRVDQSPSSLSASVGDRVTITCVLTDTSYPLYSTYWYQQKPGSSNKEQISISGRYSESVNKGTKSFTLTISSLQPEDFATYYCRAMGTNIWTGDGAGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical Antigen Recognition Mode of a Shark Immunoglobulin New Antigen Receptor (IgNAR) Variable Domain Characterized by Humanization and Structural Analysis.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Immune system
molecule keywords Shark V-NAR
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2012-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hgmA00
3HUJE 1QFWM 5TF0A 4DN4H 1DSFH 1KTDA 4I9WD 3WFEH 2F53A 5I1KH 4P0DA 2M26A 1UQSA 1E28A 4RNRB 4HMDA 3LN4A 3GB7A 4LLUA 3RUGB 5JDSA 3C6LD 3KPQB 4OBRA 1CD8A 3FO9B 1IC5L 5IF0A 4YGVB 3LB6C 5E1AA 3M8OH 4Z7VB 1JYXA 3C08L 3QEHB 3CVIL 4WW1B 5T5FL 1A7OH 4JB9H 5FO8A 5IGXH 3EOYG 4H5SB 3EDEA 4WTZG 4R0LB 2IADB 4FRWA 1I85C 2EDNA 5C0RL 5HJ3B 1S7RB 2A73B 4Y8DC 3HB3C 4X4XB 1H15A 1OSPH 3LKRB 1A8JH 1HSBB 3T0EC 3ULUF 1MNUL 3HFML 5D7LB 1U8IB 3EYOA 4S0SD 1OGAB 2CDEB 5DS8B 3C60C 4RGNB 4XPHL 5GGVH 1DFBL 1YNTA 2J4WL 4I77L 1JI2A 1BOGB 1K3ZA 2YK1H 4UBDD 5EZOL 4LCCB 5EU5A 5DUML 3IT8D 1CIDA 1PD6A 3QWOB 3NOIA 4ZUTA 3RVTC 5C9JA 4NO5A 3ARTA 3H42H 1HKFA 4OZIF 5BS0B 1FNLA 4PRDA 1ADQH 5B38A 5ALCH 1QQDB 3BH9B 1LE5A 4QHKI 1U93B 3G6JE 1QTYT 3GMOB 1RMFH 1U8QB 3BZEB 5EOCL 1T4KA 1CXIA 4XPFL 2H1PH 3QP3A 1PZ5B 5EUOE 2ZUQB 1HN1A 3MOBL 2AJZA 1U3HC 1WITA 4HS8H 5IB4A 1MELA 5KJRL 3UAJD 1P4LB 4C56E 4UT6H 1F3DJ 2ZCHL 4Y4KB 3VDBA 2WIIB 5FYJE 3ILQC 1GGBL 1I4FA 2FZ3A 3QXDB 5DQ9A 3K4DA 3CMOH 1EAPA 1MH5A 2YRLA 2A9ML 3AXLA 5LBSL 4D9QE 3H9SB 1XF1A 1SY6L 2PO6D 4DUWA 4QTHB 5KSAC 1O5DT 4HC1A 2DAVA 1E28B 5HHNB 1IKFL 4RAVA 3TNMA 1MY7A 3CX5K 2YBRA 4KFZC 1YMMA 3R0NA 5EBLB 3RX5A 4E5XA 4HD9A 4NBYB 4U0RB 4F2MA 3UYOD 5DRZB 2WW8A 4N5ED 1YN7B 3QDMD 4FQLL 2R4SL 3C8KA 1BFOA 5L0QC 1BD2D 2XWTB 1KIPB 5I2IB 4Y1AE 1N2RB 4TUJA 4XMLH 5DVKA 3F8UB 4D0CB 2UVEA 4NJ9H 3REWA 4YHIA 2DN7A 4PG2C 3RGVA 2X4NA 1NMCC 3OAYK 4WU5B 2APBA 5BVPL 1UM5H 4ETQA 5FYKL 3G04B 2VWEC 1NGZB 5EBGA 4L3AA 3T0XA 5T1DH 1S7TA 4PBXA 1C8PA 1N59A 1BLNA 3EUUA 3WN5C 3GSRA 2X40A 2A77H 1CQYA 1EFXA 1FNSL 1KB9J 4HIEB 1EMTH 3CK0L 3BZFB 2C3HA 3GMOA 2VLKE 3HG1A 3VRJA 4GUPB 3BZEA 3IB4A 2VLLA 3OL2A 4XGZB 4ONOA 5IHLB 5TDPB 3QI9A 3TBWB 4FFZL 2Q8BL 3KXFE 5GGQL 1RD6A 5I8EB 5BZWB 4Q6YA 2YRZA 3ARDB 3BN9C 1PW3A 2C4FU 2AXFA 3I75B 2ZUUA 4Y4HB 2WIIA 3LPWA 4MXWH 1WT5A 3RP1A 1FQ9C 1KUMA 3UTPE 2FB4H 4JLRA 4XX1E 2Y07H 4FABL 1RHFA 4IRSA 2GT9B 4G8FA 1X7QB 4YZFE 1KIUA 3C6LB 2HJFB 4LCWE 5HHQB 1IQDB 1BF2A 2JK5B 3S37X 4R4BA 3H9SE 5DVLA 4EI6B 1R24B 3PNWA 3KXFD 3PDDA 3ZE0F 2V5YA 2OTPA 2IPKB 3OGCA 4GUPA 2BNRD 3VD3A 1ZVYA 4L3ED 1K4DA 3SDDB 5I74C 4XCNB 3MACH 5B38G 4PS4H 5DURD 4QY8B 2NXYB 3MLTA 5CMAA 4Z78B 4GAGL 1TVDA 2FSEB 3O0RH 3BO8B 4GO6B 1S7UB 4APQA 4JHZA 2YKLL 1N2RA 3L7FB 4WENB 2BERA 4E41E 2DQFA 4KRPC 3QJHA 4WUUB 5KOMC 4Y4HC 4Y4FD 1IM3B 3BXNA 2PW1B 3OAUL 4W4OA 5A2FA 4LU5H 2X4NB 2A9NH 3V9FA 3BDXA 1A7QL 4OKVB 3OX8B 4FFWC 2HT4D 1KEGL 5DMIH 4CMMA 5C0IA 4KK8D 4LU5L 2NXYC 2FNBA 3MFFB 5IQ9B 4K3DL 3REVB 4XB7A 5L6YH 1G7PB 2A0LD 1UM6H 1FV1A 3CLEL 4JDZA 4X9GA 1KB5A 4DN3L 1G7IB 3WV0A 4EI5A 4Y5VC 1WFUA 1QFPA 2NX5E 2DI9A 1LP9F 3X3FL 5J6GA 4JO3H 1P7QA 3S35X 5CP3A 1XGRB 4OTXL 5C09E 4I2XB 3L7FA 3PABA 4JFDB 4XCYB 3ARFB 3SE9H 2R0ZL 3TPUA 1CBVH 3VW3H 4NUGH 1G7LB 2NY0D 1FFNB 2GTZB 3TBYA 4K23H 5TDOB 1VDGA 2G60L 5MEOB 4IDJL 2BSSA 3U36A 3ZTJG 3VXUD 1FBIH 3MJ8B 4W6WB 5D1ZD 5BRZB 5F7UA 3W9DA 4NN5C 1I9IH 5D2LF 1PEZA 1NGPH 3VFWA 4P5TC 3WJLA 2YD6A 4MNQB 3GIVB 1RIUL 1T5XB 1B2WH 2BDNH 4R4BB 4LVEA 4FZEL 4NHCH 4GG6E 2GITB 2AVGA 3RY5A 4KRPB 4NOFA 3SJVE 1LHZA 1PY4A 4I5BA 4FMFA 4AIXA 3TFKD 3GHBH 3D3VE 2YD9A 4XZUA 1CLOH 3C8DA 5IMLA 3SKMB 1D6EA 4O2FB 4V1DD 1PFCA 2XWJA 4S10A 3TCLA 2EYTA 5JIKA 5KW9L 2FIKA 3HC4H 1MREL 2UYLB 4LIQE 4LQFH 3L5HA 3SBWC 3S5LB 5F96L 3DARA 3O4LE 3D9AH 4P3CL 2NY7H 2HMID 3T0AA 3UBXG 3U9UA 5HHXH 1AD0B 3C60B 4NNYB 2NW3A 4HPOH 5CWSB 2NNAA 3S35L 2X4RB 3FRUB 2G2RA 1MAJA 3P4NA 3QH3B 4NNYA 4U3XA 1UJ3C 1GOGA 4HG4J 5BJTA 5E6YA 1BQHB 2VAAB 1F3DH 1Q1JH 3IF1B 1RZKC 3P40A 35C8L 1T04A 4QGTA 3S6CA 3MZGB 3HI1A 3WEXB 4XNYH 2OMBA 2ADGA 1HHJB 1T04B 2CUMA 3MV7D 3BPLB 4IDJH 2FHFA 2I07A 1K8IB 3GHEH 1FNFA 2OTUA 4MJID 4MNGE 3QHZL 2PN5A 3PQYA 3HC0A 2ZG1A 1BX2B 4OSUL 2GJZB 2YR3A 2ZOKA 2DLIA 3CDGA 3SDAA 2MCPL 2W0KA 5A2KH 3IJYB 4C58B 5C3TA 1C7SA 4RCAA 2B0SH 2AKRA 3JVGA 4LMQI 4JQVA 1CCZA 1RK0A 2P45B 1IFHL 4MB3A 4JQXA 4CMHB 5ESQA 3KPRD 3MV8D 3P2TA 4WU5A 4ZO9A 2Q8AH 1WLHA 2BVUA 3HMWL 3WNPA 3IRZA 3ZE2E 2AK4E 4XX1G 3TT3H 1FFPB 4P99A 1YEEL 2DQHL 2ZWLT 3V6OE 4TRPL 1S7TB 3A6BL 1L7IH 3QUZC 2FD6H 5CIPH 3GO1H 4HIJA 5EUKB 4NFBA 2R0KL 1QA9B 2Z8VC 1MJUH 1EO5A 2DBLH 4GRWH 3JV6A 4QRRE 3T0WA 1WTGT 3Q2CA 2VLMD 4PRIA 7CGTA 2GJJA 2FJFA 2JLLA 3WIIL 3VA2C 3MRFB 4WRLA 1QPXA 1FN4B 5HYQB 2VLLB 5DGQA 2EXWC 3MV9D 4PJFE 2R29H 4OUOA 1NEUA 2VLJE 5HYSA 4RGNC 5CZKA 4LKCB 4ACPA 3C2SA 4WU7B 2NTSP 3PWJB 5F1OB 4M6AA 5T3ZL 1L4IA 1QFWH 5I1IL 3S35H 4HLZG 1A21A 1RK1A 1MCOH 3PL6A 4X7EC 4DK3A 4PB0H 1O7VA 2BFVH 3RWDA 4KROD 3TV3H 5KVMC 2VDRH 3FT3B 5E2WL 2GYSA 3D0VB 1INQA 3KVQA 5EZLB 4M8VA 3WUWB 1FCGA 2ADFL 4LQFL 2FX7L 3D0VA 5EZLA 4G8FB 2Q20A 1SBSH 5C6TL 4LLQA 2BNRA 3PWVB 2OSLB 4R26L 2PTTB 1U36A 2CD0A 2ATKA 4M43L 4QT5B 1T2QL 1JPGA 2AABH 4LLQB 4YNYA 2BXYA 5IEHB 3D85A 2I07B 3F65A 1TXKA 5K9QG 1TITA 1SJXA 4LSUL 1NDMB 1HIMH 3O6FD 3DMMD 3JWNC 3CZJA 4W6XB 1UGNA 5ICXA 4KKLC 3K3QA 3PV6B 3HAEG 2VERN 1FZJA 2ENSA 4M3KB 4H20L 4YHLL 2FGWH 3MTRA 4CGTA 2CLVB 4GMSH 4ZTPH 4C55A 2B1AH 3CFJB 2VL5A 5C0JB 1VEMA 3VWKB 4U6XA 5JXED 2PCPA 5E00B 3TZVB 3TO4A 5K9OA 2X9XA 4NPYB 4U0QB 1FL3A 2R0ZH 4OGXL 5LGJB 1Q38A 1EXUB 5MENE 3QG6B 5DWUL 2DMKA 3HG1D 1YPZA 3FQXB 5EBMA 3QFDA 3RZWA 5KANG 4QOKA 3MRBB 3GBNH 1R24A 1NH6A 4YEFA 4JFPB 4WUUD 3IETB 1F6AA 1RUPH 2P8PB 2AV1B 5CLWA 2ERJC 5IKCA 2WUBL 3UC0H 4Q58C 5CJXC 1M7IB 1JV5A 1DQLL 1YEKH 5KW9H 2O5YH 3MLSL 4GAYB 1ZAGA 4JKKA 5B39G 2O61B 4KVNL 3SDXE 2VLKA 2BHYA 4X5WA 5E7BA 1IC4H 1WCBB 3WBDA 1OHQA 4QXTA 5JMOC 2PF6A 3MREA 4P46B 3ZSTA 3W11D 4AMKL 5TDOA 3C2AH 1RUKL 2QADD 2CMRH 5DHVB 3QO1A 4FTVE 2QQNL 1Y0LB 4KMLB 4UDTB 3WO4B 3RGHA 4U1IB 4IBLT 1JHKH 4S1RL 3U30C 3J8F7 5FYLD 1HXMB 1Q0YH 1FNGB 2LVEA 4P4KD 4ZOBA 5M7QA 1CDGA 3EDKA 5A2IH 1TZGL 3O11B 1YEEH 2DQHH 1EFQA 5LXGH 4Y1AA 1U3ZA 5H94A 2VL4A 1WBZB 2JCCB 1CF8H 2ICES 4HS8L 3FQTB 3CFBB 2NMSA 2H1PL 5FGCE 5F7EH 1T7YA 1W0VB 1DQJB 2C3VB 2R1XA 3GB7B 3VMNA 2OTWB 3W0WD 4DZBB 3O3EA 5DEZA 3ARFA 3RNKB 3HI6H 3TPKA 4DTGH 2NR6D 4K94L 3QUXD 4RBPH 1HXYB 2R2BA 2P48B 3LQZB 2WBJC 4F3FB 1K5NA 1P1ZA 5FYJD 2E27H 4M6NH 1X5HA 1JRHH 2BDNL 1RURH 3LN9A 2BOBB 1XMWA 3PGCB 4K9EH 4OM0H 3VD4A 5DHVH 4AH2B 4I3GA 2R2HB 3IXAB 2XNAB 2HT4C 3OAUH 1CL7H 1G0DA 1NCWL 1D9KB 4D9LL 2FEDC 4CVUA 4MJ6A 5GRJH 4OCSH 2X1QA 3IXAA 3BQUC 1YJDC 4HGKC 3MC0A 4JJ5A 2BSTA 3B8YA 4TRPH 2GY7B 1J1PL 4KRPD 3SE9L 5IB2B 2H8PA 4YHPA 5MENB 3B5TA 2VIRA 3AREB 4LPCA 2LTQC 3IFLH 4AQOA 4YFEA 1A6TA 2DM4A 4UT9H 1OAQH 1U8NA 4YHPB 1UM5L 3IDIB 1GIGH 2MKLC 4QXUH 1J0ZA 4O9HH 4DN3H 5CLTA 3WXWL 6FABH 1JGEB 4KGLA 1H3UA 3C8KB 5I1KL 2JCCE 4LSPH 3BAEH 4P4KA 4NN6C 2VDPL 5D9SB 3QBTB 3PWPB 1MFCH 2R2HA 2NY6D 1FZKB 2H32B 4H0GA 3RTQD 5C0CD 4J3TA 1RZKL 3LZFL 4MAYB 4I0KA 1XH3A 3QA3B 1BVLB 1VCAA 2IQ9L 4HUWB 5FA4A 4D8PB 3INUH 1I3RB 5FCUH 2X1OA 1E6OH 2J5LB 4FTVB 4K3GA 4PJAF 2H45A 3A67L 3U0WL 2V7NA 1A7RH 1SEQH 2Z93B 1KJ3H 1RZ7L 2VC2L 5KN5B 5ALBH 4G8GE 1I1AD 3ZZ1A 1Y6NR 2ILLA 3GMLA 3G08A 4HMEA 2ZSWA 1A9BB 1YJDL 1XCTA 1JF5A 3BP7B 4HPOL 4M4PA 2YA0A 1MLCB 3SBWA 5FUOH 2X9WA 4C4KO 2GSIB 2MNUA 1S5HA 3K2UH 4OCXH 3BWUC 1UYWL 4U1LA 3U4AA 2F53E 1CLZH 1XZ0A 4L8SB 4PJFB 4JRYB 1D3CA 5I2IA 1PY9A 2COQA 2Y7QA 4MYWB 2A83A 3IDUA 2FJGA 5ESQB 3SDAD 1EO8H 4LCWD 3IVKB 3P30H 1MCIA 1WWCA 4XNUL 3U4EA 1ZHKB 2PUQT 5MP6L 3IS0X 1V7ML 3GSNL 5D7LD 4P2QD 1MLBA 1JPSL 2H9GA 3VWJA 1VGEL 4X8XA 3NTCH 3VG0L 5BZDB 3OJMB 5HSFA 5FM4A 1B6UA 1F42A 3G6JF 4HIJB 3KNBB 4FS0A 3S34L 1B2WL 1FL6A 4P2OD 1I9RL 1KC5H 3BKJL 5JIIA 1NGQH 4JO1H 2BVPA 3QWRD 2PYFB 2QSCH 3F58L 5DJ8A 2FIRT 3TVMB 4LLWA 1U8PA 3QWQB 4PTTA 5D71H 2QHLA 3GSXA 4JFXB 3RI5F 5E08H 1F2QA 4H1LB 2W07A 1G6RA 1S9YA 2ARJA 4HGMA 5A2JH 1RK1B 3VWJC 4ALAH 2BHUA 3NGBC 4NQUA 2QLVB 3KLAA 3NA4A 2A9MH 1AXSA 3OQ3B 4YXHL 5L8LB 3UTZA 3EGSB 4NWUH 4LNRB 4PJHF 2VDOH 5E6ID 5KSBA 5B8CA 5I17B 1UH3A 1EH9A 2Z31C 4F80A 4JHWH 1CICA 4U6HA 1A2YA 1OAZH 1NGWB 1KIRA 1ORSA 3D1MC 3I9GL 3Q48A 5M94B 1MRCH 4FQQB 4HKJB 2QKIB 4D9LH 3HR5B 2DKMA 4DN4L 4A6YA 1OARH 3MNVA 1KIRB 1IEBA 3MOAH 2ZSWB 3MA9H 3S8WA 4XP6H 1TCRB 3A6BH 2NZ9D 3O45A 4JDZB 5GS2D 3RVVD 1T21A 3PV6A 4D0BA 1IAII 3WJJA 4Z7WF 5F3BA 1L6XA 2D7NA 4IRJD 1ITBB 1CTNA 4OLVH 1QEWB 5FUCC 3RPIA 5HDBE 1AI1L 3LQAC 1KTRL 4J8RB 4DKEH 2R8SL 1D5IL 2AJUL 3KPQA 5I15L 1YDPA 1XR8A 5I1GH 4AT6B 3RIFF 3WE6B 4OGYH 4H26A 4WWKC 3NPZB 2ICWA 5CEZH 5KBNC 5FO8B 1U3HA 1AGEB 3DX9A 3QIWD 4L4TD 5DRWB 1C5CH 1F00I 4MAYD 3I02A 5JPMA 2EYSA 1Z9LA 4K2UL 1MLBB 1UJ3A 2UY7A 1P7QD 3RUGF 3KPRA 1E4XL 3D3VB 4ERSH 2X1WL 5IP4A 2XZAL 3QXAA 4LSVH 1NBZB 3HN3A 5L8KB 1OGAA 2CDEA 2EIEA 5E8EB 5CJ5A 3HB3D 3BDYL 1XGUB 3J7HA 4Y2DA 1A4KA 2P47B 3O6LH 2JCCA 5I0ZA 2FO4A 5I9QB 5J0BA 5FKPB 4NO0B 4G9DB 1T5WA 2C4FT 4WEBL 4QO1A 8CGTA 4YAQB 4PRHE 3LB6D 1I1YB 2A6DB 4NQSB 5CCKH 4G9DA 1P69B 3GI9L 4JFXA 5A40E 4JGUA 2HT2D 1CICC 5IB1B 5HXMA 5D8JL 3NCYP 1HQRB 3KYAA 3RL2B 3C5ZC 1C5DB 4OV5A 5BCAA 4UINL 1I8IA 1U8QA 1V3JA 5DZLA 3CU1A 3CPLB 3JWOC 3PL6C 3BW9A 3I6GB 3MYJA 12E8H 2HA1A 2ICEB 5IW6A 5E6ZA 4APQD 2XWTA 1CICD 3FKUS 4HK3J 2Z8SA 3WN5A 4ELKB 4LVOB 3ZTNL 3JTTB 1TVHB 2W59A 1KJVB 3MLUH 1NGWA 2CO6B 5ELIA 5IOPA 3EW3B 3WNMA 3TNNA 5DDHB 1SY6H 1Q72L 5I71B 3WXVL 1CLOL 2M8XA 3BKYH 5TH2A 4ZFGL 3VFGH 2A6KB 3Q6FB 4NHUA 4LEOA 1NGXB 4F7PB 3C08H 3K4ZA 4KJWC 4JDTH 5A16B 1I7RB 1NLBL 3CX2A 1U8KB 1FIGH 4M1CD 3O4OB 5KJRH 4WEBH 1ZHNB 5CJOH 4V1DA 4WI2A 5F88A 2I9TB 2NW2A 1J0YA 1ZHNA 4X4ME 2WLYA 5F89A 3GNML 4MXQC 4N8CH 1ZLVK 2FH8A 1WQVT 4M00A 3FT2B 2GK2A 4Z77A 2AEWA 2FGWL 4JCLA 4RMTA 5C0AE 4ERSL 3OJDA 1B0RA 3DUSA 1MRDH 1QLEH 4LGRB 1F90H 4YHYC 1DVFA 3H42L 3V4VL 1IKFH 3SDYL 3T3PF 1FYHB 1LNUA 2W0FB 5K59E 1I1CA 2DMCA 4G8GB 3DUHA 3FB8A 5C0BA 4JKLA 1YC7A 4PR5A 1I3UA 2W0FA 2EDTA 5FHAH 2I9LB 4B50A 4KK5C 4PLKC 4WI5A 5EBLA 1IGYA 3QDAA 1RVFH 3CMOL 2FDBP 3CSYB 4JY5L 2MCPH 3WLBA 1A9BA 5IROC 2VKXA 5GSRA 3X11A 2IPUG 1WWAX 2XPGA 3PQYB 1KSRA 4M1GH 1MCQA 3QHZH 4RFEA 1KACB 2E8YA 4X0KA 5EOQL 1C5DA 1JUFA 5DJZA 1WTLA 4LNVA 2A9NL 4U1MA 3EYQD 1ZV5A 3HE6B 4JO4L 1A7NL 4PGCB 4M5YL 1GRWA 5BXFA 5L9DL 5ISZA 2XZCL 3F7YB 4AEIL 1RZFL 2V2XB 1XR9A 1GHFH 1AD9A 3H9YA 1EPFA 1UWEL 1JZ2A 2EDQA 1DN0B 2EIZA 1G7MA 4BH8A 1YPZE 2DM7A 3ARED 3HE7C 4I3RH 4XPBH 4ZFGH 4HWZA 3MMEA 1QYGL 5EU6E 5DT1L 3RZCD 5DUMH 5HHOA 2PTTA 4ZAKB 2AXHA 4UQ2A 3QULA 1H5BA 1R3JA 5JW5A 1YEFH 2BVTA 3D0LB 3GIZH 4K94C 5F7YC 1H3XA 2Z0BA 3RBSA 1DR9A 3S3SA 3NCMA 3RWHA 4BFEA 1XCTB 1U3YA 5IFAH 2NY3B 4LLWB 4Z5RA 2HP4A 2UZYB 3TBWA 4P2YA 1B4RA 2OX5A 1T0MB 4CVXB 32C2B 1MY5A 4RGMC 1CWVA 5C1MB 2AJZB 2AQ2A 1KIPA 4YHMH 3NABL 3IGAB 3WYRA 5T3ZD 5F1KC 5HGHB 3DVGA 4QHNA 43CAA 1FVDB 4DVRL 1VGEH 1M1SA 5F9WB 4JZNA 1F4YH 1FVDA 3LMJH 5FF6B 1LNUB 4PG2A 3RGVC 3RI5K 4FZ8H 3L5JA 3AM8C 1HZHH 3GRWH 4NSKB 2C9AA 5EC1B 1B9ZA 3GGWB 5HI5D 1UFUA 2AXGB 3QIBD 3BN3B 4HEPG 3O6FA 5J12B 4QT5A 1I7TA 3QUXA 1ZHLA 1ORQB 5T3ZE 1T6VN 4OZGA 2YPVH 3P11L 5SV3A 4K2UH 2YWYA 5L88L 4H8WH 3MGOA 1KJMA 4C56B 2B5IB 4EN3D 5DRZA 4EI5B 2OZ4L 5DJZB 1RUQH 2IGFH 2NY6C 2VZOA 3NMEA 2DBJA 4PJGF 4MA3B 4ZFFA 2CXKA 3TP4A 3P0VH 2I24N 5C07D 3TIEB 1F02I 4HUKB 2NY1C 4PJXA 4X4YB 3VGAC 4QRRA 1KCRH 4XCFL 4OD2A 2VMFA 4MXQD 4Q9QH 5C09B 1XR9B 3GBMH 1LEKA 4JLRB 4NWTH 5IJKA 2XQYK 1FVCA 3IDJB 2QTEA 3KPRB 4JHAL 2R1WA 3L5XH 3MRGA 4L5FH 1XF3B 1JWUB 1OSZB 1D7FA 1YPZB 4OLYL 1WZ1H 4PJ9D 1IEAB 1FNGA 1TJIH 1ORSB 2WINB 2EE2A 3RX8A 1XGUA 4HQQL 3HAEH 5MEQB 3KJ4C 1S7XB 3LKQA 4NNPH 4K3JH 4LPTA 5FHBL 3SPVA 5MI0C 3ARQA 5B3JE 4XHQA 2W0LA 4KAQL 5EO1B 5IJVA 2VLKD 1FIEA 1NBVL 1LEGB 4XCNA 3WHE1 2HLAA 3QHFL 2XXCB 2EDFA 5D2LB 3RPIB 3MRJB 3FT4B 4YBLB 1ACZA 2XACC 2DQIH 1CE6B 5I19H 1AGCA 4ALAL 3PQYE 5KSAB 3QIWA 4L4TA 1CU4L 5EA0H 5ECJE 1JPTL 4NGHH 3O2DA 1A6VH 5I1DA 2E7LA 1ZT4A 5GGRY 2EDXA 3HCVB 3CFEB 5DD3H 3U9UB 2BSRB 3HZMA 1DBML 4LHQB 5GS1A 1IC7L 3MBEB 3ARBB 4BSVB 4JFZH 3BE1H 3RKPA 1VADA 4G3YH 3VXSD 5ALCL 1Y6KR 4K71C 1A7PL 3F7VB 3L3IB 1FYTE 3G6DH 3RL1B 3TZVD 4TNWF 1YYLH 3GJFH 3NPSB 1PGRB 2EYTB 5JHDE 1CG9B 1FL5A 1T5WB 2Y72A 1V3LA 2R23B 3UX9B 4TN9A 3KJ6L 5I8KL 1BJ1H 4JPVH 2HG5B 1HYSD 4YBLC 1N6VA 3LVEA 3EFDL 4LPXA 3UJTL 3DMMA 4K23L 1FFNA 4WWID 4G6AD 3U6RA 1N3NB 2YKLH 5JNYA 5FGSA 4W70A 2WBJB 1JRHI 4Y5XA 1QO3B 3GJEA 4U7MA 2YS4A 1HWHB 1MCBA 5BRZA 4WFHE 5I30L 3MRHA 4CBPA 3QUMA 4IRZL 3BOVA 3CVIH 5F72S 1MPAH 1XF5A 5T5FH 2DRUA 3KG5A 2VAAA 2RGSA 4ETYA 5T3XL 2NZIA 4OF0A 4WDIA 2HT3C 4QRTB 1DANT 1ZEAH 1FORL 3S96B 3MYZA 5L6YL 3C2AL 5JQ6H 2RFXA 3RZCC 4KTDH 3S88H 4LCUB 4GBXC 1TIUA 4NT6A 1XIWA 5B3NA 5GISH 4H8WC 1KEGH 4WI9A 4J4PC 1U91B 4PY8J 2W65B 1QQDA 3LKNB 4PRPB 3PP4H 4RWHA 3DMMB 4Z7VE 4DEPC 3R06A 1M6OA 1I8LA 5DUBB 1CZ8H 4JM4H 3BAEL 2F9BT 3LOWA 1GZPB 1MFBH 3OR7B 3CVHL 4ONGH 4KZEH 3RQ3A 2Z91B 4DJMA 3KLHC 4DFIA 4DZ8B 3VXUA 4OFPA 5LQBH 3GSNB 2AJYH 4Y2DD 5D93B 4GAFB 1YEGL 3HMXL 1OGAD 3MV7E 3SGEH 3SGJA 1JHLL 4ODTL 3UTSB 3BRGC 4UB0L 4WI3A 1KTLA 1ZT1A 4F57L 5F1NA 4TUOB 4K7FB 1X5GA 1MCSA 4HT1H 4AIZA 2G5BA 3TO2A 1BJ8A 4HZAA 3U9PH 5LGJA 4MAYA 4G8IB 4LLMA 4R97B 4YJZL 3DECA 1H3VA 1QNZL 5IHUH 4F15C 1FSKC 2P8LB 4OCRL 4JJHA 1EEYA 4J3XA 3QXUA 3KPPB 5FDWA 1AFVH 1KBGL 5I1JH 5C6WH 3EFFA 3QDJB 4HZLA 1C1EL 1HHHA 4TVPH 5FUZH 4TNWK 4X5XB 1NCUA 3PWUA 1G7QB 4RZCB 1M7XA 3MV9B 3OZ9H 3KPPA 2R23A 5ESVA 1EGJL 5JXEC 3V7AE 3B83A 3ZDYF 4NYLB 5IROA 3FAXA 3EO9L 5DJ6B 1LD9B 5IHZA 2F5BL 1JGDB 1J1XL 4CKVX 3GRWA 4P59H 3RVXD 4MX7A 4PYHA 5C0CA 5F6IC 4HUXA 1M05A 1N6UA 2DQEH 5DJAB 4DWHA 4XP9H 3V0VA 3C6SB 1IAOA 1U8HA 2WQRA 3DBXB 4M3JA 1NL0H 4QHUB 4RQQA 4LSTL 3TJEL 5EU4A 1K85A 4ODUA 4FG6C 1D9KD 4XBGA 4MLIA 3BZ4A 4I77H 3DBXA 4QHUA 3BKMH 2A83B 2OK0H 3V6BR 1F4WH 3WS3B 2HJLB 4UNUA 1VHPA 4ONFH 2IH3B 1X4XA 3IDNA 4Z76B 1H3WM 4OIIL 1YQVH 4LHUD 3G6AB 3DHMA 5EU6B 2J8UE 2P46B 4Y8AA 4XXDB 2P5WD 1ZLSH 3TCXA 1R3HA 2Y5TA 3JV6B 2XTJD 3QAZC 4QHKJ 2DQUH 2OLDA 2DM2A 3AY4C 3BEVB 3OSKA 5C3LD 2XYCA 5I1IH 4J3UA 3T0EA 2Z35A 2R4RL 1BX2A 1HKLL 1XGQA 3PV7A 4MNQE 4RNRA 3U7WH 1HK6A 3T77B 4K7PH 3FB7A 3B5GA 5EPMA 4FQXB 3T3ME 3TIDB 3VCLB 4PP1D 4KPHH 1ZTXH 5I8EA 2CGRH 5BZWA 5BOPA 4KKCC 4PJDB 4AG4H 4CU8A 4L4TE 4Z18A 4LSSH 2J88H 4OLZH 3TYFA 4K8RC 1BWMA 3L7EA 1KOAA 2BY2A 1RHHA 4H26B 2FEDD 4GRLB 5J06A 3F62A 5J3HD 4G6JH 4NKDA 3B43A 2DWEA 2CLZA 5T1MB 3IDNB 4OB5H 3RUGE 2DTML 4FMKA 2ICCA 3EGSA 3WIHL 3HNVL 2UZIL 4FQIL 4MNQD 1CDBA 4GQPH 3UTOA 1P2CB 4CN4A 3WS6C 1H5BC 3QUZB 3WIHA 2ITCB 3LEVL 3NAAH 4QYOA 4MAUL 1T7WA 3BP5A 2JJUA 4Y1AD 4Y5VA 1MSPA 4NUJA 3Q0HA 1I7UB 4R4FL 4ZUTB 3N1PC 4Q9BA 2MPAL 3MUGB 5I18H 3GJFB 4NQCB 4X6FA 3QIWC 3V52H 5HDOA 1ZT7A 1CXHA 3B9KC 5DJXB 4OM1L 1BZ9B 5EU6D 4WWKD 1I1AA 3GJFA 3HZKB 4NM8L 4NQCA 3CFBA 3V95A 3IFNL 4J8RA 5E2TL 1RUAL 1FDLL 3OF6D 4QXGL 3UTTE 2HMIC 1KENH 1BHGA 4WUUE 4NKDB 1VFUA 3W5MA 5I75B 1E4KC 1QSZA 4LVHB 5TDNA 1QSEE 4PJEF 2IADA 3O41B 1P4LA 4NKIH 3V4PH 5ICZB 4PGDA 3W9DB 2XY1A 3DRTA 2KH2B 1P2CA 2X6MA 4WWKA 3IKKA 4ISVA 3TYGH 1J1OH 3N06B 4PJIE 3QNXB 4RGNE 4LOUD 9CGTA 1YMMD 1OAKH 4JFPA 3R8BB 1BOYA 1YNTB 5ANMA 3ZKMD 5GRXG 4JPIB 4RWYH 2OR8A 2OZ4A 1QD0A 5J1AB 2EH8L 3MUGA 3PF2A 5TQ2H 2AJXL 5GJSL 2VXTH 4CU7A 5FECA 4G8EA 1MQKH 1U6AL 2IG2H 4UILL 5CSBA 2K7PA 4ZSOE 1J88A 1VB9A 1DBAH 3GMLB 4XC1L 5KS9E 3U6RB 2ZOLB 2BVOA 5L7XL 5H35A 1BJ1J 3EYSL 4FOMA 5E1AB 4CMHC 1S7VA 3N85H 4NQVB 2XG5A 4YC2B 4EJ1C 1TPXC 1NCAL 1AD0A 3C60A 4ODHH 4PJCE 3LRHA 4U1LB 3O6ML 5T33H 1WEJL 4AH2A 3FT2A 4Z77B 4NQTA 5JORB 5H2BB 2D0FA 4XP1L 2X10A 1NAKH 5C0BE 1JK8B 2IPUK 3FQXA 1ZVSA 4DUXA 3MRDA 5T5NG 4XWGL 3CVHA 2R0WH 4OLXH 1VADB 2D7OA 4JGMA 1OLZA 2B7DT 3V6ZB 4U1JA 1YY9D 4CAGA 1BOGA 1DQML 1KCSH 3EYFA 4QTHA 4XPAL 1A22B 1FJ1A 4UTAH 4NCC1 1IM9B 4XPGH 1NANH 5CEYB 1FLTX 2MCG1 1Z0NA 5J7CC 2Y6SC 3QG7H 4X4MA 2P5WA 1FG9C 5F70A 3TH4T 5CGYD 1R3KB 3R06B 1WIUA 4FQ2H 3CJJA 1CDJA 2ZOLA 3CFIC 1J8HE 1GVIA 3WKML 4ZUSA 1WCBA 2VXUL 2KDGA 3IXTA 5E6IB 4S11A 1AY1H 1KIQB 1KLFA 1RZJC 2GCYA 3ELAT 4U6VH 3IJYA 4X7FC 3HR6A 2VXQL 1TETH 5D9SA 3AS2A 5CD5C 3O8XD 4OLWL 1IGFH 2OI9C 5HHPB 5J56B 2UWEF 5CWSA 3MV01 4AM0B 5E0QA 4HBCH 5FYLE 5D7SH 4XVJL 3F7YA 4HFUL 4X80L 4HIHB 3W2DH 2ZKHL 5AZ2L 2LFGA 1JTOA 4LPUA 4FQHB 2QSVA 3UTQB 3U7YH 2F54B 1QR1A 2EC8A 4HWBA 1F3RB 4LCYB 5L2KD 3G04A 3QDJE 4OBSA 2Z92B 5D7IF 1PYWA 2F53D 2D7MA 4JN1L 1A2YB 4OT1L 4UQ2B 1XAUA 2IFFL 5D72H 5F9JA 3MRCB 4X83A 5JR1H 3KYOA 1S78D 1EJOL 5GGSB 2YBRB 1KEML 1X6LA 4G6FD 3SDDA 4F7EB 1ZXQA 2SEBA 2CK0H 5GS0L 1HILB 2VZVA 3R0MA 5HHMD 3MV7B 1TQBC 3BZDA 4EIGB 3VMPA 1IGTA 3QDJD 1JZ3A 1OP5H 2W91A 1YC8A 5IM7B 1YMHA 2YSSB 1ZLVH 3DVGB 3LQMA 4XRCB 3QJHB 2GKIA 4UIMB 1GCFA 4LASL 1IGIL 1ZHKA 2AJSH 3O3BA 4KXZH 3KPSB 3ZKNC 1Z0MA 2J6EA 2P7TB 3ULVE 1RJYB 1ZHBB 4XPBL 1AGDB 3O3BB 1F58H 1I3RA 3GMMB 4MXWL 5KOVC 4WIQA 2DD8L 3NCYS 3QDMB 5FDWB 4K7PY 4MD4B 3B9EA 4PY7A 1BIIB 4O51A 1OLLA 3UJIH 3DROB 5IB2A 3PGFH 5ITFA 1F13A 5MI0B 1INDL 4YDKL 5AZEH 3RY6A 1ZGLP 4ZNEE 2XA8H 2Q7YB 4FQ1L 1MCWW 4XPTH 4MA7H 3O2WH 1X44A 2AJVH 3LRSA 4YFLI 4YXKL 4X6DA 1NAMH 5E4IA 1LO4H 3HE7B 3HUJF 1Q9OB 3ECBA 5D7LE 3PE9A 3CD4A 1NEZG 2H3NA 3D69A 4P2RD 4LLUB 5JDSB 2APVA 1KCUH 3TPUB 3VWKA 4I0CC 4M1DH 3GI8L 5SWZA 5FKAA 5EBWB 3BKCL 1IMHC 3GBLA 3HZYB 3O2DH 2W0PA 5JW3L 3FO1A 1OTSC 2XOTA 2VXUH 2VKWA 3GMRB 4JQIL 4NQEB 1FVCB 2YD8A 4H25A 2ZJSH 4KRNA 4U7SA 4CN1A 4K07A 4M5ZH 4O58H 1BFSA 3B5HA 4WW2A 4Y19D 1A6UL 1JGUH 4RGOH 5JHLH 4YBQD 4NN7B 4S1DD 3TA3B 1IL1B 3SY0B 5T3XE 1I8MB 3L3JA 4XBPA 3VXTA 1BREA 5EC1A 5ETUA 2FJHA 4KTEH 3TA3A 2VUOA 2P8PA 1VGKA 3LKOA 4QXWA 1CGXA 3PHOB 4KQ4L 3GZKA 2C1OA 2CGRL 4Q74A 3GKWL 4KMTH 4X7SH 5FKPA 2I5YH 4KDWA 3MRJA 3QPXL 2WWMD 2HJKA 2IALA 5KSVA 4HWBH 3VD5A 1RU9H 3VXRB 1MF2H 5FKAB 1TQBB 2ATPA 1HHKB 3V0AC 5KG9B 1UWGL 1CDCA 5F9WC 3KYNB 5L0QB 4RISL 4WCYL 1AR2A 4M62L 3IDXH 1N6QH 1DZBA 2NYYD 3PDOB 4XBEH 1ITCA 1OTUD 3BH8B 4X6CE 3U1SH 2NNAB 4Y2DC 4HKBB 1EEZB 1H3PH 3MBEC 2OQJB 1VEOA 4I4WB 5FGBC 5D1QB 2V2TA 3UROR 4AJ0A 3ROLB 3MV8A 4Y4KA 4YFLF 3ARPA 3LDBB 4FFYH 5KANI 1F4AA 4YHKH 2V2TB 4MD4A 4NNXB 4ESKA 4QRPE 3MRQA 2X4OA 3MODH 3NFPB 1WBYB 2V7HB 2OL3A 3MQIA 4OUUA 1EHXA 5EU7C 3LN4B 3MV8E 1MVUB 1QLRA 4Z7VF 3PJSA 1HSAA 3LD8C 4IRJA 2X5PA 2HT3D 5CHNB 1MIMH 3FHAA 1FG2A 1SMAA 2HH0L 3RTQA 2EH7H 3MA7B 5EBWA 2HFFB 2AI0H 1JUFB 3BPNB 4TSBH 4DTGL 1B0GA 2DQTL 4YK4C 1OTTD 3C5ZB 3RAJL 3P0GB 4PRHB 1PX4A 3G9VA 1U58B 5B8CB 5I17A 3BDYH 2VDQL 3H6JA 2X4RA 3FRUA 4PJAA 1D5ZB 4JCMA 5K9QI 4IDLA 1U58A 2A77L 5IBLD 3O6KH 4NKOA 4OZHF 4M4RA 4Y4HD 5IQ7H 2N7AA 3GIVA 4KV5E 4QHLB 1UWXH 2E7CA 2X41A 5LAXB 1OM3L 1BJMA 2H6PB 5CILL 1IAMA 3MNVB 4GQ9H 1KTDB 2IJ0C 3QDGE 5IVNA 4LCUA 6CGTA 2P49B 4UB0H 1A47A 3I3BA 3QCTL 2A1WL 5DD5L 4P2RA 1TJHL 3LEVH 5EWIL 3BT2H 4L29A 2G9HB 3P9LA 3V5HA 4ZAKC 2UUDH 4S0TD 5FIEA 1UVQA 1W0VA 2Y9RT 5FYKU 4DKEL 4Z7UE 4HIEA 3KPLA 1HQRA 4Z5RB 5FK9A 5DK0A 5HYSB 1DDHB 3IDMA 1MWAH 4UQ3B 2VAJA 2E6QA 2FECI 1N26A 4MZ3A 3HNTH 3BIKB 4JFQB 5TE6L 2L7UA 3BWAB 1QO3A 1N0XH 3OBAA 1OAUL 4XHJC 4KJWD 3VXSA 4HCRL 3O2VH 3BIKA 4PUBH 3BMWA 1FZKA 3MLSH 4JAMA 1P9MC 2PXYB 1TJGH 5EC2B 4NKOB 3OJ2C 2YC1B 4JEGB 4RX4D 4HK0B 5TGBB 2FBJH 5KVFH 1YEIL 1A9EA 5T1LB 1CT8B 4HH9B 1EVUA 5INCA 4AQ1B 2L4OA 3BRDA 1BD2B 1CD9B 3QNZB 2E7MA 3PWVA 4LGPB 2GSGA 4ODSH 4X6DF 4KHXL 1W72L 4C83B 5GGTH 5I30H 4YHOH 4FTVD 5F44A 4PJEA 5EIIA 5HI3D 2A6DA 3R8QA 2FEEI 2JJTA 1BQLL 4QWWC 5D5MA 4M93B 3FN0L 2CKBB 3G5XA 1YQVL 3LS4H 1P7KB 2BX5A 1HILA 2O93L 1UH4A 3CXDH 4OV5B 1KYOJ 4EUPB 3KYKL 1Y18B 3FQUA 3V79C 2R0LH 3ABZA 4J7RA 5HGGS 5E2VL 1OQXA 3X12A 3QIBC 5LWYH 2XQBH 2YMXH 1WSST 4HDIB 1DQTA 4NZTH 1KN4H 3ARRA 4GJTB 4PJ9A 2KQNA 4HAGA 1DP0A 2V9TA 3HPLB 3RIAF 3NBNA 2NY5H 1GGYA 4PJCF 1JNLH 4MLSA 4OZGF 5D6DC 2LU7A 3ARUA 1NCTA 4FQPA 3U0TB 2WMPA 3RJDA 3SE3C 2H6PA 4RDQG 4EN3C 1QVOB 3QQ3B 4N0YL 4Y4FA 3QULB 3B2UD 3MRKA 1IZKA 4Z7OE 3OB0H 4WTWA 3LKSB 2DIJA 1RZIB 2VLME 4OCWH 4FTVA 5DTFA 1BD2E 4P3DA 1P7HL 2YPKA 4N5EC 4UOW1 1SBSL 5AWNL 4MQSB 3VE0B 3TESA 3Q1SL 1WFTA 1S7SA 3BSZH 1UACL 3MGTA 4EN3A 2YHGA 4KI1A 4R8WH 1FGNH 4PV8B 4LPYA 3OXRB 3TO4C 1DVFD 2OR7A 4GAYA 4XMPH 1K3IA 4RX4A 3X12B 1P6FA 2G5RA 4BSWB 2DYPD 1UXWB 4Z7QE 1LO2L 5ALBL 1WIOA 3QIBA 4HMCA 3H9HA 4DKAA 5B8CC 4HW6A 1A0QH 4R4ND 4IJ3C 1A02N 3NIGE 5GGSY 4D9RE 3CH1A 3QQ9D 4EDXB 4MZ2A 1FCCA 1MCWM 4D9QD 4NSKA 3HHRB 3VFNA 3W0WB 4LCWB 3WIFA 1WISA 2VDKH 5GS2H 4N9GB 4Z7NF 2V5MA 1JWUA 2JJSC 1H5BB 5JW5B 3FMGH 1AE6H 1OL0A 3I6KA 3U2SB 3F6LA 3FO0L 5MERA 2MFNA 4NO2A 5EOTB 3EYQC 1I7ZB 1QFWI 5FYKE 1MUJB 1AQKL 3PXHA 5KSAD 1JCKA 3UTPD 3RDTB 3QPQC 2ADIA 3MJ9H 4YR6A 4HEME 1QEWA 3UBXI 3HRPA 5IMOA 5GGRB 3HE7D 1JVKA 2IBZY 1WUNT 1BEYH 1Z3GH 3RVTD 4PGCA 3PHQB 2J6EL 4QHNB 4U2ZA 1FC2D 4GAJL 1LE9A 3M1BB 1HXYA 4GKSB 5IK3A 3B2UC 3HPLA 3PDOA 4EDXA 4OZFH 5JIPA 5J89A 2A6JB 4DCQA 1DQDH 2WM0A 2DI7A 4N0UB 1IZJA 1E6JH 5C07E 1AO7E 4TPRL 4NQDD 3IU3A 2AJ3B 5TPWL 2FX9L 2PYEA 4S2SB 4HBCL 4LLYB 5DUPH 3BMVA 1YYLL 3D39B 4N0RA 2AJ3A 4NO0A 4G5ZH 4JG1H 2A38A 1H8NA 2Q86A 5HHMB 4M1CC 3QIUC 5J4MA 3GSVB 5DSCA 2AEQL 5E2UH 1IQWH 4HCRA 3P4OA 4Y4KD 3HC0B 3TIEA 1QSEA 5SWSB 4NQXA 1L0YA 2ATPB 1NQBA 4J3SA 3UTTA 4NM4H 2YD3A 2JIXA 5HGDA 4PRIE 5AWNH 2FL5B 2NY4D 3LQZA 1DBKL 5C0BD 4K9EC 4XAKE 1U3HB 1CDIA 1H15B 3C09B 1T89C 2BXZA 4JZNB 2QQLL 2VR4A 3QDHA 5JORA 4HC1L 3V6OA 3BIBX 3DYOA 2V9QA 4Q6IB 4Z0BH 4N0YH 4BFIA 5DS8A 3VRIA 4APQC 2QJDA 2DLGA 3MPCA 1B90A 3PQYD 3REVA 1DUZB 5DJYB 2E6JA 2VH5L 3UZQA 4MJIA 3EYUL 1AGFA 4ZG1A 2R56H 1I7ZA 5CGMA 2LVCA 4ZPVA 1MJ7H 3ZKND 4DW2H 1UB5A 3U83A 3AU1B 3TA3D 3MUY1 2ZPKL 2YXFA 3ZE1E 4UUJA 3NN8A 3EYSH 4GMTL 4NZRL 1A6TB 3GKWH 4KMTL 5CHNA 4NFCA 4P4RB 5FGBA 5IF0B 1J8HB 3G6JB 3O3DA 4KHTH 1FGNL 1JMXA 1UCBL 4NBZB 1FYTD 2H2PC 5DQDH 3IDYB 4HUVB 2QSQA 1LDSA 2EDEA 5ESAA 1N7MH 3D85D 3GK8H 1VENA 1S78C 3S4SA 4NDMB 3BRFA 1IKNA 1ZT4B 2YOCA 3QZWA 5J12C 2VLJA 2VQ1B 2EE6A 3FN9A 1GXEA 1XZ0B 4L8SA 4PJFA 4R90H 2APWA 1D5XA 2YC1A 4K3EL 3DX7B 5CEXA 3RVUC 3ULVL 1DL7H 1KXQE 1NUDA 4NIKB 1WFOA 5GJTL 4ZO6A 4MHHG 2LTQB 1DE4A 3G5ZB 1AJ7L 1EEQA 2R39A 2FATL 2DQGL 3JV4B 5GHWH 5C0GA 3UYRH 1J1OL 5BMFH 4PLJD 5HDQL 1OTTC 1D9KA 2M1KA 3DO3A 4L8BB 4MJ4A 1A3RL 4E42A 5HI5C 3R1GH 1J10A 3HE6D 1EEYB 2C26A 4KQ3L 4YX2L 5KVDL 2J8UA 1ZE3C 3SOBL 3OKMB 2XFXA 3P9LB 1DQQB 3V5HB 3KYMB 2Y06L 1T1ZB 1LO3L 1YEHL 1X4YA 4M7LH 2J7LA 4EZMA 3PGDB 4IMKC 3QIUB 3TBVB 4LQ1A 3ARGB 3VXRE 3BP7A 2DM3A 4OZ4B 4V1DB 2CO7B 5I1AA 1KIQA 2GCYB 4XNXH 3B2VH 2I60L 3T0BA 3VFOB 5CGYC 4JY6B 3V4UL 1U42A 3O9WA 3DX7A 5CEXB 5IB4B 1TQCB 3OKLA 1RZ8B 3P4NB 3QH3A 4MB5A 4GAJH 2Q3AA 1G7JA 2OR9L 1AXSB 3ARDD 3OKLB 4MAUH 1AD9B 4QF1A 5E99H 5T1MA 4JY4A 5J13C 5CJQL 3NIFE 3SE4A 1XF2A 3MXVH 2XN9D 5DI8B 2O26U 1OY3B 5CJXA 4QYOB 3WCYA 4LBEA 4PB9H 1E4WL 2DIBA 2GUOB 3HRZA 3MJGX 5FOJA 2Z93A 5B39A 1QRNB 1CDHA 5TE6H 4XAWL 5E2UL 3QXTA 1SVCP 4Z7WE 1NKOA 1YZZA 5HYIA 1MCCA 4PJIF 3T4YB 3BIAX 2DDQH 5I75C 5FO7A 4PJBA 1PVHA 1HH9B 3WO3B 5CIPA 2F8OA 1QBMH 3O9WB 1S9XA 4QEGA 3B9KA 5FCSH 2CLVA 1ZWIA 2VLKB 3OXSB 3VXUE 3X3GL 1EERB 3ROOA 2EDRA 1A7NH 4JN2A 3B9KB 2VSCA 2VXSH 3O8XA 5IG7B 4D0DB 4QF1B 3T2OA 5ABDE 2IH3A 1MFAH 5ID1A 3HMXA 4R3SA 5DJ0B 3SKNB 3RGVB 3DUUA 5DEGA 4QRTA 4NPYA 2X7LA 3MCLL 1Y0LA 2ATKB 4M61A 4F9PC 2AERT 3D3VA 4KK5D 1ZKAA 1YYML 1P4BH 3QQ9C 5DEGB 5DVOA 3T08A 3DGCR 2RBLA 4C59B 3UPAA 3RHWF 1FRGL 5SWZD 5KTEH 1N5AA 1PBYA 5DLML 4G43B 5IESH 5HYJD 1AY1L 3BP5B 3X13A 5IHZB 4BA8A 4U3HA 5J1AA 1T1WB 1HQ4A 1R0AL 3U0PB 4IRSD 4UV4H 4GXVL 3QWRA 1HOCB 4L9LA 5BRZE 2NTFB 2P44B 4OB5L 1GH7A 1WIPA 1AH1A 2MQ0A 4BSWA 3LN5B 4PJXB 5F9AC 5TQ0L 7FABL 4LMQE 3N1FC 5KG9A 3DETD 2DQCH 4FQCH 3DSNA 1G6RB 1OP3H 2LABA 3BVNA 5KS9B 5LWYL 5HI4D 1XF4B 4PB9L 1S7QA 1CGYA 3W9EA 1JL8A 4RMRA 5ID0A 2W9LA 4JO2L 4F3FA 5K9JL 3P77A 3AS1A 3ULVF 3QI9D 4ELKA 3VFNB 3W0WA 2BRRL 4LCWA 5HVWA 4JVUA 4QLRA 1EJ6A 5KAQF 3KPOA 3D6GA 1J7VR 3VFSA 1EHLH 3VD9A 3MRIA 5DJ2A 3L1OL 4JDTL 4R6UA 1VFOA 3FRPA 1G7PA 4GRWF 1TTUA 4XVTH 3T0EB 2FJHB 3BKYL 3RWFA 4GW5B 2V2WB 4HKZA 3LEYH 5EU3B 3TEUA 5D70H 2AW2A 1RSFA 5H37G 3FOMB 4Z95H 2E5EA 3V0WH 5D7KD 2JB6B 2R69L 3UYPA 1TCRA 3H9ZA 3GSQA 1U9KA 3MCLH 1S9XB 3I3EA 4QWWD 2DQJL 3OKEB 2EH8H 4E41A 3UTTB 1ZK9A 1T4KB 5JOFA 3RWEB 3TBYB 1T1XA 3SN6N 1KFAL 4M7JH 3HI5H 5KVEH 2DWEB 3KYNA 4NQDA 1B0GB 2HKHL 4IIQC 7FABH 3HCVA 3LQAL 3DUUB 4S1QH 1CLYH 4OQ1A 3DO7A 3OF6A 1F4HA 4L8DA 3CCHB 4G9FA 3VXQA 4HPYH 1SJVA 4H0IA 1OD7A 1KLGA 1PX3A 1OSZA 4QRQA 1CLYL 4G9FB 2FATH 1FFOA 4P5KB 4QHLA 1KELH 3BT2L 4QRRD 5EO0B 2J12B 1UB5B 2DI8A 1J0JA 4OQTL 3MX0A 1ZGLB 3CFDB 2GEEA 5HVGB 3O2DL 4LIQL 3ULUC 2XWBB 5E2TH 5IKCB 4Y2DB 4JPKH 2A6KA 3Q6FA 1LEIB 4LEOB 5HHNA 5I6XC 2Q86B 3E6FA 5JUEL 3U7AA 4ZS6C 4RAHA 4D3CH 1KJ2B 3UPRB 1EO7A 4JFFE 4XVUC 5KVGH 4YDJB 2DQIL 1C12A 3S5LA 3RU8H 3N0PB 3RTQB 3SDCB 3QRGL 1X5XA 3KXFA 1E4KA 2JIXB 2UV3A 4U49A 1GZQA 1YY9C 5ID0B 4H88H 2ZPKH 3EIFA 5DF0A 4ODSL 1CXKA 3V4UH 3CLEH 4YDIH 3BW9B 2BY3A 1E4JA 1J5OL 3TJHD 3HG1E 4XNXL 4OJFH 4D0CA 5FCUL 2BSRA 3HZMB 1YEJL 2BJMH 4HWBL 4AEHL 1NKRA 1I8KB 4NOBA 2NQCA 3MLVL 3PP4L 5IBLC 4I48A 1UJTA 4MA8H 3MLYH 1J11A 5LAXA 1PG7X 3MOAL 3V8CA 1JN6B 3N1MC 3OWEA 5A1AA 1XIWB 5BQ7B 1RUML 3ULVH 1TZIB 1NUFA 3ALPA 4XVSL 1OAZL 4LHUB 3MLXH 2YUWA 1KV3A 1TETL 4NM4L 3IFOB 5TJWK 3OV6A 2DQGH 5I0DA 5DJXA 4HX1B 2BVPB 1L7TH 4P9MH 4OZFG 5JXAH 1EFXD 1I85A 3AM8A 3G6JA 3QEGH 1H8SA 1XCQB 3RWEA 4NZUH 4M9PA 1OAQL 4ENEC 4JDVB 3VFVA 3U4BH 1JZ7A 2P42B 1GAFH 2I9TA 3DWTA 1MHEB 5DEFB 2J1KA 1UA6H 5ICZA 4L8DB 1CDUA 4UU9B 5IVZA 3S37L 3DLQR 2PTUA 5B22A 1AHWB 2H26B 4ZODA 4I48B 1MCJA 1ZANL 4BQBA 5EIVA 5CZXD 4HBQA 1RIVH 4IRSB 3OB8A 3Q5YA 2AQ1A 1S5IL 3CFDA 5FB8B 5AD0A 3SQBA 3DV6A 4MA1B 1VPOH 1OAYL 5D1ZC 2FHCA 1R3IL 2MQCA 5CBAB 2RAMA 1JHTA 1P53A 2FJFB 1MCPH 3I2CL 4MHHI 5EZIL 5DURB 4P5MB 3PGDA 3VG9C 1I75A 3P0VL 2VXQH 4NRYB 1F6FB 1IGML 3VI3F 1HH6A 4WTZA 3VXSE 1BGXH 2MJWA 5DD3L 2E9BA 5IBUB 5CMAB 2R0LL 4DZ8A 1TZHB 1IQWL 1IAOB 3ZO0A 2IG2L 1DEDA 1ND0B 1CD1A 4D9RD 3BKCH 1HCVA 4QOKD 1YUHA 4MJ5A 3FL7A 4N68A 4OCXL 3HUJA 1INQB 1SYVB 4KJYA 4XCEA 4F7CA 3MCKA 1AR1D 4JG0L 4YPGB 5DC9B 3FMGL 1IAIL 3MLYL 2VLRB 1SYVA 4KJYB 2IPTH 2OQJA 5FYLL 4LSQH 4I4WA 3NCBB 4HUUB 4N0UE 1G0YR 1UC6A 1X7QA 5K33A 2F5AL 3QDGA 4U2YA 4OLUL 4TSCH 3C9NA 5JXEA 4YNYB 4U6HB 4HXAL 5CEYA 2UWEA 5TF1L 4RA0C 1SVZA 4AENA 1J5OH 1MHCB 1XGTB 1JZ8A 2D0HA 1Q9OA 3DGGA 3FQNB 4A6YB 5HYSG 1WZ1L 3ME0A 4XP5L 1JGDA 3DGGB 3FQNA 2WIMA 3HZVA 3K8KA 3HNSL 4IRJB 3BP4A 1AGCB 3IFPA 5F1SA 3P0YL 5E9DB 3NCJH 3K74B 4AM0A 4IM8A 4NP4L 2FJGB 4BK4A 5GJSH 3ZKSD 4OI8A 4XVSH 3UTZB 4GW1A 3GSUB 4U1NA 2ZCKH 1FAIL 3EO1A 2C7UA 4U6VL 3WKNA 1FFQA 4K8RH 5BV7L 2VR9A 5HJ3A 5BO1H 3F5WB 1AHWC 1J0HA 1OF2B 1DL7L 4N0FA 5EBMB 2Z92A 1X4ZA 3IJHA 2P4AB 3U30B 4Y5VB 1JHTB 4P2OA 4LEXL 5F6HI 2O5ZH 3EYVA 3PWNB 1FLRH 4LHJB 1ZHLB 1HNFA 4HS6B 4YDVA 5IMLB 2CRIA 2VNCA 5GRZA 3K1DA 3UZVB 3LPGA 4OD3L 3RVXC 3ILPA 1JP5A 3NGBB 1OWWA 1RIVL 2N1KA 2IFGA 3MRRA 4EKXA 2Y06H 3LMJL 4BM7A 4ZNCD 4NQSA 2BNQA 2XA3A 1S9YB 4M8QA 3QUXC 4DW2L 1AKJA 2XZZA 4RFOL 5CINL 4NJAL 3S4SG 2VH5H 1OVZA 3LPFA 2OJZL 4WW1A 3HPJB 1D9KC 1GAFL 4OD2B 1QACA 4MNHB 3UCRA 3T1FA 4Q6IC 1AGDA 4PRHA 3MUHL 3SKJH 2ZNWA 1CYGA 1P5VA 3L3HB 2B8OT 1NBQA 1FFOB 3JV0A 2EEDA 1RFDL 4WY7H 3KR3H 1MQKL 1U6AH 1V3KA 1U8IA 1EAPB 1V5JA 1MH5B 1IEAA 4JRYE 4YC2C 3L5WB 3F7VA 3L3IA 1OGAE 3BD5A 3HI1B 4PREB 4LARH 3DURB 1NCCH 3KLHD 2HFEA 2F74A 5CBEB 3FHQA 1OAYH 5SX5H 1BFTA 1KJ2A 1JTTA 1M7IA 1CXEA 3ZHLA 4JFDD 1BZQK 4HGWB 4MQ7B 3F12A 2APFA 2HG5A 3Q5TA 3DI3B 2BVOB 3F12B 1NCBL 2B20A 2MHAA 1R0AH 1M7DA 3C5SA 1J9CT 3QIWB 4L4TB 5JW4N 5E95B 1FSKB 2E7BA 2LV4A 4NCDA 2DBLL 2Q7NA 2IAMC 1NCNA 1JZ5A 5DD1L 3JTTA 1FDLH 1KTLB 1ZT1B 3SGKC 5ADPH 3ESUF 3ZYOA 2IPTL 3DX6A 1LK2A 3L1OH 3U82B 3A0OA 1C5BL 3V6OC 4F33B 2Y36H 5CZXC 4BQ9A 4L3EA 3UC0L 5T1LA 2OL3B 3SQOH 15C8L 1DUZA 5HYJB 1I3GL 2QADC 2P5EE 2EO9A 5E8NB 3MFGB 3GJFK 1FPTL 3D39D 4ZOCA 2ZG3A 4HIIB 1BEYL 1Z3GL 5D7IA 4GBXD 1R3JB 3BH9A 4K8RL 5BV7H 2OZ4H 4ENED 5D1XC 1RV6X 4LSRH 4ZUSB 4Z7NE 3T3PE 1T7ZA 1S7SB 3VXMA 3WDHA 4UQ3A 3K80A 3QIUA 4OF6A 3WFDH 3MBXH 2ZOKB 4BZ2L 3B9AA 2A0LC 2XTJE 3I6GA 4D94A 4O00A 4PD4J 4ZD3L 1RZGA 5HGBA 3BGFB 3GSNA 4ODVL 2YZ8A 1E4WH 3MLRH 4X7DC 4R2GB 5IT2L 1LP9A 3CC5B 4N5UA 3D39E 5I73B 3NH7H 3QEQA 4FFWD 5C8JA 4K7FA 3QUYB 3CXDL 1ZVSB 3CFCL 1XIWC 3KPMB 3QA3A 5BVJB 4H20H 3VGDA 2ORBH 1Z6JT 1FLRL 5C08D 5I18L 4YHZL 3FFCB 5AD0B 5A3IC 4MQXD 3RWGB 2BSTB 1R3LB 5HYEA 2IH1B 3PDGA 4ZUUB 2X4TA 4OUUB 4WUKL 4I3SH 4OI9A 4KVCH 3QDJA 4HZLB 1U0QA 5FV2A 3ET9F 4ZUUA 3VFTB 3VU2A 4NZUL 5IB3A 5ENWB 4NO2B 1VACA 3MNWB 4TSAH 3HC3H 1IC1A 3QUML 5DD6A 1IGIH 1CE1L 2GTWB 4F8TA 3WDIA 1RIHH 3OMZA 2HTKD 4DOHB 1B4JH 2QADB 3FTGA 4YHYB 3WHXB 3DMMC 1LP9B 3CC5A 1ZLWK 4PJ9B 5SWQB 5C0FB 4WV1B 5A2LH 3OHXB 4RSVA 4R2GC 4TSBL 2BCKA 4E9LA 4ZD3H 5E8PA 3QIBB 4QRPB 1WAAF 2DQDH 1G7MB 4BH8B 1CGSH 3SQOL 1NMAL 3KR3L 3EJYC 3MLZL 4JHWL 4TYUA 1N59B 4G80A 5FGRA 3DV4B 2BP3A 1CK0L 5CP7A 1W0YT 2DKUA 4I9WE 2RB8A 3KS0H 4PY7B 5HHVL 5F1IA 4PJEB 5TE4H 5IB3B 1IQDA 1YMMB 5EUKA 2CIKA 5IMKB 4LVNC 2F8XC 1G9MC 4LLVA 4WI6A 2PYFA 1UVQB 2EE9A 5FAAA 5EO1A 2E7LC 3ZLQC 5F21B 1CFNB 3BD4A 2Y36L 2EXWD 4BZ1L 2ORBL 3HS0A 4NQED 3BP4B 4OZHB 3WHXA 3GSVA 1BF8A 3TWCH 4PJCA 1JWMB 4MX7B 5C0CB 1Q94A 2X42A 5EUOB 4X6EA 4U3CA 3FONB 3EOAB 4HJ0D 2DJSA 4OCLC 2VJXA 5JZ7C 1A7RL 1SEQL 4K55A 4APQB 5KS9A 5FHBH 2GHWB 5IVXF 4XCEB 2YPLB 4PGJA 3OKYA 5DR5H 1MHPL 2EYRA 3L6FA 4XP4L 1MIML 4R3SB 1AQKH 2I5YL 5DMIL 5D5MF 5E8OB 3BPNC 2QEJA 1T3FB 5GGUB 5E7FA 4F8QA 2HVKA 3CNKA 1T5XA 2BNRB 5DHYA 5ANME 4XTRC 5KVEL 1G6VK 1NFDB 1WICA 3SKJL 1OB1A 4X98A 1SMOA 5DZNA 4JZJA 4G43A 3ARFD 4I0PA 4FXGB 5CJOL 2F19H 5TFSL 1BIHA 4O5LH 5IJKC 4RMSA 4UV4L 3QCUL 3SCMA 2KL6A 1UEMA 5AUMA 4N1HB 1F2XK 2ZSVB 4GH7B 1CI5A 3BO8A 4HLJA 3VFPB 1ZT7B 5L2KE 4HULB 2CRZA 1TMCB 3OKEA 5I1LA 4YXKH 4HG4K 4PTUB 2R2CA 3I75A 3CFJA 4YIQB 4IIQB 5C0AD 3L6FB 1QR4A 1J1PH 1F3JB 4CDHA 3GJEB 4P9ML 1MVFA 1KCUL 5TDNB 4NKQB 4D3CL 3GSOB 5E5MA 5TF1H 3DI2B 2B2XH 5F7KC 1QHOA 1A1MA 4GXUN 5HHME 3C6LA 2KKQA 3NH7L 4OFDA 1K4CB 4LIQH 3AB0C 3ZYIA 4RDQF 3M45A 3L3JB 4O02L 4AEFA 3S3PA 4BFIB 4JHAH 4L5FL 5EOTA 1IAIH 2I26N 3V6ZA 3EZJB 4F37F 2AJSL 1X5KA 3WNOA 2DMBA 2HFEB 4GRLD 4M6NL 3UBXA 3R1GL 3VDAA 3TYGL 1NC2D 1MCNA 4UIKH 1KLUA 2F53B 4I5BB 1XGPB 1K4DB 1B4JL 1IGFL 4LVNB 4NQCD 2X4QA 4I18A 1NMBH 2YUZA 1A6UH 3HI6L 1RFDH 1OGTA 1KPRB 3QFJE 1INEH 4YH6A 5T3XH 5DK2A 1MFEL 3PXJA 2MHAB 4X99B 4OLEA 1YDPB 1DLHA 5EIQA 2Y25A 4XP5H 2QL1A 4J4PD 1GZPA 2Z9TA 5MEOA 3QG7L 4OCYL 5CILH 3HPJA 1DLHB 2BNUA 5ESAB 4P2OC 1U8JA 2VZSA 4QRUA 3SDXA 2R1YB 3LKRA 4UI2A 4OKVA 2DWDB 3RVWC 4MNQA 1J18A 4G7VL 3ZDZE 3FRPG 3IDGB 4IMLB 2G5BB 2VDKL 3T0EE 2HLFD 1E6JL 2AJVL 3TO4D 1LMKA 5HHVH 1Q9LA 4P9HH 4YXLL 3ZTJH 1BQHA 1NC2B 3SDAC 2IFFH 4YX2H 4DVRH 1D5IH 1IAKA 1QBML 3SCMB 2L0DA 1LEIA 1LILA 1TJGL 3W0WE 2Z8WC 3VXMB 3HLAB 4HK3N 3U4BL 4Y4FC 2H2SC 2HRPH 3E1F1 3RNQB 4PJ5E 5D93C 3MRFA 5E6IA 2LQRA 3TBSB 3T0ED 5GJTH 2X89D 5KVDH 4EBQL 2XXMB 3NFSH 4JFQA 4U1GC 1UACH 2HFGH 4QRUB 3SDXB 3EZ8A 3MJ9L 4M03A 3SDAB 4PG9A 2BSSB 3U36B 2G2RB 5IWLA 1A4JA 4GKZB 3B4NA 3OJDB 4ZFZA 3BZ4B 4WDIB 2MMXA 3W39A 3PGCA 1AO7D 3IAPA 1H0DB 3K46A 1OW0C 4L8BA 4TOYH 1HHJA 1WZLA 2HKFH 1BQSA 3MRNA 4MDJA 3PL6D 5BZDA 1JZ4A 4KGJA 3W5NA 4Y89A 4XXDA 1IGJB 4IOFC 4MXVE 5F8QC 2QBWA 2J2ZA 1VACB 2HVJA 5A16A 3MV9A 3RY4A 1LQSR 4L4VA 3B6SB 1N8ZB 5F9OL 1Q9KA 1LO0H 1MJ8H 4RFNC 3ZT5A 4HUVA 1OAXH 4TTGA 1FN4A 1NL0L 2XN9E 4U1HA 2WP3O 1AC0A 4FA8A 1P9MA 4LEXH 2NY0B 3BQUA 1DBKH 1EV2E 3TA3C 5C70A 1QOKA 1JGVH 1YUHB 25C8H 4MGXA 1V05A 4XC3L 5I76B 1XF4A 3W9EB 3RWDB 1P6AB 4OQTH 5K9OB 2G75B 2LAGB 3WDJA 1EBAA 1Q9LB 5CKAA 4E42B 2ADFH 5LGKA 4Q9RL 1YEIH 2X4TB 2AAVA 2JJSA 1OSPL 3DXAB 2I9LA 2YEZA 1LK3H 3D0LA 4OF5A 3TBTA 1R3HB 3P0YH 4PBVC 5T1DL 2CDGB 4KK9D 1GGCL 1NAMB 2AK4A 2N7BA 3B3IB 1PKQE 1OAKL 1KPUA 2BVYA 2QHRH 3MGTB 3KS0J 4JB9L 3WO4C 3ARBD 3ZDYE 2EC9T 5KAQG 3CDGB 3OPZH 2W9DH 3TVMA 5F6HJ 2C1PA 2J8HA 4EUPA 5IVOA 4G5ZL 4JG1L 4PRBB 5BS0D 4QRPD 2OCFD 1CGVA 3VJ6A 1XIWD 3FN0H 1F45A 1RUKH 1VESA 3O6MH 5C0FA 3H9HB 4IOSD 3B8SA 4BFGA 2DD8H 2VWEE 3BGAA 2WZPD 3U48A 4P2CG 5FM5M 3TO2B 5CAYB 1GSMA 3K0WA 4Y19E 3ZDXE 5E1HB 4W4OC 3DO7B 3SDXF 5IB5A 3SGDH 1GPOH 3IVKA 1T2JA 2C3XA 3ISWA 1CS6A 3P9WB 2XQYG 4IRJC 2DLEA 2AXGA 1G7QA 3CFCH 3GMMA 1NDMA 3RVVC 5DJDA 2XKNA 1V7NL 5E8EA 5D1XD 1JYNA 5K9JH 1MUJA 4ODWB 2CSPA 3FO0H 1RJZA 1KG0A 5F7DA 5KZCD 5HD8D 1KJMB 5I15H 4KPHL 5CIPB 3S98A 3ZL4H 2EXYD 5GSVB 1JTPA 4Z8FL 4WVRA 1NSNH 2JELL 2F5BH 3NCJL 5JTWA 3BVNB 3L3DA 1BZ9A 4DZBA 3E3QE 3TZVA 1DEEB 1NUNB 3O4LA 2NY5C 4N0CD 1GOFA 1MRFL 1U95B 4DKFH 4H88L 5JOFB 1NCWH 5DJ0A 3VWJD 4DFHA 3SKNA 1DN2A 1DVFC 3OAZH 5FA3B 4P2QA 3SDCC 3NFNA 1A1MB 4FQ1H 4PGDB 4YHKL 3DRQA 1QBLL 4X8JA 4OIIH 2YPLE 2JK5A 4ODWA 2F5AH 5EU3A 4I13B 2ZUQC 1AXIB 4MJ6B 4MS8C 4GG6A 1KLUB 2C3WA 5E8DL 4BKLA 4KH2A 5TH2B 4MSWB 2D4FA 3GSWB 4JPIA 3NAAL 1FJ1B 4ZQKB 4HS6A 2OMNA 2DQCL 4FQCL 1NFIA 2ZSVA 3T04D 3O45B 4Q97A 3STLB 4MSWA 3P4OB 4FQJL 1OWRM 3V4VH 3QAZB 4WEUD 3FQTA 2RQ8A 4EI5D 3ES6B 1CFVL 4P57B 3PHQA 4GG8B 2EEBA 4JO2H 1KJ2L 1QSVA 5DR5L 4XAWH 4XWOC 1KC5L 3BKJH 3E6HB 2F15A 3WE6A 2WBWB 3WLWC 2R1YA 2HN7A 2NY3C 3D18B 3ZMRA 4DQOH 4O02H 3FOLB 3CFEA 2P5EA 1UADC 1PSKL 3FOLA 1ZEAL 3MRIB 5DJ2B 1CN4A 4M6ML 5C0IB 4CMMB 4YLQT 5EO0A 1YYMH 5AG9A 4F33A 1L9NA 1M71B 1NGPL 4PGZA 1QLFA 2BRQA 3O11A 3QSKB 3WD5H 5F6IB 2PYEB 5M95B 3RL1A 5E99L 2HKFL 4G8EB 4MXVF 5C07A 2FD6L 3RZCB 1XGPA 1A4KB 1YEDA 1T66C 2VDML 5DA4A 1IRAY 3C87A 3MO1B 1UEYA 1KB5B 4PJ8C 4YDJA 3QUKA 3TCLB 1WK0A 2OTWA 1QLRB 3JVGC 3LS4L 1AIFA 4RGND 1F4XH 3CDCA 4ONFL 4O5LL 1S7VB 3OR6A 1GZQB 4R4FH 2W9DL 2OXHA 3BKML 3K7UA 3KJ6H 4NO3B 4WFFD 1U92A 3X14B 2B39A 1B6DA 4DAGH 3SE8H 4R97C 1RUQL 4OD3H 4OGYL 3D2UD 3BWAA 4P23D 4U31A 4UINH 2NX5B 3PGFL 3EDDA 4JFFD 3QEQB 3SGKA 4P4KB 5C8JB 1HXMA 5E24E 3I6LE 4NC0B 3NTCL 4LVOC 2IAMA 1EGJA 4HXBH 3VRIB 4NN7C 5MP6H 5ANMB 1RJYA 3R4DA 2WV3A 4RRPG 5T5NF 4PP2A 1JNHA 3FFCA 2GY5A 5GGVY 3ZE1F 2J88L 4OLZL 3O8XC 3GRWL 3MO1A 3VRLE 3K8LA 3CIQA 5CJ8A 4XNYL 4Y4KC 2AV7B 4ZFOA 2VO5A 1RIHL 4PIRF 1N64H 4MCZA 1SJHB 3LKNA 4PRPA 5I73C 4D2NA 2FIKB 2W60A 4G7YH 5DD6B 2BNQE 5KN5A 2HT2C 3O3EB 3RNQA 5DVNA 3DSFL 1BWWA 2KPNA 1CFQB 3TN0D 1HIML 4EEEA 4HV8A 4XNQB 3GMPB 3RAJH 1WT5C 3W82A 2EE3A 3LD8B 5HHOD 3RJQB 4ZXBC 1C16B 5D1XB 4ODVH 1T80A 1VFMA 5BXFB 3MLZH 3QO0A 4B53A 5I66A 3SE4C 1IILE 4QRQB 4MQXC 3CVHB 3QUYA 3WFDL 1Z5LB 1JF1B 5GHWL 5BMFL 3IF1A 5J1TC 3RWJA 1J0IA 2OP4L 4KRMB 3TT1L 2IEPA 1BD2A 5HDBF 1H8OA 5GS0C 3RWJB 4PV9B 4FQXC 3KNBA 2CIKB 1IGYB 1ES0A 1KPVB 3GSRB 2CQVA 2JB5H 1C12B 4LSRL 4WHDA 1AC6A 5E9DE 4HUNB 1BVKB 4TNVK 4XGZA 3RVWD 1MHEA 5CKGA 4I1NB 3FFDA 3P9MA 5F7WC 3U46B 3RU8L 1BM3L 1FC1A 4WJ5A 3ULUE 3UTSA 1RZ8A 3MJ6A 1NGYA 1P4BL 4HIHA 2P24A 1AHWA 2H26A 3OHXA 3N1QC 5EA0L 3OAYH 4LVHC 4GKOA 4MD0B 1RQ5A 5IB5B 4TPRH 4JR9H 4PJDF 3I02B 1SYSA 5JPMB 3U1SL 3OPZL 1WFNA 1MWAB 1JHKL 4HF5H 1XF2B 4M7KL 3G5YA 2ZG2A 5CBAA 2QQNH 4HFUH 3H3KA 4X80H 3W2DL 5TQ0H 1RJZB 3WHE0 1I7TB 3BUYB 2ZCLL 5ESVB 3BPLC 1J8HD 4RMUA 1MCDA 1JWSA 4N1EA 5BW7C 1CZ8L 4U6TA 1JPSH 1LEGA 2CDFA 4S1QL 2CR6A 2AK1L 3MUZ1 4BZYA 5F3BB 1S5HB 3U79A 1I1YA 4WO4D 3VGHA 1BGXL 2BY1A 4I2XA 4Y16D 4DAGL 4PJDA 4YO0B 4XRCA 3FONA 3HZYA 2IBGA 4YIQA 5HGDB 1IEHA 3GM0A 4KJQD 3FT3A 3U7WL 4Z7UA 1CE1H 3SDDC 4MCYA 3WFZA 2R4RH 1XT5A 4XH2A 3VXRD 3L9RA 3QCVH 2JF1A 5DC0A 3T1FB 1I1AC 3LEYL 4DKDC 3EHBD 5ETUB 3W81A 1JNJA 1T03L 2F54E 3P11H 2OJZH 3DJ9A 2VXSL 3BUYA 2BHZA 5E94A 3EJJX 5IQ7L 5MHSD 3FQRA 1WV7T 1MCEA 4UDUB 4LLYA 2DL9A 1KG0B 3FOMA 3UTSE 3BISA 2X4UB 2N56A 3OKDA 4N9OB 3MRRB 4K71B 2LAAA 4PTTB 2WLZA 3WNKA 2CH8A 4TOYL 4PJAE 4KKBC 4DOHE 4FZ8L 3CDFA 4AIOA 1DUYB 4XNMB 5E9DA 2QHRL 4G7VH 1B0WA 1QSEB 4PRID 5BO1L 1D5MB 2ZUWA 4P9HC 5D1ZA 4UNVA 5JW4M 4XCYA 1FAIH 4KTDL 4JVWA 3S88L 1HCFX 5IIEA 4ZMAT 5JZ7D 5GZOC 4GRWE 1X5LA 4P59L 4TVSa 3EJYD 5J11C 4IOIB 1NC4A 5CSZB 4ZDHB 5IIEB 1X6NA 3CCHA 1URLA 1RZJL 4OQTA 1OF2A 1KCVL 3RIFK 5IW6B 1DE4B 1UKTA 4PP1C 5GS0H 4FN0A 1RZJH 3QQ4A 1CIUA 3D5OF 4LK4A 4HXBL 3EYOB 4V2CB 3C5ZD 2AP2A 3S96A 15C8H 3QQ4B 3GI8H 3V5KA 4YDVB 3RWGA 4UIKL 4NKIL 4Y1AB 5H94B 5DDHA 2I60H 1RI8A 3F6IA 4P46D 4YAQA 5J57B 5D6CB 4YDIL 5D7JA 2JB6A 2QSTA 3QUZD 2L7JA 3MOBH 4JM2C 5EIIB 3L3KB 4NO5B 2KUTA 2UVFA 3PWLA 1KGCE 3ES6A 5EORH 1DQDL 5C0EA 1RZ7H 3VFUA 1LVEA 1RZFH 4JFFA 5I16B 4HSQA 1FIGL 5SWSA 4XAKD 5CD5D 3M07A 1CLCA 1PG7W 3D2UA 2HH0H 3EYUH 2FGZA 3VGAB 2ITDA 2P5EB 4WHYH 3WFHB 3MRHB 3KDMB 2RHEA 3UZEA 3DRTB 1FYTB 2AGJL 5DFWH 5TE4L 2HTKC 4N0FB 4S1SL 2HTLD 1DFBH 4NZDA 5JQHC 3G5ZA 5B4MD 1PDKA 1KCVH 4R8WL 1PKQB 4EI5C 3EAKA 3ZT7A 4I0PC 4G9FE 5C0AB 1AR1C 2X09A 2HRLA 3F7QA 4KUCD 3P4MA 1J87A 1GJIA 3CX5J 1RZIA 4M93C 2J8UB 4NZTL 3HRZB 1OAXL 1K8IA 3TT1H 3FQWA 2EC9U 2AK1H 4J3OC 4U05A 2DICA 3TBVA 3IKCA 43C9B 3DPBA 4L4JA 5DD0H 3NVQA 4WFHD 1ZWIB 2ICEA 3QI9B 1N3NA 4R0LC 2ARWA 3UP1A 4TSAL 3KDMA 4TSCL 1MI5B 1EGJH 3NZ8B 5SX4I 3ETBF 3IGAA 2OM5A 1D5ZA 2VLJB 2VQ1A 4OLYH 1MOEA 5EH1A 4BSJA 5DLMH 5GS3A 5D7LA 5JW4R 1W72B 2EYRB 3SE3A 3QQNA 5HDLA 4G8IA 5E5RB 4MWFB 4LLMB 5D6DA 1NLBH 4M48L 5DGRA 1OT1A 4X7TB 3QCUH 4PREA 5KS9F 1QKZL 2LE9A 1NBYA 4WI8A 3N85L 4JFYA 4KDTA 2ADJA 5C9JB 2HJFA 1QSFB 5GGTL 4YHNA 1CGWA 5D7JB 1CFTB 2GQHA 2WWMC 2NY7L 4NCC2 4WHTB 1HE7A 2B0SL 3OKMA 5GGTA 4NYLA 4XPHH 4RFNB 4KK6C 4F7EA 2OXGA 4MA8L 4XP9L 5HYFA 3FQUB 1Y18A 1VFAA 1XEDA 1JGVL 1HOCA 2NW2B 1SM3L 1BVZA 3MBXL 1V8HA 2P8MB 4M1DL 3RKDD 3GK8L 4WI7A 5DMKA 3LEXB 1MQ8A 3NFSL 1E27A 3VXSB 5I1CL 1I1FA 4LL9A 3AS3A 3HUJB 4ZUWB 2ESVA 3PWPA 1A3QA 4WV1C 2DQFB 1MWAL 5DO2C 2AXJA 4OKDA 3NIDE 1KJ3L 3MLPA 3V4PL 2A6JA 5MEPB 3LKSA 2ZZUT 2F58H 1J86A 3C9NB 2VDNH 3PUCA 3QFDB 4D8PA 5FO9A 1TJIL 5IMKA 4PJGA 1EHAA 4UOJA 3FO2B 3SKOA 1ZA3B 4BUGA 1HI6A 2GFBA 3TC9A 2YA1A 2Q7YA 4X98B 3LZFH 1IE5A 2PO6A 3G08B 2GTWA 3OXRA 3JBG7 1WZKA 1G6RL 1ORQA 4XVJH 4RFEB 3L3GB 5TDPA 4CW1A 1E4XH 2AI0L 4NC2B 2SEBB 1MF2L 4PJBE 3SKUD 4M6MH 4YR6B 4FXKB 3T65B 5D1QD 4J6RH 4P46C 5GQBA 1S9KC 1R5IB 1KNOB 2PW2A 4L9LB 4Z7WA 1J8KA 1IFHH 4F7MB 3DVFA 2OK0L 2BMKA 2XTJB 1MCRA 4XI5C 1MI5A 1NUGA 4X7SL 4X99A 2IQAB 4MD5B 4HS3A 3RVUD 1KELL 1VFBB 3L7EB 4MB4A 1QRNE 2OP4H 4YK4B 4LP4A 3ESVF 3SDYH 1OARL 5I1CH 3FO1B 4GKSA 1NMCB 2RR3A 3P77B 2DQJH 2XTLA 4ETQB 3NZHH 4A6YL 1X5FA 2P5WE 2VLRD 4UTAL 1V7MH 3GSNH 1AP2A 1FP5A 3ARBA 1KN4L 3QUXB 3T3MF 2HKHH 1K6QL 5C2UB 1I9IL 1AE6L 4JQIH 2XTJC 4I8DA 4OLUH 5E2VH 3VXNB 5DMYA 3SE8L 4LLVB 3U7YL 4GG6B 1YY8A 2WINA 3QRGH 5FUZL 1MRCL 2XWBA 3Q6GL 3I85A 4P23C 5BV7B 1T1YB 2X1PA 3OKDB 4KVCL 8FABA 35C8H 5C9KA 1NEZA 3TWCL 1S9VB 4KKBD 4RFOH 5CINH 1T1WA 2YZ1A 4DEPB 5IBUG 3Q3GB 1S9WB 3HZVB 1FO0L 3B2VL 4JZOA 4CNIB 1BMGA 1RAMA 5DMKB 4I18B 3FT4A 1ED3B 3VFRA 3WXVH 1IM9D 1NC4D 4GBXB 5H35B 5SWZB 4PJ8D 2YK1L 1PEWA 4JO1L 1W72H 3MGAA 1G7LA 5AZEL 4YDKH 1IGMH 4LNRA 2IMNA 4F37K 5I1DB 5E9DD 4ZSOA 4P3WA 3RGVD 3ZL4L 3T2PA 1VERA 2X4PA 5SV4A 4GXVH 5CP7B 5FO9B 1OB1B 3MRLB 3TJEH 4UOW0 5E94B 2ITCA 4LSSL 4QOKE 4MVBC 2CLRB 3WMSA 1AGFB 4HF5L 2HLAB 2HYMA 4WEMB 1JE6A 1JNLL 2VITA 1GOHA 2CLRA 4HGWA 4MQ7A 1IAKB 4PJHA 5FM8A 2HVJB 3BYYA 4BZ1H 1T2XA 2CMRL 4MA3A 4X6FB 1UCBH 5C0EB 1UENA 2YMXL 1NCAH 2BNQB 1QSFD 1TJHH 3IU4L 4HT1L 4L4VE 4OZ4A 3VFGL 4P57A 5DMGC 2A6IA 4LHUG 4B7IA 4P23B 4WUUA 4N0CC 3IFNH 3IFLL 4GXUM 3L3OA 5DD1H 1JGEA 2ICWB 3DXAE 3HMXH 1T20B 4ZXBB 3DX8B 4LLDA 4NQCE 5JXAL 4OZHE 4G7YL 5DRXB 3DTXA 3VI4E 1LK2B 3UJTH 3FZUD 4GKZA 2VB5A 1UJ3B 1CGUA 4A2LA 2R56L 5F7NC 2WWKT 1XF5B 2FBJL 3QPXH 4HAFA 3T2NL 3DVNB 1YJDH 1MFAL 4LKXA 2FH6A 4NNXA 1AGBA 3O3AA 3A67H 3U0WH 4HIIA 3O3AB 4KKAC 1LK3L 2FO4B 3DXAA 3HLAA 2EDKA 4BZ2H 1F90L 4Z8FH 4HH8A 5D2LA 2K3TA 2EKSA 4QGYA 5GGSA 4WY7L 2NY1B 1DQQA 4J1UA 3EO9H 4NQXB 3RUGA 5C0ND 2E6PA 3T2QA 3UJJL 1MFEH 1KCKA 2VN7A 3CUPA 4KY1H 1FZOA 2HFFA 5FYJU 4JRXA 1AXTL 4PJHE 2VZUA 4K3EH 3SDCA 5DJCA 2CRMA 2EDJA 1EAJA 3MRMB 2ID5A 3OJVC 2PXYC 2IANE 1ZSDB 2AKRB 2PYEE 3O0RL 3PL6B 1D6VL 4P5TB 5FUOL 3VGFA 3MR9B 4KROB 4MJIB 2IAMB 3BYTA 3Q6GH 4X6BB 3C09C 1TVBA 3WUWG 4I3SL 5CEZL 2EDOA 2IH1A 2FYYA 5FYKD 4LRIA 1ZLSL 3T4AA 1I9JH 2VDNL 4U6YB 4FQXD 2DLHA 1JYWA 1U91A 5DFVD 1WEJH 1OCWH 1JPFB 2ENYA 4ELME 5B4MC 1RU9L 1PSKH 4XVUD 4X9BA 2DDQL 2XG4A 2EIBA 2CR3A 1EIBA 1VFAB 1QHPA 2EDDA 4R9HA 2BFVL 3TV3L 4G6JL 4LP5A 2UY6A 2KBGA 5C0DA 3HI5L 3V5DA 1UT9A 1FNAA 4YBHA 4LASH 5SWQA 5DHXB 3EDJA 4WU7A 4TULL 4ODBD 2QQQA 3F7PC 2F19L 5TFSH 3BPCA 4J6RL 4PJ8A 1JPTH 4JAMB 1R5VB 1PQZA 4FFZH 5FHAL 1W8OA 4JM2D 4WNQA 1KGCD 4R7NB 4MNGA 5GGVL 4G42B 1R5VA 1PQZB 4S1SH 4KI5D 4LKXB 4NRXB 4MDJB 5F7LB 4HWZB 5HHQA 1XFPA 2LU3A 4XWGH 5KTEL 4R90L 2PKDA 4X5XA 2Z8RA 3VXTB 3KLDA 5JHDB 3EJZD 4P3DB 3ULSB 3MROB 1L6ZA 5HI3C 1QRNA 1TZGH 2OTUB 3MRBA 1C5BH 4MA1C 4BKLB 1FNEA 1U8LA 4C56D 1HZHL 3LRSB 3PIQA 2VABB 4LF3A 4XNZC 4PRAA 4DQOL 1JWMA 4WHYG 4JRXB 2OYPA 1TLKA 1G1YA 3MV7A 3LEXA